data_5UNF
# 
_entry.id   5UNF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.302 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5UNF         
WWPDB D_1000226050 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5UNG PDB . 
unspecified 5UNH PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5UNF 
_pdbx_database_status.recvd_initial_deposition_date   2017-01-30 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Zhang, H.'        1  ? 
'Han, G.W.'        2  ? 
'Batyuk, A.'       3  ? 
'Ishchenko, A.'    4  ? 
'White, K.L.'      5  ? 
'Patel, N.'        6  ? 
'Sadybekov, A.'    7  ? 
'Zamlynny, B.'     8  ? 
'Rudd, M.T.'       9  ? 
'Hollenstein, K.'  10 ? 
'Tolstikova, A.'   11 ? 
'White, T.A.'      12 ? 
'Hunter, M.S.'     13 ? 
'Weierstall, U.'   14 ? 
'Liu, W.'          15 ? 
'Babaoglu, K.'     16 ? 
'Moore, E.L.'      17 ? 
'Katz, R.D.'       18 ? 
'Shipman, J.M.'    19 ? 
'Garcia-Calvo, M.' 20 ? 
'Sharma, S.'       21 ? 
'Sheth, P.'        22 ? 
'Soisson, S.M.'    23 ? 
'Stevens, R.C.'    24 ? 
'Katritch, V.'     25 ? 
'Cherezov, V.'     26 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            544 
_citation.language                  ? 
_citation.page_first                327 
_citation.page_last                 332 
_citation.title                     'Structural basis for selectivity and diversity in angiotensin II receptors.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nature22035 
_citation.pdbx_database_id_PubMed   28379944 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Zhang, H.'        1  ? 
primary 'Han, G.W.'        2  ? 
primary 'Batyuk, A.'       3  ? 
primary 'Ishchenko, A.'    4  ? 
primary 'White, K.L.'      5  ? 
primary 'Patel, N.'        6  ? 
primary 'Sadybekov, A.'    7  ? 
primary 'Zamlynny, B.'     8  ? 
primary 'Rudd, M.T.'       9  ? 
primary 'Hollenstein, K.'  10 ? 
primary 'Tolstikova, A.'   11 ? 
primary 'White, T.A.'      12 ? 
primary 'Hunter, M.S.'     13 ? 
primary 'Weierstall, U.'   14 ? 
primary 'Liu, W.'          15 ? 
primary 'Babaoglu, K.'     16 ? 
primary 'Moore, E.L.'      17 ? 
primary 'Katz, R.D.'       18 ? 
primary 'Shipman, J.M.'    19 ? 
primary 'Garcia-Calvo, M.' 20 ? 
primary 'Sharma, S.'       21 ? 
primary 'Sheth, P.'        22 ? 
primary 'Soisson, S.M.'    23 ? 
primary 'Stevens, R.C.'    24 ? 
primary 'Katritch, V.'     25 ? 
primary 'Cherezov, V.'     26 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   104.33 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5UNF 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     77.390 
_cell.length_a_esd                 ? 
_cell.length_b                     69.110 
_cell.length_b_esd                 ? 
_cell.length_c                     90.070 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5UNF 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Chimera protein of Type-2 angiotensin II receptor and Soluble cytochrome b562' 46506.535 2 ? 
'M1007W, H1102I, R1106L' 'UNP P0ABE7 residues 23-128 and UNP P50052 35-335 linked via LINKER resdiues GSGS' ? 
2 non-polymer syn 
"N-benzyl-N-(2-ethyl-4-oxo-3-{[2'-(2H-tetrazol-5-yl)[1,1'-biphenyl]-4-yl]methyl}-3,4-dihydroquinazolin-6-yl)thiophene-2-carboxamide" 
623.726   2 ? ?                        ?                                                                                  ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Cytochrome b-562,Angiotensin II type-2 receptor,AT2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLAN
EGKVKEAQAAAEQLKTTRNAYIQKYLGSGSCSQKPSDKHLDAIPILYYIIFVIGFLVNIVVVTLFCCQKGPKKVSSIYIF
NLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIV
PLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSY
GKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNR
FQQKLRSVFRV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLAN
EGKVKEAQAAAEQLKTTRNAYIQKYLGSGSCSQKPSDKHLDAIPILYYIIFVIGFLVNIVVVTLFCCQKGPKKVSSIYIF
NLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIV
PLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSY
GKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNR
FQQKLRSVFRV
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ASP n 
1 3   LEU n 
1 4   GLU n 
1 5   ASP n 
1 6   ASN n 
1 7   TRP n 
1 8   GLU n 
1 9   THR n 
1 10  LEU n 
1 11  ASN n 
1 12  ASP n 
1 13  ASN n 
1 14  LEU n 
1 15  LYS n 
1 16  VAL n 
1 17  ILE n 
1 18  GLU n 
1 19  LYS n 
1 20  ALA n 
1 21  ASP n 
1 22  ASN n 
1 23  ALA n 
1 24  ALA n 
1 25  GLN n 
1 26  VAL n 
1 27  LYS n 
1 28  ASP n 
1 29  ALA n 
1 30  LEU n 
1 31  THR n 
1 32  LYS n 
1 33  MET n 
1 34  ARG n 
1 35  ALA n 
1 36  ALA n 
1 37  ALA n 
1 38  LEU n 
1 39  ASP n 
1 40  ALA n 
1 41  GLN n 
1 42  LYS n 
1 43  ALA n 
1 44  THR n 
1 45  PRO n 
1 46  PRO n 
1 47  LYS n 
1 48  LEU n 
1 49  GLU n 
1 50  ASP n 
1 51  LYS n 
1 52  SER n 
1 53  PRO n 
1 54  ASP n 
1 55  SER n 
1 56  PRO n 
1 57  GLU n 
1 58  MET n 
1 59  LYS n 
1 60  ASP n 
1 61  PHE n 
1 62  ARG n 
1 63  HIS n 
1 64  GLY n 
1 65  PHE n 
1 66  ASP n 
1 67  ILE n 
1 68  LEU n 
1 69  VAL n 
1 70  GLY n 
1 71  GLN n 
1 72  ILE n 
1 73  ASP n 
1 74  ASP n 
1 75  ALA n 
1 76  LEU n 
1 77  LYS n 
1 78  LEU n 
1 79  ALA n 
1 80  ASN n 
1 81  GLU n 
1 82  GLY n 
1 83  LYS n 
1 84  VAL n 
1 85  LYS n 
1 86  GLU n 
1 87  ALA n 
1 88  GLN n 
1 89  ALA n 
1 90  ALA n 
1 91  ALA n 
1 92  GLU n 
1 93  GLN n 
1 94  LEU n 
1 95  LYS n 
1 96  THR n 
1 97  THR n 
1 98  ARG n 
1 99  ASN n 
1 100 ALA n 
1 101 TYR n 
1 102 ILE n 
1 103 GLN n 
1 104 LYS n 
1 105 TYR n 
1 106 LEU n 
1 107 GLY n 
1 108 SER n 
1 109 GLY n 
1 110 SER n 
1 111 CYS n 
1 112 SER n 
1 113 GLN n 
1 114 LYS n 
1 115 PRO n 
1 116 SER n 
1 117 ASP n 
1 118 LYS n 
1 119 HIS n 
1 120 LEU n 
1 121 ASP n 
1 122 ALA n 
1 123 ILE n 
1 124 PRO n 
1 125 ILE n 
1 126 LEU n 
1 127 TYR n 
1 128 TYR n 
1 129 ILE n 
1 130 ILE n 
1 131 PHE n 
1 132 VAL n 
1 133 ILE n 
1 134 GLY n 
1 135 PHE n 
1 136 LEU n 
1 137 VAL n 
1 138 ASN n 
1 139 ILE n 
1 140 VAL n 
1 141 VAL n 
1 142 VAL n 
1 143 THR n 
1 144 LEU n 
1 145 PHE n 
1 146 CYS n 
1 147 CYS n 
1 148 GLN n 
1 149 LYS n 
1 150 GLY n 
1 151 PRO n 
1 152 LYS n 
1 153 LYS n 
1 154 VAL n 
1 155 SER n 
1 156 SER n 
1 157 ILE n 
1 158 TYR n 
1 159 ILE n 
1 160 PHE n 
1 161 ASN n 
1 162 LEU n 
1 163 ALA n 
1 164 VAL n 
1 165 ALA n 
1 166 ASP n 
1 167 LEU n 
1 168 LEU n 
1 169 LEU n 
1 170 LEU n 
1 171 ALA n 
1 172 THR n 
1 173 LEU n 
1 174 PRO n 
1 175 LEU n 
1 176 TRP n 
1 177 ALA n 
1 178 THR n 
1 179 TYR n 
1 180 TYR n 
1 181 SER n 
1 182 TYR n 
1 183 ARG n 
1 184 TYR n 
1 185 ASP n 
1 186 TRP n 
1 187 LEU n 
1 188 PHE n 
1 189 GLY n 
1 190 PRO n 
1 191 VAL n 
1 192 MET n 
1 193 CYS n 
1 194 LYS n 
1 195 VAL n 
1 196 PHE n 
1 197 GLY n 
1 198 SER n 
1 199 PHE n 
1 200 LEU n 
1 201 THR n 
1 202 LEU n 
1 203 ASN n 
1 204 MET n 
1 205 PHE n 
1 206 ALA n 
1 207 SER n 
1 208 ILE n 
1 209 PHE n 
1 210 PHE n 
1 211 ILE n 
1 212 THR n 
1 213 CYS n 
1 214 MET n 
1 215 SER n 
1 216 VAL n 
1 217 ASP n 
1 218 ARG n 
1 219 TYR n 
1 220 GLN n 
1 221 SER n 
1 222 VAL n 
1 223 ILE n 
1 224 TYR n 
1 225 PRO n 
1 226 PHE n 
1 227 LEU n 
1 228 SER n 
1 229 GLN n 
1 230 ARG n 
1 231 ARG n 
1 232 ASN n 
1 233 PRO n 
1 234 TRP n 
1 235 GLN n 
1 236 ALA n 
1 237 SER n 
1 238 TYR n 
1 239 ILE n 
1 240 VAL n 
1 241 PRO n 
1 242 LEU n 
1 243 VAL n 
1 244 TRP n 
1 245 CYS n 
1 246 MET n 
1 247 ALA n 
1 248 CYS n 
1 249 LEU n 
1 250 SER n 
1 251 SER n 
1 252 LEU n 
1 253 PRO n 
1 254 THR n 
1 255 PHE n 
1 256 TYR n 
1 257 PHE n 
1 258 ARG n 
1 259 ASP n 
1 260 VAL n 
1 261 ARG n 
1 262 THR n 
1 263 ILE n 
1 264 GLU n 
1 265 TYR n 
1 266 LEU n 
1 267 GLY n 
1 268 VAL n 
1 269 ASN n 
1 270 ALA n 
1 271 CYS n 
1 272 ILE n 
1 273 MET n 
1 274 ALA n 
1 275 PHE n 
1 276 PRO n 
1 277 PRO n 
1 278 GLU n 
1 279 LYS n 
1 280 TYR n 
1 281 ALA n 
1 282 GLN n 
1 283 TRP n 
1 284 SER n 
1 285 ALA n 
1 286 GLY n 
1 287 ILE n 
1 288 ALA n 
1 289 LEU n 
1 290 MET n 
1 291 LYS n 
1 292 ASN n 
1 293 ILE n 
1 294 LEU n 
1 295 GLY n 
1 296 PHE n 
1 297 ILE n 
1 298 ILE n 
1 299 PRO n 
1 300 LEU n 
1 301 ILE n 
1 302 PHE n 
1 303 ILE n 
1 304 ALA n 
1 305 THR n 
1 306 CYS n 
1 307 TYR n 
1 308 PHE n 
1 309 GLY n 
1 310 ILE n 
1 311 ARG n 
1 312 LYS n 
1 313 HIS n 
1 314 LEU n 
1 315 LEU n 
1 316 LYS n 
1 317 THR n 
1 318 ASN n 
1 319 SER n 
1 320 TYR n 
1 321 GLY n 
1 322 LYS n 
1 323 ASN n 
1 324 ARG n 
1 325 ILE n 
1 326 THR n 
1 327 ARG n 
1 328 ASP n 
1 329 GLN n 
1 330 VAL n 
1 331 LEU n 
1 332 LYS n 
1 333 MET n 
1 334 ALA n 
1 335 ALA n 
1 336 ALA n 
1 337 VAL n 
1 338 VAL n 
1 339 LEU n 
1 340 ALA n 
1 341 PHE n 
1 342 ILE n 
1 343 ILE n 
1 344 CYS n 
1 345 TRP n 
1 346 LEU n 
1 347 PRO n 
1 348 PHE n 
1 349 HIS n 
1 350 VAL n 
1 351 LEU n 
1 352 THR n 
1 353 PHE n 
1 354 LEU n 
1 355 ASP n 
1 356 ALA n 
1 357 LEU n 
1 358 ALA n 
1 359 TRP n 
1 360 MET n 
1 361 GLY n 
1 362 VAL n 
1 363 ILE n 
1 364 ASN n 
1 365 SER n 
1 366 CYS n 
1 367 GLU n 
1 368 VAL n 
1 369 ILE n 
1 370 ALA n 
1 371 VAL n 
1 372 ILE n 
1 373 ASP n 
1 374 LEU n 
1 375 ALA n 
1 376 LEU n 
1 377 PRO n 
1 378 PHE n 
1 379 ALA n 
1 380 ILE n 
1 381 LEU n 
1 382 LEU n 
1 383 GLY n 
1 384 PHE n 
1 385 THR n 
1 386 ASN n 
1 387 SER n 
1 388 CYS n 
1 389 VAL n 
1 390 ASN n 
1 391 PRO n 
1 392 PHE n 
1 393 LEU n 
1 394 TYR n 
1 395 CYS n 
1 396 PHE n 
1 397 VAL n 
1 398 GLY n 
1 399 ASN n 
1 400 ARG n 
1 401 PHE n 
1 402 GLN n 
1 403 GLN n 
1 404 LYS n 
1 405 LEU n 
1 406 ARG n 
1 407 SER n 
1 408 VAL n 
1 409 PHE n 
1 410 ARG n 
1 411 VAL n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   110 ?     ? cybC  ? ? ? ? ? ? 'Escherichia coli' 562  ? ? ? ? ? ? ? ? 'Spodoptera frugiperda' 
7108 ? ? ? ? ? ? sf9 ? ? ? ? ? ? ? ? ? ? ? pFastBac ? ? 
1 2 sample 'Biological sequence' 111 411 Human ? AGTR2 ? ? ? ? ? ? 'Homo sapiens'     9606 ? ? ? ? ? ? ? ? 'Spodoptera frugiperda' 
7108 ? ? ? ? ? ? sf9 ? ? ? ? ? ? ? ? ? ? ? pFastBac ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP C562_ECOLX  P0ABE7 ? 1 
;ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLAN
EGKVKEAQAAAEQLKTTRNAYHQKYR
;
23 
2 UNP AGTR2_HUMAN P50052 ? 1 
;CSQKPSDKHLDAIPILYYIIFVIGFLVNIVVVTLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGP
VMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIVPLVWCMACLSSLPTFYFRDVRTIEYLGVNA
CIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHV
LTFLDALAWMGVINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRV
;
35 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5UNF A 1   ? 106 ? P0ABE7 23 ? 128 ? 1001 1106 
2 2 5UNF A 111 ? 411 ? P50052 35 ? 335 ? 35   335  
3 1 5UNF B 1   ? 106 ? P0ABE7 23 ? 128 ? 1001 1106 
4 2 5UNF B 111 ? 411 ? P50052 35 ? 335 ? 35   335  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5UNF TRP A 7   ? UNP P0ABE7 MET 29  'engineered mutation' 1007 1  
1 5UNF ILE A 102 ? UNP P0ABE7 HIS 124 'engineered mutation' 1102 2  
1 5UNF LEU A 106 ? UNP P0ABE7 ARG 128 'engineered mutation' 1106 3  
1 5UNF GLY A 107 ? UNP P0ABE7 ?   ?   linker                1107 4  
1 5UNF SER A 108 ? UNP P0ABE7 ?   ?   linker                1108 5  
1 5UNF GLY A 109 ? UNP P0ABE7 ?   ?   linker                1109 6  
1 5UNF SER A 110 ? UNP P0ABE7 ?   ?   linker                1110 7  
3 5UNF TRP B 7   ? UNP P0ABE7 MET 29  'engineered mutation' 1007 8  
3 5UNF ILE B 102 ? UNP P0ABE7 HIS 124 'engineered mutation' 1102 9  
3 5UNF LEU B 106 ? UNP P0ABE7 ARG 128 'engineered mutation' 1106 10 
3 5UNF GLY B 107 ? UNP P0ABE7 ?   ?   linker                1107 11 
3 5UNF SER B 108 ? UNP P0ABE7 ?   ?   linker                1108 12 
3 5UNF GLY B 109 ? UNP P0ABE7 ?   ?   linker                1109 13 
3 5UNF SER B 110 ? UNP P0ABE7 ?   ?   linker                1110 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
8ES non-polymer         . 
"N-benzyl-N-(2-ethyl-4-oxo-3-{[2'-(2H-tetrazol-5-yl)[1,1'-biphenyl]-4-yl]methyl}-3,4-dihydroquinazolin-6-yl)thiophene-2-carboxamide" 
? 'C36 H29 N7 O2 S' 623.726 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5UNF 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.51 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         50.98 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'LIPIDIC CUBIC PHASE' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'100 mM Tris-HCl, pH 8.0, 25 mM potassium formate, 25% (v/v) PEG400, and 0.3% (v/v) (+/-)-2-Methyl-2,4-pentanediol' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     294 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   Y 
# 
_diffrn_detector.details                      'K-B mirrors' 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'CS-PAD CXI-1' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-12-09 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.3 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'FREE ELECTRON LASER' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLAC LCLS BEAMLINE CXI' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.3 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   CXI 
_diffrn_source.pdbx_synchrotron_site       'SLAC LCLS' 
# 
_reflns.B_iso_Wilson_estimate            90.78 
_reflns.entry_id                         5UNF 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.8 
_reflns.d_resolution_low                 30 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       22934 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  61.6 
_reflns.pdbx_Rmerge_I_obs                0.164 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            4.1 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.8 
_reflns_shell.d_res_low                   2.9 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         0.8 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        100 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                1.72 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             61.6 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            7.10360 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            -1.58750 
_refine.aniso_B[2][2]                            -10.18020 
_refine.aniso_B[2][3]                            0.00000 
_refine.aniso_B[3][3]                            3.07660 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               111.90 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.926 
_refine.correlation_coeff_Fo_to_Fc_free          0.900 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5UNF 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.80 
_refine.ls_d_res_low                             29.57 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     22906 
_refine.ls_number_reflns_R_free                  1118 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.9 
_refine.ls_percent_reflns_R_free                 4.880 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.228 
_refine.ls_R_factor_R_free                       0.256 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.227 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      '4YAY, 4ZUD' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.359 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_analyze.entry_id                        5UNF 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_coordinate_error_obs    0.48 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        6151 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         92 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               6243 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        29.57 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.90 ? 8739 ? t_angle_deg               2.50  HARMONIC     
'X-RAY DIFFRACTION' ? ?    ? 2836 ? t_dihedral_angle_d        15.00 SINUSOIDAL   
'X-RAY DIFFRACTION' ? ?    ? ?    ? t_incorr_chiral_ct        ?     ?            
'X-RAY DIFFRACTION' ? ?    ? ?    ? t_pseud_angle             ?     ?            
'X-RAY DIFFRACTION' ? ?    ? 117  ? t_trig_c_planes           2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?    ? 925  ? t_gen_planes              5.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?    ? 6414 ? t_it                      20.00 HARMONIC     
'X-RAY DIFFRACTION' ? ?    ? ?    ? t_nbd                     ?     ?            
'X-RAY DIFFRACTION' ? 2.54 ? ?    ? t_omega_torsion           ?     ?            
'X-RAY DIFFRACTION' ? 1.53 ? ?    ? t_other_torsion           ?     ?            
'X-RAY DIFFRACTION' ? ?    ? ?    ? t_improper_torsion        ?     ?            
'X-RAY DIFFRACTION' ? ?    ? 850  ? t_chiral_improper_torsion 5.00  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? ?    ? ?    ? t_sum_occupancies         ?     ?            
'X-RAY DIFFRACTION' ? ?    ? ?    ? t_utility_distance        ?     ?            
'X-RAY DIFFRACTION' ? ?    ? ?    ? t_utility_angle           ?     ?            
'X-RAY DIFFRACTION' ? ?    ? ?    ? t_utility_torsion         ?     ?            
'X-RAY DIFFRACTION' ? ?    ? 7691 ? t_ideal_dist_contact      4.00  SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.80 
_refine_ls_shell.d_res_low                        2.92 
_refine_ls_shell.number_reflns_all                2762 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             149 
_refine_ls_shell.number_reflns_R_work             2613 
_refine_ls_shell.percent_reflns_obs               99.78 
_refine_ls_shell.percent_reflns_R_free            5.39 
_refine_ls_shell.R_factor_all                     0.225 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.249 
_refine_ls_shell.R_factor_R_free_error            0.000 
_refine_ls_shell.R_factor_R_work                  0.224 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   12 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5UNF 
_struct.title                        
;XFEL structure of human angiotensin II type 2 receptor (Monoclinic form) in complex with compound 1 (N-benzyl-N-(2-ethyl-4-oxo-3-{[2'-(2H-tetrazol-5-yl)[1,1'-biphenyl]-4-yl])
;
_struct.pdbx_descriptor              'Soluble cytochrome b562,Type-2 angiotensin II receptor' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5UNF 
_struct_keywords.text            
;human Angiotensin II receptor complex, GPCR signaling, GPCR, BRIL, membrane protein, LCP, XFEL, blood pressure regulation, monoclinic crystal, compound 1 (cpd 1), SIGNALING PROTEIN
;
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'AUTHORS STATE THAT THE BIOLOGICAL UNIT IS UNKNOWN' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 2   ? LYS A 19  ? ASP A 1002 LYS A 1019 1 ? 18 
HELX_P HELX_P2  AA2 ASN A 22  ? ALA A 43  ? ASN A 1022 ALA A 1043 1 ? 22 
HELX_P HELX_P3  AA3 SER A 55  ? GLY A 82  ? SER A 1055 GLY A 1082 1 ? 28 
HELX_P HELX_P4  AA4 LYS A 83  ? GLU A 92  ? LYS A 1083 GLU A 1092 1 ? 10 
HELX_P HELX_P5  AA5 GLU A 92  ? ALA A 100 ? GLU A 1092 ALA A 1100 1 ? 9  
HELX_P HELX_P6  AA6 ASP A 121 ? GLN A 148 ? ASP A 45   GLN A 72   1 ? 28 
HELX_P HELX_P7  AA7 VAL A 154 ? ALA A 171 ? VAL A 78   ALA A 95   1 ? 18 
HELX_P HELX_P8  AA8 THR A 172 ? TYR A 182 ? THR A 96   TYR A 106  1 ? 11 
HELX_P HELX_P9  AA9 PHE A 188 ? TYR A 224 ? PHE A 112  TYR A 148  1 ? 37 
HELX_P HELX_P10 AB1 TRP A 234 ? SER A 251 ? TRP A 158  SER A 175  1 ? 18 
HELX_P HELX_P11 AB2 SER A 251 ? PHE A 257 ? SER A 175  PHE A 181  1 ? 7  
HELX_P HELX_P12 AB3 PRO A 276 ? LYS A 279 ? PRO A 200  LYS A 203  5 ? 4  
HELX_P HELX_P13 AB4 TYR A 280 ? PHE A 296 ? TYR A 204  PHE A 220  1 ? 17 
HELX_P HELX_P14 AB5 PHE A 296 ? THR A 317 ? PHE A 220  THR A 241  1 ? 22 
HELX_P HELX_P15 AB6 GLY A 321 ? MET A 360 ? GLY A 245  MET A 284  1 ? 40 
HELX_P HELX_P16 AB7 SER A 365 ? CYS A 395 ? SER A 289  CYS A 319  1 ? 31 
HELX_P HELX_P17 AB8 VAL A 397 ? ARG A 410 ? VAL A 321  ARG A 334  1 ? 14 
HELX_P HELX_P18 AB9 ASP B 2   ? LYS B 19  ? ASP B 1002 LYS B 1019 1 ? 18 
HELX_P HELX_P19 AC1 ASN B 22  ? ALA B 43  ? ASN B 1022 ALA B 1043 1 ? 22 
HELX_P HELX_P20 AC2 SER B 55  ? GLY B 82  ? SER B 1055 GLY B 1082 1 ? 28 
HELX_P HELX_P21 AC3 LYS B 83  ? ALA B 91  ? LYS B 1083 ALA B 1091 1 ? 9  
HELX_P HELX_P22 AC4 GLU B 92  ? GLN B 103 ? GLU B 1092 GLN B 1103 1 ? 12 
HELX_P HELX_P23 AC5 GLY B 107 ? CYS B 111 ? GLY B 1107 CYS B 35   5 ? 5  
HELX_P HELX_P24 AC6 ASP B 121 ? GLN B 148 ? ASP B 45   GLN B 72   1 ? 28 
HELX_P HELX_P25 AC7 VAL B 154 ? ALA B 171 ? VAL B 78   ALA B 95   1 ? 18 
HELX_P HELX_P26 AC8 THR B 172 ? TYR B 182 ? THR B 96   TYR B 106  1 ? 11 
HELX_P HELX_P27 AC9 PHE B 188 ? TYR B 224 ? PHE B 112  TYR B 148  1 ? 37 
HELX_P HELX_P28 AD1 GLN B 235 ? SER B 251 ? GLN B 159  SER B 175  1 ? 17 
HELX_P HELX_P29 AD2 SER B 251 ? PHE B 257 ? SER B 175  PHE B 181  1 ? 7  
HELX_P HELX_P30 AD3 PRO B 276 ? GLU B 278 ? PRO B 200  GLU B 202  5 ? 3  
HELX_P HELX_P31 AD4 LYS B 279 ? PHE B 296 ? LYS B 203  PHE B 220  1 ? 18 
HELX_P HELX_P32 AD5 PHE B 296 ? LEU B 315 ? PHE B 220  LEU B 239  1 ? 20 
HELX_P HELX_P33 AD6 GLY B 321 ? MET B 360 ? GLY B 245  MET B 284  1 ? 40 
HELX_P HELX_P34 AD7 SER B 365 ? TYR B 394 ? SER B 289  TYR B 318  1 ? 30 
HELX_P HELX_P35 AD8 TYR B 394 ? ARG B 410 ? TYR B 318  ARG B 334  1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 193 SG ? ? ? 1_555 A CYS 271 SG ? ? A CYS 117 A CYS 195 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf2 disulf ? ? B CYS 111 SG ? ? ? 1_555 B CYS 366 SG ? ? B CYS 35  B CYS 290 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf3 disulf ? ? B CYS 193 SG ? ? ? 1_555 B CYS 271 SG ? ? B CYS 117 B CYS 195 1_555 ? ? ? ? ? ? ? 2.026 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 258 ? THR A 262 ? ARG A 182 THR A 186 
AA1 2 ASN A 269 ? MET A 273 ? ASN A 193 MET A 197 
AA2 1 ARG B 258 ? THR B 262 ? ARG B 182 THR B 186 
AA2 2 ASN B 269 ? MET B 273 ? ASN B 193 MET B 197 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 261 ? N ARG A 185 O ALA A 270 ? O ALA A 194 
AA2 1 2 N ASP B 259 ? N ASP B 183 O ILE B 272 ? O ILE B 196 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A 8ES 1501 ? 16 'binding site for residue 8ES A 1501' 
AC2 Software B 8ES 1201 ? 15 'binding site for residue 8ES B 1201' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 16 TYR A 127 ? TYR A 51  . ? 1_555 ? 
2  AC1 16 TRP A 176 ? TRP A 100 . ? 1_555 ? 
3  AC1 16 TYR A 179 ? TYR A 103 . ? 1_555 ? 
4  AC1 16 TYR A 184 ? TYR A 108 . ? 1_555 ? 
5  AC1 16 LEU A 200 ? LEU A 124 . ? 1_555 ? 
6  AC1 16 THR A 201 ? THR A 125 . ? 1_555 ? 
7  AC1 16 MET A 204 ? MET A 128 . ? 1_555 ? 
8  AC1 16 PHE A 205 ? PHE A 129 . ? 1_555 ? 
9  AC1 16 THR A 254 ? THR A 178 . ? 1_555 ? 
10 AC1 16 ARG A 258 ? ARG A 182 . ? 1_555 ? 
11 AC1 16 MET A 290 ? MET A 214 . ? 1_555 ? 
12 AC1 16 LYS A 291 ? LYS A 215 . ? 1_555 ? 
13 AC1 16 TRP A 345 ? TRP A 269 . ? 1_555 ? 
14 AC1 16 PHE A 348 ? PHE A 272 . ? 1_555 ? 
15 AC1 16 ILE A 380 ? ILE A 304 . ? 1_555 ? 
16 AC1 16 PHE A 384 ? PHE A 308 . ? 1_555 ? 
17 AC2 15 TYR B 127 ? TYR B 51  . ? 1_555 ? 
18 AC2 15 TRP B 176 ? TRP B 100 . ? 1_555 ? 
19 AC2 15 TYR B 179 ? TYR B 103 . ? 1_555 ? 
20 AC2 15 TYR B 184 ? TYR B 108 . ? 1_555 ? 
21 AC2 15 LEU B 200 ? LEU B 124 . ? 1_555 ? 
22 AC2 15 THR B 201 ? THR B 125 . ? 1_555 ? 
23 AC2 15 MET B 204 ? MET B 128 . ? 1_555 ? 
24 AC2 15 PHE B 205 ? PHE B 129 . ? 1_555 ? 
25 AC2 15 THR B 254 ? THR B 178 . ? 1_555 ? 
26 AC2 15 ARG B 258 ? ARG B 182 . ? 1_555 ? 
27 AC2 15 LYS B 291 ? LYS B 215 . ? 1_555 ? 
28 AC2 15 TRP B 345 ? TRP B 269 . ? 1_555 ? 
29 AC2 15 PHE B 348 ? PHE B 272 . ? 1_555 ? 
30 AC2 15 ILE B 380 ? ILE B 304 . ? 1_555 ? 
31 AC2 15 PHE B 384 ? PHE B 308 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5UNF 
_atom_sites.fract_transf_matrix[1][1]   0.012922 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003301 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014470 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011459 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 1   ? 102.539 28.809  52.879  1.00 174.71 ? 1001 ALA A N   1 
ATOM   2    C CA  . ALA A 1 1   ? 103.410 27.737  53.358  1.00 174.36 ? 1001 ALA A CA  1 
ATOM   3    C C   . ALA A 1 1   ? 102.592 26.524  53.849  1.00 177.28 ? 1001 ALA A C   1 
ATOM   4    O O   . ALA A 1 1   ? 103.155 25.439  54.018  1.00 176.54 ? 1001 ALA A O   1 
ATOM   5    C CB  . ALA A 1 1   ? 104.303 28.251  54.476  1.00 179.42 ? 1001 ALA A CB  1 
ATOM   6    N N   . ASP A 1 2   ? 101.268 26.711  54.062  1.00 173.72 ? 1002 ASP A N   1 
ATOM   7    C CA  . ASP A 1 2   ? 100.330 25.667  54.500  1.00 173.04 ? 1002 ASP A CA  1 
ATOM   8    C C   . ASP A 1 2   ? 100.087 24.653  53.366  1.00 173.10 ? 1002 ASP A C   1 
ATOM   9    O O   . ASP A 1 2   ? 100.116 25.037  52.197  1.00 170.82 ? 1002 ASP A O   1 
ATOM   10   C CB  . ASP A 1 2   ? 99.002  26.313  54.949  1.00 176.73 ? 1002 ASP A CB  1 
ATOM   11   C CG  . ASP A 1 2   ? 97.935  25.362  55.469  1.00 186.56 ? 1002 ASP A CG  1 
ATOM   12   O OD1 . ASP A 1 2   ? 98.296  24.266  55.956  1.00 187.22 ? 1002 ASP A OD1 1 
ATOM   13   O OD2 . ASP A 1 2   ? 96.749  25.753  55.476  1.00 192.62 ? 1002 ASP A OD2 1 
ATOM   14   N N   . LEU A 1 3   ? 99.834  23.366  53.715  1.00 168.76 ? 1003 LEU A N   1 
ATOM   15   C CA  . LEU A 1 3   ? 99.610  22.273  52.754  1.00 165.45 ? 1003 LEU A CA  1 
ATOM   16   C C   . LEU A 1 3   ? 98.328  22.508  51.917  1.00 167.06 ? 1003 LEU A C   1 
ATOM   17   O O   . LEU A 1 3   ? 98.354  22.295  50.705  1.00 164.46 ? 1003 LEU A O   1 
ATOM   18   C CB  . LEU A 1 3   ? 99.516  20.918  53.494  1.00 166.43 ? 1003 LEU A CB  1 
ATOM   19   C CG  . LEU A 1 3   ? 99.374  19.644  52.631  1.00 169.16 ? 1003 LEU A CG  1 
ATOM   20   C CD1 . LEU A 1 3   ? 100.618 19.391  51.795  1.00 167.59 ? 1003 LEU A CD1 1 
ATOM   21   C CD2 . LEU A 1 3   ? 99.140  18.432  53.497  1.00 173.54 ? 1003 LEU A CD2 1 
ATOM   22   N N   . GLU A 1 4   ? 97.229  22.946  52.560  1.00 164.69 ? 1004 GLU A N   1 
ATOM   23   C CA  . GLU A 1 4   ? 95.942  23.221  51.905  1.00 163.95 ? 1004 GLU A CA  1 
ATOM   24   C C   . GLU A 1 4   ? 96.070  24.390  50.901  1.00 165.64 ? 1004 GLU A C   1 
ATOM   25   O O   . GLU A 1 4   ? 95.520  24.318  49.799  1.00 164.00 ? 1004 GLU A O   1 
ATOM   26   C CB  . GLU A 1 4   ? 94.875  23.543  52.969  1.00 168.40 ? 1004 GLU A CB  1 
ATOM   27   C CG  . GLU A 1 4   ? 93.481  23.805  52.416  1.00 180.85 ? 1004 GLU A CG  1 
ATOM   28   C CD  . GLU A 1 4   ? 92.417  24.189  53.430  1.00 209.10 ? 1004 GLU A CD  1 
ATOM   29   O OE1 . GLU A 1 4   ? 91.281  24.492  52.999  1.00 206.40 ? 1004 GLU A OE1 1 
ATOM   30   O OE2 . GLU A 1 4   ? 92.718  24.212  54.646  1.00 207.41 ? 1004 GLU A OE2 1 
ATOM   31   N N   . ASP A 1 5   ? 96.803  25.448  51.293  1.00 162.29 ? 1005 ASP A N   1 
ATOM   32   C CA  . ASP A 1 5   ? 97.023  26.659  50.498  1.00 161.55 ? 1005 ASP A CA  1 
ATOM   33   C C   . ASP A 1 5   ? 97.980  26.393  49.328  1.00 160.55 ? 1005 ASP A C   1 
ATOM   34   O O   . ASP A 1 5   ? 97.850  27.037  48.284  1.00 159.23 ? 1005 ASP A O   1 
ATOM   35   C CB  . ASP A 1 5   ? 97.579  27.774  51.393  1.00 166.35 ? 1005 ASP A CB  1 
ATOM   36   C CG  . ASP A 1 5   ? 96.653  28.149  52.541  1.00 180.74 ? 1005 ASP A CG  1 
ATOM   37   O OD1 . ASP A 1 5   ? 95.418  27.971  52.398  1.00 181.77 ? 1005 ASP A OD1 1 
ATOM   38   O OD2 . ASP A 1 5   ? 97.153  28.671  53.556  1.00 189.58 ? 1005 ASP A OD2 1 
ATOM   39   N N   . ASN A 1 6   ? 98.931  25.450  49.498  1.00 154.49 ? 1006 ASN A N   1 
ATOM   40   C CA  . ASN A 1 6   ? 99.863  25.066  48.438  1.00 151.26 ? 1006 ASN A CA  1 
ATOM   41   C C   . ASN A 1 6   ? 99.133  24.227  47.385  1.00 152.31 ? 1006 ASN A C   1 
ATOM   42   O O   . ASN A 1 6   ? 99.420  24.388  46.197  1.00 150.71 ? 1006 ASN A O   1 
ATOM   43   C CB  . ASN A 1 6   ? 101.078 24.319  48.993  1.00 150.76 ? 1006 ASN A CB  1 
ATOM   44   C CG  . ASN A 1 6   ? 102.024 25.178  49.808  1.00 169.82 ? 1006 ASN A CG  1 
ATOM   45   O OD1 . ASN A 1 6   ? 102.018 26.416  49.744  1.00 161.89 ? 1006 ASN A OD1 1 
ATOM   46   N ND2 . ASN A 1 6   ? 102.905 24.530  50.551  1.00 162.85 ? 1006 ASN A ND2 1 
ATOM   47   N N   . TRP A 1 7   ? 98.157  23.369  47.803  1.00 148.13 ? 1007 TRP A N   1 
ATOM   48   C CA  . TRP A 1 7   ? 97.338  22.608  46.852  1.00 146.45 ? 1007 TRP A CA  1 
ATOM   49   C C   . TRP A 1 7   ? 96.401  23.549  46.102  1.00 148.33 ? 1007 TRP A C   1 
ATOM   50   O O   . TRP A 1 7   ? 96.074  23.283  44.946  1.00 147.11 ? 1007 TRP A O   1 
ATOM   51   C CB  . TRP A 1 7   ? 96.539  21.475  47.513  1.00 146.46 ? 1007 TRP A CB  1 
ATOM   52   C CG  . TRP A 1 7   ? 97.339  20.225  47.713  1.00 147.07 ? 1007 TRP A CG  1 
ATOM   53   C CD1 . TRP A 1 7   ? 97.884  19.774  48.877  1.00 150.99 ? 1007 TRP A CD1 1 
ATOM   54   C CD2 . TRP A 1 7   ? 97.780  19.323  46.688  1.00 145.77 ? 1007 TRP A CD2 1 
ATOM   55   N NE1 . TRP A 1 7   ? 98.591  18.614  48.652  1.00 149.99 ? 1007 TRP A NE1 1 
ATOM   56   C CE2 . TRP A 1 7   ? 98.547  18.317  47.315  1.00 150.07 ? 1007 TRP A CE2 1 
ATOM   57   C CE3 . TRP A 1 7   ? 97.574  19.248  45.300  1.00 146.24 ? 1007 TRP A CE3 1 
ATOM   58   C CZ2 . TRP A 1 7   ? 99.118  17.254  46.602  1.00 148.88 ? 1007 TRP A CZ2 1 
ATOM   59   C CZ3 . TRP A 1 7   ? 98.168  18.214  44.591  1.00 147.12 ? 1007 TRP A CZ3 1 
ATOM   60   C CH2 . TRP A 1 7   ? 98.908  17.218  45.242  1.00 148.12 ? 1007 TRP A CH2 1 
ATOM   61   N N   . GLU A 1 8   ? 96.015  24.673  46.736  1.00 144.58 ? 1008 GLU A N   1 
ATOM   62   C CA  . GLU A 1 8   ? 95.188  25.690  46.096  1.00 144.50 ? 1008 GLU A CA  1 
ATOM   63   C C   . GLU A 1 8   ? 96.033  26.401  45.024  1.00 143.70 ? 1008 GLU A C   1 
ATOM   64   O O   . GLU A 1 8   ? 95.535  26.640  43.927  1.00 143.12 ? 1008 GLU A O   1 
ATOM   65   C CB  . GLU A 1 8   ? 94.620  26.668  47.139  1.00 148.76 ? 1008 GLU A CB  1 
ATOM   66   C CG  . GLU A 1 8   ? 93.614  27.663  46.579  1.00 161.71 ? 1008 GLU A CG  1 
ATOM   67   C CD  . GLU A 1 8   ? 92.929  28.562  47.594  1.00 187.43 ? 1008 GLU A CD  1 
ATOM   68   O OE1 . GLU A 1 8   ? 92.953  28.232  48.803  1.00 185.36 ? 1008 GLU A OE1 1 
ATOM   69   O OE2 . GLU A 1 8   ? 92.303  29.559  47.168  1.00 183.40 ? 1008 GLU A OE2 1 
ATOM   70   N N   . THR A 1 9   ? 97.332  26.648  45.318  1.00 137.00 ? 1009 THR A N   1 
ATOM   71   C CA  . THR A 1 9   ? 98.282  27.275  44.391  1.00 134.69 ? 1009 THR A CA  1 
ATOM   72   C C   . THR A 1 9   ? 98.543  26.314  43.208  1.00 133.76 ? 1009 THR A C   1 
ATOM   73   O O   . THR A 1 9   ? 98.640  26.774  42.068  1.00 132.89 ? 1009 THR A O   1 
ATOM   74   C CB  . THR A 1 9   ? 99.581  27.653  45.130  1.00 142.75 ? 1009 THR A CB  1 
ATOM   75   O OG1 . THR A 1 9   ? 99.257  28.430  46.286  1.00 144.77 ? 1009 THR A OG1 1 
ATOM   76   C CG2 . THR A 1 9   ? 100.569 28.423  44.246  1.00 140.77 ? 1009 THR A CG2 1 
ATOM   77   N N   . LEU A 1 10  ? 98.619  24.988  43.481  1.00 127.39 ? 1010 LEU A N   1 
ATOM   78   C CA  . LEU A 1 10  ? 98.818  23.957  42.454  1.00 124.84 ? 1010 LEU A CA  1 
ATOM   79   C C   . LEU A 1 10  ? 97.597  23.838  41.536  1.00 128.76 ? 1010 LEU A C   1 
ATOM   80   O O   . LEU A 1 10  ? 97.770  23.725  40.325  1.00 127.80 ? 1010 LEU A O   1 
ATOM   81   C CB  . LEU A 1 10  ? 99.119  22.581  43.082  1.00 124.09 ? 1010 LEU A CB  1 
ATOM   82   C CG  . LEU A 1 10  ? 100.508 22.376  43.681  1.00 127.89 ? 1010 LEU A CG  1 
ATOM   83   C CD1 . LEU A 1 10  ? 100.566 21.116  44.519  1.00 128.31 ? 1010 LEU A CD1 1 
ATOM   84   C CD2 . LEU A 1 10  ? 101.569 22.322  42.604  1.00 128.92 ? 1010 LEU A CD2 1 
ATOM   85   N N   . ASN A 1 11  ? 96.373  23.879  42.104  1.00 126.37 ? 1011 ASN A N   1 
ATOM   86   C CA  . ASN A 1 11  ? 95.123  23.743  41.348  1.00 127.23 ? 1011 ASN A CA  1 
ATOM   87   C C   . ASN A 1 11  ? 94.794  25.024  40.546  1.00 130.11 ? 1011 ASN A C   1 
ATOM   88   O O   . ASN A 1 11  ? 94.319  24.901  39.416  1.00 130.09 ? 1011 ASN A O   1 
ATOM   89   C CB  . ASN A 1 11  ? 93.957  23.404  42.285  1.00 131.28 ? 1011 ASN A CB  1 
ATOM   90   C CG  . ASN A 1 11  ? 94.078  22.052  42.974  1.00 158.84 ? 1011 ASN A CG  1 
ATOM   91   O OD1 . ASN A 1 11  ? 94.673  21.094  42.455  1.00 152.39 ? 1011 ASN A OD1 1 
ATOM   92   N ND2 . ASN A 1 11  ? 93.460  21.929  44.140  1.00 153.27 ? 1011 ASN A ND2 1 
ATOM   93   N N   . ASP A 1 12  ? 95.042  26.235  41.113  1.00 126.07 ? 1012 ASP A N   1 
ATOM   94   C CA  . ASP A 1 12  ? 94.768  27.512  40.430  1.00 126.99 ? 1012 ASP A CA  1 
ATOM   95   C C   . ASP A 1 12  ? 95.649  27.701  39.192  1.00 127.90 ? 1012 ASP A C   1 
ATOM   96   O O   . ASP A 1 12  ? 95.169  28.236  38.190  1.00 129.03 ? 1012 ASP A O   1 
ATOM   97   C CB  . ASP A 1 12  ? 94.968  28.721  41.365  1.00 130.36 ? 1012 ASP A CB  1 
ATOM   98   C CG  . ASP A 1 12  ? 93.952  28.871  42.482  1.00 143.81 ? 1012 ASP A CG  1 
ATOM   99   O OD1 . ASP A 1 12  ? 93.141  27.935  42.684  1.00 144.84 ? 1012 ASP A OD1 1 
ATOM   100  O OD2 . ASP A 1 12  ? 93.975  29.916  43.164  1.00 152.08 ? 1012 ASP A OD2 1 
ATOM   101  N N   . ASN A 1 13  ? 96.933  27.287  39.267  1.00 120.65 ? 1013 ASN A N   1 
ATOM   102  C CA  . ASN A 1 13  ? 97.880  27.418  38.157  1.00 118.39 ? 1013 ASN A CA  1 
ATOM   103  C C   . ASN A 1 13  ? 97.611  26.357  37.076  1.00 119.89 ? 1013 ASN A C   1 
ATOM   104  O O   . ASN A 1 13  ? 97.939  26.602  35.915  1.00 119.71 ? 1013 ASN A O   1 
ATOM   105  C CB  . ASN A 1 13  ? 99.318  27.323  38.645  1.00 116.58 ? 1013 ASN A CB  1 
ATOM   106  C CG  . ASN A 1 13  ? 99.763  28.464  39.533  1.00 137.25 ? 1013 ASN A CG  1 
ATOM   107  O OD1 . ASN A 1 13  ? 100.639 28.301  40.380  1.00 133.04 ? 1013 ASN A OD1 1 
ATOM   108  N ND2 . ASN A 1 13  ? 99.153  29.637  39.392  1.00 129.11 ? 1013 ASN A ND2 1 
ATOM   109  N N   . LEU A 1 14  ? 96.990  25.205  37.438  1.00 114.72 ? 1014 LEU A N   1 
ATOM   110  C CA  . LEU A 1 14  ? 96.590  24.177  36.465  1.00 114.28 ? 1014 LEU A CA  1 
ATOM   111  C C   . LEU A 1 14  ? 95.531  24.725  35.510  1.00 119.66 ? 1014 LEU A C   1 
ATOM   112  O O   . LEU A 1 14  ? 95.544  24.394  34.324  1.00 119.99 ? 1014 LEU A O   1 
ATOM   113  C CB  . LEU A 1 14  ? 96.062  22.909  37.157  1.00 114.38 ? 1014 LEU A CB  1 
ATOM   114  C CG  . LEU A 1 14  ? 97.085  21.952  37.750  1.00 116.98 ? 1014 LEU A CG  1 
ATOM   115  C CD1 . LEU A 1 14  ? 96.422  20.966  38.692  1.00 117.80 ? 1014 LEU A CD1 1 
ATOM   116  C CD2 . LEU A 1 14  ? 97.882  21.232  36.656  1.00 118.39 ? 1014 LEU A CD2 1 
ATOM   117  N N   . LYS A 1 15  ? 94.631  25.590  36.039  1.00 116.99 ? 1015 LYS A N   1 
ATOM   118  C CA  . LYS A 1 15  ? 93.556  26.258  35.298  1.00 119.24 ? 1015 LYS A CA  1 
ATOM   119  C C   . LYS A 1 15  ? 94.136  27.262  34.308  1.00 121.79 ? 1015 LYS A C   1 
ATOM   120  O O   . LYS A 1 15  ? 93.516  27.536  33.279  1.00 124.19 ? 1015 LYS A O   1 
ATOM   121  C CB  . LYS A 1 15  ? 92.585  26.970  36.267  1.00 123.94 ? 1015 LYS A CB  1 
ATOM   122  C CG  . LYS A 1 15  ? 91.995  26.098  37.388  1.00 140.38 ? 1015 LYS A CG  1 
ATOM   123  C CD  . LYS A 1 15  ? 91.125  24.929  36.899  1.00 152.48 ? 1015 LYS A CD  1 
ATOM   124  C CE  . LYS A 1 15  ? 90.591  24.078  38.034  1.00 161.87 ? 1015 LYS A CE  1 
ATOM   125  N NZ  . LYS A 1 15  ? 89.687  24.838  38.944  1.00 171.63 ? 1015 LYS A NZ  1 
ATOM   126  N N   . VAL A 1 16  ? 95.328  27.816  34.628  1.00 114.53 ? 1016 VAL A N   1 
ATOM   127  C CA  . VAL A 1 16  ? 96.031  28.787  33.790  1.00 113.92 ? 1016 VAL A CA  1 
ATOM   128  C C   . VAL A 1 16  ? 96.616  28.053  32.567  1.00 116.50 ? 1016 VAL A C   1 
ATOM   129  O O   . VAL A 1 16  ? 96.425  28.520  31.446  1.00 117.71 ? 1016 VAL A O   1 
ATOM   130  C CB  . VAL A 1 16  ? 97.123  29.557  34.589  1.00 115.93 ? 1016 VAL A CB  1 
ATOM   131  C CG1 . VAL A 1 16  ? 97.923  30.495  33.688  1.00 116.27 ? 1016 VAL A CG1 1 
ATOM   132  C CG2 . VAL A 1 16  ? 96.513  30.329  35.755  1.00 117.23 ? 1016 VAL A CG2 1 
ATOM   133  N N   . ILE A 1 17  ? 97.285  26.890  32.786  1.00 110.63 ? 1017 ILE A N   1 
ATOM   134  C CA  . ILE A 1 17  ? 97.917  26.057  31.747  1.00 109.54 ? 1017 ILE A CA  1 
ATOM   135  C C   . ILE A 1 17  ? 96.868  25.636  30.690  1.00 116.89 ? 1017 ILE A C   1 
ATOM   136  O O   . ILE A 1 17  ? 97.149  25.735  29.495  1.00 117.75 ? 1017 ILE A O   1 
ATOM   137  C CB  . ILE A 1 17  ? 98.608  24.806  32.376  1.00 110.06 ? 1017 ILE A CB  1 
ATOM   138  C CG1 . ILE A 1 17  ? 99.666  25.222  33.425  1.00 108.14 ? 1017 ILE A CG1 1 
ATOM   139  C CG2 . ILE A 1 17  ? 99.236  23.914  31.291  1.00 110.69 ? 1017 ILE A CG2 1 
ATOM   140  C CD1 . ILE A 1 17  ? 100.296 24.066  34.249  1.00 113.89 ? 1017 ILE A CD1 1 
ATOM   141  N N   . GLU A 1 18  ? 95.670  25.189  31.131  1.00 115.21 ? 1018 GLU A N   1 
ATOM   142  C CA  . GLU A 1 18  ? 94.576  24.749  30.247  1.00 118.39 ? 1018 GLU A CA  1 
ATOM   143  C C   . GLU A 1 18  ? 94.115  25.871  29.306  1.00 124.95 ? 1018 GLU A C   1 
ATOM   144  O O   . GLU A 1 18  ? 93.858  25.618  28.128  1.00 127.02 ? 1018 GLU A O   1 
ATOM   145  C CB  . GLU A 1 18  ? 93.362  24.257  31.068  1.00 121.41 ? 1018 GLU A CB  1 
ATOM   146  C CG  . GLU A 1 18  ? 93.621  23.064  31.976  1.00 130.26 ? 1018 GLU A CG  1 
ATOM   147  C CD  . GLU A 1 18  ? 92.442  22.597  32.815  1.00 153.66 ? 1018 GLU A CD  1 
ATOM   148  O OE1 . GLU A 1 18  ? 92.684  21.957  33.864  1.00 150.51 ? 1018 GLU A OE1 1 
ATOM   149  O OE2 . GLU A 1 18  ? 91.285  22.921  32.463  1.00 149.39 ? 1018 GLU A OE2 1 
ATOM   150  N N   . LYS A 1 19  ? 94.001  27.103  29.837  1.00 121.55 ? 1019 LYS A N   1 
ATOM   151  C CA  . LYS A 1 19  ? 93.515  28.276  29.105  1.00 124.59 ? 1019 LYS A CA  1 
ATOM   152  C C   . LYS A 1 19  ? 94.681  29.173  28.622  1.00 126.91 ? 1019 LYS A C   1 
ATOM   153  O O   . LYS A 1 19  ? 94.442  30.310  28.202  1.00 128.78 ? 1019 LYS A O   1 
ATOM   154  C CB  . LYS A 1 19  ? 92.560  29.095  30.002  1.00 129.20 ? 1019 LYS A CB  1 
ATOM   155  C CG  . LYS A 1 19  ? 91.322  28.330  30.471  1.00 143.72 ? 1019 LYS A CG  1 
ATOM   156  C CD  . LYS A 1 19  ? 90.451  29.170  31.397  1.00 154.14 ? 1019 LYS A CD  1 
ATOM   157  C CE  . LYS A 1 19  ? 89.244  28.402  31.879  1.00 164.29 ? 1019 LYS A CE  1 
ATOM   158  N NZ  . LYS A 1 19  ? 88.388  29.224  32.772  1.00 173.74 ? 1019 LYS A NZ  1 
ATOM   159  N N   . ALA A 1 20  ? 95.930  28.656  28.655  1.00 120.04 ? 1020 ALA A N   1 
ATOM   160  C CA  . ALA A 1 20  ? 97.116  29.409  28.230  1.00 118.40 ? 1020 ALA A CA  1 
ATOM   161  C C   . ALA A 1 20  ? 97.199  29.497  26.712  1.00 123.62 ? 1020 ALA A C   1 
ATOM   162  O O   . ALA A 1 20  ? 96.823  28.555  26.007  1.00 123.93 ? 1020 ALA A O   1 
ATOM   163  C CB  . ALA A 1 20  ? 98.381  28.772  28.778  1.00 115.32 ? 1020 ALA A CB  1 
ATOM   164  N N   . ASP A 1 21  ? 97.703  30.641  26.221  1.00 120.95 ? 1021 ASP A N   1 
ATOM   165  C CA  . ASP A 1 21  ? 97.864  30.935  24.800  1.00 123.08 ? 1021 ASP A CA  1 
ATOM   166  C C   . ASP A 1 21  ? 99.297  30.666  24.354  1.00 123.37 ? 1021 ASP A C   1 
ATOM   167  O O   . ASP A 1 21  ? 99.509  29.977  23.353  1.00 123.41 ? 1021 ASP A O   1 
ATOM   168  C CB  . ASP A 1 21  ? 97.482  32.407  24.511  1.00 128.62 ? 1021 ASP A CB  1 
ATOM   169  C CG  . ASP A 1 21  ? 96.068  32.817  24.912  1.00 146.62 ? 1021 ASP A CG  1 
ATOM   170  O OD1 . ASP A 1 21  ? 95.205  31.920  25.068  1.00 148.81 ? 1021 ASP A OD1 1 
ATOM   171  O OD2 . ASP A 1 21  ? 95.810  34.037  25.010  1.00 156.49 ? 1021 ASP A OD2 1 
ATOM   172  N N   . ASN A 1 22  ? 100.283 31.204  25.110  1.00 116.92 ? 1022 ASN A N   1 
ATOM   173  C CA  . ASN A 1 22  ? 101.711 31.097  24.802  1.00 114.39 ? 1022 ASN A CA  1 
ATOM   174  C C   . ASN A 1 22  ? 102.461 30.212  25.838  1.00 113.83 ? 1022 ASN A C   1 
ATOM   175  O O   . ASN A 1 22  ? 101.931 29.914  26.914  1.00 112.55 ? 1022 ASN A O   1 
ATOM   176  C CB  . ASN A 1 22  ? 102.347 32.496  24.744  1.00 115.22 ? 1022 ASN A CB  1 
ATOM   177  C CG  . ASN A 1 22  ? 102.131 33.343  25.973  1.00 133.92 ? 1022 ASN A CG  1 
ATOM   178  O OD1 . ASN A 1 22  ? 102.755 33.144  27.014  1.00 122.38 ? 1022 ASN A OD1 1 
ATOM   179  N ND2 . ASN A 1 22  ? 101.306 34.368  25.844  1.00 131.03 ? 1022 ASN A ND2 1 
ATOM   180  N N   . ALA A 1 23  ? 103.699 29.796  25.480  1.00 107.80 ? 1023 ALA A N   1 
ATOM   181  C CA  . ALA A 1 23  ? 104.583 28.944  26.277  1.00 104.41 ? 1023 ALA A CA  1 
ATOM   182  C C   . ALA A 1 23  ? 105.066 29.652  27.544  1.00 106.70 ? 1023 ALA A C   1 
ATOM   183  O O   . ALA A 1 23  ? 105.386 28.977  28.524  1.00 104.55 ? 1023 ALA A O   1 
ATOM   184  C CB  . ALA A 1 23  ? 105.779 28.522  25.441  1.00 104.83 ? 1023 ALA A CB  1 
ATOM   185  N N   . ALA A 1 24  ? 105.129 31.002  27.524  1.00 104.35 ? 1024 ALA A N   1 
ATOM   186  C CA  . ALA A 1 24  ? 105.547 31.811  28.672  1.00 103.75 ? 1024 ALA A CA  1 
ATOM   187  C C   . ALA A 1 24  ? 104.514 31.734  29.810  1.00 107.07 ? 1024 ALA A C   1 
ATOM   188  O O   . ALA A 1 24  ? 104.910 31.728  30.976  1.00 105.55 ? 1024 ALA A O   1 
ATOM   189  C CB  . ALA A 1 24  ? 105.757 33.254  28.251  1.00 106.97 ? 1024 ALA A CB  1 
ATOM   190  N N   . GLN A 1 25  ? 103.198 31.651  29.471  1.00 104.61 ? 1025 GLN A N   1 
ATOM   191  C CA  . GLN A 1 25  ? 102.113 31.503  30.455  1.00 104.44 ? 1025 GLN A CA  1 
ATOM   192  C C   . GLN A 1 25  ? 102.208 30.152  31.153  1.00 105.04 ? 1025 GLN A C   1 
ATOM   193  O O   . GLN A 1 25  ? 102.035 30.077  32.371  1.00 104.03 ? 1025 GLN A O   1 
ATOM   194  C CB  . GLN A 1 25  ? 100.723 31.657  29.805  1.00 108.42 ? 1025 GLN A CB  1 
ATOM   195  C CG  . GLN A 1 25  ? 100.429 33.037  29.224  1.00 128.36 ? 1025 GLN A CG  1 
ATOM   196  C CD  . GLN A 1 25  ? 99.038  33.144  28.636  1.00 151.47 ? 1025 GLN A CD  1 
ATOM   197  O OE1 . GLN A 1 25  ? 98.845  33.705  27.554  1.00 149.98 ? 1025 GLN A OE1 1 
ATOM   198  N NE2 . GLN A 1 25  ? 98.042  32.570  29.304  1.00 143.61 ? 1025 GLN A NE2 1 
ATOM   199  N N   . VAL A 1 26  ? 102.493 29.086  30.368  1.00 100.22 ? 1026 VAL A N   1 
ATOM   200  C CA  . VAL A 1 26  ? 102.644 27.702  30.834  1.00 98.04  ? 1026 VAL A CA  1 
ATOM   201  C C   . VAL A 1 26  ? 103.884 27.614  31.746  1.00 100.64 ? 1026 VAL A C   1 
ATOM   202  O O   . VAL A 1 26  ? 103.779 27.090  32.855  1.00 99.24  ? 1026 VAL A O   1 
ATOM   203  C CB  . VAL A 1 26  ? 102.731 26.698  29.646  1.00 101.78 ? 1026 VAL A CB  1 
ATOM   204  C CG1 . VAL A 1 26  ? 102.845 25.265  30.142  1.00 100.17 ? 1026 VAL A CG1 1 
ATOM   205  C CG2 . VAL A 1 26  ? 101.530 26.833  28.721  1.00 104.03 ? 1026 VAL A CG2 1 
ATOM   206  N N   . LYS A 1 27  ? 105.039 28.162  31.286  1.00 97.49  ? 1027 LYS A N   1 
ATOM   207  C CA  . LYS A 1 27  ? 106.311 28.176  32.020  1.00 96.65  ? 1027 LYS A CA  1 
ATOM   208  C C   . LYS A 1 27  ? 106.147 28.880  33.380  1.00 100.67 ? 1027 LYS A C   1 
ATOM   209  O O   . LYS A 1 27  ? 106.577 28.332  34.394  1.00 99.67  ? 1027 LYS A O   1 
ATOM   210  C CB  . LYS A 1 27  ? 107.404 28.871  31.185  1.00 100.22 ? 1027 LYS A CB  1 
ATOM   211  C CG  . LYS A 1 27  ? 108.796 28.872  31.830  1.00 117.10 ? 1027 LYS A CG  1 
ATOM   212  C CD  . LYS A 1 27  ? 109.805 29.786  31.101  1.00 130.90 ? 1027 LYS A CD  1 
ATOM   213  C CE  . LYS A 1 27  ? 109.477 31.265  31.199  1.00 147.73 ? 1027 LYS A CE  1 
ATOM   214  N NZ  . LYS A 1 27  ? 110.486 32.110  30.514  1.00 160.12 ? 1027 LYS A NZ  1 
ATOM   215  N N   . ASP A 1 28  ? 105.510 30.080  33.391  1.00 98.56  ? 1028 ASP A N   1 
ATOM   216  C CA  . ASP A 1 28  ? 105.260 30.888  34.593  1.00 99.37  ? 1028 ASP A CA  1 
ATOM   217  C C   . ASP A 1 28  ? 104.424 30.102  35.617  1.00 101.67 ? 1028 ASP A C   1 
ATOM   218  O O   . ASP A 1 28  ? 104.819 30.016  36.782  1.00 101.35 ? 1028 ASP A O   1 
ATOM   219  C CB  . ASP A 1 28  ? 104.543 32.205  34.220  1.00 103.75 ? 1028 ASP A CB  1 
ATOM   220  C CG  . ASP A 1 28  ? 104.284 33.151  35.383  1.00 117.15 ? 1028 ASP A CG  1 
ATOM   221  O OD1 . ASP A 1 28  ? 105.206 33.348  36.207  1.00 118.22 ? 1028 ASP A OD1 1 
ATOM   222  O OD2 . ASP A 1 28  ? 103.206 33.788  35.400  1.00 125.23 ? 1028 ASP A OD2 1 
ATOM   223  N N   . ALA A 1 29  ? 103.291 29.505  35.170  1.00 96.94  ? 1029 ALA A N   1 
ATOM   224  C CA  . ALA A 1 29  ? 102.390 28.717  36.014  1.00 95.89  ? 1029 ALA A CA  1 
ATOM   225  C C   . ALA A 1 29  ? 103.113 27.504  36.628  1.00 97.32  ? 1029 ALA A C   1 
ATOM   226  O O   . ALA A 1 29  ? 102.993 27.289  37.832  1.00 97.34  ? 1029 ALA A O   1 
ATOM   227  C CB  . ALA A 1 29  ? 101.189 28.254  35.209  1.00 97.10  ? 1029 ALA A CB  1 
ATOM   228  N N   . LEU A 1 30  ? 103.902 26.756  35.817  1.00 91.70  ? 1030 LEU A N   1 
ATOM   229  C CA  . LEU A 1 30  ? 104.667 25.578  36.254  1.00 90.00  ? 1030 LEU A CA  1 
ATOM   230  C C   . LEU A 1 30  ? 105.785 25.936  37.235  1.00 93.79  ? 1030 LEU A C   1 
ATOM   231  O O   . LEU A 1 30  ? 106.149 25.098  38.057  1.00 93.39  ? 1030 LEU A O   1 
ATOM   232  C CB  . LEU A 1 30  ? 105.288 24.853  35.054  1.00 89.53  ? 1030 LEU A CB  1 
ATOM   233  C CG  . LEU A 1 30  ? 104.367 24.091  34.112  1.00 94.27  ? 1030 LEU A CG  1 
ATOM   234  C CD1 . LEU A 1 30  ? 105.053 23.833  32.800  1.00 94.49  ? 1030 LEU A CD1 1 
ATOM   235  C CD2 . LEU A 1 30  ? 103.853 22.807  34.749  1.00 96.15  ? 1030 LEU A CD2 1 
ATOM   236  N N   . THR A 1 31  ? 106.358 27.151  37.126  1.00 91.20  ? 1031 THR A N   1 
ATOM   237  C CA  . THR A 1 31  ? 107.424 27.616  38.024  1.00 92.15  ? 1031 THR A CA  1 
ATOM   238  C C   . THR A 1 31  ? 106.825 27.853  39.420  1.00 97.67  ? 1031 THR A C   1 
ATOM   239  O O   . THR A 1 31  ? 107.445 27.503  40.427  1.00 97.85  ? 1031 THR A O   1 
ATOM   240  C CB  . THR A 1 31  ? 108.094 28.874  37.453  1.00 99.62  ? 1031 THR A CB  1 
ATOM   241  O OG1 . THR A 1 31  ? 108.623 28.568  36.165  1.00 98.65  ? 1031 THR A OG1 1 
ATOM   242  C CG2 . THR A 1 31  ? 109.212 29.381  38.326  1.00 98.57  ? 1031 THR A CG2 1 
ATOM   243  N N   . LYS A 1 32  ? 105.601 28.415  39.461  1.00 95.18  ? 1032 LYS A N   1 
ATOM   244  C CA  . LYS A 1 32  ? 104.851 28.669  40.693  1.00 96.28  ? 1032 LYS A CA  1 
ATOM   245  C C   . LYS A 1 32  ? 104.422 27.344  41.321  1.00 100.26 ? 1032 LYS A C   1 
ATOM   246  O O   . LYS A 1 32  ? 104.425 27.213  42.546  1.00 101.48 ? 1032 LYS A O   1 
ATOM   247  C CB  . LYS A 1 32  ? 103.628 29.566  40.414  1.00 99.31  ? 1032 LYS A CB  1 
ATOM   248  C CG  . LYS A 1 32  ? 103.976 30.956  39.883  1.00 108.53 ? 1032 LYS A CG  1 
ATOM   249  C CD  . LYS A 1 32  ? 102.733 31.717  39.464  1.00 117.67 ? 1032 LYS A CD  1 
ATOM   250  C CE  . LYS A 1 32  ? 103.071 33.049  38.844  1.00 126.21 ? 1032 LYS A CE  1 
ATOM   251  N NZ  . LYS A 1 32  ? 101.858 33.750  38.352  1.00 133.85 ? 1032 LYS A NZ  1 
ATOM   252  N N   . MET A 1 33  ? 104.095 26.350  40.472  1.00 95.62  ? 1033 MET A N   1 
ATOM   253  C CA  . MET A 1 33  ? 103.683 25.006  40.891  1.00 94.86  ? 1033 MET A CA  1 
ATOM   254  C C   . MET A 1 33  ? 104.849 24.205  41.466  1.00 99.36  ? 1033 MET A C   1 
ATOM   255  O O   . MET A 1 33  ? 104.651 23.497  42.453  1.00 99.44  ? 1033 MET A O   1 
ATOM   256  C CB  . MET A 1 33  ? 103.067 24.226  39.727  1.00 96.02  ? 1033 MET A CB  1 
ATOM   257  C CG  . MET A 1 33  ? 101.748 24.778  39.273  1.00 100.25 ? 1033 MET A CG  1 
ATOM   258  S SD  . MET A 1 33  ? 100.991 23.792  37.972  1.00 104.16 ? 1033 MET A SD  1 
ATOM   259  C CE  . MET A 1 33  ? 100.691 22.266  38.864  1.00 100.55 ? 1033 MET A CE  1 
ATOM   260  N N   . ARG A 1 34  ? 106.056 24.302  40.855  1.00 96.30  ? 1034 ARG A N   1 
ATOM   261  C CA  . ARG A 1 34  ? 107.242 23.581  41.336  1.00 96.97  ? 1034 ARG A CA  1 
ATOM   262  C C   . ARG A 1 34  ? 107.620 24.083  42.733  1.00 104.36 ? 1034 ARG A C   1 
ATOM   263  O O   . ARG A 1 34  ? 108.036 23.291  43.577  1.00 105.02 ? 1034 ARG A O   1 
ATOM   264  C CB  . ARG A 1 34  ? 108.426 23.727  40.367  1.00 95.94  ? 1034 ARG A CB  1 
ATOM   265  C CG  . ARG A 1 34  ? 109.474 22.643  40.561  1.00 103.33 ? 1034 ARG A CG  1 
ATOM   266  C CD  . ARG A 1 34  ? 110.718 22.861  39.726  1.00 110.97 ? 1034 ARG A CD  1 
ATOM   267  N NE  . ARG A 1 34  ? 111.566 21.667  39.716  1.00 120.86 ? 1034 ARG A NE  1 
ATOM   268  C CZ  . ARG A 1 34  ? 112.504 21.375  40.614  1.00 138.49 ? 1034 ARG A CZ  1 
ATOM   269  N NH1 . ARG A 1 34  ? 112.726 22.185  41.639  1.00 127.09 ? 1034 ARG A NH1 1 
ATOM   270  N NH2 . ARG A 1 34  ? 113.209 20.257  40.505  1.00 127.65 ? 1034 ARG A NH2 1 
ATOM   271  N N   . ALA A 1 35  ? 107.434 25.397  42.980  1.00 102.91 ? 1035 ALA A N   1 
ATOM   272  C CA  . ALA A 1 35  ? 107.674 26.031  44.273  1.00 105.57 ? 1035 ALA A CA  1 
ATOM   273  C C   . ALA A 1 35  ? 106.668 25.545  45.310  1.00 111.64 ? 1035 ALA A C   1 
ATOM   274  O O   . ALA A 1 35  ? 107.058 25.209  46.426  1.00 112.97 ? 1035 ALA A O   1 
ATOM   275  C CB  . ALA A 1 35  ? 107.591 27.539  44.133  1.00 107.62 ? 1035 ALA A CB  1 
ATOM   276  N N   . ALA A 1 36  ? 105.374 25.489  44.922  1.00 108.31 ? 1036 ALA A N   1 
ATOM   277  C CA  . ALA A 1 36  ? 104.255 25.048  45.756  1.00 109.10 ? 1036 ALA A CA  1 
ATOM   278  C C   . ALA A 1 36  ? 104.333 23.546  46.075  1.00 113.80 ? 1036 ALA A C   1 
ATOM   279  O O   . ALA A 1 36  ? 103.915 23.147  47.156  1.00 114.82 ? 1036 ALA A O   1 
ATOM   280  C CB  . ALA A 1 36  ? 102.939 25.353  45.059  1.00 109.09 ? 1036 ALA A CB  1 
ATOM   281  N N   . ALA A 1 37  ? 104.857 22.722  45.143  1.00 109.97 ? 1037 ALA A N   1 
ATOM   282  C CA  . ALA A 1 37  ? 104.991 21.268  45.309  1.00 110.25 ? 1037 ALA A CA  1 
ATOM   283  C C   . ALA A 1 37  ? 106.099 20.917  46.313  1.00 117.63 ? 1037 ALA A C   1 
ATOM   284  O O   . ALA A 1 37  ? 105.905 20.025  47.145  1.00 118.42 ? 1037 ALA A O   1 
ATOM   285  C CB  . ALA A 1 37  ? 105.282 20.614  43.967  1.00 109.52 ? 1037 ALA A CB  1 
ATOM   286  N N   . LEU A 1 38  ? 107.255 21.616  46.237  1.00 116.05 ? 1038 LEU A N   1 
ATOM   287  C CA  . LEU A 1 38  ? 108.394 21.409  47.138  1.00 118.60 ? 1038 LEU A CA  1 
ATOM   288  C C   . LEU A 1 38  ? 108.089 21.942  48.539  1.00 126.70 ? 1038 LEU A C   1 
ATOM   289  O O   . LEU A 1 38  ? 108.587 21.385  49.518  1.00 128.82 ? 1038 LEU A O   1 
ATOM   290  C CB  . LEU A 1 38  ? 109.661 22.084  46.588  1.00 118.95 ? 1038 LEU A CB  1 
ATOM   291  C CG  . LEU A 1 38  ? 110.279 21.502  45.312  1.00 121.57 ? 1038 LEU A CG  1 
ATOM   292  C CD1 . LEU A 1 38  ? 111.330 22.415  44.767  1.00 122.05 ? 1038 LEU A CD1 1 
ATOM   293  C CD2 . LEU A 1 38  ? 110.863 20.115  45.546  1.00 125.09 ? 1038 LEU A CD2 1 
ATOM   294  N N   . ASP A 1 39  ? 107.274 23.018  48.630  1.00 124.52 ? 1039 ASP A N   1 
ATOM   295  C CA  . ASP A 1 39  ? 106.850 23.643  49.889  1.00 127.70 ? 1039 ASP A CA  1 
ATOM   296  C C   . ASP A 1 39  ? 105.833 22.732  50.593  1.00 133.77 ? 1039 ASP A C   1 
ATOM   297  O O   . ASP A 1 39  ? 105.893 22.576  51.815  1.00 136.28 ? 1039 ASP A O   1 
ATOM   298  C CB  . ASP A 1 39  ? 106.261 25.051  49.615  1.00 129.60 ? 1039 ASP A CB  1 
ATOM   299  C CG  . ASP A 1 39  ? 105.877 25.908  50.818  1.00 143.62 ? 1039 ASP A CG  1 
ATOM   300  O OD1 . ASP A 1 39  ? 106.181 25.506  51.963  1.00 146.92 ? 1039 ASP A OD1 1 
ATOM   301  O OD2 . ASP A 1 39  ? 105.326 27.010  50.608  1.00 149.60 ? 1039 ASP A OD2 1 
ATOM   302  N N   . ALA A 1 40  ? 104.932 22.097  49.813  1.00 129.12 ? 1040 ALA A N   1 
ATOM   303  C CA  . ALA A 1 40  ? 103.920 21.169  50.325  1.00 129.68 ? 1040 ALA A CA  1 
ATOM   304  C C   . ALA A 1 40  ? 104.559 19.857  50.792  1.00 136.13 ? 1040 ALA A C   1 
ATOM   305  O O   . ALA A 1 40  ? 104.047 19.230  51.721  1.00 137.37 ? 1040 ALA A O   1 
ATOM   306  C CB  . ALA A 1 40  ? 102.879 20.889  49.258  1.00 128.08 ? 1040 ALA A CB  1 
ATOM   307  N N   . GLN A 1 41  ? 105.693 19.464  50.165  1.00 133.39 ? 1041 GLN A N   1 
ATOM   308  C CA  . GLN A 1 41  ? 106.466 18.258  50.491  1.00 135.33 ? 1041 GLN A CA  1 
ATOM   309  C C   . GLN A 1 41  ? 107.057 18.357  51.911  1.00 145.62 ? 1041 GLN A C   1 
ATOM   310  O O   . GLN A 1 41  ? 107.192 17.339  52.595  1.00 147.48 ? 1041 GLN A O   1 
ATOM   311  C CB  . GLN A 1 41  ? 107.586 18.061  49.454  1.00 135.63 ? 1041 GLN A CB  1 
ATOM   312  C CG  . GLN A 1 41  ? 108.340 16.732  49.565  1.00 148.17 ? 1041 GLN A CG  1 
ATOM   313  C CD  . GLN A 1 41  ? 109.483 16.605  48.581  1.00 164.40 ? 1041 GLN A CD  1 
ATOM   314  O OE1 . GLN A 1 41  ? 110.007 17.592  48.051  1.00 157.68 ? 1041 GLN A OE1 1 
ATOM   315  N NE2 . GLN A 1 41  ? 109.957 15.383  48.386  1.00 158.29 ? 1041 GLN A NE2 1 
ATOM   316  N N   . LYS A 1 42  ? 107.394 19.591  52.344  1.00 145.31 ? 1042 LYS A N   1 
ATOM   317  C CA  . LYS A 1 42  ? 107.969 19.890  53.660  1.00 149.95 ? 1042 LYS A CA  1 
ATOM   318  C C   . LYS A 1 42  ? 106.881 19.921  54.753  1.00 158.20 ? 1042 LYS A C   1 
ATOM   319  O O   . LYS A 1 42  ? 107.195 19.706  55.926  1.00 161.10 ? 1042 LYS A O   1 
ATOM   320  C CB  . LYS A 1 42  ? 108.716 21.235  53.624  1.00 153.47 ? 1042 LYS A CB  1 
ATOM   321  C CG  . LYS A 1 42  ? 109.905 21.257  52.664  1.00 163.58 ? 1042 LYS A CG  1 
ATOM   322  C CD  . LYS A 1 42  ? 110.578 22.618  52.626  1.00 174.20 ? 1042 LYS A CD  1 
ATOM   323  N N   . ALA A 1 43  ? 105.611 20.181  54.366  1.00 155.15 ? 1043 ALA A N   1 
ATOM   324  C CA  . ALA A 1 43  ? 104.463 20.251  55.281  1.00 157.54 ? 1043 ALA A CA  1 
ATOM   325  C C   . ALA A 1 43  ? 104.018 18.854  55.746  1.00 165.40 ? 1043 ALA A C   1 
ATOM   326  O O   . ALA A 1 43  ? 104.250 17.865  55.048  1.00 163.60 ? 1043 ALA A O   1 
ATOM   327  C CB  . ALA A 1 43  ? 103.300 20.958  54.599  1.00 155.89 ? 1043 ALA A CB  1 
ATOM   328  N N   . THR A 1 44  ? 103.373 18.783  56.928  1.00 167.05 ? 1044 THR A N   1 
ATOM   329  C CA  . THR A 1 44  ? 102.852 17.537  57.497  1.00 169.13 ? 1044 THR A CA  1 
ATOM   330  C C   . THR A 1 44  ? 101.307 17.621  57.510  1.00 174.80 ? 1044 THR A C   1 
ATOM   331  O O   . THR A 1 44  ? 100.755 18.579  58.060  1.00 175.53 ? 1044 THR A O   1 
ATOM   332  C CB  . THR A 1 44  ? 103.452 17.280  58.895  1.00 181.40 ? 1044 THR A CB  1 
ATOM   333  O OG1 . THR A 1 44  ? 104.877 17.302  58.806  1.00 182.47 ? 1044 THR A OG1 1 
ATOM   334  C CG2 . THR A 1 44  ? 103.001 15.951  59.494  1.00 181.28 ? 1044 THR A CG2 1 
ATOM   335  N N   . PRO A 1 45  ? 100.601 16.636  56.899  1.00 171.92 ? 1045 PRO A N   1 
ATOM   336  C CA  . PRO A 1 45  ? 99.125  16.706  56.846  1.00 172.19 ? 1045 PRO A CA  1 
ATOM   337  C C   . PRO A 1 45  ? 98.456  16.585  58.238  1.00 181.85 ? 1045 PRO A C   1 
ATOM   338  O O   . PRO A 1 45  ? 99.072  16.034  59.157  1.00 184.11 ? 1045 PRO A O   1 
ATOM   339  C CB  . PRO A 1 45  ? 98.748  15.507  55.966  1.00 172.28 ? 1045 PRO A CB  1 
ATOM   340  C CG  . PRO A 1 45  ? 99.913  14.584  56.044  1.00 177.29 ? 1045 PRO A CG  1 
ATOM   341  C CD  . PRO A 1 45  ? 101.112 15.456  56.171  1.00 172.69 ? 1045 PRO A CD  1 
ATOM   342  N N   . PRO A 1 46  ? 97.191  17.086  58.410  1.00 180.43 ? 1046 PRO A N   1 
ATOM   343  C CA  . PRO A 1 46  ? 96.518  16.979  59.729  1.00 184.30 ? 1046 PRO A CA  1 
ATOM   344  C C   . PRO A 1 46  ? 96.349  15.520  60.174  1.00 191.27 ? 1046 PRO A C   1 
ATOM   345  O O   . PRO A 1 46  ? 96.493  15.221  61.360  1.00 193.99 ? 1046 PRO A O   1 
ATOM   346  C CB  . PRO A 1 46  ? 95.155  17.643  59.496  1.00 185.74 ? 1046 PRO A CB  1 
ATOM   347  C CG  . PRO A 1 46  ? 94.963  17.645  58.017  1.00 186.51 ? 1046 PRO A CG  1 
ATOM   348  C CD  . PRO A 1 46  ? 96.330  17.779  57.428  1.00 179.94 ? 1046 PRO A CD  1 
ATOM   349  N N   . LYS A 1 47  ? 96.051  14.619  59.216  1.00 187.26 ? 1047 LYS A N   1 
ATOM   350  C CA  . LYS A 1 47  ? 95.980  13.172  59.426  1.00 189.14 ? 1047 LYS A CA  1 
ATOM   351  C C   . LYS A 1 47  ? 97.416  12.654  59.414  1.00 194.52 ? 1047 LYS A C   1 
ATOM   352  O O   . LYS A 1 47  ? 98.237  13.191  58.666  1.00 191.79 ? 1047 LYS A O   1 
ATOM   353  C CB  . LYS A 1 47  ? 95.078  12.513  58.355  1.00 190.05 ? 1047 LYS A CB  1 
ATOM   354  C CG  . LYS A 1 47  ? 94.925  10.997  58.469  1.00 205.38 ? 1047 LYS A CG  1 
ATOM   355  C CD  . LYS A 1 47  ? 94.092  10.432  57.329  1.00 212.92 ? 1047 LYS A CD  1 
ATOM   356  C CE  . LYS A 1 47  ? 93.981  8.931   57.413  1.00 224.94 ? 1047 LYS A CE  1 
ATOM   357  N NZ  . LYS A 1 47  ? 93.176  8.371   56.296  1.00 232.64 ? 1047 LYS A NZ  1 
ATOM   358  N N   . LEU A 1 48  ? 97.733  11.653  60.263  1.00 195.48 ? 1048 LEU A N   1 
ATOM   359  C CA  . LEU A 1 48  ? 99.074  11.087  60.490  1.00 197.44 ? 1048 LEU A CA  1 
ATOM   360  C C   . LEU A 1 48  ? 100.066 12.257  60.809  1.00 202.51 ? 1048 LEU A C   1 
ATOM   361  O O   . LEU A 1 48  ? 101.158 12.353  60.237  1.00 200.73 ? 1048 LEU A O   1 
ATOM   362  C CB  . LEU A 1 48  ? 99.613  10.170  59.346  1.00 195.85 ? 1048 LEU A CB  1 
ATOM   363  C CG  . LEU A 1 48  ? 99.717  10.619  57.875  1.00 196.31 ? 1048 LEU A CG  1 
ATOM   364  C CD1 . LEU A 1 48  ? 100.918 9.993   57.196  1.00 196.16 ? 1048 LEU A CD1 1 
ATOM   365  C CD2 . LEU A 1 48  ? 98.435  10.318  57.102  1.00 196.97 ? 1048 LEU A CD2 1 
ATOM   366  N N   . GLU A 1 49  ? 99.641  13.136  61.748  1.00 201.74 ? 1049 GLU A N   1 
ATOM   367  C CA  . GLU A 1 49  ? 100.394 14.296  62.227  1.00 202.96 ? 1049 GLU A CA  1 
ATOM   368  C C   . GLU A 1 49  ? 101.478 13.829  63.201  1.00 211.47 ? 1049 GLU A C   1 
ATOM   369  O O   . GLU A 1 49  ? 102.660 14.098  62.974  1.00 211.72 ? 1049 GLU A O   1 
ATOM   370  C CB  . GLU A 1 49  ? 99.439  15.317  62.886  1.00 205.48 ? 1049 GLU A CB  1 
ATOM   371  C CG  . GLU A 1 49  ? 100.103 16.597  63.375  1.00 218.04 ? 1049 GLU A CG  1 
ATOM   372  C CD  . GLU A 1 49  ? 99.194  17.606  64.058  1.00 239.00 ? 1049 GLU A CD  1 
ATOM   373  O OE1 . GLU A 1 49  ? 99.722  18.628  64.552  1.00 236.87 ? 1049 GLU A OE1 1 
ATOM   374  O OE2 . GLU A 1 49  ? 97.965  17.374  64.119  1.00 229.55 ? 1049 GLU A OE2 1 
ATOM   375  N N   . ASP A 1 50  ? 101.077 13.103  64.268  1.00 211.88 ? 1050 ASP A N   1 
ATOM   376  C CA  . ASP A 1 50  ? 102.012 12.564  65.254  1.00 216.70 ? 1050 ASP A CA  1 
ATOM   377  C C   . ASP A 1 50  ? 102.534 11.222  64.722  1.00 220.06 ? 1050 ASP A C   1 
ATOM   378  O O   . ASP A 1 50  ? 102.186 10.151  65.230  1.00 221.67 ? 1050 ASP A O   1 
ATOM   379  C CB  . ASP A 1 50  ? 101.344 12.443  66.644  1.00 223.32 ? 1050 ASP A CB  1 
ATOM   380  C CG  . ASP A 1 50  ? 102.281 12.132  67.806  1.00 233.50 ? 1050 ASP A CG  1 
ATOM   381  O OD1 . ASP A 1 50  ? 103.478 11.857  67.556  1.00 233.43 ? 1050 ASP A OD1 1 
ATOM   382  O OD2 . ASP A 1 50  ? 101.819 12.176  68.967  1.00 238.49 ? 1050 ASP A OD2 1 
ATOM   383  N N   . LYS A 1 51  ? 103.344 11.305  63.652  1.00 214.00 ? 1051 LYS A N   1 
ATOM   384  C CA  . LYS A 1 51  ? 103.935 10.173  62.944  1.00 213.40 ? 1051 LYS A CA  1 
ATOM   385  C C   . LYS A 1 51  ? 105.417 10.447  62.673  1.00 217.85 ? 1051 LYS A C   1 
ATOM   386  O O   . LYS A 1 51  ? 105.765 11.557  62.262  1.00 215.87 ? 1051 LYS A O   1 
ATOM   387  C CB  . LYS A 1 51  ? 103.164 9.927   61.627  1.00 211.00 ? 1051 LYS A CB  1 
ATOM   388  C CG  . LYS A 1 51  ? 103.579 8.679   60.827  1.00 224.47 ? 1051 LYS A CG  1 
ATOM   389  C CD  . LYS A 1 51  ? 103.121 7.336   61.412  1.00 236.20 ? 1051 LYS A CD  1 
ATOM   390  C CE  . LYS A 1 51  ? 101.624 7.136   61.356  1.00 244.06 ? 1051 LYS A CE  1 
ATOM   391  N NZ  . LYS A 1 51  ? 101.244 5.781   61.830  1.00 252.93 ? 1051 LYS A NZ  1 
ATOM   392  N N   . SER A 1 52  ? 106.284 9.435   62.903  1.00 218.38 ? 1052 SER A N   1 
ATOM   393  C CA  . SER A 1 52  ? 107.736 9.523   62.694  1.00 218.14 ? 1052 SER A CA  1 
ATOM   394  C C   . SER A 1 52  ? 108.071 9.785   61.210  1.00 219.33 ? 1052 SER A C   1 
ATOM   395  O O   . SER A 1 52  ? 107.332 9.320   60.343  1.00 215.29 ? 1052 SER A O   1 
ATOM   396  C CB  . SER A 1 52  ? 108.423 8.244   63.167  1.00 220.30 ? 1052 SER A CB  1 
ATOM   397  O OG  . SER A 1 52  ? 107.964 7.101   62.465  1.00 226.68 ? 1052 SER A OG  1 
ATOM   398  N N   . PRO A 1 53  ? 109.159 10.534  60.886  1.00 216.21 ? 1053 PRO A N   1 
ATOM   399  C CA  . PRO A 1 53  ? 109.466 10.802  59.467  1.00 211.92 ? 1053 PRO A CA  1 
ATOM   400  C C   . PRO A 1 53  ? 109.969 9.556   58.726  1.00 216.23 ? 1053 PRO A C   1 
ATOM   401  O O   . PRO A 1 53  ? 109.788 9.462   57.511  1.00 211.98 ? 1053 PRO A O   1 
ATOM   402  C CB  . PRO A 1 53  ? 110.566 11.873  59.529  1.00 214.86 ? 1053 PRO A CB  1 
ATOM   403  C CG  . PRO A 1 53  ? 110.596 12.348  60.957  1.00 219.72 ? 1053 PRO A CG  1 
ATOM   404  C CD  . PRO A 1 53  ? 110.139 11.190  61.773  1.00 217.45 ? 1053 PRO A CD  1 
ATOM   405  N N   . ASP A 1 54  ? 110.570 8.592   59.458  1.00 216.30 ? 1054 ASP A N   1 
ATOM   406  C CA  . ASP A 1 54  ? 111.106 7.348   58.894  1.00 215.50 ? 1054 ASP A CA  1 
ATOM   407  C C   . ASP A 1 54  ? 109.986 6.317   58.605  1.00 217.74 ? 1054 ASP A C   1 
ATOM   408  O O   . ASP A 1 54  ? 110.271 5.248   58.057  1.00 216.84 ? 1054 ASP A O   1 
ATOM   409  C CB  . ASP A 1 54  ? 112.147 6.727   59.851  1.00 217.89 ? 1054 ASP A CB  1 
ATOM   410  C CG  . ASP A 1 54  ? 113.373 7.586   60.133  1.00 226.93 ? 1054 ASP A CG  1 
ATOM   411  O OD1 . ASP A 1 54  ? 113.381 8.771   59.723  1.00 227.08 ? 1054 ASP A OD1 1 
ATOM   412  O OD2 . ASP A 1 54  ? 114.308 7.084   60.793  1.00 232.55 ? 1054 ASP A OD2 1 
ATOM   413  N N   . SER A 1 55  ? 108.724 6.646   58.957  1.00 215.61 ? 1055 SER A N   1 
ATOM   414  C CA  . SER A 1 55  ? 107.550 5.789   58.757  1.00 214.35 ? 1055 SER A CA  1 
ATOM   415  C C   . SER A 1 55  ? 107.233 5.614   57.248  1.00 212.87 ? 1055 SER A C   1 
ATOM   416  O O   . SER A 1 55  ? 107.419 6.567   56.484  1.00 208.51 ? 1055 SER A O   1 
ATOM   417  C CB  . SER A 1 55  ? 106.346 6.380   59.484  1.00 217.33 ? 1055 SER A CB  1 
ATOM   418  O OG  . SER A 1 55  ? 105.202 5.549   59.397  1.00 226.96 ? 1055 SER A OG  1 
ATOM   419  N N   . PRO A 1 56  ? 106.748 4.418   56.801  1.00 209.88 ? 1056 PRO A N   1 
ATOM   420  C CA  . PRO A 1 56  ? 106.484 4.216   55.361  1.00 206.06 ? 1056 PRO A CA  1 
ATOM   421  C C   . PRO A 1 56  ? 105.380 5.126   54.797  1.00 203.56 ? 1056 PRO A C   1 
ATOM   422  O O   . PRO A 1 56  ? 105.470 5.497   53.627  1.00 199.41 ? 1056 PRO A O   1 
ATOM   423  C CB  . PRO A 1 56  ? 106.034 2.753   55.284  1.00 211.05 ? 1056 PRO A CB  1 
ATOM   424  C CG  . PRO A 1 56  ? 106.579 2.117   56.507  1.00 219.38 ? 1056 PRO A CG  1 
ATOM   425  C CD  . PRO A 1 56  ? 106.507 3.173   57.560  1.00 216.12 ? 1056 PRO A CD  1 
ATOM   426  N N   . GLU A 1 57  ? 104.349 5.478   55.603  1.00 199.31 ? 1057 GLU A N   1 
ATOM   427  C CA  . GLU A 1 57  ? 103.252 6.347   55.144  1.00 194.83 ? 1057 GLU A CA  1 
ATOM   428  C C   . GLU A 1 57  ? 103.713 7.835   55.078  1.00 195.03 ? 1057 GLU A C   1 
ATOM   429  O O   . GLU A 1 57  ? 103.109 8.612   54.332  1.00 191.37 ? 1057 GLU A O   1 
ATOM   430  C CB  . GLU A 1 57  ? 101.967 6.221   56.000  1.00 197.29 ? 1057 GLU A CB  1 
ATOM   431  C CG  . GLU A 1 57  ? 102.132 6.135   57.514  1.00 210.51 ? 1057 GLU A CG  1 
ATOM   432  C CD  . GLU A 1 57  ? 102.522 4.782   58.089  1.00 230.17 ? 1057 GLU A CD  1 
ATOM   433  O OE1 . GLU A 1 57  ? 102.700 3.818   57.308  1.00 221.85 ? 1057 GLU A OE1 1 
ATOM   434  O OE2 . GLU A 1 57  ? 102.618 4.680   59.333  1.00 226.31 ? 1057 GLU A OE2 1 
ATOM   435  N N   . MET A 1 58  ? 104.797 8.209   55.805  1.00 192.45 ? 1058 MET A N   1 
ATOM   436  C CA  . MET A 1 58  ? 105.385 9.557   55.743  1.00 189.84 ? 1058 MET A CA  1 
ATOM   437  C C   . MET A 1 58  ? 106.347 9.662   54.571  1.00 189.81 ? 1058 MET A C   1 
ATOM   438  O O   . MET A 1 58  ? 106.445 10.724  53.952  1.00 186.53 ? 1058 MET A O   1 
ATOM   439  C CB  . MET A 1 58  ? 106.103 9.938   57.044  1.00 195.85 ? 1058 MET A CB  1 
ATOM   440  C CG  . MET A 1 58  ? 105.168 10.405  58.138  1.00 200.81 ? 1058 MET A CG  1 
ATOM   441  S SD  . MET A 1 58  ? 104.308 11.970  57.795  1.00 201.49 ? 1058 MET A SD  1 
ATOM   442  C CE  . MET A 1 58  ? 105.703 13.114  57.723  1.00 198.78 ? 1058 MET A CE  1 
ATOM   443  N N   . LYS A 1 59  ? 107.059 8.562   54.268  1.00 186.73 ? 1059 LYS A N   1 
ATOM   444  C CA  . LYS A 1 59  ? 107.989 8.488   53.143  1.00 184.68 ? 1059 LYS A CA  1 
ATOM   445  C C   . LYS A 1 59  ? 107.211 8.440   51.820  1.00 183.08 ? 1059 LYS A C   1 
ATOM   446  O O   . LYS A 1 59  ? 107.686 8.981   50.825  1.00 180.19 ? 1059 LYS A O   1 
ATOM   447  C CB  . LYS A 1 59  ? 108.932 7.279   53.267  1.00 191.23 ? 1059 LYS A CB  1 
ATOM   448  C CG  . LYS A 1 59  ? 109.967 7.414   54.381  1.00 208.02 ? 1059 LYS A CG  1 
ATOM   449  C CD  . LYS A 1 59  ? 110.923 6.233   54.397  1.00 221.42 ? 1059 LYS A CD  1 
ATOM   450  C CE  . LYS A 1 59  ? 112.026 6.413   55.408  1.00 226.45 ? 1059 LYS A CE  1 
ATOM   451  N NZ  . LYS A 1 59  ? 112.947 5.248   55.434  1.00 232.82 ? 1059 LYS A NZ  1 
ATOM   452  N N   . ASP A 1 60  ? 106.006 7.824   51.826  1.00 178.22 ? 1060 ASP A N   1 
ATOM   453  C CA  . ASP A 1 60  ? 105.111 7.738   50.665  1.00 174.74 ? 1060 ASP A CA  1 
ATOM   454  C C   . ASP A 1 60  ? 104.531 9.119   50.335  1.00 172.85 ? 1060 ASP A C   1 
ATOM   455  O O   . ASP A 1 60  ? 104.389 9.452   49.157  1.00 169.79 ? 1060 ASP A O   1 
ATOM   456  C CB  . ASP A 1 60  ? 103.975 6.726   50.928  1.00 178.45 ? 1060 ASP A CB  1 
ATOM   457  C CG  . ASP A 1 60  ? 102.988 6.529   49.787  1.00 186.63 ? 1060 ASP A CG  1 
ATOM   458  O OD1 . ASP A 1 60  ? 103.411 6.607   48.613  1.00 185.83 ? 1060 ASP A OD1 1 
ATOM   459  O OD2 . ASP A 1 60  ? 101.819 6.188   50.069  1.00 192.64 ? 1060 ASP A OD2 1 
ATOM   460  N N   . PHE A 1 61  ? 104.199 9.916   51.381  1.00 168.13 ? 1061 PHE A N   1 
ATOM   461  C CA  . PHE A 1 61  ? 103.648 11.269  51.252  1.00 164.60 ? 1061 PHE A CA  1 
ATOM   462  C C   . PHE A 1 61  ? 104.623 12.177  50.503  1.00 165.16 ? 1061 PHE A C   1 
ATOM   463  O O   . PHE A 1 61  ? 104.218 12.844  49.549  1.00 162.33 ? 1061 PHE A O   1 
ATOM   464  C CB  . PHE A 1 61  ? 103.317 11.866  52.634  1.00 167.79 ? 1061 PHE A CB  1 
ATOM   465  C CG  . PHE A 1 61  ? 102.844 13.307  52.599  1.00 167.35 ? 1061 PHE A CG  1 
ATOM   466  C CD1 . PHE A 1 61  ? 101.511 13.614  52.345  1.00 169.22 ? 1061 PHE A CD1 1 
ATOM   467  C CD2 . PHE A 1 61  ? 103.725 14.353  52.853  1.00 169.54 ? 1061 PHE A CD2 1 
ATOM   468  C CE1 . PHE A 1 61  ? 101.075 14.947  52.315  1.00 168.88 ? 1061 PHE A CE1 1 
ATOM   469  C CE2 . PHE A 1 61  ? 103.288 15.684  52.820  1.00 171.14 ? 1061 PHE A CE2 1 
ATOM   470  C CZ  . PHE A 1 61  ? 101.964 15.971  52.562  1.00 168.00 ? 1061 PHE A CZ  1 
ATOM   471  N N   . ARG A 1 62  ? 105.901 12.202  50.935  1.00 161.94 ? 1062 ARG A N   1 
ATOM   472  C CA  . ARG A 1 62  ? 106.939 13.021  50.308  1.00 159.73 ? 1062 ARG A CA  1 
ATOM   473  C C   . ARG A 1 62  ? 107.317 12.448  48.931  1.00 159.76 ? 1062 ARG A C   1 
ATOM   474  O O   . ARG A 1 62  ? 107.705 13.217  48.050  1.00 157.51 ? 1062 ARG A O   1 
ATOM   475  C CB  . ARG A 1 62  ? 108.183 13.134  51.204  1.00 163.21 ? 1062 ARG A CB  1 
ATOM   476  C CG  . ARG A 1 62  ? 107.924 13.857  52.529  1.00 176.20 ? 1062 ARG A CG  1 
ATOM   477  C CD  . ARG A 1 62  ? 109.176 13.995  53.380  1.00 192.12 ? 1062 ARG A CD  1 
ATOM   478  N NE  . ARG A 1 62  ? 109.748 12.695  53.750  1.00 206.46 ? 1062 ARG A NE  1 
ATOM   479  C CZ  . ARG A 1 62  ? 109.449 12.026  54.860  1.00 224.62 ? 1062 ARG A CZ  1 
ATOM   480  N NH1 . ARG A 1 62  ? 108.587 12.528  55.736  1.00 211.46 ? 1062 ARG A NH1 1 
ATOM   481  N NH2 . ARG A 1 62  ? 110.017 10.852  55.106  1.00 215.45 ? 1062 ARG A NH2 1 
ATOM   482  N N   . HIS A 1 63  ? 107.164 11.113  48.735  1.00 155.35 ? 1063 HIS A N   1 
ATOM   483  C CA  . HIS A 1 63  ? 107.444 10.443  47.457  1.00 153.50 ? 1063 HIS A CA  1 
ATOM   484  C C   . HIS A 1 63  ? 106.455 10.902  46.378  1.00 150.82 ? 1063 HIS A C   1 
ATOM   485  O O   . HIS A 1 63  ? 106.846 11.057  45.220  1.00 149.27 ? 1063 HIS A O   1 
ATOM   486  C CB  . HIS A 1 63  ? 107.394 8.916   47.609  1.00 157.39 ? 1063 HIS A CB  1 
ATOM   487  C CG  . HIS A 1 63  ? 107.654 8.176   46.335  1.00 161.14 ? 1063 HIS A CG  1 
ATOM   488  N ND1 . HIS A 1 63  ? 108.940 7.940   45.888  1.00 164.29 ? 1063 HIS A ND1 1 
ATOM   489  C CD2 . HIS A 1 63  ? 106.779 7.628   45.460  1.00 162.53 ? 1063 HIS A CD2 1 
ATOM   490  C CE1 . HIS A 1 63  ? 108.809 7.273   44.752  1.00 163.95 ? 1063 HIS A CE1 1 
ATOM   491  N NE2 . HIS A 1 63  ? 107.526 7.061   44.455  1.00 163.36 ? 1063 HIS A NE2 1 
ATOM   492  N N   . GLY A 1 64  ? 105.202 11.133  46.777  1.00 143.66 ? 1064 GLY A N   1 
ATOM   493  C CA  . GLY A 1 64  ? 104.150 11.619  45.892  1.00 139.91 ? 1064 GLY A CA  1 
ATOM   494  C C   . GLY A 1 64  ? 104.486 12.958  45.265  1.00 138.02 ? 1064 GLY A C   1 
ATOM   495  O O   . GLY A 1 64  ? 104.147 13.197  44.103  1.00 136.01 ? 1064 GLY A O   1 
ATOM   496  N N   . PHE A 1 65  ? 105.189 13.830  46.025  1.00 132.36 ? 1065 PHE A N   1 
ATOM   497  C CA  . PHE A 1 65  ? 105.615 15.139  45.541  1.00 129.52 ? 1065 PHE A CA  1 
ATOM   498  C C   . PHE A 1 65  ? 106.878 15.012  44.675  1.00 131.32 ? 1065 PHE A C   1 
ATOM   499  O O   . PHE A 1 65  ? 107.082 15.864  43.815  1.00 129.73 ? 1065 PHE A O   1 
ATOM   500  C CB  . PHE A 1 65  ? 105.848 16.130  46.688  1.00 131.88 ? 1065 PHE A CB  1 
ATOM   501  C CG  . PHE A 1 65  ? 104.563 16.528  47.370  1.00 133.29 ? 1065 PHE A CG  1 
ATOM   502  C CD1 . PHE A 1 65  ? 103.729 17.490  46.812  1.00 134.70 ? 1065 PHE A CD1 1 
ATOM   503  C CD2 . PHE A 1 65  ? 104.195 15.956  48.579  1.00 137.41 ? 1065 PHE A CD2 1 
ATOM   504  C CE1 . PHE A 1 65  ? 102.527 17.841  47.430  1.00 136.06 ? 1065 PHE A CE1 1 
ATOM   505  C CE2 . PHE A 1 65  ? 102.999 16.320  49.206  1.00 140.53 ? 1065 PHE A CE2 1 
ATOM   506  C CZ  . PHE A 1 65  ? 102.174 17.263  48.630  1.00 137.08 ? 1065 PHE A CZ  1 
ATOM   507  N N   . ASP A 1 66  ? 107.693 13.942  44.854  1.00 127.55 ? 1066 ASP A N   1 
ATOM   508  C CA  . ASP A 1 66  ? 108.858 13.701  43.989  1.00 126.57 ? 1066 ASP A CA  1 
ATOM   509  C C   . ASP A 1 66  ? 108.376 13.302  42.588  1.00 125.11 ? 1066 ASP A C   1 
ATOM   510  O O   . ASP A 1 66  ? 108.985 13.706  41.597  1.00 123.53 ? 1066 ASP A O   1 
ATOM   511  C CB  . ASP A 1 66  ? 109.807 12.636  44.575  1.00 131.93 ? 1066 ASP A CB  1 
ATOM   512  C CG  . ASP A 1 66  ? 110.634 13.090  45.775  1.00 147.20 ? 1066 ASP A CG  1 
ATOM   513  O OD1 . ASP A 1 66  ? 110.843 14.319  45.929  1.00 147.21 ? 1066 ASP A OD1 1 
ATOM   514  O OD2 . ASP A 1 66  ? 111.190 12.216  46.473  1.00 157.04 ? 1066 ASP A OD2 1 
ATOM   515  N N   . ILE A 1 67  ? 107.248 12.564  42.512  1.00 119.28 ? 1067 ILE A N   1 
ATOM   516  C CA  . ILE A 1 67  ? 106.598 12.181  41.252  1.00 117.58 ? 1067 ILE A CA  1 
ATOM   517  C C   . ILE A 1 67  ? 105.991 13.439  40.610  1.00 116.89 ? 1067 ILE A C   1 
ATOM   518  O O   . ILE A 1 67  ? 106.143 13.654  39.406  1.00 115.65 ? 1067 ILE A O   1 
ATOM   519  C CB  . ILE A 1 67  ? 105.520 11.067  41.472  1.00 122.19 ? 1067 ILE A CB  1 
ATOM   520  C CG1 . ILE A 1 67  ? 106.119 9.815   42.161  1.00 125.49 ? 1067 ILE A CG1 1 
ATOM   521  C CG2 . ILE A 1 67  ? 104.813 10.700  40.146  1.00 122.73 ? 1067 ILE A CG2 1 
ATOM   522  C CD1 . ILE A 1 67  ? 105.098 8.702   42.507  1.00 135.69 ? 1067 ILE A CD1 1 
ATOM   523  N N   . LEU A 1 68  ? 105.325 14.274  41.437  1.00 110.93 ? 1068 LEU A N   1 
ATOM   524  C CA  . LEU A 1 68  ? 104.645 15.509  41.045  1.00 108.02 ? 1068 LEU A CA  1 
ATOM   525  C C   . LEU A 1 68  ? 105.644 16.537  40.486  1.00 107.81 ? 1068 LEU A C   1 
ATOM   526  O O   . LEU A 1 68  ? 105.394 17.070  39.412  1.00 106.45 ? 1068 LEU A O   1 
ATOM   527  C CB  . LEU A 1 68  ? 103.890 16.098  42.256  1.00 108.19 ? 1068 LEU A CB  1 
ATOM   528  C CG  . LEU A 1 68  ? 102.958 17.292  42.003  1.00 112.06 ? 1068 LEU A CG  1 
ATOM   529  C CD1 . LEU A 1 68  ? 101.763 16.882  41.173  1.00 112.42 ? 1068 LEU A CD1 1 
ATOM   530  C CD2 . LEU A 1 68  ? 102.441 17.854  43.309  1.00 115.20 ? 1068 LEU A CD2 1 
ATOM   531  N N   . VAL A 1 69  ? 106.775 16.790  41.191  1.00 102.82 ? 1069 VAL A N   1 
ATOM   532  C CA  . VAL A 1 69  ? 107.827 17.730  40.755  1.00 101.31 ? 1069 VAL A CA  1 
ATOM   533  C C   . VAL A 1 69  ? 108.452 17.207  39.434  1.00 103.02 ? 1069 VAL A C   1 
ATOM   534  O O   . VAL A 1 69  ? 108.751 18.006  38.542  1.00 101.95 ? 1069 VAL A O   1 
ATOM   535  C CB  . VAL A 1 69  ? 108.907 17.962  41.857  1.00 106.57 ? 1069 VAL A CB  1 
ATOM   536  C CG1 . VAL A 1 69  ? 110.104 18.746  41.328  1.00 106.70 ? 1069 VAL A CG1 1 
ATOM   537  C CG2 . VAL A 1 69  ? 108.312 18.669  43.069  1.00 106.62 ? 1069 VAL A CG2 1 
ATOM   538  N N   . GLY A 1 70  ? 108.587 15.884  39.317  1.00 98.85  ? 1070 GLY A N   1 
ATOM   539  C CA  . GLY A 1 70  ? 109.113 15.236  38.120  1.00 98.62  ? 1070 GLY A CA  1 
ATOM   540  C C   . GLY A 1 70  ? 108.319 15.557  36.866  1.00 99.82  ? 1070 GLY A C   1 
ATOM   541  O O   . GLY A 1 70  ? 108.891 15.999  35.868  1.00 98.76  ? 1070 GLY A O   1 
ATOM   542  N N   . GLN A 1 71  ? 106.977 15.392  36.932  1.00 95.27  ? 1071 GLN A N   1 
ATOM   543  C CA  . GLN A 1 71  ? 106.047 15.688  35.831  1.00 94.14  ? 1071 GLN A CA  1 
ATOM   544  C C   . GLN A 1 71  ? 106.023 17.200  35.512  1.00 94.83  ? 1071 GLN A C   1 
ATOM   545  O O   . GLN A 1 71  ? 105.793 17.566  34.357  1.00 94.41  ? 1071 GLN A O   1 
ATOM   546  C CB  . GLN A 1 71  ? 104.631 15.200  36.165  1.00 96.21  ? 1071 GLN A CB  1 
ATOM   547  C CG  . GLN A 1 71  ? 104.497 13.681  36.311  1.00 111.31 ? 1071 GLN A CG  1 
ATOM   548  C CD  . GLN A 1 71  ? 103.100 13.243  36.703  1.00 128.88 ? 1071 GLN A CD  1 
ATOM   549  O OE1 . GLN A 1 71  ? 102.372 13.936  37.427  1.00 124.16 ? 1071 GLN A OE1 1 
ATOM   550  N NE2 . GLN A 1 71  ? 102.737 12.030  36.324  1.00 120.85 ? 1071 GLN A NE2 1 
ATOM   551  N N   . ILE A 1 72  ? 106.271 18.069  36.534  1.00 89.27  ? 1072 ILE A N   1 
ATOM   552  C CA  . ILE A 1 72  ? 106.371 19.535  36.394  1.00 87.28  ? 1072 ILE A CA  1 
ATOM   553  C C   . ILE A 1 72  ? 107.626 19.857  35.574  1.00 89.80  ? 1072 ILE A C   1 
ATOM   554  O O   . ILE A 1 72  ? 107.567 20.708  34.689  1.00 89.12  ? 1072 ILE A O   1 
ATOM   555  C CB  . ILE A 1 72  ? 106.376 20.272  37.780  1.00 89.89  ? 1072 ILE A CB  1 
ATOM   556  C CG1 . ILE A 1 72  ? 105.012 20.103  38.504  1.00 90.29  ? 1072 ILE A CG1 1 
ATOM   557  C CG2 . ILE A 1 72  ? 106.715 21.767  37.614  1.00 89.97  ? 1072 ILE A CG2 1 
ATOM   558  C CD1 . ILE A 1 72  ? 104.933 20.639  39.948  1.00 96.94  ? 1072 ILE A CD1 1 
ATOM   559  N N   . ASP A 1 73  ? 108.743 19.152  35.855  1.00 86.26  ? 1073 ASP A N   1 
ATOM   560  C CA  . ASP A 1 73  ? 110.021 19.323  35.163  1.00 86.45  ? 1073 ASP A CA  1 
ATOM   561  C C   . ASP A 1 73  ? 109.924 18.846  33.712  1.00 91.86  ? 1073 ASP A C   1 
ATOM   562  O O   . ASP A 1 73  ? 110.525 19.475  32.833  1.00 91.34  ? 1073 ASP A O   1 
ATOM   563  C CB  . ASP A 1 73  ? 111.135 18.575  35.899  1.00 89.24  ? 1073 ASP A CB  1 
ATOM   564  C CG  . ASP A 1 73  ? 111.439 19.169  37.257  1.00 95.78  ? 1073 ASP A CG  1 
ATOM   565  O OD1 . ASP A 1 73  ? 111.108 20.350  37.469  1.00 94.28  ? 1073 ASP A OD1 1 
ATOM   566  O OD2 . ASP A 1 73  ? 112.065 18.471  38.085  1.00 102.28 ? 1073 ASP A OD2 1 
ATOM   567  N N   . ASP A 1 74  ? 109.147 17.761  33.454  1.00 89.93  ? 1074 ASP A N   1 
ATOM   568  C CA  . ASP A 1 74  ? 108.906 17.264  32.098  1.00 91.09  ? 1074 ASP A CA  1 
ATOM   569  C C   . ASP A 1 74  ? 108.107 18.289  31.305  1.00 93.51  ? 1074 ASP A C   1 
ATOM   570  O O   . ASP A 1 74  ? 108.389 18.504  30.128  1.00 94.34  ? 1074 ASP A O   1 
ATOM   571  C CB  . ASP A 1 74  ? 108.180 15.907  32.111  1.00 94.97  ? 1074 ASP A CB  1 
ATOM   572  C CG  . ASP A 1 74  ? 108.988 14.735  32.646  1.00 110.36 ? 1074 ASP A CG  1 
ATOM   573  O OD1 . ASP A 1 74  ? 110.240 14.784  32.557  1.00 110.86 ? 1074 ASP A OD1 1 
ATOM   574  O OD2 . ASP A 1 74  ? 108.370 13.713  33.020  1.00 119.40 ? 1074 ASP A OD2 1 
ATOM   575  N N   . ALA A 1 75  ? 107.151 18.961  31.970  1.00 87.91  ? 1075 ALA A N   1 
ATOM   576  C CA  . ALA A 1 75  ? 106.316 20.000  31.373  1.00 86.87  ? 1075 ALA A CA  1 
ATOM   577  C C   . ALA A 1 75  ? 107.126 21.290  31.142  1.00 88.45  ? 1075 ALA A C   1 
ATOM   578  O O   . ALA A 1 75  ? 106.989 21.907  30.083  1.00 88.15  ? 1075 ALA A O   1 
ATOM   579  C CB  . ALA A 1 75  ? 105.121 20.273  32.266  1.00 87.17  ? 1075 ALA A CB  1 
ATOM   580  N N   . LEU A 1 76  ? 107.993 21.673  32.117  1.00 83.83  ? 1076 LEU A N   1 
ATOM   581  C CA  . LEU A 1 76  ? 108.886 22.837  32.025  1.00 83.25  ? 1076 LEU A CA  1 
ATOM   582  C C   . LEU A 1 76  ? 109.871 22.664  30.881  1.00 87.80  ? 1076 LEU A C   1 
ATOM   583  O O   . LEU A 1 76  ? 110.195 23.652  30.228  1.00 87.44  ? 1076 LEU A O   1 
ATOM   584  C CB  . LEU A 1 76  ? 109.649 23.081  33.342  1.00 83.15  ? 1076 LEU A CB  1 
ATOM   585  C CG  . LEU A 1 76  ? 108.902 23.821  34.471  1.00 87.38  ? 1076 LEU A CG  1 
ATOM   586  C CD1 . LEU A 1 76  ? 109.584 23.619  35.815  1.00 87.66  ? 1076 LEU A CD1 1 
ATOM   587  C CD2 . LEU A 1 76  ? 108.747 25.318  34.158  1.00 89.88  ? 1076 LEU A CD2 1 
ATOM   588  N N   . LYS A 1 77  ? 110.318 21.404  30.618  1.00 85.37  ? 1077 LYS A N   1 
ATOM   589  C CA  . LYS A 1 77  ? 111.221 21.060  29.508  1.00 86.40  ? 1077 LYS A CA  1 
ATOM   590  C C   . LYS A 1 77  ? 110.573 21.449  28.179  1.00 90.72  ? 1077 LYS A C   1 
ATOM   591  O O   . LYS A 1 77  ? 111.193 22.141  27.377  1.00 90.86  ? 1077 LYS A O   1 
ATOM   592  C CB  . LYS A 1 77  ? 111.563 19.550  29.535  1.00 90.02  ? 1077 LYS A CB  1 
ATOM   593  C CG  . LYS A 1 77  ? 112.508 19.052  28.437  1.00 107.39 ? 1077 LYS A CG  1 
ATOM   594  C CD  . LYS A 1 77  ? 113.992 19.155  28.769  1.00 119.37 ? 1077 LYS A CD  1 
ATOM   595  C CE  . LYS A 1 77  ? 114.834 18.576  27.658  1.00 131.49 ? 1077 LYS A CE  1 
ATOM   596  N NZ  . LYS A 1 77  ? 114.610 17.113  27.438  1.00 141.34 ? 1077 LYS A NZ  1 
ATOM   597  N N   . LEU A 1 78  ? 109.298 21.049  27.988  1.00 87.23  ? 1078 LEU A N   1 
ATOM   598  C CA  . LEU A 1 78  ? 108.500 21.315  26.786  1.00 88.20  ? 1078 LEU A CA  1 
ATOM   599  C C   . LEU A 1 78  ? 108.161 22.805  26.659  1.00 93.15  ? 1078 LEU A C   1 
ATOM   600  O O   . LEU A 1 78  ? 108.232 23.342  25.551  1.00 94.41  ? 1078 LEU A O   1 
ATOM   601  C CB  . LEU A 1 78  ? 107.205 20.482  26.812  1.00 88.65  ? 1078 LEU A CB  1 
ATOM   602  C CG  . LEU A 1 78  ? 107.389 18.962  26.774  1.00 93.71  ? 1078 LEU A CG  1 
ATOM   603  C CD1 . LEU A 1 78  ? 106.161 18.242  27.252  1.00 94.03  ? 1078 LEU A CD1 1 
ATOM   604  C CD2 . LEU A 1 78  ? 107.848 18.481  25.405  1.00 97.99  ? 1078 LEU A CD2 1 
ATOM   605  N N   . ALA A 1 79  ? 107.806 23.471  27.783  1.00 89.15  ? 1079 ALA A N   1 
ATOM   606  C CA  . ALA A 1 79  ? 107.471 24.902  27.809  1.00 89.42  ? 1079 ALA A CA  1 
ATOM   607  C C   . ALA A 1 79  ? 108.669 25.754  27.358  1.00 94.50  ? 1079 ALA A C   1 
ATOM   608  O O   . ALA A 1 79  ? 108.485 26.701  26.590  1.00 94.80  ? 1079 ALA A O   1 
ATOM   609  C CB  . ALA A 1 79  ? 107.026 25.316  29.208  1.00 89.10  ? 1079 ALA A CB  1 
ATOM   610  N N   . ASN A 1 80  ? 109.894 25.384  27.804  1.00 91.48  ? 1080 ASN A N   1 
ATOM   611  C CA  . ASN A 1 80  ? 111.147 26.069  27.456  1.00 92.47  ? 1080 ASN A CA  1 
ATOM   612  C C   . ASN A 1 80  ? 111.563 25.780  26.001  1.00 96.67  ? 1080 ASN A C   1 
ATOM   613  O O   . ASN A 1 80  ? 112.333 26.552  25.427  1.00 97.35  ? 1080 ASN A O   1 
ATOM   614  C CB  . ASN A 1 80  ? 112.274 25.657  28.404  1.00 96.23  ? 1080 ASN A CB  1 
ATOM   615  C CG  . ASN A 1 80  ? 112.077 26.093  29.837  1.00 136.17 ? 1080 ASN A CG  1 
ATOM   616  O OD1 . ASN A 1 80  ? 111.468 27.126  30.131  1.00 133.07 ? 1080 ASN A OD1 1 
ATOM   617  N ND2 . ASN A 1 80  ? 112.666 25.349  30.761  1.00 133.74 ? 1080 ASN A ND2 1 
ATOM   618  N N   . GLU A 1 81  ? 111.063 24.680  25.413  1.00 92.70  ? 1081 GLU A N   1 
ATOM   619  C CA  . GLU A 1 81  ? 111.345 24.327  24.021  1.00 94.19  ? 1081 GLU A CA  1 
ATOM   620  C C   . GLU A 1 81  ? 110.326 24.999  23.075  1.00 100.04 ? 1081 GLU A C   1 
ATOM   621  O O   . GLU A 1 81  ? 110.515 24.985  21.859  1.00 101.64 ? 1081 GLU A O   1 
ATOM   622  C CB  . GLU A 1 81  ? 111.337 22.799  23.827  1.00 96.03  ? 1081 GLU A CB  1 
ATOM   623  C CG  . GLU A 1 81  ? 112.494 22.090  24.510  1.00 104.59 ? 1081 GLU A CG  1 
ATOM   624  C CD  . GLU A 1 81  ? 112.492 20.575  24.440  1.00 124.38 ? 1081 GLU A CD  1 
ATOM   625  O OE1 . GLU A 1 81  ? 113.341 19.962  25.123  1.00 126.26 ? 1081 GLU A OE1 1 
ATOM   626  O OE2 . GLU A 1 81  ? 111.625 19.996  23.748  1.00 114.76 ? 1081 GLU A OE2 1 
ATOM   627  N N   . GLY A 1 82  ? 109.287 25.609  23.649  1.00 96.43  ? 1082 GLY A N   1 
ATOM   628  C CA  . GLY A 1 82  ? 108.233 26.283  22.900  1.00 98.08  ? 1082 GLY A CA  1 
ATOM   629  C C   . GLY A 1 82  ? 107.152 25.327  22.442  1.00 103.88 ? 1082 GLY A C   1 
ATOM   630  O O   . GLY A 1 82  ? 106.481 25.575  21.436  1.00 106.07 ? 1082 GLY A O   1 
ATOM   631  N N   . LYS A 1 83  ? 106.984 24.219  23.182  1.00 99.67  ? 1083 LYS A N   1 
ATOM   632  C CA  . LYS A 1 83  ? 106.003 23.173  22.896  1.00 101.11 ? 1083 LYS A CA  1 
ATOM   633  C C   . LYS A 1 83  ? 104.844 23.304  23.888  1.00 105.37 ? 1083 LYS A C   1 
ATOM   634  O O   . LYS A 1 83  ? 104.835 22.640  24.926  1.00 102.94 ? 1083 LYS A O   1 
ATOM   635  C CB  . LYS A 1 83  ? 106.675 21.786  22.959  1.00 103.26 ? 1083 LYS A CB  1 
ATOM   636  C CG  . LYS A 1 83  ? 107.803 21.608  21.941  1.00 113.82 ? 1083 LYS A CG  1 
ATOM   637  C CD  . LYS A 1 83  ? 108.487 20.264  22.075  1.00 119.81 ? 1083 LYS A CD  1 
ATOM   638  C CE  . LYS A 1 83  ? 109.593 20.097  21.069  1.00 127.03 ? 1083 LYS A CE  1 
ATOM   639  N NZ  . LYS A 1 83  ? 110.282 18.790  21.233  1.00 133.50 ? 1083 LYS A NZ  1 
ATOM   640  N N   . VAL A 1 84  ? 103.880 24.202  23.569  1.00 104.95 ? 1084 VAL A N   1 
ATOM   641  C CA  . VAL A 1 84  ? 102.723 24.571  24.403  1.00 105.16 ? 1084 VAL A CA  1 
ATOM   642  C C   . VAL A 1 84  ? 101.772 23.372  24.589  1.00 110.47 ? 1084 VAL A C   1 
ATOM   643  O O   . VAL A 1 84  ? 101.558 22.958  25.727  1.00 108.14 ? 1084 VAL A O   1 
ATOM   644  C CB  . VAL A 1 84  ? 101.947 25.777  23.806  1.00 111.57 ? 1084 VAL A CB  1 
ATOM   645  C CG1 . VAL A 1 84  ? 100.841 26.240  24.751  1.00 111.49 ? 1084 VAL A CG1 1 
ATOM   646  C CG2 . VAL A 1 84  ? 102.882 26.928  23.498  1.00 111.04 ? 1084 VAL A CG2 1 
ATOM   647  N N   . LYS A 1 85  ? 101.188 22.844  23.480  1.00 110.59 ? 1085 LYS A N   1 
ATOM   648  C CA  . LYS A 1 85  ? 100.228 21.728  23.495  1.00 112.68 ? 1085 LYS A CA  1 
ATOM   649  C C   . LYS A 1 85  ? 100.844 20.466  24.117  1.00 115.85 ? 1085 LYS A C   1 
ATOM   650  O O   . LYS A 1 85  ? 100.120 19.707  24.761  1.00 115.75 ? 1085 LYS A O   1 
ATOM   651  C CB  . LYS A 1 85  ? 99.705  21.407  22.079  1.00 119.34 ? 1085 LYS A CB  1 
ATOM   652  C CG  . LYS A 1 85  ? 98.598  22.349  21.556  1.00 132.35 ? 1085 LYS A CG  1 
ATOM   653  C CD  . LYS A 1 85  ? 99.016  23.812  21.355  1.00 137.58 ? 1085 LYS A CD  1 
ATOM   654  C CE  . LYS A 1 85  ? 97.859  24.678  20.924  1.00 145.57 ? 1085 LYS A CE  1 
ATOM   655  N NZ  . LYS A 1 85  ? 98.269  26.095  20.755  1.00 150.49 ? 1085 LYS A NZ  1 
ATOM   656  N N   . GLU A 1 86  ? 102.171 20.265  23.957  1.00 111.77 ? 1086 GLU A N   1 
ATOM   657  C CA  . GLU A 1 86  ? 102.908 19.146  24.555  1.00 110.79 ? 1086 GLU A CA  1 
ATOM   658  C C   . GLU A 1 86  ? 103.007 19.332  26.075  1.00 112.56 ? 1086 GLU A C   1 
ATOM   659  O O   . GLU A 1 86  ? 102.782 18.379  26.823  1.00 112.19 ? 1086 GLU A O   1 
ATOM   660  C CB  . GLU A 1 86  ? 104.317 18.983  23.947  1.00 111.97 ? 1086 GLU A CB  1 
ATOM   661  C CG  . GLU A 1 86  ? 104.397 18.648  22.462  1.00 128.03 ? 1086 GLU A CG  1 
ATOM   662  C CD  . GLU A 1 86  ? 104.211 19.747  21.426  1.00 159.77 ? 1086 GLU A CD  1 
ATOM   663  O OE1 . GLU A 1 86  ? 104.766 19.585  20.316  1.00 164.08 ? 1086 GLU A OE1 1 
ATOM   664  O OE2 . GLU A 1 86  ? 103.640 20.813  21.750  1.00 156.35 ? 1086 GLU A OE2 1 
ATOM   665  N N   . ALA A 1 87  ? 103.348 20.568  26.524  1.00 107.51 ? 1087 ALA A N   1 
ATOM   666  C CA  . ALA A 1 87  ? 103.465 20.938  27.938  1.00 105.08 ? 1087 ALA A CA  1 
ATOM   667  C C   . ALA A 1 87  ? 102.104 20.875  28.634  1.00 110.05 ? 1087 ALA A C   1 
ATOM   668  O O   . ALA A 1 87  ? 102.029 20.380  29.759  1.00 108.30 ? 1087 ALA A O   1 
ATOM   669  C CB  . ALA A 1 87  ? 104.056 22.331  28.072  1.00 104.55 ? 1087 ALA A CB  1 
ATOM   670  N N   . GLN A 1 88  ? 101.024 21.345  27.950  1.00 109.26 ? 1088 GLN A N   1 
ATOM   671  C CA  . GLN A 1 88  ? 99.643  21.315  28.453  1.00 110.29 ? 1088 GLN A CA  1 
ATOM   672  C C   . GLN A 1 88  ? 99.167  19.867  28.610  1.00 116.17 ? 1088 GLN A C   1 
ATOM   673  O O   . GLN A 1 88  ? 98.422  19.576  29.546  1.00 115.41 ? 1088 GLN A O   1 
ATOM   674  C CB  . GLN A 1 88  ? 98.691  22.099  27.531  1.00 114.20 ? 1088 GLN A CB  1 
ATOM   675  C CG  . GLN A 1 88  ? 98.936  23.612  27.522  1.00 125.41 ? 1088 GLN A CG  1 
ATOM   676  C CD  . GLN A 1 88  ? 98.019  24.398  26.600  1.00 142.88 ? 1088 GLN A CD  1 
ATOM   677  O OE1 . GLN A 1 88  ? 97.327  23.855  25.729  1.00 140.22 ? 1088 GLN A OE1 1 
ATOM   678  N NE2 . GLN A 1 88  ? 98.039  25.715  26.737  1.00 132.77 ? 1088 GLN A NE2 1 
ATOM   679  N N   . ALA A 1 89  ? 99.626  18.959  27.715  1.00 115.16 ? 1089 ALA A N   1 
ATOM   680  C CA  . ALA A 1 89  ? 99.318  17.524  27.766  1.00 117.23 ? 1089 ALA A CA  1 
ATOM   681  C C   . ALA A 1 89  ? 100.058 16.850  28.928  1.00 119.87 ? 1089 ALA A C   1 
ATOM   682  O O   . ALA A 1 89  ? 99.485  15.995  29.604  1.00 120.05 ? 1089 ALA A O   1 
ATOM   683  C CB  . ALA A 1 89  ? 99.690  16.857  26.449  1.00 120.48 ? 1089 ALA A CB  1 
ATOM   684  N N   . ALA A 1 90  ? 101.332 17.242  29.155  1.00 115.05 ? 1090 ALA A N   1 
ATOM   685  C CA  . ALA A 1 90  ? 102.167 16.728  30.241  1.00 113.64 ? 1090 ALA A CA  1 
ATOM   686  C C   . ALA A 1 90  ? 101.630 17.184  31.590  1.00 117.62 ? 1090 ALA A C   1 
ATOM   687  O O   . ALA A 1 90  ? 101.637 16.406  32.543  1.00 116.72 ? 1090 ALA A O   1 
ATOM   688  C CB  . ALA A 1 90  ? 103.606 17.191  30.062  1.00 112.78 ? 1090 ALA A CB  1 
ATOM   689  N N   . ALA A 1 91  ? 101.126 18.438  31.654  1.00 115.30 ? 1091 ALA A N   1 
ATOM   690  C CA  . ALA A 1 91  ? 100.556 19.056  32.854  1.00 115.06 ? 1091 ALA A CA  1 
ATOM   691  C C   . ALA A 1 91  ? 99.213  18.422  33.235  1.00 123.05 ? 1091 ALA A C   1 
ATOM   692  O O   . ALA A 1 91  ? 98.774  18.555  34.381  1.00 122.04 ? 1091 ALA A O   1 
ATOM   693  C CB  . ALA A 1 91  ? 100.371 20.550  32.632  1.00 115.41 ? 1091 ALA A CB  1 
ATOM   694  N N   . GLU A 1 92  ? 98.563  17.735  32.283  1.00 123.84 ? 1092 GLU A N   1 
ATOM   695  C CA  . GLU A 1 92  ? 97.284  17.084  32.537  1.00 126.74 ? 1092 GLU A CA  1 
ATOM   696  C C   . GLU A 1 92  ? 97.505  15.762  33.304  1.00 131.70 ? 1092 GLU A C   1 
ATOM   697  O O   . GLU A 1 92  ? 96.585  15.292  33.974  1.00 132.71 ? 1092 GLU A O   1 
ATOM   698  C CB  . GLU A 1 92  ? 96.535  16.849  31.223  1.00 131.55 ? 1092 GLU A CB  1 
ATOM   699  C CG  . GLU A 1 92  ? 95.134  17.451  31.209  1.00 145.93 ? 1092 GLU A CG  1 
ATOM   700  C CD  . GLU A 1 92  ? 94.945  18.955  31.301  1.00 166.20 ? 1092 GLU A CD  1 
ATOM   701  O OE1 . GLU A 1 92  ? 95.944  19.705  31.221  1.00 159.61 ? 1092 GLU A OE1 1 
ATOM   702  O OE2 . GLU A 1 92  ? 93.773  19.384  31.391  1.00 160.99 ? 1092 GLU A OE2 1 
ATOM   703  N N   . GLN A 1 93  ? 98.742  15.207  33.261  1.00 127.64 ? 1093 GLN A N   1 
ATOM   704  C CA  . GLN A 1 93  ? 99.121  14.003  34.008  1.00 128.15 ? 1093 GLN A CA  1 
ATOM   705  C C   . GLN A 1 93  ? 99.277  14.319  35.504  1.00 130.73 ? 1093 GLN A C   1 
ATOM   706  O O   . GLN A 1 93  ? 99.271  13.395  36.319  1.00 130.97 ? 1093 GLN A O   1 
ATOM   707  C CB  . GLN A 1 93  ? 100.417 13.384  33.462  1.00 129.58 ? 1093 GLN A CB  1 
ATOM   708  C CG  . GLN A 1 93  ? 100.284 12.777  32.067  1.00 148.53 ? 1093 GLN A CG  1 
ATOM   709  C CD  . GLN A 1 93  ? 101.571 12.151  31.565  1.00 168.48 ? 1093 GLN A CD  1 
ATOM   710  O OE1 . GLN A 1 93  ? 102.678 12.436  32.046  1.00 161.44 ? 1093 GLN A OE1 1 
ATOM   711  N NE2 . GLN A 1 93  ? 101.456 11.322  30.541  1.00 164.34 ? 1093 GLN A NE2 1 
ATOM   712  N N   . LEU A 1 94  ? 99.410  15.620  35.862  1.00 126.08 ? 1094 LEU A N   1 
ATOM   713  C CA  . LEU A 1 94  ? 99.525  16.095  37.249  1.00 125.00 ? 1094 LEU A CA  1 
ATOM   714  C C   . LEU A 1 94  ? 98.222  15.842  38.010  1.00 131.71 ? 1094 LEU A C   1 
ATOM   715  O O   . LEU A 1 94  ? 98.255  15.629  39.223  1.00 131.01 ? 1094 LEU A O   1 
ATOM   716  C CB  . LEU A 1 94  ? 99.886  17.597  37.292  1.00 123.24 ? 1094 LEU A CB  1 
ATOM   717  C CG  . LEU A 1 94  ? 101.252 18.004  36.725  1.00 126.44 ? 1094 LEU A CG  1 
ATOM   718  C CD1 . LEU A 1 94  ? 101.344 19.489  36.531  1.00 125.66 ? 1094 LEU A CD1 1 
ATOM   719  C CD2 . LEU A 1 94  ? 102.375 17.536  37.602  1.00 128.24 ? 1094 LEU A CD2 1 
ATOM   720  N N   . LYS A 1 95  ? 97.080  15.846  37.285  1.00 131.25 ? 1095 LYS A N   1 
ATOM   721  C CA  . LYS A 1 95  ? 95.744  15.578  37.829  1.00 133.51 ? 1095 LYS A CA  1 
ATOM   722  C C   . LYS A 1 95  ? 95.656  14.144  38.359  1.00 140.06 ? 1095 LYS A C   1 
ATOM   723  O O   . LYS A 1 95  ? 95.099  13.932  39.433  1.00 140.38 ? 1095 LYS A O   1 
ATOM   724  C CB  . LYS A 1 95  ? 94.655  15.819  36.767  1.00 138.32 ? 1095 LYS A CB  1 
ATOM   725  C CG  . LYS A 1 95  ? 94.574  17.257  36.270  1.00 150.80 ? 1095 LYS A CG  1 
ATOM   726  C CD  . LYS A 1 95  ? 93.473  17.427  35.250  1.00 162.51 ? 1095 LYS A CD  1 
ATOM   727  C CE  . LYS A 1 95  ? 93.381  18.837  34.730  1.00 171.04 ? 1095 LYS A CE  1 
ATOM   728  N NZ  . LYS A 1 95  ? 92.284  18.975  33.741  1.00 182.27 ? 1095 LYS A NZ  1 
ATOM   729  N N   . THR A 1 96  ? 96.235  13.168  37.615  1.00 138.21 ? 1096 THR A N   1 
ATOM   730  C CA  . THR A 1 96  ? 96.275  11.745  37.983  1.00 140.32 ? 1096 THR A CA  1 
ATOM   731  C C   . THR A 1 96  ? 97.037  11.590  39.314  1.00 143.75 ? 1096 THR A C   1 
ATOM   732  O O   . THR A 1 96  ? 96.603  10.831  40.182  1.00 144.94 ? 1096 THR A O   1 
ATOM   733  C CB  . THR A 1 96  ? 96.917  10.921  36.848  1.00 149.37 ? 1096 THR A CB  1 
ATOM   734  O OG1 . THR A 1 96  ? 96.245  11.197  35.616  1.00 150.55 ? 1096 THR A OG1 1 
ATOM   735  C CG2 . THR A 1 96  ? 96.897  9.419   37.121  1.00 150.43 ? 1096 THR A CG2 1 
ATOM   736  N N   . THR A 1 97  ? 98.143  12.345  39.479  1.00 138.54 ? 1097 THR A N   1 
ATOM   737  C CA  . THR A 1 97  ? 98.962  12.353  40.692  1.00 137.72 ? 1097 THR A CA  1 
ATOM   738  C C   . THR A 1 97  ? 98.194  13.089  41.814  1.00 142.43 ? 1097 THR A C   1 
ATOM   739  O O   . THR A 1 97  ? 98.270  12.674  42.973  1.00 142.61 ? 1097 THR A O   1 
ATOM   740  C CB  . THR A 1 97  ? 100.333 12.998  40.393  1.00 143.01 ? 1097 THR A CB  1 
ATOM   741  O OG1 . THR A 1 97  ? 100.936 12.320  39.289  1.00 142.18 ? 1097 THR A OG1 1 
ATOM   742  C CG2 . THR A 1 97  ? 101.283 12.969  41.590  1.00 141.28 ? 1097 THR A CG2 1 
ATOM   743  N N   . ARG A 1 98  ? 97.430  14.151  41.457  1.00 139.58 ? 1098 ARG A N   1 
ATOM   744  C CA  . ARG A 1 98  ? 96.641  14.952  42.404  1.00 140.08 ? 1098 ARG A CA  1 
ATOM   745  C C   . ARG A 1 98  ? 95.472  14.109  42.965  1.00 147.33 ? 1098 ARG A C   1 
ATOM   746  O O   . ARG A 1 98  ? 95.134  14.248  44.143  1.00 147.62 ? 1098 ARG A O   1 
ATOM   747  C CB  . ARG A 1 98  ? 96.122  16.244  41.730  1.00 140.29 ? 1098 ARG A CB  1 
ATOM   748  C CG  . ARG A 1 98  ? 95.519  17.257  42.708  1.00 152.40 ? 1098 ARG A CG  1 
ATOM   749  C CD  . ARG A 1 98  ? 94.016  17.437  42.625  1.00 166.98 ? 1098 ARG A CD  1 
ATOM   750  N NE  . ARG A 1 98  ? 93.613  18.279  41.495  1.00 179.08 ? 1098 ARG A NE  1 
ATOM   751  C CZ  . ARG A 1 98  ? 93.234  17.822  40.306  1.00 197.59 ? 1098 ARG A CZ  1 
ATOM   752  N NH1 . ARG A 1 98  ? 92.870  18.668  39.349  1.00 187.23 ? 1098 ARG A NH1 1 
ATOM   753  N NH2 . ARG A 1 98  ? 93.188  16.516  40.071  1.00 186.32 ? 1098 ARG A NH2 1 
ATOM   754  N N   . ASN A 1 99  ? 94.892  13.217  42.136  1.00 146.21 ? 1099 ASN A N   1 
ATOM   755  C CA  . ASN A 1 99  ? 93.797  12.329  42.542  1.00 149.17 ? 1099 ASN A CA  1 
ATOM   756  C C   . ASN A 1 99  ? 94.313  11.214  43.465  1.00 153.83 ? 1099 ASN A C   1 
ATOM   757  O O   . ASN A 1 99  ? 93.572  10.759  44.337  1.00 155.44 ? 1099 ASN A O   1 
ATOM   758  C CB  . ASN A 1 99  ? 93.103  11.726  41.318  1.00 153.54 ? 1099 ASN A CB  1 
ATOM   759  C CG  . ASN A 1 99  ? 92.453  12.733  40.393  1.00 182.18 ? 1099 ASN A CG  1 
ATOM   760  O OD1 . ASN A 1 99  ? 92.291  13.920  40.713  1.00 176.70 ? 1099 ASN A OD1 1 
ATOM   761  N ND2 . ASN A 1 99  ? 92.079  12.279  39.211  1.00 177.35 ? 1099 ASN A ND2 1 
ATOM   762  N N   . ALA A 1 100 ? 95.585  10.794  43.285  1.00 148.99 ? 1100 ALA A N   1 
ATOM   763  C CA  . ALA A 1 100 ? 96.230  9.766   44.105  1.00 175.09 ? 1100 ALA A CA  1 
ATOM   764  C C   . ALA A 1 100 ? 96.545  10.303  45.498  1.00 207.86 ? 1100 ALA A C   1 
ATOM   765  O O   . ALA A 1 100 ? 96.842  9.531   46.406  1.00 172.67 ? 1100 ALA A O   1 
ATOM   766  C CB  . ALA A 1 100 ? 97.504  9.280   43.429  1.00 175.35 ? 1100 ALA A CB  1 
ATOM   767  N N   . HIS A 1 119 ? 86.160  -5.065  53.533  1.00 183.15 ? 43   HIS A N   1 
ATOM   768  C CA  . HIS A 1 119 ? 85.490  -6.287  53.103  1.00 181.34 ? 43   HIS A CA  1 
ATOM   769  C C   . HIS A 1 119 ? 84.359  -6.660  54.065  1.00 184.79 ? 43   HIS A C   1 
ATOM   770  O O   . HIS A 1 119 ? 84.595  -6.827  55.266  1.00 187.63 ? 43   HIS A O   1 
ATOM   771  C CB  . HIS A 1 119 ? 86.494  -7.453  52.993  1.00 183.90 ? 43   HIS A CB  1 
ATOM   772  C CG  . HIS A 1 119 ? 85.864  -8.756  52.602  1.00 186.29 ? 43   HIS A CG  1 
ATOM   773  N ND1 . HIS A 1 119 ? 85.379  -9.640  53.554  1.00 188.50 ? 43   HIS A ND1 1 
ATOM   774  C CD2 . HIS A 1 119 ? 85.638  -9.272  51.372  1.00 185.64 ? 43   HIS A CD2 1 
ATOM   775  C CE1 . HIS A 1 119 ? 84.877  -10.658 52.875  1.00 187.62 ? 43   HIS A CE1 1 
ATOM   776  N NE2 . HIS A 1 119 ? 85.013  -10.485 51.560  1.00 185.51 ? 43   HIS A NE2 1 
ATOM   777  N N   . LEU A 1 120 ? 83.142  -6.833  53.523  1.00 178.53 ? 44   LEU A N   1 
ATOM   778  C CA  . LEU A 1 120 ? 81.973  -7.250  54.296  1.00 178.23 ? 44   LEU A CA  1 
ATOM   779  C C   . LEU A 1 120 ? 81.500  -8.622  53.823  1.00 179.15 ? 44   LEU A C   1 
ATOM   780  O O   . LEU A 1 120 ? 81.366  -8.846  52.619  1.00 176.41 ? 44   LEU A O   1 
ATOM   781  C CB  . LEU A 1 120 ? 80.828  -6.219  54.205  1.00 176.55 ? 44   LEU A CB  1 
ATOM   782  C CG  . LEU A 1 120 ? 81.081  -4.842  54.840  1.00 182.31 ? 44   LEU A CG  1 
ATOM   783  C CD1 . LEU A 1 120 ? 79.951  -3.893  54.538  1.00 180.84 ? 44   LEU A CD1 1 
ATOM   784  C CD2 . LEU A 1 120 ? 81.287  -4.943  56.355  1.00 188.06 ? 44   LEU A CD2 1 
ATOM   785  N N   . ASP A 1 121 ? 81.263  -9.544  54.775  1.00 175.65 ? 45   ASP A N   1 
ATOM   786  C CA  . ASP A 1 121 ? 80.801  -10.910 54.503  1.00 174.30 ? 45   ASP A CA  1 
ATOM   787  C C   . ASP A 1 121 ? 79.344  -10.925 54.017  1.00 173.27 ? 45   ASP A C   1 
ATOM   788  O O   . ASP A 1 121 ? 78.927  -11.898 53.387  1.00 171.57 ? 45   ASP A O   1 
ATOM   789  C CB  . ASP A 1 121 ? 80.932  -11.783 55.765  1.00 179.43 ? 45   ASP A CB  1 
ATOM   790  C CG  . ASP A 1 121 ? 82.346  -11.939 56.303  1.00 187.83 ? 45   ASP A CG  1 
ATOM   791  O OD1 . ASP A 1 121 ? 83.305  -11.599 55.573  1.00 188.14 ? 45   ASP A OD1 1 
ATOM   792  O OD2 . ASP A 1 121 ? 82.495  -12.452 57.432  1.00 191.94 ? 45   ASP A OD2 1 
ATOM   793  N N   . ALA A 1 122 ? 78.578  -9.853  54.317  1.00 167.31 ? 46   ALA A N   1 
ATOM   794  C CA  . ALA A 1 122 ? 77.173  -9.697  53.939  1.00 164.13 ? 46   ALA A CA  1 
ATOM   795  C C   . ALA A 1 122 ? 77.003  -9.566  52.421  1.00 162.65 ? 46   ALA A C   1 
ATOM   796  O O   . ALA A 1 122 ? 76.061  -10.136 51.882  1.00 160.97 ? 46   ALA A O   1 
ATOM   797  C CB  . ALA A 1 122 ? 76.584  -8.476  54.626  1.00 165.01 ? 46   ALA A CB  1 
ATOM   798  N N   . ILE A 1 123 ? 77.911  -8.826  51.738  1.00 156.42 ? 47   ILE A N   1 
ATOM   799  C CA  . ILE A 1 123 ? 77.880  -8.572  50.288  1.00 152.64 ? 47   ILE A CA  1 
ATOM   800  C C   . ILE A 1 123 ? 77.795  -9.927  49.496  1.00 154.82 ? 47   ILE A C   1 
ATOM   801  O O   . ILE A 1 123 ? 76.809  -10.082 48.780  1.00 152.61 ? 47   ILE A O   1 
ATOM   802  C CB  . ILE A 1 123 ? 79.104  -7.718  49.832  1.00 155.18 ? 47   ILE A CB  1 
ATOM   803  C CG1 . ILE A 1 123 ? 79.029  -6.267  50.391  1.00 155.75 ? 47   ILE A CG1 1 
ATOM   804  C CG2 . ILE A 1 123 ? 79.281  -7.711  48.303  1.00 153.22 ? 47   ILE A CG2 1 
ATOM   805  C CD1 . ILE A 1 123 ? 77.802  -5.410  49.929  1.00 160.33 ? 47   ILE A CD1 1 
ATOM   806  N N   . PRO A 1 124 ? 78.718  -10.926 49.611  1.00 152.25 ? 48   PRO A N   1 
ATOM   807  C CA  . PRO A 1 124 ? 78.541  -12.164 48.822  1.00 151.22 ? 48   PRO A CA  1 
ATOM   808  C C   . PRO A 1 124 ? 77.239  -12.909 49.165  1.00 154.31 ? 48   PRO A C   1 
ATOM   809  O O   . PRO A 1 124 ? 76.668  -13.542 48.278  1.00 152.18 ? 48   PRO A O   1 
ATOM   810  C CB  . PRO A 1 124 ? 79.762  -13.006 49.204  1.00 155.18 ? 48   PRO A CB  1 
ATOM   811  C CG  . PRO A 1 124 ? 80.771  -12.023 49.667  1.00 160.51 ? 48   PRO A CG  1 
ATOM   812  C CD  . PRO A 1 124 ? 79.979  -10.973 50.381  1.00 156.02 ? 48   PRO A CD  1 
ATOM   813  N N   . ILE A 1 125 ? 76.751  -12.802 50.425  1.00 152.52 ? 49   ILE A N   1 
ATOM   814  C CA  . ILE A 1 125 ? 75.504  -13.444 50.868  1.00 153.03 ? 49   ILE A CA  1 
ATOM   815  C C   . ILE A 1 125 ? 74.302  -12.750 50.183  1.00 155.01 ? 49   ILE A C   1 
ATOM   816  O O   . ILE A 1 125 ? 73.495  -13.436 49.555  1.00 153.97 ? 49   ILE A O   1 
ATOM   817  C CB  . ILE A 1 125 ? 75.363  -13.439 52.421  1.00 158.74 ? 49   ILE A CB  1 
ATOM   818  C CG1 . ILE A 1 125 ? 76.547  -14.177 53.118  1.00 161.57 ? 49   ILE A CG1 1 
ATOM   819  C CG2 . ILE A 1 125 ? 74.008  -14.012 52.867  1.00 160.39 ? 49   ILE A CG2 1 
ATOM   820  C CD1 . ILE A 1 125 ? 76.766  -15.711 52.780  1.00 169.59 ? 49   ILE A CD1 1 
ATOM   821  N N   . LEU A 1 126 ? 74.212  -11.404 50.282  1.00 150.59 ? 50   LEU A N   1 
ATOM   822  C CA  . LEU A 1 126 ? 73.155  -10.577 49.679  1.00 148.14 ? 50   LEU A CA  1 
ATOM   823  C C   . LEU A 1 126 ? 73.074  -10.775 48.159  1.00 148.81 ? 50   LEU A C   1 
ATOM   824  O O   . LEU A 1 126 ? 71.971  -10.847 47.623  1.00 147.31 ? 50   LEU A O   1 
ATOM   825  C CB  . LEU A 1 126 ? 73.388  -9.085  49.989  1.00 147.81 ? 50   LEU A CB  1 
ATOM   826  C CG  . LEU A 1 126 ? 72.683  -8.464  51.217  1.00 154.10 ? 50   LEU A CG  1 
ATOM   827  C CD1 . LEU A 1 126 ? 72.978  -9.215  52.510  1.00 157.30 ? 50   LEU A CD1 1 
ATOM   828  C CD2 . LEU A 1 126 ? 73.057  -6.996  51.370  1.00 155.98 ? 50   LEU A CD2 1 
ATOM   829  N N   . TYR A 1 127 ? 74.232  -10.891 47.478  1.00 144.18 ? 51   TYR A N   1 
ATOM   830  C CA  . TYR A 1 127 ? 74.324  -11.111 46.029  1.00 141.61 ? 51   TYR A CA  1 
ATOM   831  C C   . TYR A 1 127 ? 73.715  -12.476 45.632  1.00 146.06 ? 51   TYR A C   1 
ATOM   832  O O   . TYR A 1 127 ? 73.075  -12.552 44.584  1.00 144.20 ? 51   TYR A O   1 
ATOM   833  C CB  . TYR A 1 127 ? 75.787  -11.017 45.561  1.00 142.12 ? 51   TYR A CB  1 
ATOM   834  C CG  . TYR A 1 127 ? 76.260  -9.608  45.250  1.00 141.92 ? 51   TYR A CG  1 
ATOM   835  C CD1 . TYR A 1 127 ? 76.165  -8.593  46.201  1.00 144.76 ? 51   TYR A CD1 1 
ATOM   836  C CD2 . TYR A 1 127 ? 76.952  -9.329  44.076  1.00 140.68 ? 51   TYR A CD2 1 
ATOM   837  C CE1 . TYR A 1 127 ? 76.614  -7.302  45.929  1.00 144.35 ? 51   TYR A CE1 1 
ATOM   838  C CE2 . TYR A 1 127 ? 77.435  -8.050  43.806  1.00 140.57 ? 51   TYR A CE2 1 
ATOM   839  C CZ  . TYR A 1 127 ? 77.271  -7.041  44.741  1.00 148.09 ? 51   TYR A CZ  1 
ATOM   840  O OH  . TYR A 1 127 ? 77.741  -5.776  44.489  1.00 147.56 ? 51   TYR A OH  1 
ATOM   841  N N   . TYR A 1 128 ? 73.869  -13.528 46.469  1.00 144.85 ? 52   TYR A N   1 
ATOM   842  C CA  . TYR A 1 128 ? 73.263  -14.833 46.178  1.00 145.21 ? 52   TYR A CA  1 
ATOM   843  C C   . TYR A 1 128 ? 71.759  -14.830 46.512  1.00 148.73 ? 52   TYR A C   1 
ATOM   844  O O   . TYR A 1 128 ? 71.009  -15.561 45.860  1.00 147.94 ? 52   TYR A O   1 
ATOM   845  C CB  . TYR A 1 128 ? 73.961  -15.989 46.920  1.00 148.93 ? 52   TYR A CB  1 
ATOM   846  C CG  . TYR A 1 128 ? 75.174  -16.534 46.195  1.00 150.64 ? 52   TYR A CG  1 
ATOM   847  C CD1 . TYR A 1 128 ? 75.035  -17.453 45.157  1.00 152.19 ? 52   TYR A CD1 1 
ATOM   848  C CD2 . TYR A 1 128 ? 76.462  -16.202 46.601  1.00 152.15 ? 52   TYR A CD2 1 
ATOM   849  C CE1 . TYR A 1 128 ? 76.147  -17.966 44.490  1.00 153.08 ? 52   TYR A CE1 1 
ATOM   850  C CE2 . TYR A 1 128 ? 77.584  -16.720 45.951  1.00 153.19 ? 52   TYR A CE2 1 
ATOM   851  C CZ  . TYR A 1 128 ? 77.422  -17.602 44.894  1.00 160.52 ? 52   TYR A CZ  1 
ATOM   852  O OH  . TYR A 1 128 ? 78.524  -18.111 44.248  1.00 162.63 ? 52   TYR A OH  1 
ATOM   853  N N   . ILE A 1 129 ? 71.316  -14.009 47.501  1.00 145.73 ? 53   ILE A N   1 
ATOM   854  C CA  . ILE A 1 129 ? 69.895  -13.902 47.886  1.00 146.04 ? 53   ILE A CA  1 
ATOM   855  C C   . ILE A 1 129 ? 69.103  -13.292 46.702  1.00 147.38 ? 53   ILE A C   1 
ATOM   856  O O   . ILE A 1 129 ? 68.086  -13.861 46.300  1.00 147.23 ? 53   ILE A O   1 
ATOM   857  C CB  . ILE A 1 129 ? 69.701  -13.085 49.203  1.00 150.44 ? 53   ILE A CB  1 
ATOM   858  C CG1 . ILE A 1 129 ? 70.363  -13.820 50.396  1.00 153.62 ? 53   ILE A CG1 1 
ATOM   859  C CG2 . ILE A 1 129 ? 68.205  -12.838 49.489  1.00 151.53 ? 53   ILE A CG2 1 
ATOM   860  C CD1 . ILE A 1 129 ? 70.363  -13.074 51.740  1.00 164.30 ? 53   ILE A CD1 1 
ATOM   861  N N   . ILE A 1 130 ? 69.605  -12.179 46.117  1.00 141.37 ? 54   ILE A N   1 
ATOM   862  C CA  . ILE A 1 130 ? 68.986  -11.491 44.975  1.00 138.42 ? 54   ILE A CA  1 
ATOM   863  C C   . ILE A 1 130 ? 69.067  -12.403 43.728  1.00 140.50 ? 54   ILE A C   1 
ATOM   864  O O   . ILE A 1 130 ? 68.140  -12.396 42.917  1.00 138.95 ? 54   ILE A O   1 
ATOM   865  C CB  . ILE A 1 130 ? 69.664  -10.103 44.735  1.00 139.89 ? 54   ILE A CB  1 
ATOM   866  C CG1 . ILE A 1 130 ? 69.545  -9.175  45.987  1.00 141.44 ? 54   ILE A CG1 1 
ATOM   867  C CG2 . ILE A 1 130 ? 69.144  -9.396  43.472  1.00 138.27 ? 54   ILE A CG2 1 
ATOM   868  C CD1 . ILE A 1 130 ? 68.078  -8.776  46.493  1.00 148.53 ? 54   ILE A CD1 1 
ATOM   869  N N   . PHE A 1 131 ? 70.135  -13.219 43.615  1.00 137.46 ? 55   PHE A N   1 
ATOM   870  C CA  . PHE A 1 131 ? 70.325  -14.153 42.505  1.00 136.67 ? 55   PHE A CA  1 
ATOM   871  C C   . PHE A 1 131 ? 69.199  -15.197 42.432  1.00 140.99 ? 55   PHE A C   1 
ATOM   872  O O   . PHE A 1 131 ? 68.603  -15.344 41.372  1.00 139.06 ? 55   PHE A O   1 
ATOM   873  C CB  . PHE A 1 131 ? 71.685  -14.877 42.614  1.00 139.45 ? 55   PHE A CB  1 
ATOM   874  C CG  . PHE A 1 131 ? 71.832  -16.063 41.686  1.00 141.24 ? 55   PHE A CG  1 
ATOM   875  C CD1 . PHE A 1 131 ? 72.084  -15.880 40.333  1.00 142.77 ? 55   PHE A CD1 1 
ATOM   876  C CD2 . PHE A 1 131 ? 71.748  -17.361 42.173  1.00 145.48 ? 55   PHE A CD2 1 
ATOM   877  C CE1 . PHE A 1 131 ? 72.205  -16.973 39.473  1.00 143.96 ? 55   PHE A CE1 1 
ATOM   878  C CE2 . PHE A 1 131 ? 71.878  -18.455 41.314  1.00 148.65 ? 55   PHE A CE2 1 
ATOM   879  C CZ  . PHE A 1 131 ? 72.113  -18.254 39.971  1.00 145.00 ? 55   PHE A CZ  1 
ATOM   880  N N   . VAL A 1 132 ? 68.942  -15.935 43.531  1.00 139.84 ? 56   VAL A N   1 
ATOM   881  C CA  . VAL A 1 132 ? 67.960  -17.024 43.557  1.00 141.04 ? 56   VAL A CA  1 
ATOM   882  C C   . VAL A 1 132 ? 66.513  -16.429 43.502  1.00 143.82 ? 56   VAL A C   1 
ATOM   883  O O   . VAL A 1 132 ? 65.695  -16.951 42.743  1.00 143.34 ? 56   VAL A O   1 
ATOM   884  C CB  . VAL A 1 132 ? 68.153  -17.973 44.786  1.00 147.62 ? 56   VAL A CB  1 
ATOM   885  C CG1 . VAL A 1 132 ? 68.094  -17.230 46.122  1.00 148.28 ? 56   VAL A CG1 1 
ATOM   886  C CG2 . VAL A 1 132 ? 67.171  -19.144 44.760  1.00 149.31 ? 56   VAL A CG2 1 
ATOM   887  N N   . ILE A 1 133 ? 66.219  -15.338 44.250  1.00 139.62 ? 57   ILE A N   1 
ATOM   888  C CA  . ILE A 1 133 ? 64.885  -14.710 44.251  1.00 138.96 ? 57   ILE A CA  1 
ATOM   889  C C   . ILE A 1 133 ? 64.587  -14.170 42.836  1.00 139.70 ? 57   ILE A C   1 
ATOM   890  O O   . ILE A 1 133 ? 63.551  -14.514 42.265  1.00 139.66 ? 57   ILE A O   1 
ATOM   891  C CB  . ILE A 1 133 ? 64.762  -13.597 45.341  1.00 142.22 ? 57   ILE A CB  1 
ATOM   892  C CG1 . ILE A 1 133 ? 64.804  -14.230 46.758  1.00 145.37 ? 57   ILE A CG1 1 
ATOM   893  C CG2 . ILE A 1 133 ? 63.466  -12.774 45.160  1.00 142.31 ? 57   ILE A CG2 1 
ATOM   894  C CD1 . ILE A 1 133 ? 64.775  -13.241 47.946  1.00 153.66 ? 57   ILE A CD1 1 
ATOM   895  N N   . GLY A 1 134 ? 65.517  -13.393 42.283  1.00 133.40 ? 58   GLY A N   1 
ATOM   896  C CA  . GLY A 1 134 ? 65.395  -12.805 40.954  1.00 130.53 ? 58   GLY A CA  1 
ATOM   897  C C   . GLY A 1 134 ? 65.371  -13.800 39.813  1.00 133.25 ? 58   GLY A C   1 
ATOM   898  O O   . GLY A 1 134 ? 64.715  -13.554 38.797  1.00 131.47 ? 58   GLY A O   1 
ATOM   899  N N   . PHE A 1 135 ? 66.097  -14.925 39.958  1.00 130.74 ? 59   PHE A N   1 
ATOM   900  C CA  . PHE A 1 135 ? 66.158  -15.943 38.913  1.00 130.44 ? 59   PHE A CA  1 
ATOM   901  C C   . PHE A 1 135 ? 64.839  -16.705 38.853  1.00 135.23 ? 59   PHE A C   1 
ATOM   902  O O   . PHE A 1 135 ? 64.332  -16.935 37.762  1.00 133.72 ? 59   PHE A O   1 
ATOM   903  C CB  . PHE A 1 135 ? 67.336  -16.908 39.143  1.00 133.31 ? 59   PHE A CB  1 
ATOM   904  C CG  . PHE A 1 135 ? 67.797  -17.629 37.898  1.00 134.43 ? 59   PHE A CG  1 
ATOM   905  C CD1 . PHE A 1 135 ? 67.225  -18.838 37.521  1.00 138.98 ? 59   PHE A CD1 1 
ATOM   906  C CD2 . PHE A 1 135 ? 68.812  -17.100 37.105  1.00 134.91 ? 59   PHE A CD2 1 
ATOM   907  C CE1 . PHE A 1 135 ? 67.649  -19.498 36.361  1.00 139.49 ? 59   PHE A CE1 1 
ATOM   908  C CE2 . PHE A 1 135 ? 69.232  -17.760 35.944  1.00 137.22 ? 59   PHE A CE2 1 
ATOM   909  C CZ  . PHE A 1 135 ? 68.645  -18.952 35.579  1.00 136.66 ? 59   PHE A CZ  1 
ATOM   910  N N   . LEU A 1 136 ? 64.263  -17.045 40.028  1.00 134.12 ? 60   LEU A N   1 
ATOM   911  C CA  . LEU A 1 136 ? 63.006  -17.791 40.145  1.00 136.02 ? 60   LEU A CA  1 
ATOM   912  C C   . LEU A 1 136 ? 61.775  -16.942 39.740  1.00 139.55 ? 60   LEU A C   1 
ATOM   913  O O   . LEU A 1 136 ? 60.818  -17.519 39.216  1.00 140.30 ? 60   LEU A O   1 
ATOM   914  C CB  . LEU A 1 136 ? 62.805  -18.318 41.578  1.00 138.58 ? 60   LEU A CB  1 
ATOM   915  C CG  . LEU A 1 136 ? 63.347  -19.733 41.918  1.00 145.35 ? 60   LEU A CG  1 
ATOM   916  C CD1 . LEU A 1 136 ? 64.846  -19.890 41.631  1.00 144.25 ? 60   LEU A CD1 1 
ATOM   917  C CD2 . LEU A 1 136 ? 63.056  -20.089 43.358  1.00 150.44 ? 60   LEU A CD2 1 
ATOM   918  N N   . VAL A 1 137 ? 61.791  -15.600 39.963  1.00 134.32 ? 61   VAL A N   1 
ATOM   919  C CA  . VAL A 1 137 ? 60.651  -14.738 39.588  1.00 133.20 ? 61   VAL A CA  1 
ATOM   920  C C   . VAL A 1 137 ? 60.643  -14.542 38.041  1.00 134.57 ? 61   VAL A C   1 
ATOM   921  O O   . VAL A 1 137 ? 59.559  -14.419 37.464  1.00 134.90 ? 61   VAL A O   1 
ATOM   922  C CB  . VAL A 1 137 ? 60.583  -13.365 40.327  1.00 135.99 ? 61   VAL A CB  1 
ATOM   923  C CG1 . VAL A 1 137 ? 60.258  -13.545 41.806  1.00 138.00 ? 61   VAL A CG1 1 
ATOM   924  C CG2 . VAL A 1 137 ? 61.850  -12.537 40.140  1.00 133.49 ? 61   VAL A CG2 1 
ATOM   925  N N   . ASN A 1 138 ? 61.830  -14.549 37.379  1.00 128.06 ? 62   ASN A N   1 
ATOM   926  C CA  . ASN A 1 138 ? 61.921  -14.427 35.919  1.00 125.70 ? 62   ASN A CA  1 
ATOM   927  C C   . ASN A 1 138 ? 61.717  -15.807 35.246  1.00 131.50 ? 62   ASN A C   1 
ATOM   928  O O   . ASN A 1 138 ? 61.402  -15.848 34.057  1.00 130.04 ? 62   ASN A O   1 
ATOM   929  C CB  . ASN A 1 138 ? 63.248  -13.803 35.483  1.00 120.71 ? 62   ASN A CB  1 
ATOM   930  C CG  . ASN A 1 138 ? 63.328  -12.311 35.714  1.00 125.97 ? 62   ASN A CG  1 
ATOM   931  O OD1 . ASN A 1 138 ? 62.576  -11.525 35.131  1.00 114.94 ? 62   ASN A OD1 1 
ATOM   932  N ND2 . ASN A 1 138 ? 64.338  -11.874 36.437  1.00 116.16 ? 62   ASN A ND2 1 
ATOM   933  N N   . ILE A 1 139 ? 61.852  -16.924 36.011  1.00 131.10 ? 63   ILE A N   1 
ATOM   934  C CA  . ILE A 1 139 ? 61.602  -18.288 35.512  1.00 133.11 ? 63   ILE A CA  1 
ATOM   935  C C   . ILE A 1 139 ? 60.092  -18.454 35.263  1.00 139.61 ? 63   ILE A C   1 
ATOM   936  O O   . ILE A 1 139 ? 59.703  -19.023 34.243  1.00 139.54 ? 63   ILE A O   1 
ATOM   937  C CB  . ILE A 1 139 ? 62.159  -19.392 36.481  1.00 138.10 ? 63   ILE A CB  1 
ATOM   938  C CG1 . ILE A 1 139 ? 63.710  -19.494 36.403  1.00 137.38 ? 63   ILE A CG1 1 
ATOM   939  C CG2 . ILE A 1 139 ? 61.532  -20.778 36.219  1.00 141.54 ? 63   ILE A CG2 1 
ATOM   940  C CD1 . ILE A 1 139 ? 64.353  -19.881 34.977  1.00 144.85 ? 63   ILE A CD1 1 
ATOM   941  N N   . VAL A 1 140 ? 59.256  -17.920 36.174  1.00 137.96 ? 64   VAL A N   1 
ATOM   942  C CA  . VAL A 1 140 ? 57.793  -17.994 36.089  1.00 140.08 ? 64   VAL A CA  1 
ATOM   943  C C   . VAL A 1 140 ? 57.298  -17.167 34.865  1.00 142.78 ? 64   VAL A C   1 
ATOM   944  O O   . VAL A 1 140 ? 56.316  -17.558 34.239  1.00 143.56 ? 64   VAL A O   1 
ATOM   945  C CB  . VAL A 1 140 ? 57.127  -17.514 37.416  1.00 145.53 ? 64   VAL A CB  1 
ATOM   946  C CG1 . VAL A 1 140 ? 55.601  -17.578 37.340  1.00 147.48 ? 64   VAL A CG1 1 
ATOM   947  C CG2 . VAL A 1 140 ? 57.624  -18.332 38.608  1.00 147.16 ? 64   VAL A CG2 1 
ATOM   948  N N   . VAL A 1 141 ? 58.007  -16.078 34.502  1.00 137.15 ? 65   VAL A N   1 
ATOM   949  C CA  . VAL A 1 141 ? 57.633  -15.195 33.385  1.00 135.54 ? 65   VAL A CA  1 
ATOM   950  C C   . VAL A 1 141 ? 58.024  -15.846 32.020  1.00 139.78 ? 65   VAL A C   1 
ATOM   951  O O   . VAL A 1 141 ? 57.193  -15.861 31.108  1.00 139.78 ? 65   VAL A O   1 
ATOM   952  C CB  . VAL A 1 141 ? 58.280  -13.787 33.540  1.00 136.75 ? 65   VAL A CB  1 
ATOM   953  C CG1 . VAL A 1 141 ? 57.959  -12.885 32.350  1.00 134.86 ? 65   VAL A CG1 1 
ATOM   954  C CG2 . VAL A 1 141 ? 57.830  -13.124 34.835  1.00 137.22 ? 65   VAL A CG2 1 
ATOM   955  N N   . VAL A 1 142 ? 59.274  -16.355 31.880  1.00 136.25 ? 66   VAL A N   1 
ATOM   956  C CA  . VAL A 1 142 ? 59.784  -16.964 30.636  1.00 135.93 ? 66   VAL A CA  1 
ATOM   957  C C   . VAL A 1 142 ? 58.939  -18.202 30.257  1.00 143.56 ? 66   VAL A C   1 
ATOM   958  O O   . VAL A 1 142 ? 58.450  -18.278 29.127  1.00 142.98 ? 66   VAL A O   1 
ATOM   959  C CB  . VAL A 1 142 ? 61.291  -17.343 30.749  1.00 138.90 ? 66   VAL A CB  1 
ATOM   960  C CG1 . VAL A 1 142 ? 61.756  -18.184 29.560  1.00 138.70 ? 66   VAL A CG1 1 
ATOM   961  C CG2 . VAL A 1 142 ? 62.164  -16.102 30.901  1.00 136.29 ? 66   VAL A CG2 1 
ATOM   962  N N   . THR A 1 143 ? 58.769  -19.150 31.202  1.00 143.71 ? 67   THR A N   1 
ATOM   963  C CA  . THR A 1 143 ? 58.037  -20.408 30.994  1.00 146.92 ? 67   THR A CA  1 
ATOM   964  C C   . THR A 1 143 ? 56.526  -20.167 30.739  1.00 153.37 ? 67   THR A C   1 
ATOM   965  O O   . THR A 1 143 ? 55.882  -21.011 30.116  1.00 154.96 ? 67   THR A O   1 
ATOM   966  C CB  . THR A 1 143 ? 58.210  -21.352 32.192  1.00 156.55 ? 67   THR A CB  1 
ATOM   967  O OG1 . THR A 1 143 ? 57.765  -20.698 33.381  1.00 155.64 ? 67   THR A OG1 1 
ATOM   968  C CG2 . THR A 1 143 ? 59.654  -21.831 32.363  1.00 153.83 ? 67   THR A CG2 1 
ATOM   969  N N   . LEU A 1 144 ? 55.976  -19.029 31.218  1.00 149.93 ? 68   LEU A N   1 
ATOM   970  C CA  . LEU A 1 144 ? 54.570  -18.642 31.045  1.00 151.57 ? 68   LEU A CA  1 
ATOM   971  C C   . LEU A 1 144 ? 54.278  -18.355 29.566  1.00 155.50 ? 68   LEU A C   1 
ATOM   972  O O   . LEU A 1 144 ? 53.317  -18.890 29.015  1.00 156.85 ? 68   LEU A O   1 
ATOM   973  C CB  . LEU A 1 144 ? 54.273  -17.396 31.926  1.00 150.69 ? 68   LEU A CB  1 
ATOM   974  C CG  . LEU A 1 144 ? 52.867  -16.760 31.931  1.00 156.94 ? 68   LEU A CG  1 
ATOM   975  C CD1 . LEU A 1 144 ? 52.625  -15.998 33.218  1.00 157.31 ? 68   LEU A CD1 1 
ATOM   976  C CD2 . LEU A 1 144 ? 52.633  -15.852 30.715  1.00 157.71 ? 68   LEU A CD2 1 
ATOM   977  N N   . PHE A 1 145 ? 55.123  -17.514 28.941  1.00 150.28 ? 69   PHE A N   1 
ATOM   978  C CA  . PHE A 1 145 ? 55.023  -17.050 27.558  1.00 149.38 ? 69   PHE A CA  1 
ATOM   979  C C   . PHE A 1 145 ? 55.025  -18.208 26.535  1.00 156.09 ? 69   PHE A C   1 
ATOM   980  O O   . PHE A 1 145 ? 54.361  -18.093 25.503  1.00 156.33 ? 69   PHE A O   1 
ATOM   981  C CB  . PHE A 1 145 ? 56.211  -16.108 27.253  1.00 147.72 ? 69   PHE A CB  1 
ATOM   982  C CG  . PHE A 1 145 ? 56.253  -15.511 25.863  1.00 147.60 ? 69   PHE A CG  1 
ATOM   983  C CD1 . PHE A 1 145 ? 55.637  -14.295 25.591  1.00 149.56 ? 69   PHE A CD1 1 
ATOM   984  C CD2 . PHE A 1 145 ? 56.945  -16.144 24.836  1.00 149.15 ? 69   PHE A CD2 1 
ATOM   985  C CE1 . PHE A 1 145 ? 55.682  -13.741 24.308  1.00 149.05 ? 69   PHE A CE1 1 
ATOM   986  C CE2 . PHE A 1 145 ? 56.980  -15.595 23.551  1.00 150.57 ? 69   PHE A CE2 1 
ATOM   987  C CZ  . PHE A 1 145 ? 56.358  -14.392 23.299  1.00 147.67 ? 69   PHE A CZ  1 
ATOM   988  N N   . CYS A 1 146 ? 55.786  -19.289 26.798  1.00 154.07 ? 70   CYS A N   1 
ATOM   989  C CA  . CYS A 1 146 ? 55.970  -20.375 25.838  1.00 155.30 ? 70   CYS A CA  1 
ATOM   990  C C   . CYS A 1 146 ? 54.842  -21.442 25.942  1.00 164.12 ? 70   CYS A C   1 
ATOM   991  O O   . CYS A 1 146 ? 53.996  -21.509 25.049  1.00 164.96 ? 70   CYS A O   1 
ATOM   992  C CB  . CYS A 1 146 ? 57.339  -21.025 26.027  1.00 154.42 ? 70   CYS A CB  1 
ATOM   993  S SG  . CYS A 1 146 ? 58.743  -19.906 25.765  1.00 154.13 ? 70   CYS A SG  1 
ATOM   994  N N   . CYS A 1 147 ? 54.876  -22.302 26.982  1.00 163.56 ? 71   CYS A N   1 
ATOM   995  C CA  . CYS A 1 147 ? 54.005  -23.474 27.121  1.00 167.58 ? 71   CYS A CA  1 
ATOM   996  C C   . CYS A 1 147 ? 52.629  -23.119 27.742  1.00 174.07 ? 71   CYS A C   1 
ATOM   997  O O   . CYS A 1 147 ? 51.728  -23.959 27.666  1.00 177.02 ? 71   CYS A O   1 
ATOM   998  C CB  . CYS A 1 147 ? 54.705  -24.535 27.968  1.00 169.14 ? 71   CYS A CB  1 
ATOM   999  S SG  . CYS A 1 147 ? 56.254  -25.155 27.258  1.00 171.30 ? 71   CYS A SG  1 
ATOM   1000 N N   . GLN A 1 148 ? 52.452  -21.926 28.357  1.00 169.20 ? 72   GLN A N   1 
ATOM   1001 C CA  . GLN A 1 148 ? 51.159  -21.632 28.995  1.00 171.13 ? 72   GLN A CA  1 
ATOM   1002 C C   . GLN A 1 148 ? 50.489  -20.328 28.452  1.00 173.69 ? 72   GLN A C   1 
ATOM   1003 O O   . GLN A 1 148 ? 49.519  -19.858 29.060  1.00 174.51 ? 72   GLN A O   1 
ATOM   1004 C CB  . GLN A 1 148 ? 51.313  -21.512 30.523  1.00 172.55 ? 72   GLN A CB  1 
ATOM   1005 C CG  . GLN A 1 148 ? 51.772  -22.805 31.212  1.00 182.27 ? 72   GLN A CG  1 
ATOM   1006 C CD  . GLN A 1 148 ? 51.730  -22.729 32.722  1.00 195.67 ? 72   GLN A CD  1 
ATOM   1007 O OE1 . GLN A 1 148 ? 52.524  -23.365 33.418  1.00 190.11 ? 72   GLN A OE1 1 
ATOM   1008 N NE2 . GLN A 1 148 ? 50.814  -21.940 33.266  1.00 186.38 ? 72   GLN A NE2 1 
ATOM   1009 N N   . LYS A 1 149 ? 50.946  -19.789 27.299  1.00 167.88 ? 73   LYS A N   1 
ATOM   1010 C CA  . LYS A 1 149 ? 50.313  -18.596 26.725  1.00 166.54 ? 73   LYS A CA  1 
ATOM   1011 C C   . LYS A 1 149 ? 50.412  -18.646 25.184  1.00 170.00 ? 73   LYS A C   1 
ATOM   1012 O O   . LYS A 1 149 ? 49.479  -19.118 24.532  1.00 171.86 ? 73   LYS A O   1 
ATOM   1013 C CB  . LYS A 1 149 ? 50.939  -17.298 27.290  1.00 165.71 ? 73   LYS A CB  1 
ATOM   1014 C CG  . LYS A 1 149 ? 50.181  -16.017 26.909  1.00 176.21 ? 73   LYS A CG  1 
ATOM   1015 C CD  . LYS A 1 149 ? 50.818  -14.727 27.470  1.00 180.71 ? 73   LYS A CD  1 
ATOM   1016 C CE  . LYS A 1 149 ? 52.159  -14.349 26.870  1.00 184.01 ? 73   LYS A CE  1 
ATOM   1017 N NZ  . LYS A 1 149 ? 52.059  -14.039 25.417  1.00 189.69 ? 73   LYS A NZ  1 
ATOM   1018 N N   . GLY A 1 150 ? 51.535  -18.170 24.636  1.00 163.91 ? 74   GLY A N   1 
ATOM   1019 C CA  . GLY A 1 150 ? 51.789  -18.117 23.198  1.00 162.90 ? 74   GLY A CA  1 
ATOM   1020 C C   . GLY A 1 150 ? 52.621  -16.918 22.759  1.00 162.95 ? 74   GLY A C   1 
ATOM   1021 O O   . GLY A 1 150 ? 52.922  -16.039 23.577  1.00 160.83 ? 74   GLY A O   1 
ATOM   1022 N N   . PRO A 1 151 ? 52.994  -16.829 21.452  1.00 157.90 ? 75   PRO A N   1 
ATOM   1023 C CA  . PRO A 1 151 ? 53.821  -15.693 20.999  1.00 153.93 ? 75   PRO A CA  1 
ATOM   1024 C C   . PRO A 1 151 ? 52.975  -14.528 20.428  1.00 155.07 ? 75   PRO A C   1 
ATOM   1025 O O   . PRO A 1 151 ? 53.488  -13.716 19.648  1.00 152.65 ? 75   PRO A O   1 
ATOM   1026 C CB  . PRO A 1 151 ? 54.704  -16.323 19.909  1.00 155.24 ? 75   PRO A CB  1 
ATOM   1027 C CG  . PRO A 1 151 ? 53.981  -17.610 19.486  1.00 163.13 ? 75   PRO A CG  1 
ATOM   1028 C CD  . PRO A 1 151 ? 52.755  -17.779 20.347  1.00 161.27 ? 75   PRO A CD  1 
ATOM   1029 N N   . LYS A 1 152 ? 51.692  -14.426 20.846  1.00 151.37 ? 76   LYS A N   1 
ATOM   1030 C CA  . LYS A 1 152 ? 50.769  -13.370 20.410  1.00 149.91 ? 76   LYS A CA  1 
ATOM   1031 C C   . LYS A 1 152 ? 50.993  -12.078 21.229  1.00 149.33 ? 76   LYS A C   1 
ATOM   1032 O O   . LYS A 1 152 ? 51.706  -12.103 22.238  1.00 148.16 ? 76   LYS A O   1 
ATOM   1033 C CB  . LYS A 1 152 ? 49.308  -13.843 20.527  1.00 155.38 ? 76   LYS A CB  1 
ATOM   1034 C CG  . LYS A 1 152 ? 48.951  -14.954 19.533  1.00 165.53 ? 76   LYS A CG  1 
ATOM   1035 C CD  . LYS A 1 152 ? 47.521  -15.492 19.694  1.00 175.93 ? 76   LYS A CD  1 
ATOM   1036 C CE  . LYS A 1 152 ? 47.281  -16.272 20.973  1.00 185.76 ? 76   LYS A CE  1 
ATOM   1037 N NZ  . LYS A 1 152 ? 48.125  -17.497 21.051  1.00 193.41 ? 76   LYS A NZ  1 
ATOM   1038 N N   . LYS A 1 153 ? 50.402  -10.946 20.755  1.00 143.00 ? 77   LYS A N   1 
ATOM   1039 C CA  . LYS A 1 153 ? 50.485  -9.573  21.302  1.00 139.84 ? 77   LYS A CA  1 
ATOM   1040 C C   . LYS A 1 153 ? 51.884  -8.978  21.066  1.00 137.37 ? 77   LYS A C   1 
ATOM   1041 O O   . LYS A 1 153 ? 52.845  -9.724  20.889  1.00 136.05 ? 77   LYS A O   1 
ATOM   1042 C CB  . LYS A 1 153 ? 50.125  -9.480  22.798  1.00 143.33 ? 77   LYS A CB  1 
ATOM   1043 C CG  . LYS A 1 153 ? 48.664  -9.800  23.117  1.00 161.23 ? 77   LYS A CG  1 
ATOM   1044 C CD  . LYS A 1 153 ? 48.293  -9.449  24.563  1.00 172.08 ? 77   LYS A CD  1 
ATOM   1045 C CE  . LYS A 1 153 ? 48.348  -7.957  24.835  1.00 181.90 ? 77   LYS A CE  1 
ATOM   1046 N NZ  . LYS A 1 153 ? 48.025  -7.634  26.246  1.00 192.66 ? 77   LYS A NZ  1 
ATOM   1047 N N   . VAL A 1 154 ? 51.990  -7.629  21.048  1.00 130.04 ? 78   VAL A N   1 
ATOM   1048 C CA  . VAL A 1 154 ? 53.267  -6.958  20.779  1.00 125.89 ? 78   VAL A CA  1 
ATOM   1049 C C   . VAL A 1 154 ? 53.984  -6.675  22.118  1.00 125.92 ? 78   VAL A C   1 
ATOM   1050 O O   . VAL A 1 154 ? 55.186  -6.922  22.221  1.00 123.97 ? 78   VAL A O   1 
ATOM   1051 C CB  . VAL A 1 154 ? 53.078  -5.659  19.939  1.00 128.50 ? 78   VAL A CB  1 
ATOM   1052 C CG1 . VAL A 1 154 ? 54.416  -4.974  19.667  1.00 125.44 ? 78   VAL A CG1 1 
ATOM   1053 C CG2 . VAL A 1 154 ? 52.353  -5.951  18.624  1.00 129.62 ? 78   VAL A CG2 1 
ATOM   1054 N N   . SER A 1 155 ? 53.240  -6.184  23.135  1.00 121.45 ? 79   SER A N   1 
ATOM   1055 C CA  . SER A 1 155 ? 53.749  -5.859  24.474  1.00 119.55 ? 79   SER A CA  1 
ATOM   1056 C C   . SER A 1 155 ? 54.344  -7.091  25.168  1.00 120.80 ? 79   SER A C   1 
ATOM   1057 O O   . SER A 1 155 ? 55.342  -6.957  25.873  1.00 118.84 ? 79   SER A O   1 
ATOM   1058 C CB  . SER A 1 155 ? 52.636  -5.273  25.338  1.00 124.93 ? 79   SER A CB  1 
ATOM   1059 O OG  . SER A 1 155 ? 51.541  -6.168  25.456  1.00 137.98 ? 79   SER A OG  1 
ATOM   1060 N N   . SER A 1 156 ? 53.747  -8.285  24.940  1.00 117.36 ? 80   SER A N   1 
ATOM   1061 C CA  . SER A 1 156 ? 54.188  -9.566  25.505  1.00 117.26 ? 80   SER A CA  1 
ATOM   1062 C C   . SER A 1 156 ? 55.579  -9.971  24.992  1.00 117.40 ? 80   SER A C   1 
ATOM   1063 O O   . SER A 1 156 ? 56.307  -10.667 25.706  1.00 116.98 ? 80   SER A O   1 
ATOM   1064 C CB  . SER A 1 156 ? 53.187  -10.669 25.174  1.00 123.45 ? 80   SER A CB  1 
ATOM   1065 O OG  . SER A 1 156 ? 51.908  -10.399 25.723  1.00 133.20 ? 80   SER A OG  1 
ATOM   1066 N N   . ILE A 1 157 ? 55.946  -9.539  23.763  1.00 111.13 ? 81   ILE A N   1 
ATOM   1067 C CA  . ILE A 1 157 ? 57.245  -9.846  23.155  1.00 108.63 ? 81   ILE A CA  1 
ATOM   1068 C C   . ILE A 1 157 ? 58.333  -9.081  23.913  1.00 109.88 ? 81   ILE A C   1 
ATOM   1069 O O   . ILE A 1 157 ? 59.373  -9.665  24.219  1.00 109.47 ? 81   ILE A O   1 
ATOM   1070 C CB  . ILE A 1 157 ? 57.281  -9.538  21.627  1.00 110.65 ? 81   ILE A CB  1 
ATOM   1071 C CG1 . ILE A 1 157 ? 56.034  -10.090 20.873  1.00 112.98 ? 81   ILE A CG1 1 
ATOM   1072 C CG2 . ILE A 1 157 ? 58.593  -9.995  20.973  1.00 110.06 ? 81   ILE A CG2 1 
ATOM   1073 C CD1 . ILE A 1 157 ? 55.728  -11.615 20.992  1.00 121.88 ? 81   ILE A CD1 1 
ATOM   1074 N N   . TYR A 1 158 ? 58.073  -7.800  24.268  1.00 104.59 ? 82   TYR A N   1 
ATOM   1075 C CA  . TYR A 1 158 ? 59.026  -6.990  25.032  1.00 102.55 ? 82   TYR A CA  1 
ATOM   1076 C C   . TYR A 1 158 ? 59.198  -7.570  26.446  1.00 107.14 ? 82   TYR A C   1 
ATOM   1077 O O   . TYR A 1 158 ? 60.315  -7.555  26.956  1.00 106.49 ? 82   TYR A O   1 
ATOM   1078 C CB  . TYR A 1 158 ? 58.604  -5.509  25.103  1.00 102.66 ? 82   TYR A CB  1 
ATOM   1079 C CG  . TYR A 1 158 ? 58.359  -4.862  23.755  1.00 103.28 ? 82   TYR A CG  1 
ATOM   1080 C CD1 . TYR A 1 158 ? 59.417  -4.553  22.904  1.00 103.58 ? 82   TYR A CD1 1 
ATOM   1081 C CD2 . TYR A 1 158 ? 57.083  -4.446  23.382  1.00 104.77 ? 82   TYR A CD2 1 
ATOM   1082 C CE1 . TYR A 1 158 ? 59.197  -3.942  21.668  1.00 103.32 ? 82   TYR A CE1 1 
ATOM   1083 C CE2 . TYR A 1 158 ? 56.855  -3.811  22.161  1.00 104.81 ? 82   TYR A CE2 1 
ATOM   1084 C CZ  . TYR A 1 158 ? 57.913  -3.565  21.304  1.00 109.51 ? 82   TYR A CZ  1 
ATOM   1085 O OH  . TYR A 1 158 ? 57.678  -2.958  20.090  1.00 108.55 ? 82   TYR A OH  1 
ATOM   1086 N N   . ILE A 1 159 ? 58.107  -8.127  27.050  1.00 104.76 ? 83   ILE A N   1 
ATOM   1087 C CA  . ILE A 1 159 ? 58.117  -8.779  28.377  1.00 105.38 ? 83   ILE A CA  1 
ATOM   1088 C C   . ILE A 1 159 ? 59.119  -9.946  28.372  1.00 107.34 ? 83   ILE A C   1 
ATOM   1089 O O   . ILE A 1 159 ? 59.957  -10.035 29.274  1.00 106.45 ? 83   ILE A O   1 
ATOM   1090 C CB  . ILE A 1 159 ? 56.692  -9.281  28.809  1.00 111.09 ? 83   ILE A CB  1 
ATOM   1091 C CG1 . ILE A 1 159 ? 55.610  -8.169  28.778  1.00 111.92 ? 83   ILE A CG1 1 
ATOM   1092 C CG2 . ILE A 1 159 ? 56.717  -9.987  30.179  1.00 113.58 ? 83   ILE A CG2 1 
ATOM   1093 C CD1 . ILE A 1 159 ? 55.780  -7.020  29.731  1.00 121.44 ? 83   ILE A CD1 1 
ATOM   1094 N N   . PHE A 1 160 ? 59.019  -10.834 27.355  1.00 102.89 ? 84   PHE A N   1 
ATOM   1095 C CA  . PHE A 1 160 ? 59.881  -12.007 27.215  1.00 102.47 ? 84   PHE A CA  1 
ATOM   1096 C C   . PHE A 1 160 ? 61.357  -11.578 27.057  1.00 104.01 ? 84   PHE A C   1 
ATOM   1097 O O   . PHE A 1 160 ? 62.220  -12.098 27.771  1.00 104.34 ? 84   PHE A O   1 
ATOM   1098 C CB  . PHE A 1 160 ? 59.433  -12.872 26.025  1.00 104.86 ? 84   PHE A CB  1 
ATOM   1099 C CG  . PHE A 1 160 ? 60.257  -14.125 25.840  1.00 107.08 ? 84   PHE A CG  1 
ATOM   1100 C CD1 . PHE A 1 160 ? 59.988  -15.270 26.579  1.00 112.62 ? 84   PHE A CD1 1 
ATOM   1101 C CD2 . PHE A 1 160 ? 61.292  -14.167 24.912  1.00 107.83 ? 84   PHE A CD2 1 
ATOM   1102 C CE1 . PHE A 1 160 ? 60.757  -16.427 26.412  1.00 114.36 ? 84   PHE A CE1 1 
ATOM   1103 C CE2 . PHE A 1 160 ? 62.057  -15.326 24.743  1.00 111.41 ? 84   PHE A CE2 1 
ATOM   1104 C CZ  . PHE A 1 160 ? 61.786  -16.447 25.495  1.00 111.76 ? 84   PHE A CZ  1 
ATOM   1105 N N   . ASN A 1 161 ? 61.633  -10.613 26.155  1.00 97.41  ? 85   ASN A N   1 
ATOM   1106 C CA  . ASN A 1 161 ? 62.980  -10.100 25.920  1.00 94.78  ? 85   ASN A CA  1 
ATOM   1107 C C   . ASN A 1 161 ? 63.529  -9.418  27.169  1.00 97.82  ? 85   ASN A C   1 
ATOM   1108 O O   . ASN A 1 161 ? 64.729  -9.514  27.424  1.00 96.96  ? 85   ASN A O   1 
ATOM   1109 C CB  . ASN A 1 161 ? 62.991  -9.143  24.750  1.00 92.58  ? 85   ASN A CB  1 
ATOM   1110 C CG  . ASN A 1 161 ? 62.872  -9.831  23.416  1.00 107.04 ? 85   ASN A CG  1 
ATOM   1111 O OD1 . ASN A 1 161 ? 63.824  -10.429 22.911  1.00 97.84  ? 85   ASN A OD1 1 
ATOM   1112 N ND2 . ASN A 1 161 ? 61.734  -9.693  22.773  1.00 98.65  ? 85   ASN A ND2 1 
ATOM   1113 N N   . LEU A 1 162 ? 62.651  -8.767  27.964  1.00 94.77  ? 86   LEU A N   1 
ATOM   1114 C CA  . LEU A 1 162 ? 63.037  -8.133  29.228  1.00 94.62  ? 86   LEU A CA  1 
ATOM   1115 C C   . LEU A 1 162 ? 63.403  -9.219  30.248  1.00 100.42 ? 86   LEU A C   1 
ATOM   1116 O O   . LEU A 1 162 ? 64.431  -9.102  30.915  1.00 99.89  ? 86   LEU A O   1 
ATOM   1117 C CB  . LEU A 1 162 ? 61.908  -7.213  29.764  1.00 94.90  ? 86   LEU A CB  1 
ATOM   1118 C CG  . LEU A 1 162 ? 62.160  -6.470  31.090  1.00 99.84  ? 86   LEU A CG  1 
ATOM   1119 C CD1 . LEU A 1 162 ? 63.376  -5.571  31.005  1.00 98.79  ? 86   LEU A CD1 1 
ATOM   1120 C CD2 . LEU A 1 162 ? 60.958  -5.655  31.496  1.00 102.36 ? 86   LEU A CD2 1 
ATOM   1121 N N   . ALA A 1 163 ? 62.580  -10.297 30.323  1.00 98.66  ? 87   ALA A N   1 
ATOM   1122 C CA  . ALA A 1 163 ? 62.783  -11.433 31.229  1.00 99.71  ? 87   ALA A CA  1 
ATOM   1123 C C   . ALA A 1 163 ? 64.083  -12.171 30.895  1.00 102.21 ? 87   ALA A C   1 
ATOM   1124 O O   . ALA A 1 163 ? 64.812  -12.528 31.814  1.00 102.00 ? 87   ALA A O   1 
ATOM   1125 C CB  . ALA A 1 163 ? 61.601  -12.386 31.154  1.00 102.32 ? 87   ALA A CB  1 
ATOM   1126 N N   . VAL A 1 164 ? 64.394  -12.351 29.587  1.00 97.84  ? 88   VAL A N   1 
ATOM   1127 C CA  . VAL A 1 164 ? 65.635  -12.988 29.111  1.00 97.49  ? 88   VAL A CA  1 
ATOM   1128 C C   . VAL A 1 164 ? 66.848  -12.111 29.526  1.00 101.12 ? 88   VAL A C   1 
ATOM   1129 O O   . VAL A 1 164 ? 67.778  -12.625 30.154  1.00 101.78 ? 88   VAL A O   1 
ATOM   1130 C CB  . VAL A 1 164 ? 65.604  -13.246 27.576  1.00 100.39 ? 88   VAL A CB  1 
ATOM   1131 C CG1 . VAL A 1 164 ? 66.994  -13.564 27.025  1.00 99.35  ? 88   VAL A CG1 1 
ATOM   1132 C CG2 . VAL A 1 164 ? 64.608  -14.349 27.222  1.00 101.95 ? 88   VAL A CG2 1 
ATOM   1133 N N   . ALA A 1 165 ? 66.804  -10.794 29.219  1.00 96.46  ? 89   ALA A N   1 
ATOM   1134 C CA  . ALA A 1 165 ? 67.857  -9.836  29.575  1.00 95.49  ? 89   ALA A CA  1 
ATOM   1135 C C   . ALA A 1 165 ? 68.084  -9.791  31.098  1.00 101.21 ? 89   ALA A C   1 
ATOM   1136 O O   . ALA A 1 165 ? 69.237  -9.759  31.532  1.00 100.64 ? 89   ALA A O   1 
ATOM   1137 C CB  . ALA A 1 165 ? 67.501  -8.449  29.061  1.00 94.70  ? 89   ALA A CB  1 
ATOM   1138 N N   . ASP A 1 166 ? 66.987  -9.816  31.902  1.00 99.55  ? 90   ASP A N   1 
ATOM   1139 C CA  . ASP A 1 166 ? 67.053  -9.818  33.371  1.00 100.77 ? 90   ASP A CA  1 
ATOM   1140 C C   . ASP A 1 166 ? 67.625  -11.128 33.893  1.00 106.64 ? 90   ASP A C   1 
ATOM   1141 O O   . ASP A 1 166 ? 68.489  -11.109 34.770  1.00 106.90 ? 90   ASP A O   1 
ATOM   1142 C CB  . ASP A 1 166 ? 65.667  -9.580  33.999  1.00 103.34 ? 90   ASP A CB  1 
ATOM   1143 C CG  . ASP A 1 166 ? 65.115  -8.178  33.851  1.00 111.36 ? 90   ASP A CG  1 
ATOM   1144 O OD1 . ASP A 1 166 ? 65.908  -7.215  33.939  1.00 109.70 ? 90   ASP A OD1 1 
ATOM   1145 O OD2 . ASP A 1 166 ? 63.872  -8.034  33.800  1.00 119.64 ? 90   ASP A OD2 1 
ATOM   1146 N N   . LEU A 1 167 ? 67.139  -12.263 33.347  1.00 104.14 ? 91   LEU A N   1 
ATOM   1147 C CA  . LEU A 1 167 ? 67.548  -13.614 33.720  1.00 105.80 ? 91   LEU A CA  1 
ATOM   1148 C C   . LEU A 1 167 ? 69.065  -13.792 33.519  1.00 110.45 ? 91   LEU A C   1 
ATOM   1149 O O   . LEU A 1 167 ? 69.755  -14.254 34.435  1.00 111.41 ? 91   LEU A O   1 
ATOM   1150 C CB  . LEU A 1 167 ? 66.758  -14.636 32.874  1.00 106.50 ? 91   LEU A CB  1 
ATOM   1151 C CG  . LEU A 1 167 ? 66.782  -16.102 33.304  1.00 113.37 ? 91   LEU A CG  1 
ATOM   1152 C CD1 . LEU A 1 167 ? 65.996  -16.307 34.597  1.00 115.28 ? 91   LEU A CD1 1 
ATOM   1153 C CD2 . LEU A 1 167 ? 66.158  -16.973 32.239  1.00 116.67 ? 91   LEU A CD2 1 
ATOM   1154 N N   . LEU A 1 168 ? 69.584  -13.363 32.344  1.00 105.65 ? 92   LEU A N   1 
ATOM   1155 C CA  . LEU A 1 168 ? 71.005  -13.477 32.000  1.00 105.03 ? 92   LEU A CA  1 
ATOM   1156 C C   . LEU A 1 168 ? 71.862  -12.483 32.806  1.00 109.91 ? 92   LEU A C   1 
ATOM   1157 O O   . LEU A 1 168 ? 73.036  -12.772 33.059  1.00 110.37 ? 92   LEU A O   1 
ATOM   1158 C CB  . LEU A 1 168 ? 71.238  -13.256 30.491  1.00 103.26 ? 92   LEU A CB  1 
ATOM   1159 C CG  . LEU A 1 168 ? 70.641  -14.296 29.526  1.00 107.80 ? 92   LEU A CG  1 
ATOM   1160 C CD1 . LEU A 1 168 ? 70.848  -13.880 28.092  1.00 106.03 ? 92   LEU A CD1 1 
ATOM   1161 C CD2 . LEU A 1 168 ? 71.238  -15.679 29.752  1.00 111.87 ? 92   LEU A CD2 1 
ATOM   1162 N N   . LEU A 1 169 ? 71.286  -11.322 33.198  1.00 106.36 ? 93   LEU A N   1 
ATOM   1163 C CA  . LEU A 1 169 ? 71.977  -10.306 34.006  1.00 106.48 ? 93   LEU A CA  1 
ATOM   1164 C C   . LEU A 1 169 ? 72.209  -10.830 35.429  1.00 113.42 ? 93   LEU A C   1 
ATOM   1165 O O   . LEU A 1 169 ? 73.317  -10.712 35.959  1.00 113.69 ? 93   LEU A O   1 
ATOM   1166 C CB  . LEU A 1 169 ? 71.166  -8.992  34.037  1.00 105.51 ? 93   LEU A CB  1 
ATOM   1167 C CG  . LEU A 1 169 ? 71.751  -7.813  34.836  1.00 110.45 ? 93   LEU A CG  1 
ATOM   1168 C CD1 . LEU A 1 169 ? 73.024  -7.292  34.203  1.00 109.95 ? 93   LEU A CD1 1 
ATOM   1169 C CD2 . LEU A 1 169 ? 70.756  -6.674  34.920  1.00 112.83 ? 93   LEU A CD2 1 
ATOM   1170 N N   . LEU A 1 170 ? 71.155  -11.420 36.035  1.00 111.56 ? 94   LEU A N   1 
ATOM   1171 C CA  . LEU A 1 170 ? 71.175  -12.003 37.380  1.00 113.32 ? 94   LEU A CA  1 
ATOM   1172 C C   . LEU A 1 170 ? 72.043  -13.264 37.425  1.00 118.69 ? 94   LEU A C   1 
ATOM   1173 O O   . LEU A 1 170 ? 72.556  -13.608 38.490  1.00 119.50 ? 94   LEU A O   1 
ATOM   1174 C CB  . LEU A 1 170 ? 69.743  -12.334 37.835  1.00 114.22 ? 94   LEU A CB  1 
ATOM   1175 C CG  . LEU A 1 170 ? 68.807  -11.144 38.082  1.00 118.09 ? 94   LEU A CG  1 
ATOM   1176 C CD1 . LEU A 1 170 ? 67.381  -11.563 38.026  1.00 118.96 ? 94   LEU A CD1 1 
ATOM   1177 C CD2 . LEU A 1 170 ? 69.140  -10.415 39.383  1.00 121.08 ? 94   LEU A CD2 1 
ATOM   1178 N N   . ALA A 1 171 ? 72.243  -13.922 36.262  1.00 115.20 ? 95   ALA A N   1 
ATOM   1179 C CA  . ALA A 1 171 ? 73.063  -15.127 36.121  1.00 116.27 ? 95   ALA A CA  1 
ATOM   1180 C C   . ALA A 1 171 ? 74.581  -14.830 36.325  1.00 120.68 ? 95   ALA A C   1 
ATOM   1181 O O   . ALA A 1 171 ? 75.357  -15.774 36.490  1.00 121.55 ? 95   ALA A O   1 
ATOM   1182 C CB  . ALA A 1 171 ? 72.838  -15.744 34.746  1.00 116.28 ? 95   ALA A CB  1 
ATOM   1183 N N   . THR A 1 172 ? 74.998  -13.539 36.325  1.00 116.42 ? 96   THR A N   1 
ATOM   1184 C CA  . THR A 1 172 ? 76.413  -13.168 36.512  1.00 116.38 ? 96   THR A CA  1 
ATOM   1185 C C   . THR A 1 172 ? 76.738  -12.912 38.007  1.00 122.38 ? 96   THR A C   1 
ATOM   1186 O O   . THR A 1 172 ? 77.919  -12.870 38.361  1.00 122.93 ? 96   THR A O   1 
ATOM   1187 C CB  . THR A 1 172 ? 76.789  -11.926 35.679  1.00 117.59 ? 96   THR A CB  1 
ATOM   1188 O OG1 . THR A 1 172 ? 76.025  -10.801 36.116  1.00 114.76 ? 96   THR A OG1 1 
ATOM   1189 C CG2 . THR A 1 172 ? 76.624  -12.143 34.177  1.00 112.35 ? 96   THR A CG2 1 
ATOM   1190 N N   . LEU A 1 173 ? 75.699  -12.764 38.876  1.00 119.70 ? 97   LEU A N   1 
ATOM   1191 C CA  . LEU A 1 173 ? 75.852  -12.515 40.320  1.00 121.18 ? 97   LEU A CA  1 
ATOM   1192 C C   . LEU A 1 173 ? 76.765  -13.572 41.005  1.00 128.03 ? 97   LEU A C   1 
ATOM   1193 O O   . LEU A 1 173 ? 77.619  -13.140 41.785  1.00 128.76 ? 97   LEU A O   1 
ATOM   1194 C CB  . LEU A 1 173 ? 74.498  -12.467 41.045  1.00 121.49 ? 97   LEU A CB  1 
ATOM   1195 C CG  . LEU A 1 173 ? 73.722  -11.157 40.900  1.00 124.51 ? 97   LEU A CG  1 
ATOM   1196 C CD1 . LEU A 1 173 ? 72.315  -11.291 41.410  1.00 125.04 ? 97   LEU A CD1 1 
ATOM   1197 C CD2 . LEU A 1 173 ? 74.419  -10.023 41.631  1.00 127.33 ? 97   LEU A CD2 1 
ATOM   1198 N N   . PRO A 1 174 ? 76.701  -14.908 40.707  1.00 125.91 ? 98   PRO A N   1 
ATOM   1199 C CA  . PRO A 1 174 ? 77.639  -15.840 41.371  1.00 128.14 ? 98   PRO A CA  1 
ATOM   1200 C C   . PRO A 1 174 ? 79.118  -15.495 41.101  1.00 133.03 ? 98   PRO A C   1 
ATOM   1201 O O   . PRO A 1 174 ? 79.957  -15.775 41.956  1.00 134.81 ? 98   PRO A O   1 
ATOM   1202 C CB  . PRO A 1 174 ? 77.283  -17.197 40.757  1.00 130.20 ? 98   PRO A CB  1 
ATOM   1203 C CG  . PRO A 1 174 ? 75.870  -17.055 40.323  1.00 133.25 ? 98   PRO A CG  1 
ATOM   1204 C CD  . PRO A 1 174 ? 75.760  -15.645 39.834  1.00 126.66 ? 98   PRO A CD  1 
ATOM   1205 N N   . LEU A 1 175 ? 79.427  -14.857 39.943  1.00 128.01 ? 99   LEU A N   1 
ATOM   1206 C CA  . LEU A 1 175 ? 80.791  -14.444 39.586  1.00 128.12 ? 99   LEU A CA  1 
ATOM   1207 C C   . LEU A 1 175 ? 81.278  -13.275 40.433  1.00 133.50 ? 99   LEU A C   1 
ATOM   1208 O O   . LEU A 1 175 ? 82.407  -13.321 40.924  1.00 134.61 ? 99   LEU A O   1 
ATOM   1209 C CB  . LEU A 1 175 ? 80.900  -14.044 38.102  1.00 126.04 ? 99   LEU A CB  1 
ATOM   1210 C CG  . LEU A 1 175 ? 80.716  -15.120 37.049  1.00 130.22 ? 99   LEU A CG  1 
ATOM   1211 C CD1 . LEU A 1 175 ? 80.653  -14.500 35.671  1.00 128.31 ? 99   LEU A CD1 1 
ATOM   1212 C CD2 . LEU A 1 175 ? 81.844  -16.153 37.110  1.00 134.41 ? 99   LEU A CD2 1 
ATOM   1213 N N   . TRP A 1 176 ? 80.452  -12.209 40.573  1.00 129.81 ? 100  TRP A N   1 
ATOM   1214 C CA  . TRP A 1 176 ? 80.850  -10.997 41.297  1.00 130.66 ? 100  TRP A CA  1 
ATOM   1215 C C   . TRP A 1 176 ? 80.936  -11.277 42.793  1.00 137.63 ? 100  TRP A C   1 
ATOM   1216 O O   . TRP A 1 176 ? 81.791  -10.698 43.458  1.00 139.16 ? 100  TRP A O   1 
ATOM   1217 C CB  . TRP A 1 176 ? 79.898  -9.815  41.029  1.00 127.76 ? 100  TRP A CB  1 
ATOM   1218 C CG  . TRP A 1 176 ? 79.516  -9.627  39.581  1.00 126.64 ? 100  TRP A CG  1 
ATOM   1219 C CD1 . TRP A 1 176 ? 78.249  -9.602  39.078  1.00 128.08 ? 100  TRP A CD1 1 
ATOM   1220 C CD2 . TRP A 1 176 ? 80.394  -9.693  38.441  1.00 125.82 ? 100  TRP A CD2 1 
ATOM   1221 N NE1 . TRP A 1 176 ? 78.285  -9.504  37.706  1.00 125.86 ? 100  TRP A NE1 1 
ATOM   1222 C CE2 . TRP A 1 176 ? 79.587  -9.596  37.285  1.00 127.81 ? 100  TRP A CE2 1 
ATOM   1223 C CE3 . TRP A 1 176 ? 81.789  -9.797  38.284  1.00 128.10 ? 100  TRP A CE3 1 
ATOM   1224 C CZ2 . TRP A 1 176 ? 80.126  -9.590  35.990  1.00 126.14 ? 100  TRP A CZ2 1 
ATOM   1225 C CZ3 . TRP A 1 176 ? 82.320  -9.799  37.003  1.00 128.58 ? 100  TRP A CZ3 1 
ATOM   1226 C CH2 . TRP A 1 176 ? 81.495  -9.683  35.874  1.00 127.14 ? 100  TRP A CH2 1 
ATOM   1227 N N   . ALA A 1 177 ? 80.101  -12.199 43.313  1.00 134.86 ? 101  ALA A N   1 
ATOM   1228 C CA  . ALA A 1 177 ? 80.154  -12.599 44.721  1.00 137.10 ? 101  ALA A CA  1 
ATOM   1229 C C   . ALA A 1 177 ? 81.452  -13.371 45.013  1.00 142.92 ? 101  ALA A C   1 
ATOM   1230 O O   . ALA A 1 177 ? 82.070  -13.141 46.051  1.00 144.42 ? 101  ALA A O   1 
ATOM   1231 C CB  . ALA A 1 177 ? 78.940  -13.440 45.077  1.00 138.13 ? 101  ALA A CB  1 
ATOM   1232 N N   . THR A 1 178 ? 81.884  -14.246 44.066  1.00 139.00 ? 102  THR A N   1 
ATOM   1233 C CA  . THR A 1 178 ? 83.119  -15.040 44.158  1.00 140.60 ? 102  THR A CA  1 
ATOM   1234 C C   . THR A 1 178 ? 84.332  -14.098 44.040  1.00 145.31 ? 102  THR A C   1 
ATOM   1235 O O   . THR A 1 178 ? 85.244  -14.178 44.859  1.00 146.99 ? 102  THR A O   1 
ATOM   1236 C CB  . THR A 1 178 ? 83.129  -16.143 43.076  1.00 145.84 ? 102  THR A CB  1 
ATOM   1237 O OG1 . THR A 1 178 ? 81.994  -16.992 43.261  1.00 144.76 ? 102  THR A OG1 1 
ATOM   1238 C CG2 . THR A 1 178 ? 84.389  -16.987 43.109  1.00 146.16 ? 102  THR A CG2 1 
ATOM   1239 N N   . TYR A 1 179 ? 84.313  -13.188 43.043  1.00 140.66 ? 103  TYR A N   1 
ATOM   1240 C CA  . TYR A 1 179 ? 85.364  -12.192 42.792  1.00 141.11 ? 103  TYR A CA  1 
ATOM   1241 C C   . TYR A 1 179 ? 85.528  -11.276 44.027  1.00 146.82 ? 103  TYR A C   1 
ATOM   1242 O O   . TYR A 1 179 ? 86.660  -11.005 44.425  1.00 148.09 ? 103  TYR A O   1 
ATOM   1243 C CB  . TYR A 1 179 ? 85.019  -11.386 41.523  1.00 139.68 ? 103  TYR A CB  1 
ATOM   1244 C CG  . TYR A 1 179 ? 85.971  -10.264 41.149  1.00 141.63 ? 103  TYR A CG  1 
ATOM   1245 C CD1 . TYR A 1 179 ? 87.282  -10.535 40.765  1.00 145.10 ? 103  TYR A CD1 1 
ATOM   1246 C CD2 . TYR A 1 179 ? 85.505  -8.966  40.968  1.00 140.81 ? 103  TYR A CD2 1 
ATOM   1247 C CE1 . TYR A 1 179 ? 88.142  -9.516  40.346  1.00 146.31 ? 103  TYR A CE1 1 
ATOM   1248 C CE2 . TYR A 1 179 ? 86.348  -7.944  40.530  1.00 141.66 ? 103  TYR A CE2 1 
ATOM   1249 C CZ  . TYR A 1 179 ? 87.666  -8.221  40.225  1.00 150.42 ? 103  TYR A CZ  1 
ATOM   1250 O OH  . TYR A 1 179 ? 88.492  -7.209  39.796  1.00 150.87 ? 103  TYR A OH  1 
ATOM   1251 N N   . TYR A 1 180 ? 84.408  -10.875 44.673  1.00 143.25 ? 104  TYR A N   1 
ATOM   1252 C CA  . TYR A 1 180 ? 84.436  -10.055 45.891  1.00 144.85 ? 104  TYR A CA  1 
ATOM   1253 C C   . TYR A 1 180 ? 84.996  -10.869 47.075  1.00 152.66 ? 104  TYR A C   1 
ATOM   1254 O O   . TYR A 1 180 ? 85.747  -10.314 47.882  1.00 154.17 ? 104  TYR A O   1 
ATOM   1255 C CB  . TYR A 1 180 ? 83.032  -9.518  46.224  1.00 144.49 ? 104  TYR A CB  1 
ATOM   1256 C CG  . TYR A 1 180 ? 82.983  -8.585  47.418  1.00 147.46 ? 104  TYR A CG  1 
ATOM   1257 C CD1 . TYR A 1 180 ? 83.118  -7.211  47.259  1.00 148.73 ? 104  TYR A CD1 1 
ATOM   1258 C CD2 . TYR A 1 180 ? 82.744  -9.072  48.700  1.00 150.28 ? 104  TYR A CD2 1 
ATOM   1259 C CE1 . TYR A 1 180 ? 83.049  -6.344  48.351  1.00 150.82 ? 104  TYR A CE1 1 
ATOM   1260 C CE2 . TYR A 1 180 ? 82.688  -8.217  49.801  1.00 152.66 ? 104  TYR A CE2 1 
ATOM   1261 C CZ  . TYR A 1 180 ? 82.828  -6.852  49.621  1.00 159.20 ? 104  TYR A CZ  1 
ATOM   1262 O OH  . TYR A 1 180 ? 82.760  -6.006  50.704  1.00 161.55 ? 104  TYR A OH  1 
ATOM   1263 N N   . SER A 1 181 ? 84.626  -12.178 47.174  1.00 150.40 ? 105  SER A N   1 
ATOM   1264 C CA  . SER A 1 181 ? 85.068  -13.092 48.242  1.00 153.44 ? 105  SER A CA  1 
ATOM   1265 C C   . SER A 1 181 ? 86.588  -13.288 48.236  1.00 159.91 ? 105  SER A C   1 
ATOM   1266 O O   . SER A 1 181 ? 87.192  -13.341 49.309  1.00 162.62 ? 105  SER A O   1 
ATOM   1267 C CB  . SER A 1 181 ? 84.390  -14.453 48.114  1.00 156.88 ? 105  SER A CB  1 
ATOM   1268 O OG  . SER A 1 181 ? 82.987  -14.361 48.299  1.00 163.94 ? 105  SER A OG  1 
ATOM   1269 N N   . TYR A 1 182 ? 87.204  -13.388 47.040  1.00 155.21 ? 106  TYR A N   1 
ATOM   1270 C CA  . TYR A 1 182 ? 88.651  -13.560 46.910  1.00 157.05 ? 106  TYR A CA  1 
ATOM   1271 C C   . TYR A 1 182 ? 89.374  -12.186 46.911  1.00 160.87 ? 106  TYR A C   1 
ATOM   1272 O O   . TYR A 1 182 ? 90.498  -12.087 46.418  1.00 161.78 ? 106  TYR A O   1 
ATOM   1273 C CB  . TYR A 1 182 ? 89.002  -14.359 45.637  1.00 157.57 ? 106  TYR A CB  1 
ATOM   1274 C CG  . TYR A 1 182 ? 88.655  -15.830 45.733  1.00 160.50 ? 106  TYR A CG  1 
ATOM   1275 C CD1 . TYR A 1 182 ? 89.527  -16.734 46.338  1.00 165.51 ? 106  TYR A CD1 1 
ATOM   1276 C CD2 . TYR A 1 182 ? 87.488  -16.332 45.167  1.00 159.25 ? 106  TYR A CD2 1 
ATOM   1277 C CE1 . TYR A 1 182 ? 89.217  -18.090 46.426  1.00 167.25 ? 106  TYR A CE1 1 
ATOM   1278 C CE2 . TYR A 1 182 ? 87.169  -17.687 45.247  1.00 160.96 ? 106  TYR A CE2 1 
ATOM   1279 C CZ  . TYR A 1 182 ? 88.039  -18.564 45.873  1.00 171.34 ? 106  TYR A CZ  1 
ATOM   1280 O OH  . TYR A 1 182 ? 87.734  -19.902 45.951  1.00 173.31 ? 106  TYR A OH  1 
ATOM   1281 N N   . ARG A 1 183 ? 88.751  -11.156 47.542  1.00 156.49 ? 107  ARG A N   1 
ATOM   1282 C CA  . ARG A 1 183 ? 89.251  -9.778  47.695  1.00 156.64 ? 107  ARG A CA  1 
ATOM   1283 C C   . ARG A 1 183 ? 89.749  -9.227  46.339  1.00 158.70 ? 107  ARG A C   1 
ATOM   1284 O O   . ARG A 1 183 ? 90.876  -8.742  46.230  1.00 159.97 ? 107  ARG A O   1 
ATOM   1285 C CB  . ARG A 1 183 ? 90.365  -9.702  48.758  1.00 160.68 ? 107  ARG A CB  1 
ATOM   1286 N N   . TYR A 1 184 ? 88.873  -9.315  45.317  1.00 151.90 ? 108  TYR A N   1 
ATOM   1287 C CA  . TYR A 1 184 ? 89.039  -8.849  43.936  1.00 149.46 ? 108  TYR A CA  1 
ATOM   1288 C C   . TYR A 1 184 ? 90.251  -9.538  43.262  1.00 154.86 ? 108  TYR A C   1 
ATOM   1289 O O   . TYR A 1 184 ? 91.069  -8.877  42.611  1.00 154.59 ? 108  TYR A O   1 
ATOM   1290 C CB  . TYR A 1 184 ? 89.174  -7.318  43.872  1.00 150.10 ? 108  TYR A CB  1 
ATOM   1291 C CG  . TYR A 1 184 ? 87.958  -6.615  44.420  1.00 150.29 ? 108  TYR A CG  1 
ATOM   1292 C CD1 . TYR A 1 184 ? 86.802  -6.490  43.662  1.00 149.37 ? 108  TYR A CD1 1 
ATOM   1293 C CD2 . TYR A 1 184 ? 87.962  -6.071  45.701  1.00 152.90 ? 108  TYR A CD2 1 
ATOM   1294 C CE1 . TYR A 1 184 ? 85.672  -5.865  44.170  1.00 149.10 ? 108  TYR A CE1 1 
ATOM   1295 C CE2 . TYR A 1 184 ? 86.843  -5.425  46.212  1.00 152.79 ? 108  TYR A CE2 1 
ATOM   1296 C CZ  . TYR A 1 184 ? 85.700  -5.324  45.442  1.00 157.22 ? 108  TYR A CZ  1 
ATOM   1297 O OH  . TYR A 1 184 ? 84.599  -4.687  45.935  1.00 157.73 ? 108  TYR A OH  1 
ATOM   1298 N N   . ASP A 1 185 ? 90.302  -10.886 43.363  1.00 152.37 ? 109  ASP A N   1 
ATOM   1299 C CA  . ASP A 1 185 ? 91.309  -11.709 42.698  1.00 153.15 ? 109  ASP A CA  1 
ATOM   1300 C C   . ASP A 1 185 ? 90.617  -12.525 41.621  1.00 154.35 ? 109  ASP A C   1 
ATOM   1301 O O   . ASP A 1 185 ? 89.966  -13.533 41.922  1.00 153.81 ? 109  ASP A O   1 
ATOM   1302 C CB  . ASP A 1 185 ? 92.073  -12.603 43.695  1.00 158.33 ? 109  ASP A CB  1 
ATOM   1303 C CG  . ASP A 1 185 ? 93.347  -13.232 43.149  1.00 171.66 ? 109  ASP A CG  1 
ATOM   1304 O OD1 . ASP A 1 185 ? 93.849  -12.756 42.103  1.00 171.14 ? 109  ASP A OD1 1 
ATOM   1305 O OD2 . ASP A 1 185 ? 93.914  -14.102 43.835  1.00 181.05 ? 109  ASP A OD2 1 
ATOM   1306 N N   . TRP A 1 186 ? 90.687  -12.038 40.372  1.00 148.64 ? 110  TRP A N   1 
ATOM   1307 C CA  . TRP A 1 186 ? 90.051  -12.678 39.230  1.00 145.97 ? 110  TRP A CA  1 
ATOM   1308 C C   . TRP A 1 186 ? 90.784  -13.989 38.916  1.00 151.29 ? 110  TRP A C   1 
ATOM   1309 O O   . TRP A 1 186 ? 91.946  -13.971 38.494  1.00 151.78 ? 110  TRP A O   1 
ATOM   1310 C CB  . TRP A 1 186 ? 90.034  -11.725 38.025  1.00 142.48 ? 110  TRP A CB  1 
ATOM   1311 C CG  . TRP A 1 186 ? 89.225  -12.228 36.868  1.00 140.85 ? 110  TRP A CG  1 
ATOM   1312 C CD1 . TRP A 1 186 ? 89.672  -12.963 35.811  1.00 143.49 ? 110  TRP A CD1 1 
ATOM   1313 C CD2 . TRP A 1 186 ? 87.810  -12.087 36.690  1.00 138.42 ? 110  TRP A CD2 1 
ATOM   1314 N NE1 . TRP A 1 186 ? 88.629  -13.256 34.964  1.00 140.73 ? 110  TRP A NE1 1 
ATOM   1315 C CE2 . TRP A 1 186 ? 87.473  -12.734 35.481  1.00 140.87 ? 110  TRP A CE2 1 
ATOM   1316 C CE3 . TRP A 1 186 ? 86.790  -11.473 37.436  1.00 138.89 ? 110  TRP A CE3 1 
ATOM   1317 C CZ2 . TRP A 1 186 ? 86.158  -12.782 34.997  1.00 138.00 ? 110  TRP A CZ2 1 
ATOM   1318 C CZ3 . TRP A 1 186 ? 85.490  -11.514 36.954  1.00 138.22 ? 110  TRP A CZ3 1 
ATOM   1319 C CH2 . TRP A 1 186 ? 85.183  -12.162 35.748  1.00 137.50 ? 110  TRP A CH2 1 
ATOM   1320 N N   . LEU A 1 187 ? 90.114  -15.124 39.199  1.00 148.42 ? 111  LEU A N   1 
ATOM   1321 C CA  . LEU A 1 187 ? 90.651  -16.476 39.013  1.00 150.15 ? 111  LEU A CA  1 
ATOM   1322 C C   . LEU A 1 187 ? 89.935  -17.210 37.854  1.00 152.64 ? 111  LEU A C   1 
ATOM   1323 O O   . LEU A 1 187 ? 89.714  -18.421 37.934  1.00 153.07 ? 111  LEU A O   1 
ATOM   1324 C CB  . LEU A 1 187 ? 90.497  -17.276 40.332  1.00 152.51 ? 111  LEU A CB  1 
ATOM   1325 C CG  . LEU A 1 187 ? 91.223  -16.739 41.592  1.00 159.86 ? 111  LEU A CG  1 
ATOM   1326 C CD1 . LEU A 1 187 ? 90.727  -17.436 42.844  1.00 161.73 ? 111  LEU A CD1 1 
ATOM   1327 C CD2 . LEU A 1 187 ? 92.747  -16.844 41.469  1.00 164.70 ? 111  LEU A CD2 1 
ATOM   1328 N N   . PHE A 1 188 ? 89.603  -16.479 36.766  1.00 147.20 ? 112  PHE A N   1 
ATOM   1329 C CA  . PHE A 1 188 ? 88.890  -17.041 35.613  1.00 145.24 ? 112  PHE A CA  1 
ATOM   1330 C C   . PHE A 1 188 ? 89.609  -16.743 34.264  1.00 146.55 ? 112  PHE A C   1 
ATOM   1331 O O   . PHE A 1 188 ? 89.089  -17.095 33.199  1.00 144.39 ? 112  PHE A O   1 
ATOM   1332 C CB  . PHE A 1 188 ? 87.455  -16.479 35.557  1.00 145.18 ? 112  PHE A CB  1 
ATOM   1333 C CG  . PHE A 1 188 ? 86.582  -16.801 36.748  1.00 147.90 ? 112  PHE A CG  1 
ATOM   1334 C CD1 . PHE A 1 188 ? 85.802  -17.951 36.768  1.00 151.69 ? 112  PHE A CD1 1 
ATOM   1335 C CD2 . PHE A 1 188 ? 86.493  -15.924 37.825  1.00 150.99 ? 112  PHE A CD2 1 
ATOM   1336 C CE1 . PHE A 1 188 ? 84.973  -18.236 37.859  1.00 153.58 ? 112  PHE A CE1 1 
ATOM   1337 C CE2 . PHE A 1 188 ? 85.661  -16.209 38.917  1.00 154.70 ? 112  PHE A CE2 1 
ATOM   1338 C CZ  . PHE A 1 188 ? 84.905  -17.361 38.925  1.00 153.12 ? 112  PHE A CZ  1 
ATOM   1339 N N   . GLY A 1 189 ? 90.785  -16.120 34.325  1.00 143.06 ? 113  GLY A N   1 
ATOM   1340 C CA  . GLY A 1 189 ? 91.551  -15.777 33.131  1.00 142.05 ? 113  GLY A CA  1 
ATOM   1341 C C   . GLY A 1 189 ? 91.168  -14.429 32.547  1.00 143.02 ? 113  GLY A C   1 
ATOM   1342 O O   . GLY A 1 189 ? 90.019  -14.006 32.682  1.00 140.60 ? 113  GLY A O   1 
ATOM   1343 N N   . PRO A 1 190 ? 92.098  -13.732 31.847  1.00 139.86 ? 114  PRO A N   1 
ATOM   1344 C CA  . PRO A 1 190 ? 91.778  -12.391 31.324  1.00 137.85 ? 114  PRO A CA  1 
ATOM   1345 C C   . PRO A 1 190 ? 90.779  -12.402 30.153  1.00 139.28 ? 114  PRO A C   1 
ATOM   1346 O O   . PRO A 1 190 ? 90.232  -11.344 29.824  1.00 137.11 ? 114  PRO A O   1 
ATOM   1347 C CB  . PRO A 1 190 ? 93.137  -11.867 30.844  1.00 141.13 ? 114  PRO A CB  1 
ATOM   1348 C CG  . PRO A 1 190 ? 94.155  -12.726 31.519  1.00 148.62 ? 114  PRO A CG  1 
ATOM   1349 C CD  . PRO A 1 190 ? 93.513  -14.066 31.605  1.00 143.96 ? 114  PRO A CD  1 
ATOM   1350 N N   . VAL A 1 191 ? 90.534  -13.573 29.532  1.00 135.54 ? 115  VAL A N   1 
ATOM   1351 C CA  . VAL A 1 191 ? 89.594  -13.695 28.414  1.00 133.05 ? 115  VAL A CA  1 
ATOM   1352 C C   . VAL A 1 191 ? 88.155  -13.549 28.963  1.00 134.90 ? 115  VAL A C   1 
ATOM   1353 O O   . VAL A 1 191 ? 87.377  -12.769 28.412  1.00 132.16 ? 115  VAL A O   1 
ATOM   1354 C CB  . VAL A 1 191 ? 89.790  -15.021 27.621  1.00 137.83 ? 115  VAL A CB  1 
ATOM   1355 C CG1 . VAL A 1 191 ? 88.745  -15.173 26.513  1.00 135.59 ? 115  VAL A CG1 1 
ATOM   1356 C CG2 . VAL A 1 191 ? 91.199  -15.107 27.035  1.00 139.42 ? 115  VAL A CG2 1 
ATOM   1357 N N   . MET A 1 192 ? 87.835  -14.232 30.086  1.00 132.47 ? 116  MET A N   1 
ATOM   1358 C CA  . MET A 1 192 ? 86.502  -14.164 30.697  1.00 130.99 ? 116  MET A CA  1 
ATOM   1359 C C   . MET A 1 192 ? 86.278  -12.807 31.395  1.00 131.89 ? 116  MET A C   1 
ATOM   1360 O O   . MET A 1 192 ? 85.132  -12.466 31.691  1.00 130.63 ? 116  MET A O   1 
ATOM   1361 C CB  . MET A 1 192 ? 86.278  -15.307 31.686  1.00 135.34 ? 116  MET A CB  1 
ATOM   1362 C CG  . MET A 1 192 ? 86.282  -16.655 31.016  1.00 140.33 ? 116  MET A CG  1 
ATOM   1363 S SD  . MET A 1 192 ? 85.844  -18.015 32.116  1.00 147.38 ? 116  MET A SD  1 
ATOM   1364 C CE  . MET A 1 192 ? 86.192  -19.411 31.041  1.00 144.79 ? 116  MET A CE  1 
ATOM   1365 N N   . CYS A 1 193 ? 87.353  -12.023 31.616  1.00 127.19 ? 117  CYS A N   1 
ATOM   1366 C CA  . CYS A 1 193 ? 87.260  -10.665 32.159  1.00 125.45 ? 117  CYS A CA  1 
ATOM   1367 C C   . CYS A 1 193 ? 86.587  -9.767  31.101  1.00 126.61 ? 117  CYS A C   1 
ATOM   1368 O O   . CYS A 1 193 ? 85.691  -8.991  31.437  1.00 125.60 ? 117  CYS A O   1 
ATOM   1369 C CB  . CYS A 1 193 ? 88.642  -10.151 32.570  1.00 127.19 ? 117  CYS A CB  1 
ATOM   1370 S SG  . CYS A 1 193 ? 88.689  -8.416  33.096  1.00 130.51 ? 117  CYS A SG  1 
ATOM   1371 N N   . LYS A 1 194 ? 86.953  -9.958  29.808  1.00 121.46 ? 118  LYS A N   1 
ATOM   1372 C CA  . LYS A 1 194 ? 86.370  -9.230  28.674  1.00 118.73 ? 118  LYS A CA  1 
ATOM   1373 C C   . LYS A 1 194 ? 85.002  -9.785  28.276  1.00 121.74 ? 118  LYS A C   1 
ATOM   1374 O O   . LYS A 1 194 ? 84.122  -9.006  27.917  1.00 119.90 ? 118  LYS A O   1 
ATOM   1375 C CB  . LYS A 1 194 ? 87.288  -9.273  27.437  1.00 120.56 ? 118  LYS A CB  1 
ATOM   1376 C CG  . LYS A 1 194 ? 88.611  -8.556  27.588  1.00 127.52 ? 118  LYS A CG  1 
ATOM   1377 C CD  . LYS A 1 194 ? 89.396  -8.558  26.284  1.00 133.00 ? 118  LYS A CD  1 
ATOM   1378 C CE  . LYS A 1 194 ? 90.714  -7.820  26.368  1.00 141.58 ? 118  LYS A CE  1 
ATOM   1379 N NZ  . LYS A 1 194 ? 90.539  -6.369  26.647  1.00 146.68 ? 118  LYS A NZ  1 
ATOM   1380 N N   . VAL A 1 195 ? 84.840  -11.131 28.283  1.00 119.18 ? 119  VAL A N   1 
ATOM   1381 C CA  . VAL A 1 195 ? 83.614  -11.811 27.845  1.00 117.63 ? 119  VAL A CA  1 
ATOM   1382 C C   . VAL A 1 195 ? 82.474  -11.561 28.866  1.00 120.60 ? 119  VAL A C   1 
ATOM   1383 O O   . VAL A 1 195 ? 81.449  -11.003 28.470  1.00 118.65 ? 119  VAL A O   1 
ATOM   1384 C CB  . VAL A 1 195 ? 83.832  -13.333 27.610  1.00 122.56 ? 119  VAL A CB  1 
ATOM   1385 C CG1 . VAL A 1 195 ? 82.515  -14.042 27.294  1.00 121.45 ? 119  VAL A CG1 1 
ATOM   1386 C CG2 . VAL A 1 195 ? 84.844  -13.573 26.491  1.00 122.74 ? 119  VAL A CG2 1 
ATOM   1387 N N   . PHE A 1 196 ? 82.639  -11.958 30.151  1.00 118.57 ? 120  PHE A N   1 
ATOM   1388 C CA  . PHE A 1 196 ? 81.569  -11.769 31.144  1.00 118.18 ? 120  PHE A CA  1 
ATOM   1389 C C   . PHE A 1 196 ? 81.396  -10.290 31.502  1.00 119.55 ? 120  PHE A C   1 
ATOM   1390 O O   . PHE A 1 196 ? 80.284  -9.889  31.852  1.00 117.91 ? 120  PHE A O   1 
ATOM   1391 C CB  . PHE A 1 196 ? 81.802  -12.584 32.420  1.00 122.23 ? 120  PHE A CB  1 
ATOM   1392 C CG  . PHE A 1 196 ? 81.655  -14.066 32.184  1.00 125.04 ? 120  PHE A CG  1 
ATOM   1393 C CD1 . PHE A 1 196 ? 80.396  -14.636 31.992  1.00 128.00 ? 120  PHE A CD1 1 
ATOM   1394 C CD2 . PHE A 1 196 ? 82.764  -14.903 32.207  1.00 128.98 ? 120  PHE A CD2 1 
ATOM   1395 C CE1 . PHE A 1 196 ? 80.263  -16.007 31.767  1.00 130.13 ? 120  PHE A CE1 1 
ATOM   1396 C CE2 . PHE A 1 196 ? 82.629  -16.275 31.996  1.00 133.01 ? 120  PHE A CE2 1 
ATOM   1397 C CZ  . PHE A 1 196 ? 81.380  -16.819 31.780  1.00 130.78 ? 120  PHE A CZ  1 
ATOM   1398 N N   . GLY A 1 197 ? 82.460  -9.500  31.359  1.00 115.51 ? 121  GLY A N   1 
ATOM   1399 C CA  . GLY A 1 197 ? 82.404  -8.058  31.564  1.00 114.23 ? 121  GLY A CA  1 
ATOM   1400 C C   . GLY A 1 197 ? 81.454  -7.415  30.568  1.00 114.44 ? 121  GLY A C   1 
ATOM   1401 O O   . GLY A 1 197 ? 80.621  -6.593  30.955  1.00 113.10 ? 121  GLY A O   1 
ATOM   1402 N N   . SER A 1 198 ? 81.539  -7.831  29.278  1.00 108.88 ? 122  SER A N   1 
ATOM   1403 C CA  . SER A 1 198 ? 80.673  -7.343  28.198  1.00 106.21 ? 122  SER A CA  1 
ATOM   1404 C C   . SER A 1 198 ? 79.289  -7.990  28.246  1.00 108.84 ? 122  SER A C   1 
ATOM   1405 O O   . SER A 1 198 ? 78.318  -7.333  27.882  1.00 106.92 ? 122  SER A O   1 
ATOM   1406 C CB  . SER A 1 198 ? 81.302  -7.603  26.839  1.00 108.40 ? 122  SER A CB  1 
ATOM   1407 O OG  . SER A 1 198 ? 82.521  -6.893  26.741  1.00 117.55 ? 122  SER A OG  1 
ATOM   1408 N N   . PHE A 1 199 ? 79.198  -9.274  28.685  1.00 105.95 ? 123  PHE A N   1 
ATOM   1409 C CA  . PHE A 1 199 ? 77.929  -10.001 28.819  1.00 105.30 ? 123  PHE A CA  1 
ATOM   1410 C C   . PHE A 1 199 ? 77.059  -9.323  29.887  1.00 108.77 ? 123  PHE A C   1 
ATOM   1411 O O   . PHE A 1 199 ? 75.841  -9.236  29.724  1.00 108.06 ? 123  PHE A O   1 
ATOM   1412 C CB  . PHE A 1 199 ? 78.189  -11.482 29.162  1.00 108.54 ? 123  PHE A CB  1 
ATOM   1413 C CG  . PHE A 1 199 ? 76.959  -12.363 29.202  1.00 110.25 ? 123  PHE A CG  1 
ATOM   1414 C CD1 . PHE A 1 199 ? 76.440  -12.916 28.035  1.00 112.52 ? 123  PHE A CD1 1 
ATOM   1415 C CD2 . PHE A 1 199 ? 76.369  -12.709 30.414  1.00 113.87 ? 123  PHE A CD2 1 
ATOM   1416 C CE1 . PHE A 1 199 ? 75.315  -13.753 28.073  1.00 114.11 ? 123  PHE A CE1 1 
ATOM   1417 C CE2 . PHE A 1 199 ? 75.246  -13.551 30.452  1.00 117.33 ? 123  PHE A CE2 1 
ATOM   1418 C CZ  . PHE A 1 199 ? 74.727  -14.066 29.280  1.00 114.79 ? 123  PHE A CZ  1 
ATOM   1419 N N   . LEU A 1 200 ? 77.701  -8.810  30.955  1.00 105.68 ? 124  LEU A N   1 
ATOM   1420 C CA  . LEU A 1 200 ? 77.064  -8.056  32.034  1.00 105.48 ? 124  LEU A CA  1 
ATOM   1421 C C   . LEU A 1 200 ? 76.448  -6.758  31.508  1.00 108.16 ? 124  LEU A C   1 
ATOM   1422 O O   . LEU A 1 200 ? 75.271  -6.503  31.743  1.00 107.99 ? 124  LEU A O   1 
ATOM   1423 C CB  . LEU A 1 200 ? 78.106  -7.742  33.130  1.00 106.79 ? 124  LEU A CB  1 
ATOM   1424 C CG  . LEU A 1 200 ? 77.731  -6.706  34.196  1.00 111.38 ? 124  LEU A CG  1 
ATOM   1425 C CD1 . LEU A 1 200 ? 76.646  -7.223  35.125  1.00 112.37 ? 124  LEU A CD1 1 
ATOM   1426 C CD2 . LEU A 1 200 ? 78.942  -6.306  34.984  1.00 114.35 ? 124  LEU A CD2 1 
ATOM   1427 N N   . THR A 1 201 ? 77.261  -5.937  30.822  1.00 103.26 ? 125  THR A N   1 
ATOM   1428 C CA  . THR A 1 201 ? 76.879  -4.634  30.281  1.00 101.50 ? 125  THR A CA  1 
ATOM   1429 C C   . THR A 1 201 ? 75.820  -4.821  29.157  1.00 102.95 ? 125  THR A C   1 
ATOM   1430 O O   . THR A 1 201 ? 74.868  -4.040  29.099  1.00 101.58 ? 125  THR A O   1 
ATOM   1431 C CB  . THR A 1 201 ? 78.150  -3.924  29.781  1.00 110.55 ? 125  THR A CB  1 
ATOM   1432 O OG1 . THR A 1 201 ? 79.098  -3.886  30.848  1.00 112.47 ? 125  THR A OG1 1 
ATOM   1433 C CG2 . THR A 1 201 ? 77.893  -2.514  29.291  1.00 108.40 ? 125  THR A CG2 1 
ATOM   1434 N N   . LEU A 1 202 ? 75.970  -5.876  28.309  1.00 98.59  ? 126  LEU A N   1 
ATOM   1435 C CA  . LEU A 1 202 ? 75.061  -6.196  27.195  1.00 96.70  ? 126  LEU A CA  1 
ATOM   1436 C C   . LEU A 1 202 ? 73.634  -6.392  27.718  1.00 99.37  ? 126  LEU A C   1 
ATOM   1437 O O   . LEU A 1 202 ? 72.723  -5.692  27.276  1.00 98.39  ? 126  LEU A O   1 
ATOM   1438 C CB  . LEU A 1 202 ? 75.559  -7.468  26.457  1.00 97.01  ? 126  LEU A CB  1 
ATOM   1439 C CG  . LEU A 1 202 ? 74.921  -7.871  25.116  1.00 100.58 ? 126  LEU A CG  1 
ATOM   1440 C CD1 . LEU A 1 202 ? 75.745  -8.926  24.440  1.00 101.41 ? 126  LEU A CD1 1 
ATOM   1441 C CD2 . LEU A 1 202 ? 73.497  -8.369  25.271  1.00 102.69 ? 126  LEU A CD2 1 
ATOM   1442 N N   . ASN A 1 203 ? 73.451  -7.328  28.671  1.00 95.88  ? 127  ASN A N   1 
ATOM   1443 C CA  . ASN A 1 203 ? 72.146  -7.656  29.245  1.00 95.39  ? 127  ASN A CA  1 
ATOM   1444 C C   . ASN A 1 203 ? 71.658  -6.550  30.196  1.00 98.38  ? 127  ASN A C   1 
ATOM   1445 O O   . ASN A 1 203 ? 70.448  -6.428  30.377  1.00 98.11  ? 127  ASN A O   1 
ATOM   1446 C CB  . ASN A 1 203 ? 72.204  -8.988  29.970  1.00 95.88  ? 127  ASN A CB  1 
ATOM   1447 C CG  . ASN A 1 203 ? 72.456  -10.139 29.029  1.00 113.72 ? 127  ASN A CG  1 
ATOM   1448 O OD1 . ASN A 1 203 ? 71.681  -10.399 28.102  1.00 104.52 ? 127  ASN A OD1 1 
ATOM   1449 N ND2 . ASN A 1 203 ? 73.520  -10.880 29.270  1.00 108.27 ? 127  ASN A ND2 1 
ATOM   1450 N N   . MET A 1 204 ? 72.573  -5.731  30.775  1.00 94.45  ? 128  MET A N   1 
ATOM   1451 C CA  . MET A 1 204 ? 72.168  -4.600  31.620  1.00 93.84  ? 128  MET A CA  1 
ATOM   1452 C C   . MET A 1 204 ? 71.446  -3.564  30.773  1.00 96.93  ? 128  MET A C   1 
ATOM   1453 O O   . MET A 1 204 ? 70.356  -3.128  31.142  1.00 97.06  ? 128  MET A O   1 
ATOM   1454 C CB  . MET A 1 204 ? 73.358  -3.956  32.349  1.00 96.46  ? 128  MET A CB  1 
ATOM   1455 C CG  . MET A 1 204 ? 72.938  -2.786  33.222  1.00 100.01 ? 128  MET A CG  1 
ATOM   1456 S SD  . MET A 1 204 ? 74.278  -1.729  33.804  1.00 104.71 ? 128  MET A SD  1 
ATOM   1457 C CE  . MET A 1 204 ? 74.836  -1.023  32.272  1.00 99.95  ? 128  MET A CE  1 
ATOM   1458 N N   . PHE A 1 205 ? 72.055  -3.177  29.630  1.00 92.12  ? 129  PHE A N   1 
ATOM   1459 C CA  . PHE A 1 205 ? 71.457  -2.217  28.713  1.00 90.56  ? 129  PHE A CA  1 
ATOM   1460 C C   . PHE A 1 205 ? 70.253  -2.828  28.007  1.00 93.42  ? 129  PHE A C   1 
ATOM   1461 O O   . PHE A 1 205 ? 69.272  -2.117  27.813  1.00 92.80  ? 129  PHE A O   1 
ATOM   1462 C CB  . PHE A 1 205 ? 72.460  -1.686  27.684  1.00 91.55  ? 129  PHE A CB  1 
ATOM   1463 C CG  . PHE A 1 205 ? 73.387  -0.634  28.240  1.00 93.15  ? 129  PHE A CG  1 
ATOM   1464 C CD1 . PHE A 1 205 ? 72.921  0.643   28.526  1.00 95.83  ? 129  PHE A CD1 1 
ATOM   1465 C CD2 . PHE A 1 205 ? 74.744  -0.882  28.373  1.00 95.91  ? 129  PHE A CD2 1 
ATOM   1466 C CE1 . PHE A 1 205 ? 73.779  1.623   29.027  1.00 97.22  ? 129  PHE A CE1 1 
ATOM   1467 C CE2 . PHE A 1 205 ? 75.607  0.106   28.853  1.00 99.45  ? 129  PHE A CE2 1 
ATOM   1468 C CZ  . PHE A 1 205 ? 75.118  1.349   29.186  1.00 97.32  ? 129  PHE A CZ  1 
ATOM   1469 N N   . ALA A 1 206 ? 70.283  -4.138  27.684  1.00 89.94  ? 130  ALA A N   1 
ATOM   1470 C CA  . ALA A 1 206 ? 69.129  -4.792  27.057  1.00 90.09  ? 130  ALA A CA  1 
ATOM   1471 C C   . ALA A 1 206 ? 67.911  -4.729  27.991  1.00 96.27  ? 130  ALA A C   1 
ATOM   1472 O O   . ALA A 1 206 ? 66.796  -4.512  27.522  1.00 95.67  ? 130  ALA A O   1 
ATOM   1473 C CB  . ALA A 1 206 ? 69.460  -6.225  26.697  1.00 91.46  ? 130  ALA A CB  1 
ATOM   1474 N N   . SER A 1 207 ? 68.145  -4.813  29.320  1.00 94.79  ? 131  SER A N   1 
ATOM   1475 C CA  . SER A 1 207 ? 67.095  -4.686  30.332  1.00 95.81  ? 131  SER A CA  1 
ATOM   1476 C C   . SER A 1 207 ? 66.528  -3.261  30.348  1.00 98.83  ? 131  SER A C   1 
ATOM   1477 O O   . SER A 1 207 ? 65.325  -3.082  30.174  1.00 98.43  ? 131  SER A O   1 
ATOM   1478 C CB  . SER A 1 207 ? 67.631  -5.057  31.713  1.00 101.11 ? 131  SER A CB  1 
ATOM   1479 O OG  . SER A 1 207 ? 66.648  -4.893  32.722  1.00 111.75 ? 131  SER A OG  1 
ATOM   1480 N N   . ILE A 1 208 ? 67.414  -2.252  30.499  1.00 94.13  ? 132  ILE A N   1 
ATOM   1481 C CA  . ILE A 1 208 ? 67.070  -0.827  30.576  1.00 92.90  ? 132  ILE A CA  1 
ATOM   1482 C C   . ILE A 1 208 ? 66.374  -0.362  29.263  1.00 94.57  ? 132  ILE A C   1 
ATOM   1483 O O   . ILE A 1 208 ? 65.403  0.395   29.342  1.00 94.17  ? 132  ILE A O   1 
ATOM   1484 C CB  . ILE A 1 208 ? 68.352  0.018   30.871  1.00 95.71  ? 132  ILE A CB  1 
ATOM   1485 C CG1 . ILE A 1 208 ? 68.990  -0.413  32.227  1.00 97.48  ? 132  ILE A CG1 1 
ATOM   1486 C CG2 . ILE A 1 208 ? 68.039  1.516   30.885  1.00 95.79  ? 132  ILE A CG2 1 
ATOM   1487 C CD1 . ILE A 1 208 ? 70.341  0.221   32.577  1.00 104.59 ? 132  ILE A CD1 1 
ATOM   1488 N N   . PHE A 1 209 ? 66.844  -0.819  28.083  1.00 89.47  ? 133  PHE A N   1 
ATOM   1489 C CA  . PHE A 1 209 ? 66.247  -0.387  26.821  1.00 87.73  ? 133  PHE A CA  1 
ATOM   1490 C C   . PHE A 1 209 ? 64.883  -1.034  26.613  1.00 92.99  ? 133  PHE A C   1 
ATOM   1491 O O   . PHE A 1 209 ? 64.007  -0.372  26.058  1.00 92.98  ? 133  PHE A O   1 
ATOM   1492 C CB  . PHE A 1 209 ? 67.143  -0.673  25.609  1.00 88.16  ? 133  PHE A CB  1 
ATOM   1493 C CG  . PHE A 1 209 ? 68.521  -0.050  25.624  1.00 88.67  ? 133  PHE A CG  1 
ATOM   1494 C CD1 . PHE A 1 209 ? 68.717  1.233   26.121  1.00 91.59  ? 133  PHE A CD1 1 
ATOM   1495 C CD2 . PHE A 1 209 ? 69.584  -0.667  24.975  1.00 89.96  ? 133  PHE A CD2 1 
ATOM   1496 C CE1 . PHE A 1 209 ? 69.986  1.821   26.103  1.00 92.18  ? 133  PHE A CE1 1 
ATOM   1497 C CE2 . PHE A 1 209 ? 70.846  -0.066  24.927  1.00 92.36  ? 133  PHE A CE2 1 
ATOM   1498 C CZ  . PHE A 1 209 ? 71.040  1.172   25.491  1.00 90.52  ? 133  PHE A CZ  1 
ATOM   1499 N N   . PHE A 1 210 ? 64.670  -2.291  27.075  1.00 90.92  ? 134  PHE A N   1 
ATOM   1500 C CA  . PHE A 1 210 ? 63.347  -2.912  26.936  1.00 92.07  ? 134  PHE A CA  1 
ATOM   1501 C C   . PHE A 1 210 ? 62.361  -2.311  27.982  1.00 97.79  ? 134  PHE A C   1 
ATOM   1502 O O   . PHE A 1 210 ? 61.161  -2.263  27.704  1.00 98.04  ? 134  PHE A O   1 
ATOM   1503 C CB  . PHE A 1 210 ? 63.385  -4.446  27.030  1.00 94.83  ? 134  PHE A CB  1 
ATOM   1504 C CG  . PHE A 1 210 ? 63.868  -5.108  25.755  1.00 95.86  ? 134  PHE A CG  1 
ATOM   1505 C CD1 . PHE A 1 210 ? 63.074  -5.112  24.609  1.00 98.74  ? 134  PHE A CD1 1 
ATOM   1506 C CD2 . PHE A 1 210 ? 65.053  -5.836  25.735  1.00 97.66  ? 134  PHE A CD2 1 
ATOM   1507 C CE1 . PHE A 1 210 ? 63.513  -5.732  23.434  1.00 99.23  ? 134  PHE A CE1 1 
ATOM   1508 C CE2 . PHE A 1 210 ? 65.484  -6.472  24.566  1.00 100.11 ? 134  PHE A CE2 1 
ATOM   1509 C CZ  . PHE A 1 210 ? 64.710  -6.417  23.422  1.00 98.06  ? 134  PHE A CZ  1 
ATOM   1510 N N   . ILE A 1 211 ? 62.873  -1.784  29.127  1.00 95.18  ? 135  ILE A N   1 
ATOM   1511 C CA  . ILE A 1 211 ? 62.074  -1.044  30.128  1.00 95.89  ? 135  ILE A CA  1 
ATOM   1512 C C   . ILE A 1 211 ? 61.557  0.239   29.459  1.00 98.24  ? 135  ILE A C   1 
ATOM   1513 O O   . ILE A 1 211 ? 60.388  0.598   29.617  1.00 99.35  ? 135  ILE A O   1 
ATOM   1514 C CB  . ILE A 1 211 ? 62.901  -0.745  31.430  1.00 99.60  ? 135  ILE A CB  1 
ATOM   1515 C CG1 . ILE A 1 211 ? 63.204  -2.043  32.213  1.00 101.27 ? 135  ILE A CG1 1 
ATOM   1516 C CG2 . ILE A 1 211 ? 62.180  0.274   32.344  1.00 100.69 ? 135  ILE A CG2 1 
ATOM   1517 C CD1 . ILE A 1 211 ? 64.178  -1.889  33.392  1.00 108.29 ? 135  ILE A CD1 1 
ATOM   1518 N N   . THR A 1 212 ? 62.438  0.897   28.680  1.00 92.30  ? 136  THR A N   1 
ATOM   1519 C CA  . THR A 1 212 ? 62.161  2.123   27.936  1.00 90.87  ? 136  THR A CA  1 
ATOM   1520 C C   . THR A 1 212 ? 61.106  1.837   26.850  1.00 96.12  ? 136  THR A C   1 
ATOM   1521 O O   . THR A 1 212 ? 60.188  2.643   26.688  1.00 96.38  ? 136  THR A O   1 
ATOM   1522 C CB  . THR A 1 212 ? 63.465  2.676   27.344  1.00 89.35  ? 136  THR A CB  1 
ATOM   1523 O OG1 . THR A 1 212 ? 64.411  2.866   28.398  1.00 87.25  ? 136  THR A OG1 1 
ATOM   1524 C CG2 . THR A 1 212 ? 63.264  3.976   26.604  1.00 85.00  ? 136  THR A CG2 1 
ATOM   1525 N N   . CYS A 1 213 ? 61.212  0.680   26.141  1.00 92.80  ? 137  CYS A N   1 
ATOM   1526 C CA  . CYS A 1 213 ? 60.241  0.274   25.115  1.00 92.78  ? 137  CYS A CA  1 
ATOM   1527 C C   . CYS A 1 213 ? 58.856  0.130   25.733  1.00 97.94  ? 137  CYS A C   1 
ATOM   1528 O O   . CYS A 1 213 ? 57.892  0.629   25.155  1.00 97.99  ? 137  CYS A O   1 
ATOM   1529 C CB  . CYS A 1 213 ? 60.665  -1.019  24.426  1.00 93.19  ? 137  CYS A CB  1 
ATOM   1530 S SG  . CYS A 1 213 ? 62.083  -0.838  23.314  1.00 95.47  ? 137  CYS A SG  1 
ATOM   1531 N N   . MET A 1 214 ? 58.762  -0.524  26.913  1.00 95.69  ? 138  MET A N   1 
ATOM   1532 C CA  . MET A 1 214 ? 57.503  -0.738  27.642  1.00 97.23  ? 138  MET A CA  1 
ATOM   1533 C C   . MET A 1 214 ? 56.783  0.582   27.961  1.00 101.46 ? 138  MET A C   1 
ATOM   1534 O O   . MET A 1 214 ? 55.561  0.642   27.823  1.00 102.66 ? 138  MET A O   1 
ATOM   1535 C CB  . MET A 1 214 ? 57.732  -1.505  28.959  1.00 100.50 ? 138  MET A CB  1 
ATOM   1536 C CG  . MET A 1 214 ? 58.031  -2.990  28.780  1.00 104.53 ? 138  MET A CG  1 
ATOM   1537 S SD  . MET A 1 214 ? 56.729  -3.915  27.906  1.00 109.98 ? 138  MET A SD  1 
ATOM   1538 C CE  . MET A 1 214 ? 55.269  -3.521  28.923  1.00 108.63 ? 138  MET A CE  1 
ATOM   1539 N N   . SER A 1 215 ? 57.524  1.622   28.394  1.00 96.80  ? 139  SER A N   1 
ATOM   1540 C CA  . SER A 1 215 ? 56.936  2.919   28.732  1.00 96.89  ? 139  SER A CA  1 
ATOM   1541 C C   . SER A 1 215 ? 56.418  3.632   27.467  1.00 100.11 ? 139  SER A C   1 
ATOM   1542 O O   . SER A 1 215 ? 55.348  4.241   27.513  1.00 100.66 ? 139  SER A O   1 
ATOM   1543 C CB  . SER A 1 215 ? 57.946  3.797   29.465  1.00 99.65  ? 139  SER A CB  1 
ATOM   1544 O OG  . SER A 1 215 ? 58.309  3.212   30.707  1.00 108.12 ? 139  SER A OG  1 
ATOM   1545 N N   . VAL A 1 216 ? 57.153  3.516   26.340  1.00 95.25  ? 140  VAL A N   1 
ATOM   1546 C CA  . VAL A 1 216 ? 56.780  4.097   25.044  1.00 94.43  ? 140  VAL A CA  1 
ATOM   1547 C C   . VAL A 1 216 ? 55.544  3.344   24.496  1.00 100.14 ? 140  VAL A C   1 
ATOM   1548 O O   . VAL A 1 216 ? 54.649  3.980   23.934  1.00 99.98  ? 140  VAL A O   1 
ATOM   1549 C CB  . VAL A 1 216 ? 57.973  4.071   24.043  1.00 96.57  ? 140  VAL A CB  1 
ATOM   1550 C CG1 . VAL A 1 216 ? 57.546  4.502   22.639  1.00 95.99  ? 140  VAL A CG1 1 
ATOM   1551 C CG2 . VAL A 1 216 ? 59.134  4.936   24.541  1.00 95.32  ? 140  VAL A CG2 1 
ATOM   1552 N N   . ASP A 1 217 ? 55.486  2.004   24.704  1.00 98.47  ? 141  ASP A N   1 
ATOM   1553 C CA  . ASP A 1 217 ? 54.379  1.144   24.260  1.00 100.41 ? 141  ASP A CA  1 
ATOM   1554 C C   . ASP A 1 217 ? 53.102  1.441   25.072  1.00 107.20 ? 141  ASP A C   1 
ATOM   1555 O O   . ASP A 1 217 ? 52.035  1.623   24.477  1.00 107.61 ? 141  ASP A O   1 
ATOM   1556 C CB  . ASP A 1 217 ? 54.752  -0.348  24.378  1.00 102.69 ? 141  ASP A CB  1 
ATOM   1557 C CG  . ASP A 1 217 ? 53.700  -1.289  23.815  1.00 114.51 ? 141  ASP A CG  1 
ATOM   1558 O OD1 . ASP A 1 217 ? 53.588  -1.377  22.573  1.00 113.96 ? 141  ASP A OD1 1 
ATOM   1559 O OD2 . ASP A 1 217 ? 53.021  -1.971  24.616  1.00 123.75 ? 141  ASP A OD2 1 
ATOM   1560 N N   . ARG A 1 218 ? 53.218  1.499   26.423  1.00 105.17 ? 142  ARG A N   1 
ATOM   1561 C CA  . ARG A 1 218 ? 52.090  1.819   27.304  1.00 107.15 ? 142  ARG A CA  1 
ATOM   1562 C C   . ARG A 1 218 ? 51.560  3.225   27.023  1.00 111.89 ? 142  ARG A C   1 
ATOM   1563 O O   . ARG A 1 218 ? 50.346  3.417   27.063  1.00 113.60 ? 142  ARG A O   1 
ATOM   1564 C CB  . ARG A 1 218 ? 52.455  1.692   28.792  1.00 107.29 ? 142  ARG A CB  1 
ATOM   1565 C CG  . ARG A 1 218 ? 52.537  0.263   29.309  1.00 115.85 ? 142  ARG A CG  1 
ATOM   1566 C CD  . ARG A 1 218 ? 52.774  0.265   30.803  1.00 123.19 ? 142  ARG A CD  1 
ATOM   1567 N NE  . ARG A 1 218 ? 52.624  -1.066  31.389  1.00 132.39 ? 142  ARG A NE  1 
ATOM   1568 C CZ  . ARG A 1 218 ? 52.741  -1.328  32.688  1.00 148.31 ? 142  ARG A CZ  1 
ATOM   1569 N NH1 . ARG A 1 218 ? 53.020  -0.355  33.548  1.00 137.06 ? 142  ARG A NH1 1 
ATOM   1570 N NH2 . ARG A 1 218 ? 52.584  -2.566  33.136  1.00 135.72 ? 142  ARG A NH2 1 
ATOM   1571 N N   . TYR A 1 219 ? 52.457  4.196   26.714  1.00 106.80 ? 143  TYR A N   1 
ATOM   1572 C CA  . TYR A 1 219 ? 52.063  5.568   26.389  1.00 106.69 ? 143  TYR A CA  1 
ATOM   1573 C C   . TYR A 1 219 ? 51.279  5.595   25.076  1.00 111.73 ? 143  TYR A C   1 
ATOM   1574 O O   . TYR A 1 219 ? 50.214  6.206   25.027  1.00 112.86 ? 143  TYR A O   1 
ATOM   1575 C CB  . TYR A 1 219 ? 53.282  6.510   26.311  1.00 106.14 ? 143  TYR A CB  1 
ATOM   1576 C CG  . TYR A 1 219 ? 52.955  7.880   25.751  1.00 108.18 ? 143  TYR A CG  1 
ATOM   1577 C CD1 . TYR A 1 219 ? 52.274  8.824   26.515  1.00 111.26 ? 143  TYR A CD1 1 
ATOM   1578 C CD2 . TYR A 1 219 ? 53.368  8.249   24.474  1.00 108.15 ? 143  TYR A CD2 1 
ATOM   1579 C CE1 . TYR A 1 219 ? 51.947  10.075  25.994  1.00 112.52 ? 143  TYR A CE1 1 
ATOM   1580 C CE2 . TYR A 1 219 ? 53.065  9.505   23.950  1.00 109.09 ? 143  TYR A CE2 1 
ATOM   1581 C CZ  . TYR A 1 219 ? 52.359  10.418  24.717  1.00 118.34 ? 143  TYR A CZ  1 
ATOM   1582 O OH  . TYR A 1 219 ? 52.055  11.659  24.213  1.00 119.84 ? 143  TYR A OH  1 
ATOM   1583 N N   . GLN A 1 220 ? 51.781  4.897   24.039  1.00 107.72 ? 144  GLN A N   1 
ATOM   1584 C CA  . GLN A 1 220 ? 51.162  4.816   22.712  1.00 107.97 ? 144  GLN A CA  1 
ATOM   1585 C C   . GLN A 1 220 ? 49.792  4.084   22.798  1.00 115.58 ? 144  GLN A C   1 
ATOM   1586 O O   . GLN A 1 220 ? 48.923  4.316   21.955  1.00 115.98 ? 144  GLN A O   1 
ATOM   1587 C CB  . GLN A 1 220 ? 52.123  4.099   21.748  1.00 107.57 ? 144  GLN A CB  1 
ATOM   1588 C CG  . GLN A 1 220 ? 51.753  4.181   20.268  1.00 110.54 ? 144  GLN A CG  1 
ATOM   1589 C CD  . GLN A 1 220 ? 52.816  3.597   19.356  1.00 123.05 ? 144  GLN A CD  1 
ATOM   1590 O OE1 . GLN A 1 220 ? 52.813  3.839   18.151  1.00 117.18 ? 144  GLN A OE1 1 
ATOM   1591 N NE2 . GLN A 1 220 ? 53.798  2.888   19.906  1.00 115.15 ? 144  GLN A NE2 1 
ATOM   1592 N N   . SER A 1 221 ? 49.596  3.244   23.840  1.00 114.50 ? 145  SER A N   1 
ATOM   1593 C CA  . SER A 1 221 ? 48.343  2.525   24.098  1.00 117.51 ? 145  SER A CA  1 
ATOM   1594 C C   . SER A 1 221 ? 47.312  3.430   24.783  1.00 123.42 ? 145  SER A C   1 
ATOM   1595 O O   . SER A 1 221 ? 46.112  3.223   24.612  1.00 125.33 ? 145  SER A O   1 
ATOM   1596 C CB  . SER A 1 221 ? 48.599  1.293   24.963  1.00 122.42 ? 145  SER A CB  1 
ATOM   1597 O OG  . SER A 1 221 ? 49.487  0.389   24.326  1.00 131.77 ? 145  SER A OG  1 
ATOM   1598 N N   . VAL A 1 222 ? 47.783  4.418   25.568  1.00 119.25 ? 146  VAL A N   1 
ATOM   1599 C CA  . VAL A 1 222 ? 46.929  5.357   26.295  1.00 120.56 ? 146  VAL A CA  1 
ATOM   1600 C C   . VAL A 1 222 ? 46.477  6.492   25.342  1.00 125.55 ? 146  VAL A C   1 
ATOM   1601 O O   . VAL A 1 222 ? 45.272  6.674   25.167  1.00 127.14 ? 146  VAL A O   1 
ATOM   1602 C CB  . VAL A 1 222 ? 47.639  5.920   27.560  1.00 123.28 ? 146  VAL A CB  1 
ATOM   1603 C CG1 . VAL A 1 222 ? 46.851  7.069   28.182  1.00 124.19 ? 146  VAL A CG1 1 
ATOM   1604 C CG2 . VAL A 1 222 ? 47.886  4.820   28.590  1.00 123.62 ? 146  VAL A CG2 1 
ATOM   1605 N N   . ILE A 1 223 ? 47.432  7.242   24.737  1.00 121.05 ? 147  ILE A N   1 
ATOM   1606 C CA  . ILE A 1 223 ? 47.147  8.384   23.855  1.00 121.21 ? 147  ILE A CA  1 
ATOM   1607 C C   . ILE A 1 223 ? 46.385  7.880   22.572  1.00 126.98 ? 147  ILE A C   1 
ATOM   1608 O O   . ILE A 1 223 ? 45.439  8.553   22.150  1.00 127.96 ? 147  ILE A O   1 
ATOM   1609 C CB  . ILE A 1 223 ? 48.450  9.189   23.497  1.00 122.17 ? 147  ILE A CB  1 
ATOM   1610 C CG1 . ILE A 1 223 ? 48.161  10.479  22.679  1.00 122.93 ? 147  ILE A CG1 1 
ATOM   1611 C CG2 . ILE A 1 223 ? 49.534  8.347   22.826  1.00 121.45 ? 147  ILE A CG2 1 
ATOM   1612 C CD1 . ILE A 1 223 ? 47.376  11.600  23.413  1.00 135.23 ? 147  ILE A CD1 1 
ATOM   1613 N N   . TYR A 1 224 ? 46.744  6.697   22.012  1.00 123.80 ? 148  TYR A N   1 
ATOM   1614 C CA  . TYR A 1 224 ? 46.043  6.127   20.847  1.00 125.13 ? 148  TYR A CA  1 
ATOM   1615 C C   . TYR A 1 224 ? 45.428  4.760   21.234  1.00 132.85 ? 148  TYR A C   1 
ATOM   1616 O O   . TYR A 1 224 ? 46.130  3.742   21.191  1.00 131.84 ? 148  TYR A O   1 
ATOM   1617 C CB  . TYR A 1 224 ? 46.971  5.993   19.618  1.00 124.13 ? 148  TYR A CB  1 
ATOM   1618 C CG  . TYR A 1 224 ? 47.629  7.289   19.192  1.00 123.85 ? 148  TYR A CG  1 
ATOM   1619 C CD1 . TYR A 1 224 ? 46.951  8.211   18.400  1.00 126.64 ? 148  TYR A CD1 1 
ATOM   1620 C CD2 . TYR A 1 224 ? 48.957  7.556   19.508  1.00 122.27 ? 148  TYR A CD2 1 
ATOM   1621 C CE1 . TYR A 1 224 ? 47.554  9.406   18.001  1.00 126.09 ? 148  TYR A CE1 1 
ATOM   1622 C CE2 . TYR A 1 224 ? 49.568  8.749   19.123  1.00 121.66 ? 148  TYR A CE2 1 
ATOM   1623 C CZ  . TYR A 1 224 ? 48.861  9.674   18.373  1.00 129.37 ? 148  TYR A CZ  1 
ATOM   1624 O OH  . TYR A 1 224 ? 49.471  10.838  17.967  1.00 128.25 ? 148  TYR A OH  1 
ATOM   1625 N N   . PRO A 1 225 ? 44.130  4.717   21.652  1.00 133.56 ? 149  PRO A N   1 
ATOM   1626 C CA  . PRO A 1 225 ? 43.537  3.432   22.089  1.00 136.12 ? 149  PRO A CA  1 
ATOM   1627 C C   . PRO A 1 225 ? 43.420  2.394   20.955  1.00 142.16 ? 149  PRO A C   1 
ATOM   1628 O O   . PRO A 1 225 ? 43.430  1.194   21.243  1.00 142.82 ? 149  PRO A O   1 
ATOM   1629 C CB  . PRO A 1 225 ? 42.141  3.833   22.590  1.00 140.62 ? 149  PRO A CB  1 
ATOM   1630 C CG  . PRO A 1 225 ? 42.220  5.309   22.839  1.00 143.69 ? 149  PRO A CG  1 
ATOM   1631 C CD  . PRO A 1 225 ? 43.166  5.826   21.802  1.00 136.59 ? 149  PRO A CD  1 
ATOM   1632 N N   . PHE A 1 226 ? 43.302  2.848   19.689  1.00 139.13 ? 150  PHE A N   1 
ATOM   1633 C CA  . PHE A 1 226 ? 43.202  1.982   18.506  1.00 178.48 ? 150  PHE A CA  1 
ATOM   1634 C C   . PHE A 1 226 ? 44.539  1.272   18.201  1.00 206.53 ? 150  PHE A C   1 
ATOM   1635 O O   . PHE A 1 226 ? 45.607  1.800   18.507  1.00 163.79 ? 150  PHE A O   1 
ATOM   1636 C CB  . PHE A 1 226 ? 42.762  2.796   17.280  1.00 180.60 ? 150  PHE A CB  1 
ATOM   1637 C CG  . PHE A 1 226 ? 43.619  3.985   16.901  1.00 179.47 ? 150  PHE A CG  1 
ATOM   1638 C CD1 . PHE A 1 226 ? 44.677  3.846   16.009  1.00 180.56 ? 150  PHE A CD1 1 
ATOM   1639 C CD2 . PHE A 1 226 ? 43.317  5.258   17.372  1.00 181.37 ? 150  PHE A CD2 1 
ATOM   1640 C CE1 . PHE A 1 226 ? 45.449  4.950   15.636  1.00 179.24 ? 150  PHE A CE1 1 
ATOM   1641 C CE2 . PHE A 1 226 ? 44.088  6.363   16.995  1.00 181.93 ? 150  PHE A CE2 1 
ATOM   1642 C CZ  . PHE A 1 226 ? 45.144  6.202   16.125  1.00 178.09 ? 150  PHE A CZ  1 
ATOM   1643 N N   . PRO A 1 233 ? 51.731  -4.733  14.662  1.00 128.89 ? 157  PRO A N   1 
ATOM   1644 C CA  . PRO A 1 233 ? 52.079  -6.106  14.273  1.00 129.81 ? 157  PRO A CA  1 
ATOM   1645 C C   . PRO A 1 233 ? 53.495  -6.199  13.692  1.00 132.22 ? 157  PRO A C   1 
ATOM   1646 O O   . PRO A 1 233 ? 54.247  -7.114  14.047  1.00 131.58 ? 157  PRO A O   1 
ATOM   1647 C CB  . PRO A 1 233 ? 51.022  -6.457  13.214  1.00 133.97 ? 157  PRO A CB  1 
ATOM   1648 C CG  . PRO A 1 233 ? 50.412  -5.144  12.804  1.00 137.93 ? 157  PRO A CG  1 
ATOM   1649 C CD  . PRO A 1 233 ? 50.486  -4.283  14.015  1.00 132.10 ? 157  PRO A CD  1 
ATOM   1650 N N   . TRP A 1 234 ? 53.855  -5.244  12.804  1.00 127.44 ? 158  TRP A N   1 
ATOM   1651 C CA  . TRP A 1 234 ? 55.146  -5.192  12.116  1.00 125.26 ? 158  TRP A CA  1 
ATOM   1652 C C   . TRP A 1 234 ? 56.260  -4.721  13.068  1.00 124.72 ? 158  TRP A C   1 
ATOM   1653 O O   . TRP A 1 234 ? 57.290  -5.387  13.173  1.00 124.05 ? 158  TRP A O   1 
ATOM   1654 C CB  . TRP A 1 234 ? 55.053  -4.242  10.897  1.00 123.91 ? 158  TRP A CB  1 
ATOM   1655 C CG  . TRP A 1 234 ? 55.884  -4.649  9.710   1.00 124.74 ? 158  TRP A CG  1 
ATOM   1656 C CD1 . TRP A 1 234 ? 55.431  -5.239  8.566   1.00 129.37 ? 158  TRP A CD1 1 
ATOM   1657 C CD2 . TRP A 1 234 ? 57.315  -4.572  9.583   1.00 122.73 ? 158  TRP A CD2 1 
ATOM   1658 N NE1 . TRP A 1 234 ? 56.482  -5.489  7.713   1.00 128.07 ? 158  TRP A NE1 1 
ATOM   1659 C CE2 . TRP A 1 234 ? 57.652  -5.103  8.318   1.00 127.27 ? 158  TRP A CE2 1 
ATOM   1660 C CE3 . TRP A 1 234 ? 58.345  -4.082  10.405  1.00 122.05 ? 158  TRP A CE3 1 
ATOM   1661 C CZ2 . TRP A 1 234 ? 58.975  -5.167  7.860   1.00 125.22 ? 158  TRP A CZ2 1 
ATOM   1662 C CZ3 . TRP A 1 234 ? 59.655  -4.151  9.952   1.00 122.26 ? 158  TRP A CZ3 1 
ATOM   1663 C CH2 . TRP A 1 234 ? 59.960  -4.690  8.696   1.00 123.43 ? 158  TRP A CH2 1 
ATOM   1664 N N   . GLN A 1 235 ? 56.028  -3.589  13.781  1.00 117.90 ? 159  GLN A N   1 
ATOM   1665 C CA  . GLN A 1 235 ? 56.953  -2.860  14.669  1.00 114.57 ? 159  GLN A CA  1 
ATOM   1666 C C   . GLN A 1 235 ? 57.780  -3.807  15.602  1.00 114.70 ? 159  GLN A C   1 
ATOM   1667 O O   . GLN A 1 235 ? 58.934  -3.489  15.885  1.00 113.20 ? 159  GLN A O   1 
ATOM   1668 C CB  . GLN A 1 235 ? 56.194  -1.831  15.544  1.00 115.96 ? 159  GLN A CB  1 
ATOM   1669 C CG  . GLN A 1 235 ? 55.144  -2.397  16.515  1.00 134.38 ? 159  GLN A CG  1 
ATOM   1670 C CD  . GLN A 1 235 ? 54.436  -1.333  17.331  1.00 155.52 ? 159  GLN A CD  1 
ATOM   1671 O OE1 . GLN A 1 235 ? 54.211  -0.201  16.882  1.00 150.28 ? 159  GLN A OE1 1 
ATOM   1672 N NE2 . GLN A 1 235 ? 53.972  -1.710  18.513  1.00 149.78 ? 159  GLN A NE2 1 
ATOM   1673 N N   . ALA A 1 236 ? 57.220  -4.962  16.022  1.00 109.27 ? 160  ALA A N   1 
ATOM   1674 C CA  . ALA A 1 236 ? 57.894  -5.907  16.916  1.00 107.44 ? 160  ALA A CA  1 
ATOM   1675 C C   . ALA A 1 236 ? 59.044  -6.664  16.220  1.00 107.02 ? 160  ALA A C   1 
ATOM   1676 O O   . ALA A 1 236 ? 60.048  -6.952  16.872  1.00 105.71 ? 160  ALA A O   1 
ATOM   1677 C CB  . ALA A 1 236 ? 56.893  -6.906  17.456  1.00 110.40 ? 160  ALA A CB  1 
ATOM   1678 N N   . SER A 1 237 ? 58.902  -6.991  14.914  1.00 101.39 ? 161  SER A N   1 
ATOM   1679 C CA  . SER A 1 237 ? 59.918  -7.745  14.155  1.00 99.53  ? 161  SER A CA  1 
ATOM   1680 C C   . SER A 1 237 ? 61.194  -6.929  13.913  1.00 97.78  ? 161  SER A C   1 
ATOM   1681 O O   . SER A 1 237 ? 62.233  -7.507  13.590  1.00 97.14  ? 161  SER A O   1 
ATOM   1682 C CB  . SER A 1 237 ? 59.358  -8.185  12.806  1.00 104.27 ? 161  SER A CB  1 
ATOM   1683 O OG  . SER A 1 237 ? 59.032  -7.067  11.995  1.00 112.69 ? 161  SER A OG  1 
ATOM   1684 N N   . TYR A 1 238 ? 61.096  -5.592  14.025  1.00 89.95  ? 162  TYR A N   1 
ATOM   1685 C CA  . TYR A 1 238 ? 62.184  -4.648  13.787  1.00 86.37  ? 162  TYR A CA  1 
ATOM   1686 C C   . TYR A 1 238 ? 62.817  -4.134  15.101  1.00 88.80  ? 162  TYR A C   1 
ATOM   1687 O O   . TYR A 1 238 ? 64.042  -3.974  15.149  1.00 87.63  ? 162  TYR A O   1 
ATOM   1688 C CB  . TYR A 1 238 ? 61.655  -3.450  12.969  1.00 85.74  ? 162  TYR A CB  1 
ATOM   1689 C CG  . TYR A 1 238 ? 62.621  -2.292  12.864  1.00 83.77  ? 162  TYR A CG  1 
ATOM   1690 C CD1 . TYR A 1 238 ? 63.676  -2.318  11.957  1.00 84.71  ? 162  TYR A CD1 1 
ATOM   1691 C CD2 . TYR A 1 238 ? 62.468  -1.159  13.654  1.00 83.30  ? 162  TYR A CD2 1 
ATOM   1692 C CE1 . TYR A 1 238 ? 64.584  -1.266  11.876  1.00 83.53  ? 162  TYR A CE1 1 
ATOM   1693 C CE2 . TYR A 1 238 ? 63.367  -0.100  13.580  1.00 82.74  ? 162  TYR A CE2 1 
ATOM   1694 C CZ  . TYR A 1 238 ? 64.424  -0.155  12.687  1.00 88.01  ? 162  TYR A CZ  1 
ATOM   1695 O OH  . TYR A 1 238 ? 65.308  0.892   12.614  1.00 86.21  ? 162  TYR A OH  1 
ATOM   1696 N N   . ILE A 1 239 ? 61.996  -3.842  16.136  1.00 84.58  ? 163  ILE A N   1 
ATOM   1697 C CA  . ILE A 1 239 ? 62.467  -3.248  17.396  1.00 83.06  ? 163  ILE A CA  1 
ATOM   1698 C C   . ILE A 1 239 ? 63.301  -4.270  18.208  1.00 86.70  ? 163  ILE A C   1 
ATOM   1699 O O   . ILE A 1 239 ? 64.395  -3.900  18.633  1.00 85.76  ? 163  ILE A O   1 
ATOM   1700 C CB  . ILE A 1 239 ? 61.283  -2.702  18.231  1.00 86.39  ? 163  ILE A CB  1 
ATOM   1701 C CG1 . ILE A 1 239 ? 60.671  -1.495  17.489  1.00 86.06  ? 163  ILE A CG1 1 
ATOM   1702 C CG2 . ILE A 1 239 ? 61.732  -2.278  19.645  1.00 86.49  ? 163  ILE A CG2 1 
ATOM   1703 C CD1 . ILE A 1 239 ? 59.510  -0.964  18.062  1.00 94.10  ? 163  ILE A CD1 1 
ATOM   1704 N N   . VAL A 1 240 ? 62.817  -5.521  18.410  1.00 83.88  ? 164  VAL A N   1 
ATOM   1705 C CA  . VAL A 1 240 ? 63.548  -6.549  19.184  1.00 83.88  ? 164  VAL A CA  1 
ATOM   1706 C C   . VAL A 1 240 ? 65.026  -6.646  18.663  1.00 85.77  ? 164  VAL A C   1 
ATOM   1707 O O   . VAL A 1 240 ? 65.924  -6.463  19.488  1.00 83.82  ? 164  VAL A O   1 
ATOM   1708 C CB  . VAL A 1 240 ? 62.847  -7.940  19.171  1.00 89.59  ? 164  VAL A CB  1 
ATOM   1709 C CG1 . VAL A 1 240 ? 63.697  -9.006  19.863  1.00 89.84  ? 164  VAL A CG1 1 
ATOM   1710 C CG2 . VAL A 1 240 ? 61.464  -7.860  19.811  1.00 90.62  ? 164  VAL A CG2 1 
ATOM   1711 N N   . PRO A 1 241 ? 65.318  -6.827  17.333  1.00 82.60  ? 165  PRO A N   1 
ATOM   1712 C CA  . PRO A 1 241 ? 66.731  -6.875  16.900  1.00 81.77  ? 165  PRO A CA  1 
ATOM   1713 C C   . PRO A 1 241 ? 67.464  -5.547  17.125  1.00 85.33  ? 165  PRO A C   1 
ATOM   1714 O O   . PRO A 1 241 ? 68.619  -5.570  17.542  1.00 85.48  ? 165  PRO A O   1 
ATOM   1715 C CB  . PRO A 1 241 ? 66.641  -7.189  15.400  1.00 83.45  ? 165  PRO A CB  1 
ATOM   1716 C CG  . PRO A 1 241 ? 65.287  -7.746  15.195  1.00 89.02  ? 165  PRO A CG  1 
ATOM   1717 C CD  . PRO A 1 241 ? 64.414  -7.056  16.186  1.00 84.61  ? 165  PRO A CD  1 
ATOM   1718 N N   . LEU A 1 242 ? 66.792  -4.401  16.880  1.00 81.12  ? 166  LEU A N   1 
ATOM   1719 C CA  . LEU A 1 242 ? 67.377  -3.067  17.040  1.00 79.77  ? 166  LEU A CA  1 
ATOM   1720 C C   . LEU A 1 242 ? 67.781  -2.803  18.507  1.00 83.71  ? 166  LEU A C   1 
ATOM   1721 O O   . LEU A 1 242 ? 68.818  -2.176  18.745  1.00 82.99  ? 166  LEU A O   1 
ATOM   1722 C CB  . LEU A 1 242 ? 66.381  -1.992  16.565  1.00 79.36  ? 166  LEU A CB  1 
ATOM   1723 C CG  . LEU A 1 242 ? 66.850  -0.527  16.592  1.00 83.07  ? 166  LEU A CG  1 
ATOM   1724 C CD1 . LEU A 1 242 ? 67.969  -0.278  15.590  1.00 82.43  ? 166  LEU A CD1 1 
ATOM   1725 C CD2 . LEU A 1 242 ? 65.709  0.398   16.280  1.00 86.12  ? 166  LEU A CD2 1 
ATOM   1726 N N   . VAL A 1 243 ? 66.981  -3.291  19.476  1.00 80.66  ? 167  VAL A N   1 
ATOM   1727 C CA  . VAL A 1 243 ? 67.264  -3.099  20.897  1.00 80.85  ? 167  VAL A CA  1 
ATOM   1728 C C   . VAL A 1 243 ? 68.487  -3.963  21.272  1.00 87.01  ? 167  VAL A C   1 
ATOM   1729 O O   . VAL A 1 243 ? 69.407  -3.452  21.920  1.00 86.87  ? 167  VAL A O   1 
ATOM   1730 C CB  . VAL A 1 243 ? 66.040  -3.392  21.803  1.00 85.06  ? 167  VAL A CB  1 
ATOM   1731 C CG1 . VAL A 1 243 ? 66.406  -3.279  23.276  1.00 85.15  ? 167  VAL A CG1 1 
ATOM   1732 C CG2 . VAL A 1 243 ? 64.894  -2.445  21.482  1.00 84.55  ? 167  VAL A CG2 1 
ATOM   1733 N N   . TRP A 1 244 ? 68.535  -5.234  20.810  1.00 84.86  ? 168  TRP A N   1 
ATOM   1734 C CA  . TRP A 1 244 ? 69.682  -6.101  21.090  1.00 85.47  ? 168  TRP A CA  1 
ATOM   1735 C C   . TRP A 1 244 ? 70.937  -5.586  20.382  1.00 88.74  ? 168  TRP A C   1 
ATOM   1736 O O   . TRP A 1 244 ? 72.035  -5.760  20.913  1.00 89.27  ? 168  TRP A O   1 
ATOM   1737 C CB  . TRP A 1 244 ? 69.420  -7.562  20.697  1.00 85.33  ? 168  TRP A CB  1 
ATOM   1738 C CG  . TRP A 1 244 ? 68.487  -8.279  21.629  1.00 87.49  ? 168  TRP A CG  1 
ATOM   1739 C CD1 . TRP A 1 244 ? 67.168  -8.553  21.421  1.00 91.01  ? 168  TRP A CD1 1 
ATOM   1740 C CD2 . TRP A 1 244 ? 68.789  -8.737  22.957  1.00 88.08  ? 168  TRP A CD2 1 
ATOM   1741 N NE1 . TRP A 1 244 ? 66.639  -9.194  22.519  1.00 91.77  ? 168  TRP A NE1 1 
ATOM   1742 C CE2 . TRP A 1 244 ? 67.614  -9.318  23.478  1.00 93.17  ? 168  TRP A CE2 1 
ATOM   1743 C CE3 . TRP A 1 244 ? 69.950  -8.737  23.749  1.00 89.40  ? 168  TRP A CE3 1 
ATOM   1744 C CZ2 . TRP A 1 244 ? 67.564  -9.895  24.754  1.00 93.53  ? 168  TRP A CZ2 1 
ATOM   1745 C CZ3 . TRP A 1 244 ? 69.902  -9.318  25.008  1.00 91.88  ? 168  TRP A CZ3 1 
ATOM   1746 C CH2 . TRP A 1 244 ? 68.719  -9.878  25.502  1.00 93.48  ? 168  TRP A CH2 1 
ATOM   1747 N N   . CYS A 1 245 ? 70.777  -4.919  19.220  1.00 83.83  ? 169  CYS A N   1 
ATOM   1748 C CA  . CYS A 1 245 ? 71.893  -4.351  18.466  1.00 82.90  ? 169  CYS A CA  1 
ATOM   1749 C C   . CYS A 1 245 ? 72.509  -3.186  19.248  1.00 86.42  ? 169  CYS A C   1 
ATOM   1750 O O   . CYS A 1 245 ? 73.733  -3.140  19.385  1.00 86.37  ? 169  CYS A O   1 
ATOM   1751 C CB  . CYS A 1 245 ? 71.447  -3.908  17.077  1.00 82.41  ? 169  CYS A CB  1 
ATOM   1752 S SG  . CYS A 1 245 ? 72.769  -3.178  16.079  1.00 85.66  ? 169  CYS A SG  1 
ATOM   1753 N N   . MET A 1 246 ? 71.662  -2.270  19.784  1.00 82.75  ? 170  MET A N   1 
ATOM   1754 C CA  . MET A 1 246 ? 72.113  -1.109  20.567  1.00 82.86  ? 170  MET A CA  1 
ATOM   1755 C C   . MET A 1 246 ? 72.743  -1.555  21.893  1.00 87.99  ? 170  MET A C   1 
ATOM   1756 O O   . MET A 1 246 ? 73.657  -0.888  22.373  1.00 88.02  ? 170  MET A O   1 
ATOM   1757 C CB  . MET A 1 246 ? 70.971  -0.121  20.836  1.00 84.92  ? 170  MET A CB  1 
ATOM   1758 C CG  . MET A 1 246 ? 70.428  0.531   19.574  1.00 87.90  ? 170  MET A CG  1 
ATOM   1759 S SD  . MET A 1 246 ? 69.117  1.747   19.843  1.00 91.86  ? 170  MET A SD  1 
ATOM   1760 C CE  . MET A 1 246 ? 67.841  0.714   20.572  1.00 89.08  ? 170  MET A CE  1 
ATOM   1761 N N   . ALA A 1 247 ? 72.301  -2.711  22.440  1.00 85.37  ? 171  ALA A N   1 
ATOM   1762 C CA  . ALA A 1 247 ? 72.852  -3.310  23.659  1.00 86.03  ? 171  ALA A CA  1 
ATOM   1763 C C   . ALA A 1 247 ? 74.282  -3.850  23.408  1.00 91.69  ? 171  ALA A C   1 
ATOM   1764 O O   . ALA A 1 247 ? 75.148  -3.702  24.277  1.00 91.53  ? 171  ALA A O   1 
ATOM   1765 C CB  . ALA A 1 247 ? 71.942  -4.424  24.151  1.00 87.14  ? 171  ALA A CB  1 
ATOM   1766 N N   . CYS A 1 248 ? 74.528  -4.448  22.208  1.00 89.15  ? 172  CYS A N   1 
ATOM   1767 C CA  . CYS A 1 248 ? 75.837  -4.988  21.808  1.00 89.94  ? 172  CYS A CA  1 
ATOM   1768 C C   . CYS A 1 248 ? 76.826  -3.858  21.571  1.00 92.51  ? 172  CYS A C   1 
ATOM   1769 O O   . CYS A 1 248 ? 78.005  -4.020  21.883  1.00 92.86  ? 172  CYS A O   1 
ATOM   1770 C CB  . CYS A 1 248 ? 75.719  -5.864  20.565  1.00 90.73  ? 172  CYS A CB  1 
ATOM   1771 S SG  . CYS A 1 248 ? 74.776  -7.385  20.813  1.00 95.81  ? 172  CYS A SG  1 
ATOM   1772 N N   . LEU A 1 249 ? 76.359  -2.731  20.986  1.00 86.94  ? 173  LEU A N   1 
ATOM   1773 C CA  . LEU A 1 249 ? 77.223  -1.585  20.684  1.00 85.55  ? 173  LEU A CA  1 
ATOM   1774 C C   . LEU A 1 249 ? 77.598  -0.833  21.966  1.00 90.00  ? 173  LEU A C   1 
ATOM   1775 O O   . LEU A 1 249 ? 78.703  -0.299  22.053  1.00 90.37  ? 173  LEU A O   1 
ATOM   1776 C CB  . LEU A 1 249 ? 76.556  -0.624  19.684  1.00 84.00  ? 173  LEU A CB  1 
ATOM   1777 C CG  . LEU A 1 249 ? 76.175  -1.194  18.311  1.00 87.01  ? 173  LEU A CG  1 
ATOM   1778 C CD1 . LEU A 1 249 ? 75.439  -0.174  17.494  1.00 85.82  ? 173  LEU A CD1 1 
ATOM   1779 C CD2 . LEU A 1 249 ? 77.383  -1.688  17.552  1.00 89.91  ? 173  LEU A CD2 1 
ATOM   1780 N N   . SER A 1 250 ? 76.694  -0.821  22.965  1.00 86.80  ? 174  SER A N   1 
ATOM   1781 C CA  . SER A 1 250 ? 76.918  -0.175  24.264  1.00 87.63  ? 174  SER A CA  1 
ATOM   1782 C C   . SER A 1 250 ? 77.934  -0.954  25.122  1.00 93.52  ? 174  SER A C   1 
ATOM   1783 O O   . SER A 1 250 ? 78.590  -0.355  25.982  1.00 94.35  ? 174  SER A O   1 
ATOM   1784 C CB  . SER A 1 250 ? 75.603  -0.047  25.030  1.00 90.57  ? 174  SER A CB  1 
ATOM   1785 O OG  . SER A 1 250 ? 74.650  0.733   24.329  1.00 97.28  ? 174  SER A OG  1 
ATOM   1786 N N   . SER A 1 251 ? 78.056  -2.284  24.889  1.00 90.16  ? 175  SER A N   1 
ATOM   1787 C CA  . SER A 1 251 ? 78.948  -3.165  25.650  1.00 91.13  ? 175  SER A CA  1 
ATOM   1788 C C   . SER A 1 251 ? 80.312  -3.383  24.945  1.00 94.37  ? 175  SER A C   1 
ATOM   1789 O O   . SER A 1 251 ? 81.100  -4.198  25.424  1.00 95.47  ? 175  SER A O   1 
ATOM   1790 C CB  . SER A 1 251 ? 78.281  -4.520  25.882  1.00 95.30  ? 175  SER A CB  1 
ATOM   1791 O OG  . SER A 1 251 ? 78.034  -5.207  24.666  1.00 103.75 ? 175  SER A OG  1 
ATOM   1792 N N   . LEU A 1 252 ? 80.595  -2.666  23.831  1.00 88.93  ? 176  LEU A N   1 
ATOM   1793 C CA  . LEU A 1 252 ? 81.871  -2.797  23.109  1.00 88.64  ? 176  LEU A CA  1 
ATOM   1794 C C   . LEU A 1 252 ? 83.006  -2.059  23.842  1.00 94.51  ? 176  LEU A C   1 
ATOM   1795 O O   . LEU A 1 252 ? 84.043  -2.696  24.046  1.00 95.18  ? 176  LEU A O   1 
ATOM   1796 C CB  . LEU A 1 252 ? 81.781  -2.294  21.665  1.00 87.28  ? 176  LEU A CB  1 
ATOM   1797 C CG  . LEU A 1 252 ? 80.948  -3.127  20.710  1.00 90.58  ? 176  LEU A CG  1 
ATOM   1798 C CD1 . LEU A 1 252 ? 80.574  -2.340  19.515  1.00 89.90  ? 176  LEU A CD1 1 
ATOM   1799 C CD2 . LEU A 1 252 ? 81.628  -4.443  20.354  1.00 92.67  ? 176  LEU A CD2 1 
ATOM   1800 N N   . PRO A 1 253 ? 82.865  -0.768  24.297  1.00 91.82  ? 177  PRO A N   1 
ATOM   1801 C CA  . PRO A 1 253 ? 83.985  -0.123  25.020  1.00 93.31  ? 177  PRO A CA  1 
ATOM   1802 C C   . PRO A 1 253 ? 84.382  -0.903  26.281  1.00 98.94  ? 177  PRO A C   1 
ATOM   1803 O O   . PRO A 1 253 ? 85.473  -0.703  26.810  1.00 100.33 ? 177  PRO A O   1 
ATOM   1804 C CB  . PRO A 1 253 ? 83.429  1.257   25.377  1.00 94.64  ? 177  PRO A CB  1 
ATOM   1805 C CG  . PRO A 1 253 ? 82.375  1.513   24.353  1.00 97.36  ? 177  PRO A CG  1 
ATOM   1806 C CD  . PRO A 1 253 ? 81.731  0.172   24.152  1.00 92.21  ? 177  PRO A CD  1 
ATOM   1807 N N   . THR A 1 254 ? 83.511  -1.827  26.723  1.00 95.26  ? 178  THR A N   1 
ATOM   1808 C CA  . THR A 1 254 ? 83.756  -2.727  27.846  1.00 96.30  ? 178  THR A CA  1 
ATOM   1809 C C   . THR A 1 254 ? 84.757  -3.808  27.403  1.00 101.11 ? 178  THR A C   1 
ATOM   1810 O O   . THR A 1 254 ? 85.746  -4.045  28.093  1.00 102.79 ? 178  THR A O   1 
ATOM   1811 C CB  . THR A 1 254 ? 82.426  -3.328  28.331  1.00 104.39 ? 178  THR A CB  1 
ATOM   1812 O OG1 . THR A 1 254 ? 81.449  -2.295  28.494  1.00 105.73 ? 178  THR A OG1 1 
ATOM   1813 C CG2 . THR A 1 254 ? 82.579  -4.155  29.595  1.00 103.04 ? 178  THR A CG2 1 
ATOM   1814 N N   . PHE A 1 255 ? 84.513  -4.428  26.226  1.00 96.21  ? 179  PHE A N   1 
ATOM   1815 C CA  . PHE A 1 255 ? 85.343  -5.492  25.656  1.00 96.87  ? 179  PHE A CA  1 
ATOM   1816 C C   . PHE A 1 255 ? 86.748  -4.976  25.306  1.00 102.30 ? 179  PHE A C   1 
ATOM   1817 O O   . PHE A 1 255 ? 87.718  -5.737  25.386  1.00 103.77 ? 179  PHE A O   1 
ATOM   1818 C CB  . PHE A 1 255 ? 84.670  -6.073  24.394  1.00 97.26  ? 179  PHE A CB  1 
ATOM   1819 C CG  . PHE A 1 255 ? 85.214  -7.413  23.954  1.00 99.97  ? 179  PHE A CG  1 
ATOM   1820 C CD1 . PHE A 1 255 ? 86.334  -7.494  23.129  1.00 104.18 ? 179  PHE A CD1 1 
ATOM   1821 C CD2 . PHE A 1 255 ? 84.590  -8.594  24.336  1.00 102.41 ? 179  PHE A CD2 1 
ATOM   1822 C CE1 . PHE A 1 255 ? 86.849  -8.736  22.738  1.00 106.11 ? 179  PHE A CE1 1 
ATOM   1823 C CE2 . PHE A 1 255 ? 85.098  -9.836  23.935  1.00 106.48 ? 179  PHE A CE2 1 
ATOM   1824 C CZ  . PHE A 1 255 ? 86.226  -9.899  23.141  1.00 105.41 ? 179  PHE A CZ  1 
ATOM   1825 N N   . TYR A 1 256 ? 86.860  -3.691  24.933  1.00 97.79  ? 180  TYR A N   1 
ATOM   1826 C CA  . TYR A 1 256 ? 88.140  -3.126  24.535  1.00 98.77  ? 180  TYR A CA  1 
ATOM   1827 C C   . TYR A 1 256 ? 89.004  -2.701  25.730  1.00 105.93 ? 180  TYR A C   1 
ATOM   1828 O O   . TYR A 1 256 ? 90.231  -2.691  25.595  1.00 107.78 ? 180  TYR A O   1 
ATOM   1829 C CB  . TYR A 1 256 ? 87.951  -1.904  23.624  1.00 98.29  ? 180  TYR A CB  1 
ATOM   1830 C CG  . TYR A 1 256 ? 87.028  -2.115  22.444  1.00 97.28  ? 180  TYR A CG  1 
ATOM   1831 C CD1 . TYR A 1 256 ? 87.209  -3.190  21.576  1.00 98.96  ? 180  TYR A CD1 1 
ATOM   1832 C CD2 . TYR A 1 256 ? 86.107  -1.139  22.077  1.00 96.11  ? 180  TYR A CD2 1 
ATOM   1833 C CE1 . TYR A 1 256 ? 86.374  -3.378  20.477  1.00 97.03  ? 180  TYR A CE1 1 
ATOM   1834 C CE2 . TYR A 1 256 ? 85.309  -1.284  20.944  1.00 95.03  ? 180  TYR A CE2 1 
ATOM   1835 C CZ  . TYR A 1 256 ? 85.449  -2.404  20.144  1.00 100.57 ? 180  TYR A CZ  1 
ATOM   1836 O OH  . TYR A 1 256 ? 84.650  -2.552  19.043  1.00 99.09  ? 180  TYR A OH  1 
ATOM   1837 N N   . PHE A 1 257 ? 88.394  -2.313  26.871  1.00 102.63 ? 181  PHE A N   1 
ATOM   1838 C CA  . PHE A 1 257 ? 89.189  -1.801  27.984  1.00 104.70 ? 181  PHE A CA  1 
ATOM   1839 C C   . PHE A 1 257 ? 89.231  -2.774  29.184  1.00 110.85 ? 181  PHE A C   1 
ATOM   1840 O O   . PHE A 1 257 ? 90.258  -2.797  29.859  1.00 112.66 ? 181  PHE A O   1 
ATOM   1841 C CB  . PHE A 1 257 ? 88.665  -0.439  28.447  1.00 106.01 ? 181  PHE A CB  1 
ATOM   1842 C CG  . PHE A 1 257 ? 88.866  0.622   27.388  1.00 107.05 ? 181  PHE A CG  1 
ATOM   1843 C CD1 . PHE A 1 257 ? 90.093  1.264   27.245  1.00 111.96 ? 181  PHE A CD1 1 
ATOM   1844 C CD2 . PHE A 1 257 ? 87.837  0.963   26.516  1.00 106.64 ? 181  PHE A CD2 1 
ATOM   1845 C CE1 . PHE A 1 257 ? 90.288  2.220   26.245  1.00 112.51 ? 181  PHE A CE1 1 
ATOM   1846 C CE2 . PHE A 1 257 ? 88.033  1.921   25.517  1.00 109.05 ? 181  PHE A CE2 1 
ATOM   1847 C CZ  . PHE A 1 257 ? 89.260  2.534   25.382  1.00 109.19 ? 181  PHE A CZ  1 
ATOM   1848 N N   . ARG A 1 258 ? 88.174  -3.578  29.449  1.00 107.38 ? 182  ARG A N   1 
ATOM   1849 C CA  . ARG A 1 258 ? 88.228  -4.545  30.562  1.00 108.94 ? 182  ARG A CA  1 
ATOM   1850 C C   . ARG A 1 258 ? 89.324  -5.583  30.296  1.00 115.82 ? 182  ARG A C   1 
ATOM   1851 O O   . ARG A 1 258 ? 89.406  -6.116  29.193  1.00 114.93 ? 182  ARG A O   1 
ATOM   1852 C CB  . ARG A 1 258 ? 86.869  -5.237  30.808  1.00 107.57 ? 182  ARG A CB  1 
ATOM   1853 C CG  . ARG A 1 258 ? 85.846  -4.384  31.568  1.00 116.67 ? 182  ARG A CG  1 
ATOM   1854 C CD  . ARG A 1 258 ? 86.228  -4.236  33.032  1.00 130.50 ? 182  ARG A CD  1 
ATOM   1855 N NE  . ARG A 1 258 ? 85.328  -3.356  33.773  1.00 142.42 ? 182  ARG A NE  1 
ATOM   1856 C CZ  . ARG A 1 258 ? 85.458  -3.081  35.068  1.00 166.70 ? 182  ARG A CZ  1 
ATOM   1857 N NH1 . ARG A 1 258 ? 86.439  -3.628  35.774  1.00 161.23 ? 182  ARG A NH1 1 
ATOM   1858 N NH2 . ARG A 1 258 ? 84.605  -2.264  35.668  1.00 155.55 ? 182  ARG A NH2 1 
ATOM   1859 N N   . ASP A 1 259 ? 90.225  -5.780  31.277  1.00 115.52 ? 183  ASP A N   1 
ATOM   1860 C CA  . ASP A 1 259 ? 91.356  -6.712  31.196  1.00 117.44 ? 183  ASP A CA  1 
ATOM   1861 C C   . ASP A 1 259 ? 91.934  -6.958  32.597  1.00 123.55 ? 183  ASP A C   1 
ATOM   1862 O O   . ASP A 1 259 ? 91.773  -6.114  33.481  1.00 123.89 ? 183  ASP A O   1 
ATOM   1863 C CB  . ASP A 1 259 ? 92.447  -6.169  30.241  1.00 120.23 ? 183  ASP A CB  1 
ATOM   1864 C CG  . ASP A 1 259 ? 93.513  -7.177  29.840  1.00 132.41 ? 183  ASP A CG  1 
ATOM   1865 O OD1 . ASP A 1 259 ? 93.164  -8.363  29.635  1.00 132.84 ? 183  ASP A OD1 1 
ATOM   1866 O OD2 . ASP A 1 259 ? 94.657  -6.754  29.585  1.00 139.01 ? 183  ASP A OD2 1 
ATOM   1867 N N   . VAL A 1 260 ? 92.586  -8.118  32.801  1.00 120.72 ? 184  VAL A N   1 
ATOM   1868 C CA  . VAL A 1 260 ? 93.212  -8.479  34.075  1.00 122.65 ? 184  VAL A CA  1 
ATOM   1869 C C   . VAL A 1 260 ? 94.580  -7.793  34.164  1.00 128.40 ? 184  VAL A C   1 
ATOM   1870 O O   . VAL A 1 260 ? 95.413  -7.950  33.269  1.00 128.82 ? 184  VAL A O   1 
ATOM   1871 C CB  . VAL A 1 260 ? 93.322  -10.019 34.257  1.00 127.36 ? 184  VAL A CB  1 
ATOM   1872 C CG1 . VAL A 1 260 ? 94.251  -10.391 35.420  1.00 130.41 ? 184  VAL A CG1 1 
ATOM   1873 C CG2 . VAL A 1 260 ? 91.944  -10.638 34.443  1.00 125.22 ? 184  VAL A CG2 1 
ATOM   1874 N N   . ARG A 1 261 ? 94.785  -7.005  35.234  1.00 126.24 ? 185  ARG A N   1 
ATOM   1875 C CA  . ARG A 1 261 ? 96.036  -6.293  35.511  1.00 128.85 ? 185  ARG A CA  1 
ATOM   1876 C C   . ARG A 1 261 ? 96.410  -6.449  36.977  1.00 136.65 ? 185  ARG A C   1 
ATOM   1877 O O   . ARG A 1 261 ? 95.531  -6.441  37.845  1.00 135.70 ? 185  ARG A O   1 
ATOM   1878 C CB  . ARG A 1 261 ? 95.934  -4.797  35.139  1.00 126.55 ? 185  ARG A CB  1 
ATOM   1879 C CG  . ARG A 1 261 ? 95.695  -4.512  33.656  1.00 130.37 ? 185  ARG A CG  1 
ATOM   1880 C CD  . ARG A 1 261 ? 96.844  -4.941  32.752  1.00 136.31 ? 185  ARG A CD  1 
ATOM   1881 N NE  . ARG A 1 261 ? 96.496  -4.808  31.337  1.00 135.01 ? 185  ARG A NE  1 
ATOM   1882 C CZ  . ARG A 1 261 ? 96.684  -3.706  30.618  1.00 146.50 ? 185  ARG A CZ  1 
ATOM   1883 N NH1 . ARG A 1 261 ? 96.325  -3.671  29.342  1.00 134.83 ? 185  ARG A NH1 1 
ATOM   1884 N NH2 . ARG A 1 261 ? 97.219  -2.626  31.173  1.00 131.24 ? 185  ARG A NH2 1 
ATOM   1885 N N   . THR A 1 262 ? 97.715  -6.593  37.257  1.00 137.39 ? 186  THR A N   1 
ATOM   1886 C CA  . THR A 1 262 ? 98.210  -6.772  38.624  1.00 140.65 ? 186  THR A CA  1 
ATOM   1887 C C   . THR A 1 262 ? 98.213  -5.416  39.347  1.00 145.60 ? 186  THR A C   1 
ATOM   1888 O O   . THR A 1 262 ? 98.824  -4.455  38.875  1.00 145.99 ? 186  THR A O   1 
ATOM   1889 C CB  . THR A 1 262 ? 99.610  -7.421  38.629  1.00 153.26 ? 186  THR A CB  1 
ATOM   1890 O OG1 . THR A 1 262 ? 100.549 -6.537  38.021  1.00 155.81 ? 186  THR A OG1 1 
ATOM   1891 C CG2 . THR A 1 262 ? 99.636  -8.775  37.921  1.00 151.31 ? 186  THR A CG2 1 
ATOM   1892 N N   . ILE A 1 263 ? 97.477  -5.340  40.463  1.00 142.55 ? 187  ILE A N   1 
ATOM   1893 C CA  . ILE A 1 263 ? 97.380  -4.140  41.290  1.00 143.74 ? 187  ILE A CA  1 
ATOM   1894 C C   . ILE A 1 263 ? 98.475  -4.259  42.340  1.00 152.61 ? 187  ILE A C   1 
ATOM   1895 O O   . ILE A 1 263 ? 98.291  -4.948  43.342  1.00 153.43 ? 187  ILE A O   1 
ATOM   1896 C CB  . ILE A 1 263 ? 95.940  -3.975  41.883  1.00 144.51 ? 187  ILE A CB  1 
ATOM   1897 C CG1 . ILE A 1 263 ? 94.837  -4.100  40.808  1.00 140.89 ? 187  ILE A CG1 1 
ATOM   1898 C CG2 . ILE A 1 263 ? 95.786  -2.688  42.677  1.00 145.97 ? 187  ILE A CG2 1 
ATOM   1899 C CD1 . ILE A 1 263 ? 94.874  -3.074  39.608  1.00 146.51 ? 187  ILE A CD1 1 
ATOM   1900 N N   . GLU A 1 264 ? 99.642  -3.646  42.054  1.00 152.28 ? 188  GLU A N   1 
ATOM   1901 C CA  . GLU A 1 264 ? 100.887 -3.700  42.826  1.00 156.42 ? 188  GLU A CA  1 
ATOM   1902 C C   . GLU A 1 264 ? 100.696 -3.433  44.338  1.00 163.09 ? 188  GLU A C   1 
ATOM   1903 O O   . GLU A 1 264 ? 101.280 -4.164  45.141  1.00 165.56 ? 188  GLU A O   1 
ATOM   1904 C CB  . GLU A 1 264 ? 101.892 -2.676  42.284  1.00 159.61 ? 188  GLU A CB  1 
ATOM   1905 N N   . TYR A 1 265 ? 99.906  -2.407  44.726  1.00 159.22 ? 189  TYR A N   1 
ATOM   1906 C CA  . TYR A 1 265 ? 99.733  -2.056  46.142  1.00 161.52 ? 189  TYR A CA  1 
ATOM   1907 C C   . TYR A 1 265 ? 98.754  -3.028  46.866  1.00 163.52 ? 189  TYR A C   1 
ATOM   1908 O O   . TYR A 1 265 ? 98.625  -2.941  48.090  1.00 165.27 ? 189  TYR A O   1 
ATOM   1909 C CB  . TYR A 1 265 ? 99.246  -0.603  46.316  1.00 162.67 ? 189  TYR A CB  1 
ATOM   1910 C CG  . TYR A 1 265 ? 97.928  -0.267  45.652  1.00 160.40 ? 189  TYR A CG  1 
ATOM   1911 C CD1 . TYR A 1 265 ? 97.889  0.234   44.353  1.00 160.24 ? 189  TYR A CD1 1 
ATOM   1912 C CD2 . TYR A 1 265 ? 96.731  -0.333  46.360  1.00 159.62 ? 189  TYR A CD2 1 
ATOM   1913 C CE1 . TYR A 1 265 ? 96.683  0.597   43.753  1.00 157.48 ? 189  TYR A CE1 1 
ATOM   1914 C CE2 . TYR A 1 265 ? 95.518  0.018   45.768  1.00 156.82 ? 189  TYR A CE2 1 
ATOM   1915 C CZ  . TYR A 1 265 ? 95.498  0.483   44.463  1.00 162.09 ? 189  TYR A CZ  1 
ATOM   1916 O OH  . TYR A 1 265 ? 94.304  0.832   43.877  1.00 158.70 ? 189  TYR A OH  1 
ATOM   1917 N N   . LEU A 1 266 ? 98.103  -3.955  46.132  1.00 156.81 ? 190  LEU A N   1 
ATOM   1918 C CA  . LEU A 1 266 ? 97.209  -4.961  46.721  1.00 155.17 ? 190  LEU A CA  1 
ATOM   1919 C C   . LEU A 1 266 ? 97.746  -6.384  46.505  1.00 159.75 ? 190  LEU A C   1 
ATOM   1920 O O   . LEU A 1 266 ? 97.307  -7.313  47.188  1.00 159.85 ? 190  LEU A O   1 
ATOM   1921 C CB  . LEU A 1 266 ? 95.788  -4.860  46.146  1.00 150.77 ? 190  LEU A CB  1 
ATOM   1922 C CG  . LEU A 1 266 ? 94.962  -3.619  46.496  1.00 153.87 ? 190  LEU A CG  1 
ATOM   1923 C CD1 . LEU A 1 266 ? 93.689  -3.579  45.688  1.00 149.60 ? 190  LEU A CD1 1 
ATOM   1924 C CD2 . LEU A 1 266 ? 94.636  -3.565  47.985  1.00 158.17 ? 190  LEU A CD2 1 
ATOM   1925 N N   . GLY A 1 267 ? 98.687  -6.530  45.568  1.00 156.28 ? 191  GLY A N   1 
ATOM   1926 C CA  . GLY A 1 267 ? 99.293  -7.805  45.192  1.00 156.55 ? 191  GLY A CA  1 
ATOM   1927 C C   . GLY A 1 267 ? 98.275  -8.804  44.681  1.00 157.19 ? 191  GLY A C   1 
ATOM   1928 O O   . GLY A 1 267 ? 98.372  -9.988  44.985  1.00 157.00 ? 191  GLY A O   1 
ATOM   1929 N N   . VAL A 1 268 ? 97.283  -8.326  43.907  1.00 150.50 ? 192  VAL A N   1 
ATOM   1930 C CA  . VAL A 1 268 ? 96.163  -9.141  43.443  1.00 147.14 ? 192  VAL A CA  1 
ATOM   1931 C C   . VAL A 1 268 ? 95.920  -8.901  41.926  1.00 148.11 ? 192  VAL A C   1 
ATOM   1932 O O   . VAL A 1 268 ? 96.208  -7.807  41.432  1.00 147.54 ? 192  VAL A O   1 
ATOM   1933 C CB  . VAL A 1 268 ? 94.931  -8.752  44.309  1.00 149.64 ? 192  VAL A CB  1 
ATOM   1934 C CG1 . VAL A 1 268 ? 94.353  -7.381  43.921  1.00 147.52 ? 192  VAL A CG1 1 
ATOM   1935 C CG2 . VAL A 1 268 ? 93.868  -9.825  44.266  1.00 147.30 ? 192  VAL A CG2 1 
ATOM   1936 N N   . ASN A 1 269 ? 95.428  -9.929  41.189  1.00 142.50 ? 193  ASN A N   1 
ATOM   1937 C CA  . ASN A 1 269 ? 95.114  -9.784  39.758  1.00 139.42 ? 193  ASN A CA  1 
ATOM   1938 C C   . ASN A 1 269 ? 93.648  -9.431  39.610  1.00 140.63 ? 193  ASN A C   1 
ATOM   1939 O O   . ASN A 1 269 ? 92.779  -10.294 39.748  1.00 139.19 ? 193  ASN A O   1 
ATOM   1940 C CB  . ASN A 1 269 ? 95.468  -11.037 38.945  1.00 140.02 ? 193  ASN A CB  1 
ATOM   1941 C CG  . ASN A 1 269 ? 96.946  -11.303 38.819  1.00 164.80 ? 193  ASN A CG  1 
ATOM   1942 O OD1 . ASN A 1 269 ? 97.769  -10.788 39.585  1.00 166.72 ? 193  ASN A OD1 1 
ATOM   1943 N ND2 . ASN A 1 269 ? 97.314  -12.132 37.855  1.00 152.97 ? 193  ASN A ND2 1 
ATOM   1944 N N   . ALA A 1 270 ? 93.373  -8.141  39.380  1.00 136.60 ? 194  ALA A N   1 
ATOM   1945 C CA  . ALA A 1 270 ? 92.015  -7.633  39.292  1.00 134.01 ? 194  ALA A CA  1 
ATOM   1946 C C   . ALA A 1 270 ? 91.577  -7.418  37.849  1.00 136.47 ? 194  ALA A C   1 
ATOM   1947 O O   . ALA A 1 270 ? 92.373  -7.007  36.999  1.00 135.99 ? 194  ALA A O   1 
ATOM   1948 C CB  . ALA A 1 270 ? 91.906  -6.324  40.053  1.00 135.36 ? 194  ALA A CB  1 
ATOM   1949 N N   . CYS A 1 271 ? 90.291  -7.706  37.588  1.00 132.14 ? 195  CYS A N   1 
ATOM   1950 C CA  . CYS A 1 271 ? 89.615  -7.504  36.306  1.00 129.96 ? 195  CYS A CA  1 
ATOM   1951 C C   . CYS A 1 271 ? 89.180  -6.046  36.236  1.00 132.27 ? 195  CYS A C   1 
ATOM   1952 O O   . CYS A 1 271 ? 88.061  -5.713  36.629  1.00 131.23 ? 195  CYS A O   1 
ATOM   1953 C CB  . CYS A 1 271 ? 88.444  -8.479  36.168  1.00 129.16 ? 195  CYS A CB  1 
ATOM   1954 S SG  . CYS A 1 271 ? 87.429  -8.253  34.680  1.00 130.21 ? 195  CYS A SG  1 
ATOM   1955 N N   . ILE A 1 272 ? 90.116  -5.157  35.859  1.00 128.55 ? 196  ILE A N   1 
ATOM   1956 C CA  . ILE A 1 272 ? 89.875  -3.710  35.852  1.00 127.40 ? 196  ILE A CA  1 
ATOM   1957 C C   . ILE A 1 272 ? 89.537  -3.192  34.444  1.00 128.10 ? 196  ILE A C   1 
ATOM   1958 O O   . ILE A 1 272 ? 89.528  -3.949  33.477  1.00 126.35 ? 196  ILE A O   1 
ATOM   1959 C CB  . ILE A 1 272 ? 91.100  -2.927  36.406  1.00 133.34 ? 196  ILE A CB  1 
ATOM   1960 C CG1 . ILE A 1 272 ? 92.343  -3.047  35.471  1.00 134.72 ? 196  ILE A CG1 1 
ATOM   1961 C CG2 . ILE A 1 272 ? 91.407  -3.325  37.851  1.00 136.80 ? 196  ILE A CG2 1 
ATOM   1962 C CD1 . ILE A 1 272 ? 93.461  -2.068  35.761  1.00 143.91 ? 196  ILE A CD1 1 
ATOM   1963 N N   . MET A 1 273 ? 89.293  -1.877  34.355  1.00 123.86 ? 197  MET A N   1 
ATOM   1964 C CA  . MET A 1 273 ? 89.037  -1.136  33.130  1.00 122.04 ? 197  MET A CA  1 
ATOM   1965 C C   . MET A 1 273 ? 90.384  -0.531  32.682  1.00 127.99 ? 197  MET A C   1 
ATOM   1966 O O   . MET A 1 273 ? 90.686  0.619   33.006  1.00 128.42 ? 197  MET A O   1 
ATOM   1967 C CB  . MET A 1 273 ? 87.941  -0.086  33.414  1.00 123.16 ? 197  MET A CB  1 
ATOM   1968 C CG  . MET A 1 273 ? 87.252  0.468   32.189  1.00 124.62 ? 197  MET A CG  1 
ATOM   1969 S SD  . MET A 1 273 ? 86.079  -0.650  31.397  1.00 126.02 ? 197  MET A SD  1 
ATOM   1970 C CE  . MET A 1 273 ? 85.413  0.432   30.153  1.00 120.78 ? 197  MET A CE  1 
ATOM   1971 N N   . ALA A 1 274 ? 91.235  -1.361  32.033  1.00 125.99 ? 198  ALA A N   1 
ATOM   1972 C CA  . ALA A 1 274 ? 92.625  -1.060  31.649  1.00 128.62 ? 198  ALA A CA  1 
ATOM   1973 C C   . ALA A 1 274 ? 92.728  0.062   30.608  1.00 134.20 ? 198  ALA A C   1 
ATOM   1974 O O   . ALA A 1 274 ? 93.033  -0.189  29.435  1.00 133.13 ? 198  ALA A O   1 
ATOM   1975 C CB  . ALA A 1 274 ? 93.298  -2.311  31.100  1.00 129.80 ? 198  ALA A CB  1 
ATOM   1976 N N   . PHE A 1 275 ? 92.588  1.308   31.069  1.00 133.15 ? 199  PHE A N   1 
ATOM   1977 C CA  . PHE A 1 275 ? 92.750  2.483   30.217  1.00 133.67 ? 199  PHE A CA  1 
ATOM   1978 C C   . PHE A 1 275 ? 94.235  2.794   30.014  1.00 142.15 ? 199  PHE A C   1 
ATOM   1979 O O   . PHE A 1 275 ? 95.033  2.329   30.831  1.00 144.12 ? 199  PHE A O   1 
ATOM   1980 C CB  . PHE A 1 275 ? 92.037  3.700   30.827  1.00 135.36 ? 199  PHE A CB  1 
ATOM   1981 C CG  . PHE A 1 275 ? 90.564  3.587   31.130  1.00 134.68 ? 199  PHE A CG  1 
ATOM   1982 C CD1 . PHE A 1 275 ? 89.634  3.479   30.099  1.00 135.22 ? 199  PHE A CD1 1 
ATOM   1983 C CD2 . PHE A 1 275 ? 90.088  3.816   32.417  1.00 137.49 ? 199  PHE A CD2 1 
ATOM   1984 C CE1 . PHE A 1 275 ? 88.263  3.478   30.368  1.00 134.05 ? 199  PHE A CE1 1 
ATOM   1985 C CE2 . PHE A 1 275 ? 88.718  3.824   32.684  1.00 138.25 ? 199  PHE A CE2 1 
ATOM   1986 C CZ  . PHE A 1 275 ? 87.814  3.674   31.656  1.00 133.75 ? 199  PHE A CZ  1 
ATOM   1987 N N   . PRO A 1 276 ? 94.658  3.604   28.997  1.00 140.51 ? 200  PRO A N   1 
ATOM   1988 C CA  . PRO A 1 276 ? 96.087  3.953   28.898  1.00 144.16 ? 200  PRO A CA  1 
ATOM   1989 C C   . PRO A 1 276 ? 96.546  4.647   30.188  1.00 152.28 ? 200  PRO A C   1 
ATOM   1990 O O   . PRO A 1 276 ? 95.861  5.560   30.642  1.00 151.12 ? 200  PRO A O   1 
ATOM   1991 C CB  . PRO A 1 276 ? 96.143  4.876   27.672  1.00 145.35 ? 200  PRO A CB  1 
ATOM   1992 C CG  . PRO A 1 276 ? 94.908  4.583   26.904  1.00 146.01 ? 200  PRO A CG  1 
ATOM   1993 C CD  . PRO A 1 276 ? 93.876  4.272   27.935  1.00 140.03 ? 200  PRO A CD  1 
ATOM   1994 N N   . PRO A 1 277 ? 97.608  4.150   30.869  1.00 153.22 ? 201  PRO A N   1 
ATOM   1995 C CA  . PRO A 1 277 ? 97.993  4.739   32.169  1.00 156.21 ? 201  PRO A CA  1 
ATOM   1996 C C   . PRO A 1 277 ? 98.383  6.222   32.074  1.00 162.44 ? 201  PRO A C   1 
ATOM   1997 O O   . PRO A 1 277 ? 98.100  6.975   33.010  1.00 162.71 ? 201  PRO A O   1 
ATOM   1998 C CB  . PRO A 1 277 ? 99.202  3.899   32.600  1.00 161.12 ? 201  PRO A CB  1 
ATOM   1999 C CG  . PRO A 1 277 ? 99.698  3.249   31.351  1.00 164.95 ? 201  PRO A CG  1 
ATOM   2000 C CD  . PRO A 1 277 ? 98.483  3.016   30.513  1.00 156.19 ? 201  PRO A CD  1 
ATOM   2001 N N   . GLU A 1 278 ? 99.003  6.648   30.943  1.00 160.03 ? 202  GLU A N   1 
ATOM   2002 C CA  . GLU A 1 278 ? 99.418  8.043   30.720  1.00 161.74 ? 202  GLU A CA  1 
ATOM   2003 C C   . GLU A 1 278 ? 98.174  8.965   30.609  1.00 162.28 ? 202  GLU A C   1 
ATOM   2004 O O   . GLU A 1 278 ? 98.263  10.175  30.841  1.00 163.94 ? 202  GLU A O   1 
ATOM   2005 C CB  . GLU A 1 278 ? 100.319 8.191   29.465  1.00 164.30 ? 202  GLU A CB  1 
ATOM   2006 C CG  . GLU A 1 278 ? 99.742  7.732   28.122  1.00 171.79 ? 202  GLU A CG  1 
ATOM   2007 C CD  . GLU A 1 278 ? 99.630  6.244   27.831  1.00 187.95 ? 202  GLU A CD  1 
ATOM   2008 O OE1 . GLU A 1 278 ? 100.089 5.426   28.662  1.00 183.94 ? 202  GLU A OE1 1 
ATOM   2009 O OE2 . GLU A 1 278 ? 99.152  5.900   26.726  1.00 175.95 ? 202  GLU A OE2 1 
ATOM   2010 N N   . LYS A 1 279 ? 97.023  8.359   30.258  1.00 153.60 ? 203  LYS A N   1 
ATOM   2011 C CA  . LYS A 1 279 ? 95.728  9.009   30.119  1.00 149.94 ? 203  LYS A CA  1 
ATOM   2012 C C   . LYS A 1 279 ? 94.664  8.184   30.860  1.00 149.97 ? 203  LYS A C   1 
ATOM   2013 O O   . LYS A 1 279 ? 93.753  7.648   30.226  1.00 146.46 ? 203  LYS A O   1 
ATOM   2014 C CB  . LYS A 1 279 ? 95.380  9.180   28.624  1.00 150.13 ? 203  LYS A CB  1 
ATOM   2015 N N   . TYR A 1 280 ? 94.816  8.016   32.197  1.00 146.79 ? 204  TYR A N   1 
ATOM   2016 C CA  . TYR A 1 280 ? 93.888  7.174   32.948  1.00 144.05 ? 204  TYR A CA  1 
ATOM   2017 C C   . TYR A 1 280 ? 92.763  8.018   33.587  1.00 147.60 ? 204  TYR A C   1 
ATOM   2018 O O   . TYR A 1 280 ? 91.612  7.582   33.577  1.00 144.09 ? 204  TYR A O   1 
ATOM   2019 C CB  . TYR A 1 280 ? 94.627  6.367   34.033  1.00 146.45 ? 204  TYR A CB  1 
ATOM   2020 C CG  . TYR A 1 280 ? 93.827  5.192   34.552  1.00 144.52 ? 204  TYR A CG  1 
ATOM   2021 C CD1 . TYR A 1 280 ? 93.929  3.937   33.959  1.00 144.84 ? 204  TYR A CD1 1 
ATOM   2022 C CD2 . TYR A 1 280 ? 92.962  5.335   35.633  1.00 144.37 ? 204  TYR A CD2 1 
ATOM   2023 C CE1 . TYR A 1 280 ? 93.174  2.860   34.413  1.00 143.27 ? 204  TYR A CE1 1 
ATOM   2024 C CE2 . TYR A 1 280 ? 92.214  4.259   36.107  1.00 143.36 ? 204  TYR A CE2 1 
ATOM   2025 C CZ  . TYR A 1 280 ? 92.318  3.026   35.488  1.00 147.56 ? 204  TYR A CZ  1 
ATOM   2026 O OH  . TYR A 1 280 ? 91.582  1.959   35.930  1.00 145.08 ? 204  TYR A OH  1 
ATOM   2027 N N   . ALA A 1 281 ? 93.102  9.200   34.159  1.00 147.32 ? 205  ALA A N   1 
ATOM   2028 C CA  . ALA A 1 281 ? 92.151  10.092  34.844  1.00 146.80 ? 205  ALA A CA  1 
ATOM   2029 C C   . ALA A 1 281 ? 91.085  10.650  33.884  1.00 148.33 ? 205  ALA A C   1 
ATOM   2030 O O   . ALA A 1 281 ? 89.937  10.821  34.299  1.00 146.22 ? 205  ALA A O   1 
ATOM   2031 C CB  . ALA A 1 281 ? 92.892  11.244  35.499  1.00 150.96 ? 205  ALA A CB  1 
ATOM   2032 N N   . GLN A 1 282 ? 91.461  10.945  32.620  1.00 144.94 ? 206  GLN A N   1 
ATOM   2033 C CA  . GLN A 1 282 ? 90.527  11.469  31.622  1.00 142.31 ? 206  GLN A CA  1 
ATOM   2034 C C   . GLN A 1 282 ? 89.514  10.375  31.198  1.00 142.55 ? 206  GLN A C   1 
ATOM   2035 O O   . GLN A 1 282 ? 88.307  10.643  31.115  1.00 140.43 ? 206  GLN A O   1 
ATOM   2036 C CB  . GLN A 1 282 ? 91.236  12.063  30.373  1.00 144.54 ? 206  GLN A CB  1 
ATOM   2037 C CG  . GLN A 1 282 ? 92.528  11.404  29.811  1.00 165.96 ? 206  GLN A CG  1 
ATOM   2038 C CD  . GLN A 1 282 ? 93.800  11.814  30.534  1.00 188.93 ? 206  GLN A CD  1 
ATOM   2039 O OE1 . GLN A 1 282 ? 93.964  11.581  31.741  1.00 186.01 ? 206  GLN A OE1 1 
ATOM   2040 N NE2 . GLN A 1 282 ? 94.797  12.264  29.777  1.00 181.91 ? 206  GLN A NE2 1 
ATOM   2041 N N   . TRP A 1 283 ? 90.014  9.151   30.971  1.00 138.09 ? 207  TRP A N   1 
ATOM   2042 C CA  . TRP A 1 283 ? 89.213  7.998   30.586  1.00 134.79 ? 207  TRP A CA  1 
ATOM   2043 C C   . TRP A 1 283 ? 88.249  7.567   31.684  1.00 136.34 ? 207  TRP A C   1 
ATOM   2044 O O   . TRP A 1 283 ? 87.108  7.225   31.375  1.00 133.58 ? 207  TRP A O   1 
ATOM   2045 C CB  . TRP A 1 283 ? 90.110  6.822   30.230  1.00 134.29 ? 207  TRP A CB  1 
ATOM   2046 C CG  . TRP A 1 283 ? 90.486  6.767   28.787  1.00 134.67 ? 207  TRP A CG  1 
ATOM   2047 C CD1 . TRP A 1 283 ? 91.672  7.137   28.227  1.00 139.67 ? 207  TRP A CD1 1 
ATOM   2048 C CD2 . TRP A 1 283 ? 89.630  6.393   27.707  1.00 131.81 ? 207  TRP A CD2 1 
ATOM   2049 N NE1 . TRP A 1 283 ? 91.625  6.966   26.866  1.00 137.82 ? 207  TRP A NE1 1 
ATOM   2050 C CE2 . TRP A 1 283 ? 90.376  6.523   26.517  1.00 136.29 ? 207  TRP A CE2 1 
ATOM   2051 C CE3 . TRP A 1 283 ? 88.298  5.955   27.628  1.00 130.43 ? 207  TRP A CE3 1 
ATOM   2052 C CZ2 . TRP A 1 283 ? 89.836  6.229   25.264  1.00 133.55 ? 207  TRP A CZ2 1 
ATOM   2053 C CZ3 . TRP A 1 283 ? 87.764  5.662   26.385  1.00 129.87 ? 207  TRP A CZ3 1 
ATOM   2054 C CH2 . TRP A 1 283 ? 88.523  5.814   25.221  1.00 130.99 ? 207  TRP A CH2 1 
ATOM   2055 N N   . SER A 1 284 ? 88.701  7.562   32.951  1.00 134.00 ? 208  SER A N   1 
ATOM   2056 C CA  . SER A 1 284 ? 87.875  7.169   34.093  1.00 133.06 ? 208  SER A CA  1 
ATOM   2057 C C   . SER A 1 284 ? 86.712  8.137   34.278  1.00 134.88 ? 208  SER A C   1 
ATOM   2058 O O   . SER A 1 284 ? 85.603  7.702   34.580  1.00 132.34 ? 208  SER A O   1 
ATOM   2059 C CB  . SER A 1 284 ? 88.713  7.104   35.363  1.00 139.48 ? 208  SER A CB  1 
ATOM   2060 O OG  . SER A 1 284 ? 89.756  6.157   35.215  1.00 149.62 ? 208  SER A OG  1 
ATOM   2061 N N   . ALA A 1 285 ? 86.960  9.443   34.053  1.00 132.38 ? 209  ALA A N   1 
ATOM   2062 C CA  . ALA A 1 285 ? 85.950  10.495  34.146  1.00 131.32 ? 209  ALA A CA  1 
ATOM   2063 C C   . ALA A 1 285 ? 84.983  10.433  32.960  1.00 132.09 ? 209  ALA A C   1 
ATOM   2064 O O   . ALA A 1 285 ? 83.787  10.643  33.138  1.00 130.23 ? 209  ALA A O   1 
ATOM   2065 C CB  . ALA A 1 285 ? 86.621  11.860  34.204  1.00 134.30 ? 209  ALA A CB  1 
ATOM   2066 N N   . GLY A 1 286 ? 85.511  10.118  31.778  1.00 127.92 ? 210  GLY A N   1 
ATOM   2067 C CA  . GLY A 1 286 ? 84.744  10.027  30.540  1.00 125.08 ? 210  GLY A CA  1 
ATOM   2068 C C   . GLY A 1 286 ? 83.754  8.879   30.467  1.00 125.94 ? 210  GLY A C   1 
ATOM   2069 O O   . GLY A 1 286 ? 82.592  9.093   30.111  1.00 123.70 ? 210  GLY A O   1 
ATOM   2070 N N   . ILE A 1 287 ? 84.203  7.647   30.789  1.00 122.35 ? 211  ILE A N   1 
ATOM   2071 C CA  . ILE A 1 287 ? 83.364  6.441   30.747  1.00 120.47 ? 211  ILE A CA  1 
ATOM   2072 C C   . ILE A 1 287 ? 82.342  6.486   31.926  1.00 125.64 ? 211  ILE A C   1 
ATOM   2073 O O   . ILE A 1 287 ? 81.249  5.940   31.779  1.00 123.90 ? 211  ILE A O   1 
ATOM   2074 C CB  . ILE A 1 287 ? 84.236  5.146   30.763  1.00 124.10 ? 211  ILE A CB  1 
ATOM   2075 C CG1 . ILE A 1 287 ? 85.169  5.096   29.523  1.00 124.66 ? 211  ILE A CG1 1 
ATOM   2076 C CG2 . ILE A 1 287 ? 83.402  3.857   30.856  1.00 123.15 ? 211  ILE A CG2 1 
ATOM   2077 C CD1 . ILE A 1 287 ? 84.471  5.100   28.082  1.00 128.49 ? 211  ILE A CD1 1 
ATOM   2078 N N   . ALA A 1 288 ? 82.660  7.188   33.042  1.00 124.63 ? 212  ALA A N   1 
ATOM   2079 C CA  . ALA A 1 288 ? 81.713  7.355   34.157  1.00 124.58 ? 212  ALA A CA  1 
ATOM   2080 C C   . ALA A 1 288 ? 80.517  8.217   33.714  1.00 126.99 ? 212  ALA A C   1 
ATOM   2081 O O   . ALA A 1 288 ? 79.379  7.906   34.072  1.00 125.74 ? 212  ALA A O   1 
ATOM   2082 C CB  . ALA A 1 288 ? 82.403  7.974   35.367  1.00 127.79 ? 212  ALA A CB  1 
ATOM   2083 N N   . LEU A 1 289 ? 80.777  9.268   32.892  1.00 123.22 ? 213  LEU A N   1 
ATOM   2084 C CA  . LEU A 1 289 ? 79.733  10.126  32.320  1.00 121.55 ? 213  LEU A CA  1 
ATOM   2085 C C   . LEU A 1 289 ? 78.875  9.340   31.314  1.00 122.04 ? 213  LEU A C   1 
ATOM   2086 O O   . LEU A 1 289 ? 77.669  9.571   31.249  1.00 121.05 ? 213  LEU A O   1 
ATOM   2087 C CB  . LEU A 1 289 ? 80.319  11.388  31.644  1.00 122.49 ? 213  LEU A CB  1 
ATOM   2088 C CG  . LEU A 1 289 ? 80.468  12.692  32.486  1.00 129.50 ? 213  LEU A CG  1 
ATOM   2089 C CD1 . LEU A 1 289 ? 79.110  13.249  32.930  1.00 129.03 ? 213  LEU A CD1 1 
ATOM   2090 C CD2 . LEU A 1 289 ? 81.380  12.524  33.672  1.00 134.33 ? 213  LEU A CD2 1 
ATOM   2091 N N   . MET A 1 290 ? 79.487  8.388   30.567  1.00 116.78 ? 214  MET A N   1 
ATOM   2092 C CA  . MET A 1 290 ? 78.791  7.509   29.614  1.00 114.29 ? 214  MET A CA  1 
ATOM   2093 C C   . MET A 1 290 ? 77.743  6.666   30.348  1.00 115.43 ? 214  MET A C   1 
ATOM   2094 O O   . MET A 1 290 ? 76.625  6.517   29.859  1.00 113.56 ? 214  MET A O   1 
ATOM   2095 C CB  . MET A 1 290 ? 79.802  6.604   28.872  1.00 117.03 ? 214  MET A CB  1 
ATOM   2096 C CG  . MET A 1 290 ? 79.165  5.594   27.914  1.00 119.30 ? 214  MET A CG  1 
ATOM   2097 S SD  . MET A 1 290 ? 80.390  4.504   27.138  1.00 124.16 ? 214  MET A SD  1 
ATOM   2098 C CE  . MET A 1 290 ? 79.314  3.404   26.243  1.00 119.05 ? 214  MET A CE  1 
ATOM   2099 N N   . LYS A 1 291 ? 78.103  6.157   31.539  1.00 111.72 ? 215  LYS A N   1 
ATOM   2100 C CA  . LYS A 1 291 ? 77.231  5.343   32.392  1.00 110.80 ? 215  LYS A CA  1 
ATOM   2101 C C   . LYS A 1 291 ? 75.979  6.117   32.804  1.00 112.42 ? 215  LYS A C   1 
ATOM   2102 O O   . LYS A 1 291 ? 74.875  5.583   32.718  1.00 110.82 ? 215  LYS A O   1 
ATOM   2103 C CB  . LYS A 1 291 ? 77.991  4.878   33.654  1.00 115.20 ? 215  LYS A CB  1 
ATOM   2104 C CG  . LYS A 1 291 ? 79.234  4.045   33.369  1.00 126.75 ? 215  LYS A CG  1 
ATOM   2105 C CD  . LYS A 1 291 ? 79.955  3.672   34.644  1.00 135.25 ? 215  LYS A CD  1 
ATOM   2106 C CE  . LYS A 1 291 ? 81.177  2.845   34.357  1.00 143.62 ? 215  LYS A CE  1 
ATOM   2107 N NZ  . LYS A 1 291 ? 81.848  2.418   35.608  1.00 151.71 ? 215  LYS A NZ  1 
ATOM   2108 N N   . ASN A 1 292 ? 76.159  7.388   33.224  1.00 108.39 ? 216  ASN A N   1 
ATOM   2109 C CA  . ASN A 1 292 ? 75.094  8.268   33.704  1.00 107.06 ? 216  ASN A CA  1 
ATOM   2110 C C   . ASN A 1 292 ? 74.144  8.689   32.576  1.00 107.20 ? 216  ASN A C   1 
ATOM   2111 O O   . ASN A 1 292 ? 72.936  8.561   32.748  1.00 106.24 ? 216  ASN A O   1 
ATOM   2112 C CB  . ASN A 1 292 ? 75.689  9.520   34.366  1.00 106.97 ? 216  ASN A CB  1 
ATOM   2113 C CG  . ASN A 1 292 ? 76.460  9.262   35.646  1.00 117.34 ? 216  ASN A CG  1 
ATOM   2114 O OD1 . ASN A 1 292 ? 77.313  10.061  36.047  1.00 113.21 ? 216  ASN A OD1 1 
ATOM   2115 N ND2 . ASN A 1 292 ? 76.200  8.135   36.310  1.00 101.71 ? 216  ASN A ND2 1 
ATOM   2116 N N   . ILE A 1 293 ? 74.678  9.176   31.439  1.00 101.70 ? 217  ILE A N   1 
ATOM   2117 C CA  . ILE A 1 293 ? 73.895  9.658   30.298  1.00 99.57  ? 217  ILE A CA  1 
ATOM   2118 C C   . ILE A 1 293 ? 73.126  8.492   29.611  1.00 101.17 ? 217  ILE A C   1 
ATOM   2119 O O   . ILE A 1 293 ? 71.904  8.557   29.509  1.00 100.17 ? 217  ILE A O   1 
ATOM   2120 C CB  . ILE A 1 293 ? 74.811  10.386  29.270  1.00 102.51 ? 217  ILE A CB  1 
ATOM   2121 C CG1 . ILE A 1 293 ? 75.559  11.565  29.929  1.00 104.63 ? 217  ILE A CG1 1 
ATOM   2122 C CG2 . ILE A 1 293 ? 73.996  10.870  28.058  1.00 101.78 ? 217  ILE A CG2 1 
ATOM   2123 C CD1 . ILE A 1 293 ? 76.659  12.221  29.054  1.00 113.05 ? 217  ILE A CD1 1 
ATOM   2124 N N   . LEU A 1 294 ? 73.839  7.455   29.143  1.00 96.67  ? 218  LEU A N   1 
ATOM   2125 C CA  . LEU A 1 294 ? 73.268  6.342   28.375  1.00 95.04  ? 218  LEU A CA  1 
ATOM   2126 C C   . LEU A 1 294 ? 72.452  5.363   29.251  1.00 98.66  ? 218  LEU A C   1 
ATOM   2127 O O   . LEU A 1 294 ? 71.457  4.816   28.773  1.00 97.21  ? 218  LEU A O   1 
ATOM   2128 C CB  . LEU A 1 294 ? 74.420  5.572   27.686  1.00 95.00  ? 218  LEU A CB  1 
ATOM   2129 C CG  . LEU A 1 294 ? 74.089  4.464   26.679  1.00 98.41  ? 218  LEU A CG  1 
ATOM   2130 C CD1 . LEU A 1 294 ? 73.337  5.011   25.473  1.00 97.61  ? 218  LEU A CD1 1 
ATOM   2131 C CD2 . LEU A 1 294 ? 75.355  3.802   26.188  1.00 100.20 ? 218  LEU A CD2 1 
ATOM   2132 N N   . GLY A 1 295 ? 72.889  5.135   30.491  1.00 96.44  ? 219  GLY A N   1 
ATOM   2133 C CA  . GLY A 1 295 ? 72.258  4.165   31.385  1.00 96.53  ? 219  GLY A CA  1 
ATOM   2134 C C   . GLY A 1 295 ? 71.239  4.680   32.383  1.00 100.17 ? 219  GLY A C   1 
ATOM   2135 O O   . GLY A 1 295 ? 70.559  3.873   33.027  1.00 100.29 ? 219  GLY A O   1 
ATOM   2136 N N   . PHE A 1 296 ? 71.116  6.016   32.541  1.00 95.85  ? 220  PHE A N   1 
ATOM   2137 C CA  . PHE A 1 296 ? 70.145  6.551   33.492  1.00 95.50  ? 220  PHE A CA  1 
ATOM   2138 C C   . PHE A 1 296 ? 69.446  7.800   32.926  1.00 97.74  ? 220  PHE A C   1 
ATOM   2139 O O   . PHE A 1 296 ? 68.227  7.772   32.795  1.00 96.41  ? 220  PHE A O   1 
ATOM   2140 C CB  . PHE A 1 296 ? 70.810  6.879   34.845  1.00 98.70  ? 220  PHE A CB  1 
ATOM   2141 C CG  . PHE A 1 296 ? 69.851  7.296   35.939  1.00 100.76 ? 220  PHE A CG  1 
ATOM   2142 C CD1 . PHE A 1 296 ? 69.132  6.345   36.656  1.00 103.99 ? 220  PHE A CD1 1 
ATOM   2143 C CD2 . PHE A 1 296 ? 69.715  8.634   36.294  1.00 103.17 ? 220  PHE A CD2 1 
ATOM   2144 C CE1 . PHE A 1 296 ? 68.254  6.729   37.672  1.00 106.01 ? 220  PHE A CE1 1 
ATOM   2145 C CE2 . PHE A 1 296 ? 68.839  9.017   37.312  1.00 106.97 ? 220  PHE A CE2 1 
ATOM   2146 C CZ  . PHE A 1 296 ? 68.114  8.061   37.994  1.00 105.70 ? 220  PHE A CZ  1 
ATOM   2147 N N   . ILE A 1 297 ? 70.203  8.876   32.596  1.00 94.63  ? 221  ILE A N   1 
ATOM   2148 C CA  . ILE A 1 297 ? 69.665  10.164  32.133  1.00 94.79  ? 221  ILE A CA  1 
ATOM   2149 C C   . ILE A 1 297 ? 68.716  9.955   30.924  1.00 98.42  ? 221  ILE A C   1 
ATOM   2150 O O   . ILE A 1 297 ? 67.527  10.243  31.066  1.00 98.35  ? 221  ILE A O   1 
ATOM   2151 C CB  . ILE A 1 297 ? 70.785  11.191  31.779  1.00 98.46  ? 221  ILE A CB  1 
ATOM   2152 C CG1 . ILE A 1 297 ? 71.779  11.429  32.962  1.00 100.97 ? 221  ILE A CG1 1 
ATOM   2153 C CG2 . ILE A 1 297 ? 70.208  12.515  31.251  1.00 98.91  ? 221  ILE A CG2 1 
ATOM   2154 C CD1 . ILE A 1 297 ? 71.178  11.949  34.337  1.00 112.53 ? 221  ILE A CD1 1 
ATOM   2155 N N   . ILE A 1 298 ? 69.225  9.457   29.768  1.00 94.07  ? 222  ILE A N   1 
ATOM   2156 C CA  . ILE A 1 298 ? 68.426  9.256   28.541  1.00 92.52  ? 222  ILE A CA  1 
ATOM   2157 C C   . ILE A 1 298 ? 67.232  8.281   28.827  1.00 96.25  ? 222  ILE A C   1 
ATOM   2158 O O   . ILE A 1 298 ? 66.098  8.706   28.600  1.00 95.57  ? 222  ILE A O   1 
ATOM   2159 C CB  . ILE A 1 298 ? 69.287  8.757   27.336  1.00 94.37  ? 222  ILE A CB  1 
ATOM   2160 C CG1 . ILE A 1 298 ? 70.304  9.846   26.914  1.00 94.73  ? 222  ILE A CG1 1 
ATOM   2161 C CG2 . ILE A 1 298 ? 68.392  8.350   26.144  1.00 93.60  ? 222  ILE A CG2 1 
ATOM   2162 C CD1 . ILE A 1 298 ? 71.270  9.454   25.827  1.00 103.65 ? 222  ILE A CD1 1 
ATOM   2163 N N   . PRO A 1 299 ? 67.409  7.031   29.345  1.00 93.16  ? 223  PRO A N   1 
ATOM   2164 C CA  . PRO A 1 299 ? 66.226  6.174   29.570  1.00 93.36  ? 223  PRO A CA  1 
ATOM   2165 C C   . PRO A 1 299 ? 65.217  6.790   30.550  1.00 98.31  ? 223  PRO A C   1 
ATOM   2166 O O   . PRO A 1 299 ? 64.020  6.629   30.333  1.00 98.35  ? 223  PRO A O   1 
ATOM   2167 C CB  . PRO A 1 299 ? 66.812  4.885   30.149  1.00 95.45  ? 223  PRO A CB  1 
ATOM   2168 C CG  . PRO A 1 299 ? 68.186  5.224   30.564  1.00 99.95  ? 223  PRO A CG  1 
ATOM   2169 C CD  . PRO A 1 299 ? 68.656  6.312   29.681  1.00 94.68  ? 223  PRO A CD  1 
ATOM   2170 N N   . LEU A 1 300 ? 65.685  7.527   31.587  1.00 95.29  ? 224  LEU A N   1 
ATOM   2171 C CA  . LEU A 1 300 ? 64.791  8.158   32.563  1.00 95.86  ? 224  LEU A CA  1 
ATOM   2172 C C   . LEU A 1 300 ? 63.997  9.285   31.879  1.00 97.69  ? 224  LEU A C   1 
ATOM   2173 O O   . LEU A 1 300 ? 62.831  9.453   32.215  1.00 97.77  ? 224  LEU A O   1 
ATOM   2174 C CB  . LEU A 1 300 ? 65.569  8.683   33.801  1.00 97.16  ? 224  LEU A CB  1 
ATOM   2175 C CG  . LEU A 1 300 ? 64.787  9.176   35.059  1.00 103.07 ? 224  LEU A CG  1 
ATOM   2176 C CD1 . LEU A 1 300 ? 64.391  10.642  34.977  1.00 103.65 ? 224  LEU A CD1 1 
ATOM   2177 C CD2 . LEU A 1 300 ? 63.667  8.218   35.474  1.00 104.94 ? 224  LEU A CD2 1 
ATOM   2178 N N   . ILE A 1 301 ? 64.594  10.005  30.887  1.00 92.47  ? 225  ILE A N   1 
ATOM   2179 C CA  . ILE A 1 301 ? 63.880  11.051  30.132  1.00 91.53  ? 225  ILE A CA  1 
ATOM   2180 C C   . ILE A 1 301 ? 62.641  10.411  29.493  1.00 94.49  ? 225  ILE A C   1 
ATOM   2181 O O   . ILE A 1 301 ? 61.541  10.910  29.707  1.00 94.92  ? 225  ILE A O   1 
ATOM   2182 C CB  . ILE A 1 301 ? 64.772  11.779  29.079  1.00 93.77  ? 225  ILE A CB  1 
ATOM   2183 C CG1 . ILE A 1 301 ? 65.875  12.613  29.779  1.00 95.08  ? 225  ILE A CG1 1 
ATOM   2184 C CG2 . ILE A 1 301 ? 63.918  12.686  28.176  1.00 94.11  ? 225  ILE A CG2 1 
ATOM   2185 C CD1 . ILE A 1 301 ? 66.918  13.316  28.838  1.00 102.70 ? 225  ILE A CD1 1 
ATOM   2186 N N   . PHE A 1 302 ? 62.814  9.264   28.796  1.00 89.51  ? 226  PHE A N   1 
ATOM   2187 C CA  . PHE A 1 302 ? 61.731  8.504   28.163  1.00 88.89  ? 226  PHE A CA  1 
ATOM   2188 C C   . PHE A 1 302 ? 60.690  8.016   29.175  1.00 94.87  ? 226  PHE A C   1 
ATOM   2189 O O   . PHE A 1 302 ? 59.500  8.244   28.962  1.00 95.99  ? 226  PHE A O   1 
ATOM   2190 C CB  . PHE A 1 302 ? 62.290  7.291   27.408  1.00 89.58  ? 226  PHE A CB  1 
ATOM   2191 C CG  . PHE A 1 302 ? 62.972  7.606   26.102  1.00 89.51  ? 226  PHE A CG  1 
ATOM   2192 C CD1 . PHE A 1 302 ? 64.296  8.024   26.073  1.00 91.82  ? 226  PHE A CD1 1 
ATOM   2193 C CD2 . PHE A 1 302 ? 62.311  7.421   24.893  1.00 90.75  ? 226  PHE A CD2 1 
ATOM   2194 C CE1 . PHE A 1 302 ? 64.930  8.303   24.861  1.00 91.80  ? 226  PHE A CE1 1 
ATOM   2195 C CE2 . PHE A 1 302 ? 62.944  7.698   23.682  1.00 92.45  ? 226  PHE A CE2 1 
ATOM   2196 C CZ  . PHE A 1 302 ? 64.251  8.134   23.672  1.00 90.25  ? 226  PHE A CZ  1 
ATOM   2197 N N   . ILE A 1 303 ? 61.133  7.358   30.269  1.00 91.86  ? 227  ILE A N   1 
ATOM   2198 C CA  . ILE A 1 303 ? 60.256  6.791   31.302  1.00 93.17  ? 227  ILE A CA  1 
ATOM   2199 C C   . ILE A 1 303 ? 59.423  7.922   31.973  1.00 98.55  ? 227  ILE A C   1 
ATOM   2200 O O   . ILE A 1 303 ? 58.209  7.753   32.136  1.00 98.80  ? 227  ILE A O   1 
ATOM   2201 C CB  . ILE A 1 303 ? 61.080  5.986   32.353  1.00 96.79  ? 227  ILE A CB  1 
ATOM   2202 C CG1 . ILE A 1 303 ? 61.834  4.813   31.663  1.00 96.42  ? 227  ILE A CG1 1 
ATOM   2203 C CG2 . ILE A 1 303 ? 60.169  5.453   33.474  1.00 99.08  ? 227  ILE A CG2 1 
ATOM   2204 C CD1 . ILE A 1 303 ? 62.821  4.032   32.538  1.00 104.52 ? 227  ILE A CD1 1 
ATOM   2205 N N   . ALA A 1 304 ? 60.060  9.067   32.320  1.00 95.64  ? 228  ALA A N   1 
ATOM   2206 C CA  . ALA A 1 304 ? 59.381  10.199  32.967  1.00 96.46  ? 228  ALA A CA  1 
ATOM   2207 C C   . ALA A 1 304 ? 58.390  10.870  32.021  1.00 99.13  ? 228  ALA A C   1 
ATOM   2208 O O   . ALA A 1 304 ? 57.262  11.123  32.435  1.00 100.11 ? 228  ALA A O   1 
ATOM   2209 C CB  . ALA A 1 304 ? 60.392  11.223  33.457  1.00 97.31  ? 228  ALA A CB  1 
ATOM   2210 N N   . THR A 1 305 ? 58.794  11.133  30.753  1.00 93.18  ? 229  THR A N   1 
ATOM   2211 C CA  . THR A 1 305 ? 57.945  11.785  29.749  1.00 92.45  ? 229  THR A CA  1 
ATOM   2212 C C   . THR A 1 305 ? 56.720  10.911  29.454  1.00 97.27  ? 229  THR A C   1 
ATOM   2213 O O   . THR A 1 305 ? 55.619  11.450  29.332  1.00 97.93  ? 229  THR A O   1 
ATOM   2214 C CB  . THR A 1 305 ? 58.734  12.084  28.468  1.00 95.30  ? 229  THR A CB  1 
ATOM   2215 O OG1 . THR A 1 305 ? 59.890  12.851  28.802  1.00 91.70  ? 229  THR A OG1 1 
ATOM   2216 C CG2 . THR A 1 305 ? 57.905  12.843  27.428  1.00 93.73  ? 229  THR A CG2 1 
ATOM   2217 N N   . CYS A 1 306 ? 56.898  9.573   29.382  1.00 93.35  ? 230  CYS A N   1 
ATOM   2218 C CA  . CYS A 1 306 ? 55.785  8.662   29.128  1.00 94.04  ? 230  CYS A CA  1 
ATOM   2219 C C   . CYS A 1 306 ? 54.856  8.610   30.346  1.00 101.13 ? 230  CYS A C   1 
ATOM   2220 O O   . CYS A 1 306 ? 53.661  8.418   30.152  1.00 101.78 ? 230  CYS A O   1 
ATOM   2221 C CB  . CYS A 1 306 ? 56.277  7.270   28.753  1.00 93.46  ? 230  CYS A CB  1 
ATOM   2222 S SG  . CYS A 1 306 ? 57.107  7.192   27.147  1.00 95.43  ? 230  CYS A SG  1 
ATOM   2223 N N   . TYR A 1 307 ? 55.377  8.815   31.579  1.00 99.52  ? 231  TYR A N   1 
ATOM   2224 C CA  . TYR A 1 307 ? 54.526  8.825   32.769  1.00 102.06 ? 231  TYR A CA  1 
ATOM   2225 C C   . TYR A 1 307 ? 53.622  10.049  32.779  1.00 109.00 ? 231  TYR A C   1 
ATOM   2226 O O   . TYR A 1 307 ? 52.410  9.897   32.918  1.00 109.58 ? 231  TYR A O   1 
ATOM   2227 C CB  . TYR A 1 307 ? 55.330  8.770   34.075  1.00 103.86 ? 231  TYR A CB  1 
ATOM   2228 C CG  . TYR A 1 307 ? 54.475  9.076   35.294  1.00 107.89 ? 231  TYR A CG  1 
ATOM   2229 C CD1 . TYR A 1 307 ? 53.499  8.182   35.730  1.00 111.20 ? 231  TYR A CD1 1 
ATOM   2230 C CD2 . TYR A 1 307 ? 54.648  10.256  36.015  1.00 109.39 ? 231  TYR A CD2 1 
ATOM   2231 C CE1 . TYR A 1 307 ? 52.684  8.476   36.823  1.00 113.85 ? 231  TYR A CE1 1 
ATOM   2232 C CE2 . TYR A 1 307 ? 53.854  10.550  37.125  1.00 112.24 ? 231  TYR A CE2 1 
ATOM   2233 C CZ  . TYR A 1 307 ? 52.877  9.653   37.529  1.00 121.32 ? 231  TYR A CZ  1 
ATOM   2234 O OH  . TYR A 1 307 ? 52.092  9.932   38.622  1.00 125.37 ? 231  TYR A OH  1 
ATOM   2235 N N   . PHE A 1 308 ? 54.205  11.256  32.658  1.00 107.18 ? 232  PHE A N   1 
ATOM   2236 C CA  . PHE A 1 308 ? 53.441  12.500  32.674  1.00 109.03 ? 232  PHE A CA  1 
ATOM   2237 C C   . PHE A 1 308 ? 52.606  12.633  31.384  1.00 114.57 ? 232  PHE A C   1 
ATOM   2238 O O   . PHE A 1 308 ? 51.591  13.325  31.395  1.00 115.42 ? 232  PHE A O   1 
ATOM   2239 C CB  . PHE A 1 308 ? 54.358  13.718  32.868  1.00 110.47 ? 232  PHE A CB  1 
ATOM   2240 C CG  . PHE A 1 308 ? 55.030  13.726  34.224  1.00 112.82 ? 232  PHE A CG  1 
ATOM   2241 C CD1 . PHE A 1 308 ? 54.325  14.089  35.367  1.00 117.75 ? 232  PHE A CD1 1 
ATOM   2242 C CD2 . PHE A 1 308 ? 56.379  13.426  34.352  1.00 114.14 ? 232  PHE A CD2 1 
ATOM   2243 C CE1 . PHE A 1 308 ? 54.944  14.092  36.621  1.00 119.35 ? 232  PHE A CE1 1 
ATOM   2244 C CE2 . PHE A 1 308 ? 57.000  13.436  35.605  1.00 117.69 ? 232  PHE A CE2 1 
ATOM   2245 C CZ  . PHE A 1 308 ? 56.280  13.776  36.730  1.00 117.36 ? 232  PHE A CZ  1 
ATOM   2246 N N   . GLY A 1 309 ? 53.000  11.914  30.330  1.00 111.01 ? 233  GLY A N   1 
ATOM   2247 C CA  . GLY A 1 309 ? 52.260  11.845  29.076  1.00 111.30 ? 233  GLY A CA  1 
ATOM   2248 C C   . GLY A 1 309 ? 50.976  11.061  29.262  1.00 118.55 ? 233  GLY A C   1 
ATOM   2249 O O   . GLY A 1 309 ? 49.920  11.471  28.770  1.00 119.54 ? 233  GLY A O   1 
ATOM   2250 N N   . ILE A 1 310 ? 51.060  9.938   30.014  1.00 116.50 ? 234  ILE A N   1 
ATOM   2251 C CA  . ILE A 1 310 ? 49.920  9.091   30.391  1.00 118.64 ? 234  ILE A CA  1 
ATOM   2252 C C   . ILE A 1 310 ? 49.070  9.856   31.422  1.00 125.00 ? 234  ILE A C   1 
ATOM   2253 O O   . ILE A 1 310 ? 47.863  9.983   31.233  1.00 126.70 ? 234  ILE A O   1 
ATOM   2254 C CB  . ILE A 1 310 ? 50.389  7.697   30.926  1.00 121.86 ? 234  ILE A CB  1 
ATOM   2255 C CG1 . ILE A 1 310 ? 51.050  6.864   29.795  1.00 120.81 ? 234  ILE A CG1 1 
ATOM   2256 C CG2 . ILE A 1 310 ? 49.212  6.918   31.547  1.00 125.03 ? 234  ILE A CG2 1 
ATOM   2257 C CD1 . ILE A 1 310 ? 51.723  5.529   30.236  1.00 128.14 ? 234  ILE A CD1 1 
ATOM   2258 N N   . ARG A 1 311 ? 49.723  10.413  32.471  1.00 121.44 ? 235  ARG A N   1 
ATOM   2259 C CA  . ARG A 1 311 ? 49.116  11.200  33.555  1.00 122.98 ? 235  ARG A CA  1 
ATOM   2260 C C   . ARG A 1 311 ? 48.270  12.352  32.982  1.00 127.84 ? 235  ARG A C   1 
ATOM   2261 O O   . ARG A 1 311 ? 47.209  12.643  33.524  1.00 129.57 ? 235  ARG A O   1 
ATOM   2262 C CB  . ARG A 1 311 ? 50.228  11.743  34.478  1.00 122.56 ? 235  ARG A CB  1 
ATOM   2263 C CG  . ARG A 1 311 ? 49.793  12.560  35.697  1.00 135.19 ? 235  ARG A CG  1 
ATOM   2264 C CD  . ARG A 1 311 ? 51.016  12.915  36.533  1.00 145.46 ? 235  ARG A CD  1 
ATOM   2265 N NE  . ARG A 1 311 ? 50.713  13.784  37.673  1.00 156.19 ? 235  ARG A NE  1 
ATOM   2266 C CZ  . ARG A 1 311 ? 50.824  15.110  37.659  1.00 170.08 ? 235  ARG A CZ  1 
ATOM   2267 N NH1 . ARG A 1 311 ? 51.237  15.736  36.562  1.00 155.45 ? 235  ARG A NH1 1 
ATOM   2268 N NH2 . ARG A 1 311 ? 50.536  15.819  38.742  1.00 157.85 ? 235  ARG A NH2 1 
ATOM   2269 N N   . LYS A 1 312 ? 48.713  12.957  31.861  1.00 122.98 ? 236  LYS A N   1 
ATOM   2270 C CA  . LYS A 1 312 ? 48.018  14.050  31.176  1.00 123.18 ? 236  LYS A CA  1 
ATOM   2271 C C   . LYS A 1 312 ? 46.687  13.578  30.573  1.00 127.94 ? 236  LYS A C   1 
ATOM   2272 O O   . LYS A 1 312 ? 45.660  14.210  30.811  1.00 128.89 ? 236  LYS A O   1 
ATOM   2273 C CB  . LYS A 1 312 ? 48.914  14.635  30.062  1.00 123.93 ? 236  LYS A CB  1 
ATOM   2274 C CG  . LYS A 1 312 ? 48.305  15.827  29.308  1.00 139.04 ? 236  LYS A CG  1 
ATOM   2275 C CD  . LYS A 1 312 ? 49.110  16.239  28.064  1.00 148.09 ? 236  LYS A CD  1 
ATOM   2276 C CE  . LYS A 1 312 ? 49.116  15.194  26.960  1.00 157.25 ? 236  LYS A CE  1 
ATOM   2277 N NZ  . LYS A 1 312 ? 49.914  15.638  25.787  1.00 164.49 ? 236  LYS A NZ  1 
ATOM   2278 N N   . HIS A 1 313 ? 46.719  12.479  29.786  1.00 124.34 ? 237  HIS A N   1 
ATOM   2279 C CA  . HIS A 1 313 ? 45.570  11.937  29.056  1.00 125.88 ? 237  HIS A CA  1 
ATOM   2280 C C   . HIS A 1 313 ? 44.484  11.413  30.022  1.00 131.97 ? 237  HIS A C   1 
ATOM   2281 O O   . HIS A 1 313 ? 43.298  11.517  29.706  1.00 133.47 ? 237  HIS A O   1 
ATOM   2282 C CB  . HIS A 1 313 ? 46.018  10.812  28.105  1.00 125.72 ? 237  HIS A CB  1 
ATOM   2283 C CG  . HIS A 1 313 ? 44.979  10.422  27.094  1.00 130.61 ? 237  HIS A CG  1 
ATOM   2284 N ND1 . HIS A 1 313 ? 44.030  9.447   27.364  1.00 134.50 ? 237  HIS A ND1 1 
ATOM   2285 C CD2 . HIS A 1 313 ? 44.769  10.900  25.844  1.00 132.03 ? 237  HIS A CD2 1 
ATOM   2286 C CE1 . HIS A 1 313 ? 43.284  9.360   26.273  1.00 134.71 ? 237  HIS A CE1 1 
ATOM   2287 N NE2 . HIS A 1 313 ? 43.690  10.214  25.331  1.00 133.61 ? 237  HIS A NE2 1 
ATOM   2288 N N   . LEU A 1 314 ? 44.875  10.874  31.186  1.00 128.62 ? 238  LEU A N   1 
ATOM   2289 C CA  . LEU A 1 314 ? 43.901  10.371  32.161  1.00 131.03 ? 238  LEU A CA  1 
ATOM   2290 C C   . LEU A 1 314 ? 43.244  11.506  32.962  1.00 135.91 ? 238  LEU A C   1 
ATOM   2291 O O   . LEU A 1 314 ? 42.059  11.383  33.263  1.00 138.37 ? 238  LEU A O   1 
ATOM   2292 C CB  . LEU A 1 314 ? 44.521  9.365   33.153  1.00 131.11 ? 238  LEU A CB  1 
ATOM   2293 C CG  . LEU A 1 314 ? 44.679  7.879   32.734  1.00 135.61 ? 238  LEU A CG  1 
ATOM   2294 C CD1 . LEU A 1 314 ? 43.337  7.207   32.468  1.00 138.35 ? 238  LEU A CD1 1 
ATOM   2295 C CD2 . LEU A 1 314 ? 45.618  7.686   31.571  1.00 135.18 ? 238  LEU A CD2 1 
ATOM   2296 N N   . LEU A 1 315 ? 44.007  12.546  33.373  1.00 130.46 ? 239  LEU A N   1 
ATOM   2297 C CA  . LEU A 1 315 ? 43.470  13.640  34.191  1.00 131.68 ? 239  LEU A CA  1 
ATOM   2298 C C   . LEU A 1 315 ? 42.575  14.585  33.359  1.00 136.28 ? 239  LEU A C   1 
ATOM   2299 O O   . LEU A 1 315 ? 41.641  15.155  33.932  1.00 138.10 ? 239  LEU A O   1 
ATOM   2300 C CB  . LEU A 1 315 ? 44.583  14.459  34.880  1.00 130.33 ? 239  LEU A CB  1 
ATOM   2301 C CG  . LEU A 1 315 ? 45.402  13.755  35.986  1.00 134.35 ? 239  LEU A CG  1 
ATOM   2302 C CD1 . LEU A 1 315 ? 46.531  14.637  36.468  1.00 133.34 ? 239  LEU A CD1 1 
ATOM   2303 C CD2 . LEU A 1 315 ? 44.530  13.344  37.169  1.00 139.43 ? 239  LEU A CD2 1 
ATOM   2304 N N   . LYS A 1 316 ? 42.831  14.738  32.029  1.00 130.84 ? 240  LYS A N   1 
ATOM   2305 C CA  . LYS A 1 316 ? 41.991  15.600  31.180  1.00 131.38 ? 240  LYS A CA  1 
ATOM   2306 C C   . LYS A 1 316 ? 40.605  14.930  30.994  1.00 138.20 ? 240  LYS A C   1 
ATOM   2307 O O   . LYS A 1 316 ? 39.588  15.629  30.936  1.00 139.82 ? 240  LYS A O   1 
ATOM   2308 C CB  . LYS A 1 316 ? 42.651  15.933  29.818  1.00 131.34 ? 240  LYS A CB  1 
ATOM   2309 C CG  . LYS A 1 316 ? 42.951  14.743  28.897  1.00 140.70 ? 240  LYS A CG  1 
ATOM   2310 C CD  . LYS A 1 316 ? 43.561  15.147  27.533  1.00 146.17 ? 240  LYS A CD  1 
ATOM   2311 C CE  . LYS A 1 316 ? 44.935  15.781  27.610  1.00 150.18 ? 240  LYS A CE  1 
ATOM   2312 N NZ  . LYS A 1 316 ? 45.470  16.112  26.264  1.00 153.63 ? 240  LYS A NZ  1 
ATOM   2313 N N   . THR A 1 317 ? 40.574  13.576  30.967  1.00 134.93 ? 241  THR A N   1 
ATOM   2314 C CA  . THR A 1 317 ? 39.339  12.796  30.908  1.00 137.43 ? 241  THR A CA  1 
ATOM   2315 C C   . THR A 1 317 ? 38.739  12.814  32.318  1.00 143.24 ? 241  THR A C   1 
ATOM   2316 O O   . THR A 1 317 ? 39.352  12.288  33.252  1.00 142.83 ? 241  THR A O   1 
ATOM   2317 C CB  . THR A 1 317 ? 39.628  11.388  30.365  1.00 144.50 ? 241  THR A CB  1 
ATOM   2318 N N   . ASN A 1 318 ? 37.594  13.492  32.494  1.00 141.24 ? 242  ASN A N   1 
ATOM   2319 C CA  . ASN A 1 318 ? 36.984  13.662  33.812  1.00 143.01 ? 242  ASN A CA  1 
ATOM   2320 C C   . ASN A 1 318 ? 36.409  12.332  34.354  1.00 148.20 ? 242  ASN A C   1 
ATOM   2321 O O   . ASN A 1 318 ? 35.412  11.813  33.843  1.00 149.70 ? 242  ASN A O   1 
ATOM   2322 C CB  . ASN A 1 318 ? 35.882  14.723  33.764  1.00 145.85 ? 242  ASN A CB  1 
ATOM   2323 C CG  . ASN A 1 318 ? 35.229  15.035  35.095  1.00 168.33 ? 242  ASN A CG  1 
ATOM   2324 O OD1 . ASN A 1 318 ? 34.039  15.312  35.160  1.00 162.49 ? 242  ASN A OD1 1 
ATOM   2325 N ND2 . ASN A 1 318 ? 35.967  14.941  36.195  1.00 161.17 ? 242  ASN A ND2 1 
ATOM   2326 N N   . SER A 1 319 ? 37.048  11.817  35.420  1.00 144.02 ? 243  SER A N   1 
ATOM   2327 C CA  . SER A 1 319 ? 36.653  10.608  36.146  1.00 145.67 ? 243  SER A CA  1 
ATOM   2328 C C   . SER A 1 319 ? 36.148  10.996  37.546  1.00 151.23 ? 243  SER A C   1 
ATOM   2329 O O   . SER A 1 319 ? 36.730  11.893  38.162  1.00 149.23 ? 243  SER A O   1 
ATOM   2330 C CB  . SER A 1 319 ? 37.822  9.632   36.223  1.00 146.75 ? 243  SER A CB  1 
ATOM   2331 N N   . TYR A 1 320 ? 35.056  10.361  38.040  1.00 151.30 ? 244  TYR A N   1 
ATOM   2332 C CA  . TYR A 1 320 ? 34.475  10.769  39.326  1.00 154.08 ? 244  TYR A CA  1 
ATOM   2333 C C   . TYR A 1 320 ? 33.760  9.614   40.091  1.00 161.63 ? 244  TYR A C   1 
ATOM   2334 O O   . TYR A 1 320 ? 33.707  9.665   41.324  1.00 162.24 ? 244  TYR A O   1 
ATOM   2335 C CB  . TYR A 1 320 ? 33.460  11.914  39.113  1.00 157.58 ? 244  TYR A CB  1 
ATOM   2336 C CG  . TYR A 1 320 ? 32.492  11.721  37.959  1.00 160.65 ? 244  TYR A CG  1 
ATOM   2337 C CD1 . TYR A 1 320 ? 32.820  12.140  36.671  1.00 160.42 ? 244  TYR A CD1 1 
ATOM   2338 C CD2 . TYR A 1 320 ? 31.215  11.212  38.171  1.00 165.04 ? 244  TYR A CD2 1 
ATOM   2339 C CE1 . TYR A 1 320 ? 31.925  11.999  35.613  1.00 162.53 ? 244  TYR A CE1 1 
ATOM   2340 C CE2 . TYR A 1 320 ? 30.308  11.068  37.120  1.00 167.41 ? 244  TYR A CE2 1 
ATOM   2341 C CZ  . TYR A 1 320 ? 30.668  11.466  35.842  1.00 171.81 ? 244  TYR A CZ  1 
ATOM   2342 O OH  . TYR A 1 320 ? 29.785  11.333  34.797  1.00 173.55 ? 244  TYR A OH  1 
ATOM   2343 N N   . GLY A 1 321 ? 33.211  8.628   39.383  1.00 160.20 ? 245  GLY A N   1 
ATOM   2344 C CA  . GLY A 1 321 ? 32.516  7.509   40.019  1.00 163.35 ? 245  GLY A CA  1 
ATOM   2345 C C   . GLY A 1 321 ? 33.405  6.296   40.196  1.00 166.38 ? 245  GLY A C   1 
ATOM   2346 O O   . GLY A 1 321 ? 34.438  6.373   40.870  1.00 164.03 ? 245  GLY A O   1 
ATOM   2347 N N   . LYS A 1 322 ? 33.008  5.161   39.579  1.00 164.26 ? 246  LYS A N   1 
ATOM   2348 C CA  . LYS A 1 322 ? 33.779  3.909   39.553  1.00 162.68 ? 246  LYS A CA  1 
ATOM   2349 C C   . LYS A 1 322 ? 35.022  4.135   38.685  1.00 161.61 ? 246  LYS A C   1 
ATOM   2350 O O   . LYS A 1 322 ? 36.098  3.622   38.992  1.00 158.83 ? 246  LYS A O   1 
ATOM   2351 C CB  . LYS A 1 322 ? 32.885  2.746   39.033  1.00 168.17 ? 246  LYS A CB  1 
ATOM   2352 C CG  . LYS A 1 322 ? 33.525  1.341   38.914  1.00 180.54 ? 246  LYS A CG  1 
ATOM   2353 C CD  . LYS A 1 322 ? 34.388  1.134   37.651  1.00 184.79 ? 246  LYS A CD  1 
ATOM   2354 C CE  . LYS A 1 322 ? 34.982  -0.250  37.559  1.00 192.22 ? 246  LYS A CE  1 
ATOM   2355 N NZ  . LYS A 1 322 ? 35.833  -0.402  36.346  1.00 196.84 ? 246  LYS A NZ  1 
ATOM   2356 N N   . ASN A 1 323 ? 34.862  4.959   37.628  1.00 156.92 ? 247  ASN A N   1 
ATOM   2357 C CA  . ASN A 1 323 ? 35.891  5.348   36.667  1.00 152.86 ? 247  ASN A CA  1 
ATOM   2358 C C   . ASN A 1 323 ? 37.060  6.076   37.348  1.00 153.52 ? 247  ASN A C   1 
ATOM   2359 O O   . ASN A 1 323 ? 38.171  6.033   36.821  1.00 150.48 ? 247  ASN A O   1 
ATOM   2360 C CB  . ASN A 1 323 ? 35.284  6.253   35.583  1.00 154.43 ? 247  ASN A CB  1 
ATOM   2361 C CG  . ASN A 1 323 ? 34.147  5.641   34.788  1.00 183.22 ? 247  ASN A CG  1 
ATOM   2362 O OD1 . ASN A 1 323 ? 33.981  4.417   34.706  1.00 179.13 ? 247  ASN A OD1 1 
ATOM   2363 N ND2 . ASN A 1 323 ? 33.371  6.489   34.130  1.00 177.16 ? 247  ASN A ND2 1 
ATOM   2364 N N   . ARG A 1 324 ? 36.817  6.746   38.504  1.00 150.56 ? 248  ARG A N   1 
ATOM   2365 C CA  . ARG A 1 324 ? 37.865  7.464   39.242  1.00 147.93 ? 248  ARG A CA  1 
ATOM   2366 C C   . ARG A 1 324 ? 38.792  6.463   39.920  1.00 150.80 ? 248  ARG A C   1 
ATOM   2367 O O   . ARG A 1 324 ? 40.008  6.672   39.952  1.00 147.86 ? 248  ARG A O   1 
ATOM   2368 C CB  . ARG A 1 324 ? 37.262  8.436   40.270  1.00 149.97 ? 248  ARG A CB  1 
ATOM   2369 C CG  . ARG A 1 324 ? 38.296  9.374   40.884  1.00 157.02 ? 248  ARG A CG  1 
ATOM   2370 C CD  . ARG A 1 324 ? 37.682  10.388  41.825  1.00 168.35 ? 248  ARG A CD  1 
ATOM   2371 N NE  . ARG A 1 324 ? 38.684  11.348  42.291  1.00 175.54 ? 248  ARG A NE  1 
ATOM   2372 C CZ  . ARG A 1 324 ? 38.965  12.496  41.679  1.00 189.54 ? 248  ARG A CZ  1 
ATOM   2373 N NH1 . ARG A 1 324 ? 38.312  12.847  40.577  1.00 176.95 ? 248  ARG A NH1 1 
ATOM   2374 N NH2 . ARG A 1 324 ? 39.895  13.304  42.167  1.00 176.19 ? 248  ARG A NH2 1 
ATOM   2375 N N   . ILE A 1 325 ? 38.214  5.361   40.436  1.00 149.47 ? 249  ILE A N   1 
ATOM   2376 C CA  . ILE A 1 325 ? 38.951  4.269   41.075  1.00 148.66 ? 249  ILE A CA  1 
ATOM   2377 C C   . ILE A 1 325 ? 39.780  3.553   39.990  1.00 149.11 ? 249  ILE A C   1 
ATOM   2378 O O   . ILE A 1 325 ? 40.943  3.230   40.225  1.00 146.57 ? 249  ILE A O   1 
ATOM   2379 C CB  . ILE A 1 325 ? 37.977  3.306   41.827  1.00 155.53 ? 249  ILE A CB  1 
ATOM   2380 C CG1 . ILE A 1 325 ? 37.060  4.086   42.820  1.00 158.56 ? 249  ILE A CG1 1 
ATOM   2381 C CG2 . ILE A 1 325 ? 38.751  2.177   42.534  1.00 156.18 ? 249  ILE A CG2 1 
ATOM   2382 C CD1 . ILE A 1 325 ? 35.927  3.258   43.512  1.00 169.83 ? 249  ILE A CD1 1 
ATOM   2383 N N   . THR A 1 326 ? 39.188  3.383   38.782  1.00 145.34 ? 250  THR A N   1 
ATOM   2384 C CA  . THR A 1 326 ? 39.811  2.748   37.615  1.00 142.78 ? 250  THR A CA  1 
ATOM   2385 C C   . THR A 1 326 ? 40.951  3.639   37.073  1.00 141.56 ? 250  THR A C   1 
ATOM   2386 O O   . THR A 1 326 ? 41.977  3.104   36.651  1.00 139.02 ? 250  THR A O   1 
ATOM   2387 C CB  . THR A 1 326 ? 38.738  2.479   36.533  1.00 154.52 ? 250  THR A CB  1 
ATOM   2388 O OG1 . THR A 1 326 ? 37.670  1.723   37.105  1.00 157.69 ? 250  THR A OG1 1 
ATOM   2389 C CG2 . THR A 1 326 ? 39.287  1.736   35.313  1.00 152.13 ? 250  THR A CG2 1 
ATOM   2390 N N   . ARG A 1 327 ? 40.772  4.982   37.098  1.00 136.56 ? 251  ARG A N   1 
ATOM   2391 C CA  . ARG A 1 327 ? 41.765  5.950   36.609  1.00 132.89 ? 251  ARG A CA  1 
ATOM   2392 C C   . ARG A 1 327 ? 43.024  5.961   37.492  1.00 134.62 ? 251  ARG A C   1 
ATOM   2393 O O   . ARG A 1 327 ? 44.137  5.911   36.964  1.00 131.42 ? 251  ARG A O   1 
ATOM   2394 C CB  . ARG A 1 327 ? 41.162  7.366   36.561  1.00 132.74 ? 251  ARG A CB  1 
ATOM   2395 C CG  . ARG A 1 327 ? 42.066  8.418   35.915  1.00 137.88 ? 251  ARG A CG  1 
ATOM   2396 C CD  . ARG A 1 327 ? 41.588  9.826   36.208  1.00 145.36 ? 251  ARG A CD  1 
ATOM   2397 N NE  . ARG A 1 327 ? 41.727  10.154  37.631  1.00 153.25 ? 251  ARG A NE  1 
ATOM   2398 C CZ  . ARG A 1 327 ? 41.343  11.299  38.184  1.00 169.85 ? 251  ARG A CZ  1 
ATOM   2399 N NH1 . ARG A 1 327 ? 40.759  12.238  37.448  1.00 160.62 ? 251  ARG A NH1 1 
ATOM   2400 N NH2 . ARG A 1 327 ? 41.521  11.508  39.481  1.00 156.28 ? 251  ARG A NH2 1 
ATOM   2401 N N   . ASP A 1 328 ? 42.843  6.058   38.829  1.00 132.55 ? 252  ASP A N   1 
ATOM   2402 C CA  . ASP A 1 328 ? 43.938  6.139   39.795  1.00 131.13 ? 252  ASP A CA  1 
ATOM   2403 C C   . ASP A 1 328 ? 44.743  4.832   39.856  1.00 133.79 ? 252  ASP A C   1 
ATOM   2404 O O   . ASP A 1 328 ? 45.958  4.912   40.034  1.00 131.54 ? 252  ASP A O   1 
ATOM   2405 C CB  . ASP A 1 328 ? 43.420  6.491   41.197  1.00 135.34 ? 252  ASP A CB  1 
ATOM   2406 C CG  . ASP A 1 328 ? 42.831  7.891   41.329  1.00 146.32 ? 252  ASP A CG  1 
ATOM   2407 O OD1 . ASP A 1 328 ? 42.662  8.570   40.288  1.00 145.69 ? 252  ASP A OD1 1 
ATOM   2408 O OD2 . ASP A 1 328 ? 42.545  8.310   42.473  1.00 154.53 ? 252  ASP A OD2 1 
ATOM   2409 N N   . GLN A 1 329 ? 44.102  3.649   39.671  1.00 131.15 ? 253  GLN A N   1 
ATOM   2410 C CA  . GLN A 1 329 ? 44.834  2.372   39.695  1.00 130.06 ? 253  GLN A CA  1 
ATOM   2411 C C   . GLN A 1 329 ? 45.762  2.257   38.467  1.00 131.00 ? 253  GLN A C   1 
ATOM   2412 O O   . GLN A 1 329 ? 46.836  1.671   38.585  1.00 129.55 ? 253  GLN A O   1 
ATOM   2413 C CB  . GLN A 1 329 ? 43.898  1.156   39.770  1.00 134.01 ? 253  GLN A CB  1 
ATOM   2414 C CG  . GLN A 1 329 ? 43.145  1.047   41.103  1.00 152.52 ? 253  GLN A CG  1 
ATOM   2415 C CD  . GLN A 1 329 ? 42.366  -0.247  41.255  1.00 173.49 ? 253  GLN A CD  1 
ATOM   2416 O OE1 . GLN A 1 329 ? 42.813  -1.330  40.864  1.00 170.18 ? 253  GLN A OE1 1 
ATOM   2417 N NE2 . GLN A 1 329 ? 41.239  -0.185  41.942  1.00 166.11 ? 253  GLN A NE2 1 
ATOM   2418 N N   . VAL A 1 330 ? 45.377  2.857   37.317  1.00 126.12 ? 254  VAL A N   1 
ATOM   2419 C CA  . VAL A 1 330 ? 46.209  2.897   36.103  1.00 122.77 ? 254  VAL A CA  1 
ATOM   2420 C C   . VAL A 1 330 ? 47.419  3.817   36.381  1.00 123.00 ? 254  VAL A C   1 
ATOM   2421 O O   . VAL A 1 330 ? 48.545  3.478   36.011  1.00 120.28 ? 254  VAL A O   1 
ATOM   2422 C CB  . VAL A 1 330 ? 45.394  3.347   34.850  1.00 126.82 ? 254  VAL A CB  1 
ATOM   2423 C CG1 . VAL A 1 330 ? 46.284  3.545   33.625  1.00 123.83 ? 254  VAL A CG1 1 
ATOM   2424 C CG2 . VAL A 1 330 ? 44.279  2.359   34.536  1.00 129.17 ? 254  VAL A CG2 1 
ATOM   2425 N N   . LEU A 1 331 ? 47.181  4.944   37.091  1.00 119.79 ? 255  LEU A N   1 
ATOM   2426 C CA  . LEU A 1 331 ? 48.219  5.903   37.481  1.00 117.93 ? 255  LEU A CA  1 
ATOM   2427 C C   . LEU A 1 331 ? 49.168  5.294   38.511  1.00 121.46 ? 255  LEU A C   1 
ATOM   2428 O O   . LEU A 1 331 ? 50.358  5.608   38.477  1.00 119.01 ? 255  LEU A O   1 
ATOM   2429 C CB  . LEU A 1 331 ? 47.608  7.199   38.039  1.00 119.04 ? 255  LEU A CB  1 
ATOM   2430 C CG  . LEU A 1 331 ? 46.843  8.083   37.050  1.00 123.76 ? 255  LEU A CG  1 
ATOM   2431 C CD1 . LEU A 1 331 ? 46.117  9.205   37.769  1.00 125.58 ? 255  LEU A CD1 1 
ATOM   2432 C CD2 . LEU A 1 331 ? 47.768  8.649   35.974  1.00 122.85 ? 255  LEU A CD2 1 
ATOM   2433 N N   . LYS A 1 332 ? 48.650  4.423   39.418  1.00 120.25 ? 256  LYS A N   1 
ATOM   2434 C CA  . LYS A 1 332 ? 49.462  3.723   40.423  1.00 120.30 ? 256  LYS A CA  1 
ATOM   2435 C C   . LYS A 1 332 ? 50.432  2.762   39.734  1.00 122.32 ? 256  LYS A C   1 
ATOM   2436 O O   . LYS A 1 332 ? 51.600  2.702   40.120  1.00 121.07 ? 256  LYS A O   1 
ATOM   2437 C CB  . LYS A 1 332 ? 48.596  2.965   41.449  1.00 125.85 ? 256  LYS A CB  1 
ATOM   2438 C CG  . LYS A 1 332 ? 47.810  3.856   42.404  1.00 145.89 ? 256  LYS A CG  1 
ATOM   2439 C CD  . LYS A 1 332 ? 46.979  3.024   43.389  1.00 160.92 ? 256  LYS A CD  1 
ATOM   2440 C CE  . LYS A 1 332 ? 46.146  3.851   44.351  1.00 172.25 ? 256  LYS A CE  1 
ATOM   2441 N NZ  . LYS A 1 332 ? 45.107  4.665   43.659  1.00 179.04 ? 256  LYS A NZ  1 
ATOM   2442 N N   . MET A 1 333 ? 49.958  2.047   38.686  1.00 118.22 ? 257  MET A N   1 
ATOM   2443 C CA  . MET A 1 333 ? 50.776  1.128   37.882  1.00 116.45 ? 257  MET A CA  1 
ATOM   2444 C C   . MET A 1 333 ? 51.810  1.900   37.051  1.00 117.81 ? 257  MET A C   1 
ATOM   2445 O O   . MET A 1 333 ? 52.898  1.384   36.785  1.00 115.51 ? 257  MET A O   1 
ATOM   2446 C CB  . MET A 1 333 ? 49.894  0.274   36.958  1.00 119.57 ? 257  MET A CB  1 
ATOM   2447 C CG  . MET A 1 333 ? 48.985  -0.663  37.701  1.00 125.92 ? 257  MET A CG  1 
ATOM   2448 S SD  . MET A 1 333 ? 47.936  -1.621  36.602  1.00 131.64 ? 257  MET A SD  1 
ATOM   2449 C CE  . MET A 1 333 ? 47.024  -2.541  37.792  1.00 131.83 ? 257  MET A CE  1 
ATOM   2450 N N   . ALA A 1 334 ? 51.457  3.137   36.650  1.00 114.62 ? 258  ALA A N   1 
ATOM   2451 C CA  . ALA A 1 334 ? 52.295  4.033   35.858  1.00 112.55 ? 258  ALA A CA  1 
ATOM   2452 C C   . ALA A 1 334 ? 53.403  4.665   36.716  1.00 116.25 ? 258  ALA A C   1 
ATOM   2453 O O   . ALA A 1 334 ? 54.542  4.769   36.261  1.00 114.03 ? 258  ALA A O   1 
ATOM   2454 C CB  . ALA A 1 334 ? 51.436  5.124   35.229  1.00 113.32 ? 258  ALA A CB  1 
ATOM   2455 N N   . ALA A 1 335 ? 53.068  5.088   37.949  1.00 114.64 ? 259  ALA A N   1 
ATOM   2456 C CA  . ALA A 1 335 ? 54.017  5.715   38.870  1.00 114.35 ? 259  ALA A CA  1 
ATOM   2457 C C   . ALA A 1 335 ? 54.985  4.690   39.450  1.00 118.86 ? 259  ALA A C   1 
ATOM   2458 O O   . ALA A 1 335 ? 56.058  5.063   39.915  1.00 118.01 ? 259  ALA A O   1 
ATOM   2459 C CB  . ALA A 1 335 ? 53.268  6.412   39.994  1.00 116.87 ? 259  ALA A CB  1 
ATOM   2460 N N   . ALA A 1 336 ? 54.604  3.406   39.432  1.00 116.24 ? 260  ALA A N   1 
ATOM   2461 C CA  . ALA A 1 336 ? 55.418  2.331   39.978  1.00 116.21 ? 260  ALA A CA  1 
ATOM   2462 C C   . ALA A 1 336 ? 56.601  1.986   39.059  1.00 118.22 ? 260  ALA A C   1 
ATOM   2463 O O   . ALA A 1 336 ? 57.635  1.562   39.570  1.00 117.63 ? 260  ALA A O   1 
ATOM   2464 C CB  . ALA A 1 336 ? 54.565  1.099   40.200  1.00 118.66 ? 260  ALA A CB  1 
ATOM   2465 N N   . VAL A 1 337 ? 56.469  2.166   37.723  1.00 113.41 ? 261  VAL A N   1 
ATOM   2466 C CA  . VAL A 1 337 ? 57.560  1.812   36.800  1.00 111.45 ? 261  VAL A CA  1 
ATOM   2467 C C   . VAL A 1 337 ? 58.665  2.906   36.842  1.00 113.27 ? 261  VAL A C   1 
ATOM   2468 O O   . VAL A 1 337 ? 59.839  2.565   36.680  1.00 112.25 ? 261  VAL A O   1 
ATOM   2469 C CB  . VAL A 1 337 ? 57.109  1.544   35.329  1.00 114.76 ? 261  VAL A CB  1 
ATOM   2470 C CG1 . VAL A 1 337 ? 56.156  0.355   35.250  1.00 115.92 ? 261  VAL A CG1 1 
ATOM   2471 C CG2 . VAL A 1 337 ? 56.491  2.776   34.671  1.00 114.22 ? 261  VAL A CG2 1 
ATOM   2472 N N   . VAL A 1 338 ? 58.301  4.190   37.082  1.00 109.04 ? 262  VAL A N   1 
ATOM   2473 C CA  . VAL A 1 338 ? 59.274  5.288   37.125  1.00 107.55 ? 262  VAL A CA  1 
ATOM   2474 C C   . VAL A 1 338 ? 59.966  5.289   38.519  1.00 112.69 ? 262  VAL A C   1 
ATOM   2475 O O   . VAL A 1 338 ? 61.194  5.358   38.560  1.00 111.77 ? 262  VAL A O   1 
ATOM   2476 C CB  . VAL A 1 338 ? 58.664  6.680   36.775  1.00 110.95 ? 262  VAL A CB  1 
ATOM   2477 C CG1 . VAL A 1 338 ? 57.442  7.016   37.625  1.00 112.71 ? 262  VAL A CG1 1 
ATOM   2478 C CG2 . VAL A 1 338 ? 59.703  7.795   36.841  1.00 109.97 ? 262  VAL A CG2 1 
ATOM   2479 N N   . LEU A 1 339 ? 59.197  5.167   39.633  1.00 110.91 ? 263  LEU A N   1 
ATOM   2480 C CA  . LEU A 1 339 ? 59.738  5.156   41.004  1.00 111.84 ? 263  LEU A CA  1 
ATOM   2481 C C   . LEU A 1 339 ? 60.690  3.967   41.238  1.00 115.27 ? 263  LEU A C   1 
ATOM   2482 O O   . LEU A 1 339 ? 61.740  4.173   41.841  1.00 115.18 ? 263  LEU A O   1 
ATOM   2483 C CB  . LEU A 1 339 ? 58.619  5.121   42.064  1.00 113.84 ? 263  LEU A CB  1 
ATOM   2484 C CG  . LEU A 1 339 ? 58.148  6.468   42.662  1.00 119.26 ? 263  LEU A CG  1 
ATOM   2485 C CD1 . LEU A 1 339 ? 57.657  7.453   41.597  1.00 118.37 ? 263  LEU A CD1 1 
ATOM   2486 C CD2 . LEU A 1 339 ? 57.072  6.248   43.697  1.00 123.81 ? 263  LEU A CD2 1 
ATOM   2487 N N   . ALA A 1 340 ? 60.342  2.749   40.759  1.00 111.17 ? 264  ALA A N   1 
ATOM   2488 C CA  . ALA A 1 340 ? 61.183  1.556   40.920  1.00 110.94 ? 264  ALA A CA  1 
ATOM   2489 C C   . ALA A 1 340 ? 62.532  1.727   40.211  1.00 113.52 ? 264  ALA A C   1 
ATOM   2490 O O   . ALA A 1 340 ? 63.561  1.373   40.783  1.00 114.21 ? 264  ALA A O   1 
ATOM   2491 C CB  . ALA A 1 340 ? 60.471  0.324   40.386  1.00 111.79 ? 264  ALA A CB  1 
ATOM   2492 N N   . PHE A 1 341 ? 62.531  2.302   38.991  1.00 107.72 ? 265  PHE A N   1 
ATOM   2493 C CA  . PHE A 1 341 ? 63.748  2.535   38.215  1.00 105.82 ? 265  PHE A CA  1 
ATOM   2494 C C   . PHE A 1 341 ? 64.656  3.549   38.934  1.00 110.77 ? 265  PHE A C   1 
ATOM   2495 O O   . PHE A 1 341 ? 65.866  3.335   38.988  1.00 110.89 ? 265  PHE A O   1 
ATOM   2496 C CB  . PHE A 1 341 ? 63.397  3.026   36.796  1.00 105.71 ? 265  PHE A CB  1 
ATOM   2497 C CG  . PHE A 1 341 ? 64.565  3.146   35.839  1.00 105.36 ? 265  PHE A CG  1 
ATOM   2498 C CD1 . PHE A 1 341 ? 64.989  2.053   35.092  1.00 107.41 ? 265  PHE A CD1 1 
ATOM   2499 C CD2 . PHE A 1 341 ? 65.194  4.368   35.633  1.00 106.46 ? 265  PHE A CD2 1 
ATOM   2500 C CE1 . PHE A 1 341 ? 66.055  2.168   34.196  1.00 107.04 ? 265  PHE A CE1 1 
ATOM   2501 C CE2 . PHE A 1 341 ? 66.261  4.482   34.736  1.00 108.04 ? 265  PHE A CE2 1 
ATOM   2502 C CZ  . PHE A 1 341 ? 66.684  3.382   34.024  1.00 105.54 ? 265  PHE A CZ  1 
ATOM   2503 N N   . ILE A 1 342 ? 64.072  4.623   39.511  1.00 107.99 ? 266  ILE A N   1 
ATOM   2504 C CA  . ILE A 1 342 ? 64.822  5.664   40.231  1.00 108.54 ? 266  ILE A CA  1 
ATOM   2505 C C   . ILE A 1 342 ? 65.390  5.072   41.548  1.00 113.98 ? 266  ILE A C   1 
ATOM   2506 O O   . ILE A 1 342 ? 66.589  5.193   41.776  1.00 114.44 ? 266  ILE A O   1 
ATOM   2507 C CB  . ILE A 1 342 ? 63.958  6.937   40.499  1.00 112.10 ? 266  ILE A CB  1 
ATOM   2508 C CG1 . ILE A 1 342 ? 63.511  7.583   39.162  1.00 110.99 ? 266  ILE A CG1 1 
ATOM   2509 C CG2 . ILE A 1 342 ? 64.726  7.960   41.356  1.00 113.58 ? 266  ILE A CG2 1 
ATOM   2510 C CD1 . ILE A 1 342 ? 62.523  8.762   39.272  1.00 116.61 ? 266  ILE A CD1 1 
ATOM   2511 N N   . ILE A 1 343 ? 64.560  4.407   42.377  1.00 111.01 ? 267  ILE A N   1 
ATOM   2512 C CA  . ILE A 1 343 ? 65.014  3.828   43.652  1.00 112.63 ? 267  ILE A CA  1 
ATOM   2513 C C   . ILE A 1 343 ? 66.178  2.831   43.411  1.00 117.02 ? 267  ILE A C   1 
ATOM   2514 O O   . ILE A 1 343 ? 67.159  2.872   44.154  1.00 117.70 ? 267  ILE A O   1 
ATOM   2515 C CB  . ILE A 1 343 ? 63.847  3.135   44.427  1.00 116.84 ? 267  ILE A CB  1 
ATOM   2516 C CG1 . ILE A 1 343 ? 62.797  4.176   44.868  1.00 117.87 ? 267  ILE A CG1 1 
ATOM   2517 C CG2 . ILE A 1 343 ? 64.368  2.356   45.658  1.00 118.92 ? 267  ILE A CG2 1 
ATOM   2518 C CD1 . ILE A 1 343 ? 61.528  3.592   45.483  1.00 126.43 ? 267  ILE A CD1 1 
ATOM   2519 N N   . CYS A 1 344 ? 66.088  1.985   42.366  1.00 112.51 ? 268  CYS A N   1 
ATOM   2520 C CA  . CYS A 1 344 ? 67.069  0.933   42.099  1.00 112.20 ? 268  CYS A CA  1 
ATOM   2521 C C   . CYS A 1 344 ? 68.346  1.468   41.406  1.00 115.54 ? 268  CYS A C   1 
ATOM   2522 O O   . CYS A 1 344 ? 69.414  0.917   41.674  1.00 115.50 ? 268  CYS A O   1 
ATOM   2523 C CB  . CYS A 1 344 ? 66.447  -0.169  41.253  1.00 111.59 ? 268  CYS A CB  1 
ATOM   2524 S SG  . CYS A 1 344 ? 65.183  -1.138  42.112  1.00 117.02 ? 268  CYS A SG  1 
ATOM   2525 N N   . TRP A 1 345 ? 68.260  2.463   40.505  1.00 111.37 ? 269  TRP A N   1 
ATOM   2526 C CA  . TRP A 1 345 ? 69.461  2.883   39.780  1.00 110.89 ? 269  TRP A CA  1 
ATOM   2527 C C   . TRP A 1 345 ? 70.026  4.269   40.206  1.00 115.81 ? 269  TRP A C   1 
ATOM   2528 O O   . TRP A 1 345 ? 71.211  4.494   39.962  1.00 115.63 ? 269  TRP A O   1 
ATOM   2529 C CB  . TRP A 1 345 ? 69.197  2.935   38.270  1.00 108.02 ? 269  TRP A CB  1 
ATOM   2530 C CG  . TRP A 1 345 ? 69.108  1.578   37.638  1.00 108.67 ? 269  TRP A CG  1 
ATOM   2531 C CD1 . TRP A 1 345 ? 67.974  0.905   37.289  1.00 111.40 ? 269  TRP A CD1 1 
ATOM   2532 C CD2 . TRP A 1 345 ? 70.200  0.685   37.382  1.00 108.59 ? 269  TRP A CD2 1 
ATOM   2533 N NE1 . TRP A 1 345 ? 68.297  -0.328  36.767  1.00 110.76 ? 269  TRP A NE1 1 
ATOM   2534 C CE2 . TRP A 1 345 ? 69.656  -0.495  36.826  1.00 112.25 ? 269  TRP A CE2 1 
ATOM   2535 C CE3 . TRP A 1 345 ? 71.593  0.774   37.557  1.00 110.23 ? 269  TRP A CE3 1 
ATOM   2536 C CZ2 . TRP A 1 345 ? 70.455  -1.575  36.436  1.00 111.41 ? 269  TRP A CZ2 1 
ATOM   2537 C CZ3 . TRP A 1 345 ? 72.380  -0.298  37.177  1.00 111.63 ? 269  TRP A CZ3 1 
ATOM   2538 C CH2 . TRP A 1 345 ? 71.813  -1.453  36.616  1.00 111.78 ? 269  TRP A CH2 1 
ATOM   2539 N N   . LEU A 1 346 ? 69.234  5.178   40.818  1.00 113.16 ? 270  LEU A N   1 
ATOM   2540 C CA  . LEU A 1 346 ? 69.754  6.507   41.191  1.00 113.86 ? 270  LEU A CA  1 
ATOM   2541 C C   . LEU A 1 346 ? 70.950  6.396   42.187  1.00 120.37 ? 270  LEU A C   1 
ATOM   2542 O O   . LEU A 1 346 ? 71.940  7.084   41.931  1.00 120.56 ? 270  LEU A O   1 
ATOM   2543 C CB  . LEU A 1 346 ? 68.668  7.423   41.790  1.00 114.53 ? 270  LEU A CB  1 
ATOM   2544 C CG  . LEU A 1 346 ? 69.071  8.870   42.141  1.00 120.03 ? 270  LEU A CG  1 
ATOM   2545 C CD1 . LEU A 1 346 ? 69.593  9.625   40.922  1.00 118.66 ? 270  LEU A CD1 1 
ATOM   2546 C CD2 . LEU A 1 346 ? 67.908  9.623   42.746  1.00 123.50 ? 270  LEU A CD2 1 
ATOM   2547 N N   . PRO A 1 347 ? 70.943  5.544   43.265  1.00 118.19 ? 271  PRO A N   1 
ATOM   2548 C CA  . PRO A 1 347 ? 72.117  5.491   44.161  1.00 119.60 ? 271  PRO A CA  1 
ATOM   2549 C C   . PRO A 1 347 ? 73.429  5.187   43.414  1.00 122.68 ? 271  PRO A C   1 
ATOM   2550 O O   . PRO A 1 347 ? 74.428  5.862   43.672  1.00 123.22 ? 271  PRO A O   1 
ATOM   2551 C CB  . PRO A 1 347 ? 71.772  4.353   45.126  1.00 122.53 ? 271  PRO A CB  1 
ATOM   2552 C CG  . PRO A 1 347 ? 70.307  4.321   45.154  1.00 126.48 ? 271  PRO A CG  1 
ATOM   2553 C CD  . PRO A 1 347 ? 69.875  4.645   43.757  1.00 119.97 ? 271  PRO A CD  1 
ATOM   2554 N N   . PHE A 1 348 ? 73.416  4.226   42.461  1.00 117.63 ? 272  PHE A N   1 
ATOM   2555 C CA  . PHE A 1 348 ? 74.603  3.863   41.685  1.00 117.06 ? 272  PHE A CA  1 
ATOM   2556 C C   . PHE A 1 348 ? 75.131  5.046   40.847  1.00 120.26 ? 272  PHE A C   1 
ATOM   2557 O O   . PHE A 1 348 ? 76.341  5.284   40.840  1.00 120.93 ? 272  PHE A O   1 
ATOM   2558 C CB  . PHE A 1 348 ? 74.316  2.666   40.748  1.00 117.40 ? 272  PHE A CB  1 
ATOM   2559 C CG  . PHE A 1 348 ? 75.487  2.325   39.854  1.00 118.63 ? 272  PHE A CG  1 
ATOM   2560 C CD1 . PHE A 1 348 ? 76.518  1.519   40.310  1.00 123.22 ? 272  PHE A CD1 1 
ATOM   2561 C CD2 . PHE A 1 348 ? 75.579  2.846   38.568  1.00 119.29 ? 272  PHE A CD2 1 
ATOM   2562 C CE1 . PHE A 1 348 ? 77.622  1.242   39.498  1.00 124.08 ? 272  PHE A CE1 1 
ATOM   2563 C CE2 . PHE A 1 348 ? 76.685  2.574   37.761  1.00 121.85 ? 272  PHE A CE2 1 
ATOM   2564 C CZ  . PHE A 1 348 ? 77.699  1.775   38.230  1.00 121.38 ? 272  PHE A CZ  1 
ATOM   2565 N N   . HIS A 1 349 ? 74.243  5.743   40.115  1.00 115.11 ? 273  HIS A N   1 
ATOM   2566 C CA  . HIS A 1 349 ? 74.646  6.824   39.219  1.00 113.97 ? 273  HIS A CA  1 
ATOM   2567 C C   . HIS A 1 349 ? 75.028  8.086   40.007  1.00 118.94 ? 273  HIS A C   1 
ATOM   2568 O O   . HIS A 1 349 ? 75.818  8.877   39.492  1.00 118.19 ? 273  HIS A O   1 
ATOM   2569 C CB  . HIS A 1 349 ? 73.544  7.132   38.207  1.00 112.57 ? 273  HIS A CB  1 
ATOM   2570 C CG  . HIS A 1 349 ? 73.350  5.999   37.249  1.00 114.22 ? 273  HIS A CG  1 
ATOM   2571 N ND1 . HIS A 1 349 ? 74.138  5.869   36.122  1.00 114.98 ? 273  HIS A ND1 1 
ATOM   2572 C CD2 . HIS A 1 349 ? 72.532  4.924   37.334  1.00 115.17 ? 273  HIS A CD2 1 
ATOM   2573 C CE1 . HIS A 1 349 ? 73.747  4.748   35.538  1.00 113.24 ? 273  HIS A CE1 1 
ATOM   2574 N NE2 . HIS A 1 349 ? 72.785  4.144   36.232  1.00 113.71 ? 273  HIS A NE2 1 
ATOM   2575 N N   . VAL A 1 350 ? 74.547  8.244   41.264  1.00 117.10 ? 274  VAL A N   1 
ATOM   2576 C CA  . VAL A 1 350 ? 74.958  9.372   42.112  1.00 118.80 ? 274  VAL A CA  1 
ATOM   2577 C C   . VAL A 1 350 ? 76.443  9.181   42.451  1.00 124.35 ? 274  VAL A C   1 
ATOM   2578 O O   . VAL A 1 350 ? 77.237  10.092  42.221  1.00 124.87 ? 274  VAL A O   1 
ATOM   2579 C CB  . VAL A 1 350 ? 74.080  9.551   43.384  1.00 123.96 ? 274  VAL A CB  1 
ATOM   2580 C CG1 . VAL A 1 350 ? 74.729  10.495  44.394  1.00 126.25 ? 274  VAL A CG1 1 
ATOM   2581 C CG2 . VAL A 1 350 ? 72.685  10.041  43.022  1.00 122.48 ? 274  VAL A CG2 1 
ATOM   2582 N N   . LEU A 1 351 ? 76.817  7.968   42.912  1.00 121.11 ? 275  LEU A N   1 
ATOM   2583 C CA  . LEU A 1 351 ? 78.191  7.607   43.275  1.00 122.52 ? 275  LEU A CA  1 
ATOM   2584 C C   . LEU A 1 351 ? 79.127  7.649   42.063  1.00 125.19 ? 275  LEU A C   1 
ATOM   2585 O O   . LEU A 1 351 ? 80.285  8.039   42.217  1.00 126.25 ? 275  LEU A O   1 
ATOM   2586 C CB  . LEU A 1 351 ? 78.232  6.200   43.906  1.00 123.18 ? 275  LEU A CB  1 
ATOM   2587 C CG  . LEU A 1 351 ? 77.399  5.978   45.179  1.00 128.82 ? 275  LEU A CG  1 
ATOM   2588 C CD1 . LEU A 1 351 ? 77.394  4.521   45.571  1.00 129.14 ? 275  LEU A CD1 1 
ATOM   2589 C CD2 . LEU A 1 351 ? 77.878  6.850   46.333  1.00 133.49 ? 275  LEU A CD2 1 
ATOM   2590 N N   . THR A 1 352 ? 78.621  7.259   40.862  1.00 119.15 ? 276  THR A N   1 
ATOM   2591 C CA  . THR A 1 352 ? 79.365  7.243   39.595  1.00 117.82 ? 276  THR A CA  1 
ATOM   2592 C C   . THR A 1 352 ? 79.663  8.692   39.152  1.00 122.50 ? 276  THR A C   1 
ATOM   2593 O O   . THR A 1 352 ? 80.760  8.962   38.655  1.00 122.52 ? 276  THR A O   1 
ATOM   2594 C CB  . THR A 1 352 ? 78.562  6.465   38.519  1.00 121.96 ? 276  THR A CB  1 
ATOM   2595 O OG1 . THR A 1 352 ? 78.343  5.129   38.971  1.00 121.00 ? 276  THR A OG1 1 
ATOM   2596 C CG2 . THR A 1 352 ? 79.265  6.415   37.169  1.00 118.51 ? 276  THR A CG2 1 
ATOM   2597 N N   . PHE A 1 353 ? 78.692  9.615   39.338  1.00 119.74 ? 277  PHE A N   1 
ATOM   2598 C CA  . PHE A 1 353 ? 78.869  11.023  38.978  1.00 120.49 ? 277  PHE A CA  1 
ATOM   2599 C C   . PHE A 1 353 ? 79.864  11.682  39.943  1.00 128.97 ? 277  PHE A C   1 
ATOM   2600 O O   . PHE A 1 353 ? 80.706  12.462  39.494  1.00 129.26 ? 277  PHE A O   1 
ATOM   2601 C CB  . PHE A 1 353 ? 77.526  11.778  38.963  1.00 120.94 ? 277  PHE A CB  1 
ATOM   2602 C CG  . PHE A 1 353 ? 77.643  13.240  38.615  1.00 122.86 ? 277  PHE A CG  1 
ATOM   2603 C CD1 . PHE A 1 353 ? 77.836  13.645  37.301  1.00 124.78 ? 277  PHE A CD1 1 
ATOM   2604 C CD2 . PHE A 1 353 ? 77.514  14.217  39.595  1.00 126.72 ? 277  PHE A CD2 1 
ATOM   2605 C CE1 . PHE A 1 353 ? 77.962  15.000  36.983  1.00 126.37 ? 277  PHE A CE1 1 
ATOM   2606 C CE2 . PHE A 1 353 ? 77.624  15.573  39.274  1.00 130.19 ? 277  PHE A CE2 1 
ATOM   2607 C CZ  . PHE A 1 353 ? 77.848  15.955  37.971  1.00 127.15 ? 277  PHE A CZ  1 
ATOM   2608 N N   . LEU A 1 354 ? 79.791  11.340  41.254  1.00 128.65 ? 278  LEU A N   1 
ATOM   2609 C CA  . LEU A 1 354 ? 80.724  11.846  42.269  1.00 132.11 ? 278  LEU A CA  1 
ATOM   2610 C C   . LEU A 1 354 ? 82.133  11.326  41.997  1.00 138.72 ? 278  LEU A C   1 
ATOM   2611 O O   . LEU A 1 354 ? 83.099  12.072  42.175  1.00 140.41 ? 278  LEU A O   1 
ATOM   2612 C CB  . LEU A 1 354 ? 80.283  11.463  43.692  1.00 133.50 ? 278  LEU A CB  1 
ATOM   2613 C CG  . LEU A 1 354 ? 78.988  12.070  44.224  1.00 137.83 ? 278  LEU A CG  1 
ATOM   2614 C CD1 . LEU A 1 354 ? 78.619  11.447  45.555  1.00 139.23 ? 278  LEU A CD1 1 
ATOM   2615 C CD2 . LEU A 1 354 ? 79.084  13.591  44.344  1.00 141.81 ? 278  LEU A CD2 1 
ATOM   2616 N N   . ASP A 1 355 ? 82.241  10.051  41.539  1.00 135.32 ? 279  ASP A N   1 
ATOM   2617 C CA  . ASP A 1 355 ? 83.500  9.404   41.154  1.00 136.67 ? 279  ASP A CA  1 
ATOM   2618 C C   . ASP A 1 355 ? 84.151  10.152  39.993  1.00 142.34 ? 279  ASP A C   1 
ATOM   2619 O O   . ASP A 1 355 ? 85.355  10.408  40.031  1.00 144.07 ? 279  ASP A O   1 
ATOM   2620 C CB  . ASP A 1 355 ? 83.263  7.926   40.768  1.00 136.63 ? 279  ASP A CB  1 
ATOM   2621 C CG  . ASP A 1 355 ? 84.498  7.187   40.284  1.00 145.68 ? 279  ASP A CG  1 
ATOM   2622 O OD1 . ASP A 1 355 ? 85.583  7.379   40.884  1.00 148.28 ? 279  ASP A OD1 1 
ATOM   2623 O OD2 . ASP A 1 355 ? 84.363  6.352   39.367  1.00 149.85 ? 279  ASP A OD2 1 
ATOM   2624 N N   . ALA A 1 356 ? 83.343  10.509  38.971  1.00 138.01 ? 280  ALA A N   1 
ATOM   2625 C CA  . ALA A 1 356 ? 83.778  11.247  37.787  1.00 138.01 ? 280  ALA A CA  1 
ATOM   2626 C C   . ALA A 1 356 ? 84.352  12.616  38.167  1.00 145.57 ? 280  ALA A C   1 
ATOM   2627 O O   . ALA A 1 356 ? 85.371  13.016  37.607  1.00 146.49 ? 280  ALA A O   1 
ATOM   2628 C CB  . ALA A 1 356 ? 82.616  11.418  36.830  1.00 135.96 ? 280  ALA A CB  1 
ATOM   2629 N N   . LEU A 1 357 ? 83.723  13.308  39.149  1.00 143.83 ? 281  LEU A N   1 
ATOM   2630 C CA  . LEU A 1 357 ? 84.175  14.615  39.644  1.00 146.38 ? 281  LEU A CA  1 
ATOM   2631 C C   . LEU A 1 357 ? 85.516  14.486  40.382  1.00 153.60 ? 281  LEU A C   1 
ATOM   2632 O O   . LEU A 1 357 ? 86.336  15.400  40.304  1.00 155.43 ? 281  LEU A O   1 
ATOM   2633 C CB  . LEU A 1 357 ? 83.128  15.265  40.567  1.00 146.65 ? 281  LEU A CB  1 
ATOM   2634 C CG  . LEU A 1 357 ? 81.784  15.660  39.943  1.00 148.79 ? 281  LEU A CG  1 
ATOM   2635 C CD1 . LEU A 1 357 ? 80.801  16.087  41.016  1.00 149.51 ? 281  LEU A CD1 1 
ATOM   2636 C CD2 . LEU A 1 357 ? 81.950  16.753  38.879  1.00 150.94 ? 281  LEU A CD2 1 
ATOM   2637 N N   . ALA A 1 358 ? 85.755  13.335  41.052  1.00 150.59 ? 282  ALA A N   1 
ATOM   2638 C CA  . ALA A 1 358 ? 87.015  13.061  41.743  1.00 153.63 ? 282  ALA A CA  1 
ATOM   2639 C C   . ALA A 1 358 ? 88.164  12.927  40.730  1.00 158.49 ? 282  ALA A C   1 
ATOM   2640 O O   . ALA A 1 358 ? 89.241  13.478  40.967  1.00 161.08 ? 282  ALA A O   1 
ATOM   2641 C CB  . ALA A 1 358 ? 86.894  11.802  42.587  1.00 154.36 ? 282  ALA A CB  1 
ATOM   2642 N N   . TRP A 1 359 ? 87.916  12.244  39.578  1.00 152.57 ? 283  TRP A N   1 
ATOM   2643 C CA  . TRP A 1 359 ? 88.909  12.090  38.508  1.00 152.76 ? 283  TRP A CA  1 
ATOM   2644 C C   . TRP A 1 359 ? 89.143  13.417  37.770  1.00 159.10 ? 283  TRP A C   1 
ATOM   2645 O O   . TRP A 1 359 ? 90.249  13.645  37.276  1.00 160.69 ? 283  TRP A O   1 
ATOM   2646 C CB  . TRP A 1 359 ? 88.517  11.005  37.497  1.00 148.08 ? 283  TRP A CB  1 
ATOM   2647 C CG  . TRP A 1 359 ? 88.568  9.609   38.041  1.00 148.57 ? 283  TRP A CG  1 
ATOM   2648 C CD1 . TRP A 1 359 ? 87.510  8.824   38.385  1.00 149.44 ? 283  TRP A CD1 1 
ATOM   2649 C CD2 . TRP A 1 359 ? 89.746  8.865   38.378  1.00 150.50 ? 283  TRP A CD2 1 
ATOM   2650 N NE1 . TRP A 1 359 ? 87.953  7.611   38.858  1.00 149.50 ? 283  TRP A NE1 1 
ATOM   2651 C CE2 . TRP A 1 359 ? 89.322  7.614   38.879  1.00 153.43 ? 283  TRP A CE2 1 
ATOM   2652 C CE3 . TRP A 1 359 ? 91.126  9.124   38.284  1.00 154.46 ? 283  TRP A CE3 1 
ATOM   2653 C CZ2 . TRP A 1 359 ? 90.225  6.622   39.282  1.00 154.38 ? 283  TRP A CZ2 1 
ATOM   2654 C CZ3 . TRP A 1 359 ? 92.019  8.143   38.689  1.00 157.49 ? 283  TRP A CZ3 1 
ATOM   2655 C CH2 . TRP A 1 359 ? 91.568  6.909   39.181  1.00 157.08 ? 283  TRP A CH2 1 
ATOM   2656 N N   . MET A 1 360 ? 88.116  14.290  37.705  1.00 155.54 ? 284  MET A N   1 
ATOM   2657 C CA  . MET A 1 360 ? 88.216  15.612  37.071  1.00 156.54 ? 284  MET A CA  1 
ATOM   2658 C C   . MET A 1 360 ? 88.969  16.614  37.967  1.00 165.51 ? 284  MET A C   1 
ATOM   2659 O O   . MET A 1 360 ? 89.323  17.704  37.509  1.00 166.54 ? 284  MET A O   1 
ATOM   2660 C CB  . MET A 1 360 ? 86.822  16.164  36.741  1.00 156.33 ? 284  MET A CB  1 
ATOM   2661 C CG  . MET A 1 360 ? 86.132  15.428  35.630  1.00 156.67 ? 284  MET A CG  1 
ATOM   2662 S SD  . MET A 1 360 ? 84.463  16.049  35.352  1.00 158.24 ? 284  MET A SD  1 
ATOM   2663 C CE  . MET A 1 360 ? 84.010  15.077  33.971  1.00 151.65 ? 284  MET A CE  1 
ATOM   2664 N N   . GLY A 1 361 ? 89.199  16.235  39.223  1.00 164.57 ? 285  GLY A N   1 
ATOM   2665 C CA  . GLY A 1 361 ? 89.892  17.063  40.202  1.00 168.55 ? 285  GLY A CA  1 
ATOM   2666 C C   . GLY A 1 361 ? 88.982  18.007  40.957  1.00 173.59 ? 285  GLY A C   1 
ATOM   2667 O O   . GLY A 1 361 ? 89.462  18.890  41.672  1.00 176.22 ? 285  GLY A O   1 
ATOM   2668 N N   . VAL A 1 362 ? 87.660  17.821  40.804  1.00 167.67 ? 286  VAL A N   1 
ATOM   2669 C CA  . VAL A 1 362 ? 86.631  18.628  41.462  1.00 167.53 ? 286  VAL A CA  1 
ATOM   2670 C C   . VAL A 1 362 ? 86.556  18.207  42.937  1.00 173.05 ? 286  VAL A C   1 
ATOM   2671 O O   . VAL A 1 362 ? 86.576  19.070  43.816  1.00 175.11 ? 286  VAL A O   1 
ATOM   2672 C CB  . VAL A 1 362 ? 85.257  18.498  40.742  1.00 167.73 ? 286  VAL A CB  1 
ATOM   2673 C CG1 . VAL A 1 362 ? 84.182  19.330  41.439  1.00 167.77 ? 286  VAL A CG1 1 
ATOM   2674 C CG2 . VAL A 1 362 ? 85.367  18.893  39.271  1.00 166.01 ? 286  VAL A CG2 1 
ATOM   2675 N N   . ILE A 1 363 ? 86.502  16.882  43.201  1.00 169.14 ? 287  ILE A N   1 
ATOM   2676 C CA  . ILE A 1 363 ? 86.453  16.346  44.561  1.00 170.89 ? 287  ILE A CA  1 
ATOM   2677 C C   . ILE A 1 363 ? 87.866  15.931  44.967  1.00 178.32 ? 287  ILE A C   1 
ATOM   2678 O O   . ILE A 1 363 ? 88.452  15.016  44.372  1.00 177.19 ? 287  ILE A O   1 
ATOM   2679 C CB  . ILE A 1 363 ? 85.438  15.177  44.722  1.00 171.32 ? 287  ILE A CB  1 
ATOM   2680 C CG1 . ILE A 1 363 ? 84.035  15.505  44.135  1.00 168.57 ? 287  ILE A CG1 1 
ATOM   2681 C CG2 . ILE A 1 363 ? 85.350  14.704  46.164  1.00 174.01 ? 287  ILE A CG2 1 
ATOM   2682 C CD1 . ILE A 1 363 ? 83.299  16.686  44.597  1.00 176.52 ? 287  ILE A CD1 1 
ATOM   2683 N N   . ASN A 1 364 ? 88.391  16.629  45.995  1.00 179.11 ? 288  ASN A N   1 
ATOM   2684 C CA  . ASN A 1 364 ? 89.729  16.471  46.566  1.00 183.12 ? 288  ASN A CA  1 
ATOM   2685 C C   . ASN A 1 364 ? 89.692  15.771  47.941  1.00 189.16 ? 288  ASN A C   1 
ATOM   2686 O O   . ASN A 1 364 ? 90.689  15.155  48.329  1.00 190.66 ? 288  ASN A O   1 
ATOM   2687 C CB  . ASN A 1 364 ? 90.409  17.845  46.709  1.00 187.09 ? 288  ASN A CB  1 
ATOM   2688 C CG  . ASN A 1 364 ? 89.664  18.864  47.557  1.00 208.29 ? 288  ASN A CG  1 
ATOM   2689 O OD1 . ASN A 1 364 ? 88.459  18.751  47.824  1.00 198.56 ? 288  ASN A OD1 1 
ATOM   2690 N ND2 . ASN A 1 364 ? 90.357  19.928  47.938  1.00 203.12 ? 288  ASN A ND2 1 
ATOM   2691 N N   . SER A 1 365 ? 88.566  15.891  48.684  1.00 184.95 ? 289  SER A N   1 
ATOM   2692 C CA  . SER A 1 365 ? 88.403  15.266  50.003  1.00 186.00 ? 289  SER A CA  1 
ATOM   2693 C C   . SER A 1 365 ? 88.292  13.747  49.852  1.00 187.33 ? 289  SER A C   1 
ATOM   2694 O O   . SER A 1 365 ? 87.386  13.266  49.175  1.00 182.84 ? 289  SER A O   1 
ATOM   2695 C CB  . SER A 1 365 ? 87.182  15.833  50.722  1.00 188.64 ? 289  SER A CB  1 
ATOM   2696 N N   . CYS A 1 366 ? 89.241  12.999  50.449  1.00 186.11 ? 290  CYS A N   1 
ATOM   2697 C CA  . CYS A 1 366 ? 89.313  11.537  50.348  1.00 184.17 ? 290  CYS A CA  1 
ATOM   2698 C C   . CYS A 1 366 ? 88.233  10.872  51.227  1.00 186.61 ? 290  CYS A C   1 
ATOM   2699 O O   . CYS A 1 366 ? 87.910  9.704   50.988  1.00 183.87 ? 290  CYS A O   1 
ATOM   2700 C CB  . CYS A 1 366 ? 90.704  11.037  50.727  1.00 187.76 ? 290  CYS A CB  1 
ATOM   2701 S SG  . CYS A 1 366 ? 91.199  11.418  52.427  1.00 196.52 ? 290  CYS A SG  1 
ATOM   2702 N N   . GLU A 1 367 ? 87.688  11.600  52.235  1.00 184.92 ? 291  GLU A N   1 
ATOM   2703 C CA  . GLU A 1 367 ? 86.635  11.090  53.121  1.00 184.08 ? 291  GLU A CA  1 
ATOM   2704 C C   . GLU A 1 367 ? 85.404  10.684  52.305  1.00 183.77 ? 291  GLU A C   1 
ATOM   2705 O O   . GLU A 1 367 ? 84.942  9.550   52.449  1.00 182.26 ? 291  GLU A O   1 
ATOM   2706 C CB  . GLU A 1 367 ? 86.236  12.117  54.212  1.00 187.74 ? 291  GLU A CB  1 
ATOM   2707 C CG  . GLU A 1 367 ? 87.230  12.328  55.352  1.00 202.41 ? 291  GLU A CG  1 
ATOM   2708 C CD  . GLU A 1 367 ? 88.540  13.069  55.142  1.00 215.27 ? 291  GLU A CD  1 
ATOM   2709 O OE1 . GLU A 1 367 ? 89.208  13.361  56.160  1.00 210.31 ? 291  GLU A OE1 1 
ATOM   2710 O OE2 . GLU A 1 367 ? 88.896  13.372  53.979  1.00 209.46 ? 291  GLU A OE2 1 
ATOM   2711 N N   . VAL A 1 368 ? 84.909  11.575  51.411  1.00 177.99 ? 292  VAL A N   1 
ATOM   2712 C CA  . VAL A 1 368 ? 83.743  11.291  50.558  1.00 173.64 ? 292  VAL A CA  1 
ATOM   2713 C C   . VAL A 1 368 ? 84.126  10.238  49.479  1.00 174.34 ? 292  VAL A C   1 
ATOM   2714 O O   . VAL A 1 368 ? 83.246  9.511   49.022  1.00 171.14 ? 292  VAL A O   1 
ATOM   2715 C CB  . VAL A 1 368 ? 83.114  12.556  49.898  1.00 176.17 ? 292  VAL A CB  1 
ATOM   2716 C CG1 . VAL A 1 368 ? 82.453  13.460  50.933  1.00 177.29 ? 292  VAL A CG1 1 
ATOM   2717 C CG2 . VAL A 1 368 ? 84.126  13.331  49.068  1.00 176.94 ? 292  VAL A CG2 1 
ATOM   2718 N N   . ILE A 1 369 ? 85.428  10.142  49.107  1.00 171.84 ? 293  ILE A N   1 
ATOM   2719 C CA  . ILE A 1 369 ? 85.930  9.158   48.132  1.00 169.96 ? 293  ILE A CA  1 
ATOM   2720 C C   . ILE A 1 369 ? 85.892  7.752   48.785  1.00 173.50 ? 293  ILE A C   1 
ATOM   2721 O O   . ILE A 1 369 ? 85.574  6.771   48.105  1.00 171.03 ? 293  ILE A O   1 
ATOM   2722 C CB  . ILE A 1 369 ? 87.357  9.532   47.614  1.00 174.95 ? 293  ILE A CB  1 
ATOM   2723 C CG1 . ILE A 1 369 ? 87.355  10.941  46.961  1.00 175.22 ? 293  ILE A CG1 1 
ATOM   2724 C CG2 . ILE A 1 369 ? 87.890  8.471   46.624  1.00 174.17 ? 293  ILE A CG2 1 
ATOM   2725 C CD1 . ILE A 1 369 ? 88.745  11.514  46.548  1.00 185.51 ? 293  ILE A CD1 1 
ATOM   2726 N N   . ALA A 1 370 ? 86.178  7.670   50.105  1.00 171.98 ? 294  ALA A N   1 
ATOM   2727 C CA  . ALA A 1 370 ? 86.142  6.418   50.872  1.00 172.10 ? 294  ALA A CA  1 
ATOM   2728 C C   . ALA A 1 370 ? 84.698  5.912   51.031  1.00 172.36 ? 294  ALA A C   1 
ATOM   2729 O O   . ALA A 1 370 ? 84.470  4.699   51.030  1.00 171.05 ? 294  ALA A O   1 
ATOM   2730 C CB  . ALA A 1 370 ? 86.781  6.623   52.236  1.00 176.73 ? 294  ALA A CB  1 
ATOM   2731 N N   . VAL A 1 371 ? 83.730  6.855   51.148  1.00 167.02 ? 295  VAL A N   1 
ATOM   2732 C CA  . VAL A 1 371 ? 82.289  6.590   51.266  1.00 164.41 ? 295  VAL A CA  1 
ATOM   2733 C C   . VAL A 1 371 ? 81.815  5.894   49.978  1.00 163.85 ? 295  VAL A C   1 
ATOM   2734 O O   . VAL A 1 371 ? 81.194  4.836   50.067  1.00 162.47 ? 295  VAL A O   1 
ATOM   2735 C CB  . VAL A 1 371 ? 81.470  7.890   51.565  1.00 168.28 ? 295  VAL A CB  1 
ATOM   2736 C CG1 . VAL A 1 371 ? 79.961  7.636   51.525  1.00 165.89 ? 295  VAL A CG1 1 
ATOM   2737 C CG2 . VAL A 1 371 ? 81.871  8.501   52.904  1.00 171.58 ? 295  VAL A CG2 1 
ATOM   2738 N N   . ILE A 1 372 ? 82.168  6.456   48.790  1.00 157.91 ? 296  ILE A N   1 
ATOM   2739 C CA  . ILE A 1 372 ? 81.823  5.913   47.463  1.00 154.26 ? 296  ILE A CA  1 
ATOM   2740 C C   . ILE A 1 372 ? 82.260  4.435   47.371  1.00 158.11 ? 296  ILE A C   1 
ATOM   2741 O O   . ILE A 1 372 ? 81.456  3.598   46.965  1.00 155.71 ? 296  ILE A O   1 
ATOM   2742 C CB  . ILE A 1 372 ? 82.462  6.758   46.309  1.00 156.20 ? 296  ILE A CB  1 
ATOM   2743 C CG1 . ILE A 1 372 ? 81.984  8.230   46.354  1.00 156.59 ? 296  ILE A CG1 1 
ATOM   2744 C CG2 . ILE A 1 372 ? 82.169  6.130   44.928  1.00 153.69 ? 296  ILE A CG2 1 
ATOM   2745 C CD1 . ILE A 1 372 ? 82.712  9.196   45.389  1.00 163.23 ? 296  ILE A CD1 1 
ATOM   2746 N N   . ASP A 1 373 ? 83.511  4.123   47.785  1.00 157.08 ? 297  ASP A N   1 
ATOM   2747 C CA  . ASP A 1 373 ? 84.086  2.772   47.722  1.00 157.20 ? 297  ASP A CA  1 
ATOM   2748 C C   . ASP A 1 373 ? 83.263  1.741   48.502  1.00 160.71 ? 297  ASP A C   1 
ATOM   2749 O O   . ASP A 1 373 ? 83.052  0.648   47.984  1.00 158.97 ? 297  ASP A O   1 
ATOM   2750 C CB  . ASP A 1 373 ? 85.533  2.744   48.265  1.00 162.16 ? 297  ASP A CB  1 
ATOM   2751 C CG  . ASP A 1 373 ? 86.574  3.478   47.440  1.00 171.98 ? 297  ASP A CG  1 
ATOM   2752 O OD1 . ASP A 1 373 ? 86.240  3.934   46.324  1.00 170.38 ? 297  ASP A OD1 1 
ATOM   2753 O OD2 . ASP A 1 373 ? 87.742  3.533   47.877  1.00 179.67 ? 297  ASP A OD2 1 
ATOM   2754 N N   . LEU A 1 374 ? 82.829  2.060   49.740  1.00 158.63 ? 298  LEU A N   1 
ATOM   2755 C CA  . LEU A 1 374 ? 82.095  1.084   50.543  1.00 158.78 ? 298  LEU A CA  1 
ATOM   2756 C C   . LEU A 1 374 ? 80.598  1.085   50.161  1.00 159.42 ? 298  LEU A C   1 
ATOM   2757 O O   . LEU A 1 374 ? 79.943  0.059   50.336  1.00 158.62 ? 298  LEU A O   1 
ATOM   2758 C CB  . LEU A 1 374 ? 82.278  1.332   52.067  1.00 162.14 ? 298  LEU A CB  1 
ATOM   2759 C CG  . LEU A 1 374 ? 81.885  2.691   52.701  1.00 167.98 ? 298  LEU A CG  1 
ATOM   2760 C CD1 . LEU A 1 374 ? 80.383  2.766   52.982  1.00 166.84 ? 298  LEU A CD1 1 
ATOM   2761 C CD2 . LEU A 1 374 ? 82.563  2.854   54.052  1.00 174.10 ? 298  LEU A CD2 1 
ATOM   2762 N N   . ALA A 1 375 ? 80.071  2.212   49.633  1.00 153.90 ? 299  ALA A N   1 
ATOM   2763 C CA  . ALA A 1 375 ? 78.654  2.330   49.265  1.00 151.27 ? 299  ALA A CA  1 
ATOM   2764 C C   . ALA A 1 375 ? 78.380  1.808   47.839  1.00 151.48 ? 299  ALA A C   1 
ATOM   2765 O O   . ALA A 1 375 ? 77.218  1.591   47.489  1.00 149.67 ? 299  ALA A O   1 
ATOM   2766 C CB  . ALA A 1 375 ? 78.207  3.781   49.370  1.00 151.94 ? 299  ALA A CB  1 
ATOM   2767 N N   . LEU A 1 376 ? 79.438  1.605   47.030  1.00 146.63 ? 300  LEU A N   1 
ATOM   2768 C CA  . LEU A 1 376 ? 79.327  1.137   45.647  1.00 143.55 ? 300  LEU A CA  1 
ATOM   2769 C C   . LEU A 1 376 ? 78.866  -0.355  45.566  1.00 145.35 ? 300  LEU A C   1 
ATOM   2770 O O   . LEU A 1 376 ? 77.956  -0.614  44.779  1.00 143.07 ? 300  LEU A O   1 
ATOM   2771 C CB  . LEU A 1 376 ? 80.660  1.305   44.901  1.00 143.88 ? 300  LEU A CB  1 
ATOM   2772 N N   . PRO A 1 377 ? 79.408  -1.346  46.340  1.00 142.27 ? 301  PRO A N   1 
ATOM   2773 C CA  . PRO A 1 377 ? 78.909  -2.734  46.195  1.00 141.05 ? 301  PRO A CA  1 
ATOM   2774 C C   . PRO A 1 377 ? 77.416  -2.868  46.508  1.00 142.47 ? 301  PRO A C   1 
ATOM   2775 O O   . PRO A 1 377 ? 76.746  -3.710  45.912  1.00 140.50 ? 301  PRO A O   1 
ATOM   2776 C CB  . PRO A 1 377 ? 79.736  -3.519  47.213  1.00 145.57 ? 301  PRO A CB  1 
ATOM   2777 C CG  . PRO A 1 377 ? 80.945  -2.696  47.441  1.00 151.63 ? 301  PRO A CG  1 
ATOM   2778 C CD  . PRO A 1 377 ? 80.491  -1.280  47.342  1.00 146.43 ? 301  PRO A CD  1 
ATOM   2779 N N   . PHE A 1 378 ? 76.893  -2.025  47.423  1.00 139.10 ? 302  PHE A N   1 
ATOM   2780 C CA  . PHE A 1 378 ? 75.477  -2.010  47.791  1.00 138.18 ? 302  PHE A CA  1 
ATOM   2781 C C   . PHE A 1 378 ? 74.628  -1.373  46.686  1.00 137.65 ? 302  PHE A C   1 
ATOM   2782 O O   . PHE A 1 378 ? 73.561  -1.898  46.365  1.00 135.93 ? 302  PHE A O   1 
ATOM   2783 C CB  . PHE A 1 378 ? 75.266  -1.257  49.113  1.00 142.26 ? 302  PHE A CB  1 
ATOM   2784 C CG  . PHE A 1 378 ? 75.879  -1.919  50.323  1.00 147.00 ? 302  PHE A CG  1 
ATOM   2785 C CD1 . PHE A 1 378 ? 75.150  -2.828  51.082  1.00 151.62 ? 302  PHE A CD1 1 
ATOM   2786 C CD2 . PHE A 1 378 ? 77.170  -1.603  50.730  1.00 151.10 ? 302  PHE A CD2 1 
ATOM   2787 C CE1 . PHE A 1 378 ? 75.706  -3.420  52.219  1.00 155.20 ? 302  PHE A CE1 1 
ATOM   2788 C CE2 . PHE A 1 378 ? 77.729  -2.201  51.864  1.00 156.67 ? 302  PHE A CE2 1 
ATOM   2789 C CZ  . PHE A 1 378 ? 76.990  -3.099  52.604  1.00 155.77 ? 302  PHE A CZ  1 
ATOM   2790 N N   . ALA A 1 379 ? 75.103  -0.244  46.105  1.00 132.14 ? 303  ALA A N   1 
ATOM   2791 C CA  . ALA A 1 379 ? 74.415  0.483   45.037  1.00 129.14 ? 303  ALA A CA  1 
ATOM   2792 C C   . ALA A 1 379 ? 74.312  -0.366  43.766  1.00 130.50 ? 303  ALA A C   1 
ATOM   2793 O O   . ALA A 1 379 ? 73.332  -0.236  43.026  1.00 128.62 ? 303  ALA A O   1 
ATOM   2794 C CB  . ALA A 1 379 ? 75.145  1.779   44.740  1.00 129.69 ? 303  ALA A CB  1 
ATOM   2795 N N   . ILE A 1 380 ? 75.323  -1.238  43.527  1.00 126.76 ? 304  ILE A N   1 
ATOM   2796 C CA  . ILE A 1 380 ? 75.392  -2.178  42.398  1.00 124.72 ? 304  ILE A CA  1 
ATOM   2797 C C   . ILE A 1 380 ? 74.315  -3.270  42.590  1.00 128.64 ? 304  ILE A C   1 
ATOM   2798 O O   . ILE A 1 380 ? 73.690  -3.683  41.611  1.00 127.21 ? 304  ILE A O   1 
ATOM   2799 C CB  . ILE A 1 380 ? 76.827  -2.784  42.257  1.00 128.23 ? 304  ILE A CB  1 
ATOM   2800 C CG1 . ILE A 1 380 ? 77.832  -1.692  41.791  1.00 128.29 ? 304  ILE A CG1 1 
ATOM   2801 C CG2 . ILE A 1 380 ? 76.842  -3.977  41.280  1.00 127.49 ? 304  ILE A CG2 1 
ATOM   2802 C CD1 . ILE A 1 380 ? 79.306  -2.096  41.737  1.00 134.27 ? 304  ILE A CD1 1 
ATOM   2803 N N   . LEU A 1 381 ? 74.077  -3.697  43.844  1.00 126.57 ? 305  LEU A N   1 
ATOM   2804 C CA  . LEU A 1 381 ? 73.081  -4.721  44.157  1.00 126.79 ? 305  LEU A CA  1 
ATOM   2805 C C   . LEU A 1 381 ? 71.657  -4.230  43.820  1.00 130.22 ? 305  LEU A C   1 
ATOM   2806 O O   . LEU A 1 381 ? 70.875  -5.008  43.271  1.00 129.37 ? 305  LEU A O   1 
ATOM   2807 C CB  . LEU A 1 381 ? 73.171  -5.120  45.641  1.00 129.21 ? 305  LEU A CB  1 
ATOM   2808 C CG  . LEU A 1 381 ? 72.294  -6.288  46.098  1.00 134.83 ? 305  LEU A CG  1 
ATOM   2809 C CD1 . LEU A 1 381 ? 72.697  -7.586  45.406  1.00 134.59 ? 305  LEU A CD1 1 
ATOM   2810 C CD2 . LEU A 1 381 ? 72.388  -6.467  47.584  1.00 140.04 ? 305  LEU A CD2 1 
ATOM   2811 N N   . LEU A 1 382 ? 71.334  -2.941  44.116  1.00 126.92 ? 306  LEU A N   1 
ATOM   2812 C CA  . LEU A 1 382 ? 70.021  -2.346  43.820  1.00 125.91 ? 306  LEU A CA  1 
ATOM   2813 C C   . LEU A 1 382 ? 69.743  -2.331  42.309  1.00 127.43 ? 306  LEU A C   1 
ATOM   2814 O O   . LEU A 1 382 ? 68.585  -2.424  41.906  1.00 126.51 ? 306  LEU A O   1 
ATOM   2815 C CB  . LEU A 1 382 ? 69.895  -0.920  44.379  1.00 126.38 ? 306  LEU A CB  1 
ATOM   2816 C CG  . LEU A 1 382 ? 69.794  -0.758  45.902  1.00 133.34 ? 306  LEU A CG  1 
ATOM   2817 C CD1 . LEU A 1 382 ? 69.834  0.710   46.290  1.00 133.83 ? 306  LEU A CD1 1 
ATOM   2818 C CD2 . LEU A 1 382 ? 68.521  -1.409  46.456  1.00 136.17 ? 306  LEU A CD2 1 
ATOM   2819 N N   . GLY A 1 383 ? 70.801  -2.237  41.501  1.00 122.59 ? 307  GLY A N   1 
ATOM   2820 C CA  . GLY A 1 383 ? 70.711  -2.298  40.046  1.00 120.06 ? 307  GLY A CA  1 
ATOM   2821 C C   . GLY A 1 383 ? 70.189  -3.648  39.596  1.00 122.64 ? 307  GLY A C   1 
ATOM   2822 O O   . GLY A 1 383 ? 69.273  -3.716  38.772  1.00 121.25 ? 307  GLY A O   1 
ATOM   2823 N N   . PHE A 1 384 ? 70.739  -4.738  40.182  1.00 119.63 ? 308  PHE A N   1 
ATOM   2824 C CA  . PHE A 1 384 ? 70.298  -6.116  39.930  1.00 119.47 ? 308  PHE A CA  1 
ATOM   2825 C C   . PHE A 1 384 ? 68.919  -6.373  40.530  1.00 122.93 ? 308  PHE A C   1 
ATOM   2826 O O   . PHE A 1 384 ? 68.186  -7.217  40.020  1.00 122.07 ? 308  PHE A O   1 
ATOM   2827 C CB  . PHE A 1 384 ? 71.295  -7.151  40.494  1.00 122.83 ? 308  PHE A CB  1 
ATOM   2828 C CG  . PHE A 1 384 ? 72.634  -7.248  39.804  1.00 123.96 ? 308  PHE A CG  1 
ATOM   2829 C CD1 . PHE A 1 384 ? 72.783  -8.004  38.645  1.00 126.21 ? 308  PHE A CD1 1 
ATOM   2830 C CD2 . PHE A 1 384 ? 73.770  -6.688  40.375  1.00 126.86 ? 308  PHE A CD2 1 
ATOM   2831 C CE1 . PHE A 1 384 ? 74.029  -8.128  38.026  1.00 126.73 ? 308  PHE A CE1 1 
ATOM   2832 C CE2 . PHE A 1 384 ? 75.020  -6.829  39.766  1.00 129.42 ? 308  PHE A CE2 1 
ATOM   2833 C CZ  . PHE A 1 384 ? 75.139  -7.541  38.590  1.00 126.46 ? 308  PHE A CZ  1 
ATOM   2834 N N   . THR A 1 385 ? 68.577  -5.659  41.626  1.00 120.17 ? 309  THR A N   1 
ATOM   2835 C CA  . THR A 1 385 ? 67.298  -5.789  42.334  1.00 120.94 ? 309  THR A CA  1 
ATOM   2836 C C   . THR A 1 385 ? 66.160  -5.274  41.423  1.00 122.72 ? 309  THR A C   1 
ATOM   2837 O O   . THR A 1 385 ? 65.039  -5.765  41.532  1.00 123.06 ? 309  THR A O   1 
ATOM   2838 C CB  . THR A 1 385 ? 67.359  -5.042  43.679  1.00 130.38 ? 309  THR A CB  1 
ATOM   2839 O OG1 . THR A 1 385 ? 68.463  -5.546  44.426  1.00 131.15 ? 309  THR A OG1 1 
ATOM   2840 C CG2 . THR A 1 385 ? 66.092  -5.204  44.509  1.00 130.90 ? 309  THR A CG2 1 
ATOM   2841 N N   . ASN A 1 386 ? 66.463  -4.347  40.483  1.00 116.83 ? 310  ASN A N   1 
ATOM   2842 C CA  . ASN A 1 386 ? 65.472  -3.844  39.521  1.00 114.86 ? 310  ASN A CA  1 
ATOM   2843 C C   . ASN A 1 386 ? 64.976  -4.993  38.618  1.00 116.65 ? 310  ASN A C   1 
ATOM   2844 O O   . ASN A 1 386 ? 63.825  -4.976  38.190  1.00 116.41 ? 310  ASN A O   1 
ATOM   2845 C CB  . ASN A 1 386 ? 66.058  -2.704  38.674  1.00 114.57 ? 310  ASN A CB  1 
ATOM   2846 C CG  . ASN A 1 386 ? 65.072  -2.016  37.749  1.00 138.14 ? 310  ASN A CG  1 
ATOM   2847 O OD1 . ASN A 1 386 ? 65.301  -1.903  36.542  1.00 132.95 ? 310  ASN A OD1 1 
ATOM   2848 N ND2 . ASN A 1 386 ? 63.938  -1.571  38.281  1.00 129.75 ? 310  ASN A ND2 1 
ATOM   2849 N N   . SER A 1 387 ? 65.834  -6.013  38.382  1.00 111.77 ? 311  SER A N   1 
ATOM   2850 C CA  . SER A 1 387 ? 65.507  -7.197  37.580  1.00 110.76 ? 311  SER A CA  1 
ATOM   2851 C C   . SER A 1 387 ? 64.580  -8.153  38.359  1.00 114.40 ? 311  SER A C   1 
ATOM   2852 O O   . SER A 1 387 ? 64.003  -9.065  37.761  1.00 113.64 ? 311  SER A O   1 
ATOM   2853 C CB  . SER A 1 387 ? 66.780  -7.924  37.154  1.00 113.67 ? 311  SER A CB  1 
ATOM   2854 O OG  . SER A 1 387 ? 67.613  -7.084  36.369  1.00 117.90 ? 311  SER A OG  1 
ATOM   2855 N N   . CYS A 1 388 ? 64.442  -7.936  39.686  1.00 111.97 ? 312  CYS A N   1 
ATOM   2856 C CA  . CYS A 1 388 ? 63.547  -8.702  40.566  1.00 113.78 ? 312  CYS A CA  1 
ATOM   2857 C C   . CYS A 1 388 ? 62.176  -8.042  40.593  1.00 117.92 ? 312  CYS A C   1 
ATOM   2858 O O   . CYS A 1 388 ? 61.174  -8.708  40.849  1.00 119.17 ? 312  CYS A O   1 
ATOM   2859 C CB  . CYS A 1 388 ? 64.127  -8.815  41.976  1.00 115.37 ? 312  CYS A CB  1 
ATOM   2860 S SG  . CYS A 1 388 ? 65.800  -9.503  42.048  1.00 118.94 ? 312  CYS A SG  1 
ATOM   2861 N N   . VAL A 1 389 ? 62.149  -6.715  40.358  1.00 112.86 ? 313  VAL A N   1 
ATOM   2862 C CA  . VAL A 1 389 ? 60.954  -5.874  40.370  1.00 112.51 ? 313  VAL A CA  1 
ATOM   2863 C C   . VAL A 1 389 ? 60.204  -6.003  39.028  1.00 115.60 ? 313  VAL A C   1 
ATOM   2864 O O   . VAL A 1 389 ? 58.985  -6.158  39.046  1.00 116.03 ? 313  VAL A O   1 
ATOM   2865 C CB  . VAL A 1 389 ? 61.326  -4.393  40.667  1.00 115.35 ? 313  VAL A CB  1 
ATOM   2866 C CG1 . VAL A 1 389 ? 60.093  -3.488  40.643  1.00 115.29 ? 313  VAL A CG1 1 
ATOM   2867 C CG2 . VAL A 1 389 ? 62.056  -4.267  42.004  1.00 116.42 ? 313  VAL A CG2 1 
ATOM   2868 N N   . ASN A 1 390 ? 60.932  -5.947  37.880  1.00 111.21 ? 314  ASN A N   1 
ATOM   2869 C CA  . ASN A 1 390 ? 60.389  -6.001  36.508  1.00 110.47 ? 314  ASN A CA  1 
ATOM   2870 C C   . ASN A 1 390 ? 59.353  -7.163  36.290  1.00 117.32 ? 314  ASN A C   1 
ATOM   2871 O O   . ASN A 1 390 ? 58.325  -6.877  35.676  1.00 117.14 ? 314  ASN A O   1 
ATOM   2872 C CB  . ASN A 1 390 ? 61.509  -6.147  35.460  1.00 107.89 ? 314  ASN A CB  1 
ATOM   2873 C CG  . ASN A 1 390 ? 62.371  -4.910  35.265  1.00 123.16 ? 314  ASN A CG  1 
ATOM   2874 O OD1 . ASN A 1 390 ? 62.019  -3.785  35.651  1.00 113.02 ? 314  ASN A OD1 1 
ATOM   2875 N ND2 . ASN A 1 390 ? 63.481  -5.079  34.562  1.00 113.16 ? 314  ASN A ND2 1 
ATOM   2876 N N   . PRO A 1 391 ? 59.542  -8.433  36.749  1.00 115.99 ? 315  PRO A N   1 
ATOM   2877 C CA  . PRO A 1 391 ? 58.516  -9.462  36.474  1.00 117.81 ? 315  PRO A CA  1 
ATOM   2878 C C   . PRO A 1 391 ? 57.133  -9.094  37.047  1.00 124.25 ? 315  PRO A C   1 
ATOM   2879 O O   . PRO A 1 391 ? 56.137  -9.208  36.325  1.00 124.95 ? 315  PRO A O   1 
ATOM   2880 C CB  . PRO A 1 391 ? 59.071  -10.713 37.164  1.00 120.98 ? 315  PRO A CB  1 
ATOM   2881 C CG  . PRO A 1 391 ? 60.103  -10.221 38.098  1.00 124.94 ? 315  PRO A CG  1 
ATOM   2882 C CD  . PRO A 1 391 ? 60.691  -9.020  37.464  1.00 118.03 ? 315  PRO A CD  1 
ATOM   2883 N N   . PHE A 1 392 ? 57.076  -8.625  38.318  1.00 121.30 ? 316  PHE A N   1 
ATOM   2884 C CA  . PHE A 1 392 ? 55.836  -8.219  38.990  1.00 122.53 ? 316  PHE A CA  1 
ATOM   2885 C C   . PHE A 1 392 ? 55.231  -6.966  38.350  1.00 124.35 ? 316  PHE A C   1 
ATOM   2886 O O   . PHE A 1 392 ? 54.040  -6.929  38.058  1.00 125.14 ? 316  PHE A O   1 
ATOM   2887 C CB  . PHE A 1 392 ? 56.087  -7.945  40.491  1.00 125.61 ? 316  PHE A CB  1 
ATOM   2888 C CG  . PHE A 1 392 ? 56.660  -9.070  41.325  1.00 128.54 ? 316  PHE A CG  1 
ATOM   2889 C CD1 . PHE A 1 392 ? 55.833  -10.054 41.857  1.00 133.94 ? 316  PHE A CD1 1 
ATOM   2890 C CD2 . PHE A 1 392 ? 58.001  -9.067  41.696  1.00 129.77 ? 316  PHE A CD2 1 
ATOM   2891 C CE1 . PHE A 1 392 ? 56.354  -11.067 42.668  1.00 136.19 ? 316  PHE A CE1 1 
ATOM   2892 C CE2 . PHE A 1 392 ? 58.521  -10.078 42.513  1.00 133.95 ? 316  PHE A CE2 1 
ATOM   2893 C CZ  . PHE A 1 392 ? 57.694  -11.071 42.993  1.00 134.33 ? 316  PHE A CZ  1 
ATOM   2894 N N   . LEU A 1 393 ? 56.081  -5.958  38.120  1.00 118.40 ? 317  LEU A N   1 
ATOM   2895 C CA  . LEU A 1 393 ? 55.790  -4.613  37.630  1.00 116.80 ? 317  LEU A CA  1 
ATOM   2896 C C   . LEU A 1 393 ? 55.237  -4.575  36.170  1.00 119.57 ? 317  LEU A C   1 
ATOM   2897 O O   . LEU A 1 393 ? 54.644  -3.559  35.795  1.00 118.40 ? 317  LEU A O   1 
ATOM   2898 C CB  . LEU A 1 393 ? 57.119  -3.830  37.686  1.00 114.92 ? 317  LEU A CB  1 
ATOM   2899 C CG  . LEU A 1 393 ? 57.108  -2.315  37.533  1.00 118.42 ? 317  LEU A CG  1 
ATOM   2900 C CD1 . LEU A 1 393 ? 56.336  -1.658  38.651  1.00 120.07 ? 317  LEU A CD1 1 
ATOM   2901 C CD2 . LEU A 1 393 ? 58.521  -1.774  37.547  1.00 119.70 ? 317  LEU A CD2 1 
ATOM   2902 N N   . TYR A 1 394 ? 55.422  -5.645  35.358  1.00 116.37 ? 318  TYR A N   1 
ATOM   2903 C CA  . TYR A 1 394 ? 54.962  -5.617  33.961  1.00 115.48 ? 318  TYR A CA  1 
ATOM   2904 C C   . TYR A 1 394 ? 54.140  -6.858  33.563  1.00 122.87 ? 318  TYR A C   1 
ATOM   2905 O O   . TYR A 1 394 ? 53.123  -6.697  32.894  1.00 122.95 ? 318  TYR A O   1 
ATOM   2906 C CB  . TYR A 1 394 ? 56.156  -5.503  32.988  1.00 113.62 ? 318  TYR A CB  1 
ATOM   2907 C CG  . TYR A 1 394 ? 56.981  -4.248  33.163  1.00 112.34 ? 318  TYR A CG  1 
ATOM   2908 C CD1 . TYR A 1 394 ? 56.609  -3.055  32.553  1.00 112.99 ? 318  TYR A CD1 1 
ATOM   2909 C CD2 . TYR A 1 394 ? 58.155  -4.262  33.906  1.00 112.28 ? 318  TYR A CD2 1 
ATOM   2910 C CE1 . TYR A 1 394 ? 57.364  -1.896  32.714  1.00 112.07 ? 318  TYR A CE1 1 
ATOM   2911 C CE2 . TYR A 1 394 ? 58.915  -3.108  34.080  1.00 111.71 ? 318  TYR A CE2 1 
ATOM   2912 C CZ  . TYR A 1 394 ? 58.515  -1.926  33.484  1.00 118.40 ? 318  TYR A CZ  1 
ATOM   2913 O OH  . TYR A 1 394 ? 59.268  -0.791  33.653  1.00 119.30 ? 318  TYR A OH  1 
ATOM   2914 N N   . CYS A 1 395 ? 54.601  -8.080  33.897  1.00 122.07 ? 319  CYS A N   1 
ATOM   2915 C CA  . CYS A 1 395 ? 53.910  -9.299  33.466  1.00 124.63 ? 319  CYS A CA  1 
ATOM   2916 C C   . CYS A 1 395 ? 52.705  -9.598  34.365  1.00 134.09 ? 319  CYS A C   1 
ATOM   2917 O O   . CYS A 1 395 ? 51.636  -9.918  33.840  1.00 135.35 ? 319  CYS A O   1 
ATOM   2918 C CB  . CYS A 1 395 ? 54.861  -10.491 33.440  1.00 124.73 ? 319  CYS A CB  1 
ATOM   2919 S SG  . CYS A 1 395 ? 54.081  -12.051 32.936  1.00 131.01 ? 319  CYS A SG  1 
ATOM   2920 N N   . PHE A 1 396 ? 52.883  -9.563  35.699  1.00 133.57 ? 320  PHE A N   1 
ATOM   2921 C CA  . PHE A 1 396 ? 51.822  -9.952  36.625  1.00 137.32 ? 320  PHE A CA  1 
ATOM   2922 C C   . PHE A 1 396 ? 50.825  -8.784  36.863  1.00 144.86 ? 320  PHE A C   1 
ATOM   2923 O O   . PHE A 1 396 ? 49.669  -8.909  36.452  1.00 146.36 ? 320  PHE A O   1 
ATOM   2924 C CB  . PHE A 1 396 ? 52.412  -10.443 37.966  1.00 139.91 ? 320  PHE A CB  1 
ATOM   2925 C CG  . PHE A 1 396 ? 53.374  -11.607 37.819  1.00 140.85 ? 320  PHE A CG  1 
ATOM   2926 C CD1 . PHE A 1 396 ? 52.904  -12.899 37.610  1.00 145.61 ? 320  PHE A CD1 1 
ATOM   2927 C CD2 . PHE A 1 396 ? 54.744  -11.418 37.935  1.00 140.47 ? 320  PHE A CD2 1 
ATOM   2928 C CE1 . PHE A 1 396 ? 53.793  -13.968 37.460  1.00 146.19 ? 320  PHE A CE1 1 
ATOM   2929 C CE2 . PHE A 1 396 ? 55.632  -12.487 37.794  1.00 142.98 ? 320  PHE A CE2 1 
ATOM   2930 C CZ  . PHE A 1 396 ? 55.151  -13.756 37.562  1.00 142.97 ? 320  PHE A CZ  1 
ATOM   2931 N N   . VAL A 1 397 ? 51.261  -7.669  37.506  1.00 142.31 ? 321  VAL A N   1 
ATOM   2932 C CA  . VAL A 1 397 ? 50.395  -6.513  37.832  1.00 143.47 ? 321  VAL A CA  1 
ATOM   2933 C C   . VAL A 1 397 ? 50.023  -5.750  36.519  1.00 147.44 ? 321  VAL A C   1 
ATOM   2934 O O   . VAL A 1 397 ? 48.932  -5.179  36.432  1.00 148.10 ? 321  VAL A O   1 
ATOM   2935 C CB  . VAL A 1 397 ? 51.066  -5.563  38.881  1.00 146.55 ? 321  VAL A CB  1 
ATOM   2936 C CG1 . VAL A 1 397 ? 50.192  -4.346  39.194  1.00 146.89 ? 321  VAL A CG1 1 
ATOM   2937 C CG2 . VAL A 1 397 ? 51.398  -6.316  40.171  1.00 147.94 ? 321  VAL A CG2 1 
ATOM   2938 N N   . GLY A 1 398 ? 50.901  -5.806  35.517  1.00 143.06 ? 322  GLY A N   1 
ATOM   2939 C CA  . GLY A 1 398 ? 50.696  -5.153  34.228  1.00 142.06 ? 322  GLY A CA  1 
ATOM   2940 C C   . GLY A 1 398 ? 49.625  -5.758  33.337  1.00 149.19 ? 322  GLY A C   1 
ATOM   2941 O O   . GLY A 1 398 ? 49.271  -5.162  32.316  1.00 148.07 ? 322  GLY A O   1 
ATOM   2942 N N   . ASN A 1 399 ? 49.102  -6.948  33.702  1.00 149.39 ? 323  ASN A N   1 
ATOM   2943 C CA  . ASN A 1 399 ? 48.040  -7.619  32.941  1.00 151.97 ? 323  ASN A CA  1 
ATOM   2944 C C   . ASN A 1 399 ? 46.688  -6.907  33.172  1.00 158.70 ? 323  ASN A C   1 
ATOM   2945 O O   . ASN A 1 399 ? 45.835  -6.903  32.280  1.00 159.38 ? 323  ASN A O   1 
ATOM   2946 C CB  . ASN A 1 399 ? 47.950  -9.105  33.329  1.00 156.04 ? 323  ASN A CB  1 
ATOM   2947 C CG  . ASN A 1 399 ? 46.951  -9.926  32.530  1.00 186.38 ? 323  ASN A CG  1 
ATOM   2948 O OD1 . ASN A 1 399 ? 46.593  -9.607  31.386  1.00 180.67 ? 323  ASN A OD1 1 
ATOM   2949 N ND2 . ASN A 1 399 ? 46.550  -11.057 33.086  1.00 182.71 ? 323  ASN A ND2 1 
ATOM   2950 N N   . ARG A 1 400 ? 46.506  -6.300  34.369  1.00 156.24 ? 324  ARG A N   1 
ATOM   2951 C CA  . ARG A 1 400 ? 45.291  -5.559  34.727  1.00 157.88 ? 324  ARG A CA  1 
ATOM   2952 C C   . ARG A 1 400 ? 45.256  -4.201  34.016  1.00 160.07 ? 324  ARG A C   1 
ATOM   2953 O O   . ARG A 1 400 ? 44.171  -3.674  33.763  1.00 161.01 ? 324  ARG A O   1 
ATOM   2954 C CB  . ARG A 1 400 ? 45.183  -5.358  36.248  1.00 158.85 ? 324  ARG A CB  1 
ATOM   2955 C CG  . ARG A 1 400 ? 45.139  -6.643  37.073  1.00 170.44 ? 324  ARG A CG  1 
ATOM   2956 C CD  . ARG A 1 400 ? 44.955  -6.350  38.554  1.00 182.66 ? 324  ARG A CD  1 
ATOM   2957 N NE  . ARG A 1 400 ? 46.044  -5.543  39.111  1.00 190.36 ? 324  ARG A NE  1 
ATOM   2958 C CZ  . ARG A 1 400 ? 46.086  -5.098  40.364  1.00 206.52 ? 324  ARG A CZ  1 
ATOM   2959 N NH1 . ARG A 1 400 ? 45.095  -5.371  41.206  1.00 197.70 ? 324  ARG A NH1 1 
ATOM   2960 N NH2 . ARG A 1 400 ? 47.111  -4.368  40.782  1.00 191.16 ? 324  ARG A NH2 1 
ATOM   2961 N N   . PHE A 1 401 ? 46.449  -3.643  33.685  1.00 154.02 ? 325  PHE A N   1 
ATOM   2962 C CA  . PHE A 1 401 ? 46.614  -2.365  32.977  1.00 152.08 ? 325  PHE A CA  1 
ATOM   2963 C C   . PHE A 1 401 ? 45.903  -2.426  31.617  1.00 158.73 ? 325  PHE A C   1 
ATOM   2964 O O   . PHE A 1 401 ? 45.372  -1.421  31.157  1.00 158.25 ? 325  PHE A O   1 
ATOM   2965 C CB  . PHE A 1 401 ? 48.117  -2.043  32.802  1.00 150.33 ? 325  PHE A CB  1 
ATOM   2966 C CG  . PHE A 1 401 ? 48.464  -0.645  32.330  1.00 149.25 ? 325  PHE A CG  1 
ATOM   2967 C CD1 . PHE A 1 401 ? 48.500  -0.337  30.975  1.00 150.64 ? 325  PHE A CD1 1 
ATOM   2968 C CD2 . PHE A 1 401 ? 48.849  0.336   33.237  1.00 150.28 ? 325  PHE A CD2 1 
ATOM   2969 C CE1 . PHE A 1 401 ? 48.846  0.947   30.540  1.00 149.51 ? 325  PHE A CE1 1 
ATOM   2970 C CE2 . PHE A 1 401 ? 49.211  1.614   32.800  1.00 151.02 ? 325  PHE A CE2 1 
ATOM   2971 C CZ  . PHE A 1 401 ? 49.199  1.914   31.456  1.00 147.80 ? 325  PHE A CZ  1 
ATOM   2972 N N   . GLN A 1 402 ? 45.874  -3.626  31.004  1.00 157.73 ? 326  GLN A N   1 
ATOM   2973 C CA  . GLN A 1 402 ? 45.224  -3.938  29.728  1.00 159.08 ? 326  GLN A CA  1 
ATOM   2974 C C   . GLN A 1 402 ? 43.694  -3.793  29.832  1.00 167.02 ? 326  GLN A C   1 
ATOM   2975 O O   . GLN A 1 402 ? 43.075  -3.168  28.970  1.00 166.53 ? 326  GLN A O   1 
ATOM   2976 C CB  . GLN A 1 402 ? 45.595  -5.381  29.316  1.00 161.17 ? 326  GLN A CB  1 
ATOM   2977 C CG  . GLN A 1 402 ? 44.979  -5.876  28.003  1.00 180.29 ? 326  GLN A CG  1 
ATOM   2978 C CD  . GLN A 1 402 ? 45.186  -7.360  27.755  1.00 201.43 ? 326  GLN A CD  1 
ATOM   2979 O OE1 . GLN A 1 402 ? 45.159  -7.824  26.612  1.00 197.29 ? 326  GLN A OE1 1 
ATOM   2980 N NE2 . GLN A 1 402 ? 45.416  -8.142  28.809  1.00 194.64 ? 326  GLN A NE2 1 
ATOM   2981 N N   . GLN A 1 403 ? 43.098  -4.393  30.881  1.00 167.32 ? 327  GLN A N   1 
ATOM   2982 C CA  . GLN A 1 403 ? 41.655  -4.434  31.122  1.00 171.21 ? 327  GLN A CA  1 
ATOM   2983 C C   . GLN A 1 403 ? 41.116  -3.078  31.631  1.00 176.48 ? 327  GLN A C   1 
ATOM   2984 O O   . GLN A 1 403 ? 40.013  -2.687  31.245  1.00 177.97 ? 327  GLN A O   1 
ATOM   2985 C CB  . GLN A 1 403 ? 41.344  -5.542  32.155  1.00 175.22 ? 327  GLN A CB  1 
ATOM   2986 C CG  . GLN A 1 403 ? 39.854  -5.858  32.389  1.00 195.94 ? 327  GLN A CG  1 
ATOM   2987 C CD  . GLN A 1 403 ? 39.146  -6.536  31.229  1.00 218.01 ? 327  GLN A CD  1 
ATOM   2988 O OE1 . GLN A 1 403 ? 39.757  -7.011  30.261  1.00 212.97 ? 327  GLN A OE1 1 
ATOM   2989 N NE2 . GLN A 1 403 ? 37.838  -6.696  31.363  1.00 213.45 ? 327  GLN A NE2 1 
ATOM   2990 N N   . LYS A 1 404 ? 41.880  -2.383  32.501  1.00 172.24 ? 328  LYS A N   1 
ATOM   2991 C CA  . LYS A 1 404 ? 41.481  -1.115  33.124  1.00 172.79 ? 328  LYS A CA  1 
ATOM   2992 C C   . LYS A 1 404 ? 41.685  0.082   32.165  1.00 175.60 ? 328  LYS A C   1 
ATOM   2993 O O   . LYS A 1 404 ? 41.081  1.136   32.385  1.00 175.56 ? 328  LYS A O   1 
ATOM   2994 C CB  . LYS A 1 404 ? 42.259  -0.879  34.432  1.00 174.56 ? 328  LYS A CB  1 
ATOM   2995 C CG  . LYS A 1 404 ? 41.879  -1.844  35.564  1.00 190.99 ? 328  LYS A CG  1 
ATOM   2996 C CD  . LYS A 1 404 ? 40.422  -1.697  36.018  1.00 204.25 ? 328  LYS A CD  1 
ATOM   2997 C CE  . LYS A 1 404 ? 40.023  -2.718  37.053  1.00 217.00 ? 328  LYS A CE  1 
ATOM   2998 N NZ  . LYS A 1 404 ? 38.628  -2.489  37.518  1.00 222.68 ? 328  LYS A NZ  1 
ATOM   2999 N N   . LEU A 1 405 ? 42.478  -0.094  31.091  1.00 171.00 ? 329  LEU A N   1 
ATOM   3000 C CA  . LEU A 1 405 ? 42.691  0.956   30.091  1.00 169.36 ? 329  LEU A CA  1 
ATOM   3001 C C   . LEU A 1 405 ? 41.549  0.922   29.058  1.00 176.87 ? 329  LEU A C   1 
ATOM   3002 O O   . LEU A 1 405 ? 41.155  1.970   28.540  1.00 176.08 ? 329  LEU A O   1 
ATOM   3003 C CB  . LEU A 1 405 ? 44.068  0.791   29.414  1.00 166.17 ? 329  LEU A CB  1 
ATOM   3004 C CG  . LEU A 1 405 ? 44.536  1.882   28.449  1.00 168.32 ? 329  LEU A CG  1 
ATOM   3005 C CD1 . LEU A 1 405 ? 44.577  3.242   29.139  1.00 167.77 ? 329  LEU A CD1 1 
ATOM   3006 C CD2 . LEU A 1 405 ? 45.907  1.537   27.877  1.00 168.02 ? 329  LEU A CD2 1 
ATOM   3007 N N   . ARG A 1 406 ? 41.002  -0.282  28.787  1.00 177.05 ? 330  ARG A N   1 
ATOM   3008 C CA  . ARG A 1 406 ? 39.876  -0.473  27.871  1.00 179.89 ? 330  ARG A CA  1 
ATOM   3009 C C   . ARG A 1 406 ? 38.557  -0.065  28.554  1.00 188.35 ? 330  ARG A C   1 
ATOM   3010 O O   . ARG A 1 406 ? 37.583  0.236   27.863  1.00 189.85 ? 330  ARG A O   1 
ATOM   3011 C CB  . ARG A 1 406 ? 39.809  -1.930  27.384  1.00 181.68 ? 330  ARG A CB  1 
ATOM   3012 N N   . SER A 1 407 ? 38.532  -0.050  29.910  1.00 186.65 ? 331  SER A N   1 
ATOM   3013 C CA  . SER A 1 407 ? 37.362  0.337   30.709  1.00 189.94 ? 331  SER A CA  1 
ATOM   3014 C C   . SER A 1 407 ? 37.147  1.856   30.675  1.00 193.59 ? 331  SER A C   1 
ATOM   3015 O O   . SER A 1 407 ? 36.006  2.301   30.532  1.00 195.71 ? 331  SER A O   1 
ATOM   3016 C CB  . SER A 1 407 ? 37.508  -0.133  32.154  1.00 194.63 ? 331  SER A CB  1 
ATOM   3017 O OG  . SER A 1 407 ? 37.529  -1.549  32.248  1.00 205.25 ? 331  SER A OG  1 
ATOM   3018 N N   . VAL A 1 408 ? 38.238  2.647   30.799  1.00 187.35 ? 332  VAL A N   1 
ATOM   3019 C CA  . VAL A 1 408 ? 38.173  4.115   30.773  1.00 186.37 ? 332  VAL A CA  1 
ATOM   3020 C C   . VAL A 1 408 ? 37.931  4.598   29.320  1.00 190.09 ? 332  VAL A C   1 
ATOM   3021 O O   . VAL A 1 408 ? 37.324  5.654   29.129  1.00 189.93 ? 332  VAL A O   1 
ATOM   3022 C CB  . VAL A 1 408 ? 39.426  4.807   31.390  1.00 187.23 ? 332  VAL A CB  1 
ATOM   3023 C CG1 . VAL A 1 408 ? 39.464  4.633   32.904  1.00 188.18 ? 332  VAL A CG1 1 
ATOM   3024 C CG2 . VAL A 1 408 ? 40.733  4.333   30.744  1.00 183.96 ? 332  VAL A CG2 1 
ATOM   3025 N N   . PHE A 1 409 ? 38.382  3.815   28.314  1.00 186.42 ? 333  PHE A N   1 
ATOM   3026 C CA  . PHE A 1 409 ? 38.219  4.140   26.893  1.00 185.95 ? 333  PHE A CA  1 
ATOM   3027 C C   . PHE A 1 409 ? 36.797  3.781   26.410  1.00 193.55 ? 333  PHE A C   1 
ATOM   3028 O O   . PHE A 1 409 ? 36.128  4.636   25.826  1.00 193.98 ? 333  PHE A O   1 
ATOM   3029 C CB  . PHE A 1 409 ? 39.276  3.411   26.043  1.00 185.39 ? 333  PHE A CB  1 
ATOM   3030 N N   . ARG A 1 410 ? 36.343  2.523   26.675  1.00 192.40 ? 334  ARG A N   1 
ATOM   3031 C CA  . ARG A 1 410 ? 35.026  1.961   26.319  1.00 225.19 ? 334  ARG A CA  1 
ATOM   3032 C C   . ARG A 1 410 ? 34.746  2.115   24.814  1.00 237.68 ? 334  ARG A C   1 
ATOM   3033 O O   . ARG A 1 410 ? 33.885  1.427   24.268  1.00 208.72 ? 334  ARG A O   1 
ATOM   3034 C CB  . ARG A 1 410 ? 33.899  2.621   27.133  1.00 225.70 ? 334  ARG A CB  1 
ATOM   3035 N N   . ALA B 1 1   ? 45.030  41.773  -2.640  1.00 110.43 ? 1001 ALA B N   1 
ATOM   3036 C CA  . ALA B 1 1   ? 44.277  41.103  -3.699  1.00 108.88 ? 1001 ALA B CA  1 
ATOM   3037 C C   . ALA B 1 1   ? 44.954  39.775  -4.118  1.00 110.45 ? 1001 ALA B C   1 
ATOM   3038 O O   . ALA B 1 1   ? 44.320  38.948  -4.785  1.00 109.38 ? 1001 ALA B O   1 
ATOM   3039 C CB  . ALA B 1 1   ? 44.136  42.024  -4.903  1.00 114.36 ? 1001 ALA B CB  1 
ATOM   3040 N N   . ASP B 1 2   ? 46.230  39.573  -3.713  1.00 106.27 ? 1002 ASP B N   1 
ATOM   3041 C CA  . ASP B 1 2   ? 47.017  38.361  -3.985  1.00 105.13 ? 1002 ASP B CA  1 
ATOM   3042 C C   . ASP B 1 2   ? 46.491  37.182  -3.154  1.00 103.46 ? 1002 ASP B C   1 
ATOM   3043 O O   . ASP B 1 2   ? 46.004  37.399  -2.044  1.00 101.54 ? 1002 ASP B O   1 
ATOM   3044 C CB  . ASP B 1 2   ? 48.506  38.622  -3.671  1.00 110.26 ? 1002 ASP B CB  1 
ATOM   3045 C CG  . ASP B 1 2   ? 49.463  37.468  -3.936  1.00 119.13 ? 1002 ASP B CG  1 
ATOM   3046 O OD1 . ASP B 1 2   ? 49.142  36.607  -4.791  1.00 119.05 ? 1002 ASP B OD1 1 
ATOM   3047 O OD2 . ASP B 1 2   ? 50.569  37.477  -3.361  1.00 126.11 ? 1002 ASP B OD2 1 
ATOM   3048 N N   . LEU B 1 3   ? 46.601  35.938  -3.682  1.00 97.57  ? 1003 LEU B N   1 
ATOM   3049 C CA  . LEU B 1 3   ? 46.114  34.715  -3.018  1.00 92.83  ? 1003 LEU B CA  1 
ATOM   3050 C C   . LEU B 1 3   ? 46.880  34.431  -1.700  1.00 94.06  ? 1003 LEU B C   1 
ATOM   3051 O O   . LEU B 1 3   ? 46.254  34.075  -0.702  1.00 89.98  ? 1003 LEU B O   1 
ATOM   3052 C CB  . LEU B 1 3   ? 46.247  33.507  -3.963  1.00 93.69  ? 1003 LEU B CB  1 
ATOM   3053 C CG  . LEU B 1 3   ? 45.702  32.160  -3.467  1.00 95.58  ? 1003 LEU B CG  1 
ATOM   3054 C CD1 . LEU B 1 3   ? 44.191  32.201  -3.312  1.00 93.03  ? 1003 LEU B CD1 1 
ATOM   3055 C CD2 . LEU B 1 3   ? 46.058  31.055  -4.426  1.00 100.00 ? 1003 LEU B CD2 1 
ATOM   3056 N N   . GLU B 1 4   ? 48.215  34.591  -1.705  1.00 93.76  ? 1004 GLU B N   1 
ATOM   3057 C CA  . GLU B 1 4   ? 49.075  34.371  -0.536  1.00 94.01  ? 1004 GLU B CA  1 
ATOM   3058 C C   . GLU B 1 4   ? 48.745  35.380  0.588   1.00 97.74  ? 1004 GLU B C   1 
ATOM   3059 O O   . GLU B 1 4   ? 48.688  34.999  1.761   1.00 96.26  ? 1004 GLU B O   1 
ATOM   3060 C CB  . GLU B 1 4   ? 50.554  34.490  -0.952  1.00 99.86  ? 1004 GLU B CB  1 
ATOM   3061 C CG  . GLU B 1 4   ? 51.554  34.243  0.169   1.00 112.26 ? 1004 GLU B CG  1 
ATOM   3062 C CD  . GLU B 1 4   ? 53.019  34.422  -0.186  1.00 137.40 ? 1004 GLU B CD  1 
ATOM   3063 O OE1 . GLU B 1 4   ? 53.859  34.305  0.734   1.00 141.38 ? 1004 GLU B OE1 1 
ATOM   3064 O OE2 . GLU B 1 4   ? 53.329  34.705  -1.367  1.00 130.13 ? 1004 GLU B OE2 1 
ATOM   3065 N N   . ASP B 1 5   ? 48.523  36.658  0.213   1.00 95.67  ? 1005 ASP B N   1 
ATOM   3066 C CA  . ASP B 1 5   ? 48.221  37.764  1.123   1.00 95.90  ? 1005 ASP B CA  1 
ATOM   3067 C C   . ASP B 1 5   ? 46.796  37.650  1.681   1.00 96.79  ? 1005 ASP B C   1 
ATOM   3068 O O   . ASP B 1 5   ? 46.562  38.085  2.811   1.00 96.48  ? 1005 ASP B O   1 
ATOM   3069 C CB  . ASP B 1 5   ? 48.401  39.098  0.393   1.00 101.17 ? 1005 ASP B CB  1 
ATOM   3070 C CG  . ASP B 1 5   ? 49.810  39.314  -0.131  1.00 113.02 ? 1005 ASP B CG  1 
ATOM   3071 O OD1 . ASP B 1 5   ? 50.759  38.756  0.464   1.00 113.72 ? 1005 ASP B OD1 1 
ATOM   3072 O OD2 . ASP B 1 5   ? 49.968  40.073  -1.101  1.00 122.48 ? 1005 ASP B OD2 1 
ATOM   3073 N N   . ASN B 1 6   ? 45.851  37.062  0.900   1.00 91.09  ? 1006 ASN B N   1 
ATOM   3074 C CA  . ASN B 1 6   ? 44.473  36.814  1.338   1.00 87.52  ? 1006 ASN B CA  1 
ATOM   3075 C C   . ASN B 1 6   ? 44.444  35.683  2.352   1.00 90.68  ? 1006 ASN B C   1 
ATOM   3076 O O   . ASN B 1 6   ? 43.681  35.772  3.313   1.00 88.94  ? 1006 ASN B O   1 
ATOM   3077 C CB  . ASN B 1 6   ? 43.547  36.503  0.168   1.00 85.01  ? 1006 ASN B CB  1 
ATOM   3078 C CG  . ASN B 1 6   ? 43.151  37.710  -0.638  1.00 107.73 ? 1006 ASN B CG  1 
ATOM   3079 O OD1 . ASN B 1 6   ? 43.035  38.828  -0.121  1.00 104.64 ? 1006 ASN B OD1 1 
ATOM   3080 N ND2 . ASN B 1 6   ? 42.803  37.489  -1.895  1.00 100.73 ? 1006 ASN B ND2 1 
ATOM   3081 N N   . TRP B 1 7   ? 45.298  34.638  2.174   1.00 88.98  ? 1007 TRP B N   1 
ATOM   3082 C CA  . TRP B 1 7   ? 45.400  33.555  3.156   1.00 88.52  ? 1007 TRP B CA  1 
ATOM   3083 C C   . TRP B 1 7   ? 46.049  34.070  4.436   1.00 93.22  ? 1007 TRP B C   1 
ATOM   3084 O O   . TRP B 1 7   ? 45.733  33.575  5.517   1.00 92.14  ? 1007 TRP B O   1 
ATOM   3085 C CB  . TRP B 1 7   ? 46.160  32.331  2.630   1.00 88.97  ? 1007 TRP B CB  1 
ATOM   3086 C CG  . TRP B 1 7   ? 45.302  31.413  1.815   1.00 89.24  ? 1007 TRP B CG  1 
ATOM   3087 C CD1 . TRP B 1 7   ? 45.274  31.306  0.457   1.00 93.41  ? 1007 TRP B CD1 1 
ATOM   3088 C CD2 . TRP B 1 7   ? 44.255  30.562  2.309   1.00 87.32  ? 1007 TRP B CD2 1 
ATOM   3089 N NE1 . TRP B 1 7   ? 44.311  30.399  0.074   1.00 92.19  ? 1007 TRP B NE1 1 
ATOM   3090 C CE2 . TRP B 1 7   ? 43.662  29.936  1.191   1.00 91.73  ? 1007 TRP B CE2 1 
ATOM   3091 C CE3 . TRP B 1 7   ? 43.762  30.262  3.593   1.00 87.48  ? 1007 TRP B CE3 1 
ATOM   3092 C CZ2 . TRP B 1 7   ? 42.605  29.025  1.316   1.00 90.19  ? 1007 TRP B CZ2 1 
ATOM   3093 C CZ3 . TRP B 1 7   ? 42.697  29.382  3.712   1.00 87.90  ? 1007 TRP B CZ3 1 
ATOM   3094 C CH2 . TRP B 1 7   ? 42.146  28.756  2.587   1.00 88.87  ? 1007 TRP B CH2 1 
ATOM   3095 N N   . GLU B 1 8   ? 46.906  35.098  4.323   1.00 91.92  ? 1008 GLU B N   1 
ATOM   3096 C CA  . GLU B 1 8   ? 47.522  35.730  5.481   1.00 94.26  ? 1008 GLU B CA  1 
ATOM   3097 C C   . GLU B 1 8   ? 46.443  36.516  6.242   1.00 97.07  ? 1008 GLU B C   1 
ATOM   3098 O O   . GLU B 1 8   ? 46.401  36.453  7.468   1.00 97.63  ? 1008 GLU B O   1 
ATOM   3099 C CB  . GLU B 1 8   ? 48.701  36.620  5.055   1.00 99.97  ? 1008 GLU B CB  1 
ATOM   3100 C CG  . GLU B 1 8   ? 49.520  37.159  6.215   1.00 115.60 ? 1008 GLU B CG  1 
ATOM   3101 C CD  . GLU B 1 8   ? 50.804  37.877  5.840   1.00 149.64 ? 1008 GLU B CD  1 
ATOM   3102 O OE1 . GLU B 1 8   ? 51.267  37.730  4.684   1.00 146.09 ? 1008 GLU B OE1 1 
ATOM   3103 O OE2 . GLU B 1 8   ? 51.393  38.524  6.736   1.00 151.77 ? 1008 GLU B OE2 1 
ATOM   3104 N N   . THR B 1 9   ? 45.515  37.173  5.504   1.00 91.81  ? 1009 THR B N   1 
ATOM   3105 C CA  . THR B 1 9   ? 44.393  37.930  6.073   1.00 90.72  ? 1009 THR B CA  1 
ATOM   3106 C C   . THR B 1 9   ? 43.420  36.947  6.764   1.00 91.14  ? 1009 THR B C   1 
ATOM   3107 O O   . THR B 1 9   ? 42.895  37.258  7.834   1.00 91.31  ? 1009 THR B O   1 
ATOM   3108 C CB  . THR B 1 9   ? 43.697  38.763  4.976   1.00 97.93  ? 1009 THR B CB  1 
ATOM   3109 O OG1 . THR B 1 9   ? 44.667  39.546  4.283   1.00 101.07 ? 1009 THR B OG1 1 
ATOM   3110 C CG2 . THR B 1 9   ? 42.616  39.677  5.527   1.00 97.90  ? 1009 THR B CG2 1 
ATOM   3111 N N   . LEU B 1 10  ? 43.213  35.753  6.162   1.00 84.69  ? 1010 LEU B N   1 
ATOM   3112 C CA  . LEU B 1 10  ? 42.342  34.707  6.712   1.00 81.77  ? 1010 LEU B CA  1 
ATOM   3113 C C   . LEU B 1 10  ? 42.934  34.100  7.976   1.00 85.05  ? 1010 LEU B C   1 
ATOM   3114 O O   . LEU B 1 10  ? 42.199  33.874  8.932   1.00 84.54  ? 1010 LEU B O   1 
ATOM   3115 C CB  . LEU B 1 10  ? 42.086  33.586  5.680   1.00 80.14  ? 1010 LEU B CB  1 
ATOM   3116 C CG  . LEU B 1 10  ? 41.135  33.904  4.522   1.00 84.41  ? 1010 LEU B CG  1 
ATOM   3117 C CD1 . LEU B 1 10  ? 41.209  32.853  3.457   1.00 84.49  ? 1010 LEU B CD1 1 
ATOM   3118 C CD2 . LEU B 1 10  ? 39.713  34.028  5.002   1.00 85.98  ? 1010 LEU B CD2 1 
ATOM   3119 N N   . ASN B 1 11  ? 44.255  33.842  7.981   1.00 81.87  ? 1011 ASN B N   1 
ATOM   3120 C CA  . ASN B 1 11  ? 44.935  33.206  9.103   1.00 82.49  ? 1011 ASN B CA  1 
ATOM   3121 C C   . ASN B 1 11  ? 45.217  34.208  10.237  1.00 87.72  ? 1011 ASN B C   1 
ATOM   3122 O O   . ASN B 1 11  ? 45.187  33.796  11.393  1.00 87.98  ? 1011 ASN B O   1 
ATOM   3123 C CB  . ASN B 1 11  ? 46.231  32.549  8.645   1.00 82.68  ? 1011 ASN B CB  1 
ATOM   3124 C CG  . ASN B 1 11  ? 46.015  31.333  7.759   1.00 95.71  ? 1011 ASN B CG  1 
ATOM   3125 O OD1 . ASN B 1 11  ? 45.252  30.413  8.083   1.00 84.84  ? 1011 ASN B OD1 1 
ATOM   3126 N ND2 . ASN B 1 11  ? 46.773  31.243  6.679   1.00 89.00  ? 1011 ASN B ND2 1 
ATOM   3127 N N   . ASP B 1 12  ? 45.460  35.500  9.936   1.00 86.00  ? 1012 ASP B N   1 
ATOM   3128 C CA  . ASP B 1 12  ? 45.690  36.490  10.998  1.00 89.75  ? 1012 ASP B CA  1 
ATOM   3129 C C   . ASP B 1 12  ? 44.370  36.789  11.750  1.00 92.85  ? 1012 ASP B C   1 
ATOM   3130 O O   . ASP B 1 12  ? 44.389  36.874  12.981  1.00 95.01  ? 1012 ASP B O   1 
ATOM   3131 C CB  . ASP B 1 12  ? 46.308  37.793  10.452  1.00 94.97  ? 1012 ASP B CB  1 
ATOM   3132 C CG  . ASP B 1 12  ? 47.747  37.690  9.935   1.00 112.80 ? 1012 ASP B CG  1 
ATOM   3133 O OD1 . ASP B 1 12  ? 48.298  36.556  9.901   1.00 113.50 ? 1012 ASP B OD1 1 
ATOM   3134 O OD2 . ASP B 1 12  ? 48.318  38.740  9.555   1.00 122.52 ? 1012 ASP B OD2 1 
ATOM   3135 N N   . ASN B 1 13  ? 43.228  36.899  11.014  1.00 85.83  ? 1013 ASN B N   1 
ATOM   3136 C CA  . ASN B 1 13  ? 41.897  37.143  11.590  1.00 84.34  ? 1013 ASN B CA  1 
ATOM   3137 C C   . ASN B 1 13  ? 41.351  35.898  12.296  1.00 85.86  ? 1013 ASN B C   1 
ATOM   3138 O O   . ASN B 1 13  ? 40.549  36.036  13.215  1.00 86.38  ? 1013 ASN B O   1 
ATOM   3139 C CB  . ASN B 1 13  ? 40.904  37.601  10.529  1.00 81.02  ? 1013 ASN B CB  1 
ATOM   3140 C CG  . ASN B 1 13  ? 41.033  39.055  10.160  1.00 97.67  ? 1013 ASN B CG  1 
ATOM   3141 O OD1 . ASN B 1 13  ? 40.722  39.941  10.957  1.00 97.73  ? 1013 ASN B OD1 1 
ATOM   3142 N ND2 . ASN B 1 13  ? 41.354  39.335  8.909   1.00 83.41  ? 1013 ASN B ND2 1 
ATOM   3143 N N   . LEU B 1 14  ? 41.791  34.698  11.891  1.00 80.79  ? 1014 LEU B N   1 
ATOM   3144 C CA  . LEU B 1 14  ? 41.377  33.444  12.528  1.00 79.98  ? 1014 LEU B CA  1 
ATOM   3145 C C   . LEU B 1 14  ? 41.996  33.355  13.937  1.00 87.83  ? 1014 LEU B C   1 
ATOM   3146 O O   . LEU B 1 14  ? 41.371  32.814  14.851  1.00 88.55  ? 1014 LEU B O   1 
ATOM   3147 C CB  . LEU B 1 14  ? 41.787  32.240  11.654  1.00 78.20  ? 1014 LEU B CB  1 
ATOM   3148 C CG  . LEU B 1 14  ? 41.160  30.885  11.976  1.00 82.20  ? 1014 LEU B CG  1 
ATOM   3149 C CD1 . LEU B 1 14  ? 39.666  30.892  11.678  1.00 80.35  ? 1014 LEU B CD1 1 
ATOM   3150 C CD2 . LEU B 1 14  ? 41.800  29.796  11.149  1.00 83.29  ? 1014 LEU B CD2 1 
ATOM   3151 N N   . LYS B 1 15  ? 43.212  33.933  14.108  1.00 87.17  ? 1015 LYS B N   1 
ATOM   3152 C CA  . LYS B 1 15  ? 43.926  34.025  15.384  1.00 91.52  ? 1015 LYS B CA  1 
ATOM   3153 C C   . LYS B 1 15  ? 43.222  35.002  16.322  1.00 98.24  ? 1015 LYS B C   1 
ATOM   3154 O O   . LYS B 1 15  ? 43.195  34.768  17.531  1.00 101.55 ? 1015 LYS B O   1 
ATOM   3155 C CB  . LYS B 1 15  ? 45.390  34.459  15.178  1.00 97.22  ? 1015 LYS B CB  1 
ATOM   3156 C CG  . LYS B 1 15  ? 46.260  33.454  14.427  1.00 111.79 ? 1015 LYS B CG  1 
ATOM   3157 C CD  . LYS B 1 15  ? 47.667  33.997  14.214  1.00 125.01 ? 1015 LYS B CD  1 
ATOM   3158 C CE  . LYS B 1 15  ? 48.532  33.067  13.404  1.00 133.18 ? 1015 LYS B CE  1 
ATOM   3159 N NZ  . LYS B 1 15  ? 49.882  33.646  13.173  1.00 145.85 ? 1015 LYS B NZ  1 
ATOM   3160 N N   . VAL B 1 16  ? 42.663  36.105  15.763  1.00 93.56  ? 1016 VAL B N   1 
ATOM   3161 C CA  . VAL B 1 16  ? 41.929  37.147  16.501  1.00 95.79  ? 1016 VAL B CA  1 
ATOM   3162 C C   . VAL B 1 16  ? 40.702  36.508  17.192  1.00 98.21  ? 1016 VAL B C   1 
ATOM   3163 O O   . VAL B 1 16  ? 40.481  36.760  18.377  1.00 102.09 ? 1016 VAL B O   1 
ATOM   3164 C CB  . VAL B 1 16  ? 41.515  38.331  15.572  1.00 98.74  ? 1016 VAL B CB  1 
ATOM   3165 C CG1 . VAL B 1 16  ? 40.644  39.350  16.305  1.00 101.89 ? 1016 VAL B CG1 1 
ATOM   3166 C CG2 . VAL B 1 16  ? 42.739  39.015  14.969  1.00 100.29 ? 1016 VAL B CG2 1 
ATOM   3167 N N   . ILE B 1 17  ? 39.953  35.646  16.457  1.00 89.09  ? 1017 ILE B N   1 
ATOM   3168 C CA  . ILE B 1 17  ? 38.755  34.937  16.932  1.00 87.52  ? 1017 ILE B CA  1 
ATOM   3169 C C   . ILE B 1 17  ? 39.096  34.091  18.182  1.00 95.96  ? 1017 ILE B C   1 
ATOM   3170 O O   . ILE B 1 17  ? 38.346  34.133  19.157  1.00 97.94  ? 1017 ILE B O   1 
ATOM   3171 C CB  . ILE B 1 17  ? 38.152  34.049  15.801  1.00 85.35  ? 1017 ILE B CB  1 
ATOM   3172 C CG1 . ILE B 1 17  ? 37.788  34.905  14.555  1.00 83.18  ? 1017 ILE B CG1 1 
ATOM   3173 C CG2 . ILE B 1 17  ? 36.933  33.268  16.303  1.00 85.17  ? 1017 ILE B CG2 1 
ATOM   3174 C CD1 . ILE B 1 17  ? 37.345  34.125  13.291  1.00 84.74  ? 1017 ILE B CD1 1 
ATOM   3175 N N   . GLU B 1 18  ? 40.226  33.349  18.154  1.00 94.48  ? 1018 GLU B N   1 
ATOM   3176 C CA  . GLU B 1 18  ? 40.674  32.494  19.269  1.00 98.32  ? 1018 GLU B CA  1 
ATOM   3177 C C   . GLU B 1 18  ? 40.915  33.299  20.548  1.00 107.91 ? 1018 GLU B C   1 
ATOM   3178 O O   . GLU B 1 18  ? 40.554  32.842  21.634  1.00 110.66 ? 1018 GLU B O   1 
ATOM   3179 C CB  . GLU B 1 18  ? 41.970  31.740  18.908  1.00 99.93  ? 1018 GLU B CB  1 
ATOM   3180 C CG  . GLU B 1 18  ? 41.871  30.787  17.725  1.00 107.97 ? 1018 GLU B CG  1 
ATOM   3181 C CD  . GLU B 1 18  ? 43.159  30.054  17.379  1.00 136.11 ? 1018 GLU B CD  1 
ATOM   3182 O OE1 . GLU B 1 18  ? 43.292  29.633  16.208  1.00 128.08 ? 1018 GLU B OE1 1 
ATOM   3183 O OE2 . GLU B 1 18  ? 44.060  29.961  18.246  1.00 138.96 ? 1018 GLU B OE2 1 
ATOM   3184 N N   . LYS B 1 19  ? 41.536  34.489  20.413  1.00 106.75 ? 1019 LYS B N   1 
ATOM   3185 C CA  . LYS B 1 19  ? 41.897  35.361  21.533  1.00 113.10 ? 1019 LYS B CA  1 
ATOM   3186 C C   . LYS B 1 19  ? 40.875  36.510  21.721  1.00 118.11 ? 1019 LYS B C   1 
ATOM   3187 O O   . LYS B 1 19  ? 41.153  37.456  22.465  1.00 123.29 ? 1019 LYS B O   1 
ATOM   3188 C CB  . LYS B 1 19  ? 43.307  35.946  21.310  1.00 118.50 ? 1019 LYS B CB  1 
ATOM   3189 C CG  . LYS B 1 19  ? 44.414  34.895  21.222  1.00 135.34 ? 1019 LYS B CG  1 
ATOM   3190 C CD  . LYS B 1 19  ? 45.779  35.533  21.021  1.00 149.18 ? 1019 LYS B CD  1 
ATOM   3191 C CE  . LYS B 1 19  ? 46.875  34.502  20.959  1.00 162.93 ? 1019 LYS B CE  1 
ATOM   3192 N NZ  . LYS B 1 19  ? 48.209  35.129  20.773  1.00 177.05 ? 1019 LYS B NZ  1 
ATOM   3193 N N   . ALA B 1 20  ? 39.693  36.409  21.083  1.00 110.18 ? 1020 ALA B N   1 
ATOM   3194 C CA  . ALA B 1 20  ? 38.652  37.433  21.183  1.00 111.08 ? 1020 ALA B CA  1 
ATOM   3195 C C   . ALA B 1 20  ? 37.926  37.357  22.520  1.00 119.88 ? 1020 ALA B C   1 
ATOM   3196 O O   . ALA B 1 20  ? 37.725  36.267  23.064  1.00 119.37 ? 1020 ALA B O   1 
ATOM   3197 C CB  . ALA B 1 20  ? 37.653  37.289  20.049  1.00 106.35 ? 1020 ALA B CB  1 
ATOM   3198 N N   . ASP B 1 21  ? 37.529  38.529  23.039  1.00 121.48 ? 1021 ASP B N   1 
ATOM   3199 C CA  . ASP B 1 21  ? 36.823  38.677  24.309  1.00 127.19 ? 1021 ASP B CA  1 
ATOM   3200 C C   . ASP B 1 21  ? 35.321  38.812  24.077  1.00 129.79 ? 1021 ASP B C   1 
ATOM   3201 O O   . ASP B 1 21  ? 34.536  38.103  24.712  1.00 130.16 ? 1021 ASP B O   1 
ATOM   3202 C CB  . ASP B 1 21  ? 37.358  39.908  25.079  1.00 136.42 ? 1021 ASP B CB  1 
ATOM   3203 C CG  . ASP B 1 21  ? 38.851  39.908  25.383  1.00 151.39 ? 1021 ASP B CG  1 
ATOM   3204 O OD1 . ASP B 1 21  ? 39.469  38.816  25.358  1.00 151.20 ? 1021 ASP B OD1 1 
ATOM   3205 O OD2 . ASP B 1 21  ? 39.388  40.987  25.707  1.00 162.10 ? 1021 ASP B OD2 1 
ATOM   3206 N N   . ASN B 1 22  ? 34.925  39.719  23.153  1.00 124.80 ? 1022 ASN B N   1 
ATOM   3207 C CA  . ASN B 1 22  ? 33.527  40.024  22.837  1.00 123.68 ? 1022 ASN B CA  1 
ATOM   3208 C C   . ASN B 1 22  ? 33.142  39.552  21.408  1.00 119.71 ? 1022 ASN B C   1 
ATOM   3209 O O   . ASN B 1 22  ? 34.013  39.240  20.591  1.00 115.57 ? 1022 ASN B O   1 
ATOM   3210 C CB  . ASN B 1 22  ? 33.271  41.534  22.982  1.00 129.89 ? 1022 ASN B CB  1 
ATOM   3211 C CG  . ASN B 1 22  ? 34.199  42.419  22.188  1.00 152.75 ? 1022 ASN B CG  1 
ATOM   3212 O OD1 . ASN B 1 22  ? 34.079  42.553  20.971  1.00 143.87 ? 1022 ASN B OD1 1 
ATOM   3213 N ND2 . ASN B 1 22  ? 35.088  43.113  22.880  1.00 149.00 ? 1022 ASN B ND2 1 
ATOM   3214 N N   . ALA B 1 23  ? 31.817  39.499  21.137  1.00 114.58 ? 1023 ALA B N   1 
ATOM   3215 C CA  . ALA B 1 23  ? 31.215  39.072  19.868  1.00 108.59 ? 1023 ALA B CA  1 
ATOM   3216 C C   . ALA B 1 23  ? 31.527  40.046  18.733  1.00 109.69 ? 1023 ALA B C   1 
ATOM   3217 O O   . ALA B 1 23  ? 31.537  39.633  17.574  1.00 104.81 ? 1023 ALA B O   1 
ATOM   3218 C CB  . ALA B 1 23  ? 29.709  38.943  20.025  1.00 110.72 ? 1023 ALA B CB  1 
ATOM   3219 N N   . ALA B 1 24  ? 31.772  41.334  19.060  1.00 109.88 ? 1024 ALA B N   1 
ATOM   3220 C CA  . ALA B 1 24  ? 32.107  42.369  18.079  1.00 109.01 ? 1024 ALA B CA  1 
ATOM   3221 C C   . ALA B 1 24  ? 33.489  42.114  17.461  1.00 109.42 ? 1024 ALA B C   1 
ATOM   3222 O O   . ALA B 1 24  ? 33.666  42.375  16.272  1.00 106.83 ? 1024 ALA B O   1 
ATOM   3223 C CB  . ALA B 1 24  ? 32.068  43.742  18.724  1.00 116.18 ? 1024 ALA B CB  1 
ATOM   3224 N N   . GLN B 1 25  ? 34.456  41.582  18.257  1.00 105.79 ? 1025 GLN B N   1 
ATOM   3225 C CA  . GLN B 1 25  ? 35.801  41.228  17.774  1.00 102.92 ? 1025 GLN B CA  1 
ATOM   3226 C C   . GLN B 1 25  ? 35.723  40.070  16.784  1.00 99.87  ? 1025 GLN B C   1 
ATOM   3227 O O   . GLN B 1 25  ? 36.402  40.096  15.755  1.00 96.95  ? 1025 GLN B O   1 
ATOM   3228 C CB  . GLN B 1 25  ? 36.748  40.861  18.932  1.00 107.45 ? 1025 GLN B CB  1 
ATOM   3229 C CG  . GLN B 1 25  ? 37.056  42.000  19.899  1.00 129.82 ? 1025 GLN B CG  1 
ATOM   3230 C CD  . GLN B 1 25  ? 38.020  41.599  20.994  1.00 153.86 ? 1025 GLN B CD  1 
ATOM   3231 O OE1 . GLN B 1 25  ? 37.831  41.933  22.169  1.00 156.27 ? 1025 GLN B OE1 1 
ATOM   3232 N NE2 . GLN B 1 25  ? 39.050  40.833  20.650  1.00 142.67 ? 1025 GLN B NE2 1 
ATOM   3233 N N   . VAL B 1 26  ? 34.877  39.058  17.101  1.00 93.90  ? 1026 VAL B N   1 
ATOM   3234 C CA  . VAL B 1 26  ? 34.642  37.860  16.286  1.00 88.22  ? 1026 VAL B CA  1 
ATOM   3235 C C   . VAL B 1 26  ? 33.957  38.279  14.971  1.00 89.14  ? 1026 VAL B C   1 
ATOM   3236 O O   . VAL B 1 26  ? 34.421  37.892  13.900  1.00 85.76  ? 1026 VAL B O   1 
ATOM   3237 C CB  . VAL B 1 26  ? 33.809  36.792  17.056  1.00 91.87  ? 1026 VAL B CB  1 
ATOM   3238 C CG1 . VAL B 1 26  ? 33.605  35.536  16.214  1.00 87.45  ? 1026 VAL B CG1 1 
ATOM   3239 C CG2 . VAL B 1 26  ? 34.459  36.432  18.388  1.00 94.95  ? 1026 VAL B CG2 1 
ATOM   3240 N N   . LYS B 1 27  ? 32.882  39.101  15.062  1.00 87.36  ? 1027 LYS B N   1 
ATOM   3241 C CA  . LYS B 1 27  ? 32.115  39.605  13.916  1.00 86.25  ? 1027 LYS B CA  1 
ATOM   3242 C C   . LYS B 1 27  ? 33.024  40.390  12.950  1.00 90.56  ? 1027 LYS B C   1 
ATOM   3243 O O   . LYS B 1 27  ? 32.985  40.139  11.744  1.00 87.21  ? 1027 LYS B O   1 
ATOM   3244 C CB  . LYS B 1 27  ? 30.954  40.494  14.396  1.00 92.41  ? 1027 LYS B CB  1 
ATOM   3245 C CG  . LYS B 1 27  ? 30.042  41.015  13.278  1.00 105.56 ? 1027 LYS B CG  1 
ATOM   3246 C CD  . LYS B 1 27  ? 29.040  42.081  13.757  1.00 119.82 ? 1027 LYS B CD  1 
ATOM   3247 C CE  . LYS B 1 27  ? 29.687  43.384  14.176  1.00 136.93 ? 1027 LYS B CE  1 
ATOM   3248 N NZ  . LYS B 1 27  ? 28.676  44.383  14.611  1.00 153.62 ? 1027 LYS B NZ  1 
ATOM   3249 N N   . ASP B 1 28  ? 33.849  41.319  13.491  1.00 91.51  ? 1028 ASP B N   1 
ATOM   3250 C CA  . ASP B 1 28  ? 34.787  42.153  12.727  1.00 93.07  ? 1028 ASP B CA  1 
ATOM   3251 C C   . ASP B 1 28  ? 35.791  41.282  11.955  1.00 94.16  ? 1028 ASP B C   1 
ATOM   3252 O O   . ASP B 1 28  ? 35.952  41.473  10.748  1.00 93.02  ? 1028 ASP B O   1 
ATOM   3253 C CB  . ASP B 1 28  ? 35.538  43.121  13.665  1.00 100.49 ? 1028 ASP B CB  1 
ATOM   3254 C CG  . ASP B 1 28  ? 36.494  44.081  12.975  1.00 118.63 ? 1028 ASP B CG  1 
ATOM   3255 O OD1 . ASP B 1 28  ? 36.108  44.659  11.931  1.00 119.72 ? 1028 ASP B OD1 1 
ATOM   3256 O OD2 . ASP B 1 28  ? 37.576  44.352  13.545  1.00 129.86 ? 1028 ASP B OD2 1 
ATOM   3257 N N   . ALA B 1 29  ? 36.434  40.310  12.646  1.00 89.11  ? 1029 ALA B N   1 
ATOM   3258 C CA  . ALA B 1 29  ? 37.407  39.391  12.059  1.00 86.00  ? 1029 ALA B CA  1 
ATOM   3259 C C   . ALA B 1 29  ? 36.777  38.557  10.927  1.00 85.98  ? 1029 ALA B C   1 
ATOM   3260 O O   . ALA B 1 29  ? 37.372  38.473  9.856   1.00 84.93  ? 1029 ALA B O   1 
ATOM   3261 C CB  . ALA B 1 29  ? 37.975  38.475  13.130  1.00 87.06  ? 1029 ALA B CB  1 
ATOM   3262 N N   . LEU B 1 30  ? 35.562  37.993  11.146  1.00 80.55  ? 1030 LEU B N   1 
ATOM   3263 C CA  . LEU B 1 30  ? 34.829  37.179  10.159  1.00 77.45  ? 1030 LEU B CA  1 
ATOM   3264 C C   . LEU B 1 30  ? 34.388  37.993  8.934   1.00 81.86  ? 1030 LEU B C   1 
ATOM   3265 O O   . LEU B 1 30  ? 34.260  37.424  7.848   1.00 79.55  ? 1030 LEU B O   1 
ATOM   3266 C CB  . LEU B 1 30  ? 33.584  36.542  10.795  1.00 77.40  ? 1030 LEU B CB  1 
ATOM   3267 C CG  . LEU B 1 30  ? 33.779  35.416  11.799  1.00 81.51  ? 1030 LEU B CG  1 
ATOM   3268 C CD1 . LEU B 1 30  ? 32.537  35.222  12.634  1.00 82.68  ? 1030 LEU B CD1 1 
ATOM   3269 C CD2 . LEU B 1 30  ? 34.225  34.116  11.116  1.00 81.61  ? 1030 LEU B CD2 1 
ATOM   3270 N N   . THR B 1 31  ? 34.112  39.302  9.111   1.00 81.38  ? 1031 THR B N   1 
ATOM   3271 C CA  . THR B 1 31  ? 33.706  40.191  8.015   1.00 82.03  ? 1031 THR B CA  1 
ATOM   3272 C C   . THR B 1 31  ? 34.907  40.404  7.079   1.00 84.86  ? 1031 THR B C   1 
ATOM   3273 O O   . THR B 1 31  ? 34.748  40.400  5.854   1.00 83.69  ? 1031 THR B O   1 
ATOM   3274 C CB  . THR B 1 31  ? 33.163  41.509  8.577   1.00 94.39  ? 1031 THR B CB  1 
ATOM   3275 O OG1 . THR B 1 31  ? 32.061  41.220  9.434   1.00 94.80  ? 1031 THR B OG1 1 
ATOM   3276 C CG2 . THR B 1 31  ? 32.713  42.467  7.490   1.00 97.03  ? 1031 THR B CG2 1 
ATOM   3277 N N   . LYS B 1 32  ? 36.110  40.558  7.671   1.00 81.76  ? 1032 LYS B N   1 
ATOM   3278 C CA  . LYS B 1 32  ? 37.369  40.727  6.944   1.00 81.81  ? 1032 LYS B CA  1 
ATOM   3279 C C   . LYS B 1 32  ? 37.725  39.436  6.225   1.00 82.50  ? 1032 LYS B C   1 
ATOM   3280 O O   . LYS B 1 32  ? 38.253  39.479  5.115   1.00 82.40  ? 1032 LYS B O   1 
ATOM   3281 C CB  . LYS B 1 32  ? 38.505  41.150  7.902   1.00 85.97  ? 1032 LYS B CB  1 
ATOM   3282 C CG  . LYS B 1 32  ? 38.286  42.499  8.580   1.00 87.68  ? 1032 LYS B CG  1 
ATOM   3283 C CD  . LYS B 1 32  ? 39.344  42.764  9.628   1.00 91.20  ? 1032 LYS B CD  1 
ATOM   3284 C CE  . LYS B 1 32  ? 39.088  44.036  10.388  1.00 99.64  ? 1032 LYS B CE  1 
ATOM   3285 N NZ  . LYS B 1 32  ? 40.076  44.223  11.480  1.00 112.25 ? 1032 LYS B NZ  1 
ATOM   3286 N N   . MET B 1 33  ? 37.406  38.287  6.856   1.00 76.67  ? 1033 MET B N   1 
ATOM   3287 C CA  . MET B 1 33  ? 37.658  36.948  6.318   1.00 73.80  ? 1033 MET B CA  1 
ATOM   3288 C C   . MET B 1 33  ? 36.742  36.631  5.141   1.00 76.11  ? 1033 MET B C   1 
ATOM   3289 O O   . MET B 1 33  ? 37.210  36.031  4.175   1.00 75.12  ? 1033 MET B O   1 
ATOM   3290 C CB  . MET B 1 33  ? 37.483  35.870  7.393   1.00 74.88  ? 1033 MET B CB  1 
ATOM   3291 C CG  . MET B 1 33  ? 38.524  35.923  8.468   1.00 79.73  ? 1033 MET B CG  1 
ATOM   3292 S SD  . MET B 1 33  ? 38.371  34.589  9.671   1.00 83.79  ? 1033 MET B SD  1 
ATOM   3293 C CE  . MET B 1 33  ? 38.702  33.155  8.613   1.00 78.44  ? 1033 MET B CE  1 
ATOM   3294 N N   . ARG B 1 34  ? 35.438  37.015  5.217   1.00 72.10  ? 1034 ARG B N   1 
ATOM   3295 C CA  . ARG B 1 34  ? 34.484  36.756  4.134   1.00 71.19  ? 1034 ARG B CA  1 
ATOM   3296 C C   . ARG B 1 34  ? 34.906  37.533  2.875   1.00 77.16  ? 1034 ARG B C   1 
ATOM   3297 O O   . ARG B 1 34  ? 34.773  37.021  1.761   1.00 77.33  ? 1034 ARG B O   1 
ATOM   3298 C CB  . ARG B 1 34  ? 33.051  37.120  4.548   1.00 69.35  ? 1034 ARG B CB  1 
ATOM   3299 C CG  . ARG B 1 34  ? 32.008  36.455  3.660   1.00 71.27  ? 1034 ARG B CG  1 
ATOM   3300 C CD  . ARG B 1 34  ? 30.596  36.930  3.935   1.00 73.70  ? 1034 ARG B CD  1 
ATOM   3301 N NE  . ARG B 1 34  ? 29.611  36.043  3.310   1.00 74.33  ? 1034 ARG B NE  1 
ATOM   3302 C CZ  . ARG B 1 34  ? 29.164  36.149  2.064   1.00 86.88  ? 1034 ARG B CZ  1 
ATOM   3303 N NH1 . ARG B 1 34  ? 29.620  37.108  1.266   1.00 74.85  ? 1034 ARG B NH1 1 
ATOM   3304 N NH2 . ARG B 1 34  ? 28.273  35.286  1.599   1.00 76.35  ? 1034 ARG B NH2 1 
ATOM   3305 N N   . ALA B 1 35  ? 35.454  38.746  3.070   1.00 75.23  ? 1035 ALA B N   1 
ATOM   3306 C CA  . ALA B 1 35  ? 35.961  39.589  1.997   1.00 77.51  ? 1035 ALA B CA  1 
ATOM   3307 C C   . ALA B 1 35  ? 37.213  38.969  1.363   1.00 81.15  ? 1035 ALA B C   1 
ATOM   3308 O O   . ALA B 1 35  ? 37.317  38.930  0.137   1.00 81.72  ? 1035 ALA B O   1 
ATOM   3309 C CB  . ALA B 1 35  ? 36.270  40.976  2.534   1.00 81.25  ? 1035 ALA B CB  1 
ATOM   3310 N N   . ALA B 1 36  ? 38.141  38.451  2.201   1.00 76.71  ? 1036 ALA B N   1 
ATOM   3311 C CA  . ALA B 1 36  ? 39.394  37.832  1.764   1.00 76.37  ? 1036 ALA B CA  1 
ATOM   3312 C C   . ALA B 1 36  ? 39.143  36.492  1.082   1.00 79.88  ? 1036 ALA B C   1 
ATOM   3313 O O   . ALA B 1 36  ? 39.872  36.146  0.156   1.00 80.61  ? 1036 ALA B O   1 
ATOM   3314 C CB  . ALA B 1 36  ? 40.326  37.640  2.951   1.00 76.71  ? 1036 ALA B CB  1 
ATOM   3315 N N   . ALA B 1 37  ? 38.120  35.741  1.536   1.00 75.83  ? 1037 ALA B N   1 
ATOM   3316 C CA  . ALA B 1 37  ? 37.775  34.433  0.979   1.00 75.32  ? 1037 ALA B CA  1 
ATOM   3317 C C   . ALA B 1 37  ? 37.216  34.566  -0.448  1.00 81.46  ? 1037 ALA B C   1 
ATOM   3318 O O   . ALA B 1 37  ? 37.593  33.780  -1.319  1.00 81.85  ? 1037 ALA B O   1 
ATOM   3319 C CB  . ALA B 1 37  ? 36.769  33.729  1.871   1.00 74.53  ? 1037 ALA B CB  1 
ATOM   3320 N N   . LEU B 1 38  ? 36.334  35.559  -0.683  1.00 79.60  ? 1038 LEU B N   1 
ATOM   3321 C CA  . LEU B 1 38  ? 35.732  35.824  -1.995  1.00 82.01  ? 1038 LEU B CA  1 
ATOM   3322 C C   . LEU B 1 38  ? 36.761  36.420  -2.964  1.00 90.57  ? 1038 LEU B C   1 
ATOM   3323 O O   . LEU B 1 38  ? 36.679  36.169  -4.166  1.00 92.41  ? 1038 LEU B O   1 
ATOM   3324 C CB  . LEU B 1 38  ? 34.523  36.771  -1.865  1.00 82.99  ? 1038 LEU B CB  1 
ATOM   3325 C CG  . LEU B 1 38  ? 33.277  36.233  -1.143  1.00 85.85  ? 1038 LEU B CG  1 
ATOM   3326 C CD1 . LEU B 1 38  ? 32.307  37.339  -0.855  1.00 87.30  ? 1038 LEU B CD1 1 
ATOM   3327 C CD2 . LEU B 1 38  ? 32.599  35.119  -1.936  1.00 88.55  ? 1038 LEU B CD2 1 
ATOM   3328 N N   . ASP B 1 39  ? 37.724  37.207  -2.437  1.00 89.10  ? 1039 ASP B N   1 
ATOM   3329 C CA  . ASP B 1 39  ? 38.809  37.835  -3.205  1.00 92.11  ? 1039 ASP B CA  1 
ATOM   3330 C C   . ASP B 1 39  ? 39.826  36.763  -3.619  1.00 95.08  ? 1039 ASP B C   1 
ATOM   3331 O O   . ASP B 1 39  ? 40.317  36.793  -4.749  1.00 98.03  ? 1039 ASP B O   1 
ATOM   3332 C CB  . ASP B 1 39  ? 39.475  38.957  -2.367  1.00 95.48  ? 1039 ASP B CB  1 
ATOM   3333 C CG  . ASP B 1 39  ? 40.573  39.794  -3.029  1.00 113.85 ? 1039 ASP B CG  1 
ATOM   3334 O OD1 . ASP B 1 39  ? 40.781  39.650  -4.257  1.00 116.91 ? 1039 ASP B OD1 1 
ATOM   3335 O OD2 . ASP B 1 39  ? 41.179  40.639  -2.327  1.00 121.99 ? 1039 ASP B OD2 1 
ATOM   3336 N N   . ALA B 1 40  ? 40.109  35.793  -2.715  1.00 87.97  ? 1040 ALA B N   1 
ATOM   3337 C CA  . ALA B 1 40  ? 41.036  34.683  -2.970  1.00 87.19  ? 1040 ALA B CA  1 
ATOM   3338 C C   . ALA B 1 40  ? 40.440  33.695  -3.975  1.00 90.89  ? 1040 ALA B C   1 
ATOM   3339 O O   . ALA B 1 40  ? 41.187  33.074  -4.729  1.00 91.85  ? 1040 ALA B O   1 
ATOM   3340 C CB  . ALA B 1 40  ? 41.378  33.971  -1.672  1.00 85.28  ? 1040 ALA B CB  1 
ATOM   3341 N N   . GLN B 1 41  ? 39.093  33.577  -4.000  1.00 86.97  ? 1041 GLN B N   1 
ATOM   3342 C CA  . GLN B 1 41  ? 38.335  32.708  -4.910  1.00 88.35  ? 1041 GLN B CA  1 
ATOM   3343 C C   . GLN B 1 41  ? 38.515  33.161  -6.372  1.00 97.71  ? 1041 GLN B C   1 
ATOM   3344 O O   . GLN B 1 41  ? 38.514  32.328  -7.278  1.00 99.37  ? 1041 GLN B O   1 
ATOM   3345 C CB  . GLN B 1 41  ? 36.844  32.720  -4.523  1.00 88.27  ? 1041 GLN B CB  1 
ATOM   3346 C CG  . GLN B 1 41  ? 35.980  31.700  -5.268  1.00 93.25  ? 1041 GLN B CG  1 
ATOM   3347 C CD  . GLN B 1 41  ? 34.508  31.790  -4.921  1.00 104.26 ? 1041 GLN B CD  1 
ATOM   3348 O OE1 . GLN B 1 41  ? 34.004  32.811  -4.430  1.00 100.46 ? 1041 GLN B OE1 1 
ATOM   3349 N NE2 . GLN B 1 41  ? 33.766  30.748  -5.253  1.00 90.89  ? 1041 GLN B NE2 1 
ATOM   3350 N N   . LYS B 1 42  ? 38.679  34.481  -6.585  1.00 97.37  ? 1042 LYS B N   1 
ATOM   3351 C CA  . LYS B 1 42  ? 38.864  35.101  -7.901  1.00 102.36 ? 1042 LYS B CA  1 
ATOM   3352 C C   . LYS B 1 42  ? 40.318  34.945  -8.396  1.00 111.40 ? 1042 LYS B C   1 
ATOM   3353 O O   . LYS B 1 42  ? 40.555  34.980  -9.606  1.00 115.19 ? 1042 LYS B O   1 
ATOM   3354 C CB  . LYS B 1 42  ? 38.483  36.592  -7.846  1.00 105.50 ? 1042 LYS B CB  1 
ATOM   3355 C CG  . LYS B 1 42  ? 37.013  36.837  -7.509  1.00 115.30 ? 1042 LYS B CG  1 
ATOM   3356 C CD  . LYS B 1 42  ? 36.690  38.315  -7.417  1.00 126.65 ? 1042 LYS B CD  1 
ATOM   3357 N N   . ALA B 1 43  ? 41.281  34.767  -7.461  1.00 107.88 ? 1043 ALA B N   1 
ATOM   3358 C CA  . ALA B 1 43  ? 42.713  34.610  -7.759  1.00 110.46 ? 1043 ALA B CA  1 
ATOM   3359 C C   . ALA B 1 43  ? 43.029  33.217  -8.334  1.00 116.95 ? 1043 ALA B C   1 
ATOM   3360 O O   . ALA B 1 43  ? 42.300  32.260  -8.074  1.00 115.03 ? 1043 ALA B O   1 
ATOM   3361 C CB  . ALA B 1 43  ? 43.534  34.839  -6.494  1.00 108.78 ? 1043 ALA B CB  1 
ATOM   3362 N N   . THR B 1 44  ? 44.126  33.112  -9.109  1.00 118.03 ? 1044 THR B N   1 
ATOM   3363 C CA  . THR B 1 44  ? 44.596  31.853  -9.698  1.00 120.25 ? 1044 THR B CA  1 
ATOM   3364 C C   . THR B 1 44  ? 45.945  31.486  -9.037  1.00 124.20 ? 1044 THR B C   1 
ATOM   3365 O O   . THR B 1 44  ? 46.866  32.312  -9.042  1.00 125.30 ? 1044 THR B O   1 
ATOM   3366 C CB  . THR B 1 44  ? 44.692  31.975  -11.229 1.00 133.53 ? 1044 THR B CB  1 
ATOM   3367 O OG1 . THR B 1 44  ? 43.426  32.395  -11.745 1.00 134.15 ? 1044 THR B OG1 1 
ATOM   3368 C CG2 . THR B 1 44  ? 45.116  30.670  -11.898 1.00 135.25 ? 1044 THR B CG2 1 
ATOM   3369 N N   . PRO B 1 45  ? 46.074  30.263  -8.454  1.00 119.64 ? 1045 PRO B N   1 
ATOM   3370 C CA  . PRO B 1 45  ? 47.330  29.895  -7.760  1.00 119.82 ? 1045 PRO B CA  1 
ATOM   3371 C C   . PRO B 1 45  ? 48.548  29.801  -8.703  1.00 130.07 ? 1045 PRO B C   1 
ATOM   3372 O O   . PRO B 1 45  ? 48.362  29.594  -9.904  1.00 133.12 ? 1045 PRO B O   1 
ATOM   3373 C CB  . PRO B 1 45  ? 47.014  28.518  -7.163  1.00 119.79 ? 1045 PRO B CB  1 
ATOM   3374 C CG  . PRO B 1 45  ? 45.873  28.004  -7.942  1.00 124.97 ? 1045 PRO B CG  1 
ATOM   3375 C CD  . PRO B 1 45  ? 45.064  29.194  -8.333  1.00 119.74 ? 1045 PRO B CD  1 
ATOM   3376 N N   . PRO B 1 46  ? 49.805  29.951  -8.181  1.00 129.25 ? 1046 PRO B N   1 
ATOM   3377 C CA  . PRO B 1 46  ? 50.994  29.878  -9.066  1.00 135.49 ? 1046 PRO B CA  1 
ATOM   3378 C C   . PRO B 1 46  ? 51.103  28.522  -9.769  1.00 143.84 ? 1046 PRO B C   1 
ATOM   3379 O O   . PRO B 1 46  ? 51.493  28.463  -10.936 1.00 148.30 ? 1046 PRO B O   1 
ATOM   3380 C CB  . PRO B 1 46  ? 52.173  30.101  -8.109  1.00 137.57 ? 1046 PRO B CB  1 
ATOM   3381 C CG  . PRO B 1 46  ? 51.632  29.813  -6.745  1.00 136.59 ? 1046 PRO B CG  1 
ATOM   3382 C CD  . PRO B 1 46  ? 50.198  30.218  -6.781  1.00 128.02 ? 1046 PRO B CD  1 
ATOM   3383 N N   . LYS B 1 47  ? 50.746  27.440  -9.056  1.00 139.22 ? 1047 LYS B N   1 
ATOM   3384 C CA  . LYS B 1 47  ? 50.680  26.091  -9.608  1.00 142.49 ? 1047 LYS B CA  1 
ATOM   3385 C C   . LYS B 1 47  ? 49.323  25.964  -10.307 1.00 147.12 ? 1047 LYS B C   1 
ATOM   3386 O O   . LYS B 1 47  ? 48.350  26.580  -9.856  1.00 142.73 ? 1047 LYS B O   1 
ATOM   3387 C CB  . LYS B 1 47  ? 50.917  25.031  -8.517  1.00 143.27 ? 1047 LYS B CB  1 
ATOM   3388 C CG  . LYS B 1 47  ? 52.339  25.098  -7.942  1.00 154.35 ? 1047 LYS B CG  1 
ATOM   3389 C CD  . LYS B 1 47  ? 52.608  24.055  -6.868  1.00 161.31 ? 1047 LYS B CD  1 
ATOM   3390 C CE  . LYS B 1 47  ? 54.008  24.191  -6.316  1.00 169.80 ? 1047 LYS B CE  1 
ATOM   3391 N NZ  . LYS B 1 47  ? 54.295  23.172  -5.276  1.00 175.59 ? 1047 LYS B NZ  1 
ATOM   3392 N N   . LEU B 1 48  ? 49.278  25.246  -11.456 1.00 149.32 ? 1048 LEU B N   1 
ATOM   3393 C CA  . LEU B 1 48  ? 48.112  25.120  -12.356 1.00 150.86 ? 1048 LEU B CA  1 
ATOM   3394 C C   . LEU B 1 48  ? 47.629  26.551  -12.747 1.00 152.86 ? 1048 LEU B C   1 
ATOM   3395 O O   . LEU B 1 48  ? 46.438  26.868  -12.672 1.00 149.45 ? 1048 LEU B O   1 
ATOM   3396 C CB  . LEU B 1 48  ? 46.957  24.263  -11.774 1.00 148.28 ? 1048 LEU B CB  1 
ATOM   3397 N N   . GLU B 1 49  ? 48.597  27.407  -13.151 1.00 151.83 ? 1049 GLU B N   1 
ATOM   3398 C CA  . GLU B 1 49  ? 48.382  28.788  -13.587 1.00 151.79 ? 1049 GLU B CA  1 
ATOM   3399 C C   . GLU B 1 49  ? 47.836  28.790  -15.013 1.00 160.66 ? 1049 GLU B C   1 
ATOM   3400 O O   . GLU B 1 49  ? 46.766  29.351  -15.252 1.00 159.38 ? 1049 GLU B O   1 
ATOM   3401 C CB  . GLU B 1 49  ? 49.693  29.593  -13.484 1.00 155.00 ? 1049 GLU B CB  1 
ATOM   3402 C CG  . GLU B 1 49  ? 49.572  31.063  -13.860 1.00 166.80 ? 1049 GLU B CG  1 
ATOM   3403 C CD  . GLU B 1 49  ? 50.845  31.887  -13.783 1.00 191.40 ? 1049 GLU B CD  1 
ATOM   3404 O OE1 . GLU B 1 49  ? 50.788  33.084  -14.144 1.00 187.81 ? 1049 GLU B OE1 1 
ATOM   3405 O OE2 . GLU B 1 49  ? 51.899  31.343  -13.377 1.00 186.42 ? 1049 GLU B OE2 1 
ATOM   3406 N N   . ASP B 1 50  ? 48.555  28.135  -15.953 1.00 163.29 ? 1050 ASP B N   1 
ATOM   3407 C CA  . ASP B 1 50  ? 48.130  28.002  -17.344 1.00 169.75 ? 1050 ASP B CA  1 
ATOM   3408 C C   . ASP B 1 50  ? 47.149  26.819  -17.444 1.00 174.55 ? 1050 ASP B C   1 
ATOM   3409 O O   . ASP B 1 50  ? 47.468  25.769  -18.008 1.00 178.84 ? 1050 ASP B O   1 
ATOM   3410 C CB  . ASP B 1 50  ? 49.349  27.835  -18.270 1.00 178.92 ? 1050 ASP B CB  1 
ATOM   3411 N N   . LYS B 1 51  ? 45.964  26.995  -16.834 1.00 166.80 ? 1051 LYS B N   1 
ATOM   3412 C CA  . LYS B 1 51  ? 44.889  26.006  -16.749 1.00 166.49 ? 1051 LYS B CA  1 
ATOM   3413 C C   . LYS B 1 51  ? 43.543  26.673  -17.055 1.00 170.85 ? 1051 LYS B C   1 
ATOM   3414 O O   . LYS B 1 51  ? 43.277  27.770  -16.554 1.00 166.78 ? 1051 LYS B O   1 
ATOM   3415 C CB  . LYS B 1 51  ? 44.887  25.370  -15.337 1.00 162.57 ? 1051 LYS B CB  1 
ATOM   3416 C CG  . LYS B 1 51  ? 43.895  24.217  -15.117 1.00 172.01 ? 1051 LYS B CG  1 
ATOM   3417 C CD  . LYS B 1 51  ? 44.290  22.884  -15.771 1.00 184.94 ? 1051 LYS B CD  1 
ATOM   3418 C CE  . LYS B 1 51  ? 45.506  22.247  -15.136 1.00 190.07 ? 1051 LYS B CE  1 
ATOM   3419 N NZ  . LYS B 1 51  ? 45.791  20.913  -15.719 1.00 203.32 ? 1051 LYS B NZ  1 
ATOM   3420 N N   . SER B 1 52  ? 42.698  26.010  -17.870 1.00 172.98 ? 1052 SER B N   1 
ATOM   3421 C CA  . SER B 1 52  ? 41.372  26.504  -18.264 1.00 173.88 ? 1052 SER B CA  1 
ATOM   3422 C C   . SER B 1 52  ? 40.440  26.653  -17.033 1.00 170.75 ? 1052 SER B C   1 
ATOM   3423 O O   . SER B 1 52  ? 40.573  25.876  -16.085 1.00 166.56 ? 1052 SER B O   1 
ATOM   3424 C CB  . SER B 1 52  ? 40.740  25.567  -19.292 1.00 184.56 ? 1052 SER B CB  1 
ATOM   3425 O OG  . SER B 1 52  ? 40.575  24.253  -18.783 1.00 193.04 ? 1052 SER B OG  1 
ATOM   3426 N N   . PRO B 1 53  ? 39.507  27.641  -17.011 1.00 165.99 ? 1053 PRO B N   1 
ATOM   3427 C CA  . PRO B 1 53  ? 38.625  27.788  -15.834 1.00 159.60 ? 1053 PRO B CA  1 
ATOM   3428 C C   . PRO B 1 53  ? 37.587  26.660  -15.729 1.00 164.85 ? 1053 PRO B C   1 
ATOM   3429 O O   . PRO B 1 53  ? 37.141  26.350  -14.624 1.00 159.89 ? 1053 PRO B O   1 
ATOM   3430 C CB  . PRO B 1 53  ? 37.930  29.139  -16.070 1.00 161.29 ? 1053 PRO B CB  1 
ATOM   3431 C CG  . PRO B 1 53  ? 38.676  29.791  -17.202 1.00 171.10 ? 1053 PRO B CG  1 
ATOM   3432 C CD  . PRO B 1 53  ? 39.217  28.674  -18.024 1.00 172.05 ? 1053 PRO B CD  1 
ATOM   3433 N N   . ASP B 1 54  ? 37.224  26.033  -16.868 1.00 168.24 ? 1054 ASP B N   1 
ATOM   3434 C CA  . ASP B 1 54  ? 36.247  24.940  -16.926 1.00 171.08 ? 1054 ASP B CA  1 
ATOM   3435 C C   . ASP B 1 54  ? 36.866  23.591  -16.471 1.00 174.33 ? 1054 ASP B C   1 
ATOM   3436 O O   . ASP B 1 54  ? 36.151  22.588  -16.401 1.00 177.06 ? 1054 ASP B O   1 
ATOM   3437 C CB  . ASP B 1 54  ? 35.683  24.800  -18.357 1.00 181.82 ? 1054 ASP B CB  1 
ATOM   3438 C CG  . ASP B 1 54  ? 34.940  26.019  -18.889 1.00 193.21 ? 1054 ASP B CG  1 
ATOM   3439 O OD1 . ASP B 1 54  ? 34.979  27.081  -18.226 1.00 187.92 ? 1054 ASP B OD1 1 
ATOM   3440 O OD2 . ASP B 1 54  ? 34.343  25.918  -19.980 1.00 206.08 ? 1054 ASP B OD2 1 
ATOM   3441 N N   . SER B 1 55  ? 38.179  23.578  -16.152 1.00 167.32 ? 1055 SER B N   1 
ATOM   3442 C CA  . SER B 1 55  ? 38.921  22.393  -15.702 1.00 167.04 ? 1055 SER B CA  1 
ATOM   3443 C C   . SER B 1 55  ? 38.438  21.926  -14.306 1.00 163.67 ? 1055 SER B C   1 
ATOM   3444 O O   . SER B 1 55  ? 38.101  22.776  -13.476 1.00 156.91 ? 1055 SER B O   1 
ATOM   3445 C CB  . SER B 1 55  ? 40.415  22.698  -15.668 1.00 169.78 ? 1055 SER B CB  1 
ATOM   3446 O OG  . SER B 1 55  ? 41.189  21.564  -15.321 1.00 180.66 ? 1055 SER B OG  1 
ATOM   3447 N N   . PRO B 1 56  ? 38.405  20.590  -14.023 1.00 161.86 ? 1056 PRO B N   1 
ATOM   3448 C CA  . PRO B 1 56  ? 37.902  20.120  -12.714 1.00 156.76 ? 1056 PRO B CA  1 
ATOM   3449 C C   . PRO B 1 56  ? 38.753  20.577  -11.519 1.00 151.99 ? 1056 PRO B C   1 
ATOM   3450 O O   . PRO B 1 56  ? 38.186  20.788  -10.447 1.00 146.64 ? 1056 PRO B O   1 
ATOM   3451 C CB  . PRO B 1 56  ? 37.963  18.594  -12.834 1.00 164.33 ? 1056 PRO B CB  1 
ATOM   3452 C CG  . PRO B 1 56  ? 37.956  18.323  -14.294 1.00 176.98 ? 1056 PRO B CG  1 
ATOM   3453 C CD  . PRO B 1 56  ? 38.729  19.447  -14.902 1.00 171.28 ? 1056 PRO B CD  1 
ATOM   3454 N N   . GLU B 1 57  ? 40.089  20.722  -11.688 1.00 147.40 ? 1057 GLU B N   1 
ATOM   3455 C CA  . GLU B 1 57  ? 40.980  21.154  -10.597 1.00 140.91 ? 1057 GLU B CA  1 
ATOM   3456 C C   . GLU B 1 57  ? 40.843  22.677  -10.338 1.00 137.50 ? 1057 GLU B C   1 
ATOM   3457 O O   . GLU B 1 57  ? 41.149  23.114  -9.227  1.00 131.36 ? 1057 GLU B O   1 
ATOM   3458 C CB  . GLU B 1 57  ? 42.470  20.790  -10.832 1.00 144.76 ? 1057 GLU B CB  1 
ATOM   3459 C CG  . GLU B 1 57  ? 43.035  20.969  -12.239 1.00 161.07 ? 1057 GLU B CG  1 
ATOM   3460 C CD  . GLU B 1 57  ? 42.710  19.874  -13.246 1.00 189.94 ? 1057 GLU B CD  1 
ATOM   3461 O OE1 . GLU B 1 57  ? 41.996  18.908  -12.890 1.00 186.48 ? 1057 GLU B OE1 1 
ATOM   3462 O OE2 . GLU B 1 57  ? 43.201  19.971  -14.393 1.00 190.26 ? 1057 GLU B OE2 1 
ATOM   3463 N N   . MET B 1 58  ? 40.360  23.467  -11.318 1.00 135.03 ? 1058 MET B N   1 
ATOM   3464 C CA  . MET B 1 58  ? 40.117  24.895  -11.084 1.00 130.30 ? 1058 MET B CA  1 
ATOM   3465 C C   . MET B 1 58  ? 38.718  25.096  -10.489 1.00 130.16 ? 1058 MET B C   1 
ATOM   3466 O O   . MET B 1 58  ? 38.541  25.988  -9.655  1.00 124.69 ? 1058 MET B O   1 
ATOM   3467 C CB  . MET B 1 58  ? 40.297  25.742  -12.349 1.00 136.26 ? 1058 MET B CB  1 
ATOM   3468 C CG  . MET B 1 58  ? 41.754  26.057  -12.657 1.00 140.91 ? 1058 MET B CG  1 
ATOM   3469 S SD  . MET B 1 58  ? 42.604  27.024  -11.359 1.00 138.43 ? 1058 MET B SD  1 
ATOM   3470 C CE  . MET B 1 58  ? 41.684  28.569  -11.422 1.00 132.95 ? 1058 MET B CE  1 
ATOM   3471 N N   . LYS B 1 59  ? 37.736  24.248  -10.886 1.00 129.57 ? 1059 LYS B N   1 
ATOM   3472 C CA  . LYS B 1 59  ? 36.377  24.288  -10.332 1.00 127.28 ? 1059 LYS B CA  1 
ATOM   3473 C C   . LYS B 1 59  ? 36.388  23.829  -8.860  1.00 125.15 ? 1059 LYS B C   1 
ATOM   3474 O O   . LYS B 1 59  ? 35.608  24.344  -8.057  1.00 121.01 ? 1059 LYS B O   1 
ATOM   3475 C CB  . LYS B 1 59  ? 35.399  23.434  -11.159 1.00 135.53 ? 1059 LYS B CB  1 
ATOM   3476 C CG  . LYS B 1 59  ? 35.071  24.022  -12.527 1.00 147.81 ? 1059 LYS B CG  1 
ATOM   3477 C CD  . LYS B 1 59  ? 34.031  23.189  -13.251 1.00 161.26 ? 1059 LYS B CD  1 
ATOM   3478 C CE  . LYS B 1 59  ? 33.606  23.831  -14.545 1.00 175.45 ? 1059 LYS B CE  1 
ATOM   3479 N NZ  . LYS B 1 59  ? 32.596  23.012  -15.261 1.00 191.45 ? 1059 LYS B NZ  1 
ATOM   3480 N N   . ASP B 1 60  ? 37.300  22.892  -8.510  1.00 121.37 ? 1060 ASP B N   1 
ATOM   3481 C CA  . ASP B 1 60  ? 37.490  22.392  -7.146  1.00 117.48 ? 1060 ASP B CA  1 
ATOM   3482 C C   . ASP B 1 60  ? 38.100  23.484  -6.256  1.00 114.86 ? 1060 ASP B C   1 
ATOM   3483 O O   . ASP B 1 60  ? 37.725  23.602  -5.088  1.00 111.23 ? 1060 ASP B O   1 
ATOM   3484 C CB  . ASP B 1 60  ? 38.389  21.135  -7.151  1.00 122.47 ? 1060 ASP B CB  1 
ATOM   3485 C CG  . ASP B 1 60  ? 38.647  20.506  -5.787  1.00 130.20 ? 1060 ASP B CG  1 
ATOM   3486 O OD1 . ASP B 1 60  ? 37.733  20.547  -4.926  1.00 128.58 ? 1060 ASP B OD1 1 
ATOM   3487 O OD2 . ASP B 1 60  ? 39.717  19.881  -5.617  1.00 137.04 ? 1060 ASP B OD2 1 
ATOM   3488 N N   . PHE B 1 61  ? 39.040  24.279  -6.819  1.00 110.14 ? 1061 PHE B N   1 
ATOM   3489 C CA  . PHE B 1 61  ? 39.718  25.380  -6.133  1.00 105.44 ? 1061 PHE B CA  1 
ATOM   3490 C C   . PHE B 1 61  ? 38.711  26.426  -5.670  1.00 105.30 ? 1061 PHE B C   1 
ATOM   3491 O O   . PHE B 1 61  ? 38.742  26.811  -4.502  1.00 101.38 ? 1061 PHE B O   1 
ATOM   3492 C CB  . PHE B 1 61  ? 40.775  26.026  -7.049  1.00 109.14 ? 1061 PHE B CB  1 
ATOM   3493 C CG  . PHE B 1 61  ? 41.455  27.240  -6.466  1.00 107.65 ? 1061 PHE B CG  1 
ATOM   3494 C CD1 . PHE B 1 61  ? 42.543  27.104  -5.613  1.00 109.45 ? 1061 PHE B CD1 1 
ATOM   3495 C CD2 . PHE B 1 61  ? 41.030  28.520  -6.796  1.00 109.11 ? 1061 PHE B CD2 1 
ATOM   3496 C CE1 . PHE B 1 61  ? 43.168  28.225  -5.073  1.00 108.48 ? 1061 PHE B CE1 1 
ATOM   3497 C CE2 . PHE B 1 61  ? 41.654  29.640  -6.253  1.00 110.00 ? 1061 PHE B CE2 1 
ATOM   3498 C CZ  . PHE B 1 61  ? 42.727  29.487  -5.405  1.00 106.88 ? 1061 PHE B CZ  1 
ATOM   3499 N N   . ARG B 1 62  ? 37.824  26.882  -6.578  1.00 103.15 ? 1062 ARG B N   1 
ATOM   3500 C CA  . ARG B 1 62  ? 36.799  27.880  -6.262  1.00 100.78 ? 1062 ARG B CA  1 
ATOM   3501 C C   . ARG B 1 62  ? 35.712  27.270  -5.364  1.00 102.50 ? 1062 ARG B C   1 
ATOM   3502 O O   . ARG B 1 62  ? 35.118  27.994  -4.564  1.00 99.69  ? 1062 ARG B O   1 
ATOM   3503 C CB  . ARG B 1 62  ? 36.175  28.467  -7.537  1.00 104.39 ? 1062 ARG B CB  1 
ATOM   3504 C CG  . ARG B 1 62  ? 37.163  29.256  -8.396  1.00 117.53 ? 1062 ARG B CG  1 
ATOM   3505 C CD  . ARG B 1 62  ? 36.510  29.872  -9.625  1.00 136.26 ? 1062 ARG B CD  1 
ATOM   3506 N NE  . ARG B 1 62  ? 35.950  28.860  -10.523 1.00 154.21 ? 1062 ARG B NE  1 
ATOM   3507 C CZ  . ARG B 1 62  ? 36.613  28.301  -11.530 1.00 173.13 ? 1062 ARG B CZ  1 
ATOM   3508 N NH1 . ARG B 1 62  ? 37.866  28.657  -11.790 1.00 161.38 ? 1062 ARG B NH1 1 
ATOM   3509 N NH2 . ARG B 1 62  ? 36.027  27.387  -12.290 1.00 163.35 ? 1062 ARG B NH2 1 
ATOM   3510 N N   . HIS B 1 63  ? 35.484  25.938  -5.467  1.00 100.65 ? 1063 HIS B N   1 
ATOM   3511 C CA  . HIS B 1 63  ? 34.505  25.222  -4.642  1.00 100.08 ? 1063 HIS B CA  1 
ATOM   3512 C C   . HIS B 1 63  ? 34.938  25.226  -3.167  1.00 98.13  ? 1063 HIS B C   1 
ATOM   3513 O O   . HIS B 1 63  ? 34.087  25.339  -2.279  1.00 96.49  ? 1063 HIS B O   1 
ATOM   3514 C CB  . HIS B 1 63  ? 34.312  23.780  -5.140  1.00 105.54 ? 1063 HIS B CB  1 
ATOM   3515 C CG  . HIS B 1 63  ? 33.334  22.995  -4.325  1.00 109.84 ? 1063 HIS B CG  1 
ATOM   3516 N ND1 . HIS B 1 63  ? 31.971  23.108  -4.530  1.00 113.72 ? 1063 HIS B ND1 1 
ATOM   3517 C CD2 . HIS B 1 63  ? 33.555  22.108  -3.329  1.00 111.41 ? 1063 HIS B CD2 1 
ATOM   3518 C CE1 . HIS B 1 63  ? 31.407  22.299  -3.647  1.00 113.98 ? 1063 HIS B CE1 1 
ATOM   3519 N NE2 . HIS B 1 63  ? 32.320  21.672  -2.904  1.00 112.97 ? 1063 HIS B NE2 1 
ATOM   3520 N N   . GLY B 1 64  ? 36.247  25.125  -2.932  1.00 91.45  ? 1064 GLY B N   1 
ATOM   3521 C CA  . GLY B 1 64  ? 36.833  25.157  -1.597  1.00 87.52  ? 1064 GLY B CA  1 
ATOM   3522 C C   . GLY B 1 64  ? 36.515  26.439  -0.850  1.00 86.67  ? 1064 GLY B C   1 
ATOM   3523 O O   . GLY B 1 64  ? 36.309  26.411  0.368   1.00 84.56  ? 1064 GLY B O   1 
ATOM   3524 N N   . PHE B 1 65  ? 36.438  27.574  -1.588  1.00 81.30  ? 1065 PHE B N   1 
ATOM   3525 C CA  . PHE B 1 65  ? 36.113  28.875  -1.009  1.00 77.92  ? 1065 PHE B CA  1 
ATOM   3526 C C   . PHE B 1 65  ? 34.598  29.016  -0.812  1.00 81.18  ? 1065 PHE B C   1 
ATOM   3527 O O   . PHE B 1 65  ? 34.188  29.767  0.071   1.00 79.04  ? 1065 PHE B O   1 
ATOM   3528 C CB  . PHE B 1 65  ? 36.654  30.027  -1.861  1.00 79.91  ? 1065 PHE B CB  1 
ATOM   3529 C CG  . PHE B 1 65  ? 38.159  30.110  -1.820  1.00 80.75  ? 1065 PHE B CG  1 
ATOM   3530 C CD1 . PHE B 1 65  ? 38.810  30.696  -0.740  1.00 81.70  ? 1065 PHE B CD1 1 
ATOM   3531 C CD2 . PHE B 1 65  ? 38.927  29.620  -2.865  1.00 84.93  ? 1065 PHE B CD2 1 
ATOM   3532 C CE1 . PHE B 1 65  ? 40.203  30.746  -0.686  1.00 82.87  ? 1065 PHE B CE1 1 
ATOM   3533 C CE2 . PHE B 1 65  ? 40.322  29.691  -2.820  1.00 88.03  ? 1065 PHE B CE2 1 
ATOM   3534 C CZ  . PHE B 1 65  ? 40.950  30.255  -1.731  1.00 84.10  ? 1065 PHE B CZ  1 
ATOM   3535 N N   . ASP B 1 66  ? 33.769  28.269  -1.578  1.00 79.74  ? 1066 ASP B N   1 
ATOM   3536 C CA  . ASP B 1 66  ? 32.314  28.269  -1.372  1.00 80.12  ? 1066 ASP B CA  1 
ATOM   3537 C C   . ASP B 1 66  ? 31.991  27.564  -0.048  1.00 81.88  ? 1066 ASP B C   1 
ATOM   3538 O O   . ASP B 1 66  ? 31.086  27.995  0.668   1.00 81.30  ? 1066 ASP B O   1 
ATOM   3539 C CB  . ASP B 1 66  ? 31.559  27.616  -2.551  1.00 85.76  ? 1066 ASP B CB  1 
ATOM   3540 C CG  . ASP B 1 66  ? 31.499  28.444  -3.828  1.00 94.91  ? 1066 ASP B CG  1 
ATOM   3541 O OD1 . ASP B 1 66  ? 31.636  29.689  -3.740  1.00 93.03  ? 1066 ASP B OD1 1 
ATOM   3542 O OD2 . ASP B 1 66  ? 31.174  27.870  -4.889  1.00 104.31 ? 1066 ASP B OD2 1 
ATOM   3543 N N   . ILE B 1 67  ? 32.779  26.516  0.299   1.00 77.45  ? 1067 ILE B N   1 
ATOM   3544 C CA  . ILE B 1 67  ? 32.669  25.791  1.571   1.00 76.41  ? 1067 ILE B CA  1 
ATOM   3545 C C   . ILE B 1 67  ? 33.138  26.715  2.704   1.00 76.22  ? 1067 ILE B C   1 
ATOM   3546 O O   . ILE B 1 67  ? 32.483  26.797  3.740   1.00 75.07  ? 1067 ILE B O   1 
ATOM   3547 C CB  . ILE B 1 67  ? 33.477  24.450  1.544   1.00 81.08  ? 1067 ILE B CB  1 
ATOM   3548 C CG1 . ILE B 1 67  ? 33.033  23.537  0.375   1.00 85.14  ? 1067 ILE B CG1 1 
ATOM   3549 C CG2 . ILE B 1 67  ? 33.389  23.710  2.899   1.00 82.34  ? 1067 ILE B CG2 1 
ATOM   3550 C CD1 . ILE B 1 67  ? 33.852  22.223  0.218   1.00 94.56  ? 1067 ILE B CD1 1 
ATOM   3551 N N   . LEU B 1 68  ? 34.264  27.421  2.475   1.00 71.45  ? 1068 LEU B N   1 
ATOM   3552 C CA  . LEU B 1 68  ? 34.915  28.330  3.419   1.00 69.41  ? 1068 LEU B CA  1 
ATOM   3553 C C   . LEU B 1 68  ? 34.005  29.525  3.756   1.00 72.92  ? 1068 LEU B C   1 
ATOM   3554 O O   . LEU B 1 68  ? 33.825  29.811  4.936   1.00 72.86  ? 1068 LEU B O   1 
ATOM   3555 C CB  . LEU B 1 68  ? 36.252  28.823  2.829   1.00 69.11  ? 1068 LEU B CB  1 
ATOM   3556 C CG  . LEU B 1 68  ? 37.179  29.632  3.745   1.00 72.89  ? 1068 LEU B CG  1 
ATOM   3557 C CD1 . LEU B 1 68  ? 37.725  28.768  4.876   1.00 73.24  ? 1068 LEU B CD1 1 
ATOM   3558 C CD2 . LEU B 1 68  ? 38.352  30.177  2.959   1.00 76.00  ? 1068 LEU B CD2 1 
ATOM   3559 N N   . VAL B 1 69  ? 33.418  30.196  2.736   1.00 69.75  ? 1069 VAL B N   1 
ATOM   3560 C CA  . VAL B 1 69  ? 32.502  31.338  2.927   1.00 70.01  ? 1069 VAL B CA  1 
ATOM   3561 C C   . VAL B 1 69  ? 31.232  30.857  3.696   1.00 75.72  ? 1069 VAL B C   1 
ATOM   3562 O O   . VAL B 1 69  ? 30.733  31.577  4.564   1.00 75.80  ? 1069 VAL B O   1 
ATOM   3563 C CB  . VAL B 1 69  ? 32.129  32.027  1.576   1.00 75.02  ? 1069 VAL B CB  1 
ATOM   3564 C CG1 . VAL B 1 69  ? 31.010  33.052  1.744   1.00 75.77  ? 1069 VAL B CG1 1 
ATOM   3565 C CG2 . VAL B 1 69  ? 33.347  32.677  0.934   1.00 74.42  ? 1069 VAL B CG2 1 
ATOM   3566 N N   . GLY B 1 70  ? 30.761  29.648  3.390   1.00 73.82  ? 1070 GLY B N   1 
ATOM   3567 C CA  . GLY B 1 70  ? 29.609  29.036  4.052   1.00 75.48  ? 1070 GLY B CA  1 
ATOM   3568 C C   . GLY B 1 70  ? 29.819  28.793  5.536   1.00 78.78  ? 1070 GLY B C   1 
ATOM   3569 O O   . GLY B 1 70  ? 28.899  28.983  6.336   1.00 79.44  ? 1070 GLY B O   1 
ATOM   3570 N N   . GLN B 1 71  ? 31.043  28.388  5.915   1.00 74.38  ? 1071 GLN B N   1 
ATOM   3571 C CA  . GLN B 1 71  ? 31.412  28.159  7.311   1.00 74.22  ? 1071 GLN B CA  1 
ATOM   3572 C C   . GLN B 1 71  ? 31.543  29.504  8.041   1.00 77.58  ? 1071 GLN B C   1 
ATOM   3573 O O   . GLN B 1 71  ? 31.127  29.608  9.200   1.00 78.50  ? 1071 GLN B O   1 
ATOM   3574 C CB  . GLN B 1 71  ? 32.709  27.347  7.406   1.00 75.08  ? 1071 GLN B CB  1 
ATOM   3575 C CG  . GLN B 1 71  ? 32.601  25.928  6.836   1.00 93.60  ? 1071 GLN B CG  1 
ATOM   3576 C CD  . GLN B 1 71  ? 33.911  25.170  6.838   1.00 113.18 ? 1071 GLN B CD  1 
ATOM   3577 O OE1 . GLN B 1 71  ? 34.968  25.668  7.251   1.00 107.02 ? 1071 GLN B OE1 1 
ATOM   3578 N NE2 . GLN B 1 71  ? 33.872  23.945  6.341   1.00 108.83 ? 1071 GLN B NE2 1 
ATOM   3579 N N   . ILE B 1 72  ? 32.074  30.544  7.337   1.00 72.06  ? 1072 ILE B N   1 
ATOM   3580 C CA  . ILE B 1 72  ? 32.212  31.921  7.838   1.00 71.27  ? 1072 ILE B CA  1 
ATOM   3581 C C   . ILE B 1 72  ? 30.809  32.502  8.145   1.00 76.34  ? 1072 ILE B C   1 
ATOM   3582 O O   . ILE B 1 72  ? 30.624  33.119  9.195   1.00 77.86  ? 1072 ILE B O   1 
ATOM   3583 C CB  . ILE B 1 72  ? 32.994  32.813  6.820   1.00 73.52  ? 1072 ILE B CB  1 
ATOM   3584 C CG1 . ILE B 1 72  ? 34.476  32.357  6.715   1.00 72.49  ? 1072 ILE B CG1 1 
ATOM   3585 C CG2 . ILE B 1 72  ? 32.921  34.303  7.217   1.00 76.01  ? 1072 ILE B CG2 1 
ATOM   3586 C CD1 . ILE B 1 72  ? 35.336  33.035  5.603   1.00 76.53  ? 1072 ILE B CD1 1 
ATOM   3587 N N   . ASP B 1 73  ? 29.826  32.267  7.258   1.00 72.35  ? 1073 ASP B N   1 
ATOM   3588 C CA  . ASP B 1 73  ? 28.462  32.759  7.428   1.00 73.67  ? 1073 ASP B CA  1 
ATOM   3589 C C   . ASP B 1 73  ? 27.762  32.094  8.629   1.00 80.03  ? 1073 ASP B C   1 
ATOM   3590 O O   . ASP B 1 73  ? 26.955  32.749  9.288   1.00 81.88  ? 1073 ASP B O   1 
ATOM   3591 C CB  . ASP B 1 73  ? 27.648  32.528  6.151   1.00 76.22  ? 1073 ASP B CB  1 
ATOM   3592 C CG  . ASP B 1 73  ? 28.032  33.466  5.020   1.00 82.81  ? 1073 ASP B CG  1 
ATOM   3593 O OD1 . ASP B 1 73  ? 28.553  34.562  5.311   1.00 82.58  ? 1073 ASP B OD1 1 
ATOM   3594 O OD2 . ASP B 1 73  ? 27.680  33.169  3.859   1.00 88.72  ? 1073 ASP B OD2 1 
ATOM   3595 N N   . ASP B 1 74  ? 28.085  30.827  8.931   1.00 77.10  ? 1074 ASP B N   1 
ATOM   3596 C CA  . ASP B 1 74  ? 27.505  30.108  10.073  1.00 79.32  ? 1074 ASP B CA  1 
ATOM   3597 C C   . ASP B 1 74  ? 28.037  30.689  11.388  1.00 84.15  ? 1074 ASP B C   1 
ATOM   3598 O O   . ASP B 1 74  ? 27.280  30.812  12.353  1.00 87.32  ? 1074 ASP B O   1 
ATOM   3599 C CB  . ASP B 1 74  ? 27.804  28.600  9.982   1.00 81.66  ? 1074 ASP B CB  1 
ATOM   3600 C CG  . ASP B 1 74  ? 27.132  27.879  8.817   1.00 92.67  ? 1074 ASP B CG  1 
ATOM   3601 O OD1 . ASP B 1 74  ? 26.080  28.368  8.336   1.00 94.05  ? 1074 ASP B OD1 1 
ATOM   3602 O OD2 . ASP B 1 74  ? 27.593  26.769  8.460   1.00 99.11  ? 1074 ASP B OD2 1 
ATOM   3603 N N   . ALA B 1 75  ? 29.334  31.063  11.411  1.00 77.94  ? 1075 ALA B N   1 
ATOM   3604 C CA  . ALA B 1 75  ? 29.990  31.694  12.556  1.00 78.17  ? 1075 ALA B CA  1 
ATOM   3605 C C   . ALA B 1 75  ? 29.536  33.142  12.703  1.00 82.80  ? 1075 ALA B C   1 
ATOM   3606 O O   . ALA B 1 75  ? 29.491  33.652  13.820  1.00 85.46  ? 1075 ALA B O   1 
ATOM   3607 C CB  . ALA B 1 75  ? 31.500  31.630  12.400  1.00 77.18  ? 1075 ALA B CB  1 
ATOM   3608 N N   . LEU B 1 76  ? 29.224  33.813  11.570  1.00 77.24  ? 1076 LEU B N   1 
ATOM   3609 C CA  . LEU B 1 76  ? 28.715  35.189  11.550  1.00 78.39  ? 1076 LEU B CA  1 
ATOM   3610 C C   . LEU B 1 76  ? 27.330  35.260  12.139  1.00 85.25  ? 1076 LEU B C   1 
ATOM   3611 O O   . LEU B 1 76  ? 26.972  36.262  12.764  1.00 87.95  ? 1076 LEU B O   1 
ATOM   3612 C CB  . LEU B 1 76  ? 28.690  35.753  10.126  1.00 77.20  ? 1076 LEU B CB  1 
ATOM   3613 C CG  . LEU B 1 76  ? 29.955  36.388  9.623   1.00 80.44  ? 1076 LEU B CG  1 
ATOM   3614 C CD1 . LEU B 1 76  ? 29.889  36.591  8.134   1.00 80.14  ? 1076 LEU B CD1 1 
ATOM   3615 C CD2 . LEU B 1 76  ? 30.221  37.713  10.333  1.00 85.06  ? 1076 LEU B CD2 1 
ATOM   3616 N N   . LYS B 1 77  ? 26.536  34.205  11.902  1.00 81.68  ? 1077 LYS B N   1 
ATOM   3617 C CA  . LYS B 1 77  ? 25.187  34.057  12.422  1.00 85.04  ? 1077 LYS B CA  1 
ATOM   3618 C C   . LYS B 1 77  ? 25.226  34.068  13.954  1.00 91.13  ? 1077 LYS B C   1 
ATOM   3619 O O   . LYS B 1 77  ? 24.478  34.814  14.582  1.00 94.05  ? 1077 LYS B O   1 
ATOM   3620 C CB  . LYS B 1 77  ? 24.558  32.761  11.884  1.00 88.28  ? 1077 LYS B CB  1 
ATOM   3621 C CG  . LYS B 1 77  ? 23.120  32.538  12.347  1.00 115.58 ? 1077 LYS B CG  1 
ATOM   3622 C CD  . LYS B 1 77  ? 22.488  31.212  11.915  1.00 131.84 ? 1077 LYS B CD  1 
ATOM   3623 C CE  . LYS B 1 77  ? 22.888  29.952  12.685  1.00 145.18 ? 1077 LYS B CE  1 
ATOM   3624 N NZ  . LYS B 1 77  ? 24.357  29.675  12.660  1.00 148.81 ? 1077 LYS B NZ  1 
ATOM   3625 N N   . LEU B 1 78  ? 26.154  33.280  14.541  1.00 85.85  ? 1078 LEU B N   1 
ATOM   3626 C CA  . LEU B 1 78  ? 26.346  33.143  15.984  1.00 87.79  ? 1078 LEU B CA  1 
ATOM   3627 C C   . LEU B 1 78  ? 26.915  34.432  16.598  1.00 93.39  ? 1078 LEU B C   1 
ATOM   3628 O O   . LEU B 1 78  ? 26.471  34.826  17.678  1.00 97.21  ? 1078 LEU B O   1 
ATOM   3629 C CB  . LEU B 1 78  ? 27.282  31.959  16.279  1.00 86.13  ? 1078 LEU B CB  1 
ATOM   3630 C CG  . LEU B 1 78  ? 26.758  30.580  15.866  1.00 90.17  ? 1078 LEU B CG  1 
ATOM   3631 C CD1 . LEU B 1 78  ? 27.869  29.580  15.756  1.00 88.39  ? 1078 LEU B CD1 1 
ATOM   3632 C CD2 . LEU B 1 78  ? 25.632  30.106  16.774  1.00 96.35  ? 1078 LEU B CD2 1 
ATOM   3633 N N   . ALA B 1 79  ? 27.881  35.090  15.913  1.00 87.19  ? 1079 ALA B N   1 
ATOM   3634 C CA  . ALA B 1 79  ? 28.494  36.342  16.372  1.00 88.70  ? 1079 ALA B CA  1 
ATOM   3635 C C   . ALA B 1 79  ? 27.452  37.454  16.493  1.00 97.05  ? 1079 ALA B C   1 
ATOM   3636 O O   . ALA B 1 79  ? 27.475  38.201  17.472  1.00 100.65 ? 1079 ALA B O   1 
ATOM   3637 C CB  . ALA B 1 79  ? 29.599  36.768  15.419  1.00 86.47  ? 1079 ALA B CB  1 
ATOM   3638 N N   . ASN B 1 80  ? 26.513  37.531  15.515  1.00 93.78  ? 1080 ASN B N   1 
ATOM   3639 C CA  . ASN B 1 80  ? 25.427  38.519  15.481  1.00 97.58  ? 1080 ASN B CA  1 
ATOM   3640 C C   . ASN B 1 80  ? 24.348  38.203  16.528  1.00 105.50 ? 1080 ASN B C   1 
ATOM   3641 O O   . ASN B 1 80  ? 23.602  39.105  16.916  1.00 109.68 ? 1080 ASN B O   1 
ATOM   3642 C CB  . ASN B 1 80  ? 24.795  38.583  14.088  1.00 98.40  ? 1080 ASN B CB  1 
ATOM   3643 C CG  . ASN B 1 80  ? 25.717  39.104  13.009  1.00 125.30 ? 1080 ASN B CG  1 
ATOM   3644 O OD1 . ASN B 1 80  ? 26.599  39.939  13.243  1.00 120.54 ? 1080 ASN B OD1 1 
ATOM   3645 N ND2 . ASN B 1 80  ? 25.476  38.681  11.782  1.00 118.16 ? 1080 ASN B ND2 1 
ATOM   3646 N N   . GLU B 1 81  ? 24.267  36.938  16.984  1.00 100.84 ? 1081 GLU B N   1 
ATOM   3647 C CA  . GLU B 1 81  ? 23.311  36.527  18.015  1.00 104.47 ? 1081 GLU B CA  1 
ATOM   3648 C C   . GLU B 1 81  ? 23.911  36.736  19.426  1.00 111.16 ? 1081 GLU B C   1 
ATOM   3649 O O   . GLU B 1 81  ? 23.189  36.631  20.422  1.00 115.68 ? 1081 GLU B O   1 
ATOM   3650 C CB  . GLU B 1 81  ? 22.886  35.061  17.820  1.00 104.47 ? 1081 GLU B CB  1 
ATOM   3651 C CG  . GLU B 1 81  ? 22.044  34.827  16.574  1.00 111.26 ? 1081 GLU B CG  1 
ATOM   3652 C CD  . GLU B 1 81  ? 21.679  33.386  16.264  1.00 130.72 ? 1081 GLU B CD  1 
ATOM   3653 O OE1 . GLU B 1 81  ? 21.146  33.140  15.158  1.00 121.69 ? 1081 GLU B OE1 1 
ATOM   3654 O OE2 . GLU B 1 81  ? 21.966  32.499  17.101  1.00 128.06 ? 1081 GLU B OE2 1 
ATOM   3655 N N   . GLY B 1 82  ? 25.203  37.066  19.483  1.00 105.06 ? 1082 GLY B N   1 
ATOM   3656 C CA  . GLY B 1 82  ? 25.928  37.291  20.730  1.00 107.81 ? 1082 GLY B CA  1 
ATOM   3657 C C   . GLY B 1 82  ? 26.441  36.003  21.339  1.00 110.56 ? 1082 GLY B C   1 
ATOM   3658 O O   . GLY B 1 82  ? 26.622  35.916  22.558  1.00 114.61 ? 1082 GLY B O   1 
ATOM   3659 N N   . LYS B 1 83  ? 26.673  34.991  20.484  1.00 101.38 ? 1083 LYS B N   1 
ATOM   3660 C CA  . LYS B 1 83  ? 27.153  33.669  20.875  1.00 99.98  ? 1083 LYS B CA  1 
ATOM   3661 C C   . LYS B 1 83  ? 28.633  33.554  20.497  1.00 100.17 ? 1083 LYS B C   1 
ATOM   3662 O O   . LYS B 1 83  ? 28.962  33.047  19.421  1.00 95.85  ? 1083 LYS B O   1 
ATOM   3663 C CB  . LYS B 1 83  ? 26.289  32.576  20.211  1.00 100.49 ? 1083 LYS B CB  1 
ATOM   3664 C CG  . LYS B 1 83  ? 24.815  32.634  20.615  1.00 113.89 ? 1083 LYS B CG  1 
ATOM   3665 C CD  . LYS B 1 83  ? 23.980  31.591  19.898  1.00 120.19 ? 1083 LYS B CD  1 
ATOM   3666 C CE  . LYS B 1 83  ? 22.532  31.662  20.313  1.00 131.01 ? 1083 LYS B CE  1 
ATOM   3667 N NZ  . LYS B 1 83  ? 21.707  30.661  19.591  1.00 140.19 ? 1083 LYS B NZ  1 
ATOM   3668 N N   . VAL B 1 84  ? 29.523  34.064  21.385  1.00 98.62  ? 1084 VAL B N   1 
ATOM   3669 C CA  . VAL B 1 84  ? 30.984  34.153  21.199  1.00 95.95  ? 1084 VAL B CA  1 
ATOM   3670 C C   . VAL B 1 84  ? 31.618  32.749  21.117  1.00 97.01  ? 1084 VAL B C   1 
ATOM   3671 O O   . VAL B 1 84  ? 32.216  32.430  20.090  1.00 92.34  ? 1084 VAL B O   1 
ATOM   3672 C CB  . VAL B 1 84  ? 31.659  34.974  22.333  1.00 104.40 ? 1084 VAL B CB  1 
ATOM   3673 C CG1 . VAL B 1 84  ? 33.146  35.181  22.048  1.00 102.68 ? 1084 VAL B CG1 1 
ATOM   3674 C CG2 . VAL B 1 84  ? 30.970  36.319  22.522  1.00 107.14 ? 1084 VAL B CG2 1 
ATOM   3675 N N   . LYS B 1 85  ? 31.506  31.935  22.199  1.00 97.02  ? 1085 LYS B N   1 
ATOM   3676 C CA  . LYS B 1 85  ? 32.085  30.585  22.295  1.00 96.74  ? 1085 LYS B CA  1 
ATOM   3677 C C   . LYS B 1 85  ? 31.545  29.661  21.194  1.00 96.59  ? 1085 LYS B C   1 
ATOM   3678 O O   . LYS B 1 85  ? 32.284  28.794  20.727  1.00 94.82  ? 1085 LYS B O   1 
ATOM   3679 C CB  . LYS B 1 85  ? 31.824  29.951  23.676  1.00 105.31 ? 1085 LYS B CB  1 
ATOM   3680 C CG  . LYS B 1 85  ? 32.771  30.421  24.800  1.00 129.84 ? 1085 LYS B CG  1 
ATOM   3681 C CD  . LYS B 1 85  ? 32.660  31.904  25.173  1.00 147.31 ? 1085 LYS B CD  1 
ATOM   3682 C CE  . LYS B 1 85  ? 33.674  32.297  26.219  1.00 169.12 ? 1085 LYS B CE  1 
ATOM   3683 N NZ  . LYS B 1 85  ? 33.576  33.740  26.563  1.00 184.07 ? 1085 LYS B NZ  1 
ATOM   3684 N N   . GLU B 1 86  ? 30.285  29.869  20.758  1.00 91.89  ? 1086 GLU B N   1 
ATOM   3685 C CA  . GLU B 1 86  ? 29.667  29.112  19.664  1.00 88.61  ? 1086 GLU B CA  1 
ATOM   3686 C C   . GLU B 1 86  ? 30.309  29.498  18.325  1.00 87.46  ? 1086 GLU B C   1 
ATOM   3687 O O   . GLU B 1 86  ? 30.623  28.617  17.519  1.00 84.53  ? 1086 GLU B O   1 
ATOM   3688 C CB  . GLU B 1 86  ? 28.140  29.322  19.600  1.00 91.32  ? 1086 GLU B CB  1 
ATOM   3689 C CG  . GLU B 1 86  ? 27.329  28.850  20.800  1.00 103.76 ? 1086 GLU B CG  1 
ATOM   3690 C CD  . GLU B 1 86  ? 27.268  29.705  22.054  1.00 116.66 ? 1086 GLU B CD  1 
ATOM   3691 O OE1 . GLU B 1 86  ? 26.241  29.600  22.755  1.00 107.94 ? 1086 GLU B OE1 1 
ATOM   3692 O OE2 . GLU B 1 86  ? 28.146  30.572  22.263  1.00 107.42 ? 1086 GLU B OE2 1 
ATOM   3693 N N   . ALA B 1 87  ? 30.498  30.826  18.094  1.00 82.88  ? 1087 ALA B N   1 
ATOM   3694 C CA  . ALA B 1 87  ? 31.116  31.379  16.889  1.00 78.95  ? 1087 ALA B CA  1 
ATOM   3695 C C   . ALA B 1 87  ? 32.588  30.977  16.798  1.00 82.52  ? 1087 ALA B C   1 
ATOM   3696 O O   . ALA B 1 87  ? 33.045  30.620  15.711  1.00 79.82  ? 1087 ALA B O   1 
ATOM   3697 C CB  . ALA B 1 87  ? 30.984  32.891  16.876  1.00 80.07  ? 1087 ALA B CB  1 
ATOM   3698 N N   . GLN B 1 88  ? 33.317  31.000  17.945  1.00 81.50  ? 1088 GLN B N   1 
ATOM   3699 C CA  . GLN B 1 88  ? 34.726  30.597  18.041  1.00 81.16  ? 1088 GLN B CA  1 
ATOM   3700 C C   . GLN B 1 88  ? 34.872  29.098  17.746  1.00 86.62  ? 1088 GLN B C   1 
ATOM   3701 O O   . GLN B 1 88  ? 35.872  28.699  17.153  1.00 86.22  ? 1088 GLN B O   1 
ATOM   3702 C CB  . GLN B 1 88  ? 35.315  30.936  19.422  1.00 86.46  ? 1088 GLN B CB  1 
ATOM   3703 C CG  . GLN B 1 88  ? 35.442  32.441  19.693  1.00 95.18  ? 1088 GLN B CG  1 
ATOM   3704 C CD  . GLN B 1 88  ? 35.998  32.791  21.057  1.00 115.78 ? 1088 GLN B CD  1 
ATOM   3705 O OE1 . GLN B 1 88  ? 36.083  31.961  21.968  1.00 116.50 ? 1088 GLN B OE1 1 
ATOM   3706 N NE2 . GLN B 1 88  ? 36.339  34.057  21.245  1.00 106.96 ? 1088 GLN B NE2 1 
ATOM   3707 N N   . ALA B 1 89  ? 33.862  28.278  18.128  1.00 85.23  ? 1089 ALA B N   1 
ATOM   3708 C CA  . ALA B 1 89  ? 33.820  26.836  17.851  1.00 85.71  ? 1089 ALA B CA  1 
ATOM   3709 C C   . ALA B 1 89  ? 33.553  26.572  16.358  1.00 88.04  ? 1089 ALA B C   1 
ATOM   3710 O O   . ALA B 1 89  ? 34.154  25.669  15.771  1.00 87.31  ? 1089 ALA B O   1 
ATOM   3711 C CB  . ALA B 1 89  ? 32.753  26.170  18.699  1.00 89.95  ? 1089 ALA B CB  1 
ATOM   3712 N N   . ALA B 1 90  ? 32.656  27.371  15.748  1.00 84.34  ? 1090 ALA B N   1 
ATOM   3713 C CA  . ALA B 1 90  ? 32.316  27.280  14.328  1.00 82.22  ? 1090 ALA B CA  1 
ATOM   3714 C C   . ALA B 1 90  ? 33.496  27.701  13.466  1.00 84.83  ? 1090 ALA B C   1 
ATOM   3715 O O   . ALA B 1 90  ? 33.746  27.090  12.428  1.00 83.98  ? 1090 ALA B O   1 
ATOM   3716 C CB  . ALA B 1 90  ? 31.103  28.150  14.023  1.00 82.70  ? 1090 ALA B CB  1 
ATOM   3717 N N   . ALA B 1 91  ? 34.243  28.730  13.924  1.00 81.48  ? 1091 ALA B N   1 
ATOM   3718 C CA  . ALA B 1 91  ? 35.419  29.284  13.247  1.00 79.53  ? 1091 ALA B CA  1 
ATOM   3719 C C   . ALA B 1 91  ? 36.602  28.317  13.297  1.00 84.23  ? 1091 ALA B C   1 
ATOM   3720 O O   . ALA B 1 91  ? 37.530  28.451  12.504  1.00 82.61  ? 1091 ALA B O   1 
ATOM   3721 C CB  . ALA B 1 91  ? 35.813  30.608  13.884  1.00 81.07  ? 1091 ALA B CB  1 
ATOM   3722 N N   . GLU B 1 92  ? 36.570  27.344  14.218  1.00 83.92  ? 1092 GLU B N   1 
ATOM   3723 C CA  . GLU B 1 92  ? 37.632  26.351  14.348  1.00 85.27  ? 1092 GLU B CA  1 
ATOM   3724 C C   . GLU B 1 92  ? 37.494  25.283  13.239  1.00 87.99  ? 1092 GLU B C   1 
ATOM   3725 O O   . GLU B 1 92  ? 38.483  24.645  12.893  1.00 88.64  ? 1092 GLU B O   1 
ATOM   3726 C CB  . GLU B 1 92  ? 37.611  25.716  15.746  1.00 90.53  ? 1092 GLU B CB  1 
ATOM   3727 C CG  . GLU B 1 92  ? 38.944  25.819  16.488  1.00 106.60 ? 1092 GLU B CG  1 
ATOM   3728 C CD  . GLU B 1 92  ? 39.494  27.191  16.871  1.00 135.01 ? 1092 GLU B CD  1 
ATOM   3729 O OE1 . GLU B 1 92  ? 38.780  28.211  16.711  1.00 137.01 ? 1092 GLU B OE1 1 
ATOM   3730 O OE2 . GLU B 1 92  ? 40.637  27.234  17.383  1.00 128.84 ? 1092 GLU B OE2 1 
ATOM   3731 N N   . GLN B 1 93  ? 36.297  25.150  12.635  1.00 83.66  ? 1093 GLN B N   1 
ATOM   3732 C CA  . GLN B 1 93  ? 36.051  24.237  11.509  1.00 83.37  ? 1093 GLN B CA  1 
ATOM   3733 C C   . GLN B 1 93  ? 36.674  24.789  10.200  1.00 83.90  ? 1093 GLN B C   1 
ATOM   3734 O O   . GLN B 1 93  ? 36.860  24.032  9.242   1.00 84.14  ? 1093 GLN B O   1 
ATOM   3735 C CB  . GLN B 1 93  ? 34.548  23.987  11.312  1.00 85.60  ? 1093 GLN B CB  1 
ATOM   3736 C CG  . GLN B 1 93  ? 33.892  23.198  12.446  1.00 114.00 ? 1093 GLN B CG  1 
ATOM   3737 C CD  . GLN B 1 93  ? 32.416  22.948  12.220  1.00 146.22 ? 1093 GLN B CD  1 
ATOM   3738 O OE1 . GLN B 1 93  ? 31.739  23.628  11.434  1.00 143.25 ? 1093 GLN B OE1 1 
ATOM   3739 N NE2 . GLN B 1 93  ? 31.863  22.003  12.964  1.00 144.56 ? 1093 GLN B NE2 1 
ATOM   3740 N N   . LEU B 1 94  ? 37.010  26.100  10.177  1.00 77.28  ? 1094 LEU B N   1 
ATOM   3741 C CA  . LEU B 1 94  ? 37.656  26.769  9.041   1.00 74.72  ? 1094 LEU B CA  1 
ATOM   3742 C C   . LEU B 1 94  ? 39.079  26.240  8.846   1.00 77.95  ? 1094 LEU B C   1 
ATOM   3743 O O   . LEU B 1 94  ? 39.577  26.227  7.719   1.00 76.71  ? 1094 LEU B O   1 
ATOM   3744 C CB  . LEU B 1 94  ? 37.680  28.300  9.243   1.00 73.64  ? 1094 LEU B CB  1 
ATOM   3745 C CG  . LEU B 1 94  ? 36.319  29.019  9.282   1.00 78.03  ? 1094 LEU B CG  1 
ATOM   3746 C CD1 . LEU B 1 94  ? 36.456  30.421  9.782   1.00 78.14  ? 1094 LEU B CD1 1 
ATOM   3747 C CD2 . LEU B 1 94  ? 35.671  29.039  7.926   1.00 80.84  ? 1094 LEU B CD2 1 
ATOM   3748 N N   . LYS B 1 95  ? 39.722  25.792  9.949   1.00 75.83  ? 1095 LYS B N   1 
ATOM   3749 C CA  . LYS B 1 95  ? 41.064  25.204  9.950   1.00 77.28  ? 1095 LYS B CA  1 
ATOM   3750 C C   . LYS B 1 95  ? 41.088  23.908  9.145   1.00 83.79  ? 1095 LYS B C   1 
ATOM   3751 O O   . LYS B 1 95  ? 42.030  23.688  8.389   1.00 84.39  ? 1095 LYS B O   1 
ATOM   3752 C CB  . LYS B 1 95  ? 41.552  24.935  11.380  1.00 81.64  ? 1095 LYS B CB  1 
ATOM   3753 C CG  . LYS B 1 95  ? 41.708  26.174  12.236  1.00 91.38  ? 1095 LYS B CG  1 
ATOM   3754 C CD  . LYS B 1 95  ? 42.221  25.797  13.611  1.00 102.68 ? 1095 LYS B CD  1 
ATOM   3755 C CE  . LYS B 1 95  ? 42.383  27.009  14.476  1.00 111.26 ? 1095 LYS B CE  1 
ATOM   3756 N NZ  . LYS B 1 95  ? 42.902  26.660  15.821  1.00 124.80 ? 1095 LYS B NZ  1 
ATOM   3757 N N   . THR B 1 96  ? 40.039  23.062  9.293   1.00 82.43  ? 1096 THR B N   1 
ATOM   3758 C CA  . THR B 1 96  ? 39.875  21.790  8.571   1.00 85.03  ? 1096 THR B CA  1 
ATOM   3759 C C   . THR B 1 96  ? 39.828  22.071  7.055   1.00 89.11  ? 1096 THR B C   1 
ATOM   3760 O O   . THR B 1 96  ? 40.459  21.352  6.275   1.00 90.90  ? 1096 THR B O   1 
ATOM   3761 C CB  . THR B 1 96  ? 38.603  21.060  9.065   1.00 94.61  ? 1096 THR B CB  1 
ATOM   3762 O OG1 . THR B 1 96  ? 38.649  20.931  10.485  1.00 97.30  ? 1096 THR B OG1 1 
ATOM   3763 C CG2 . THR B 1 96  ? 38.429  19.686  8.434   1.00 97.02  ? 1096 THR B CG2 1 
ATOM   3764 N N   . THR B 1 97  ? 39.114  23.145  6.658   1.00 83.52  ? 1097 THR B N   1 
ATOM   3765 C CA  . THR B 1 97  ? 38.988  23.580  5.268   1.00 82.43  ? 1097 THR B CA  1 
ATOM   3766 C C   . THR B 1 97  ? 40.330  24.193  4.810   1.00 86.64  ? 1097 THR B C   1 
ATOM   3767 O O   . THR B 1 97  ? 40.729  23.989  3.660   1.00 87.72  ? 1097 THR B O   1 
ATOM   3768 C CB  . THR B 1 97  ? 37.809  24.572  5.134   1.00 84.36  ? 1097 THR B CB  1 
ATOM   3769 O OG1 . THR B 1 97  ? 36.630  23.968  5.670   1.00 84.48  ? 1097 THR B OG1 1 
ATOM   3770 C CG2 . THR B 1 97  ? 37.551  24.995  3.689   1.00 80.37  ? 1097 THR B CG2 1 
ATOM   3771 N N   . ARG B 1 98  ? 41.034  24.909  5.721   1.00 82.42  ? 1098 ARG B N   1 
ATOM   3772 C CA  . ARG B 1 98  ? 42.324  25.556  5.438   1.00 82.57  ? 1098 ARG B CA  1 
ATOM   3773 C C   . ARG B 1 98  ? 43.421  24.489  5.216   1.00 90.36  ? 1098 ARG B C   1 
ATOM   3774 O O   . ARG B 1 98  ? 44.304  24.689  4.379   1.00 90.72  ? 1098 ARG B O   1 
ATOM   3775 C CB  . ARG B 1 98  ? 42.715  26.520  6.583   1.00 80.77  ? 1098 ARG B CB  1 
ATOM   3776 C CG  . ARG B 1 98  ? 43.882  27.443  6.249   1.00 84.35  ? 1098 ARG B CG  1 
ATOM   3777 C CD  . ARG B 1 98  ? 45.162  27.150  6.989   1.00 90.06  ? 1098 ARG B CD  1 
ATOM   3778 N NE  . ARG B 1 98  ? 45.155  27.649  8.367   1.00 88.90  ? 1098 ARG B NE  1 
ATOM   3779 C CZ  . ARG B 1 98  ? 44.852  26.920  9.434   1.00 94.60  ? 1098 ARG B CZ  1 
ATOM   3780 N NH1 . ARG B 1 98  ? 44.912  27.455  10.644  1.00 78.31  ? 1098 ARG B NH1 1 
ATOM   3781 N NH2 . ARG B 1 98  ? 44.518  25.642  9.303   1.00 78.11  ? 1098 ARG B NH2 1 
ATOM   3782 N N   . ASN B 1 99  ? 43.340  23.353  5.939   1.00 90.27  ? 1099 ASN B N   1 
ATOM   3783 C CA  . ASN B 1 99  ? 44.286  22.241  5.808   1.00 94.35  ? 1099 ASN B CA  1 
ATOM   3784 C C   . ASN B 1 99  ? 44.061  21.485  4.493   1.00 101.26 ? 1099 ASN B C   1 
ATOM   3785 O O   . ASN B 1 99  ? 45.022  20.973  3.920   1.00 103.68 ? 1099 ASN B O   1 
ATOM   3786 C CB  . ASN B 1 99  ? 44.173  21.286  6.991   1.00 98.65  ? 1099 ASN B CB  1 
ATOM   3787 C CG  . ASN B 1 99  ? 44.506  21.903  8.334   1.00 125.52 ? 1099 ASN B CG  1 
ATOM   3788 O OD1 . ASN B 1 99  ? 45.036  23.019  8.442   1.00 115.44 ? 1099 ASN B OD1 1 
ATOM   3789 N ND2 . ASN B 1 99  ? 44.186  21.185  9.398   1.00 123.19 ? 1099 ASN B ND2 1 
ATOM   3790 N N   . ALA B 1 100 ? 42.801  21.449  4.001   1.00 97.49  ? 1100 ALA B N   1 
ATOM   3791 C CA  . ALA B 1 100 ? 42.437  20.825  2.725   1.00 99.37  ? 1100 ALA B CA  1 
ATOM   3792 C C   . ALA B 1 100 ? 42.985  21.646  1.538   1.00 103.21 ? 1100 ALA B C   1 
ATOM   3793 O O   . ALA B 1 100 ? 43.011  21.156  0.415   1.00 105.13 ? 1100 ALA B O   1 
ATOM   3794 C CB  . ALA B 1 100 ? 40.928  20.687  2.624   1.00 99.53  ? 1100 ALA B CB  1 
ATOM   3795 N N   . TYR B 1 101 ? 43.450  22.883  1.808   1.00 98.19  ? 1101 TYR B N   1 
ATOM   3796 C CA  . TYR B 1 101 ? 44.066  23.775  0.828   1.00 98.36  ? 1101 TYR B CA  1 
ATOM   3797 C C   . TYR B 1 101 ? 45.594  23.627  0.825   1.00 104.60 ? 1101 TYR B C   1 
ATOM   3798 O O   . TYR B 1 101 ? 46.188  23.567  -0.254  1.00 106.85 ? 1101 TYR B O   1 
ATOM   3799 C CB  . TYR B 1 101 ? 43.688  25.252  1.103   1.00 96.84  ? 1101 TYR B CB  1 
ATOM   3800 C CG  . TYR B 1 101 ? 44.506  26.252  0.305   1.00 100.24 ? 1101 TYR B CG  1 
ATOM   3801 C CD1 . TYR B 1 101 ? 44.112  26.650  -0.970  1.00 103.34 ? 1101 TYR B CD1 1 
ATOM   3802 C CD2 . TYR B 1 101 ? 45.681  26.795  0.824   1.00 101.79 ? 1101 TYR B CD2 1 
ATOM   3803 C CE1 . TYR B 1 101 ? 44.876  27.549  -1.717  1.00 105.77 ? 1101 TYR B CE1 1 
ATOM   3804 C CE2 . TYR B 1 101 ? 46.458  27.685  0.082   1.00 104.11 ? 1101 TYR B CE2 1 
ATOM   3805 C CZ  . TYR B 1 101 ? 46.054  28.057  -1.190  1.00 112.99 ? 1101 TYR B CZ  1 
ATOM   3806 O OH  . TYR B 1 101 ? 46.809  28.952  -1.911  1.00 116.40 ? 1101 TYR B OH  1 
ATOM   3807 N N   . ILE B 1 102 ? 46.235  23.644  2.020   1.00 100.52 ? 1102 ILE B N   1 
ATOM   3808 C CA  . ILE B 1 102 ? 47.698  23.612  2.140   1.00 102.81 ? 1102 ILE B CA  1 
ATOM   3809 C C   . ILE B 1 102 ? 48.244  22.249  1.594   1.00 109.78 ? 1102 ILE B C   1 
ATOM   3810 O O   . ILE B 1 102 ? 49.367  22.232  1.086   1.00 112.38 ? 1102 ILE B O   1 
ATOM   3811 C CB  . ILE B 1 102 ? 48.211  23.901  3.602   1.00 106.01 ? 1102 ILE B CB  1 
ATOM   3812 C CG1 . ILE B 1 102 ? 47.788  22.841  4.670   1.00 107.52 ? 1102 ILE B CG1 1 
ATOM   3813 C CG2 . ILE B 1 102 ? 47.812  25.301  4.063   1.00 103.34 ? 1102 ILE B CG2 1 
ATOM   3814 C CD1 . ILE B 1 102 ? 48.669  21.527  4.799   1.00 119.89 ? 1102 ILE B CD1 1 
ATOM   3815 N N   . GLN B 1 103 ? 47.448  21.146  1.643   1.00 106.00 ? 1103 GLN B N   1 
ATOM   3816 C CA  . GLN B 1 103 ? 47.921  19.852  1.138   1.00 109.84 ? 1103 GLN B CA  1 
ATOM   3817 C C   . GLN B 1 103 ? 47.436  19.631  -0.323  1.00 114.05 ? 1103 GLN B C   1 
ATOM   3818 O O   . GLN B 1 103 ? 47.574  18.527  -0.854  1.00 118.04 ? 1103 GLN B O   1 
ATOM   3819 C CB  . GLN B 1 103 ? 47.488  18.671  2.049   1.00 112.81 ? 1103 GLN B CB  1 
ATOM   3820 C CG  . GLN B 1 103 ? 45.990  18.366  2.139   1.00 119.14 ? 1103 GLN B CG  1 
ATOM   3821 C CD  . GLN B 1 103 ? 45.688  17.161  3.015   1.00 137.52 ? 1103 GLN B CD  1 
ATOM   3822 O OE1 . GLN B 1 103 ? 46.537  16.651  3.757   1.00 134.37 ? 1103 GLN B OE1 1 
ATOM   3823 N NE2 . GLN B 1 103 ? 44.453  16.692  2.967   1.00 130.38 ? 1103 GLN B NE2 1 
ATOM   3824 N N   . LYS B 1 104 ? 46.954  20.695  -0.987  1.00 107.04 ? 1104 LYS B N   1 
ATOM   3825 C CA  . LYS B 1 104 ? 46.495  20.616  -2.369  1.00 108.46 ? 1104 LYS B CA  1 
ATOM   3826 C C   . LYS B 1 104 ? 47.206  21.642  -3.258  1.00 113.58 ? 1104 LYS B C   1 
ATOM   3827 O O   . LYS B 1 104 ? 48.025  21.254  -4.086  1.00 117.62 ? 1104 LYS B O   1 
ATOM   3828 C CB  . LYS B 1 104 ? 44.967  20.822  -2.461  1.00 108.06 ? 1104 LYS B CB  1 
ATOM   3829 C CG  . LYS B 1 104 ? 44.094  19.619  -2.095  1.00 120.78 ? 1104 LYS B CG  1 
ATOM   3830 C CD  . LYS B 1 104 ? 44.044  18.583  -3.208  1.00 136.02 ? 1104 LYS B CD  1 
ATOM   3831 C CE  . LYS B 1 104 ? 43.099  17.448  -2.921  1.00 146.61 ? 1104 LYS B CE  1 
ATOM   3832 N NZ  . LYS B 1 104 ? 43.027  16.511  -4.072  1.00 158.99 ? 1104 LYS B NZ  1 
ATOM   3833 N N   . TYR B 1 105 ? 46.912  22.941  -3.079  1.00 107.14 ? 1105 TYR B N   1 
ATOM   3834 C CA  . TYR B 1 105 ? 47.392  24.002  -3.965  1.00 107.87 ? 1105 TYR B CA  1 
ATOM   3835 C C   . TYR B 1 105 ? 48.703  24.636  -3.474  1.00 114.39 ? 1105 TYR B C   1 
ATOM   3836 O O   . TYR B 1 105 ? 49.512  25.021  -4.323  1.00 117.06 ? 1105 TYR B O   1 
ATOM   3837 C CB  . TYR B 1 105 ? 46.317  25.092  -4.109  1.00 105.08 ? 1105 TYR B CB  1 
ATOM   3838 C CG  . TYR B 1 105 ? 45.023  24.508  -4.632  1.00 106.17 ? 1105 TYR B CG  1 
ATOM   3839 C CD1 . TYR B 1 105 ? 44.853  24.245  -5.988  1.00 111.59 ? 1105 TYR B CD1 1 
ATOM   3840 C CD2 . TYR B 1 105 ? 44.011  24.113  -3.761  1.00 104.13 ? 1105 TYR B CD2 1 
ATOM   3841 C CE1 . TYR B 1 105 ? 43.705  23.617  -6.465  1.00 113.66 ? 1105 TYR B CE1 1 
ATOM   3842 C CE2 . TYR B 1 105 ? 42.858  23.485  -4.226  1.00 105.97 ? 1105 TYR B CE2 1 
ATOM   3843 C CZ  . TYR B 1 105 ? 42.705  23.248  -5.581  1.00 117.67 ? 1105 TYR B CZ  1 
ATOM   3844 O OH  . TYR B 1 105 ? 41.565  22.646  -6.053  1.00 121.81 ? 1105 TYR B OH  1 
ATOM   3845 N N   . LEU B 1 106 ? 48.931  24.732  -2.141  1.00 110.11 ? 1106 LEU B N   1 
ATOM   3846 C CA  . LEU B 1 106 ? 50.169  25.312  -1.590  1.00 111.27 ? 1106 LEU B CA  1 
ATOM   3847 C C   . LEU B 1 106 ? 51.390  24.434  -1.921  1.00 120.72 ? 1106 LEU B C   1 
ATOM   3848 O O   . LEU B 1 106 ? 52.464  24.965  -2.213  1.00 122.93 ? 1106 LEU B O   1 
ATOM   3849 C CB  . LEU B 1 106 ? 50.067  25.507  -0.072  1.00 108.57 ? 1106 LEU B CB  1 
ATOM   3850 N N   . GLY B 1 107 ? 51.202  23.114  -1.904  1.00 119.75 ? 1107 GLY B N   1 
ATOM   3851 C CA  . GLY B 1 107 ? 52.265  22.158  -2.194  1.00 125.30 ? 1107 GLY B CA  1 
ATOM   3852 C C   . GLY B 1 107 ? 52.150  21.438  -3.522  1.00 133.65 ? 1107 GLY B C   1 
ATOM   3853 O O   . GLY B 1 107 ? 51.278  21.750  -4.342  1.00 132.18 ? 1107 GLY B O   1 
ATOM   3854 N N   . SER B 1 108 ? 53.025  20.442  -3.728  1.00 135.88 ? 1108 SER B N   1 
ATOM   3855 C CA  . SER B 1 108 ? 53.066  19.626  -4.942  1.00 141.14 ? 1108 SER B CA  1 
ATOM   3856 C C   . SER B 1 108 ? 51.953  18.530  -4.936  1.00 146.27 ? 1108 SER B C   1 
ATOM   3857 O O   . SER B 1 108 ? 52.085  17.512  -5.629  1.00 151.37 ? 1108 SER B O   1 
ATOM   3858 C CB  . SER B 1 108 ? 54.442  18.980  -5.094  1.00 151.30 ? 1108 SER B CB  1 
ATOM   3859 O OG  . SER B 1 108 ? 54.776  18.153  -3.992  1.00 161.83 ? 1108 SER B OG  1 
ATOM   3860 N N   . GLY B 1 109 ? 50.869  18.775  -4.181  1.00 137.86 ? 1109 GLY B N   1 
ATOM   3861 C CA  . GLY B 1 109 ? 49.715  17.881  -4.085  1.00 137.80 ? 1109 GLY B CA  1 
ATOM   3862 C C   . GLY B 1 109 ? 48.926  17.898  -5.375  1.00 141.62 ? 1109 GLY B C   1 
ATOM   3863 O O   . GLY B 1 109 ? 48.793  16.869  -6.047  1.00 146.55 ? 1109 GLY B O   1 
ATOM   3864 N N   . SER B 1 110 ? 48.432  19.092  -5.739  1.00 132.71 ? 1110 SER B N   1 
ATOM   3865 C CA  . SER B 1 110 ? 47.754  19.361  -7.001  1.00 133.06 ? 1110 SER B CA  1 
ATOM   3866 C C   . SER B 1 110 ? 48.746  20.076  -7.914  1.00 136.72 ? 1110 SER B C   1 
ATOM   3867 O O   . SER B 1 110 ? 48.655  21.286  -8.151  1.00 133.61 ? 1110 SER B O   1 
ATOM   3868 C CB  . SER B 1 110 ? 46.468  20.155  -6.788  1.00 132.00 ? 1110 SER B CB  1 
ATOM   3869 O OG  . SER B 1 110 ? 45.534  19.406  -6.030  1.00 141.47 ? 1110 SER B OG  1 
ATOM   3870 N N   . CYS B 1 111 ? 49.766  19.308  -8.335  1.00 101.99 ? 35   CYS B N   1 
ATOM   3871 C CA  . CYS B 1 111 ? 50.889  19.708  -9.184  1.00 99.90  ? 35   CYS B CA  1 
ATOM   3872 C C   . CYS B 1 111 ? 51.568  18.448  -9.703  1.00 107.41 ? 35   CYS B C   1 
ATOM   3873 O O   . CYS B 1 111 ? 51.228  17.972  -10.792 1.00 108.26 ? 35   CYS B O   1 
ATOM   3874 C CB  . CYS B 1 111 ? 51.858  20.613  -8.416  1.00 96.42  ? 35   CYS B CB  1 
ATOM   3875 S SG  . CYS B 1 111 ? 53.376  21.039  -9.316  1.00 97.93  ? 35   CYS B SG  1 
ATOM   3876 N N   . SER B 1 112 ? 52.468  17.863  -8.878  1.00 105.38 ? 36   SER B N   1 
ATOM   3877 C CA  . SER B 1 112 ? 53.194  16.626  -9.173  1.00 106.01 ? 36   SER B CA  1 
ATOM   3878 C C   . SER B 1 112 ? 52.267  15.393  -9.042  1.00 113.43 ? 36   SER B C   1 
ATOM   3879 O O   . SER B 1 112 ? 51.174  15.487  -8.461  1.00 114.19 ? 36   SER B O   1 
ATOM   3880 C CB  . SER B 1 112 ? 54.398  16.485  -8.244  1.00 107.27 ? 36   SER B CB  1 
ATOM   3881 N N   . GLN B 1 113 ? 52.712  14.243  -9.594  1.00 110.79 ? 37   GLN B N   1 
ATOM   3882 C CA  . GLN B 1 113 ? 51.971  12.980  -9.587  1.00 111.69 ? 37   GLN B CA  1 
ATOM   3883 C C   . GLN B 1 113 ? 51.916  12.357  -8.173  1.00 113.65 ? 37   GLN B C   1 
ATOM   3884 O O   . GLN B 1 113 ? 52.733  12.693  -7.310  1.00 111.22 ? 37   GLN B O   1 
ATOM   3885 C CB  . GLN B 1 113 ? 52.617  11.989  -10.569 1.00 113.60 ? 37   GLN B CB  1 
ATOM   3886 N N   . LYS B 1 114 ? 50.933  11.451  -7.954  1.00 110.89 ? 38   LYS B N   1 
ATOM   3887 C CA  . LYS B 1 114 ? 50.705  10.726  -6.698  1.00 109.66 ? 38   LYS B CA  1 
ATOM   3888 C C   . LYS B 1 114 ? 51.804  9.661   -6.460  1.00 111.32 ? 38   LYS B C   1 
ATOM   3889 O O   . LYS B 1 114 ? 52.412  9.213   -7.435  1.00 111.17 ? 38   LYS B O   1 
ATOM   3890 C CB  . LYS B 1 114 ? 49.318  10.060  -6.728  1.00 114.00 ? 38   LYS B CB  1 
ATOM   3891 N N   . PRO B 1 115 ? 52.060  9.214   -5.193  1.00 105.92 ? 39   PRO B N   1 
ATOM   3892 C CA  . PRO B 1 115 ? 53.099  8.186   -4.959  1.00 104.37 ? 39   PRO B CA  1 
ATOM   3893 C C   . PRO B 1 115 ? 52.844  6.883   -5.728  1.00 108.27 ? 39   PRO B C   1 
ATOM   3894 O O   . PRO B 1 115 ? 53.797  6.205   -6.117  1.00 107.17 ? 39   PRO B O   1 
ATOM   3895 C CB  . PRO B 1 115 ? 53.009  7.931   -3.451  1.00 105.57 ? 39   PRO B CB  1 
ATOM   3896 C CG  . PRO B 1 115 ? 51.679  8.455   -3.034  1.00 111.18 ? 39   PRO B CG  1 
ATOM   3897 C CD  . PRO B 1 115 ? 51.446  9.633   -3.917  1.00 107.17 ? 39   PRO B CD  1 
ATOM   3898 N N   . SER B 1 116 ? 51.556  6.548   -5.954  1.00 105.86 ? 40   SER B N   1 
ATOM   3899 C CA  . SER B 1 116 ? 51.114  5.380   -6.719  1.00 106.63 ? 40   SER B CA  1 
ATOM   3900 C C   . SER B 1 116 ? 51.598  5.478   -8.171  1.00 109.10 ? 40   SER B C   1 
ATOM   3901 O O   . SER B 1 116 ? 52.010  4.471   -8.752  1.00 109.25 ? 40   SER B O   1 
ATOM   3902 C CB  . SER B 1 116 ? 49.593  5.266   -6.669  1.00 111.73 ? 40   SER B CB  1 
ATOM   3903 O OG  . SER B 1 116 ? 49.135  5.203   -5.328  1.00 119.43 ? 40   SER B OG  1 
ATOM   3904 N N   . ASP B 1 117 ? 51.591  6.715   -8.727  1.00 103.89 ? 41   ASP B N   1 
ATOM   3905 C CA  . ASP B 1 117 ? 52.028  7.042   -10.089 1.00 103.09 ? 41   ASP B CA  1 
ATOM   3906 C C   . ASP B 1 117 ? 53.561  7.044   -10.218 1.00 101.42 ? 41   ASP B C   1 
ATOM   3907 O O   . ASP B 1 117 ? 54.073  6.859   -11.325 1.00 101.77 ? 41   ASP B O   1 
ATOM   3908 C CB  . ASP B 1 117 ? 51.482  8.423   -10.521 1.00 105.31 ? 41   ASP B CB  1 
ATOM   3909 C CG  . ASP B 1 117 ? 49.970  8.538   -10.634 1.00 117.80 ? 41   ASP B CG  1 
ATOM   3910 O OD1 . ASP B 1 117 ? 49.279  7.493   -10.539 1.00 119.43 ? 41   ASP B OD1 1 
ATOM   3911 O OD2 . ASP B 1 117 ? 49.480  9.660   -10.885 1.00 124.58 ? 41   ASP B OD2 1 
ATOM   3912 N N   . LYS B 1 118 ? 54.287  7.273   -9.110  1.00 92.81  ? 42   LYS B N   1 
ATOM   3913 C CA  . LYS B 1 118 ? 55.745  7.339   -9.152  1.00 89.45  ? 42   LYS B CA  1 
ATOM   3914 C C   . LYS B 1 118 ? 56.358  6.277   -8.194  1.00 90.32  ? 42   LYS B C   1 
ATOM   3915 O O   . LYS B 1 118 ? 57.324  6.563   -7.475  1.00 89.14  ? 42   LYS B O   1 
ATOM   3916 C CB  . LYS B 1 118 ? 56.235  8.771   -8.810  1.00 89.59  ? 42   LYS B CB  1 
ATOM   3917 C CG  . LYS B 1 118 ? 55.799  9.347   -7.461  1.00 93.38  ? 42   LYS B CG  1 
ATOM   3918 C CD  . LYS B 1 118 ? 56.292  10.784  -7.306  1.00 101.07 ? 42   LYS B CD  1 
ATOM   3919 C CE  . LYS B 1 118 ? 56.026  11.384  -5.943  1.00 113.65 ? 42   LYS B CE  1 
ATOM   3920 N NZ  . LYS B 1 118 ? 54.579  11.471  -5.621  1.00 124.80 ? 42   LYS B NZ  1 
ATOM   3921 N N   . HIS B 1 119 ? 55.835  5.031   -8.244  1.00 85.42  ? 43   HIS B N   1 
ATOM   3922 C CA  . HIS B 1 119 ? 56.346  3.947   -7.401  1.00 83.26  ? 43   HIS B CA  1 
ATOM   3923 C C   . HIS B 1 119 ? 57.250  3.006   -8.204  1.00 86.04  ? 43   HIS B C   1 
ATOM   3924 O O   . HIS B 1 119 ? 56.814  2.425   -9.202  1.00 88.21  ? 43   HIS B O   1 
ATOM   3925 C CB  . HIS B 1 119 ? 55.199  3.147   -6.755  1.00 84.72  ? 43   HIS B CB  1 
ATOM   3926 C CG  . HIS B 1 119 ? 55.671  2.010   -5.901  1.00 87.56  ? 43   HIS B CG  1 
ATOM   3927 N ND1 . HIS B 1 119 ? 55.873  0.744   -6.430  1.00 90.24  ? 43   HIS B ND1 1 
ATOM   3928 C CD2 . HIS B 1 119 ? 55.988  1.989   -4.585  1.00 88.20  ? 43   HIS B CD2 1 
ATOM   3929 C CE1 . HIS B 1 119 ? 56.309  -0.001  -5.426  1.00 89.23  ? 43   HIS B CE1 1 
ATOM   3930 N NE2 . HIS B 1 119 ? 56.394  0.701   -4.296  1.00 88.35  ? 43   HIS B NE2 1 
ATOM   3931 N N   . LEU B 1 120 ? 58.496  2.823   -7.730  1.00 78.90  ? 44   LEU B N   1 
ATOM   3932 C CA  . LEU B 1 120 ? 59.458  1.906   -8.339  1.00 77.91  ? 44   LEU B CA  1 
ATOM   3933 C C   . LEU B 1 120 ? 59.777  0.771   -7.372  1.00 78.78  ? 44   LEU B C   1 
ATOM   3934 O O   . LEU B 1 120 ? 60.048  1.019   -6.199  1.00 76.09  ? 44   LEU B O   1 
ATOM   3935 C CB  . LEU B 1 120 ? 60.751  2.632   -8.769  1.00 76.72  ? 44   LEU B CB  1 
ATOM   3936 C CG  . LEU B 1 120 ? 60.625  3.670   -9.896  1.00 81.80  ? 44   LEU B CG  1 
ATOM   3937 C CD1 . LEU B 1 120 ? 61.924  4.405   -10.101 1.00 80.31  ? 44   LEU B CD1 1 
ATOM   3938 C CD2 . LEU B 1 120 ? 60.176  3.030   -11.206 1.00 86.79  ? 44   LEU B CD2 1 
ATOM   3939 N N   . ASP B 1 121 ? 59.727  -0.479  -7.869  1.00 76.30  ? 45   ASP B N   1 
ATOM   3940 C CA  . ASP B 1 121 ? 60.005  -1.688  -7.086  1.00 76.15  ? 45   ASP B CA  1 
ATOM   3941 C C   . ASP B 1 121 ? 61.494  -1.803  -6.738  1.00 76.51  ? 45   ASP B C   1 
ATOM   3942 O O   . ASP B 1 121 ? 61.838  -2.502  -5.787  1.00 76.09  ? 45   ASP B O   1 
ATOM   3943 C CB  . ASP B 1 121 ? 59.558  -2.945  -7.857  1.00 80.86  ? 45   ASP B CB  1 
ATOM   3944 C CG  . ASP B 1 121 ? 58.076  -3.013  -8.186  1.00 97.83  ? 45   ASP B CG  1 
ATOM   3945 O OD1 . ASP B 1 121 ? 57.295  -2.232  -7.591  1.00 99.95  ? 45   ASP B OD1 1 
ATOM   3946 O OD2 . ASP B 1 121 ? 57.689  -3.879  -9.004  1.00 105.60 ? 45   ASP B OD2 1 
ATOM   3947 N N   . ALA B 1 122 ? 62.369  -1.125  -7.515  1.00 70.13  ? 46   ALA B N   1 
ATOM   3948 C CA  . ALA B 1 122 ? 63.820  -1.120  -7.334  1.00 67.29  ? 46   ALA B CA  1 
ATOM   3949 C C   . ALA B 1 122 ? 64.230  -0.431  -6.026  1.00 68.27  ? 46   ALA B C   1 
ATOM   3950 O O   . ALA B 1 122 ? 65.138  -0.914  -5.364  1.00 66.85  ? 46   ALA B O   1 
ATOM   3951 C CB  . ALA B 1 122 ? 64.483  -0.425  -8.507  1.00 67.54  ? 46   ALA B CB  1 
ATOM   3952 N N   . ILE B 1 123 ? 63.563  0.688   -5.657  1.00 64.02  ? 47   ILE B N   1 
ATOM   3953 C CA  . ILE B 1 123 ? 63.848  1.487   -4.453  1.00 62.31  ? 47   ILE B CA  1 
ATOM   3954 C C   . ILE B 1 123 ? 63.834  0.575   -3.176  1.00 66.51  ? 47   ILE B C   1 
ATOM   3955 O O   . ILE B 1 123 ? 64.875  0.518   -2.534  1.00 64.51  ? 47   ILE B O   1 
ATOM   3956 C CB  . ILE B 1 123 ? 62.850  2.685   -4.310  1.00 65.08  ? 47   ILE B CB  1 
ATOM   3957 C CG1 . ILE B 1 123 ? 63.067  3.743   -5.423  1.00 64.81  ? 47   ILE B CG1 1 
ATOM   3958 C CG2 . ILE B 1 123 ? 62.898  3.338   -2.920  1.00 65.01  ? 47   ILE B CG2 1 
ATOM   3959 C CD1 . ILE B 1 123 ? 64.472  4.433   -5.453  1.00 70.78  ? 47   ILE B CD1 1 
ATOM   3960 N N   . PRO B 1 124 ? 62.758  -0.174  -2.794  1.00 66.14  ? 48   PRO B N   1 
ATOM   3961 C CA  . PRO B 1 124 ? 62.854  -1.003  -1.574  1.00 66.28  ? 48   PRO B CA  1 
ATOM   3962 C C   . PRO B 1 124 ? 63.954  -2.073  -1.662  1.00 71.16  ? 48   PRO B C   1 
ATOM   3963 O O   . PRO B 1 124 ? 64.543  -2.400  -0.633  1.00 71.19  ? 48   PRO B O   1 
ATOM   3964 C CB  . PRO B 1 124 ? 61.477  -1.659  -1.482  1.00 69.40  ? 48   PRO B CB  1 
ATOM   3965 C CG  . PRO B 1 124 ? 60.577  -0.765  -2.239  1.00 74.03  ? 48   PRO B CG  1 
ATOM   3966 C CD  . PRO B 1 124 ? 61.405  -0.269  -3.381  1.00 69.27  ? 48   PRO B CD  1 
ATOM   3967 N N   . ILE B 1 125 ? 64.257  -2.587  -2.883  1.00 67.53  ? 49   ILE B N   1 
ATOM   3968 C CA  . ILE B 1 125 ? 65.310  -3.592  -3.107  1.00 67.03  ? 49   ILE B CA  1 
ATOM   3969 C C   . ILE B 1 125 ? 66.691  -2.941  -2.857  1.00 69.61  ? 49   ILE B C   1 
ATOM   3970 O O   . ILE B 1 125 ? 67.462  -3.469  -2.057  1.00 69.82  ? 49   ILE B O   1 
ATOM   3971 C CB  . ILE B 1 125 ? 65.222  -4.225  -4.531  1.00 70.84  ? 49   ILE B CB  1 
ATOM   3972 C CG1 . ILE B 1 125 ? 63.854  -4.932  -4.746  1.00 72.50  ? 49   ILE B CG1 1 
ATOM   3973 C CG2 . ILE B 1 125 ? 66.392  -5.193  -4.771  1.00 71.51  ? 49   ILE B CG2 1 
ATOM   3974 C CD1 . ILE B 1 125 ? 63.538  -5.405  -6.189  1.00 77.34  ? 49   ILE B CD1 1 
ATOM   3975 N N   . LEU B 1 126 ? 66.977  -1.790  -3.515  1.00 64.63  ? 50   LEU B N   1 
ATOM   3976 C CA  . LEU B 1 126 ? 68.230  -1.030  -3.392  1.00 62.96  ? 50   LEU B CA  1 
ATOM   3977 C C   . LEU B 1 126 ? 68.502  -0.619  -1.943  1.00 64.73  ? 50   LEU B C   1 
ATOM   3978 O O   . LEU B 1 126 ? 69.644  -0.701  -1.503  1.00 63.63  ? 50   LEU B O   1 
ATOM   3979 C CB  . LEU B 1 126 ? 68.195  0.223   -4.284  1.00 62.80  ? 50   LEU B CB  1 
ATOM   3980 C CG  . LEU B 1 126 ? 68.806  0.139   -5.704  1.00 68.56  ? 50   LEU B CG  1 
ATOM   3981 C CD1 . LEU B 1 126 ? 68.207  -0.986  -6.542  1.00 71.06  ? 50   LEU B CD1 1 
ATOM   3982 C CD2 . LEU B 1 126 ? 68.645  1.455   -6.436  1.00 69.59  ? 50   LEU B CD2 1 
ATOM   3983 N N   . TYR B 1 127 ? 67.458  -0.211  -1.204  1.00 61.55  ? 51   TYR B N   1 
ATOM   3984 C CA  . TYR B 1 127 ? 67.549  0.192   0.204   1.00 61.19  ? 51   TYR B CA  1 
ATOM   3985 C C   . TYR B 1 127 ? 67.984  -0.994  1.099   1.00 65.88  ? 51   TYR B C   1 
ATOM   3986 O O   . TYR B 1 127 ? 68.752  -0.774  2.032   1.00 65.82  ? 51   TYR B O   1 
ATOM   3987 C CB  . TYR B 1 127 ? 66.203  0.767   0.689   1.00 62.56  ? 51   TYR B CB  1 
ATOM   3988 C CG  . TYR B 1 127 ? 66.016  2.250   0.410   1.00 62.71  ? 51   TYR B CG  1 
ATOM   3989 C CD1 . TYR B 1 127 ? 66.134  2.757   -0.881  1.00 63.99  ? 51   TYR B CD1 1 
ATOM   3990 C CD2 . TYR B 1 127 ? 65.554  3.110   1.401   1.00 62.87  ? 51   TYR B CD2 1 
ATOM   3991 C CE1 . TYR B 1 127 ? 65.943  4.109   -1.146  1.00 63.03  ? 51   TYR B CE1 1 
ATOM   3992 C CE2 . TYR B 1 127 ? 65.325  4.460   1.140   1.00 62.90  ? 51   TYR B CE2 1 
ATOM   3993 C CZ  . TYR B 1 127 ? 65.514  4.953   -0.139  1.00 68.57  ? 51   TYR B CZ  1 
ATOM   3994 O OH  . TYR B 1 127 ? 65.295  6.280   -0.404  1.00 69.20  ? 51   TYR B OH  1 
ATOM   3995 N N   . TYR B 1 128 ? 67.542  -2.236  0.799   1.00 63.23  ? 52   TYR B N   1 
ATOM   3996 C CA  . TYR B 1 128 ? 67.968  -3.409  1.570   1.00 63.48  ? 52   TYR B CA  1 
ATOM   3997 C C   . TYR B 1 128 ? 69.385  -3.849  1.165   1.00 69.43  ? 52   TYR B C   1 
ATOM   3998 O O   . TYR B 1 128 ? 70.100  -4.387  2.012   1.00 69.41  ? 52   TYR B O   1 
ATOM   3999 C CB  . TYR B 1 128 ? 66.998  -4.594  1.436   1.00 65.18  ? 52   TYR B CB  1 
ATOM   4000 C CG  . TYR B 1 128 ? 65.839  -4.545  2.408   1.00 66.25  ? 52   TYR B CG  1 
ATOM   4001 C CD1 . TYR B 1 128 ? 65.988  -4.974  3.724   1.00 68.31  ? 52   TYR B CD1 1 
ATOM   4002 C CD2 . TYR B 1 128 ? 64.572  -4.151  1.993   1.00 66.76  ? 52   TYR B CD2 1 
ATOM   4003 C CE1 . TYR B 1 128 ? 64.928  -4.932  4.624   1.00 68.72  ? 52   TYR B CE1 1 
ATOM   4004 C CE2 . TYR B 1 128 ? 63.498  -4.125  2.879   1.00 67.91  ? 52   TYR B CE2 1 
ATOM   4005 C CZ  . TYR B 1 128 ? 63.682  -4.514  4.196   1.00 76.07  ? 52   TYR B CZ  1 
ATOM   4006 O OH  . TYR B 1 128 ? 62.634  -4.492  5.087   1.00 80.16  ? 52   TYR B OH  1 
ATOM   4007 N N   . ILE B 1 129 ? 69.801  -3.607  -0.109  1.00 66.82  ? 53   ILE B N   1 
ATOM   4008 C CA  . ILE B 1 129 ? 71.148  -3.962  -0.597  1.00 66.70  ? 53   ILE B CA  1 
ATOM   4009 C C   . ILE B 1 129 ? 72.191  -3.109  0.162   1.00 70.79  ? 53   ILE B C   1 
ATOM   4010 O O   . ILE B 1 129 ? 73.145  -3.670  0.701   1.00 71.43  ? 53   ILE B O   1 
ATOM   4011 C CB  . ILE B 1 129 ? 71.274  -3.801  -2.146  1.00 69.46  ? 53   ILE B CB  1 
ATOM   4012 C CG1 . ILE B 1 129 ? 70.336  -4.797  -2.871  1.00 70.99  ? 53   ILE B CG1 1 
ATOM   4013 C CG2 . ILE B 1 129 ? 72.730  -4.006  -2.608  1.00 69.33  ? 53   ILE B CG2 1 
ATOM   4014 C CD1 . ILE B 1 129 ? 70.261  -4.668  -4.396  1.00 76.68  ? 53   ILE B CD1 1 
ATOM   4015 N N   . ILE B 1 130 ? 71.966  -1.777  0.256   1.00 66.17  ? 54   ILE B N   1 
ATOM   4016 C CA  . ILE B 1 130 ? 72.849  -0.834  0.955   1.00 65.29  ? 54   ILE B CA  1 
ATOM   4017 C C   . ILE B 1 130 ? 72.811  -1.128  2.472   1.00 70.83  ? 54   ILE B C   1 
ATOM   4018 O O   . ILE B 1 130 ? 73.841  -0.993  3.140   1.00 70.82  ? 54   ILE B O   1 
ATOM   4019 C CB  . ILE B 1 130 ? 72.452  0.641   0.636   1.00 67.27  ? 54   ILE B CB  1 
ATOM   4020 C CG1 . ILE B 1 130 ? 72.530  0.943   -0.896  1.00 67.96  ? 54   ILE B CG1 1 
ATOM   4021 C CG2 . ILE B 1 130 ? 73.270  1.665   1.444   1.00 66.58  ? 54   ILE B CG2 1 
ATOM   4022 C CD1 . ILE B 1 130 ? 73.946  0.790   -1.626  1.00 73.20  ? 54   ILE B CD1 1 
ATOM   4023 N N   . PHE B 1 131 ? 71.651  -1.585  2.993   1.00 67.67  ? 55   PHE B N   1 
ATOM   4024 C CA  . PHE B 1 131 ? 71.484  -1.931  4.405   1.00 67.64  ? 55   PHE B CA  1 
ATOM   4025 C C   . PHE B 1 131 ? 72.425  -3.069  4.835   1.00 71.94  ? 55   PHE B C   1 
ATOM   4026 O O   . PHE B 1 131 ? 73.140  -2.901  5.814   1.00 70.88  ? 55   PHE B O   1 
ATOM   4027 C CB  . PHE B 1 131 ? 70.027  -2.335  4.706   1.00 70.03  ? 55   PHE B CB  1 
ATOM   4028 C CG  . PHE B 1 131 ? 69.837  -2.988  6.058   1.00 72.22  ? 55   PHE B CG  1 
ATOM   4029 C CD1 . PHE B 1 131 ? 69.827  -2.229  7.221   1.00 74.88  ? 55   PHE B CD1 1 
ATOM   4030 C CD2 . PHE B 1 131 ? 69.635  -4.359  6.164   1.00 75.33  ? 55   PHE B CD2 1 
ATOM   4031 C CE1 . PHE B 1 131 ? 69.665  -2.833  8.472   1.00 76.45  ? 55   PHE B CE1 1 
ATOM   4032 C CE2 . PHE B 1 131 ? 69.463  -4.962  7.415   1.00 78.92  ? 55   PHE B CE2 1 
ATOM   4033 C CZ  . PHE B 1 131 ? 69.473  -4.194  8.560   1.00 76.57  ? 55   PHE B CZ  1 
ATOM   4034 N N   . VAL B 1 132 ? 72.393  -4.223  4.136   1.00 70.05  ? 56   VAL B N   1 
ATOM   4035 C CA  . VAL B 1 132 ? 73.165  -5.411  4.509   1.00 71.00  ? 56   VAL B CA  1 
ATOM   4036 C C   . VAL B 1 132 ? 74.680  -5.162  4.206   1.00 74.11  ? 56   VAL B C   1 
ATOM   4037 O O   . VAL B 1 132 ? 75.505  -5.492  5.055   1.00 74.23  ? 56   VAL B O   1 
ATOM   4038 C CB  . VAL B 1 132 ? 72.630  -6.710  3.818   1.00 76.43  ? 56   VAL B CB  1 
ATOM   4039 C CG1 . VAL B 1 132 ? 72.604  -6.597  2.295   1.00 76.52  ? 56   VAL B CG1 1 
ATOM   4040 C CG2 . VAL B 1 132 ? 73.400  -7.948  4.263   1.00 77.24  ? 56   VAL B CG2 1 
ATOM   4041 N N   . ILE B 1 133 ? 75.032  -4.552  3.049   1.00 69.58  ? 57   ILE B N   1 
ATOM   4042 C CA  . ILE B 1 133 ? 76.433  -4.276  2.690   1.00 68.57  ? 57   ILE B CA  1 
ATOM   4043 C C   . ILE B 1 133 ? 77.026  -3.287  3.716   1.00 70.33  ? 57   ILE B C   1 
ATOM   4044 O O   . ILE B 1 133 ? 78.067  -3.575  4.304   1.00 69.98  ? 57   ILE B O   1 
ATOM   4045 C CB  . ILE B 1 133 ? 76.568  -3.755  1.223   1.00 71.37  ? 57   ILE B CB  1 
ATOM   4046 C CG1 . ILE B 1 133 ? 76.213  -4.892  0.223   1.00 72.88  ? 57   ILE B CG1 1 
ATOM   4047 C CG2 . ILE B 1 133 ? 77.991  -3.218  0.941   1.00 71.86  ? 57   ILE B CG2 1 
ATOM   4048 C CD1 . ILE B 1 133 ? 76.223  -4.513  -1.269  1.00 82.57  ? 57   ILE B CD1 1 
ATOM   4049 N N   . GLY B 1 134 ? 76.330  -2.179  3.951   1.00 66.23  ? 58   GLY B N   1 
ATOM   4050 C CA  . GLY B 1 134 ? 76.746  -1.148  4.894   1.00 65.55  ? 58   GLY B CA  1 
ATOM   4051 C C   . GLY B 1 134 ? 76.778  -1.578  6.347   1.00 69.93  ? 58   GLY B C   1 
ATOM   4052 O O   . GLY B 1 134 ? 77.611  -1.091  7.117   1.00 69.59  ? 58   GLY B O   1 
ATOM   4053 N N   . PHE B 1 135 ? 75.868  -2.488  6.739   1.00 66.48  ? 59   PHE B N   1 
ATOM   4054 C CA  . PHE B 1 135 ? 75.802  -2.962  8.116   1.00 66.63  ? 59   PHE B CA  1 
ATOM   4055 C C   . PHE B 1 135 ? 76.972  -3.897  8.398   1.00 71.19  ? 59   PHE B C   1 
ATOM   4056 O O   . PHE B 1 135 ? 77.595  -3.775  9.445   1.00 71.85  ? 59   PHE B O   1 
ATOM   4057 C CB  . PHE B 1 135 ? 74.464  -3.662  8.400   1.00 68.92  ? 59   PHE B CB  1 
ATOM   4058 C CG  . PHE B 1 135 ? 74.089  -3.697  9.861   1.00 71.25  ? 59   PHE B CG  1 
ATOM   4059 C CD1 . PHE B 1 135 ? 74.512  -4.738  10.682  1.00 75.48  ? 59   PHE B CD1 1 
ATOM   4060 C CD2 . PHE B 1 135 ? 73.299  -2.694  10.416  1.00 72.71  ? 59   PHE B CD2 1 
ATOM   4061 C CE1 . PHE B 1 135 ? 74.172  -4.762  12.039  1.00 77.01  ? 59   PHE B CE1 1 
ATOM   4062 C CE2 . PHE B 1 135 ? 72.964  -2.716  11.773  1.00 76.41  ? 59   PHE B CE2 1 
ATOM   4063 C CZ  . PHE B 1 135 ? 73.402  -3.752  12.575  1.00 75.65  ? 59   PHE B CZ  1 
ATOM   4064 N N   . LEU B 1 136 ? 77.305  -4.787  7.440   1.00 67.49  ? 60   LEU B N   1 
ATOM   4065 C CA  . LEU B 1 136 ? 78.391  -5.764  7.562   1.00 68.07  ? 60   LEU B CA  1 
ATOM   4066 C C   . LEU B 1 136 ? 79.792  -5.112  7.477   1.00 72.15  ? 60   LEU B C   1 
ATOM   4067 O O   . LEU B 1 136 ? 80.701  -5.619  8.138   1.00 73.14  ? 60   LEU B O   1 
ATOM   4068 C CB  . LEU B 1 136 ? 78.281  -6.853  6.477   1.00 68.63  ? 60   LEU B CB  1 
ATOM   4069 C CG  . LEU B 1 136 ? 77.465  -8.140  6.804   1.00 74.27  ? 60   LEU B CG  1 
ATOM   4070 C CD1 . LEU B 1 136 ? 76.025  -7.852  7.252   1.00 73.86  ? 60   LEU B CD1 1 
ATOM   4071 C CD2 . LEU B 1 136 ? 77.466  -9.094  5.622   1.00 77.09  ? 60   LEU B CD2 1 
ATOM   4072 N N   . VAL B 1 137 ? 79.992  -4.024  6.680   1.00 66.95  ? 61   VAL B N   1 
ATOM   4073 C CA  . VAL B 1 137 ? 81.335  -3.407  6.592   1.00 65.90  ? 61   VAL B CA  1 
ATOM   4074 C C   . VAL B 1 137 ? 81.614  -2.618  7.897   1.00 68.54  ? 61   VAL B C   1 
ATOM   4075 O O   . VAL B 1 137 ? 82.764  -2.592  8.339   1.00 69.86  ? 61   VAL B O   1 
ATOM   4076 C CB  . VAL B 1 137 ? 81.597  -2.518  5.340   1.00 68.47  ? 61   VAL B CB  1 
ATOM   4077 C CG1 . VAL B 1 137 ? 81.692  -3.359  4.077   1.00 67.98  ? 61   VAL B CG1 1 
ATOM   4078 C CG2 . VAL B 1 137 ? 80.561  -1.403  5.188   1.00 67.54  ? 61   VAL B CG2 1 
ATOM   4079 N N   . ASN B 1 138 ? 80.573  -2.018  8.523   1.00 62.22  ? 62   ASN B N   1 
ATOM   4080 C CA  . ASN B 1 138 ? 80.733  -1.302  9.792   1.00 61.24  ? 62   ASN B CA  1 
ATOM   4081 C C   . ASN B 1 138 ? 80.881  -2.319  10.966  1.00 65.48  ? 62   ASN B C   1 
ATOM   4082 O O   . ASN B 1 138 ? 81.551  -1.996  11.953  1.00 64.69  ? 62   ASN B O   1 
ATOM   4083 C CB  . ASN B 1 138 ? 79.590  -0.331  10.037  1.00 57.89  ? 62   ASN B CB  1 
ATOM   4084 C CG  . ASN B 1 138 ? 79.718  0.943   9.232   1.00 78.55  ? 62   ASN B CG  1 
ATOM   4085 O OD1 . ASN B 1 138 ? 80.552  1.809   9.527   1.00 84.65  ? 62   ASN B OD1 1 
ATOM   4086 N ND2 . ASN B 1 138 ? 78.857  1.133   8.250   1.00 60.17  ? 62   ASN B ND2 1 
ATOM   4087 N N   . ILE B 1 139 ? 80.336  -3.566  10.818  1.00 62.49  ? 63   ILE B N   1 
ATOM   4088 C CA  . ILE B 1 139 ? 80.523  -4.653  11.795  1.00 63.79  ? 63   ILE B CA  1 
ATOM   4089 C C   . ILE B 1 139 ? 82.020  -5.021  11.809  1.00 69.03  ? 63   ILE B C   1 
ATOM   4090 O O   . ILE B 1 139 ? 82.567  -5.296  12.881  1.00 69.56  ? 63   ILE B O   1 
ATOM   4091 C CB  . ILE B 1 139 ? 79.605  -5.901  11.518  1.00 67.28  ? 63   ILE B CB  1 
ATOM   4092 C CG1 . ILE B 1 139 ? 78.101  -5.599  11.776  1.00 67.52  ? 63   ILE B CG1 1 
ATOM   4093 C CG2 . ILE B 1 139 ? 80.038  -7.137  12.330  1.00 68.94  ? 63   ILE B CG2 1 
ATOM   4094 C CD1 . ILE B 1 139 ? 77.662  -5.154  13.268  1.00 75.41  ? 63   ILE B CD1 1 
ATOM   4095 N N   . VAL B 1 140 ? 82.683  -4.978  10.625  1.00 65.78  ? 64   VAL B N   1 
ATOM   4096 C CA  . VAL B 1 140 ? 84.115  -5.264  10.495  1.00 66.87  ? 64   VAL B CA  1 
ATOM   4097 C C   . VAL B 1 140 ? 84.896  -4.200  11.278  1.00 72.71  ? 64   VAL B C   1 
ATOM   4098 O O   . VAL B 1 140 ? 85.726  -4.569  12.107  1.00 73.92  ? 64   VAL B O   1 
ATOM   4099 C CB  . VAL B 1 140 ? 84.594  -5.357  9.013   1.00 69.78  ? 64   VAL B CB  1 
ATOM   4100 C CG1 . VAL B 1 140 ? 86.119  -5.416  8.917   1.00 70.15  ? 64   VAL B CG1 1 
ATOM   4101 C CG2 . VAL B 1 140 ? 83.966  -6.552  8.304   1.00 69.73  ? 64   VAL B CG2 1 
ATOM   4102 N N   . VAL B 1 141 ? 84.578  -2.891  11.056  1.00 68.07  ? 65   VAL B N   1 
ATOM   4103 C CA  . VAL B 1 141 ? 85.219  -1.723  11.703  1.00 67.38  ? 65   VAL B CA  1 
ATOM   4104 C C   . VAL B 1 141 ? 85.226  -1.893  13.237  1.00 72.79  ? 65   VAL B C   1 
ATOM   4105 O O   . VAL B 1 141 ? 86.266  -1.736  13.862  1.00 73.49  ? 65   VAL B O   1 
ATOM   4106 C CB  . VAL B 1 141 ? 84.504  -0.402  11.302  1.00 68.98  ? 65   VAL B CB  1 
ATOM   4107 C CG1 . VAL B 1 141 ? 85.105  0.802   12.016  1.00 68.96  ? 65   VAL B CG1 1 
ATOM   4108 C CG2 . VAL B 1 141 ? 84.543  -0.195  9.802   1.00 67.58  ? 65   VAL B CG2 1 
ATOM   4109 N N   . VAL B 1 142 ? 84.073  -2.234  13.815  1.00 70.32  ? 66   VAL B N   1 
ATOM   4110 C CA  . VAL B 1 142 ? 83.860  -2.415  15.247  1.00 71.55  ? 66   VAL B CA  1 
ATOM   4111 C C   . VAL B 1 142 ? 84.604  -3.686  15.770  1.00 79.88  ? 66   VAL B C   1 
ATOM   4112 O O   . VAL B 1 142 ? 85.348  -3.570  16.740  1.00 81.32  ? 66   VAL B O   1 
ATOM   4113 C CB  . VAL B 1 142 ? 82.345  -2.498  15.519  1.00 74.17  ? 66   VAL B CB  1 
ATOM   4114 C CG1 . VAL B 1 142 ? 82.055  -3.112  16.866  1.00 75.76  ? 66   VAL B CG1 1 
ATOM   4115 C CG2 . VAL B 1 142 ? 81.687  -1.132  15.378  1.00 72.36  ? 66   VAL B CG2 1 
ATOM   4116 N N   . THR B 1 143 ? 84.422  -4.869  15.139  1.00 78.02  ? 67   THR B N   1 
ATOM   4117 C CA  . THR B 1 143 ? 85.065  -6.120  15.597  1.00 80.17  ? 67   THR B CA  1 
ATOM   4118 C C   . THR B 1 143 ? 86.588  -6.108  15.328  1.00 86.64  ? 67   THR B C   1 
ATOM   4119 O O   . THR B 1 143 ? 87.315  -6.909  15.920  1.00 87.80  ? 67   THR B O   1 
ATOM   4120 C CB  . THR B 1 143 ? 84.426  -7.348  14.919  1.00 86.98  ? 67   THR B CB  1 
ATOM   4121 O OG1 . THR B 1 143 ? 84.501  -7.197  13.501  1.00 87.53  ? 67   THR B OG1 1 
ATOM   4122 C CG2 . THR B 1 143 ? 82.975  -7.566  15.343  1.00 83.98  ? 67   THR B CG2 1 
ATOM   4123 N N   . LEU B 1 144 ? 87.070  -5.177  14.481  1.00 83.87  ? 68   LEU B N   1 
ATOM   4124 C CA  . LEU B 1 144 ? 88.485  -5.058  14.119  1.00 84.80  ? 68   LEU B CA  1 
ATOM   4125 C C   . LEU B 1 144 ? 89.321  -4.602  15.321  1.00 92.46  ? 68   LEU B C   1 
ATOM   4126 O O   . LEU B 1 144 ? 90.513  -4.903  15.375  1.00 93.49  ? 68   LEU B O   1 
ATOM   4127 C CB  . LEU B 1 144 ? 88.650  -4.075  12.958  1.00 83.17  ? 68   LEU B CB  1 
ATOM   4128 C CG  . LEU B 1 144 ? 89.868  -4.252  12.088  1.00 87.97  ? 68   LEU B CG  1 
ATOM   4129 C CD1 . LEU B 1 144 ? 89.732  -5.484  11.211  1.00 87.60  ? 68   LEU B CD1 1 
ATOM   4130 C CD2 . LEU B 1 144 ? 90.011  -3.094  11.183  1.00 90.80  ? 68   LEU B CD2 1 
ATOM   4131 N N   . PHE B 1 145 ? 88.695  -3.886  16.285  1.00 90.86  ? 69   PHE B N   1 
ATOM   4132 C CA  . PHE B 1 145 ? 89.360  -3.462  17.521  1.00 93.20  ? 69   PHE B CA  1 
ATOM   4133 C C   . PHE B 1 145 ? 89.547  -4.659  18.478  1.00 102.37 ? 69   PHE B C   1 
ATOM   4134 O O   . PHE B 1 145 ? 90.550  -4.716  19.190  1.00 103.54 ? 69   PHE B O   1 
ATOM   4135 C CB  . PHE B 1 145 ? 88.576  -2.343  18.230  1.00 94.13  ? 69   PHE B CB  1 
ATOM   4136 C CG  . PHE B 1 145 ? 88.306  -1.069  17.468  1.00 93.59  ? 69   PHE B CG  1 
ATOM   4137 C CD1 . PHE B 1 145 ? 89.230  -0.032  17.468  1.00 96.92  ? 69   PHE B CD1 1 
ATOM   4138 C CD2 . PHE B 1 145 ? 87.069  -0.845  16.879  1.00 93.84  ? 69   PHE B CD2 1 
ATOM   4139 C CE1 . PHE B 1 145 ? 88.957  1.172   16.809  1.00 96.47  ? 69   PHE B CE1 1 
ATOM   4140 C CE2 . PHE B 1 145 ? 86.794  0.361   16.223  1.00 95.35  ? 69   PHE B CE2 1 
ATOM   4141 C CZ  . PHE B 1 145 ? 87.742  1.359   16.188  1.00 93.88  ? 69   PHE B CZ  1 
ATOM   4142 N N   . CYS B 1 146 ? 88.570  -5.610  18.488  1.00 101.36 ? 70   CYS B N   1 
ATOM   4143 C CA  . CYS B 1 146 ? 88.549  -6.812  19.338  1.00 104.10 ? 70   CYS B CA  1 
ATOM   4144 C C   . CYS B 1 146 ? 89.741  -7.729  19.022  1.00 111.49 ? 70   CYS B C   1 
ATOM   4145 O O   . CYS B 1 146 ? 90.509  -8.066  19.930  1.00 113.20 ? 70   CYS B O   1 
ATOM   4146 C CB  . CYS B 1 146 ? 87.236  -7.575  19.171  1.00 103.87 ? 70   CYS B CB  1 
ATOM   4147 S SG  . CYS B 1 146 ? 85.757  -6.629  19.602  1.00 106.74 ? 70   CYS B SG  1 
ATOM   4148 N N   . CYS B 1 147 ? 89.863  -8.169  17.746  1.00 108.67 ? 71   CYS B N   1 
ATOM   4149 C CA  . CYS B 1 147 ? 90.910  -9.098  17.311  1.00 110.25 ? 71   CYS B CA  1 
ATOM   4150 C C   . CYS B 1 147 ? 92.299  -8.388  17.272  1.00 116.20 ? 71   CYS B C   1 
ATOM   4151 O O   . CYS B 1 147 ? 93.318  -9.084  17.301  1.00 117.97 ? 71   CYS B O   1 
ATOM   4152 C CB  . CYS B 1 147 ? 90.576  -9.724  15.957  1.00 109.15 ? 71   CYS B CB  1 
ATOM   4153 S SG  . CYS B 1 147 ? 90.388  -8.537  14.600  1.00 110.50 ? 71   CYS B SG  1 
ATOM   4154 N N   . GLN B 1 148 ? 92.336  -7.031  17.232  1.00 111.63 ? 72   GLN B N   1 
ATOM   4155 C CA  . GLN B 1 148 ? 93.582  -6.248  17.224  1.00 136.62 ? 72   GLN B CA  1 
ATOM   4156 C C   . GLN B 1 148 ? 93.565  -5.197  18.337  1.00 148.58 ? 72   GLN B C   1 
ATOM   4157 O O   . GLN B 1 148 ? 94.530  -4.453  18.504  1.00 105.54 ? 72   GLN B O   1 
ATOM   4158 C CB  . GLN B 1 148 ? 93.815  -5.570  15.861  1.00 136.35 ? 72   GLN B CB  1 
ATOM   4159 C CG  . GLN B 1 148 ? 94.106  -6.532  14.710  1.00 149.64 ? 72   GLN B CG  1 
ATOM   4160 C CD  . GLN B 1 148 ? 94.337  -5.830  13.386  1.00 165.42 ? 72   GLN B CD  1 
ATOM   4161 O OE1 . GLN B 1 148 ? 95.026  -6.350  12.504  1.00 160.65 ? 72   GLN B OE1 1 
ATOM   4162 N NE2 . GLN B 1 148 ? 93.814  -4.616  13.225  1.00 155.04 ? 72   GLN B NE2 1 
ATOM   4163 N N   . LYS B 1 153 ? 95.132  5.686   20.579  1.00 115.83 ? 77   LYS B N   1 
ATOM   4164 C CA  . LYS B 1 153 ? 94.891  6.716   19.569  1.00 114.06 ? 77   LYS B CA  1 
ATOM   4165 C C   . LYS B 1 153 ? 93.529  7.395   19.782  1.00 115.41 ? 77   LYS B C   1 
ATOM   4166 O O   . LYS B 1 153 ? 92.498  6.719   19.866  1.00 113.49 ? 77   LYS B O   1 
ATOM   4167 C CB  . LYS B 1 153 ? 94.958  6.124   18.141  1.00 115.15 ? 77   LYS B CB  1 
ATOM   4168 C CG  . LYS B 1 153 ? 96.319  5.526   17.725  1.00 136.23 ? 77   LYS B CG  1 
ATOM   4169 C CD  . LYS B 1 153 ? 97.472  6.555   17.569  1.00 150.03 ? 77   LYS B CD  1 
ATOM   4170 C CE  . LYS B 1 153 ? 97.293  7.562   16.443  1.00 161.45 ? 77   LYS B CE  1 
ATOM   4171 N NZ  . LYS B 1 153 ? 97.236  6.916   15.101  1.00 168.55 ? 77   LYS B NZ  1 
ATOM   4172 N N   . VAL B 1 154 ? 93.547  8.740   19.876  1.00 111.54 ? 78   VAL B N   1 
ATOM   4173 C CA  . VAL B 1 154 ? 92.378  9.631   20.003  1.00 109.73 ? 78   VAL B CA  1 
ATOM   4174 C C   . VAL B 1 154 ? 91.518  9.508   18.729  1.00 108.22 ? 78   VAL B C   1 
ATOM   4175 O O   . VAL B 1 154 ? 90.290  9.498   18.813  1.00 106.19 ? 78   VAL B O   1 
ATOM   4176 C CB  . VAL B 1 154 ? 92.836  11.104  20.259  1.00 115.20 ? 78   VAL B CB  1 
ATOM   4177 C CG1 . VAL B 1 154 ? 91.653  12.075  20.302  1.00 114.00 ? 78   VAL B CG1 1 
ATOM   4178 C CG2 . VAL B 1 154 ? 93.663  11.214  21.541  1.00 117.92 ? 78   VAL B CG2 1 
ATOM   4179 N N   . SER B 1 155 ? 92.183  9.377   17.556  1.00 102.45 ? 79   SER B N   1 
ATOM   4180 C CA  . SER B 1 155 ? 91.552  9.230   16.237  1.00 98.89  ? 79   SER B CA  1 
ATOM   4181 C C   . SER B 1 155 ? 90.676  7.981   16.169  1.00 98.96  ? 79   SER B C   1 
ATOM   4182 O O   . SER B 1 155 ? 89.626  8.022   15.533  1.00 96.91  ? 79   SER B O   1 
ATOM   4183 C CB  . SER B 1 155 ? 92.609  9.170   15.139  1.00 102.29 ? 79   SER B CB  1 
ATOM   4184 O OG  . SER B 1 155 ? 93.500  8.082   15.322  1.00 111.90 ? 79   SER B OG  1 
ATOM   4185 N N   . SER B 1 156 ? 91.096  6.884   16.846  1.00 94.54  ? 80   SER B N   1 
ATOM   4186 C CA  . SER B 1 156 ? 90.375  5.607   16.901  1.00 92.51  ? 80   SER B CA  1 
ATOM   4187 C C   . SER B 1 156 ? 89.021  5.747   17.615  1.00 93.36  ? 80   SER B C   1 
ATOM   4188 O O   . SER B 1 156 ? 88.093  4.995   17.303  1.00 92.60  ? 80   SER B O   1 
ATOM   4189 C CB  . SER B 1 156 ? 91.213  4.547   17.609  1.00 97.27  ? 80   SER B CB  1 
ATOM   4190 O OG  . SER B 1 156 ? 92.422  4.291   16.915  1.00 107.38 ? 80   SER B OG  1 
ATOM   4191 N N   . ILE B 1 157 ? 88.905  6.708   18.563  1.00 87.53  ? 81   ILE B N   1 
ATOM   4192 C CA  . ILE B 1 157 ? 87.669  6.945   19.317  1.00 85.63  ? 81   ILE B CA  1 
ATOM   4193 C C   . ILE B 1 157 ? 86.630  7.548   18.371  1.00 84.24  ? 81   ILE B C   1 
ATOM   4194 O O   . ILE B 1 157 ? 85.477  7.124   18.402  1.00 82.88  ? 81   ILE B O   1 
ATOM   4195 C CB  . ILE B 1 157 ? 87.898  7.842   20.573  1.00 90.86  ? 81   ILE B CB  1 
ATOM   4196 C CG1 . ILE B 1 157 ? 89.144  7.392   21.414  1.00 94.04  ? 81   ILE B CG1 1 
ATOM   4197 C CG2 . ILE B 1 157 ? 86.631  7.967   21.435  1.00 91.37  ? 81   ILE B CG2 1 
ATOM   4198 C CD1 . ILE B 1 157 ? 89.172  5.898   21.912  1.00 102.78 ? 81   ILE B CD1 1 
ATOM   4199 N N   . TYR B 1 158 ? 87.047  8.489   17.491  1.00 78.03  ? 82   TYR B N   1 
ATOM   4200 C CA  . TYR B 1 158 ? 86.145  9.103   16.510  1.00 74.86  ? 82   TYR B CA  1 
ATOM   4201 C C   . TYR B 1 158 ? 85.688  8.057   15.483  1.00 75.07  ? 82   TYR B C   1 
ATOM   4202 O O   . TYR B 1 158 ? 84.533  8.100   15.074  1.00 73.51  ? 82   TYR B O   1 
ATOM   4203 C CB  . TYR B 1 158 ? 86.789  10.306  15.798  1.00 75.89  ? 82   TYR B CB  1 
ATOM   4204 C CG  . TYR B 1 158 ? 87.315  11.373  16.734  1.00 79.69  ? 82   TYR B CG  1 
ATOM   4205 C CD1 . TYR B 1 158 ? 86.446  12.210  17.427  1.00 82.24  ? 82   TYR B CD1 1 
ATOM   4206 C CD2 . TYR B 1 158 ? 88.676  11.630  16.832  1.00 82.08  ? 82   TYR B CD2 1 
ATOM   4207 C CE1 . TYR B 1 158 ? 86.924  13.206  18.280  1.00 84.74  ? 82   TYR B CE1 1 
ATOM   4208 C CE2 . TYR B 1 158 ? 89.165  12.640  17.660  1.00 84.78  ? 82   TYR B CE2 1 
ATOM   4209 C CZ  . TYR B 1 158 ? 88.284  13.422  18.387  1.00 91.10  ? 82   TYR B CZ  1 
ATOM   4210 O OH  . TYR B 1 158 ? 88.757  14.413  19.206  1.00 93.78  ? 82   TYR B OH  1 
ATOM   4211 N N   . ILE B 1 159 ? 86.577  7.090   15.111  1.00 70.74  ? 83   ILE B N   1 
ATOM   4212 C CA  . ILE B 1 159 ? 86.274  5.974   14.186  1.00 68.64  ? 83   ILE B CA  1 
ATOM   4213 C C   . ILE B 1 159 ? 85.107  5.147   14.740  1.00 69.84  ? 83   ILE B C   1 
ATOM   4214 O O   . ILE B 1 159 ? 84.154  4.875   14.010  1.00 67.74  ? 83   ILE B O   1 
ATOM   4215 C CB  . ILE B 1 159 ? 87.520  5.053   13.928  1.00 72.69  ? 83   ILE B CB  1 
ATOM   4216 C CG1 . ILE B 1 159 ? 88.769  5.832   13.426  1.00 73.57  ? 83   ILE B CG1 1 
ATOM   4217 C CG2 . ILE B 1 159 ? 87.184  3.873   12.991  1.00 72.23  ? 83   ILE B CG2 1 
ATOM   4218 C CD1 . ILE B 1 159 ? 88.668  6.509   12.097  1.00 77.66  ? 83   ILE B CD1 1 
ATOM   4219 N N   . PHE B 1 160 ? 85.195  4.749   16.031  1.00 66.87  ? 84   PHE B N   1 
ATOM   4220 C CA  . PHE B 1 160 ? 84.180  3.943   16.703  1.00 66.50  ? 84   PHE B CA  1 
ATOM   4221 C C   . PHE B 1 160 ? 82.835  4.695   16.742  1.00 69.34  ? 84   PHE B C   1 
ATOM   4222 O O   . PHE B 1 160 ? 81.812  4.123   16.359  1.00 68.43  ? 84   PHE B O   1 
ATOM   4223 C CB  . PHE B 1 160 ? 84.634  3.562   18.122  1.00 70.01  ? 84   PHE B CB  1 
ATOM   4224 C CG  . PHE B 1 160 ? 83.645  2.696   18.866  1.00 72.23  ? 84   PHE B CG  1 
ATOM   4225 C CD1 . PHE B 1 160 ? 83.614  1.321   18.670  1.00 75.57  ? 84   PHE B CD1 1 
ATOM   4226 C CD2 . PHE B 1 160 ? 82.757  3.253   19.782  1.00 74.83  ? 84   PHE B CD2 1 
ATOM   4227 C CE1 . PHE B 1 160 ? 82.687  0.525   19.343  1.00 77.30  ? 84   PHE B CE1 1 
ATOM   4228 C CE2 . PHE B 1 160 ? 81.847  2.453   20.472  1.00 78.39  ? 84   PHE B CE2 1 
ATOM   4229 C CZ  . PHE B 1 160 ? 81.815  1.094   20.247  1.00 76.84  ? 84   PHE B CZ  1 
ATOM   4230 N N   . ASN B 1 161 ? 82.847  5.980   17.163  1.00 64.66  ? 85   ASN B N   1 
ATOM   4231 C CA  . ASN B 1 161 ? 81.652  6.814   17.228  1.00 62.52  ? 85   ASN B CA  1 
ATOM   4232 C C   . ASN B 1 161 ? 81.064  7.030   15.839  1.00 63.28  ? 85   ASN B C   1 
ATOM   4233 O O   . ASN B 1 161 ? 79.845  7.092   15.712  1.00 61.34  ? 85   ASN B O   1 
ATOM   4234 C CB  . ASN B 1 161 ? 81.957  8.139   17.882  1.00 61.81  ? 85   ASN B CB  1 
ATOM   4235 C CG  . ASN B 1 161 ? 82.133  8.039   19.375  1.00 81.28  ? 85   ASN B CG  1 
ATOM   4236 O OD1 . ASN B 1 161 ? 81.161  7.913   20.126  1.00 73.10  ? 85   ASN B OD1 1 
ATOM   4237 N ND2 . ASN B 1 161 ? 83.362  8.183   19.846  1.00 73.19  ? 85   ASN B ND2 1 
ATOM   4238 N N   . LEU B 1 162 ? 81.917  7.104   14.797  1.00 59.51  ? 86   LEU B N   1 
ATOM   4239 C CA  . LEU B 1 162 ? 81.473  7.236   13.405  1.00 57.26  ? 86   LEU B CA  1 
ATOM   4240 C C   . LEU B 1 162 ? 80.801  5.926   12.963  1.00 62.39  ? 86   LEU B C   1 
ATOM   4241 O O   . LEU B 1 162 ? 79.726  5.970   12.367  1.00 61.19  ? 86   LEU B O   1 
ATOM   4242 C CB  . LEU B 1 162 ? 82.653  7.608   12.471  1.00 56.43  ? 86   LEU B CB  1 
ATOM   4243 C CG  . LEU B 1 162 ? 82.344  7.784   10.970  1.00 59.20  ? 86   LEU B CG  1 
ATOM   4244 C CD1 . LEU B 1 162 ? 81.318  8.873   10.733  1.00 58.88  ? 86   LEU B CD1 1 
ATOM   4245 C CD2 . LEU B 1 162 ? 83.594  8.091   10.186  1.00 59.32  ? 86   LEU B CD2 1 
ATOM   4246 N N   . ALA B 1 163 ? 81.414  4.766   13.309  1.00 60.42  ? 87   ALA B N   1 
ATOM   4247 C CA  . ALA B 1 163 ? 80.900  3.433   12.983  1.00 60.27  ? 87   ALA B CA  1 
ATOM   4248 C C   . ALA B 1 163 ? 79.560  3.185   13.666  1.00 65.57  ? 87   ALA B C   1 
ATOM   4249 O O   . ALA B 1 163 ? 78.664  2.643   13.027  1.00 65.49  ? 87   ALA B O   1 
ATOM   4250 C CB  . ALA B 1 163 ? 81.900  2.367   13.392  1.00 62.15  ? 87   ALA B CB  1 
ATOM   4251 N N   . VAL B 1 164 ? 79.408  3.618   14.947  1.00 62.89  ? 88   VAL B N   1 
ATOM   4252 C CA  . VAL B 1 164 ? 78.160  3.503   15.720  1.00 62.96  ? 88   VAL B CA  1 
ATOM   4253 C C   . VAL B 1 164 ? 77.071  4.370   15.042  1.00 66.19  ? 88   VAL B C   1 
ATOM   4254 O O   . VAL B 1 164 ? 75.993  3.852   14.750  1.00 66.72  ? 88   VAL B O   1 
ATOM   4255 C CB  . VAL B 1 164 ? 78.359  3.886   17.216  1.00 68.31  ? 88   VAL B CB  1 
ATOM   4256 C CG1 . VAL B 1 164 ? 77.033  4.130   17.932  1.00 68.52  ? 88   VAL B CG1 1 
ATOM   4257 C CG2 . VAL B 1 164 ? 79.179  2.833   17.947  1.00 69.48  ? 88   VAL B CG2 1 
ATOM   4258 N N   . ALA B 1 165 ? 77.374  5.661   14.756  1.00 60.80  ? 89   ALA B N   1 
ATOM   4259 C CA  . ALA B 1 165 ? 76.457  6.594   14.092  1.00 59.20  ? 89   ALA B CA  1 
ATOM   4260 C C   . ALA B 1 165 ? 76.034  6.067   12.715  1.00 62.16  ? 89   ALA B C   1 
ATOM   4261 O O   . ALA B 1 165 ? 74.853  6.165   12.381  1.00 62.03  ? 89   ALA B O   1 
ATOM   4262 C CB  . ALA B 1 165 ? 77.103  7.962   13.949  1.00 59.67  ? 89   ALA B CB  1 
ATOM   4263 N N   . ASP B 1 166 ? 76.984  5.484   11.933  1.00 57.57  ? 90   ASP B N   1 
ATOM   4264 C CA  . ASP B 1 166 ? 76.706  4.907   10.611  1.00 56.44  ? 90   ASP B CA  1 
ATOM   4265 C C   . ASP B 1 166 ? 75.859  3.658   10.724  1.00 62.40  ? 90   ASP B C   1 
ATOM   4266 O O   . ASP B 1 166 ? 74.894  3.506   9.984   1.00 61.83  ? 90   ASP B O   1 
ATOM   4267 C CB  . ASP B 1 166 ? 78.005  4.569   9.854   1.00 57.35  ? 90   ASP B CB  1 
ATOM   4268 C CG  . ASP B 1 166 ? 78.797  5.757   9.359   1.00 61.67  ? 90   ASP B CG  1 
ATOM   4269 O OD1 . ASP B 1 166 ? 78.169  6.748   8.918   1.00 59.09  ? 90   ASP B OD1 1 
ATOM   4270 O OD2 . ASP B 1 166 ? 80.042  5.642   9.273   1.00 68.63  ? 90   ASP B OD2 1 
ATOM   4271 N N   . LEU B 1 167 ? 76.222  2.767   11.647  1.00 61.29  ? 91   LEU B N   1 
ATOM   4272 C CA  . LEU B 1 167 ? 75.563  1.486   11.858  1.00 62.70  ? 91   LEU B CA  1 
ATOM   4273 C C   . LEU B 1 167 ? 74.089  1.691   12.333  1.00 68.86  ? 91   LEU B C   1 
ATOM   4274 O O   . LEU B 1 167 ? 73.209  0.980   11.853  1.00 69.74  ? 91   LEU B O   1 
ATOM   4275 C CB  . LEU B 1 167 ? 76.389  0.705   12.885  1.00 63.94  ? 91   LEU B CB  1 
ATOM   4276 C CG  . LEU B 1 167 ? 76.263  -0.796  12.934  1.00 69.17  ? 91   LEU B CG  1 
ATOM   4277 C CD1 . LEU B 1 167 ? 76.440  -1.408  11.563  1.00 68.72  ? 91   LEU B CD1 1 
ATOM   4278 C CD2 . LEU B 1 167 ? 77.311  -1.367  13.867  1.00 71.30  ? 91   LEU B CD2 1 
ATOM   4279 N N   . LEU B 1 168 ? 73.820  2.700   13.195  1.00 65.28  ? 92   LEU B N   1 
ATOM   4280 C CA  . LEU B 1 168 ? 72.465  3.028   13.652  1.00 65.40  ? 92   LEU B CA  1 
ATOM   4281 C C   . LEU B 1 168 ? 71.672  3.773   12.560  1.00 69.25  ? 92   LEU B C   1 
ATOM   4282 O O   . LEU B 1 168 ? 70.444  3.665   12.533  1.00 69.17  ? 92   LEU B O   1 
ATOM   4283 C CB  . LEU B 1 168 ? 72.488  3.872   14.940  1.00 66.04  ? 92   LEU B CB  1 
ATOM   4284 C CG  . LEU B 1 168 ? 73.033  3.205   16.211  1.00 71.57  ? 92   LEU B CG  1 
ATOM   4285 C CD1 . LEU B 1 168 ? 73.099  4.198   17.347  1.00 72.26  ? 92   LEU B CD1 1 
ATOM   4286 C CD2 . LEU B 1 168 ? 72.193  1.992   16.620  1.00 73.65  ? 92   LEU B CD2 1 
ATOM   4287 N N   . LEU B 1 169 ? 72.363  4.535   11.679  1.00 65.14  ? 93   LEU B N   1 
ATOM   4288 C CA  . LEU B 1 169 ? 71.736  5.258   10.561  1.00 64.12  ? 93   LEU B CA  1 
ATOM   4289 C C   . LEU B 1 169 ? 71.220  4.268   9.514   1.00 68.29  ? 93   LEU B C   1 
ATOM   4290 O O   . LEU B 1 169 ? 70.081  4.388   9.065   1.00 68.05  ? 93   LEU B O   1 
ATOM   4291 C CB  . LEU B 1 169 ? 72.737  6.246   9.920   1.00 63.54  ? 93   LEU B CB  1 
ATOM   4292 C CG  . LEU B 1 169 ? 72.239  7.097   8.739   1.00 67.35  ? 93   LEU B CG  1 
ATOM   4293 C CD1 . LEU B 1 169 ? 71.167  8.081   9.178   1.00 67.33  ? 93   LEU B CD1 1 
ATOM   4294 C CD2 . LEU B 1 169 ? 73.381  7.867   8.116   1.00 69.57  ? 93   LEU B CD2 1 
ATOM   4295 N N   . LEU B 1 170 ? 72.066  3.278   9.145   1.00 64.80  ? 94   LEU B N   1 
ATOM   4296 C CA  . LEU B 1 170 ? 71.761  2.218   8.179   1.00 64.39  ? 94   LEU B CA  1 
ATOM   4297 C C   . LEU B 1 170 ? 70.710  1.259   8.733   1.00 71.97  ? 94   LEU B C   1 
ATOM   4298 O O   . LEU B 1 170 ? 70.001  0.626   7.954   1.00 73.00  ? 94   LEU B O   1 
ATOM   4299 C CB  . LEU B 1 170 ? 73.039  1.442   7.812   1.00 63.74  ? 94   LEU B CB  1 
ATOM   4300 C CG  . LEU B 1 170 ? 74.106  2.203   7.023   1.00 66.20  ? 94   LEU B CG  1 
ATOM   4301 C CD1 . LEU B 1 170 ? 75.430  1.549   7.152   1.00 66.10  ? 94   LEU B CD1 1 
ATOM   4302 C CD2 . LEU B 1 170 ? 73.710  2.400   5.565   1.00 67.19  ? 94   LEU B CD2 1 
ATOM   4303 N N   . ALA B 1 171 ? 70.580  1.184   10.077  1.00 69.56  ? 95   ALA B N   1 
ATOM   4304 C CA  . ALA B 1 171 ? 69.604  0.336   10.771  1.00 70.11  ? 95   ALA B CA  1 
ATOM   4305 C C   . ALA B 1 171 ? 68.145  0.837   10.567  1.00 73.18  ? 95   ALA B C   1 
ATOM   4306 O O   . ALA B 1 171 ? 67.217  0.091   10.871  1.00 74.35  ? 95   ALA B O   1 
ATOM   4307 C CB  . ALA B 1 171 ? 69.923  0.286   12.257  1.00 71.52  ? 95   ALA B CB  1 
ATOM   4308 N N   . THR B 1 172 ? 67.943  2.075   10.046  1.00 66.77  ? 96   THR B N   1 
ATOM   4309 C CA  . THR B 1 172 ? 66.600  2.619   9.812   1.00 65.98  ? 96   THR B CA  1 
ATOM   4310 C C   . THR B 1 172 ? 66.105  2.308   8.377   1.00 69.89  ? 96   THR B C   1 
ATOM   4311 O O   . THR B 1 172 ? 64.909  2.441   8.120   1.00 69.36  ? 96   THR B O   1 
ATOM   4312 C CB  . THR B 1 172 ? 66.551  4.135   10.060  1.00 68.06  ? 96   THR B CB  1 
ATOM   4313 O OG1 . THR B 1 172 ? 67.405  4.802   9.134   1.00 64.05  ? 96   THR B OG1 1 
ATOM   4314 C CG2 . THR B 1 172 ? 66.898  4.516   11.495  1.00 67.41  ? 96   THR B CG2 1 
ATOM   4315 N N   . LEU B 1 173 ? 67.013  1.876   7.458   1.00 66.20  ? 97   LEU B N   1 
ATOM   4316 C CA  . LEU B 1 173 ? 66.688  1.546   6.062   1.00 65.52  ? 97   LEU B CA  1 
ATOM   4317 C C   . LEU B 1 173 ? 65.532  0.514   5.958   1.00 68.98  ? 97   LEU B C   1 
ATOM   4318 O O   . LEU B 1 173 ? 64.650  0.758   5.129   1.00 68.79  ? 97   LEU B O   1 
ATOM   4319 C CB  . LEU B 1 173 ? 67.906  1.022   5.293   1.00 65.35  ? 97   LEU B CB  1 
ATOM   4320 C CG  . LEU B 1 173 ? 68.890  2.093   4.813   1.00 69.41  ? 97   LEU B CG  1 
ATOM   4321 C CD1 . LEU B 1 173 ? 70.172  1.479   4.311   1.00 70.00  ? 97   LEU B CD1 1 
ATOM   4322 C CD2 . LEU B 1 173 ? 68.279  2.948   3.721   1.00 70.73  ? 97   LEU B CD2 1 
ATOM   4323 N N   . PRO B 1 174 ? 65.429  -0.571  6.790   1.00 65.12  ? 98   PRO B N   1 
ATOM   4324 C CA  . PRO B 1 174 ? 64.271  -1.482  6.650   1.00 65.78  ? 98   PRO B CA  1 
ATOM   4325 C C   . PRO B 1 174 ? 62.924  -0.766  6.854   1.00 69.65  ? 98   PRO B C   1 
ATOM   4326 O O   . PRO B 1 174 ? 61.934  -1.190  6.261   1.00 69.73  ? 98   PRO B O   1 
ATOM   4327 C CB  . PRO B 1 174 ? 64.499  -2.523  7.751   1.00 68.21  ? 98   PRO B CB  1 
ATOM   4328 C CG  . PRO B 1 174 ? 65.952  -2.502  7.995   1.00 71.86  ? 98   PRO B CG  1 
ATOM   4329 C CD  . PRO B 1 174 ? 66.359  -1.067  7.828   1.00 66.35  ? 98   PRO B CD  1 
ATOM   4330 N N   . LEU B 1 175 ? 62.895  0.336   7.648   1.00 65.42  ? 99   LEU B N   1 
ATOM   4331 C CA  . LEU B 1 175 ? 61.685  1.125   7.893   1.00 65.34  ? 99   LEU B CA  1 
ATOM   4332 C C   . LEU B 1 175 ? 61.266  1.925   6.669   1.00 67.94  ? 99   LEU B C   1 
ATOM   4333 O O   . LEU B 1 175 ? 60.088  1.907   6.323   1.00 68.77  ? 99   LEU B O   1 
ATOM   4334 C CB  . LEU B 1 175 ? 61.866  2.100   9.069   1.00 65.28  ? 99   LEU B CB  1 
ATOM   4335 C CG  . LEU B 1 175 ? 62.059  1.528   10.459  1.00 71.91  ? 99   LEU B CG  1 
ATOM   4336 C CD1 . LEU B 1 175 ? 62.402  2.622   11.433  1.00 71.95  ? 99   LEU B CD1 1 
ATOM   4337 C CD2 . LEU B 1 175 ? 60.819  0.786   10.936  1.00 77.86  ? 99   LEU B CD2 1 
ATOM   4338 N N   . TRP B 1 176 ? 62.209  2.652   6.032   1.00 62.79  ? 100  TRP B N   1 
ATOM   4339 C CA  . TRP B 1 176 ? 61.898  3.521   4.893   1.00 62.35  ? 100  TRP B CA  1 
ATOM   4340 C C   . TRP B 1 176 ? 61.548  2.685   3.668   1.00 67.95  ? 100  TRP B C   1 
ATOM   4341 O O   . TRP B 1 176 ? 60.697  3.106   2.888   1.00 69.29  ? 100  TRP B O   1 
ATOM   4342 C CB  . TRP B 1 176 ? 63.054  4.495   4.562   1.00 59.46  ? 100  TRP B CB  1 
ATOM   4343 C CG  . TRP B 1 176 ? 63.672  5.172   5.759   1.00 59.58  ? 100  TRP B CG  1 
ATOM   4344 C CD1 . TRP B 1 176 ? 64.989  5.139   6.112   1.00 61.94  ? 100  TRP B CD1 1 
ATOM   4345 C CD2 . TRP B 1 176 ? 62.974  5.747   6.882   1.00 59.54  ? 100  TRP B CD2 1 
ATOM   4346 N NE1 . TRP B 1 176 ? 65.175  5.787   7.313   1.00 61.34  ? 100  TRP B NE1 1 
ATOM   4347 C CE2 . TRP B 1 176 ? 63.951  6.139   7.825   1.00 63.12  ? 100  TRP B CE2 1 
ATOM   4348 C CE3 . TRP B 1 176 ? 61.621  5.995   7.171   1.00 61.19  ? 100  TRP B CE3 1 
ATOM   4349 C CZ2 . TRP B 1 176 ? 63.620  6.773   9.029   1.00 62.40  ? 100  TRP B CZ2 1 
ATOM   4350 C CZ3 . TRP B 1 176 ? 61.295  6.616   8.367   1.00 62.83  ? 100  TRP B CZ3 1 
ATOM   4351 C CH2 . TRP B 1 176 ? 62.287  7.008   9.275   1.00 63.04  ? 100  TRP B CH2 1 
ATOM   4352 N N   . ALA B 1 177 ? 62.150  1.489   3.524   1.00 63.65  ? 101  ALA B N   1 
ATOM   4353 C CA  . ALA B 1 177 ? 61.826  0.575   2.427   1.00 63.68  ? 101  ALA B CA  1 
ATOM   4354 C C   . ALA B 1 177 ? 60.404  0.026   2.586   1.00 67.73  ? 101  ALA B C   1 
ATOM   4355 O O   . ALA B 1 177 ? 59.682  -0.067  1.596   1.00 68.47  ? 101  ALA B O   1 
ATOM   4356 C CB  . ALA B 1 177 ? 62.831  -0.563  2.375   1.00 64.58  ? 101  ALA B CB  1 
ATOM   4357 N N   . THR B 1 178 ? 59.991  -0.289  3.843   1.00 63.90  ? 102  THR B N   1 
ATOM   4358 C CA  . THR B 1 178 ? 58.654  -0.797  4.184   1.00 65.30  ? 102  THR B CA  1 
ATOM   4359 C C   . THR B 1 178 ? 57.625  0.325   3.985   1.00 68.65  ? 102  THR B C   1 
ATOM   4360 O O   . THR B 1 178 ? 56.605  0.102   3.343   1.00 69.41  ? 102  THR B O   1 
ATOM   4361 C CB  . THR B 1 178 ? 58.639  -1.348  5.627   1.00 75.33  ? 102  THR B CB  1 
ATOM   4362 O OG1 . THR B 1 178 ? 59.585  -2.408  5.732   1.00 78.62  ? 102  THR B OG1 1 
ATOM   4363 C CG2 . THR B 1 178 ? 57.288  -1.878  6.043   1.00 74.55  ? 102  THR B CG2 1 
ATOM   4364 N N   . TYR B 1 179 ? 57.920  1.532   4.503   1.00 63.89  ? 103  TYR B N   1 
ATOM   4365 C CA  . TYR B 1 179 ? 57.085  2.730   4.382   1.00 63.21  ? 103  TYR B CA  1 
ATOM   4366 C C   . TYR B 1 179 ? 56.874  3.083   2.892   1.00 65.73  ? 103  TYR B C   1 
ATOM   4367 O O   . TYR B 1 179 ? 55.743  3.376   2.506   1.00 66.23  ? 103  TYR B O   1 
ATOM   4368 C CB  . TYR B 1 179 ? 57.739  3.898   5.156   1.00 63.22  ? 103  TYR B CB  1 
ATOM   4369 C CG  . TYR B 1 179 ? 57.025  5.231   5.098   1.00 65.06  ? 103  TYR B CG  1 
ATOM   4370 C CD1 . TYR B 1 179 ? 55.761  5.390   5.659   1.00 68.52  ? 103  TYR B CD1 1 
ATOM   4371 C CD2 . TYR B 1 179 ? 57.693  6.377   4.681   1.00 64.57  ? 103  TYR B CD2 1 
ATOM   4372 C CE1 . TYR B 1 179 ? 55.125  6.629   5.673   1.00 69.23  ? 103  TYR B CE1 1 
ATOM   4373 C CE2 . TYR B 1 179 ? 57.079  7.626   4.710   1.00 65.38  ? 103  TYR B CE2 1 
ATOM   4374 C CZ  . TYR B 1 179 ? 55.791  7.747   5.201   1.00 71.76  ? 103  TYR B CZ  1 
ATOM   4375 O OH  . TYR B 1 179 ? 55.186  8.975   5.229   1.00 71.25  ? 103  TYR B OH  1 
ATOM   4376 N N   . TYR B 1 180 ? 57.935  2.972   2.053   1.00 60.19  ? 104  TYR B N   1 
ATOM   4377 C CA  . TYR B 1 180 ? 57.847  3.223   0.612   1.00 59.74  ? 104  TYR B CA  1 
ATOM   4378 C C   . TYR B 1 180 ? 57.004  2.133   -0.074  1.00 67.32  ? 104  TYR B C   1 
ATOM   4379 O O   . TYR B 1 180 ? 56.227  2.459   -0.975  1.00 67.97  ? 104  TYR B O   1 
ATOM   4380 C CB  . TYR B 1 180 ? 59.250  3.295   -0.015  1.00 58.67  ? 104  TYR B CB  1 
ATOM   4381 C CG  . TYR B 1 180 ? 59.266  3.646   -1.489  1.00 59.10  ? 104  TYR B CG  1 
ATOM   4382 C CD1 . TYR B 1 180 ? 59.373  4.968   -1.909  1.00 60.00  ? 104  TYR B CD1 1 
ATOM   4383 C CD2 . TYR B 1 180 ? 59.240  2.654   -2.462  1.00 60.30  ? 104  TYR B CD2 1 
ATOM   4384 C CE1 . TYR B 1 180 ? 59.425  5.295   -3.264  1.00 59.55  ? 104  TYR B CE1 1 
ATOM   4385 C CE2 . TYR B 1 180 ? 59.271  2.970   -3.818  1.00 61.04  ? 104  TYR B CE2 1 
ATOM   4386 C CZ  . TYR B 1 180 ? 59.381  4.291   -4.215  1.00 65.10  ? 104  TYR B CZ  1 
ATOM   4387 O OH  . TYR B 1 180 ? 59.419  4.606   -5.551  1.00 65.51  ? 104  TYR B OH  1 
ATOM   4388 N N   . SER B 1 181 ? 57.160  0.846   0.356   1.00 65.62  ? 105  SER B N   1 
ATOM   4389 C CA  . SER B 1 181 ? 56.436  -0.314  -0.193  1.00 67.77  ? 105  SER B CA  1 
ATOM   4390 C C   . SER B 1 181 ? 54.927  -0.196  0.007   1.00 74.80  ? 105  SER B C   1 
ATOM   4391 O O   . SER B 1 181 ? 54.169  -0.552  -0.898  1.00 75.69  ? 105  SER B O   1 
ATOM   4392 C CB  . SER B 1 181 ? 56.916  -1.614  0.444   1.00 72.05  ? 105  SER B CB  1 
ATOM   4393 O OG  . SER B 1 181 ? 58.272  -1.883  0.137   1.00 83.28  ? 105  SER B OG  1 
ATOM   4394 N N   . TYR B 1 182 ? 54.488  0.303   1.183   1.00 72.80  ? 106  TYR B N   1 
ATOM   4395 C CA  . TYR B 1 182 ? 53.068  0.467   1.490   1.00 74.73  ? 106  TYR B CA  1 
ATOM   4396 C C   . TYR B 1 182 ? 52.550  1.838   0.976   1.00 78.57  ? 106  TYR B C   1 
ATOM   4397 O O   . TYR B 1 182 ? 51.538  2.332   1.472   1.00 79.16  ? 106  TYR B O   1 
ATOM   4398 C CB  . TYR B 1 182 ? 52.810  0.315   3.002   1.00 76.62  ? 106  TYR B CB  1 
ATOM   4399 C CG  . TYR B 1 182 ? 52.927  -1.112  3.497   1.00 80.93  ? 106  TYR B CG  1 
ATOM   4400 C CD1 . TYR B 1 182 ? 51.854  -1.996  3.397   1.00 86.14  ? 106  TYR B CD1 1 
ATOM   4401 C CD2 . TYR B 1 182 ? 54.081  -1.561  4.125   1.00 80.68  ? 106  TYR B CD2 1 
ATOM   4402 C CE1 . TYR B 1 182 ? 51.952  -3.311  3.854   1.00 89.31  ? 106  TYR B CE1 1 
ATOM   4403 C CE2 . TYR B 1 182 ? 54.192  -2.872  4.589   1.00 83.07  ? 106  TYR B CE2 1 
ATOM   4404 C CZ  . TYR B 1 182 ? 53.124  -3.745  4.453   1.00 96.45  ? 106  TYR B CZ  1 
ATOM   4405 O OH  . TYR B 1 182 ? 53.225  -5.039  4.914   1.00 101.60 ? 106  TYR B OH  1 
ATOM   4406 N N   . ARG B 1 183 ? 53.210  2.400   -0.075  1.00 73.51  ? 107  ARG B N   1 
ATOM   4407 C CA  . ARG B 1 183 ? 52.886  3.669   -0.747  1.00 72.12  ? 107  ARG B CA  1 
ATOM   4408 C C   . ARG B 1 183 ? 52.670  4.791   0.294   1.00 76.81  ? 107  ARG B C   1 
ATOM   4409 O O   . ARG B 1 183 ? 51.647  5.476   0.289   1.00 77.90  ? 107  ARG B O   1 
ATOM   4410 C CB  . ARG B 1 183 ? 51.659  3.532   -1.669  1.00 69.81  ? 107  ARG B CB  1 
ATOM   4411 C CG  . ARG B 1 183 ? 51.923  2.891   -3.038  1.00 73.42  ? 107  ARG B CG  1 
ATOM   4412 C CD  . ARG B 1 183 ? 52.433  1.459   -3.002  1.00 78.28  ? 107  ARG B CD  1 
ATOM   4413 N NE  . ARG B 1 183 ? 52.530  0.879   -4.343  1.00 80.44  ? 107  ARG B NE  1 
ATOM   4414 C CZ  . ARG B 1 183 ? 53.016  -0.331  -4.601  1.00 89.68  ? 107  ARG B CZ  1 
ATOM   4415 N NH1 . ARG B 1 183 ? 53.512  -1.080  -3.623  1.00 67.04  ? 107  ARG B NH1 1 
ATOM   4416 N NH2 . ARG B 1 183 ? 53.051  -0.784  -5.847  1.00 82.06  ? 107  ARG B NH2 1 
ATOM   4417 N N   . TYR B 1 184 ? 53.669  4.958   1.176   1.00 73.01  ? 108  TYR B N   1 
ATOM   4418 C CA  . TYR B 1 184 ? 53.780  5.959   2.238   1.00 72.14  ? 108  TYR B CA  1 
ATOM   4419 C C   . TYR B 1 184 ? 52.596  5.830   3.240   1.00 77.87  ? 108  TYR B C   1 
ATOM   4420 O O   . TYR B 1 184 ? 51.974  6.829   3.617   1.00 77.04  ? 108  TYR B O   1 
ATOM   4421 C CB  . TYR B 1 184 ? 53.872  7.383   1.658   1.00 72.41  ? 108  TYR B CB  1 
ATOM   4422 C CG  . TYR B 1 184 ? 55.096  7.560   0.770   1.00 72.78  ? 108  TYR B CG  1 
ATOM   4423 C CD1 . TYR B 1 184 ? 56.364  7.747   1.320   1.00 73.11  ? 108  TYR B CD1 1 
ATOM   4424 C CD2 . TYR B 1 184 ? 54.988  7.530   -0.615  1.00 73.89  ? 108  TYR B CD2 1 
ATOM   4425 C CE1 . TYR B 1 184 ? 57.495  7.881   0.512   1.00 73.12  ? 108  TYR B CE1 1 
ATOM   4426 C CE2 . TYR B 1 184 ? 56.110  7.681   -1.434  1.00 73.74  ? 108  TYR B CE2 1 
ATOM   4427 C CZ  . TYR B 1 184 ? 57.362  7.860   -0.866  1.00 79.75  ? 108  TYR B CZ  1 
ATOM   4428 O OH  . TYR B 1 184 ? 58.473  8.030   -1.665  1.00 80.94  ? 108  TYR B OH  1 
ATOM   4429 N N   . ASP B 1 185 ? 52.356  4.584   3.720   1.00 76.14  ? 109  ASP B N   1 
ATOM   4430 C CA  . ASP B 1 185 ? 51.375  4.282   4.758   1.00 77.58  ? 109  ASP B CA  1 
ATOM   4431 C C   . ASP B 1 185 ? 52.115  3.855   6.012   1.00 83.17  ? 109  ASP B C   1 
ATOM   4432 O O   . ASP B 1 185 ? 52.574  2.709   6.111   1.00 83.44  ? 109  ASP B O   1 
ATOM   4433 C CB  . ASP B 1 185 ? 50.367  3.211   4.305   1.00 81.29  ? 109  ASP B CB  1 
ATOM   4434 C CG  . ASP B 1 185 ? 49.124  3.072   5.181   1.00 90.33  ? 109  ASP B CG  1 
ATOM   4435 O OD1 . ASP B 1 185 ? 48.847  4.004   5.980   1.00 89.16  ? 109  ASP B OD1 1 
ATOM   4436 O OD2 . ASP B 1 185 ? 48.360  2.100   4.976   1.00 98.98  ? 109  ASP B OD2 1 
ATOM   4437 N N   . TRP B 1 186 ? 52.304  4.805   6.934   1.00 80.07  ? 110  TRP B N   1 
ATOM   4438 C CA  . TRP B 1 186 ? 53.008  4.578   8.186   1.00 80.01  ? 110  TRP B CA  1 
ATOM   4439 C C   . TRP B 1 186 ? 52.158  3.659   9.083   1.00 87.76  ? 110  TRP B C   1 
ATOM   4440 O O   . TRP B 1 186 ? 51.095  4.058   9.557   1.00 88.29  ? 110  TRP B O   1 
ATOM   4441 C CB  . TRP B 1 186 ? 53.328  5.922   8.866   1.00 77.51  ? 110  TRP B CB  1 
ATOM   4442 C CG  . TRP B 1 186 ? 54.223  5.789   10.054  1.00 77.73  ? 110  TRP B CG  1 
ATOM   4443 C CD1 . TRP B 1 186 ? 53.845  5.637   11.354  1.00 81.61  ? 110  TRP B CD1 1 
ATOM   4444 C CD2 . TRP B 1 186 ? 55.652  5.720   10.040  1.00 76.03  ? 110  TRP B CD2 1 
ATOM   4445 N NE1 . TRP B 1 186 ? 54.951  5.520   12.157  1.00 80.41  ? 110  TRP B NE1 1 
ATOM   4446 C CE2 . TRP B 1 186 ? 56.076  5.559   11.376  1.00 80.33  ? 110  TRP B CE2 1 
ATOM   4447 C CE3 . TRP B 1 186 ? 56.621  5.778   9.025   1.00 75.76  ? 110  TRP B CE3 1 
ATOM   4448 C CZ2 . TRP B 1 186 ? 57.425  5.456   11.725  1.00 78.66  ? 110  TRP B CZ2 1 
ATOM   4449 C CZ3 . TRP B 1 186 ? 57.955  5.692   9.372   1.00 76.24  ? 110  TRP B CZ3 1 
ATOM   4450 C CH2 . TRP B 1 186 ? 58.347  5.538   10.708  1.00 77.32  ? 110  TRP B CH2 1 
ATOM   4451 N N   . LEU B 1 187 ? 52.611  2.408   9.253   1.00 87.17  ? 111  LEU B N   1 
ATOM   4452 C CA  . LEU B 1 187 ? 51.919  1.372   10.034  1.00 90.01  ? 111  LEU B CA  1 
ATOM   4453 C C   . LEU B 1 187 ? 52.682  1.052   11.346  1.00 95.75  ? 111  LEU B C   1 
ATOM   4454 O O   . LEU B 1 187 ? 52.712  -0.109  11.778  1.00 96.73  ? 111  LEU B O   1 
ATOM   4455 C CB  . LEU B 1 187 ? 51.779  0.086   9.170   1.00 91.08  ? 111  LEU B CB  1 
ATOM   4456 C CG  . LEU B 1 187 ? 50.976  0.182   7.865   1.00 96.42  ? 111  LEU B CG  1 
ATOM   4457 C CD1 . LEU B 1 187 ? 51.194  -1.037  6.998   1.00 97.04  ? 111  LEU B CD1 1 
ATOM   4458 C CD2 . LEU B 1 187 ? 49.488  0.398   8.132   1.00 101.32 ? 111  LEU B CD2 1 
ATOM   4459 N N   . PHE B 1 188 ? 53.282  2.086   11.984  1.00 91.58  ? 112  PHE B N   1 
ATOM   4460 C CA  . PHE B 1 188 ? 54.075  1.915   13.204  1.00 91.26  ? 112  PHE B CA  1 
ATOM   4461 C C   . PHE B 1 188 ? 53.614  2.861   14.346  1.00 96.17  ? 112  PHE B C   1 
ATOM   4462 O O   . PHE B 1 188 ? 54.239  2.884   15.409  1.00 96.03  ? 112  PHE B O   1 
ATOM   4463 C CB  . PHE B 1 188 ? 55.562  2.170   12.898  1.00 91.14  ? 112  PHE B CB  1 
ATOM   4464 C CG  . PHE B 1 188 ? 56.187  1.233   11.890  1.00 92.34  ? 112  PHE B CG  1 
ATOM   4465 C CD1 . PHE B 1 188 ? 56.779  0.040   12.297  1.00 96.56  ? 112  PHE B CD1 1 
ATOM   4466 C CD2 . PHE B 1 188 ? 56.235  1.567   10.542  1.00 93.26  ? 112  PHE B CD2 1 
ATOM   4467 C CE1 . PHE B 1 188 ? 57.378  -0.818  11.367  1.00 96.96  ? 112  PHE B CE1 1 
ATOM   4468 C CE2 . PHE B 1 188 ? 56.829  0.709   9.614   1.00 95.77  ? 112  PHE B CE2 1 
ATOM   4469 C CZ  . PHE B 1 188 ? 57.399  -0.478  10.032  1.00 94.61  ? 112  PHE B CZ  1 
ATOM   4470 N N   . GLY B 1 189 ? 52.538  3.613   14.121  1.00 93.34  ? 113  GLY B N   1 
ATOM   4471 C CA  . GLY B 1 189 ? 52.008  4.550   15.107  1.00 94.06  ? 113  GLY B CA  1 
ATOM   4472 C C   . GLY B 1 189 ? 52.660  5.918   15.036  1.00 97.23  ? 113  GLY B C   1 
ATOM   4473 O O   . GLY B 1 189 ? 53.824  6.023   14.643  1.00 95.35  ? 113  GLY B O   1 
ATOM   4474 N N   . PRO B 1 190 ? 51.957  7.001   15.454  1.00 94.86  ? 114  PRO B N   1 
ATOM   4475 C CA  . PRO B 1 190 ? 52.544  8.354   15.333  1.00 93.33  ? 114  PRO B CA  1 
ATOM   4476 C C   . PRO B 1 190 ? 53.693  8.621   16.310  1.00 95.22  ? 114  PRO B C   1 
ATOM   4477 O O   . PRO B 1 190 ? 54.430  9.593   16.111  1.00 93.59  ? 114  PRO B O   1 
ATOM   4478 C CB  . PRO B 1 190 ? 51.368  9.286   15.655  1.00 96.58  ? 114  PRO B CB  1 
ATOM   4479 C CG  . PRO B 1 190 ? 50.138  8.432   15.484  1.00 102.64 ? 114  PRO B CG  1 
ATOM   4480 C CD  . PRO B 1 190 ? 50.560  7.069   15.926  1.00 98.42  ? 114  PRO B CD  1 
ATOM   4481 N N   . VAL B 1 191 ? 53.855  7.772   17.346  1.00 91.74  ? 115  VAL B N   1 
ATOM   4482 C CA  . VAL B 1 191 ? 54.924  7.922   18.339  1.00 90.89  ? 115  VAL B CA  1 
ATOM   4483 C C   . VAL B 1 191 ? 56.266  7.564   17.664  1.00 91.97  ? 115  VAL B C   1 
ATOM   4484 O O   . VAL B 1 191 ? 57.213  8.343   17.769  1.00 91.14  ? 115  VAL B O   1 
ATOM   4485 C CB  . VAL B 1 191 ? 54.665  7.082   19.624  1.00 96.39  ? 115  VAL B CB  1 
ATOM   4486 C CG1 . VAL B 1 191 ? 55.830  7.188   20.603  1.00 96.02  ? 115  VAL B CG1 1 
ATOM   4487 C CG2 . VAL B 1 191 ? 53.365  7.513   20.303  1.00 98.06  ? 115  VAL B CG2 1 
ATOM   4488 N N   . MET B 1 192 ? 56.316  6.449   16.906  1.00 87.21  ? 116  MET B N   1 
ATOM   4489 C CA  . MET B 1 192 ? 57.534  6.018   16.219  1.00 85.60  ? 116  MET B CA  1 
ATOM   4490 C C   . MET B 1 192 ? 57.836  6.909   15.001  1.00 83.30  ? 116  MET B C   1 
ATOM   4491 O O   . MET B 1 192 ? 58.961  6.881   14.500  1.00 82.49  ? 116  MET B O   1 
ATOM   4492 C CB  . MET B 1 192 ? 57.451  4.555   15.787  1.00 89.53  ? 116  MET B CB  1 
ATOM   4493 C CG  . MET B 1 192 ? 57.367  3.618   16.954  1.00 96.77  ? 116  MET B CG  1 
ATOM   4494 S SD  . MET B 1 192 ? 57.485  1.879   16.503  1.00 103.69 ? 116  MET B SD  1 
ATOM   4495 C CE  . MET B 1 192 ? 57.022  1.134   18.126  1.00 103.08 ? 116  MET B CE  1 
ATOM   4496 N N   . CYS B 1 193 ? 56.862  7.726   14.555  1.00 75.60  ? 117  CYS B N   1 
ATOM   4497 C CA  . CYS B 1 193 ? 57.068  8.706   13.483  1.00 71.88  ? 117  CYS B CA  1 
ATOM   4498 C C   . CYS B 1 193 ? 58.010  9.804   14.002  1.00 74.42  ? 117  CYS B C   1 
ATOM   4499 O O   . CYS B 1 193 ? 58.948  10.182  13.297  1.00 72.61  ? 117  CYS B O   1 
ATOM   4500 C CB  . CYS B 1 193 ? 55.734  9.267   12.995  1.00 71.30  ? 117  CYS B CB  1 
ATOM   4501 S SG  . CYS B 1 193 ? 55.867  10.607  11.774  1.00 73.06  ? 117  CYS B SG  1 
ATOM   4502 N N   . LYS B 1 194 ? 57.811  10.240  15.269  1.00 71.38  ? 118  LYS B N   1 
ATOM   4503 C CA  . LYS B 1 194 ? 58.680  11.212  15.930  1.00 70.67  ? 118  LYS B CA  1 
ATOM   4504 C C   . LYS B 1 194 ? 59.990  10.592  16.363  1.00 74.84  ? 118  LYS B C   1 
ATOM   4505 O O   . LYS B 1 194 ? 61.032  11.208  16.169  1.00 73.18  ? 118  LYS B O   1 
ATOM   4506 C CB  . LYS B 1 194 ? 58.015  11.841  17.164  1.00 74.15  ? 118  LYS B CB  1 
ATOM   4507 C CG  . LYS B 1 194 ? 56.892  12.782  16.858  1.00 84.46  ? 118  LYS B CG  1 
ATOM   4508 C CD  . LYS B 1 194 ? 56.433  13.511  18.101  1.00 91.04  ? 118  LYS B CD  1 
ATOM   4509 C CE  . LYS B 1 194 ? 55.383  14.545  17.789  1.00 95.49  ? 118  LYS B CE  1 
ATOM   4510 N NZ  . LYS B 1 194 ? 55.892  15.604  16.881  1.00 98.96  ? 118  LYS B NZ  1 
ATOM   4511 N N   . VAL B 1 195 ? 59.936  9.397   17.003  1.00 73.00  ? 119  VAL B N   1 
ATOM   4512 C CA  . VAL B 1 195 ? 61.102  8.730   17.586  1.00 73.12  ? 119  VAL B CA  1 
ATOM   4513 C C   . VAL B 1 195 ? 62.096  8.329   16.468  1.00 77.92  ? 119  VAL B C   1 
ATOM   4514 O O   . VAL B 1 195 ? 63.228  8.807   16.506  1.00 77.25  ? 119  VAL B O   1 
ATOM   4515 C CB  . VAL B 1 195 ? 60.714  7.507   18.459  1.00 77.52  ? 119  VAL B CB  1 
ATOM   4516 C CG1 . VAL B 1 195 ? 61.952  6.757   18.946  1.00 77.23  ? 119  VAL B CG1 1 
ATOM   4517 C CG2 . VAL B 1 195 ? 59.862  7.939   19.645  1.00 78.72  ? 119  VAL B CG2 1 
ATOM   4518 N N   . PHE B 1 196 ? 61.690  7.485   15.489  1.00 76.02  ? 120  PHE B N   1 
ATOM   4519 C CA  . PHE B 1 196 ? 62.612  7.050   14.428  1.00 75.71  ? 120  PHE B CA  1 
ATOM   4520 C C   . PHE B 1 196 ? 62.935  8.196   13.463  1.00 77.29  ? 120  PHE B C   1 
ATOM   4521 O O   . PHE B 1 196 ? 64.029  8.204   12.898  1.00 76.83  ? 120  PHE B O   1 
ATOM   4522 C CB  . PHE B 1 196 ? 62.088  5.849   13.642  1.00 78.51  ? 120  PHE B CB  1 
ATOM   4523 C CG  . PHE B 1 196 ? 62.063  4.591   14.476  1.00 82.47  ? 120  PHE B CG  1 
ATOM   4524 C CD1 . PHE B 1 196 ? 63.238  3.918   14.785  1.00 86.08  ? 120  PHE B CD1 1 
ATOM   4525 C CD2 . PHE B 1 196 ? 60.862  4.044   14.902  1.00 87.04  ? 120  PHE B CD2 1 
ATOM   4526 C CE1 . PHE B 1 196 ? 63.219  2.765   15.571  1.00 88.70  ? 120  PHE B CE1 1 
ATOM   4527 C CE2 . PHE B 1 196 ? 60.842  2.876   15.672  1.00 91.57  ? 120  PHE B CE2 1 
ATOM   4528 C CZ  . PHE B 1 196 ? 62.023  2.242   15.998  1.00 89.55  ? 120  PHE B CZ  1 
ATOM   4529 N N   . GLY B 1 197 ? 62.032  9.166   13.336  1.00 71.83  ? 121  GLY B N   1 
ATOM   4530 C CA  . GLY B 1 197 ? 62.271  10.360  12.535  1.00 69.99  ? 121  GLY B CA  1 
ATOM   4531 C C   . GLY B 1 197 ? 63.440  11.148  13.098  1.00 72.44  ? 121  GLY B C   1 
ATOM   4532 O O   . GLY B 1 197 ? 64.325  11.576  12.353  1.00 70.97  ? 121  GLY B O   1 
ATOM   4533 N N   . SER B 1 198 ? 63.472  11.285  14.439  1.00 69.49  ? 122  SER B N   1 
ATOM   4534 C CA  . SER B 1 198 ? 64.527  11.961  15.190  1.00 69.18  ? 122  SER B CA  1 
ATOM   4535 C C   . SER B 1 198 ? 65.792  11.132  15.241  1.00 73.79  ? 122  SER B C   1 
ATOM   4536 O O   . SER B 1 198 ? 66.883  11.689  15.142  1.00 73.05  ? 122  SER B O   1 
ATOM   4537 C CB  . SER B 1 198 ? 64.061  12.248  16.609  1.00 73.41  ? 122  SER B CB  1 
ATOM   4538 O OG  . SER B 1 198 ? 62.893  13.045  16.590  1.00 80.81  ? 122  SER B OG  1 
ATOM   4539 N N   . PHE B 1 199 ? 65.649  9.799   15.431  1.00 71.06  ? 123  PHE B N   1 
ATOM   4540 C CA  . PHE B 1 199 ? 66.758  8.848   15.521  1.00 70.71  ? 123  PHE B CA  1 
ATOM   4541 C C   . PHE B 1 199 ? 67.550  8.844   14.208  1.00 72.16  ? 123  PHE B C   1 
ATOM   4542 O O   . PHE B 1 199 ? 68.777  8.729   14.231  1.00 72.12  ? 123  PHE B O   1 
ATOM   4543 C CB  . PHE B 1 199 ? 66.232  7.447   15.855  1.00 73.49  ? 123  PHE B CB  1 
ATOM   4544 C CG  . PHE B 1 199 ? 67.283  6.391   16.108  1.00 75.78  ? 123  PHE B CG  1 
ATOM   4545 C CD1 . PHE B 1 199 ? 67.860  6.249   17.365  1.00 80.30  ? 123  PHE B CD1 1 
ATOM   4546 C CD2 . PHE B 1 199 ? 67.623  5.476   15.119  1.00 77.79  ? 123  PHE B CD2 1 
ATOM   4547 C CE1 . PHE B 1 199 ? 68.801  5.248   17.612  1.00 81.77  ? 123  PHE B CE1 1 
ATOM   4548 C CE2 . PHE B 1 199 ? 68.555  4.466   15.370  1.00 81.29  ? 123  PHE B CE2 1 
ATOM   4549 C CZ  . PHE B 1 199 ? 69.142  4.361   16.614  1.00 80.42  ? 123  PHE B CZ  1 
ATOM   4550 N N   . LEU B 1 200 ? 66.843  9.010   13.073  1.00 66.07  ? 124  LEU B N   1 
ATOM   4551 C CA  . LEU B 1 200 ? 67.424  9.114   11.739  1.00 64.01  ? 124  LEU B CA  1 
ATOM   4552 C C   . LEU B 1 200 ? 68.303  10.353  11.631  1.00 68.53  ? 124  LEU B C   1 
ATOM   4553 O O   . LEU B 1 200 ? 69.458  10.246  11.221  1.00 69.97  ? 124  LEU B O   1 
ATOM   4554 C CB  . LEU B 1 200 ? 66.297  9.166   10.686  1.00 63.21  ? 124  LEU B CB  1 
ATOM   4555 C CG  . LEU B 1 200 ? 66.669  9.583   9.261   1.00 66.14  ? 124  LEU B CG  1 
ATOM   4556 C CD1 . LEU B 1 200 ? 67.517  8.526   8.564   1.00 65.41  ? 124  LEU B CD1 1 
ATOM   4557 C CD2 . LEU B 1 200 ? 65.430  9.870   8.464   1.00 68.35  ? 124  LEU B CD2 1 
ATOM   4558 N N   . THR B 1 201 ? 67.755  11.521  12.011  1.00 63.35  ? 125  THR B N   1 
ATOM   4559 C CA  . THR B 1 201 ? 68.406  12.822  11.917  1.00 62.05  ? 125  THR B CA  1 
ATOM   4560 C C   . THR B 1 201 ? 69.564  12.904  12.927  1.00 67.45  ? 125  THR B C   1 
ATOM   4561 O O   . THR B 1 201 ? 70.615  13.455  12.600  1.00 68.29  ? 125  THR B O   1 
ATOM   4562 C CB  . THR B 1 201 ? 67.364  13.913  12.150  1.00 62.04  ? 125  THR B CB  1 
ATOM   4563 O OG1 . THR B 1 201 ? 66.251  13.661  11.297  1.00 57.06  ? 125  THR B OG1 1 
ATOM   4564 C CG2 . THR B 1 201 ? 67.898  15.299  11.879  1.00 59.35  ? 125  THR B CG2 1 
ATOM   4565 N N   . LEU B 1 202 ? 69.387  12.322  14.125  1.00 64.01  ? 126  LEU B N   1 
ATOM   4566 C CA  . LEU B 1 202 ? 70.391  12.295  15.196  1.00 63.75  ? 126  LEU B CA  1 
ATOM   4567 C C   . LEU B 1 202 ? 71.672  11.618  14.701  1.00 67.98  ? 126  LEU B C   1 
ATOM   4568 O O   . LEU B 1 202 ? 72.737  12.233  14.740  1.00 68.20  ? 126  LEU B O   1 
ATOM   4569 C CB  . LEU B 1 202 ? 69.815  11.554  16.434  1.00 64.15  ? 126  LEU B CB  1 
ATOM   4570 C CG  . LEU B 1 202 ? 70.574  11.603  17.768  1.00 69.04  ? 126  LEU B CG  1 
ATOM   4571 C CD1 . LEU B 1 202 ? 69.719  11.095  18.877  1.00 70.43  ? 126  LEU B CD1 1 
ATOM   4572 C CD2 . LEU B 1 202 ? 71.840  10.807  17.737  1.00 71.05  ? 126  LEU B CD2 1 
ATOM   4573 N N   . ASN B 1 203 ? 71.559  10.363  14.223  1.00 64.11  ? 127  ASN B N   1 
ATOM   4574 C CA  . ASN B 1 203 ? 72.692  9.569   13.752  1.00 63.39  ? 127  ASN B CA  1 
ATOM   4575 C C   . ASN B 1 203 ? 73.201  10.070  12.390  1.00 66.87  ? 127  ASN B C   1 
ATOM   4576 O O   . ASN B 1 203 ? 74.374  9.853   12.092  1.00 66.90  ? 127  ASN B O   1 
ATOM   4577 C CB  . ASN B 1 203 ? 72.314  8.099   13.666  1.00 61.43  ? 127  ASN B CB  1 
ATOM   4578 C CG  . ASN B 1 203 ? 72.027  7.503   15.022  1.00 67.98  ? 127  ASN B CG  1 
ATOM   4579 O OD1 . ASN B 1 203 ? 72.873  7.486   15.922  1.00 53.80  ? 127  ASN B OD1 1 
ATOM   4580 N ND2 . ASN B 1 203 ? 70.840  6.967   15.185  1.00 58.95  ? 127  ASN B ND2 1 
ATOM   4581 N N   . MET B 1 204 ? 72.354  10.755  11.581  1.00 62.84  ? 128  MET B N   1 
ATOM   4582 C CA  . MET B 1 204 ? 72.808  11.337  10.311  1.00 62.02  ? 128  MET B CA  1 
ATOM   4583 C C   . MET B 1 204 ? 73.807  12.455  10.585  1.00 67.65  ? 128  MET B C   1 
ATOM   4584 O O   . MET B 1 204 ? 74.886  12.468  9.994   1.00 68.05  ? 128  MET B O   1 
ATOM   4585 C CB  . MET B 1 204 ? 71.646  11.865  9.461   1.00 63.80  ? 128  MET B CB  1 
ATOM   4586 C CG  . MET B 1 204 ? 72.121  12.472  8.149   1.00 66.75  ? 128  MET B CG  1 
ATOM   4587 S SD  . MET B 1 204 ? 70.902  13.458  7.264   1.00 70.18  ? 128  MET B SD  1 
ATOM   4588 C CE  . MET B 1 204 ? 70.699  14.816  8.380   1.00 67.42  ? 128  MET B CE  1 
ATOM   4589 N N   . PHE B 1 205 ? 73.443  13.389  11.495  1.00 64.55  ? 129  PHE B N   1 
ATOM   4590 C CA  . PHE B 1 205 ? 74.313  14.491  11.879  1.00 64.61  ? 129  PHE B CA  1 
ATOM   4591 C C   . PHE B 1 205 ? 75.493  13.981  12.698  1.00 70.80  ? 129  PHE B C   1 
ATOM   4592 O O   . PHE B 1 205 ? 76.593  14.491  12.513  1.00 71.76  ? 129  PHE B O   1 
ATOM   4593 C CB  . PHE B 1 205 ? 73.567  15.584  12.650  1.00 66.44  ? 129  PHE B CB  1 
ATOM   4594 C CG  . PHE B 1 205 ? 72.749  16.482  11.757  1.00 66.89  ? 129  PHE B CG  1 
ATOM   4595 C CD1 . PHE B 1 205 ? 73.369  17.400  10.910  1.00 69.73  ? 129  PHE B CD1 1 
ATOM   4596 C CD2 . PHE B 1 205 ? 71.368  16.497  11.841  1.00 67.65  ? 129  PHE B CD2 1 
ATOM   4597 C CE1 . PHE B 1 205 ? 72.617  18.240  10.093  1.00 70.06  ? 129  PHE B CE1 1 
ATOM   4598 C CE2 . PHE B 1 205 ? 70.618  17.362  11.047  1.00 70.31  ? 129  PHE B CE2 1 
ATOM   4599 C CZ  . PHE B 1 205 ? 71.247  18.224  10.176  1.00 68.54  ? 129  PHE B CZ  1 
ATOM   4600 N N   . ALA B 1 206 ? 75.298  12.945  13.545  1.00 66.77  ? 130  ALA B N   1 
ATOM   4601 C CA  . ALA B 1 206 ? 76.404  12.377  14.313  1.00 66.62  ? 130  ALA B CA  1 
ATOM   4602 C C   . ALA B 1 206 ? 77.460  11.800  13.365  1.00 69.87  ? 130  ALA B C   1 
ATOM   4603 O O   . ALA B 1 206 ? 78.648  11.947  13.625  1.00 71.33  ? 130  ALA B O   1 
ATOM   4604 C CB  . ALA B 1 206 ? 75.903  11.319  15.269  1.00 67.75  ? 130  ALA B CB  1 
ATOM   4605 N N   . SER B 1 207 ? 77.028  11.241  12.216  1.00 64.35  ? 131  SER B N   1 
ATOM   4606 C CA  . SER B 1 207 ? 77.929  10.719  11.183  1.00 63.28  ? 131  SER B CA  1 
ATOM   4607 C C   . SER B 1 207 ? 78.714  11.861  10.535  1.00 67.44  ? 131  SER B C   1 
ATOM   4608 O O   . SER B 1 207 ? 79.943  11.835  10.546  1.00 68.08  ? 131  SER B O   1 
ATOM   4609 C CB  . SER B 1 207 ? 77.147  9.941   10.124  1.00 63.92  ? 131  SER B CB  1 
ATOM   4610 O OG  . SER B 1 207 ? 77.998  9.473   9.091   1.00 67.82  ? 131  SER B OG  1 
ATOM   4611 N N   . ILE B 1 208 ? 77.997  12.883  10.025  1.00 62.98  ? 132  ILE B N   1 
ATOM   4612 C CA  . ILE B 1 208 ? 78.561  14.050  9.334   1.00 62.62  ? 132  ILE B CA  1 
ATOM   4613 C C   . ILE B 1 208 ? 79.507  14.850  10.286  1.00 67.30  ? 132  ILE B C   1 
ATOM   4614 O O   . ILE B 1 208 ? 80.569  15.292  9.841   1.00 67.63  ? 132  ILE B O   1 
ATOM   4615 C CB  . ILE B 1 208 ? 77.413  14.956  8.786   1.00 64.80  ? 132  ILE B CB  1 
ATOM   4616 C CG1 . ILE B 1 208 ? 76.519  14.165  7.792   1.00 64.11  ? 132  ILE B CG1 1 
ATOM   4617 C CG2 . ILE B 1 208 ? 77.979  16.217  8.121   1.00 64.72  ? 132  ILE B CG2 1 
ATOM   4618 C CD1 . ILE B 1 208 ? 75.260  14.876  7.296   1.00 68.82  ? 132  ILE B CD1 1 
ATOM   4619 N N   . PHE B 1 209 ? 79.142  15.015  11.573  1.00 63.64  ? 133  PHE B N   1 
ATOM   4620 C CA  . PHE B 1 209 ? 79.972  15.787  12.492  1.00 64.36  ? 133  PHE B CA  1 
ATOM   4621 C C   . PHE B 1 209 ? 81.217  15.007  12.882  1.00 68.68  ? 133  PHE B C   1 
ATOM   4622 O O   . PHE B 1 209 ? 82.259  15.631  13.055  1.00 69.82  ? 133  PHE B O   1 
ATOM   4623 C CB  . PHE B 1 209 ? 79.216  16.222  13.754  1.00 67.04  ? 133  PHE B CB  1 
ATOM   4624 C CG  . PHE B 1 209 ? 77.974  17.064  13.541  1.00 68.16  ? 133  PHE B CG  1 
ATOM   4625 C CD1 . PHE B 1 209 ? 77.938  18.044  12.554  1.00 70.65  ? 133  PHE B CD1 1 
ATOM   4626 C CD2 . PHE B 1 209 ? 76.921  17.013  14.443  1.00 71.62  ? 133  PHE B CD2 1 
ATOM   4627 C CE1 . PHE B 1 209 ? 76.806  18.837  12.370  1.00 72.01  ? 133  PHE B CE1 1 
ATOM   4628 C CE2 . PHE B 1 209 ? 75.806  17.839  14.286  1.00 74.98  ? 133  PHE B CE2 1 
ATOM   4629 C CZ  . PHE B 1 209 ? 75.751  18.739  13.240  1.00 72.49  ? 133  PHE B CZ  1 
ATOM   4630 N N   . PHE B 1 210 ? 81.148  13.659  12.984  1.00 64.66  ? 134  PHE B N   1 
ATOM   4631 C CA  . PHE B 1 210 ? 82.353  12.879  13.297  1.00 64.72  ? 134  PHE B CA  1 
ATOM   4632 C C   . PHE B 1 210 ? 83.266  12.782  12.039  1.00 68.91  ? 134  PHE B C   1 
ATOM   4633 O O   . PHE B 1 210 ? 84.480  12.685  12.204  1.00 69.95  ? 134  PHE B O   1 
ATOM   4634 C CB  . PHE B 1 210 ? 82.045  11.486  13.864  1.00 65.90  ? 134  PHE B CB  1 
ATOM   4635 C CG  . PHE B 1 210 ? 81.637  11.513  15.323  1.00 67.80  ? 134  PHE B CG  1 
ATOM   4636 C CD1 . PHE B 1 210 ? 82.565  11.803  16.317  1.00 72.52  ? 134  PHE B CD1 1 
ATOM   4637 C CD2 . PHE B 1 210 ? 80.368  11.116  15.713  1.00 68.68  ? 134  PHE B CD2 1 
ATOM   4638 C CE1 . PHE B 1 210 ? 82.193  11.816  17.668  1.00 74.49  ? 134  PHE B CE1 1 
ATOM   4639 C CE2 . PHE B 1 210 ? 80.000  11.113  17.065  1.00 72.66  ? 134  PHE B CE2 1 
ATOM   4640 C CZ  . PHE B 1 210 ? 80.913  11.468  18.033  1.00 72.63  ? 134  PHE B CZ  1 
ATOM   4641 N N   . ILE B 1 211 ? 82.700  12.894  10.807  1.00 64.60  ? 135  ILE B N   1 
ATOM   4642 C CA  . ILE B 1 211 ? 83.463  12.985  9.543   1.00 64.06  ? 135  ILE B CA  1 
ATOM   4643 C C   . ILE B 1 211 ? 84.277  14.288  9.577   1.00 70.23  ? 135  ILE B C   1 
ATOM   4644 O O   . ILE B 1 211 ? 85.458  14.296  9.215   1.00 71.12  ? 135  ILE B O   1 
ATOM   4645 C CB  . ILE B 1 211 ? 82.518  12.906  8.286   1.00 65.53  ? 135  ILE B CB  1 
ATOM   4646 C CG1 . ILE B 1 211 ? 81.896  11.501  8.144   1.00 65.13  ? 135  ILE B CG1 1 
ATOM   4647 C CG2 . ILE B 1 211 ? 83.255  13.304  6.988   1.00 65.28  ? 135  ILE B CG2 1 
ATOM   4648 C CD1 . ILE B 1 211 ? 80.810  11.361  7.071   1.00 70.14  ? 135  ILE B CD1 1 
ATOM   4649 N N   . THR B 1 212 ? 83.634  15.377  10.051  1.00 67.71  ? 136  THR B N   1 
ATOM   4650 C CA  . THR B 1 212 ? 84.216  16.709  10.197  1.00 69.33  ? 136  THR B CA  1 
ATOM   4651 C C   . THR B 1 212 ? 85.343  16.668  11.245  1.00 76.96  ? 136  THR B C   1 
ATOM   4652 O O   . THR B 1 212 ? 86.396  17.255  11.001  1.00 78.08  ? 136  THR B O   1 
ATOM   4653 C CB  . THR B 1 212 ? 83.124  17.713  10.569  1.00 74.56  ? 136  THR B CB  1 
ATOM   4654 O OG1 . THR B 1 212 ? 82.095  17.656  9.585   1.00 67.95  ? 136  THR B OG1 1 
ATOM   4655 C CG2 . THR B 1 212 ? 83.646  19.132  10.695  1.00 74.58  ? 136  THR B CG2 1 
ATOM   4656 N N   . CYS B 1 213 ? 85.140  15.947  12.382  1.00 75.01  ? 137  CYS B N   1 
ATOM   4657 C CA  . CYS B 1 213 ? 86.163  15.788  13.426  1.00 77.30  ? 137  CYS B CA  1 
ATOM   4658 C C   . CYS B 1 213 ? 87.397  15.116  12.849  1.00 82.06  ? 137  CYS B C   1 
ATOM   4659 O O   . CYS B 1 213 ? 88.496  15.586  13.109  1.00 83.51  ? 137  CYS B O   1 
ATOM   4660 C CB  . CYS B 1 213 ? 85.633  15.006  14.621  1.00 78.32  ? 137  CYS B CB  1 
ATOM   4661 S SG  . CYS B 1 213 ? 84.456  15.920  15.639  1.00 83.07  ? 137  CYS B SG  1 
ATOM   4662 N N   . MET B 1 214 ? 87.218  14.040  12.051  1.00 77.79  ? 138  MET B N   1 
ATOM   4663 C CA  . MET B 1 214 ? 88.307  13.293  11.415  1.00 78.50  ? 138  MET B CA  1 
ATOM   4664 C C   . MET B 1 214 ? 89.190  14.188  10.533  1.00 82.38  ? 138  MET B C   1 
ATOM   4665 O O   . MET B 1 214 ? 90.409  14.039  10.573  1.00 82.77  ? 138  MET B O   1 
ATOM   4666 C CB  . MET B 1 214 ? 87.775  12.129  10.558  1.00 79.82  ? 138  MET B CB  1 
ATOM   4667 C CG  . MET B 1 214 ? 87.249  10.937  11.361  1.00 83.88  ? 138  MET B CG  1 
ATOM   4668 S SD  . MET B 1 214 ? 88.471  10.198  12.480  1.00 91.00  ? 138  MET B SD  1 
ATOM   4669 C CE  . MET B 1 214 ? 89.834  9.827   11.324  1.00 87.87  ? 138  MET B CE  1 
ATOM   4670 N N   . SER B 1 215 ? 88.586  15.099  9.742   1.00 78.27  ? 139  SER B N   1 
ATOM   4671 C CA  . SER B 1 215 ? 89.341  15.999  8.863   1.00 78.65  ? 139  SER B CA  1 
ATOM   4672 C C   . SER B 1 215 ? 90.138  17.030  9.688   1.00 83.81  ? 139  SER B C   1 
ATOM   4673 O O   . SER B 1 215 ? 91.282  17.324  9.341   1.00 83.93  ? 139  SER B O   1 
ATOM   4674 C CB  . SER B 1 215 ? 88.411  16.706  7.884   1.00 81.25  ? 139  SER B CB  1 
ATOM   4675 O OG  . SER B 1 215 ? 87.782  15.766  7.030   1.00 89.51  ? 139  SER B OG  1 
ATOM   4676 N N   . VAL B 1 216 ? 89.548  17.537  10.793  1.00 80.95  ? 140  VAL B N   1 
ATOM   4677 C CA  . VAL B 1 216 ? 90.182  18.493  11.713  1.00 82.68  ? 140  VAL B CA  1 
ATOM   4678 C C   . VAL B 1 216 ? 91.329  17.780  12.460  1.00 88.71  ? 140  VAL B C   1 
ATOM   4679 O O   . VAL B 1 216 ? 92.387  18.382  12.657  1.00 90.10  ? 140  VAL B O   1 
ATOM   4680 C CB  . VAL B 1 216 ? 89.144  19.115  12.695  1.00 86.39  ? 140  VAL B CB  1 
ATOM   4681 C CG1 . VAL B 1 216 ? 89.817  19.961  13.775  1.00 88.59  ? 140  VAL B CG1 1 
ATOM   4682 C CG2 . VAL B 1 216 ? 88.101  19.935  11.944  1.00 84.87  ? 140  VAL B CG2 1 
ATOM   4683 N N   . ASP B 1 217 ? 91.129  16.487  12.828  1.00 84.88  ? 141  ASP B N   1 
ATOM   4684 C CA  . ASP B 1 217 ? 92.116  15.664  13.538  1.00 85.84  ? 141  ASP B CA  1 
ATOM   4685 C C   . ASP B 1 217 ? 93.297  15.331  12.618  1.00 90.01  ? 141  ASP B C   1 
ATOM   4686 O O   . ASP B 1 217 ? 94.445  15.507  13.034  1.00 91.97  ? 141  ASP B O   1 
ATOM   4687 C CB  . ASP B 1 217 ? 91.479  14.374  14.080  1.00 86.71  ? 141  ASP B CB  1 
ATOM   4688 C CG  . ASP B 1 217 ? 92.420  13.548  14.933  1.00 99.49  ? 141  ASP B CG  1 
ATOM   4689 O OD1 . ASP B 1 217 ? 92.686  13.954  16.092  1.00 102.45 ? 141  ASP B OD1 1 
ATOM   4690 O OD2 . ASP B 1 217 ? 92.865  12.477  14.459  1.00 103.78 ? 141  ASP B OD2 1 
ATOM   4691 N N   . ARG B 1 218 ? 93.020  14.864  11.372  1.00 84.30  ? 142  ARG B N   1 
ATOM   4692 C CA  . ARG B 1 218 ? 94.060  14.556  10.386  1.00 84.31  ? 142  ARG B CA  1 
ATOM   4693 C C   . ARG B 1 218 ? 94.855  15.810  10.029  1.00 92.07  ? 142  ARG B C   1 
ATOM   4694 O O   . ARG B 1 218 ? 96.065  15.707  9.862   1.00 94.16  ? 142  ARG B O   1 
ATOM   4695 C CB  . ARG B 1 218 ? 93.490  13.923  9.109   1.00 80.37  ? 142  ARG B CB  1 
ATOM   4696 C CG  . ARG B 1 218 ? 93.095  12.458  9.243   1.00 83.62  ? 142  ARG B CG  1 
ATOM   4697 C CD  . ARG B 1 218 ? 92.648  11.910  7.900   1.00 88.90  ? 142  ARG B CD  1 
ATOM   4698 N NE  . ARG B 1 218 ? 92.477  10.456  7.923   1.00 96.14  ? 142  ARG B NE  1 
ATOM   4699 C CZ  . ARG B 1 218 ? 92.111  9.727   6.871   1.00 106.81 ? 142  ARG B CZ  1 
ATOM   4700 N NH1 . ARG B 1 218 ? 91.862  10.308  5.703   1.00 87.55  ? 142  ARG B NH1 1 
ATOM   4701 N NH2 . ARG B 1 218 ? 91.984  8.411   6.981   1.00 95.05  ? 142  ARG B NH2 1 
ATOM   4702 N N   . TYR B 1 219 ? 94.195  16.990  9.948   1.00 89.81  ? 143  TYR B N   1 
ATOM   4703 C CA  . TYR B 1 219 ? 94.866  18.262  9.656   1.00 92.09  ? 143  TYR B CA  1 
ATOM   4704 C C   . TYR B 1 219 ? 95.807  18.640  10.800  1.00 100.48 ? 143  TYR B C   1 
ATOM   4705 O O   . TYR B 1 219 ? 96.961  18.975  10.542  1.00 101.96 ? 143  TYR B O   1 
ATOM   4706 C CB  . TYR B 1 219 ? 93.850  19.395  9.397   1.00 93.06  ? 143  TYR B CB  1 
ATOM   4707 C CG  . TYR B 1 219 ? 94.480  20.770  9.323   1.00 97.46  ? 143  TYR B CG  1 
ATOM   4708 C CD1 . TYR B 1 219 ? 95.209  21.165  8.205   1.00 99.92  ? 143  TYR B CD1 1 
ATOM   4709 C CD2 . TYR B 1 219 ? 94.304  21.696  10.347  1.00 100.04 ? 143  TYR B CD2 1 
ATOM   4710 C CE1 . TYR B 1 219 ? 95.814  22.419  8.144   1.00 102.79 ? 143  TYR B CE1 1 
ATOM   4711 C CE2 . TYR B 1 219 ? 94.892  22.959  10.291  1.00 103.14 ? 143  TYR B CE2 1 
ATOM   4712 C CZ  . TYR B 1 219 ? 95.646  23.317  9.185   1.00 111.56 ? 143  TYR B CZ  1 
ATOM   4713 O OH  . TYR B 1 219 ? 96.227  24.561  9.120   1.00 115.09 ? 143  TYR B OH  1 
ATOM   4714 N N   . GLN B 1 220 ? 95.326  18.541  12.056  1.00 98.50  ? 144  GLN B N   1 
ATOM   4715 C CA  . GLN B 1 220 ? 96.082  18.864  13.267  1.00 101.15 ? 144  GLN B CA  1 
ATOM   4716 C C   . GLN B 1 220 ? 97.276  17.880  13.434  1.00 108.38 ? 144  GLN B C   1 
ATOM   4717 O O   . GLN B 1 220 ? 98.270  18.236  14.065  1.00 110.21 ? 144  GLN B O   1 
ATOM   4718 C CB  . GLN B 1 220 ? 95.136  18.819  14.482  1.00 102.08 ? 144  GLN B CB  1 
ATOM   4719 C CG  . GLN B 1 220 ? 95.695  19.418  15.769  1.00 119.66 ? 144  GLN B CG  1 
ATOM   4720 C CD  . GLN B 1 220 ? 94.679  19.498  16.891  1.00 134.95 ? 144  GLN B CD  1 
ATOM   4721 O OE1 . GLN B 1 220 ? 94.904  20.170  17.903  1.00 135.07 ? 144  GLN B OE1 1 
ATOM   4722 N NE2 . GLN B 1 220 ? 93.524  18.862  16.730  1.00 117.33 ? 144  GLN B NE2 1 
ATOM   4723 N N   . SER B 1 221 ? 97.186  16.673  12.827  1.00 105.17 ? 145  SER B N   1 
ATOM   4724 C CA  . SER B 1 221 ? 98.246  15.658  12.840  1.00 106.86 ? 145  SER B CA  1 
ATOM   4725 C C   . SER B 1 221 ? 99.324  15.964  11.799  1.00 114.96 ? 145  SER B C   1 
ATOM   4726 O O   . SER B 1 221 ? 100.480 15.584  11.984  1.00 116.50 ? 145  SER B O   1 
ATOM   4727 C CB  . SER B 1 221 ? 97.665  14.273  12.581  1.00 107.94 ? 145  SER B CB  1 
ATOM   4728 O OG  . SER B 1 221 ? 96.730  13.910  13.579  1.00 115.94 ? 145  SER B OG  1 
ATOM   4729 N N   . VAL B 1 222 ? 98.941  16.633  10.697  1.00 113.17 ? 146  VAL B N   1 
ATOM   4730 C CA  . VAL B 1 222 ? 99.850  16.992  9.608   1.00 115.15 ? 146  VAL B CA  1 
ATOM   4731 C C   . VAL B 1 222 ? 100.619 18.285  9.983   1.00 125.26 ? 146  VAL B C   1 
ATOM   4732 O O   . VAL B 1 222 ? 101.848 18.252  10.021  1.00 126.74 ? 146  VAL B O   1 
ATOM   4733 C CB  . VAL B 1 222 ? 99.090  17.146  8.255   1.00 116.84 ? 146  VAL B CB  1 
ATOM   4734 C CG1 . VAL B 1 222 ? 99.974  17.755  7.178   1.00 117.87 ? 146  VAL B CG1 1 
ATOM   4735 C CG2 . VAL B 1 222 ? 98.517  15.815  7.785   1.00 114.39 ? 146  VAL B CG2 1 
ATOM   4736 N N   . ILE B 1 223 ? 99.899  19.405  10.257  1.00 125.10 ? 147  ILE B N   1 
ATOM   4737 C CA  . ILE B 1 223 ? 100.490 20.714  10.573  1.00 129.21 ? 147  ILE B CA  1 
ATOM   4738 C C   . ILE B 1 223 ? 101.304 20.613  11.917  1.00 139.73 ? 147  ILE B C   1 
ATOM   4739 O O   . ILE B 1 223 ? 102.401 21.177  11.984  1.00 142.40 ? 147  ILE B O   1 
ATOM   4740 C CB  . ILE B 1 223 ? 99.408  21.857  10.619  1.00 131.99 ? 147  ILE B CB  1 
ATOM   4741 C CG1 . ILE B 1 223 ? 100.024 23.271  10.815  1.00 135.55 ? 147  ILE B CG1 1 
ATOM   4742 C CG2 . ILE B 1 223 ? 98.289  21.611  11.624  1.00 131.75 ? 147  ILE B CG2 1 
ATOM   4743 C CD1 . ILE B 1 223 ? 100.900 23.808  9.648   1.00 146.48 ? 147  ILE B CD1 1 
ATOM   4744 N N   . TYR B 1 224 ? 100.810 19.862  12.932  1.00 138.40 ? 148  TYR B N   1 
ATOM   4745 C CA  . TYR B 1 224 ? 101.538 19.665  14.198  1.00 141.87 ? 148  TYR B CA  1 
ATOM   4746 C C   . TYR B 1 224 ? 101.838 18.158  14.389  1.00 146.83 ? 148  TYR B C   1 
ATOM   4747 O O   . TYR B 1 224 ? 100.979 17.423  14.886  1.00 144.90 ? 148  TYR B O   1 
ATOM   4748 C CB  . TYR B 1 224 ? 100.765 20.238  15.412  1.00 144.04 ? 148  TYR B CB  1 
ATOM   4749 C CG  . TYR B 1 224 ? 100.416 21.705  15.290  1.00 147.24 ? 148  TYR B CG  1 
ATOM   4750 C CD1 . TYR B 1 224 ? 101.346 22.692  15.600  1.00 152.44 ? 148  TYR B CD1 1 
ATOM   4751 C CD2 . TYR B 1 224 ? 99.130  22.107  14.943  1.00 146.14 ? 148  TYR B CD2 1 
ATOM   4752 C CE1 . TYR B 1 224 ? 101.027 24.045  15.494  1.00 154.62 ? 148  TYR B CE1 1 
ATOM   4753 C CE2 . TYR B 1 224 ? 98.799  23.455  14.828  1.00 148.01 ? 148  TYR B CE2 1 
ATOM   4754 C CZ  . TYR B 1 224 ? 99.750  24.423  15.109  1.00 159.47 ? 148  TYR B CZ  1 
ATOM   4755 O OH  . TYR B 1 224 ? 99.421  25.754  15.017  1.00 162.10 ? 148  TYR B OH  1 
ATOM   4756 N N   . PRO B 1 225 ? 103.046 17.673  13.996  1.00 146.02 ? 149  PRO B N   1 
ATOM   4757 C CA  . PRO B 1 225 ? 103.335 16.227  14.113  1.00 145.61 ? 149  PRO B CA  1 
ATOM   4758 C C   . PRO B 1 225 ? 103.387 15.724  15.568  1.00 150.98 ? 149  PRO B C   1 
ATOM   4759 O O   . PRO B 1 225 ? 103.128 14.541  15.801  1.00 149.57 ? 149  PRO B O   1 
ATOM   4760 C CB  . PRO B 1 225 ? 104.716 16.092  13.465  1.00 149.18 ? 149  PRO B CB  1 
ATOM   4761 C CG  . PRO B 1 225 ? 104.870 17.315  12.607  1.00 153.91 ? 149  PRO B CG  1 
ATOM   4762 C CD  . PRO B 1 225 ? 104.168 18.392  13.358  1.00 149.78 ? 149  PRO B CD  1 
ATOM   4763 N N   . PHE B 1 226 ? 103.741 16.616  16.534  1.00 149.87 ? 150  PHE B N   1 
ATOM   4764 C CA  . PHE B 1 226 ? 103.870 16.384  17.985  1.00 176.64 ? 150  PHE B CA  1 
ATOM   4765 C C   . PHE B 1 226 ? 105.095 15.502  18.277  1.00 203.01 ? 150  PHE B C   1 
ATOM   4766 O O   . PHE B 1 226 ? 105.282 14.431  17.701  1.00 161.95 ? 150  PHE B O   1 
ATOM   4767 C CB  . PHE B 1 226 ? 102.600 15.763  18.610  1.00 176.40 ? 150  PHE B CB  1 
ATOM   4768 N N   . TRP B 1 234 ? 92.448  14.312  26.760  1.00 145.59 ? 158  TRP B N   1 
ATOM   4769 C CA  . TRP B 1 234 ? 91.275  14.981  27.316  1.00 145.69 ? 158  TRP B CA  1 
ATOM   4770 C C   . TRP B 1 234 ? 90.373  15.596  26.235  1.00 145.32 ? 158  TRP B C   1 
ATOM   4771 O O   . TRP B 1 234 ? 89.177  15.741  26.485  1.00 144.18 ? 158  TRP B O   1 
ATOM   4772 C CB  . TRP B 1 234 ? 91.690  16.085  28.289  1.00 148.03 ? 158  TRP B CB  1 
ATOM   4773 C CG  . TRP B 1 234 ? 92.211  15.571  29.593  1.00 152.44 ? 158  TRP B CG  1 
ATOM   4774 C CD1 . TRP B 1 234 ? 93.460  15.088  29.842  1.00 157.30 ? 158  TRP B CD1 1 
ATOM   4775 C CD2 . TRP B 1 234 ? 91.525  15.582  30.855  1.00 154.13 ? 158  TRP B CD2 1 
ATOM   4776 N NE1 . TRP B 1 234 ? 93.583  14.753  31.173  1.00 159.58 ? 158  TRP B NE1 1 
ATOM   4777 C CE2 . TRP B 1 234 ? 92.414  15.056  31.820  1.00 161.04 ? 158  TRP B CE2 1 
ATOM   4778 C CE3 . TRP B 1 234 ? 90.233  15.961  31.260  1.00 154.89 ? 158  TRP B CE3 1 
ATOM   4779 C CZ2 . TRP B 1 234 ? 92.047  14.881  33.160  1.00 162.75 ? 158  TRP B CZ2 1 
ATOM   4780 C CZ3 . TRP B 1 234 ? 89.878  15.807  32.592  1.00 158.77 ? 158  TRP B CZ3 1 
ATOM   4781 C CH2 . TRP B 1 234 ? 90.779  15.277  33.527  1.00 162.32 ? 158  TRP B CH2 1 
ATOM   4782 N N   . GLN B 1 235 ? 90.926  15.964  25.051  1.00 138.98 ? 159  GLN B N   1 
ATOM   4783 C CA  . GLN B 1 235 ? 90.132  16.591  23.981  1.00 135.37 ? 159  GLN B CA  1 
ATOM   4784 C C   . GLN B 1 235 ? 88.965  15.677  23.505  1.00 133.17 ? 159  GLN B C   1 
ATOM   4785 O O   . GLN B 1 235 ? 87.890  16.197  23.248  1.00 131.37 ? 159  GLN B O   1 
ATOM   4786 C CB  . GLN B 1 235 ? 91.005  16.978  22.766  1.00 136.17 ? 159  GLN B CB  1 
ATOM   4787 C CG  . GLN B 1 235 ? 91.746  15.823  22.065  1.00 154.00 ? 159  GLN B CG  1 
ATOM   4788 C CD  . GLN B 1 235 ? 92.563  16.275  20.871  1.00 174.42 ? 159  GLN B CD  1 
ATOM   4789 O OE1 . GLN B 1 235 ? 93.049  17.411  20.796  1.00 171.19 ? 159  GLN B OE1 1 
ATOM   4790 N NE2 . GLN B 1 235 ? 92.812  15.359  19.947  1.00 165.70 ? 159  GLN B NE2 1 
ATOM   4791 N N   . ALA B 1 236 ? 89.164  14.348  23.413  1.00 126.71 ? 160  ALA B N   1 
ATOM   4792 C CA  . ALA B 1 236 ? 88.129  13.418  22.940  1.00 123.02 ? 160  ALA B CA  1 
ATOM   4793 C C   . ALA B 1 236 ? 87.007  13.214  23.972  1.00 124.08 ? 160  ALA B C   1 
ATOM   4794 O O   . ALA B 1 236 ? 85.856  13.063  23.574  1.00 121.55 ? 160  ALA B O   1 
ATOM   4795 C CB  . ALA B 1 236 ? 88.748  12.074  22.606  1.00 123.42 ? 160  ALA B CB  1 
ATOM   4796 N N   . SER B 1 237 ? 87.334  13.210  25.283  1.00 121.15 ? 161  SER B N   1 
ATOM   4797 C CA  . SER B 1 237 ? 86.364  12.987  26.361  1.00 120.62 ? 161  SER B CA  1 
ATOM   4798 C C   . SER B 1 237 ? 85.363  14.166  26.492  1.00 121.91 ? 161  SER B C   1 
ATOM   4799 O O   . SER B 1 237 ? 84.365  14.031  27.206  1.00 121.90 ? 161  SER B O   1 
ATOM   4800 C CB  . SER B 1 237 ? 87.078  12.768  27.691  1.00 126.87 ? 161  SER B CB  1 
ATOM   4801 O OG  . SER B 1 237 ? 87.837  13.904  28.066  1.00 137.77 ? 161  SER B OG  1 
ATOM   4802 N N   . TYR B 1 238 ? 85.603  15.293  25.777  1.00 115.99 ? 162  TYR B N   1 
ATOM   4803 C CA  . TYR B 1 238 ? 84.698  16.446  25.778  1.00 114.59 ? 162  TYR B CA  1 
ATOM   4804 C C   . TYR B 1 238 ? 84.112  16.686  24.361  1.00 112.31 ? 162  TYR B C   1 
ATOM   4805 O O   . TYR B 1 238 ? 82.941  17.060  24.266  1.00 110.86 ? 162  TYR B O   1 
ATOM   4806 C CB  . TYR B 1 238 ? 85.393  17.720  26.298  1.00 118.53 ? 162  TYR B CB  1 
ATOM   4807 C CG  . TYR B 1 238 ? 85.805  17.614  27.753  1.00 124.14 ? 162  TYR B CG  1 
ATOM   4808 C CD1 . TYR B 1 238 ? 84.904  17.897  28.778  1.00 127.57 ? 162  TYR B CD1 1 
ATOM   4809 C CD2 . TYR B 1 238 ? 87.089  17.215  28.107  1.00 126.81 ? 162  TYR B CD2 1 
ATOM   4810 C CE1 . TYR B 1 238 ? 85.267  17.763  30.118  1.00 131.40 ? 162  TYR B CE1 1 
ATOM   4811 C CE2 . TYR B 1 238 ? 87.462  17.075  29.443  1.00 130.78 ? 162  TYR B CE2 1 
ATOM   4812 C CZ  . TYR B 1 238 ? 86.549  17.353  30.446  1.00 140.21 ? 162  TYR B CZ  1 
ATOM   4813 O OH  . TYR B 1 238 ? 86.925  17.222  31.763  1.00 145.08 ? 162  TYR B OH  1 
ATOM   4814 N N   . ILE B 1 239 ? 84.890  16.420  23.273  1.00 104.86 ? 163  ILE B N   1 
ATOM   4815 C CA  . ILE B 1 239 ? 84.424  16.608  21.886  1.00 100.75 ? 163  ILE B CA  1 
ATOM   4816 C C   . ILE B 1 239 ? 83.370  15.533  21.546  1.00 99.40  ? 163  ILE B C   1 
ATOM   4817 O O   . ILE B 1 239 ? 82.327  15.895  21.013  1.00 98.07  ? 163  ILE B O   1 
ATOM   4818 C CB  . ILE B 1 239 ? 85.587  16.609  20.839  1.00 103.20 ? 163  ILE B CB  1 
ATOM   4819 C CG1 . ILE B 1 239 ? 86.446  17.896  20.988  1.00 105.35 ? 163  ILE B CG1 1 
ATOM   4820 C CG2 . ILE B 1 239 ? 85.043  16.515  19.399  1.00 101.43 ? 163  ILE B CG2 1 
ATOM   4821 C CD1 . ILE B 1 239 ? 87.702  17.996  20.067  1.00 112.36 ? 163  ILE B CD1 1 
ATOM   4822 N N   . VAL B 1 240 ? 83.620  14.243  21.866  1.00 93.20  ? 164  VAL B N   1 
ATOM   4823 C CA  . VAL B 1 240 ? 82.683  13.145  21.568  1.00 90.36  ? 164  VAL B CA  1 
ATOM   4824 C C   . VAL B 1 240 ? 81.286  13.437  22.233  1.00 93.07  ? 164  VAL B C   1 
ATOM   4825 O O   . VAL B 1 240 ? 80.308  13.415  21.481  1.00 91.01  ? 164  VAL B O   1 
ATOM   4826 C CB  . VAL B 1 240 ? 83.221  11.751  21.978  1.00 94.38  ? 164  VAL B CB  1 
ATOM   4827 C CG1 . VAL B 1 240 ? 82.146  10.677  21.836  1.00 92.97  ? 164  VAL B CG1 1 
ATOM   4828 C CG2 . VAL B 1 240 ? 84.458  11.380  21.163  1.00 93.77  ? 164  VAL B CG2 1 
ATOM   4829 N N   . PRO B 1 241 ? 81.138  13.768  23.562  1.00 90.45  ? 165  PRO B N   1 
ATOM   4830 C CA  . PRO B 1 241 ? 79.788  14.069  24.091  1.00 89.56  ? 165  PRO B CA  1 
ATOM   4831 C C   . PRO B 1 241 ? 79.163  15.301  23.431  1.00 90.80  ? 165  PRO B C   1 
ATOM   4832 O O   . PRO B 1 241 ? 77.958  15.313  23.200  1.00 89.13  ? 165  PRO B O   1 
ATOM   4833 C CB  . PRO B 1 241 ? 80.037  14.325  25.584  1.00 93.98  ? 165  PRO B CB  1 
ATOM   4834 C CG  . PRO B 1 241 ? 81.328  13.673  25.881  1.00 99.54  ? 165  PRO B CG  1 
ATOM   4835 C CD  . PRO B 1 241 ? 82.145  13.847  24.642  1.00 94.02  ? 165  PRO B CD  1 
ATOM   4836 N N   . LEU B 1 242 ? 79.991  16.311  23.093  1.00 87.46  ? 166  LEU B N   1 
ATOM   4837 C CA  . LEU B 1 242 ? 79.579  17.559  22.448  1.00 86.98  ? 166  LEU B CA  1 
ATOM   4838 C C   . LEU B 1 242 ? 79.055  17.312  21.017  1.00 88.70  ? 166  LEU B C   1 
ATOM   4839 O O   . LEU B 1 242 ? 78.107  17.977  20.605  1.00 88.50  ? 166  LEU B O   1 
ATOM   4840 C CB  . LEU B 1 242 ? 80.768  18.530  22.409  1.00 88.64  ? 166  LEU B CB  1 
ATOM   4841 C CG  . LEU B 1 242 ? 80.517  19.954  21.922  1.00 94.00  ? 166  LEU B CG  1 
ATOM   4842 C CD1 . LEU B 1 242 ? 79.680  20.743  22.937  1.00 96.00  ? 166  LEU B CD1 1 
ATOM   4843 C CD2 . LEU B 1 242 ? 81.833  20.677  21.702  1.00 97.78  ? 166  LEU B CD2 1 
ATOM   4844 N N   . VAL B 1 243 ? 79.672  16.374  20.264  1.00 83.38  ? 167  VAL B N   1 
ATOM   4845 C CA  . VAL B 1 243 ? 79.261  16.038  18.889  1.00 80.71  ? 167  VAL B CA  1 
ATOM   4846 C C   . VAL B 1 243 ? 77.874  15.355  18.938  1.00 82.90  ? 167  VAL B C   1 
ATOM   4847 O O   . VAL B 1 243 ? 77.015  15.671  18.112  1.00 81.07  ? 167  VAL B O   1 
ATOM   4848 C CB  . VAL B 1 243 ? 80.313  15.166  18.153  1.00 83.96  ? 167  VAL B CB  1 
ATOM   4849 C CG1 . VAL B 1 243 ? 79.789  14.686  16.809  1.00 82.05  ? 167  VAL B CG1 1 
ATOM   4850 C CG2 . VAL B 1 243 ? 81.613  15.933  17.955  1.00 84.54  ? 167  VAL B CG2 1 
ATOM   4851 N N   . TRP B 1 244 ? 77.647  14.469  19.932  1.00 80.22  ? 168  TRP B N   1 
ATOM   4852 C CA  . TRP B 1 244 ? 76.348  13.820  20.145  1.00 79.59  ? 168  TRP B CA  1 
ATOM   4853 C C   . TRP B 1 244 ? 75.322  14.828  20.695  1.00 87.65  ? 168  TRP B C   1 
ATOM   4854 O O   . TRP B 1 244 ? 74.118  14.642  20.514  1.00 86.25  ? 168  TRP B O   1 
ATOM   4855 C CB  . TRP B 1 244 ? 76.461  12.614  21.090  1.00 78.31  ? 168  TRP B CB  1 
ATOM   4856 C CG  . TRP B 1 244 ? 77.149  11.425  20.489  1.00 77.72  ? 168  TRP B CG  1 
ATOM   4857 C CD1 . TRP B 1 244 ? 78.440  11.034  20.686  1.00 81.19  ? 168  TRP B CD1 1 
ATOM   4858 C CD2 . TRP B 1 244 ? 76.590  10.503  19.547  1.00 75.67  ? 168  TRP B CD2 1 
ATOM   4859 N NE1 . TRP B 1 244 ? 78.704  9.894   19.968  1.00 79.48  ? 168  TRP B NE1 1 
ATOM   4860 C CE2 . TRP B 1 244 ? 77.590  9.556   19.243  1.00 79.43  ? 168  TRP B CE2 1 
ATOM   4861 C CE3 . TRP B 1 244 ? 75.335  10.388  18.922  1.00 75.44  ? 168  TRP B CE3 1 
ATOM   4862 C CZ2 . TRP B 1 244 ? 77.375  8.501   18.345  1.00 77.44  ? 168  TRP B CZ2 1 
ATOM   4863 C CZ3 . TRP B 1 244 ? 75.119  9.334   18.048  1.00 75.56  ? 168  TRP B CZ3 1 
ATOM   4864 C CH2 . TRP B 1 244 ? 76.134  8.415   17.755  1.00 76.11  ? 168  TRP B CH2 1 
ATOM   4865 N N   . CYS B 1 245 ? 75.803  15.896  21.350  1.00 88.45  ? 169  CYS B N   1 
ATOM   4866 C CA  . CYS B 1 245 ? 74.944  16.941  21.886  1.00 90.39  ? 169  CYS B CA  1 
ATOM   4867 C C   . CYS B 1 245 ? 74.427  17.825  20.741  1.00 93.94  ? 169  CYS B C   1 
ATOM   4868 O O   . CYS B 1 245 ? 73.229  18.096  20.693  1.00 93.13  ? 169  CYS B O   1 
ATOM   4869 C CB  . CYS B 1 245 ? 75.680  17.765  22.936  1.00 93.43  ? 169  CYS B CB  1 
ATOM   4870 S SG  . CYS B 1 245 ? 74.690  19.099  23.649  1.00 99.25  ? 169  CYS B SG  1 
ATOM   4871 N N   . MET B 1 246 ? 75.321  18.259  19.818  1.00 90.49  ? 170  MET B N   1 
ATOM   4872 C CA  . MET B 1 246 ? 74.964  19.103  18.668  1.00 89.01  ? 170  MET B CA  1 
ATOM   4873 C C   . MET B 1 246 ? 74.077  18.351  17.678  1.00 88.86  ? 170  MET B C   1 
ATOM   4874 O O   . MET B 1 246 ? 73.239  18.975  17.034  1.00 87.42  ? 170  MET B O   1 
ATOM   4875 C CB  . MET B 1 246 ? 76.212  19.618  17.941  1.00 91.61  ? 170  MET B CB  1 
ATOM   4876 C CG  . MET B 1 246 ? 77.043  20.583  18.763  1.00 97.83  ? 170  MET B CG  1 
ATOM   4877 S SD  . MET B 1 246 ? 78.494  21.208  17.859  1.00 102.81 ? 170  MET B SD  1 
ATOM   4878 C CE  . MET B 1 246 ? 79.467  19.703  17.681  1.00 98.95  ? 170  MET B CE  1 
ATOM   4879 N N   . ALA B 1 247 ? 74.276  17.024  17.533  1.00 83.81  ? 171  ALA B N   1 
ATOM   4880 C CA  . ALA B 1 247 ? 73.458  16.187  16.648  1.00 81.99  ? 171  ALA B CA  1 
ATOM   4881 C C   . ALA B 1 247 ? 72.033  16.037  17.209  1.00 86.56  ? 171  ALA B C   1 
ATOM   4882 O O   . ALA B 1 247 ? 71.059  15.986  16.450  1.00 85.48  ? 171  ALA B O   1 
ATOM   4883 C CB  . ALA B 1 247 ? 74.106  14.823  16.467  1.00 82.07  ? 171  ALA B CB  1 
ATOM   4884 N N   . CYS B 1 248 ? 71.927  16.013  18.546  1.00 84.36  ? 172  CYS B N   1 
ATOM   4885 C CA  . CYS B 1 248 ? 70.689  15.898  19.301  1.00 84.73  ? 172  CYS B CA  1 
ATOM   4886 C C   . CYS B 1 248 ? 69.869  17.195  19.184  1.00 87.56  ? 172  CYS B C   1 
ATOM   4887 O O   . CYS B 1 248 ? 68.651  17.123  19.044  1.00 87.76  ? 172  CYS B O   1 
ATOM   4888 C CB  . CYS B 1 248 ? 71.004  15.571  20.755  1.00 87.36  ? 172  CYS B CB  1 
ATOM   4889 S SG  . CYS B 1 248 ? 69.552  15.414  21.815  1.00 92.97  ? 172  CYS B SG  1 
ATOM   4890 N N   . LEU B 1 249 ? 70.529  18.366  19.245  1.00 83.24  ? 173  LEU B N   1 
ATOM   4891 C CA  . LEU B 1 249 ? 69.883  19.682  19.138  1.00 82.97  ? 173  LEU B CA  1 
ATOM   4892 C C   . LEU B 1 249 ? 69.438  19.971  17.699  1.00 83.85  ? 173  LEU B C   1 
ATOM   4893 O O   . LEU B 1 249 ? 68.433  20.654  17.499  1.00 83.71  ? 173  LEU B O   1 
ATOM   4894 C CB  . LEU B 1 249 ? 70.826  20.806  19.619  1.00 84.28  ? 173  LEU B CB  1 
ATOM   4895 C CG  . LEU B 1 249 ? 71.323  20.742  21.067  1.00 91.11  ? 173  LEU B CG  1 
ATOM   4896 C CD1 . LEU B 1 249 ? 72.338  21.826  21.336  1.00 92.65  ? 173  LEU B CD1 1 
ATOM   4897 C CD2 . LEU B 1 249 ? 70.176  20.823  22.068  1.00 95.27  ? 173  LEU B CD2 1 
ATOM   4898 N N   . SER B 1 250 ? 70.195  19.466  16.702  1.00 77.81  ? 174  SER B N   1 
ATOM   4899 C CA  . SER B 1 250 ? 69.905  19.654  15.277  1.00 75.54  ? 174  SER B CA  1 
ATOM   4900 C C   . SER B 1 250 ? 68.731  18.785  14.828  1.00 77.44  ? 174  SER B C   1 
ATOM   4901 O O   . SER B 1 250 ? 68.127  19.060  13.787  1.00 74.97  ? 174  SER B O   1 
ATOM   4902 C CB  . SER B 1 250 ? 71.134  19.323  14.440  1.00 77.82  ? 174  SER B CB  1 
ATOM   4903 O OG  . SER B 1 250 ? 72.232  20.152  14.780  1.00 86.84  ? 174  SER B OG  1 
ATOM   4904 N N   . SER B 1 251 ? 68.419  17.732  15.613  1.00 75.29  ? 175  SER B N   1 
ATOM   4905 C CA  . SER B 1 251 ? 67.350  16.779  15.329  1.00 75.16  ? 175  SER B CA  1 
ATOM   4906 C C   . SER B 1 251 ? 66.056  17.114  16.111  1.00 80.50  ? 175  SER B C   1 
ATOM   4907 O O   . SER B 1 251 ? 65.068  16.388  15.963  1.00 80.67  ? 175  SER B O   1 
ATOM   4908 C CB  . SER B 1 251 ? 67.801  15.359  15.663  1.00 79.21  ? 175  SER B CB  1 
ATOM   4909 O OG  . SER B 1 251 ? 68.100  15.221  17.041  1.00 92.59  ? 175  SER B OG  1 
ATOM   4910 N N   . LEU B 1 252 ? 66.049  18.217  16.917  1.00 77.44  ? 176  LEU B N   1 
ATOM   4911 C CA  . LEU B 1 252 ? 64.865  18.663  17.684  1.00 77.49  ? 176  LEU B CA  1 
ATOM   4912 C C   . LEU B 1 252 ? 63.728  19.153  16.739  1.00 79.08  ? 176  LEU B C   1 
ATOM   4913 O O   . LEU B 1 252 ? 62.588  18.745  16.979  1.00 78.61  ? 176  LEU B O   1 
ATOM   4914 C CB  . LEU B 1 252 ? 65.198  19.767  18.705  1.00 78.80  ? 176  LEU B CB  1 
ATOM   4915 C CG  . LEU B 1 252 ? 66.002  19.339  19.931  1.00 84.35  ? 176  LEU B CG  1 
ATOM   4916 C CD1 . LEU B 1 252 ? 66.437  20.536  20.737  1.00 85.87  ? 176  LEU B CD1 1 
ATOM   4917 C CD2 . LEU B 1 252 ? 65.208  18.369  20.808  1.00 87.86  ? 176  LEU B CD2 1 
ATOM   4918 N N   . PRO B 1 253 ? 63.974  19.949  15.648  1.00 73.95  ? 177  PRO B N   1 
ATOM   4919 C CA  . PRO B 1 253 ? 62.852  20.336  14.762  1.00 73.12  ? 177  PRO B CA  1 
ATOM   4920 C C   . PRO B 1 253 ? 62.139  19.114  14.149  1.00 75.30  ? 177  PRO B C   1 
ATOM   4921 O O   . PRO B 1 253 ? 60.944  19.188  13.886  1.00 75.15  ? 177  PRO B O   1 
ATOM   4922 C CB  . PRO B 1 253 ? 63.531  21.175  13.675  1.00 74.12  ? 177  PRO B CB  1 
ATOM   4923 C CG  . PRO B 1 253 ? 64.787  21.671  14.307  1.00 79.06  ? 177  PRO B CG  1 
ATOM   4924 C CD  . PRO B 1 253 ? 65.244  20.549  15.180  1.00 74.83  ? 177  PRO B CD  1 
ATOM   4925 N N   . THR B 1 254 ? 62.862  17.983  13.966  1.00 70.08  ? 178  THR B N   1 
ATOM   4926 C CA  . THR B 1 254 ? 62.301  16.730  13.454  1.00 68.51  ? 178  THR B CA  1 
ATOM   4927 C C   . THR B 1 254 ? 61.342  16.148  14.478  1.00 73.46  ? 178  THR B C   1 
ATOM   4928 O O   . THR B 1 254 ? 60.225  15.793  14.129  1.00 73.87  ? 178  THR B O   1 
ATOM   4929 C CB  . THR B 1 254 ? 63.412  15.734  13.111  1.00 74.51  ? 178  THR B CB  1 
ATOM   4930 O OG1 . THR B 1 254 ? 64.381  16.350  12.272  1.00 76.06  ? 178  THR B OG1 1 
ATOM   4931 C CG2 . THR B 1 254 ? 62.886  14.484  12.469  1.00 70.90  ? 178  THR B CG2 1 
ATOM   4932 N N   . PHE B 1 255 ? 61.768  16.073  15.750  1.00 70.78  ? 179  PHE B N   1 
ATOM   4933 C CA  . PHE B 1 255 ? 60.950  15.541  16.839  1.00 71.77  ? 179  PHE B CA  1 
ATOM   4934 C C   . PHE B 1 255 ? 59.712  16.393  17.075  1.00 77.31  ? 179  PHE B C   1 
ATOM   4935 O O   . PHE B 1 255 ? 58.674  15.869  17.480  1.00 77.76  ? 179  PHE B O   1 
ATOM   4936 C CB  . PHE B 1 255 ? 61.780  15.470  18.133  1.00 74.14  ? 179  PHE B CB  1 
ATOM   4937 C CG  . PHE B 1 255 ? 61.036  14.911  19.322  1.00 76.91  ? 179  PHE B CG  1 
ATOM   4938 C CD1 . PHE B 1 255 ? 60.875  13.538  19.480  1.00 79.71  ? 179  PHE B CD1 1 
ATOM   4939 C CD2 . PHE B 1 255 ? 60.539  15.753  20.310  1.00 80.29  ? 179  PHE B CD2 1 
ATOM   4940 C CE1 . PHE B 1 255 ? 60.189  13.020  20.581  1.00 82.07  ? 179  PHE B CE1 1 
ATOM   4941 C CE2 . PHE B 1 255 ? 59.848  15.234  21.409  1.00 84.79  ? 179  PHE B CE2 1 
ATOM   4942 C CZ  . PHE B 1 255 ? 59.684  13.871  21.539  1.00 82.87  ? 179  PHE B CZ  1 
ATOM   4943 N N   . TYR B 1 256 ? 59.837  17.706  16.836  1.00 74.62  ? 180  TYR B N   1 
ATOM   4944 C CA  . TYR B 1 256 ? 58.804  18.691  17.098  1.00 75.80  ? 180  TYR B CA  1 
ATOM   4945 C C   . TYR B 1 256 ? 57.742  18.699  15.989  1.00 79.04  ? 180  TYR B C   1 
ATOM   4946 O O   . TYR B 1 256 ? 56.556  18.820  16.307  1.00 80.32  ? 180  TYR B O   1 
ATOM   4947 C CB  . TYR B 1 256 ? 59.450  20.086  17.230  1.00 77.83  ? 180  TYR B CB  1 
ATOM   4948 C CG  . TYR B 1 256 ? 58.577  21.109  17.918  1.00 82.44  ? 180  TYR B CG  1 
ATOM   4949 C CD1 . TYR B 1 256 ? 58.544  21.205  19.308  1.00 86.11  ? 180  TYR B CD1 1 
ATOM   4950 C CD2 . TYR B 1 256 ? 57.822  22.019  17.184  1.00 84.03  ? 180  TYR B CD2 1 
ATOM   4951 C CE1 . TYR B 1 256 ? 57.739  22.147  19.951  1.00 88.89  ? 180  TYR B CE1 1 
ATOM   4952 C CE2 . TYR B 1 256 ? 57.009  22.965  17.816  1.00 86.89  ? 180  TYR B CE2 1 
ATOM   4953 C CZ  . TYR B 1 256 ? 56.974  23.028  19.201  1.00 96.30  ? 180  TYR B CZ  1 
ATOM   4954 O OH  . TYR B 1 256 ? 56.176  23.956  19.833  1.00 99.16  ? 180  TYR B OH  1 
ATOM   4955 N N   . PHE B 1 257 ? 58.136  18.551  14.704  1.00 73.58  ? 181  PHE B N   1 
ATOM   4956 C CA  . PHE B 1 257 ? 57.147  18.652  13.630  1.00 73.04  ? 181  PHE B CA  1 
ATOM   4957 C C   . PHE B 1 257 ? 56.811  17.274  12.967  1.00 75.57  ? 181  PHE B C   1 
ATOM   4958 O O   . PHE B 1 257 ? 55.709  17.175  12.413  1.00 75.93  ? 181  PHE B O   1 
ATOM   4959 C CB  . PHE B 1 257 ? 57.608  19.636  12.538  1.00 73.97  ? 181  PHE B CB  1 
ATOM   4960 C CG  . PHE B 1 257 ? 57.774  21.054  13.049  1.00 76.02  ? 181  PHE B CG  1 
ATOM   4961 C CD1 . PHE B 1 257 ? 56.666  21.854  13.303  1.00 79.95  ? 181  PHE B CD1 1 
ATOM   4962 C CD2 . PHE B 1 257 ? 59.037  21.603  13.229  1.00 77.65  ? 181  PHE B CD2 1 
ATOM   4963 C CE1 . PHE B 1 257 ? 56.819  23.153  13.792  1.00 81.65  ? 181  PHE B CE1 1 
ATOM   4964 C CE2 . PHE B 1 257 ? 59.189  22.906  13.707  1.00 81.39  ? 181  PHE B CE2 1 
ATOM   4965 C CZ  . PHE B 1 257 ? 58.079  23.675  13.980  1.00 80.65  ? 181  PHE B CZ  1 
ATOM   4966 N N   . ARG B 1 258 ? 57.689  16.225  13.036  1.00 69.63  ? 182  ARG B N   1 
ATOM   4967 C CA  . ARG B 1 258 ? 57.327  14.909  12.451  1.00 68.81  ? 182  ARG B CA  1 
ATOM   4968 C C   . ARG B 1 258 ? 56.119  14.303  13.169  1.00 73.66  ? 182  ARG B C   1 
ATOM   4969 O O   . ARG B 1 258 ? 56.145  14.153  14.391  1.00 74.76  ? 182  ARG B O   1 
ATOM   4970 C CB  . ARG B 1 258 ? 58.488  13.889  12.470  1.00 67.00  ? 182  ARG B CB  1 
ATOM   4971 C CG  . ARG B 1 258 ? 59.494  14.026  11.330  1.00 68.84  ? 182  ARG B CG  1 
ATOM   4972 C CD  . ARG B 1 258 ? 58.895  13.623  9.999   1.00 63.36  ? 182  ARG B CD  1 
ATOM   4973 N NE  . ARG B 1 258 ? 59.822  13.838  8.896   1.00 59.15  ? 182  ARG B NE  1 
ATOM   4974 C CZ  . ARG B 1 258 ? 59.487  13.710  7.619   1.00 78.33  ? 182  ARG B CZ  1 
ATOM   4975 N NH1 . ARG B 1 258 ? 58.245  13.398  7.280   1.00 69.33  ? 182  ARG B NH1 1 
ATOM   4976 N NH2 . ARG B 1 258 ? 60.379  13.936  6.669   1.00 69.78  ? 182  ARG B NH2 1 
ATOM   4977 N N   . ASP B 1 259 ? 55.040  14.005  12.414  1.00 69.05  ? 183  ASP B N   1 
ATOM   4978 C CA  . ASP B 1 259 ? 53.822  13.422  12.983  1.00 69.66  ? 183  ASP B CA  1 
ATOM   4979 C C   . ASP B 1 259 ? 52.993  12.756  11.881  1.00 72.77  ? 183  ASP B C   1 
ATOM   4980 O O   . ASP B 1 259 ? 53.123  13.125  10.709  1.00 71.41  ? 183  ASP B O   1 
ATOM   4981 C CB  . ASP B 1 259 ? 52.996  14.503  13.713  1.00 72.65  ? 183  ASP B CB  1 
ATOM   4982 C CG  . ASP B 1 259 ? 51.887  13.974  14.602  1.00 80.87  ? 183  ASP B CG  1 
ATOM   4983 O OD1 . ASP B 1 259 ? 52.102  12.926  15.263  1.00 79.75  ? 183  ASP B OD1 1 
ATOM   4984 O OD2 . ASP B 1 259 ? 50.861  14.675  14.745  1.00 88.50  ? 183  ASP B OD2 1 
ATOM   4985 N N   . VAL B 1 260 ? 52.165  11.757  12.252  1.00 70.01  ? 184  VAL B N   1 
ATOM   4986 C CA  . VAL B 1 260 ? 51.295  11.037  11.318  1.00 69.85  ? 184  VAL B CA  1 
ATOM   4987 C C   . VAL B 1 260 ? 50.044  11.878  11.070  1.00 75.32  ? 184  VAL B C   1 
ATOM   4988 O O   . VAL B 1 260 ? 49.365  12.273  12.017  1.00 75.95  ? 184  VAL B O   1 
ATOM   4989 C CB  . VAL B 1 260 ? 50.947  9.611   11.827  1.00 74.07  ? 184  VAL B CB  1 
ATOM   4990 C CG1 . VAL B 1 260 ? 49.819  8.981   11.028  1.00 74.80  ? 184  VAL B CG1 1 
ATOM   4991 C CG2 . VAL B 1 260 ? 52.169  8.715   11.796  1.00 72.87  ? 184  VAL B CG2 1 
ATOM   4992 N N   . ARG B 1 261 ? 49.770  12.178  9.790   1.00 72.49  ? 185  ARG B N   1 
ATOM   4993 C CA  . ARG B 1 261 ? 48.596  12.935  9.355   1.00 73.88  ? 185  ARG B CA  1 
ATOM   4994 C C   . ARG B 1 261 ? 47.954  12.235  8.157   1.00 81.92  ? 185  ARG B C   1 
ATOM   4995 O O   . ARG B 1 261 ? 48.662  11.720  7.283   1.00 80.12  ? 185  ARG B O   1 
ATOM   4996 C CB  . ARG B 1 261 ? 48.940  14.400  9.022   1.00 70.31  ? 185  ARG B CB  1 
ATOM   4997 C CG  . ARG B 1 261 ? 49.474  15.220  10.207  1.00 74.43  ? 185  ARG B CG  1 
ATOM   4998 C CD  . ARG B 1 261 ? 48.452  15.435  11.318  1.00 71.00  ? 185  ARG B CD  1 
ATOM   4999 N NE  . ARG B 1 261 ? 49.053  16.063  12.498  1.00 75.58  ? 185  ARG B NE  1 
ATOM   5000 C CZ  . ARG B 1 261 ? 49.172  17.377  12.677  1.00 96.18  ? 185  ARG B CZ  1 
ATOM   5001 N NH1 . ARG B 1 261 ? 49.734  17.854  13.779  1.00 87.65  ? 185  ARG B NH1 1 
ATOM   5002 N NH2 . ARG B 1 261 ? 48.737  18.223  11.750  1.00 85.37  ? 185  ARG B NH2 1 
ATOM   5003 N N   . THR B 1 262 ? 46.608  12.191  8.137   1.00 82.94  ? 186  THR B N   1 
ATOM   5004 C CA  . THR B 1 262 ? 45.859  11.528  7.081   1.00 84.67  ? 186  THR B CA  1 
ATOM   5005 C C   . THR B 1 262 ? 45.851  12.421  5.835   1.00 89.46  ? 186  THR B C   1 
ATOM   5006 O O   . THR B 1 262 ? 45.444  13.586  5.900   1.00 89.12  ? 186  THR B O   1 
ATOM   5007 C CB  . THR B 1 262 ? 44.434  11.182  7.556   1.00 100.27 ? 186  THR B CB  1 
ATOM   5008 O OG1 . THR B 1 262 ? 43.714  12.383  7.829   1.00 106.95 ? 186  THR B OG1 1 
ATOM   5009 C CG2 . THR B 1 262 ? 44.425  10.284  8.788   1.00 98.74  ? 186  THR B CG2 1 
ATOM   5010 N N   . ILE B 1 263 ? 46.356  11.880  4.715   1.00 86.90  ? 187  ILE B N   1 
ATOM   5011 C CA  . ILE B 1 263 ? 46.380  12.565  3.422   1.00 87.01  ? 187  ILE B CA  1 
ATOM   5012 C C   . ILE B 1 263 ? 45.088  12.164  2.719   1.00 94.85  ? 187  ILE B C   1 
ATOM   5013 O O   . ILE B 1 263 ? 45.018  11.083  2.132   1.00 94.98  ? 187  ILE B O   1 
ATOM   5014 C CB  . ILE B 1 263 ? 47.676  12.234  2.620   1.00 88.23  ? 187  ILE B CB  1 
ATOM   5015 C CG1 . ILE B 1 263 ? 48.985  12.397  3.494   1.00 86.72  ? 187  ILE B CG1 1 
ATOM   5016 C CG2 . ILE B 1 263 ? 47.738  13.014  1.302   1.00 88.88  ? 187  ILE B CG2 1 
ATOM   5017 C CD1 . ILE B 1 263 ? 49.303  13.827  4.147   1.00 93.36  ? 187  ILE B CD1 1 
ATOM   5018 N N   . GLU B 1 264 ? 44.038  13.002  2.872   1.00 93.99  ? 188  GLU B N   1 
ATOM   5019 C CA  . GLU B 1 264 ? 42.656  12.774  2.430   1.00 96.68  ? 188  GLU B CA  1 
ATOM   5020 C C   . GLU B 1 264 ? 42.540  12.322  0.960   1.00 101.98 ? 188  GLU B C   1 
ATOM   5021 O O   . GLU B 1 264 ? 41.763  11.404  0.690   1.00 102.96 ? 188  GLU B O   1 
ATOM   5022 C CB  . GLU B 1 264 ? 41.825  14.050  2.602   1.00 99.12  ? 188  GLU B CB  1 
ATOM   5023 N N   . TYR B 1 265 ? 43.284  12.951  0.022   1.00 98.44  ? 189  TYR B N   1 
ATOM   5024 C CA  . TYR B 1 265 ? 43.172  12.614  -1.403  1.00 99.63  ? 189  TYR B CA  1 
ATOM   5025 C C   . TYR B 1 265 ? 43.913  11.294  -1.748  1.00 102.08 ? 189  TYR B C   1 
ATOM   5026 O O   . TYR B 1 265 ? 43.769  10.803  -2.872  1.00 102.98 ? 189  TYR B O   1 
ATOM   5027 C CB  . TYR B 1 265 ? 43.696  13.751  -2.301  1.00 101.01 ? 189  TYR B CB  1 
ATOM   5028 C CG  . TYR B 1 265 ? 45.141  14.150  -2.089  1.00 101.44 ? 189  TYR B CG  1 
ATOM   5029 C CD1 . TYR B 1 265 ? 45.481  15.157  -1.190  1.00 102.93 ? 189  TYR B CD1 1 
ATOM   5030 C CD2 . TYR B 1 265 ? 46.157  13.604  -2.869  1.00 101.19 ? 189  TYR B CD2 1 
ATOM   5031 C CE1 . TYR B 1 265 ? 46.805  15.565  -1.025  1.00 102.25 ? 189  TYR B CE1 1 
ATOM   5032 C CE2 . TYR B 1 265 ? 47.485  14.004  -2.713  1.00 100.28 ? 189  TYR B CE2 1 
ATOM   5033 C CZ  . TYR B 1 265 ? 47.804  14.984  -1.786  1.00 107.84 ? 189  TYR B CZ  1 
ATOM   5034 O OH  . TYR B 1 265 ? 49.108  15.386  -1.622  1.00 107.82 ? 189  TYR B OH  1 
ATOM   5035 N N   . LEU B 1 266 ? 44.661  10.709  -0.790  1.00 95.85  ? 190  LEU B N   1 
ATOM   5036 C CA  . LEU B 1 266 ? 45.358  9.431   -0.992  1.00 94.01  ? 190  LEU B CA  1 
ATOM   5037 C C   . LEU B 1 266 ? 44.790  8.337   -0.075  1.00 98.11  ? 190  LEU B C   1 
ATOM   5038 O O   . LEU B 1 266 ? 45.020  7.146   -0.326  1.00 98.30  ? 190  LEU B O   1 
ATOM   5039 C CB  . LEU B 1 266 ? 46.871  9.567   -0.754  1.00 91.02  ? 190  LEU B CB  1 
ATOM   5040 C CG  . LEU B 1 266 ? 47.673  10.383  -1.758  1.00 93.50  ? 190  LEU B CG  1 
ATOM   5041 C CD1 . LEU B 1 266 ? 49.080  10.600  -1.260  1.00 91.32  ? 190  LEU B CD1 1 
ATOM   5042 C CD2 . LEU B 1 266 ? 47.683  9.728   -3.135  1.00 95.04  ? 190  LEU B CD2 1 
ATOM   5043 N N   . GLY B 1 267 ? 44.051  8.755   0.961   1.00 94.09  ? 191  GLY B N   1 
ATOM   5044 C CA  . GLY B 1 267 ? 43.450  7.873   1.962   1.00 94.10  ? 191  GLY B CA  1 
ATOM   5045 C C   . GLY B 1 267 ? 44.495  7.048   2.683   1.00 93.73  ? 191  GLY B C   1 
ATOM   5046 O O   . GLY B 1 267 ? 44.288  5.857   2.936   1.00 94.25  ? 191  GLY B O   1 
ATOM   5047 N N   . VAL B 1 268 ? 45.640  7.684   2.997   1.00 85.64  ? 192  VAL B N   1 
ATOM   5048 C CA  . VAL B 1 268 ? 46.786  7.020   3.584   1.00 82.67  ? 192  VAL B CA  1 
ATOM   5049 C C   . VAL B 1 268 ? 47.305  7.850   4.795   1.00 83.84  ? 192  VAL B C   1 
ATOM   5050 O O   . VAL B 1 268 ? 47.204  9.077   4.791   1.00 83.11  ? 192  VAL B O   1 
ATOM   5051 C CB  . VAL B 1 268 ? 47.866  6.837   2.464   1.00 84.72  ? 192  VAL B CB  1 
ATOM   5052 C CG1 . VAL B 1 268 ? 48.613  8.128   2.147   1.00 82.79  ? 192  VAL B CG1 1 
ATOM   5053 C CG2 . VAL B 1 268 ? 48.846  5.761   2.812   1.00 83.63  ? 192  VAL B CG2 1 
ATOM   5054 N N   . ASN B 1 269 ? 47.810  7.172   5.837   1.00 79.38  ? 193  ASN B N   1 
ATOM   5055 C CA  . ASN B 1 269 ? 48.371  7.849   7.003   1.00 78.21  ? 193  ASN B CA  1 
ATOM   5056 C C   . ASN B 1 269 ? 49.862  7.982   6.812   1.00 80.18  ? 193  ASN B C   1 
ATOM   5057 O O   . ASN B 1 269 ? 50.593  6.999   6.961   1.00 80.21  ? 193  ASN B O   1 
ATOM   5058 C CB  . ASN B 1 269 ? 48.034  7.122   8.315   1.00 80.39  ? 193  ASN B CB  1 
ATOM   5059 C CG  . ASN B 1 269 ? 46.578  7.181   8.718   1.00 103.82 ? 193  ASN B CG  1 
ATOM   5060 O OD1 . ASN B 1 269 ? 45.688  7.466   7.921   1.00 94.64  ? 193  ASN B OD1 1 
ATOM   5061 N ND2 . ASN B 1 269 ? 46.299  6.880   9.974   1.00 98.31  ? 193  ASN B ND2 1 
ATOM   5062 N N   . ALA B 1 270 ? 50.316  9.188   6.432   1.00 74.15  ? 194  ALA B N   1 
ATOM   5063 C CA  . ALA B 1 270 ? 51.722  9.445   6.150   1.00 71.11  ? 194  ALA B CA  1 
ATOM   5064 C C   . ALA B 1 270 ? 52.418  10.142  7.319   1.00 73.55  ? 194  ALA B C   1 
ATOM   5065 O O   . ALA B 1 270 ? 51.826  11.001  7.976   1.00 72.98  ? 194  ALA B O   1 
ATOM   5066 C CB  . ALA B 1 270 ? 51.848  10.293  4.900   1.00 70.98  ? 194  ALA B CB  1 
ATOM   5067 N N   . CYS B 1 271 ? 53.686  9.751   7.566   1.00 69.29  ? 195  CYS B N   1 
ATOM   5068 C CA  . CYS B 1 271 ? 54.579  10.324  8.576   1.00 68.48  ? 195  CYS B CA  1 
ATOM   5069 C C   . CYS B 1 271 ? 55.207  11.575  7.971   1.00 72.48  ? 195  CYS B C   1 
ATOM   5070 O O   . CYS B 1 271 ? 56.287  11.506  7.379   1.00 72.46  ? 195  CYS B O   1 
ATOM   5071 C CB  . CYS B 1 271 ? 55.616  9.286   9.017   1.00 68.22  ? 195  CYS B CB  1 
ATOM   5072 S SG  . CYS B 1 271 ? 56.879  9.895   10.170  1.00 71.32  ? 195  CYS B SG  1 
ATOM   5073 N N   . ILE B 1 272 ? 54.463  12.697  8.008   1.00 68.66  ? 196  ILE B N   1 
ATOM   5074 C CA  . ILE B 1 272 ? 54.877  13.947  7.367   1.00 67.41  ? 196  ILE B CA  1 
ATOM   5075 C C   . ILE B 1 272 ? 55.510  14.913  8.374   1.00 70.86  ? 196  ILE B C   1 
ATOM   5076 O O   . ILE B 1 272 ? 55.591  14.630  9.569   1.00 71.37  ? 196  ILE B O   1 
ATOM   5077 C CB  . ILE B 1 272 ? 53.682  14.658  6.648   1.00 71.19  ? 196  ILE B CB  1 
ATOM   5078 C CG1 . ILE B 1 272 ? 52.621  15.174  7.656   1.00 72.75  ? 196  ILE B CG1 1 
ATOM   5079 C CG2 . ILE B 1 272 ? 53.069  13.760  5.557   1.00 72.17  ? 196  ILE B CG2 1 
ATOM   5080 C CD1 . ILE B 1 272 ? 51.630  16.149  7.081   1.00 82.57  ? 196  ILE B CD1 1 
ATOM   5081 N N   . MET B 1 273 ? 55.923  16.077  7.860   1.00 66.20  ? 197  MET B N   1 
ATOM   5082 C CA  . MET B 1 273 ? 56.478  17.182  8.617   1.00 65.48  ? 197  MET B CA  1 
ATOM   5083 C C   . MET B 1 273 ? 55.322  18.131  8.883   1.00 70.62  ? 197  MET B C   1 
ATOM   5084 O O   . MET B 1 273 ? 55.023  19.000  8.056   1.00 70.38  ? 197  MET B O   1 
ATOM   5085 C CB  . MET B 1 273 ? 57.646  17.810  7.819   1.00 66.66  ? 197  MET B CB  1 
ATOM   5086 C CG  . MET B 1 273 ? 58.682  18.485  8.668   1.00 69.61  ? 197  MET B CG  1 
ATOM   5087 S SD  . MET B 1 273 ? 59.685  17.337  9.636   1.00 72.59  ? 197  MET B SD  1 
ATOM   5088 C CE  . MET B 1 273 ? 60.690  18.489  10.515  1.00 69.57  ? 197  MET B CE  1 
ATOM   5089 N N   . ALA B 1 274 ? 54.563  17.853  9.957   1.00 68.27  ? 198  ALA B N   1 
ATOM   5090 C CA  . ALA B 1 274 ? 53.336  18.573  10.318  1.00 69.16  ? 198  ALA B CA  1 
ATOM   5091 C C   . ALA B 1 274 ? 53.638  20.019  10.838  1.00 72.48  ? 198  ALA B C   1 
ATOM   5092 O O   . ALA B 1 274 ? 53.466  20.305  12.028  1.00 71.98  ? 198  ALA B O   1 
ATOM   5093 C CB  . ALA B 1 274 ? 52.565  17.781  11.374  1.00 71.02  ? 198  ALA B CB  1 
ATOM   5094 N N   . PHE B 1 275 ? 54.057  20.927  9.919   1.00 69.76  ? 199  PHE B N   1 
ATOM   5095 C CA  . PHE B 1 275 ? 54.359  22.340  10.222  1.00 70.58  ? 199  PHE B CA  1 
ATOM   5096 C C   . PHE B 1 275 ? 53.109  23.163  10.512  1.00 77.48  ? 199  PHE B C   1 
ATOM   5097 O O   . PHE B 1 275 ? 52.025  22.763  10.066  1.00 77.66  ? 199  PHE B O   1 
ATOM   5098 C CB  . PHE B 1 275 ? 55.093  23.017  9.054   1.00 71.58  ? 199  PHE B CB  1 
ATOM   5099 C CG  . PHE B 1 275 ? 56.433  22.478  8.658   1.00 72.23  ? 199  PHE B CG  1 
ATOM   5100 C CD1 . PHE B 1 275 ? 57.520  22.582  9.519   1.00 75.84  ? 199  PHE B CD1 1 
ATOM   5101 C CD2 . PHE B 1 275 ? 56.672  22.070  7.352   1.00 73.86  ? 199  PHE B CD2 1 
ATOM   5102 C CE1 . PHE B 1 275 ? 58.788  22.159  9.123   1.00 75.91  ? 199  PHE B CE1 1 
ATOM   5103 C CE2 . PHE B 1 275 ? 57.945  21.664  6.949   1.00 75.84  ? 199  PHE B CE2 1 
ATOM   5104 C CZ  . PHE B 1 275 ? 58.998  21.726  7.832   1.00 73.94  ? 199  PHE B CZ  1 
ATOM   5105 N N   . PRO B 1 276 ? 53.227  24.370  11.144  1.00 75.81  ? 200  PRO B N   1 
ATOM   5106 C CA  . PRO B 1 276 ? 52.029  25.207  11.340  1.00 77.89  ? 200  PRO B CA  1 
ATOM   5107 C C   . PRO B 1 276 ? 51.377  25.517  9.990   1.00 84.22  ? 200  PRO B C   1 
ATOM   5108 O O   . PRO B 1 276 ? 52.080  25.958  9.079   1.00 83.46  ? 200  PRO B O   1 
ATOM   5109 C CB  . PRO B 1 276 ? 52.575  26.463  12.033  1.00 79.99  ? 200  PRO B CB  1 
ATOM   5110 C CG  . PRO B 1 276 ? 53.845  26.029  12.659  1.00 83.05  ? 200  PRO B CG  1 
ATOM   5111 C CD  . PRO B 1 276 ? 54.424  25.023  11.711  1.00 76.94  ? 200  PRO B CD  1 
ATOM   5112 N N   . PRO B 1 277 ? 50.078  25.178  9.792   1.00 82.64  ? 201  PRO B N   1 
ATOM   5113 C CA  . PRO B 1 277 ? 49.466  25.356  8.461   1.00 82.88  ? 201  PRO B CA  1 
ATOM   5114 C C   . PRO B 1 277 ? 49.446  26.814  7.995   1.00 88.82  ? 201  PRO B C   1 
ATOM   5115 O O   . PRO B 1 277 ? 49.585  27.053  6.791   1.00 88.67  ? 201  PRO B O   1 
ATOM   5116 C CB  . PRO B 1 277 ? 48.038  24.842  8.653   1.00 85.96  ? 201  PRO B CB  1 
ATOM   5117 C CG  . PRO B 1 277 ? 47.804  24.870  10.127  1.00 91.41  ? 201  PRO B CG  1 
ATOM   5118 C CD  . PRO B 1 277 ? 49.125  24.576  10.745  1.00 85.52  ? 201  PRO B CD  1 
ATOM   5119 N N   . GLU B 1 278 ? 49.316  27.783  8.938   1.00 86.69  ? 202  GLU B N   1 
ATOM   5120 C CA  . GLU B 1 278 ? 49.262  29.216  8.628   1.00 87.67  ? 202  GLU B CA  1 
ATOM   5121 C C   . GLU B 1 278 ? 50.611  29.714  8.039   1.00 90.76  ? 202  GLU B C   1 
ATOM   5122 O O   . GLU B 1 278 ? 50.590  30.709  7.318   1.00 91.70  ? 202  GLU B O   1 
ATOM   5123 C CB  . GLU B 1 278 ? 48.865  30.085  9.850   1.00 90.63  ? 202  GLU B CB  1 
ATOM   5124 C CG  . GLU B 1 278 ? 49.723  29.975  11.107  1.00 100.36 ? 202  GLU B CG  1 
ATOM   5125 C CD  . GLU B 1 278 ? 49.580  28.736  11.974  1.00 115.87 ? 202  GLU B CD  1 
ATOM   5126 O OE1 . GLU B 1 278 ? 48.721  27.873  11.675  1.00 110.30 ? 202  GLU B OE1 1 
ATOM   5127 O OE2 . GLU B 1 278 ? 50.281  28.670  13.008  1.00 108.15 ? 202  GLU B OE2 1 
ATOM   5128 N N   . LYS B 1 279 ? 51.746  29.023  8.282   1.00 85.13  ? 203  LYS B N   1 
ATOM   5129 C CA  . LYS B 1 279 ? 53.042  29.390  7.680   1.00 83.56  ? 203  LYS B CA  1 
ATOM   5130 C C   . LYS B 1 279 ? 53.775  28.132  7.192   1.00 84.40  ? 203  LYS B C   1 
ATOM   5131 O O   . LYS B 1 279 ? 54.971  27.986  7.436   1.00 82.80  ? 203  LYS B O   1 
ATOM   5132 C CB  . LYS B 1 279 ? 53.934  30.189  8.653   1.00 86.65  ? 203  LYS B CB  1 
ATOM   5133 C CG  . LYS B 1 279 ? 53.473  31.616  8.902   1.00 107.42 ? 203  LYS B CG  1 
ATOM   5134 C CD  . LYS B 1 279 ? 54.517  32.385  9.680   1.00 122.57 ? 203  LYS B CD  1 
ATOM   5135 C CE  . LYS B 1 279 ? 54.147  33.835  9.842   1.00 141.42 ? 203  LYS B CE  1 
ATOM   5136 N NZ  . LYS B 1 279 ? 55.221  34.597  10.536  1.00 154.74 ? 203  LYS B NZ  1 
ATOM   5137 N N   . TYR B 1 280 ? 53.063  27.253  6.453   1.00 80.22  ? 204  TYR B N   1 
ATOM   5138 C CA  . TYR B 1 280 ? 53.574  25.948  6.019   1.00 78.24  ? 204  TYR B CA  1 
ATOM   5139 C C   . TYR B 1 280 ? 54.677  26.098  4.934   1.00 80.52  ? 204  TYR B C   1 
ATOM   5140 O O   . TYR B 1 280 ? 55.703  25.416  5.041   1.00 79.19  ? 204  TYR B O   1 
ATOM   5141 C CB  . TYR B 1 280 ? 52.428  25.058  5.493   1.00 79.69  ? 204  TYR B CB  1 
ATOM   5142 C CG  . TYR B 1 280 ? 52.797  23.588  5.419   1.00 80.50  ? 204  TYR B CG  1 
ATOM   5143 C CD1 . TYR B 1 280 ? 53.419  23.059  4.292   1.00 81.84  ? 204  TYR B CD1 1 
ATOM   5144 C CD2 . TYR B 1 280 ? 52.528  22.727  6.480   1.00 81.24  ? 204  TYR B CD2 1 
ATOM   5145 C CE1 . TYR B 1 280 ? 53.796  21.716  4.235   1.00 82.28  ? 204  TYR B CE1 1 
ATOM   5146 C CE2 . TYR B 1 280 ? 52.903  21.383  6.436   1.00 81.52  ? 204  TYR B CE2 1 
ATOM   5147 C CZ  . TYR B 1 280 ? 53.533  20.879  5.309   1.00 89.51  ? 204  TYR B CZ  1 
ATOM   5148 O OH  . TYR B 1 280 ? 53.896  19.551  5.243   1.00 91.49  ? 204  TYR B OH  1 
ATOM   5149 N N   . ALA B 1 281 ? 54.484  26.979  3.918   1.00 76.58  ? 205  ALA B N   1 
ATOM   5150 C CA  . ALA B 1 281 ? 55.482  27.185  2.850   1.00 74.97  ? 205  ALA B CA  1 
ATOM   5151 C C   . ALA B 1 281 ? 56.767  27.792  3.408   1.00 76.62  ? 205  ALA B C   1 
ATOM   5152 O O   . ALA B 1 281 ? 57.861  27.352  3.046   1.00 75.85  ? 205  ALA B O   1 
ATOM   5153 C CB  . ALA B 1 281 ? 54.921  28.081  1.754   1.00 76.70  ? 205  ALA B CB  1 
ATOM   5154 N N   . GLN B 1 282 ? 56.625  28.770  4.319   1.00 71.94  ? 206  GLN B N   1 
ATOM   5155 C CA  . GLN B 1 282 ? 57.716  29.480  4.990   1.00 71.10  ? 206  GLN B CA  1 
ATOM   5156 C C   . GLN B 1 282 ? 58.577  28.494  5.758   1.00 73.21  ? 206  GLN B C   1 
ATOM   5157 O O   . GLN B 1 282 ? 59.793  28.533  5.630   1.00 72.17  ? 206  GLN B O   1 
ATOM   5158 C CB  . GLN B 1 282 ? 57.192  30.586  5.940   1.00 73.84  ? 206  GLN B CB  1 
ATOM   5159 C CG  . GLN B 1 282 ? 56.242  31.622  5.334   1.00 86.34  ? 206  GLN B CG  1 
ATOM   5160 C CD  . GLN B 1 282 ? 54.778  31.223  5.223   1.00 109.55 ? 206  GLN B CD  1 
ATOM   5161 O OE1 . GLN B 1 282 ? 54.395  30.195  4.679   1.00 105.82 ? 206  GLN B OE1 1 
ATOM   5162 N NE2 . GLN B 1 282 ? 53.914  32.166  5.543   1.00 107.53 ? 206  GLN B NE2 1 
ATOM   5163 N N   . TRP B 1 283 ? 57.950  27.571  6.511   1.00 69.59  ? 207  TRP B N   1 
ATOM   5164 C CA  . TRP B 1 283 ? 58.638  26.530  7.271   1.00 68.38  ? 207  TRP B CA  1 
ATOM   5165 C C   . TRP B 1 283 ? 59.284  25.491  6.368   1.00 70.47  ? 207  TRP B C   1 
ATOM   5166 O O   . TRP B 1 283 ? 60.392  25.051  6.662   1.00 69.77  ? 207  TRP B O   1 
ATOM   5167 C CB  . TRP B 1 283 ? 57.680  25.828  8.220   1.00 67.64  ? 207  TRP B CB  1 
ATOM   5168 C CG  . TRP B 1 283 ? 57.587  26.482  9.554   1.00 69.80  ? 207  TRP B CG  1 
ATOM   5169 C CD1 . TRP B 1 283 ? 56.629  27.349  9.984   1.00 74.10  ? 207  TRP B CD1 1 
ATOM   5170 C CD2 . TRP B 1 283 ? 58.547  26.385  10.609  1.00 69.80  ? 207  TRP B CD2 1 
ATOM   5171 N NE1 . TRP B 1 283 ? 56.904  27.758  11.267  1.00 74.63  ? 207  TRP B NE1 1 
ATOM   5172 C CE2 . TRP B 1 283 ? 58.083  27.189  11.673  1.00 75.37  ? 207  TRP B CE2 1 
ATOM   5173 C CE3 . TRP B 1 283 ? 59.766  25.696  10.760  1.00 70.10  ? 207  TRP B CE3 1 
ATOM   5174 C CZ2 . TRP B 1 283 ? 58.777  27.300  12.884  1.00 75.41  ? 207  TRP B CZ2 1 
ATOM   5175 C CZ3 . TRP B 1 283 ? 60.460  25.818  11.952  1.00 72.12  ? 207  TRP B CZ3 1 
ATOM   5176 C CH2 . TRP B 1 283 ? 59.966  26.608  12.999  1.00 74.43  ? 207  TRP B CH2 1 
ATOM   5177 N N   . SER B 1 284 ? 58.598  25.085  5.289   1.00 66.16  ? 208  SER B N   1 
ATOM   5178 C CA  . SER B 1 284 ? 59.123  24.109  4.336   1.00 64.43  ? 208  SER B CA  1 
ATOM   5179 C C   . SER B 1 284 ? 60.391  24.642  3.660   1.00 67.93  ? 208  SER B C   1 
ATOM   5180 O O   . SER B 1 284 ? 61.345  23.892  3.483   1.00 66.46  ? 208  SER B O   1 
ATOM   5181 C CB  . SER B 1 284 ? 58.068  23.769  3.292   1.00 67.61  ? 208  SER B CB  1 
ATOM   5182 O OG  . SER B 1 284 ? 56.895  23.242  3.888   1.00 77.55  ? 208  SER B OG  1 
ATOM   5183 N N   . ALA B 1 285 ? 60.408  25.946  3.318   1.00 65.88  ? 209  ALA B N   1 
ATOM   5184 C CA  . ALA B 1 285 ? 61.556  26.605  2.694   1.00 65.24  ? 209  ALA B CA  1 
ATOM   5185 C C   . ALA B 1 285 ? 62.668  26.817  3.711   1.00 68.27  ? 209  ALA B C   1 
ATOM   5186 O O   . ALA B 1 285 ? 63.824  26.578  3.393   1.00 67.70  ? 209  ALA B O   1 
ATOM   5187 C CB  . ALA B 1 285 ? 61.134  27.934  2.083   1.00 66.97  ? 209  ALA B CB  1 
ATOM   5188 N N   . GLY B 1 286 ? 62.299  27.204  4.932   1.00 64.97  ? 210  GLY B N   1 
ATOM   5189 C CA  . GLY B 1 286 ? 63.226  27.459  6.030   1.00 64.69  ? 210  GLY B CA  1 
ATOM   5190 C C   . GLY B 1 286 ? 63.994  26.243  6.504   1.00 67.37  ? 210  GLY B C   1 
ATOM   5191 O O   . GLY B 1 286 ? 65.219  26.312  6.653   1.00 66.89  ? 210  GLY B O   1 
ATOM   5192 N N   . ILE B 1 287 ? 63.277  25.119  6.747   1.00 63.23  ? 211  ILE B N   1 
ATOM   5193 C CA  . ILE B 1 287 ? 63.875  23.864  7.220   1.00 62.56  ? 211  ILE B CA  1 
ATOM   5194 C C   . ILE B 1 287 ? 64.738  23.263  6.089   1.00 67.03  ? 211  ILE B C   1 
ATOM   5195 O O   . ILE B 1 287 ? 65.772  22.679  6.399   1.00 66.47  ? 211  ILE B O   1 
ATOM   5196 C CB  . ILE B 1 287 ? 62.801  22.859  7.738   1.00 65.42  ? 211  ILE B CB  1 
ATOM   5197 C CG1 . ILE B 1 287 ? 62.063  23.419  8.993   1.00 67.18  ? 211  ILE B CG1 1 
ATOM   5198 C CG2 . ILE B 1 287 ? 63.387  21.484  8.048   1.00 65.10  ? 211  ILE B CG2 1 
ATOM   5199 C CD1 . ILE B 1 287 ? 62.927  23.733  10.301  1.00 75.57  ? 211  ILE B CD1 1 
ATOM   5200 N N   . ALA B 1 288 ? 64.371  23.476  4.799   1.00 64.31  ? 212  ALA B N   1 
ATOM   5201 C CA  . ALA B 1 288 ? 65.162  22.991  3.656   1.00 63.72  ? 212  ALA B CA  1 
ATOM   5202 C C   . ALA B 1 288 ? 66.529  23.687  3.605   1.00 69.14  ? 212  ALA B C   1 
ATOM   5203 O O   . ALA B 1 288 ? 67.531  23.026  3.336   1.00 67.76  ? 212  ALA B O   1 
ATOM   5204 C CB  . ALA B 1 288 ? 64.413  23.211  2.357   1.00 64.60  ? 212  ALA B CB  1 
ATOM   5205 N N   . LEU B 1 289 ? 66.573  25.010  3.907   1.00 67.90  ? 213  LEU B N   1 
ATOM   5206 C CA  . LEU B 1 289 ? 67.814  25.784  3.974   1.00 68.82  ? 213  LEU B CA  1 
ATOM   5207 C C   . LEU B 1 289 ? 68.689  25.310  5.146   1.00 73.17  ? 213  LEU B C   1 
ATOM   5208 O O   . LEU B 1 289 ? 69.909  25.283  5.005   1.00 72.77  ? 213  LEU B O   1 
ATOM   5209 C CB  . LEU B 1 289 ? 67.542  27.300  4.098   1.00 70.64  ? 213  LEU B CB  1 
ATOM   5210 C CG  . LEU B 1 289 ? 67.454  28.173  2.803   1.00 76.99  ? 213  LEU B CG  1 
ATOM   5211 C CD1 . LEU B 1 289 ? 68.784  28.202  2.044   1.00 77.83  ? 213  LEU B CD1 1 
ATOM   5212 C CD2 . LEU B 1 289 ? 66.354  27.754  1.892   1.00 79.11  ? 213  LEU B CD2 1 
ATOM   5213 N N   . MET B 1 290 ? 68.070  24.914  6.284   1.00 70.00  ? 214  MET B N   1 
ATOM   5214 C CA  . MET B 1 290 ? 68.778  24.382  7.457   1.00 69.70  ? 214  MET B CA  1 
ATOM   5215 C C   . MET B 1 290 ? 69.505  23.076  7.094   1.00 72.99  ? 214  MET B C   1 
ATOM   5216 O O   . MET B 1 290 ? 70.631  22.871  7.539   1.00 73.87  ? 214  MET B O   1 
ATOM   5217 C CB  . MET B 1 290 ? 67.803  24.155  8.624   1.00 72.35  ? 214  MET B CB  1 
ATOM   5218 C CG  . MET B 1 290 ? 68.445  23.559  9.864   1.00 75.98  ? 214  MET B CG  1 
ATOM   5219 S SD  . MET B 1 290 ? 67.227  23.301  11.157  1.00 80.92  ? 214  MET B SD  1 
ATOM   5220 C CE  . MET B 1 290 ? 68.212  22.551  12.381  1.00 77.81  ? 214  MET B CE  1 
ATOM   5221 N N   . LYS B 1 291 ? 68.868  22.212  6.274   1.00 67.64  ? 215  LYS B N   1 
ATOM   5222 C CA  . LYS B 1 291 ? 69.449  20.954  5.786   1.00 66.09  ? 215  LYS B CA  1 
ATOM   5223 C C   . LYS B 1 291 ? 70.741  21.221  4.995   1.00 70.54  ? 215  LYS B C   1 
ATOM   5224 O O   . LYS B 1 291 ? 71.740  20.545  5.225   1.00 71.05  ? 215  LYS B O   1 
ATOM   5225 C CB  . LYS B 1 291 ? 68.445  20.185  4.903   1.00 67.05  ? 215  LYS B CB  1 
ATOM   5226 C CG  . LYS B 1 291 ? 67.133  19.823  5.586   1.00 71.13  ? 215  LYS B CG  1 
ATOM   5227 C CD  . LYS B 1 291 ? 66.171  19.141  4.626   1.00 69.33  ? 215  LYS B CD  1 
ATOM   5228 C CE  . LYS B 1 291 ? 64.878  18.775  5.291   1.00 67.08  ? 215  LYS B CE  1 
ATOM   5229 N NZ  . LYS B 1 291 ? 63.984  18.039  4.369   1.00 78.98  ? 215  LYS B NZ  1 
ATOM   5230 N N   . ASN B 1 292 ? 70.716  22.218  4.072   1.00 66.42  ? 216  ASN B N   1 
ATOM   5231 C CA  . ASN B 1 292 ? 71.848  22.596  3.225   1.00 66.01  ? 216  ASN B CA  1 
ATOM   5232 C C   . ASN B 1 292 ? 72.999  23.165  4.041   1.00 71.14  ? 216  ASN B C   1 
ATOM   5233 O O   . ASN B 1 292 ? 74.113  22.653  3.951   1.00 70.69  ? 216  ASN B O   1 
ATOM   5234 C CB  . ASN B 1 292 ? 71.431  23.634  2.163   1.00 64.91  ? 216  ASN B CB  1 
ATOM   5235 C CG  . ASN B 1 292 ? 70.474  23.166  1.095   1.00 75.94  ? 216  ASN B CG  1 
ATOM   5236 O OD1 . ASN B 1 292 ? 69.729  23.962  0.521   1.00 67.97  ? 216  ASN B OD1 1 
ATOM   5237 N ND2 . ASN B 1 292 ? 70.464  21.878  0.793   1.00 65.64  ? 216  ASN B ND2 1 
ATOM   5238 N N   . ILE B 1 293 ? 72.728  24.224  4.831   1.00 68.69  ? 217  ILE B N   1 
ATOM   5239 C CA  . ILE B 1 293 ? 73.728  24.953  5.615   1.00 69.63  ? 217  ILE B CA  1 
ATOM   5240 C C   . ILE B 1 293 ? 74.379  24.035  6.677   1.00 73.82  ? 217  ILE B C   1 
ATOM   5241 O O   . ILE B 1 293 ? 75.598  23.876  6.673   1.00 73.91  ? 217  ILE B O   1 
ATOM   5242 C CB  . ILE B 1 293 ? 73.097  26.209  6.291   1.00 73.71  ? 217  ILE B CB  1 
ATOM   5243 C CG1 . ILE B 1 293 ? 72.475  27.150  5.228   1.00 74.50  ? 217  ILE B CG1 1 
ATOM   5244 C CG2 . ILE B 1 293 ? 74.141  26.953  7.144   1.00 75.31  ? 217  ILE B CG2 1 
ATOM   5245 C CD1 . ILE B 1 293 ? 71.655  28.322  5.781   1.00 83.44  ? 217  ILE B CD1 1 
ATOM   5246 N N   . LEU B 1 294 ? 73.569  23.443  7.560   1.00 70.20  ? 218  LEU B N   1 
ATOM   5247 C CA  . LEU B 1 294 ? 74.018  22.658  8.707   1.00 69.87  ? 218  LEU B CA  1 
ATOM   5248 C C   . LEU B 1 294 ? 74.512  21.239  8.312   1.00 71.40  ? 218  LEU B C   1 
ATOM   5249 O O   . LEU B 1 294 ? 75.422  20.723  8.955   1.00 72.02  ? 218  LEU B O   1 
ATOM   5250 C CB  . LEU B 1 294 ? 72.836  22.544  9.690   1.00 70.26  ? 218  LEU B CB  1 
ATOM   5251 C CG  . LEU B 1 294 ? 73.098  22.027  11.092  1.00 76.22  ? 218  LEU B CG  1 
ATOM   5252 C CD1 . LEU B 1 294 ? 74.106  22.912  11.840  1.00 78.26  ? 218  LEU B CD1 1 
ATOM   5253 C CD2 . LEU B 1 294 ? 71.821  21.988  11.872  1.00 78.46  ? 218  LEU B CD2 1 
ATOM   5254 N N   . GLY B 1 295 ? 73.924  20.638  7.283   1.00 65.37  ? 219  GLY B N   1 
ATOM   5255 C CA  . GLY B 1 295 ? 74.264  19.284  6.857   1.00 63.42  ? 219  GLY B CA  1 
ATOM   5256 C C   . GLY B 1 295 ? 75.197  19.131  5.669   1.00 65.35  ? 219  GLY B C   1 
ATOM   5257 O O   . GLY B 1 295 ? 75.637  18.010  5.380   1.00 64.28  ? 219  GLY B O   1 
ATOM   5258 N N   . PHE B 1 296 ? 75.509  20.229  4.955   1.00 61.03  ? 220  PHE B N   1 
ATOM   5259 C CA  . PHE B 1 296 ? 76.409  20.118  3.807   1.00 60.07  ? 220  PHE B CA  1 
ATOM   5260 C C   . PHE B 1 296 ? 77.384  21.313  3.747   1.00 65.88  ? 220  PHE B C   1 
ATOM   5261 O O   . PHE B 1 296 ? 78.586  21.085  3.801   1.00 66.00  ? 220  PHE B O   1 
ATOM   5262 C CB  . PHE B 1 296 ? 75.618  20.007  2.486   1.00 60.51  ? 220  PHE B CB  1 
ATOM   5263 C CG  . PHE B 1 296 ? 76.466  19.736  1.260   1.00 60.77  ? 220  PHE B CG  1 
ATOM   5264 C CD1 . PHE B 1 296 ? 76.906  18.449  0.967   1.00 62.32  ? 220  PHE B CD1 1 
ATOM   5265 C CD2 . PHE B 1 296 ? 76.770  20.755  0.365   1.00 61.98  ? 220  PHE B CD2 1 
ATOM   5266 C CE1 . PHE B 1 296 ? 77.673  18.196  -0.169  1.00 62.60  ? 220  PHE B CE1 1 
ATOM   5267 C CE2 . PHE B 1 296 ? 77.538  20.499  -0.773  1.00 64.41  ? 220  PHE B CE2 1 
ATOM   5268 C CZ  . PHE B 1 296 ? 77.981  19.221  -1.033  1.00 61.83  ? 220  PHE B CZ  1 
ATOM   5269 N N   . ILE B 1 297 ? 76.875  22.567  3.642   1.00 63.21  ? 221  ILE B N   1 
ATOM   5270 C CA  . ILE B 1 297 ? 77.681  23.785  3.479   1.00 64.35  ? 221  ILE B CA  1 
ATOM   5271 C C   . ILE B 1 297 ? 78.741  23.884  4.598   1.00 69.54  ? 221  ILE B C   1 
ATOM   5272 O O   . ILE B 1 297 ? 79.929  23.836  4.277   1.00 69.86  ? 221  ILE B O   1 
ATOM   5273 C CB  . ILE B 1 297 ? 76.805  25.078  3.433   1.00 68.48  ? 221  ILE B CB  1 
ATOM   5274 C CG1 . ILE B 1 297 ? 75.694  25.021  2.323   1.00 68.73  ? 221  ILE B CG1 1 
ATOM   5275 C CG2 . ILE B 1 297 ? 77.654  26.354  3.324   1.00 70.32  ? 221  ILE B CG2 1 
ATOM   5276 C CD1 . ILE B 1 297 ? 76.160  24.798  0.831   1.00 81.05  ? 221  ILE B CD1 1 
ATOM   5277 N N   . ILE B 1 298 ? 78.325  24.010  5.886   1.00 66.71  ? 222  ILE B N   1 
ATOM   5278 C CA  . ILE B 1 298 ? 79.245  24.157  7.032   1.00 67.63  ? 222  ILE B CA  1 
ATOM   5279 C C   . ILE B 1 298 ? 80.210  22.920  7.114   1.00 71.04  ? 222  ILE B C   1 
ATOM   5280 O O   . ILE B 1 298 ? 81.420  23.146  7.072   1.00 70.69  ? 222  ILE B O   1 
ATOM   5281 C CB  . ILE B 1 298 ? 78.495  24.378  8.381   1.00 71.01  ? 222  ILE B CB  1 
ATOM   5282 C CG1 . ILE B 1 298 ? 77.750  25.734  8.370   1.00 71.88  ? 222  ILE B CG1 1 
ATOM   5283 C CG2 . ILE B 1 298 ? 79.464  24.307  9.573   1.00 73.20  ? 222  ILE B CG2 1 
ATOM   5284 C CD1 . ILE B 1 298 ? 76.882  26.005  9.597   1.00 79.54  ? 222  ILE B CD1 1 
ATOM   5285 N N   . PRO B 1 299 ? 79.754  21.636  7.180   1.00 66.84  ? 223  PRO B N   1 
ATOM   5286 C CA  . PRO B 1 299 ? 80.732  20.533  7.264   1.00 66.40  ? 223  PRO B CA  1 
ATOM   5287 C C   . PRO B 1 299 ? 81.684  20.483  6.060   1.00 71.37  ? 223  PRO B C   1 
ATOM   5288 O O   . PRO B 1 299 ? 82.857  20.179  6.255   1.00 72.05  ? 223  PRO B O   1 
ATOM   5289 C CB  . PRO B 1 299 ? 79.863  19.275  7.311   1.00 66.58  ? 223  PRO B CB  1 
ATOM   5290 C CG  . PRO B 1 299 ? 78.526  19.699  6.884   1.00 70.51  ? 223  PRO B CG  1 
ATOM   5291 C CD  . PRO B 1 299 ? 78.373  21.122  7.259   1.00 67.11  ? 223  PRO B CD  1 
ATOM   5292 N N   . LEU B 1 300 ? 81.206  20.821  4.838   1.00 67.54  ? 224  LEU B N   1 
ATOM   5293 C CA  . LEU B 1 300 ? 82.044  20.801  3.636   1.00 67.28  ? 224  LEU B CA  1 
ATOM   5294 C C   . LEU B 1 300 ? 83.106  21.916  3.735   1.00 72.80  ? 224  LEU B C   1 
ATOM   5295 O O   . LEU B 1 300 ? 84.229  21.689  3.288   1.00 74.08  ? 224  LEU B O   1 
ATOM   5296 C CB  . LEU B 1 300 ? 81.193  20.932  2.342   1.00 66.59  ? 224  LEU B CB  1 
ATOM   5297 C CG  . LEU B 1 300 ? 81.859  20.701  0.956   1.00 71.59  ? 224  LEU B CG  1 
ATOM   5298 C CD1 . LEU B 1 300 ? 82.518  21.942  0.394   1.00 73.29  ? 224  LEU B CD1 1 
ATOM   5299 C CD2 . LEU B 1 300 ? 82.730  19.450  0.917   1.00 73.54  ? 224  LEU B CD2 1 
ATOM   5300 N N   . ILE B 1 301 ? 82.785  23.079  4.368   1.00 68.79  ? 225  ILE B N   1 
ATOM   5301 C CA  . ILE B 1 301 ? 83.765  24.164  4.573   1.00 69.82  ? 225  ILE B CA  1 
ATOM   5302 C C   . ILE B 1 301 ? 84.955  23.591  5.350   1.00 74.57  ? 225  ILE B C   1 
ATOM   5303 O O   . ILE B 1 301 ? 86.081  23.723  4.887   1.00 75.46  ? 225  ILE B O   1 
ATOM   5304 C CB  . ILE B 1 301 ? 83.162  25.422  5.278   1.00 73.51  ? 225  ILE B CB  1 
ATOM   5305 C CG1 . ILE B 1 301 ? 82.123  26.123  4.361   1.00 73.46  ? 225  ILE B CG1 1 
ATOM   5306 C CG2 . ILE B 1 301 ? 84.271  26.403  5.689   1.00 75.45  ? 225  ILE B CG2 1 
ATOM   5307 C CD1 . ILE B 1 301 ? 81.361  27.338  4.970   1.00 79.00  ? 225  ILE B CD1 1 
ATOM   5308 N N   . PHE B 1 302 ? 84.692  22.882  6.473   1.00 71.08  ? 226  PHE B N   1 
ATOM   5309 C CA  . PHE B 1 302 ? 85.706  22.223  7.307   1.00 71.41  ? 226  PHE B CA  1 
ATOM   5310 C C   . PHE B 1 302 ? 86.499  21.165  6.534   1.00 74.26  ? 226  PHE B C   1 
ATOM   5311 O O   . PHE B 1 302 ? 87.729  21.198  6.564   1.00 75.13  ? 226  PHE B O   1 
ATOM   5312 C CB  . PHE B 1 302 ? 85.063  21.559  8.528   1.00 72.70  ? 226  PHE B CB  1 
ATOM   5313 C CG  . PHE B 1 302 ? 84.631  22.506  9.619   1.00 75.80  ? 226  PHE B CG  1 
ATOM   5314 C CD1 . PHE B 1 302 ? 83.413  23.173  9.544   1.00 78.57  ? 226  PHE B CD1 1 
ATOM   5315 C CD2 . PHE B 1 302 ? 85.408  22.680  10.755  1.00 79.82  ? 226  PHE B CD2 1 
ATOM   5316 C CE1 . PHE B 1 302 ? 83.011  24.045  10.559  1.00 80.57  ? 226  PHE B CE1 1 
ATOM   5317 C CE2 . PHE B 1 302 ? 84.999  23.544  11.774  1.00 84.12  ? 226  PHE B CE2 1 
ATOM   5318 C CZ  . PHE B 1 302 ? 83.802  24.220  11.668  1.00 81.67  ? 226  PHE B CZ  1 
ATOM   5319 N N   . ILE B 1 303 ? 85.805  20.239  5.845   1.00 68.63  ? 227  ILE B N   1 
ATOM   5320 C CA  . ILE B 1 303 ? 86.421  19.135  5.097   1.00 68.13  ? 227  ILE B CA  1 
ATOM   5321 C C   . ILE B 1 303 ? 87.335  19.703  3.970   1.00 72.39  ? 227  ILE B C   1 
ATOM   5322 O O   . ILE B 1 303 ? 88.469  19.231  3.827   1.00 73.54  ? 227  ILE B O   1 
ATOM   5323 C CB  . ILE B 1 303 ? 85.330  18.173  4.527   1.00 69.72  ? 227  ILE B CB  1 
ATOM   5324 C CG1 . ILE B 1 303 ? 84.490  17.559  5.678   1.00 69.95  ? 227  ILE B CG1 1 
ATOM   5325 C CG2 . ILE B 1 303 ? 85.962  17.061  3.684   1.00 69.78  ? 227  ILE B CG2 1 
ATOM   5326 C CD1 . ILE B 1 303 ? 83.266  16.716  5.266   1.00 77.44  ? 227  ILE B CD1 1 
ATOM   5327 N N   . ALA B 1 304 ? 86.860  20.719  3.210   1.00 67.10  ? 228  ALA B N   1 
ATOM   5328 C CA  . ALA B 1 304 ? 87.630  21.320  2.115   1.00 67.00  ? 228  ALA B CA  1 
ATOM   5329 C C   . ALA B 1 304 ? 88.845  22.091  2.640   1.00 72.47  ? 228  ALA B C   1 
ATOM   5330 O O   . ALA B 1 304 ? 89.937  21.912  2.105   1.00 73.74  ? 228  ALA B O   1 
ATOM   5331 C CB  . ALA B 1 304 ? 86.750  22.245  1.293   1.00 67.26  ? 228  ALA B CB  1 
ATOM   5332 N N   . THR B 1 305 ? 88.666  22.918  3.698   1.00 68.84  ? 229  THR B N   1 
ATOM   5333 C CA  . THR B 1 305 ? 89.740  23.723  4.289   1.00 70.39  ? 229  THR B CA  1 
ATOM   5334 C C   . THR B 1 305 ? 90.829  22.803  4.865   1.00 75.08  ? 229  THR B C   1 
ATOM   5335 O O   . THR B 1 305 ? 92.015  23.099  4.700   1.00 76.35  ? 229  THR B O   1 
ATOM   5336 C CB  . THR B 1 305 ? 89.182  24.667  5.363   1.00 76.41  ? 229  THR B CB  1 
ATOM   5337 O OG1 . THR B 1 305 ? 88.148  25.459  4.781   1.00 72.44  ? 229  THR B OG1 1 
ATOM   5338 C CG2 . THR B 1 305 ? 90.247  25.587  5.956   1.00 77.98  ? 229  THR B CG2 1 
ATOM   5339 N N   . CYS B 1 306 ? 90.435  21.679  5.502   1.00 70.67  ? 230  CYS B N   1 
ATOM   5340 C CA  . CYS B 1 306 ? 91.401  20.732  6.061   1.00 71.00  ? 230  CYS B CA  1 
ATOM   5341 C C   . CYS B 1 306 ? 92.135  20.000  4.936   1.00 73.47  ? 230  CYS B C   1 
ATOM   5342 O O   . CYS B 1 306 ? 93.289  19.645  5.133   1.00 74.58  ? 230  CYS B O   1 
ATOM   5343 C CB  . CYS B 1 306 ? 90.732  19.747  7.009   1.00 70.48  ? 230  CYS B CB  1 
ATOM   5344 S SG  . CYS B 1 306 ? 90.122  20.500  8.537   1.00 75.34  ? 230  CYS B SG  1 
ATOM   5345 N N   . TYR B 1 307 ? 91.499  19.801  3.760   1.00 67.87  ? 231  TYR B N   1 
ATOM   5346 C CA  . TYR B 1 307 ? 92.169  19.150  2.637   1.00 67.48  ? 231  TYR B CA  1 
ATOM   5347 C C   . TYR B 1 307 ? 93.271  20.039  2.073   1.00 74.40  ? 231  TYR B C   1 
ATOM   5348 O O   . TYR B 1 307 ? 94.410  19.587  1.952   1.00 75.31  ? 231  TYR B O   1 
ATOM   5349 C CB  . TYR B 1 307 ? 91.191  18.760  1.513   1.00 66.99  ? 231  TYR B CB  1 
ATOM   5350 C CG  . TYR B 1 307 ? 91.910  18.356  0.242   1.00 68.99  ? 231  TYR B CG  1 
ATOM   5351 C CD1 . TYR B 1 307 ? 92.638  17.172  0.175   1.00 70.88  ? 231  TYR B CD1 1 
ATOM   5352 C CD2 . TYR B 1 307 ? 91.851  19.152  -0.897  1.00 70.15  ? 231  TYR B CD2 1 
ATOM   5353 C CE1 . TYR B 1 307 ? 93.329  16.813  -0.978  1.00 71.62  ? 231  TYR B CE1 1 
ATOM   5354 C CE2 . TYR B 1 307 ? 92.523  18.794  -2.063  1.00 71.63  ? 231  TYR B CE2 1 
ATOM   5355 C CZ  . TYR B 1 307 ? 93.256  17.618  -2.100  1.00 78.66  ? 231  TYR B CZ  1 
ATOM   5356 O OH  . TYR B 1 307 ? 93.919  17.249  -3.244  1.00 80.55  ? 231  TYR B OH  1 
ATOM   5357 N N   . PHE B 1 308 ? 92.933  21.289  1.705   1.00 71.85  ? 232  PHE B N   1 
ATOM   5358 C CA  . PHE B 1 308 ? 93.896  22.225  1.132   1.00 73.13  ? 232  PHE B CA  1 
ATOM   5359 C C   . PHE B 1 308 ? 94.907  22.682  2.207   1.00 78.56  ? 232  PHE B C   1 
ATOM   5360 O O   . PHE B 1 308 ? 96.026  23.067  1.860   1.00 79.35  ? 232  PHE B O   1 
ATOM   5361 C CB  . PHE B 1 308 ? 93.187  23.426  0.491   1.00 74.66  ? 232  PHE B CB  1 
ATOM   5362 C CG  . PHE B 1 308 ? 92.349  23.037  -0.708  1.00 74.26  ? 232  PHE B CG  1 
ATOM   5363 C CD1 . PHE B 1 308 ? 92.946  22.739  -1.930  1.00 77.51  ? 232  PHE B CD1 1 
ATOM   5364 C CD2 . PHE B 1 308 ? 90.962  23.017  -0.630  1.00 74.63  ? 232  PHE B CD2 1 
ATOM   5365 C CE1 . PHE B 1 308 ? 92.172  22.377  -3.037  1.00 77.26  ? 232  PHE B CE1 1 
ATOM   5366 C CE2 . PHE B 1 308 ? 90.187  22.662  -1.741  1.00 76.33  ? 232  PHE B CE2 1 
ATOM   5367 C CZ  . PHE B 1 308 ? 90.798  22.355  -2.941  1.00 74.89  ? 232  PHE B CZ  1 
ATOM   5368 N N   . GLY B 1 309 ? 94.527  22.558  3.483   1.00 75.32  ? 233  GLY B N   1 
ATOM   5369 C CA  . GLY B 1 309 ? 95.395  22.834  4.622   1.00 77.20  ? 233  GLY B CA  1 
ATOM   5370 C C   . GLY B 1 309 ? 96.488  21.783  4.727   1.00 82.19  ? 233  GLY B C   1 
ATOM   5371 O O   . GLY B 1 309 ? 97.656  22.117  4.960   1.00 83.90  ? 233  GLY B O   1 
ATOM   5372 N N   . ILE B 1 310 ? 96.111  20.494  4.515   1.00 77.20  ? 234  ILE B N   1 
ATOM   5373 C CA  . ILE B 1 310 ? 97.026  19.347  4.480   1.00 77.44  ? 234  ILE B CA  1 
ATOM   5374 C C   . ILE B 1 310 ? 97.861  19.442  3.201   1.00 83.69  ? 234  ILE B C   1 
ATOM   5375 O O   . ILE B 1 310 ? 99.082  19.376  3.271   1.00 84.97  ? 234  ILE B O   1 
ATOM   5376 C CB  . ILE B 1 310 ? 96.256  17.994  4.586   1.00 78.20  ? 234  ILE B CB  1 
ATOM   5377 C CG1 . ILE B 1 310 ? 95.617  17.838  5.984   1.00 77.96  ? 234  ILE B CG1 1 
ATOM   5378 C CG2 . ILE B 1 310 ? 97.186  16.804  4.298   1.00 79.49  ? 234  ILE B CG2 1 
ATOM   5379 C CD1 . ILE B 1 310 ? 94.674  16.615  6.169   1.00 79.14  ? 234  ILE B CD1 1 
ATOM   5380 N N   . ARG B 1 311 ? 97.198  19.656  2.044   1.00 80.70  ? 235  ARG B N   1 
ATOM   5381 C CA  . ARG B 1 311 ? 97.815  19.781  0.719   1.00 81.59  ? 235  ARG B CA  1 
ATOM   5382 C C   . ARG B 1 311 ? 98.916  20.847  0.738   1.00 89.41  ? 235  ARG B C   1 
ATOM   5383 O O   . ARG B 1 311 ? 99.946  20.649  0.100   1.00 90.30  ? 235  ARG B O   1 
ATOM   5384 C CB  . ARG B 1 311 ? 96.746  20.119  -0.341  1.00 80.05  ? 235  ARG B CB  1 
ATOM   5385 C CG  . ARG B 1 311 ? 97.262  20.102  -1.769  1.00 91.70  ? 235  ARG B CG  1 
ATOM   5386 C CD  . ARG B 1 311 ? 96.161  20.323  -2.778  1.00 105.95 ? 235  ARG B CD  1 
ATOM   5387 N NE  . ARG B 1 311 ? 96.669  20.252  -4.150  1.00 123.67 ? 235  ARG B NE  1 
ATOM   5388 C CZ  . ARG B 1 311 ? 96.756  19.132  -4.866  1.00 141.70 ? 235  ARG B CZ  1 
ATOM   5389 N NH1 . ARG B 1 311 ? 96.378  17.971  -4.343  1.00 127.87 ? 235  ARG B NH1 1 
ATOM   5390 N NH2 . ARG B 1 311 ? 97.235  19.162  -6.101  1.00 132.33 ? 235  ARG B NH2 1 
ATOM   5391 N N   . LYS B 1 312 ? 98.719  21.943  1.509   1.00 88.89  ? 236  LYS B N   1 
ATOM   5392 C CA  . LYS B 1 312 ? 99.684  23.042  1.659   1.00 92.89  ? 236  LYS B CA  1 
ATOM   5393 C C   . LYS B 1 312 ? 100.982 22.569  2.364   1.00 102.25 ? 236  LYS B C   1 
ATOM   5394 O O   . LYS B 1 312 ? 102.079 22.822  1.859   1.00 103.66 ? 236  LYS B O   1 
ATOM   5395 C CB  . LYS B 1 312 ? 99.053  24.201  2.460   1.00 95.57  ? 236  LYS B CB  1 
ATOM   5396 C CG  . LYS B 1 312 ? 99.959  25.427  2.629   1.00 109.11 ? 236  LYS B CG  1 
ATOM   5397 C CD  . LYS B 1 312 ? 99.395  26.470  3.605   1.00 121.31 ? 236  LYS B CD  1 
ATOM   5398 C CE  . LYS B 1 312 ? 99.349  25.985  5.041   1.00 135.29 ? 236  LYS B CE  1 
ATOM   5399 N NZ  . LYS B 1 312 ? 98.824  27.023  5.965   1.00 146.68 ? 236  LYS B NZ  1 
ATOM   5400 N N   . HIS B 1 313 ? 100.839 21.904  3.535   1.00 101.14 ? 237  HIS B N   1 
ATOM   5401 C CA  . HIS B 1 313 ? 101.947 21.434  4.375   1.00 103.97 ? 237  HIS B CA  1 
ATOM   5402 C C   . HIS B 1 313 ? 102.787 20.343  3.676   1.00 108.86 ? 237  HIS B C   1 
ATOM   5403 O O   . HIS B 1 313 ? 103.991 20.265  3.933   1.00 111.35 ? 237  HIS B O   1 
ATOM   5404 C CB  . HIS B 1 313 ? 101.414 20.886  5.710   1.00 104.42 ? 237  HIS B CB  1 
ATOM   5405 C CG  . HIS B 1 313 ? 102.488 20.567  6.707   1.00 110.50 ? 237  HIS B CG  1 
ATOM   5406 N ND1 . HIS B 1 313 ? 103.078 19.315  6.759   1.00 112.61 ? 237  HIS B ND1 1 
ATOM   5407 C CD2 . HIS B 1 313 ? 103.054 21.358  7.650   1.00 114.98 ? 237  HIS B CD2 1 
ATOM   5408 C CE1 . HIS B 1 313 ? 103.981 19.382  7.728   1.00 114.46 ? 237  HIS B CE1 1 
ATOM   5409 N NE2 . HIS B 1 313 ? 104.002 20.590  8.295   1.00 116.27 ? 237  HIS B NE2 1 
ATOM   5410 N N   . LEU B 1 314 ? 102.175 19.515  2.816   1.00 103.46 ? 238  LEU B N   1 
ATOM   5411 C CA  . LEU B 1 314 ? 102.906 18.453  2.128   1.00 104.03 ? 238  LEU B CA  1 
ATOM   5412 C C   . LEU B 1 314 ? 103.746 19.028  0.981   1.00 112.22 ? 238  LEU B C   1 
ATOM   5413 O O   . LEU B 1 314 ? 104.807 18.476  0.675   1.00 113.29 ? 238  LEU B O   1 
ATOM   5414 C CB  . LEU B 1 314 ? 101.968 17.354  1.610   1.00 101.25 ? 238  LEU B CB  1 
ATOM   5415 C CG  . LEU B 1 314 ? 101.604 16.237  2.611   1.00 104.21 ? 238  LEU B CG  1 
ATOM   5416 C CD1 . LEU B 1 314 ? 100.918 16.759  3.824   1.00 103.84 ? 238  LEU B CD1 1 
ATOM   5417 C CD2 . LEU B 1 314 ? 100.753 15.219  1.970   1.00 104.33 ? 238  LEU B CD2 1 
ATOM   5418 N N   . LEU B 1 315 ? 103.356 20.197  0.437   1.00 110.84 ? 239  LEU B N   1 
ATOM   5419 C CA  . LEU B 1 315 ? 104.133 20.908  -0.592  1.00 113.63 ? 239  LEU B CA  1 
ATOM   5420 C C   . LEU B 1 315 ? 105.090 21.939  0.060   1.00 122.28 ? 239  LEU B C   1 
ATOM   5421 O O   . LEU B 1 315 ? 105.591 22.836  -0.620  1.00 123.52 ? 239  LEU B O   1 
ATOM   5422 C CB  . LEU B 1 315 ? 103.186 21.611  -1.605  1.00 112.83 ? 239  LEU B CB  1 
ATOM   5423 C CG  . LEU B 1 315 ? 102.595 20.796  -2.792  1.00 116.14 ? 239  LEU B CG  1 
ATOM   5424 C CD1 . LEU B 1 315 ? 103.673 20.413  -3.807  1.00 118.32 ? 239  LEU B CD1 1 
ATOM   5425 C CD2 . LEU B 1 315 ? 101.762 19.588  -2.347  1.00 115.97 ? 239  LEU B CD2 1 
ATOM   5426 N N   . LYS B 1 316 ? 105.360 21.773  1.366   1.00 121.35 ? 240  LYS B N   1 
ATOM   5427 C CA  . LYS B 1 316 ? 106.159 22.686  2.181   1.00 125.21 ? 240  LYS B CA  1 
ATOM   5428 C C   . LYS B 1 316 ? 107.159 21.895  3.071   1.00 134.69 ? 240  LYS B C   1 
ATOM   5429 O O   . LYS B 1 316 ? 107.745 22.455  4.002   1.00 136.42 ? 240  LYS B O   1 
ATOM   5430 C CB  . LYS B 1 316 ? 105.175 23.516  3.038   1.00 126.87 ? 240  LYS B CB  1 
ATOM   5431 C CG  . LYS B 1 316 ? 105.745 24.708  3.796   1.00 139.60 ? 240  LYS B CG  1 
ATOM   5432 C CD  . LYS B 1 316 ? 104.679 25.395  4.677   1.00 145.13 ? 240  LYS B CD  1 
ATOM   5433 C CE  . LYS B 1 316 ? 103.516 25.988  3.909   1.00 149.96 ? 240  LYS B CE  1 
ATOM   5434 N N   . THR B 1 317 ? 107.375 20.601  2.759   1.00 133.52 ? 241  THR B N   1 
ATOM   5435 C CA  . THR B 1 317 ? 108.252 19.746  3.553   1.00 136.26 ? 241  THR B CA  1 
ATOM   5436 C C   . THR B 1 317 ? 109.481 19.324  2.707   1.00 146.38 ? 241  THR B C   1 
ATOM   5437 O O   . THR B 1 317 ? 110.587 19.820  2.960   1.00 149.25 ? 241  THR B O   1 
ATOM   5438 C CB  . THR B 1 317 ? 107.461 18.519  4.079   1.00 140.57 ? 241  THR B CB  1 
ATOM   5439 O OG1 . THR B 1 317 ? 106.273 18.965  4.739   1.00 137.24 ? 241  THR B OG1 1 
ATOM   5440 C CG2 . THR B 1 317 ? 108.284 17.641  5.028   1.00 140.54 ? 241  THR B CG2 1 
ATOM   5441 N N   . ASN B 1 318 ? 109.300 18.401  1.734   1.00 144.34 ? 242  ASN B N   1 
ATOM   5442 C CA  . ASN B 1 318 ? 110.410 17.883  0.916   1.00 147.25 ? 242  ASN B CA  1 
ATOM   5443 C C   . ASN B 1 318 ? 109.890 17.333  -0.428  1.00 151.58 ? 242  ASN B C   1 
ATOM   5444 O O   . ASN B 1 318 ? 108.745 16.867  -0.507  1.00 148.59 ? 242  ASN B O   1 
ATOM   5445 C CB  . ASN B 1 318 ? 111.135 16.784  1.712   1.00 149.27 ? 242  ASN B CB  1 
ATOM   5446 C CG  . ASN B 1 318 ? 112.331 16.163  1.048   1.00 171.35 ? 242  ASN B CG  1 
ATOM   5447 O OD1 . ASN B 1 318 ? 113.025 16.774  0.226   1.00 165.72 ? 242  ASN B OD1 1 
ATOM   5448 N ND2 . ASN B 1 318 ? 112.642 14.951  1.467   1.00 162.78 ? 242  ASN B ND2 1 
ATOM   5449 N N   . SER B 1 319 ? 110.733 17.384  -1.486  1.00 150.84 ? 243  SER B N   1 
ATOM   5450 C CA  . SER B 1 319 ? 110.317 16.937  -2.816  1.00 149.51 ? 243  SER B CA  1 
ATOM   5451 C C   . SER B 1 319 ? 111.298 15.859  -3.420  1.00 154.54 ? 243  SER B C   1 
ATOM   5452 O O   . SER B 1 319 ? 111.430 15.781  -4.647  1.00 153.90 ? 243  SER B O   1 
ATOM   5453 C CB  . SER B 1 319 ? 110.212 18.138  -3.759  1.00 153.53 ? 243  SER B CB  1 
ATOM   5454 O OG  . SER B 1 319 ? 109.519 17.791  -4.949  1.00 158.24 ? 243  SER B OG  1 
ATOM   5455 N N   . TYR B 1 320 ? 111.916 14.988  -2.560  1.00 152.12 ? 244  TYR B N   1 
ATOM   5456 C CA  . TYR B 1 320 ? 112.748 13.864  -3.046  1.00 152.80 ? 244  TYR B CA  1 
ATOM   5457 C C   . TYR B 1 320 ? 111.857 12.804  -3.722  1.00 154.17 ? 244  TYR B C   1 
ATOM   5458 O O   . TYR B 1 320 ? 110.664 12.739  -3.431  1.00 151.35 ? 244  TYR B O   1 
ATOM   5459 C CB  . TYR B 1 320 ? 113.606 13.201  -1.933  1.00 155.08 ? 244  TYR B CB  1 
ATOM   5460 C CG  . TYR B 1 320 ? 114.905 13.912  -1.588  1.00 160.61 ? 244  TYR B CG  1 
ATOM   5461 C CD1 . TYR B 1 320 ? 115.967 13.938  -2.487  1.00 164.84 ? 244  TYR B CD1 1 
ATOM   5462 C CD2 . TYR B 1 320 ? 115.149 14.367  -0.296  1.00 162.81 ? 244  TYR B CD2 1 
ATOM   5463 C CE1 . TYR B 1 320 ? 117.177 14.557  -2.166  1.00 169.45 ? 244  TYR B CE1 1 
ATOM   5464 C CE2 . TYR B 1 320 ? 116.360 14.977  0.044   1.00 167.23 ? 244  TYR B CE2 1 
ATOM   5465 C CZ  . TYR B 1 320 ? 117.372 15.072  -0.896  1.00 177.63 ? 244  TYR B CZ  1 
ATOM   5466 O OH  . TYR B 1 320 ? 118.569 15.671  -0.576  1.00 183.06 ? 244  TYR B OH  1 
ATOM   5467 N N   . GLY B 1 321 ? 112.456 11.994  -4.601  1.00 151.45 ? 245  GLY B N   1 
ATOM   5468 C CA  . GLY B 1 321 ? 111.775 10.925  -5.334  1.00 149.16 ? 245  GLY B CA  1 
ATOM   5469 C C   . GLY B 1 321 ? 111.184 9.835   -4.460  1.00 150.56 ? 245  GLY B C   1 
ATOM   5470 O O   . GLY B 1 321 ? 110.065 9.382   -4.716  1.00 147.77 ? 245  GLY B O   1 
ATOM   5471 N N   . LYS B 1 322 ? 111.936 9.401   -3.425  1.00 147.57 ? 246  LYS B N   1 
ATOM   5472 C CA  . LYS B 1 322 ? 111.487 8.371   -2.478  1.00 145.40 ? 246  LYS B CA  1 
ATOM   5473 C C   . LYS B 1 322 ? 110.366 8.912   -1.574  1.00 144.96 ? 246  LYS B C   1 
ATOM   5474 O O   . LYS B 1 322 ? 109.449 8.166   -1.219  1.00 142.81 ? 246  LYS B O   1 
ATOM   5475 C CB  . LYS B 1 322 ? 112.659 7.864   -1.621  1.00 150.18 ? 246  LYS B CB  1 
ATOM   5476 N N   . ASN B 1 323 ? 110.437 10.210  -1.219  1.00 139.65 ? 247  ASN B N   1 
ATOM   5477 C CA  . ASN B 1 323 ? 109.446 10.862  -0.361  1.00 136.50 ? 247  ASN B CA  1 
ATOM   5478 C C   . ASN B 1 323 ? 108.297 11.472  -1.195  1.00 134.34 ? 247  ASN B C   1 
ATOM   5479 O O   . ASN B 1 323 ? 107.353 12.005  -0.614  1.00 132.66 ? 247  ASN B O   1 
ATOM   5480 C CB  . ASN B 1 323 ? 110.115 11.944  0.491   1.00 140.12 ? 247  ASN B CB  1 
ATOM   5481 N N   . ARG B 1 324 ? 108.364 11.352  -2.545  1.00 127.66 ? 248  ARG B N   1 
ATOM   5482 C CA  . ARG B 1 324 ? 107.350 11.848  -3.492  1.00 124.39 ? 248  ARG B CA  1 
ATOM   5483 C C   . ARG B 1 324 ? 106.149 10.887  -3.538  1.00 121.84 ? 248  ARG B C   1 
ATOM   5484 O O   . ARG B 1 324 ? 105.004 11.333  -3.453  1.00 119.25 ? 248  ARG B O   1 
ATOM   5485 C CB  . ARG B 1 324 ? 107.981 12.010  -4.889  1.00 126.38 ? 248  ARG B CB  1 
ATOM   5486 C CG  . ARG B 1 324 ? 107.086 12.577  -5.978  1.00 135.84 ? 248  ARG B CG  1 
ATOM   5487 C CD  . ARG B 1 324 ? 107.881 12.697  -7.262  1.00 149.70 ? 248  ARG B CD  1 
ATOM   5488 N NE  . ARG B 1 324 ? 107.075 13.217  -8.364  1.00 159.72 ? 248  ARG B NE  1 
ATOM   5489 C CZ  . ARG B 1 324 ? 107.540 13.444  -9.590  1.00 176.02 ? 248  ARG B CZ  1 
ATOM   5490 N NH1 . ARG B 1 324 ? 108.815 13.207  -9.879  1.00 162.42 ? 248  ARG B NH1 1 
ATOM   5491 N NH2 . ARG B 1 324 ? 106.738 13.918  -10.533 1.00 164.83 ? 248  ARG B NH2 1 
ATOM   5492 N N   . ILE B 1 325 ? 106.425 9.571   -3.683  1.00 115.93 ? 249  ILE B N   1 
ATOM   5493 C CA  . ILE B 1 325 ? 105.437 8.487   -3.699  1.00 112.60 ? 249  ILE B CA  1 
ATOM   5494 C C   . ILE B 1 325 ? 104.610 8.539   -2.389  1.00 112.69 ? 249  ILE B C   1 
ATOM   5495 O O   . ILE B 1 325 ? 103.376 8.554   -2.442  1.00 109.88 ? 249  ILE B O   1 
ATOM   5496 C CB  . ILE B 1 325 ? 106.160 7.101   -3.890  1.00 116.53 ? 249  ILE B CB  1 
ATOM   5497 C CG1 . ILE B 1 325 ? 106.930 7.000   -5.243  1.00 118.63 ? 249  ILE B CG1 1 
ATOM   5498 C CG2 . ILE B 1 325 ? 105.212 5.916   -3.711  1.00 115.17 ? 249  ILE B CG2 1 
ATOM   5499 C CD1 . ILE B 1 325 ? 106.070 7.067   -6.584  1.00 125.32 ? 249  ILE B CD1 1 
ATOM   5500 N N   . THR B 1 326 ? 105.312 8.625   -1.232  1.00 108.84 ? 250  THR B N   1 
ATOM   5501 C CA  . THR B 1 326 ? 104.750 8.676   0.123   1.00 106.86 ? 250  THR B CA  1 
ATOM   5502 C C   . THR B 1 326 ? 103.873 9.931   0.299   1.00 108.35 ? 250  THR B C   1 
ATOM   5503 O O   . THR B 1 326 ? 102.831 9.853   0.946   1.00 106.06 ? 250  THR B O   1 
ATOM   5504 C CB  . THR B 1 326 ? 105.893 8.651   1.169   1.00 115.46 ? 250  THR B CB  1 
ATOM   5505 O OG1 . THR B 1 326 ? 106.765 7.550   0.905   1.00 116.16 ? 250  THR B OG1 1 
ATOM   5506 C CG2 . THR B 1 326 ? 105.383 8.562   2.601   1.00 112.86 ? 250  THR B CG2 1 
ATOM   5507 N N   . ARG B 1 327 ? 104.282 11.071  -0.298  1.00 105.20 ? 251  ARG B N   1 
ATOM   5508 C CA  . ARG B 1 327 ? 103.553 12.344  -0.217  1.00 103.91 ? 251  ARG B CA  1 
ATOM   5509 C C   . ARG B 1 327 ? 102.204 12.273  -0.962  1.00 103.90 ? 251  ARG B C   1 
ATOM   5510 O O   . ARG B 1 327 ? 101.181 12.678  -0.411  1.00 101.69 ? 251  ARG B O   1 
ATOM   5511 C CB  . ARG B 1 327 ? 104.405 13.489  -0.802  1.00 106.39 ? 251  ARG B CB  1 
ATOM   5512 C CG  . ARG B 1 327 ? 103.794 14.880  -0.616  1.00 114.89 ? 251  ARG B CG  1 
ATOM   5513 C CD  . ARG B 1 327 ? 104.467 15.918  -1.483  1.00 124.61 ? 251  ARG B CD  1 
ATOM   5514 N NE  . ARG B 1 327 ? 104.184 15.690  -2.899  1.00 133.23 ? 251  ARG B NE  1 
ATOM   5515 C CZ  . ARG B 1 327 ? 104.684 16.420  -3.889  1.00 152.31 ? 251  ARG B CZ  1 
ATOM   5516 N NH1 . ARG B 1 327 ? 105.520 17.420  -3.629  1.00 144.35 ? 251  ARG B NH1 1 
ATOM   5517 N NH2 . ARG B 1 327 ? 104.373 16.141  -5.148  1.00 138.81 ? 251  ARG B NH2 1 
ATOM   5518 N N   . ASP B 1 328 ? 102.223 11.794  -2.224  1.00 99.54  ? 252  ASP B N   1 
ATOM   5519 C CA  . ASP B 1 328 ? 101.045 11.713  -3.083  1.00 96.93  ? 252  ASP B CA  1 
ATOM   5520 C C   . ASP B 1 328 ? 100.024 10.694  -2.556  1.00 97.24  ? 252  ASP B C   1 
ATOM   5521 O O   . ASP B 1 328 ? 98.832  10.945  -2.699  1.00 95.69  ? 252  ASP B O   1 
ATOM   5522 C CB  . ASP B 1 328 ? 101.435 11.354  -4.525  1.00 99.52  ? 252  ASP B CB  1 
ATOM   5523 C CG  . ASP B 1 328 ? 102.237 12.424  -5.257  1.00 111.27 ? 252  ASP B CG  1 
ATOM   5524 O OD1 . ASP B 1 328 ? 102.654 13.416  -4.604  1.00 112.75 ? 252  ASP B OD1 1 
ATOM   5525 O OD2 . ASP B 1 328 ? 102.441 12.277  -6.479  1.00 117.83 ? 252  ASP B OD2 1 
ATOM   5526 N N   . GLN B 1 329 ? 100.464 9.580   -1.926  1.00 92.50  ? 253  GLN B N   1 
ATOM   5527 C CA  . GLN B 1 329 ? 99.524  8.588   -1.383  1.00 89.94  ? 253  GLN B CA  1 
ATOM   5528 C C   . GLN B 1 329 ? 98.760  9.174   -0.177  1.00 90.77  ? 253  GLN B C   1 
ATOM   5529 O O   . GLN B 1 329 ? 97.596  8.830   0.011   1.00 88.69  ? 253  GLN B O   1 
ATOM   5530 C CB  . GLN B 1 329 ? 100.212 7.268   -0.990  1.00 92.11  ? 253  GLN B CB  1 
ATOM   5531 C CG  . GLN B 1 329 ? 100.746 6.490   -2.196  1.00 111.94 ? 253  GLN B CG  1 
ATOM   5532 C CD  . GLN B 1 329 ? 101.220 5.095   -1.876  1.00 134.38 ? 253  GLN B CD  1 
ATOM   5533 O OE1 . GLN B 1 329 ? 100.597 4.361   -1.100  1.00 128.63 ? 253  GLN B OE1 1 
ATOM   5534 N NE2 . GLN B 1 329 ? 102.206 4.627   -2.631  1.00 129.97 ? 253  GLN B NE2 1 
ATOM   5535 N N   . VAL B 1 330 ? 99.389  10.085  0.598   1.00 87.20  ? 254  VAL B N   1 
ATOM   5536 C CA  . VAL B 1 330 ? 98.743  10.779  1.724   1.00 85.77  ? 254  VAL B CA  1 
ATOM   5537 C C   . VAL B 1 330 ? 97.682  11.745  1.141   1.00 87.68  ? 254  VAL B C   1 
ATOM   5538 O O   . VAL B 1 330 ? 96.573  11.832  1.672   1.00 85.91  ? 254  VAL B O   1 
ATOM   5539 C CB  . VAL B 1 330 ? 99.778  11.505  2.638   1.00 91.38  ? 254  VAL B CB  1 
ATOM   5540 C CG1 . VAL B 1 330 ? 99.093  12.337  3.714   1.00 90.64  ? 254  VAL B CG1 1 
ATOM   5541 C CG2 . VAL B 1 330 ? 100.735 10.505  3.279   1.00 92.47  ? 254  VAL B CG2 1 
ATOM   5542 N N   . LEU B 1 331 ? 98.016  12.414  0.016   1.00 84.24  ? 255  LEU B N   1 
ATOM   5543 C CA  . LEU B 1 331 ? 97.120  13.331  -0.692  1.00 82.90  ? 255  LEU B CA  1 
ATOM   5544 C C   . LEU B 1 331 ? 95.956  12.572  -1.330  1.00 85.04  ? 255  LEU B C   1 
ATOM   5545 O O   . LEU B 1 331 ? 94.849  13.111  -1.375  1.00 83.94  ? 255  LEU B O   1 
ATOM   5546 C CB  . LEU B 1 331 ? 97.870  14.137  -1.767  1.00 84.29  ? 255  LEU B CB  1 
ATOM   5547 C CG  . LEU B 1 331 ? 98.909  15.156  -1.268  1.00 91.11  ? 255  LEU B CG  1 
ATOM   5548 C CD1 . LEU B 1 331 ? 99.732  15.718  -2.414  1.00 92.81  ? 255  LEU B CD1 1 
ATOM   5549 C CD2 . LEU B 1 331 ? 98.258  16.274  -0.486  1.00 93.34  ? 255  LEU B CD2 1 
ATOM   5550 N N   . LYS B 1 332 ? 96.196  11.325  -1.811  1.00 80.91  ? 256  LYS B N   1 
ATOM   5551 C CA  . LYS B 1 332 ? 95.149  10.469  -2.393  1.00 79.03  ? 256  LYS B CA  1 
ATOM   5552 C C   . LYS B 1 332 ? 94.126  10.089  -1.321  1.00 81.43  ? 256  LYS B C   1 
ATOM   5553 O O   . LYS B 1 332 ? 92.925  10.122  -1.590  1.00 80.36  ? 256  LYS B O   1 
ATOM   5554 C CB  . LYS B 1 332 ? 95.730  9.203   -3.050  1.00 82.09  ? 256  LYS B CB  1 
ATOM   5555 C CG  . LYS B 1 332 ? 96.530  9.454   -4.324  1.00 102.76 ? 256  LYS B CG  1 
ATOM   5556 C CD  . LYS B 1 332 ? 97.073  8.145   -4.915  1.00 114.45 ? 256  LYS B CD  1 
ATOM   5557 C CE  . LYS B 1 332 ? 97.895  8.334   -6.174  1.00 125.70 ? 256  LYS B CE  1 
ATOM   5558 N NZ  . LYS B 1 332 ? 99.142  9.111   -5.930  1.00 135.41 ? 256  LYS B NZ  1 
ATOM   5559 N N   . MET B 1 333 ? 94.603  9.766   -0.096  1.00 77.58  ? 257  MET B N   1 
ATOM   5560 C CA  . MET B 1 333 ? 93.754  9.437   1.056   1.00 76.30  ? 257  MET B CA  1 
ATOM   5561 C C   . MET B 1 333 ? 92.981  10.674  1.536   1.00 79.10  ? 257  MET B C   1 
ATOM   5562 O O   . MET B 1 333 ? 91.863  10.544  2.048   1.00 77.49  ? 257  MET B O   1 
ATOM   5563 C CB  . MET B 1 333 ? 94.589  8.861   2.210   1.00 79.67  ? 257  MET B CB  1 
ATOM   5564 C CG  . MET B 1 333 ? 95.232  7.534   1.892   1.00 84.23  ? 257  MET B CG  1 
ATOM   5565 S SD  . MET B 1 333 ? 96.263  6.953   3.260   1.00 90.30  ? 257  MET B SD  1 
ATOM   5566 C CE  . MET B 1 333 ? 96.875  5.472   2.593   1.00 87.61  ? 257  MET B CE  1 
ATOM   5567 N N   . ALA B 1 334 ? 93.592  11.869  1.368   1.00 75.22  ? 258  ALA B N   1 
ATOM   5568 C CA  . ALA B 1 334 ? 93.034  13.163  1.757   1.00 73.81  ? 258  ALA B CA  1 
ATOM   5569 C C   . ALA B 1 334 ? 91.946  13.620  0.765   1.00 74.88  ? 258  ALA B C   1 
ATOM   5570 O O   . ALA B 1 334 ? 90.914  14.143  1.186   1.00 72.84  ? 258  ALA B O   1 
ATOM   5571 C CB  . ALA B 1 334 ? 94.151  14.202  1.835   1.00 75.96  ? 258  ALA B CB  1 
ATOM   5572 N N   . ALA B 1 335 ? 92.182  13.430  -0.544  1.00 71.41  ? 259  ALA B N   1 
ATOM   5573 C CA  . ALA B 1 335 ? 91.242  13.824  -1.593  1.00 70.63  ? 259  ALA B CA  1 
ATOM   5574 C C   . ALA B 1 335 ? 90.045  12.886  -1.644  1.00 74.22  ? 259  ALA B C   1 
ATOM   5575 O O   . ALA B 1 335 ? 89.003  13.253  -2.180  1.00 73.29  ? 259  ALA B O   1 
ATOM   5576 C CB  . ALA B 1 335 ? 91.945  13.834  -2.940  1.00 72.41  ? 259  ALA B CB  1 
ATOM   5577 N N   . ALA B 1 336 ? 90.197  11.666  -1.107  1.00 71.31  ? 260  ALA B N   1 
ATOM   5578 C CA  . ALA B 1 336 ? 89.147  10.658  -1.116  1.00 70.05  ? 260  ALA B CA  1 
ATOM   5579 C C   . ALA B 1 336 ? 88.056  10.967  -0.084  1.00 74.62  ? 260  ALA B C   1 
ATOM   5580 O O   . ALA B 1 336 ? 86.905  10.601  -0.319  1.00 73.75  ? 260  ALA B O   1 
ATOM   5581 C CB  . ALA B 1 336 ? 89.742  9.287   -0.844  1.00 70.94  ? 260  ALA B CB  1 
ATOM   5582 N N   . VAL B 1 337 ? 88.395  11.634  1.046   1.00 72.30  ? 261  VAL B N   1 
ATOM   5583 C CA  . VAL B 1 337 ? 87.391  11.917  2.084   1.00 71.97  ? 261  VAL B CA  1 
ATOM   5584 C C   . VAL B 1 337 ? 86.497  13.112  1.643   1.00 76.22  ? 261  VAL B C   1 
ATOM   5585 O O   . VAL B 1 337 ? 85.314  13.117  1.989   1.00 76.14  ? 261  VAL B O   1 
ATOM   5586 C CB  . VAL B 1 337 ? 87.974  12.168  3.509   1.00 76.66  ? 261  VAL B CB  1 
ATOM   5587 C CG1 . VAL B 1 337 ? 88.701  10.934  4.036   1.00 76.61  ? 261  VAL B CG1 1 
ATOM   5588 C CG2 . VAL B 1 337 ? 88.878  13.394  3.560   1.00 77.84  ? 261  VAL B CG2 1 
ATOM   5589 N N   . VAL B 1 338 ? 87.039  14.084  0.865   1.00 72.38  ? 262  VAL B N   1 
ATOM   5590 C CA  . VAL B 1 338 ? 86.273  15.254  0.410   1.00 71.18  ? 262  VAL B CA  1 
ATOM   5591 C C   . VAL B 1 338 ? 85.403  14.836  -0.815  1.00 73.39  ? 262  VAL B C   1 
ATOM   5592 O O   . VAL B 1 338 ? 84.207  15.131  -0.812  1.00 72.83  ? 262  VAL B O   1 
ATOM   5593 C CB  . VAL B 1 338 ? 87.166  16.509  0.106   1.00 76.16  ? 262  VAL B CB  1 
ATOM   5594 C CG1 . VAL B 1 338 ? 88.306  16.208  -0.860  1.00 77.26  ? 262  VAL B CG1 1 
ATOM   5595 C CG2 . VAL B 1 338 ? 86.339  17.694  -0.373  1.00 75.65  ? 262  VAL B CG2 1 
ATOM   5596 N N   . LEU B 1 339 ? 85.978  14.122  -1.811  1.00 69.32  ? 263  LEU B N   1 
ATOM   5597 C CA  . LEU B 1 339 ? 85.256  13.672  -3.012  1.00 68.91  ? 263  LEU B CA  1 
ATOM   5598 C C   . LEU B 1 339 ? 84.089  12.718  -2.675  1.00 70.55  ? 263  LEU B C   1 
ATOM   5599 O O   . LEU B 1 339 ? 83.014  12.879  -3.251  1.00 69.47  ? 263  LEU B O   1 
ATOM   5600 C CB  . LEU B 1 339 ? 86.197  12.974  -4.009  1.00 70.23  ? 263  LEU B CB  1 
ATOM   5601 C CG  . LEU B 1 339 ? 86.814  13.817  -5.145  1.00 77.09  ? 263  LEU B CG  1 
ATOM   5602 C CD1 . LEU B 1 339 ? 87.607  15.022  -4.628  1.00 78.84  ? 263  LEU B CD1 1 
ATOM   5603 C CD2 . LEU B 1 339 ? 87.695  12.957  -6.027  1.00 80.71  ? 263  LEU B CD2 1 
ATOM   5604 N N   . ALA B 1 340 ? 84.290  11.749  -1.749  1.00 66.24  ? 264  ALA B N   1 
ATOM   5605 C CA  . ALA B 1 340 ? 83.245  10.796  -1.348  1.00 65.02  ? 264  ALA B CA  1 
ATOM   5606 C C   . ALA B 1 340 ? 82.055  11.513  -0.699  1.00 68.44  ? 264  ALA B C   1 
ATOM   5607 O O   . ALA B 1 340 ? 80.907  11.185  -1.002  1.00 68.30  ? 264  ALA B O   1 
ATOM   5608 C CB  . ALA B 1 340 ? 83.806  9.761   -0.389  1.00 65.95  ? 264  ALA B CB  1 
ATOM   5609 N N   . PHE B 1 341 ? 82.326  12.514  0.160   1.00 64.06  ? 265  PHE B N   1 
ATOM   5610 C CA  . PHE B 1 341 ? 81.286  13.285  0.836   1.00 62.52  ? 265  PHE B CA  1 
ATOM   5611 C C   . PHE B 1 341 ? 80.465  14.086  -0.188  1.00 65.25  ? 265  PHE B C   1 
ATOM   5612 O O   . PHE B 1 341 ? 79.239  14.124  -0.076  1.00 64.45  ? 265  PHE B O   1 
ATOM   5613 C CB  . PHE B 1 341 ? 81.912  14.219  1.890   1.00 64.59  ? 265  PHE B CB  1 
ATOM   5614 C CG  . PHE B 1 341 ? 80.928  14.957  2.771   1.00 65.55  ? 265  PHE B CG  1 
ATOM   5615 C CD1 . PHE B 1 341 ? 80.433  14.371  3.929   1.00 67.30  ? 265  PHE B CD1 1 
ATOM   5616 C CD2 . PHE B 1 341 ? 80.555  16.266  2.482   1.00 67.90  ? 265  PHE B CD2 1 
ATOM   5617 C CE1 . PHE B 1 341 ? 79.544  15.062  4.753   1.00 68.14  ? 265  PHE B CE1 1 
ATOM   5618 C CE2 . PHE B 1 341 ? 79.671  16.957  3.311   1.00 70.28  ? 265  PHE B CE2 1 
ATOM   5619 C CZ  . PHE B 1 341 ? 79.172  16.350  4.442   1.00 67.67  ? 265  PHE B CZ  1 
ATOM   5620 N N   . ILE B 1 342 ? 81.133  14.691  -1.195  1.00 61.89  ? 266  ILE B N   1 
ATOM   5621 C CA  . ILE B 1 342 ? 80.470  15.493  -2.236  1.00 61.77  ? 266  ILE B CA  1 
ATOM   5622 C C   . ILE B 1 342 ? 79.626  14.557  -3.141  1.00 66.08  ? 266  ILE B C   1 
ATOM   5623 O O   . ILE B 1 342 ? 78.439  14.825  -3.323  1.00 66.62  ? 266  ILE B O   1 
ATOM   5624 C CB  . ILE B 1 342 ? 81.487  16.344  -3.070  1.00 65.29  ? 266  ILE B CB  1 
ATOM   5625 C CG1 . ILE B 1 342 ? 82.226  17.359  -2.160  1.00 65.72  ? 266  ILE B CG1 1 
ATOM   5626 C CG2 . ILE B 1 342 ? 80.786  17.073  -4.229  1.00 65.78  ? 266  ILE B CG2 1 
ATOM   5627 C CD1 . ILE B 1 342 ? 83.360  18.149  -2.802  1.00 68.28  ? 266  ILE B CD1 1 
ATOM   5628 N N   . ILE B 1 343 ? 80.208  13.459  -3.661  1.00 61.50  ? 267  ILE B N   1 
ATOM   5629 C CA  . ILE B 1 343 ? 79.488  12.531  -4.546  1.00 60.86  ? 267  ILE B CA  1 
ATOM   5630 C C   . ILE B 1 343 ? 78.220  11.981  -3.841  1.00 64.52  ? 267  ILE B C   1 
ATOM   5631 O O   . ILE B 1 343 ? 77.165  11.930  -4.473  1.00 64.87  ? 267  ILE B O   1 
ATOM   5632 C CB  . ILE B 1 343 ? 80.407  11.359  -5.022  1.00 64.05  ? 267  ILE B CB  1 
ATOM   5633 C CG1 . ILE B 1 343 ? 81.553  11.897  -5.921  1.00 64.84  ? 267  ILE B CG1 1 
ATOM   5634 C CG2 . ILE B 1 343 ? 79.591  10.284  -5.783  1.00 65.08  ? 267  ILE B CG2 1 
ATOM   5635 C CD1 . ILE B 1 343 ? 82.603  10.895  -6.314  1.00 72.72  ? 267  ILE B CD1 1 
ATOM   5636 N N   . CYS B 1 344 ? 78.312  11.628  -2.541  1.00 60.68  ? 268  CYS B N   1 
ATOM   5637 C CA  . CYS B 1 344 ? 77.212  11.000  -1.798  1.00 59.68  ? 268  CYS B CA  1 
ATOM   5638 C C   . CYS B 1 344 ? 76.162  12.016  -1.316  1.00 64.44  ? 268  CYS B C   1 
ATOM   5639 O O   . CYS B 1 344 ? 74.988  11.642  -1.265  1.00 65.55  ? 268  CYS B O   1 
ATOM   5640 C CB  . CYS B 1 344 ? 77.755  10.221  -0.613  1.00 59.27  ? 268  CYS B CB  1 
ATOM   5641 S SG  . CYS B 1 344 ? 78.698  8.750   -1.073  1.00 63.25  ? 268  CYS B SG  1 
ATOM   5642 N N   . TRP B 1 345 ? 76.545  13.245  -0.922  1.00 61.03  ? 269  TRP B N   1 
ATOM   5643 C CA  . TRP B 1 345 ? 75.545  14.169  -0.368  1.00 60.92  ? 269  TRP B CA  1 
ATOM   5644 C C   . TRP B 1 345 ? 75.161  15.353  -1.302  1.00 64.09  ? 269  TRP B C   1 
ATOM   5645 O O   . TRP B 1 345 ? 74.084  15.901  -1.096  1.00 63.14  ? 269  TRP B O   1 
ATOM   5646 C CB  . TRP B 1 345 ? 76.028  14.768  0.956   1.00 60.05  ? 269  TRP B CB  1 
ATOM   5647 C CG  . TRP B 1 345 ? 75.977  13.792  2.095   1.00 60.82  ? 269  TRP B CG  1 
ATOM   5648 C CD1 . TRP B 1 345 ? 77.018  13.088  2.621   1.00 63.67  ? 269  TRP B CD1 1 
ATOM   5649 C CD2 . TRP B 1 345 ? 74.793  13.321  2.763   1.00 60.49  ? 269  TRP B CD2 1 
ATOM   5650 N NE1 . TRP B 1 345 ? 76.569  12.265  3.631   1.00 62.80  ? 269  TRP B NE1 1 
ATOM   5651 C CE2 . TRP B 1 345 ? 75.204  12.379  3.728   1.00 64.29  ? 269  TRP B CE2 1 
ATOM   5652 C CE3 . TRP B 1 345 ? 73.422  13.622  2.653   1.00 61.75  ? 269  TRP B CE3 1 
ATOM   5653 C CZ2 . TRP B 1 345 ? 74.297  11.743  4.584   1.00 63.92  ? 269  TRP B CZ2 1 
ATOM   5654 C CZ3 . TRP B 1 345 ? 72.525  12.989  3.499   1.00 63.27  ? 269  TRP B CZ3 1 
ATOM   5655 C CH2 . TRP B 1 345 ? 72.963  12.066  4.453   1.00 64.02  ? 269  TRP B CH2 1 
ATOM   5656 N N   . LEU B 1 346 ? 75.993  15.751  -2.293  1.00 61.15  ? 270  LEU B N   1 
ATOM   5657 C CA  . LEU B 1 346 ? 75.647  16.893  -3.158  1.00 61.18  ? 270  LEU B CA  1 
ATOM   5658 C C   . LEU B 1 346 ? 74.309  16.644  -3.930  1.00 65.07  ? 270  LEU B C   1 
ATOM   5659 O O   . LEU B 1 346 ? 73.488  17.568  -3.928  1.00 65.19  ? 270  LEU B O   1 
ATOM   5660 C CB  . LEU B 1 346 ? 76.765  17.235  -4.158  1.00 61.84  ? 270  LEU B CB  1 
ATOM   5661 C CG  . LEU B 1 346 ? 76.551  18.463  -5.062  1.00 67.46  ? 270  LEU B CG  1 
ATOM   5662 C CD1 . LEU B 1 346 ? 76.329  19.741  -4.243  1.00 67.61  ? 270  LEU B CD1 1 
ATOM   5663 C CD2 . LEU B 1 346 ? 77.728  18.647  -5.999  1.00 71.01  ? 270  LEU B CD2 1 
ATOM   5664 N N   . PRO B 1 347 ? 74.020  15.446  -4.541  1.00 60.56  ? 271  PRO B N   1 
ATOM   5665 C CA  . PRO B 1 347 ? 72.730  15.282  -5.248  1.00 59.97  ? 271  PRO B CA  1 
ATOM   5666 C C   . PRO B 1 347 ? 71.512  15.584  -4.351  1.00 64.09  ? 271  PRO B C   1 
ATOM   5667 O O   . PRO B 1 347 ? 70.606  16.291  -4.800  1.00 64.96  ? 271  PRO B O   1 
ATOM   5668 C CB  . PRO B 1 347 ? 72.741  13.813  -5.667  1.00 61.27  ? 271  PRO B CB  1 
ATOM   5669 C CG  . PRO B 1 347 ? 74.169  13.474  -5.780  1.00 65.92  ? 271  PRO B CG  1 
ATOM   5670 C CD  . PRO B 1 347 ? 74.849  14.229  -4.681  1.00 61.51  ? 271  PRO B CD  1 
ATOM   5671 N N   . PHE B 1 348 ? 71.511  15.107  -3.083  1.00 59.37  ? 272  PHE B N   1 
ATOM   5672 C CA  . PHE B 1 348 ? 70.415  15.344  -2.149  1.00 58.64  ? 272  PHE B CA  1 
ATOM   5673 C C   . PHE B 1 348 ? 70.220  16.845  -1.854  1.00 64.27  ? 272  PHE B C   1 
ATOM   5674 O O   . PHE B 1 348 ? 69.079  17.314  -1.859  1.00 65.87  ? 272  PHE B O   1 
ATOM   5675 C CB  . PHE B 1 348 ? 70.628  14.598  -0.824  1.00 59.88  ? 272  PHE B CB  1 
ATOM   5676 C CG  . PHE B 1 348 ? 69.555  14.900  0.203   1.00 61.72  ? 272  PHE B CG  1 
ATOM   5677 C CD1 . PHE B 1 348 ? 68.342  14.214  0.192   1.00 65.01  ? 272  PHE B CD1 1 
ATOM   5678 C CD2 . PHE B 1 348 ? 69.742  15.899  1.156   1.00 64.40  ? 272  PHE B CD2 1 
ATOM   5679 C CE1 . PHE B 1 348 ? 67.338  14.521  1.112   1.00 66.42  ? 272  PHE B CE1 1 
ATOM   5680 C CE2 . PHE B 1 348 ? 68.736  16.207  2.076   1.00 67.34  ? 272  PHE B CE2 1 
ATOM   5681 C CZ  . PHE B 1 348 ? 67.539  15.519  2.043   1.00 65.79  ? 272  PHE B CZ  1 
ATOM   5682 N N   . HIS B 1 349 ? 71.307  17.580  -1.553  1.00 59.33  ? 273  HIS B N   1 
ATOM   5683 C CA  . HIS B 1 349 ? 71.219  18.991  -1.178  1.00 58.55  ? 273  HIS B CA  1 
ATOM   5684 C C   . HIS B 1 349 ? 70.924  19.879  -2.402  1.00 63.20  ? 273  HIS B C   1 
ATOM   5685 O O   . HIS B 1 349 ? 70.346  20.955  -2.223  1.00 63.81  ? 273  HIS B O   1 
ATOM   5686 C CB  . HIS B 1 349 ? 72.494  19.444  -0.476  1.00 59.08  ? 273  HIS B CB  1 
ATOM   5687 C CG  . HIS B 1 349 ? 72.645  18.784  0.857   1.00 61.84  ? 273  HIS B CG  1 
ATOM   5688 N ND1 . HIS B 1 349 ? 72.022  19.290  1.982   1.00 63.50  ? 273  HIS B ND1 1 
ATOM   5689 C CD2 . HIS B 1 349 ? 73.252  17.622  1.181   1.00 63.46  ? 273  HIS B CD2 1 
ATOM   5690 C CE1 . HIS B 1 349 ? 72.295  18.441  2.955   1.00 62.93  ? 273  HIS B CE1 1 
ATOM   5691 N NE2 . HIS B 1 349 ? 73.035  17.421  2.521   1.00 63.15  ? 273  HIS B NE2 1 
ATOM   5692 N N   . VAL B 1 350 ? 71.223  19.409  -3.632  1.00 60.21  ? 274  VAL B N   1 
ATOM   5693 C CA  . VAL B 1 350 ? 70.862  20.158  -4.846  1.00 61.02  ? 274  VAL B CA  1 
ATOM   5694 C C   . VAL B 1 350 ? 69.332  20.154  -4.958  1.00 64.12  ? 274  VAL B C   1 
ATOM   5695 O O   . VAL B 1 350 ? 68.728  21.222  -5.075  1.00 65.14  ? 274  VAL B O   1 
ATOM   5696 C CB  . VAL B 1 350 ? 71.551  19.617  -6.140  1.00 65.26  ? 274  VAL B CB  1 
ATOM   5697 C CG1 . VAL B 1 350 ? 70.896  20.182  -7.409  1.00 65.93  ? 274  VAL B CG1 1 
ATOM   5698 C CG2 . VAL B 1 350 ? 73.054  19.899  -6.129  1.00 64.91  ? 274  VAL B CG2 1 
ATOM   5699 N N   . LEU B 1 351 ? 68.716  18.960  -4.827  1.00 58.73  ? 275  LEU B N   1 
ATOM   5700 C CA  . LEU B 1 351 ? 67.257  18.762  -4.897  1.00 58.10  ? 275  LEU B CA  1 
ATOM   5701 C C   . LEU B 1 351 ? 66.537  19.472  -3.746  1.00 61.96  ? 275  LEU B C   1 
ATOM   5702 O O   . LEU B 1 351 ? 65.433  19.971  -3.958  1.00 63.01  ? 275  LEU B O   1 
ATOM   5703 C CB  . LEU B 1 351 ? 66.904  17.265  -4.875  1.00 57.10  ? 275  LEU B CB  1 
ATOM   5704 C CG  . LEU B 1 351 ? 67.490  16.396  -5.997  1.00 60.91  ? 275  LEU B CG  1 
ATOM   5705 C CD1 . LEU B 1 351 ? 67.221  14.952  -5.742  1.00 60.91  ? 275  LEU B CD1 1 
ATOM   5706 C CD2 . LEU B 1 351 ? 66.956  16.798  -7.366  1.00 63.06  ? 275  LEU B CD2 1 
ATOM   5707 N N   . THR B 1 352 ? 67.163  19.519  -2.538  1.00 56.98  ? 276  THR B N   1 
ATOM   5708 C CA  . THR B 1 352 ? 66.634  20.176  -1.332  1.00 56.62  ? 276  THR B CA  1 
ATOM   5709 C C   . THR B 1 352 ? 66.622  21.707  -1.539  1.00 63.56  ? 276  THR B C   1 
ATOM   5710 O O   . THR B 1 352 ? 65.666  22.370  -1.124  1.00 64.55  ? 276  THR B O   1 
ATOM   5711 C CB  . THR B 1 352 ? 67.460  19.773  -0.102  1.00 59.11  ? 276  THR B CB  1 
ATOM   5712 O OG1 . THR B 1 352 ? 67.389  18.361  0.049   1.00 60.44  ? 276  THR B OG1 1 
ATOM   5713 C CG2 . THR B 1 352 ? 66.975  20.420  1.175   1.00 55.99  ? 276  THR B CG2 1 
ATOM   5714 N N   . PHE B 1 353 ? 67.674  22.265  -2.181  1.00 60.52  ? 277  PHE B N   1 
ATOM   5715 C CA  . PHE B 1 353 ? 67.742  23.698  -2.453  1.00 60.85  ? 277  PHE B CA  1 
ATOM   5716 C C   . PHE B 1 353 ? 66.703  24.070  -3.532  1.00 66.03  ? 277  PHE B C   1 
ATOM   5717 O O   . PHE B 1 353 ? 66.048  25.109  -3.404  1.00 67.59  ? 277  PHE B O   1 
ATOM   5718 C CB  . PHE B 1 353 ? 69.160  24.127  -2.870  1.00 62.65  ? 277  PHE B CB  1 
ATOM   5719 C CG  . PHE B 1 353 ? 69.281  25.603  -3.192  1.00 64.96  ? 277  PHE B CG  1 
ATOM   5720 C CD1 . PHE B 1 353 ? 69.315  26.555  -2.178  1.00 68.41  ? 277  PHE B CD1 1 
ATOM   5721 C CD2 . PHE B 1 353 ? 69.397  26.038  -4.506  1.00 67.84  ? 277  PHE B CD2 1 
ATOM   5722 C CE1 . PHE B 1 353 ? 69.398  27.923  -2.478  1.00 70.68  ? 277  PHE B CE1 1 
ATOM   5723 C CE2 . PHE B 1 353 ? 69.504  27.405  -4.803  1.00 72.05  ? 277  PHE B CE2 1 
ATOM   5724 C CZ  . PHE B 1 353 ? 69.501  28.337  -3.787  1.00 70.38  ? 277  PHE B CZ  1 
ATOM   5725 N N   . LEU B 1 354 ? 66.529  23.209  -4.565  1.00 61.39  ? 278  LEU B N   1 
ATOM   5726 C CA  . LEU B 1 354 ? 65.526  23.414  -5.619  1.00 61.55  ? 278  LEU B CA  1 
ATOM   5727 C C   . LEU B 1 354 ? 64.113  23.319  -5.032  1.00 66.88  ? 278  LEU B C   1 
ATOM   5728 O O   . LEU B 1 354 ? 63.237  24.082  -5.440  1.00 67.74  ? 278  LEU B O   1 
ATOM   5729 C CB  . LEU B 1 354 ? 65.698  22.408  -6.763  1.00 61.16  ? 278  LEU B CB  1 
ATOM   5730 C CG  . LEU B 1 354 ? 66.969  22.492  -7.601  1.00 65.27  ? 278  LEU B CG  1 
ATOM   5731 C CD1 . LEU B 1 354 ? 67.053  21.339  -8.560  1.00 65.37  ? 278  LEU B CD1 1 
ATOM   5732 C CD2 . LEU B 1 354 ? 67.047  23.794  -8.365  1.00 68.53  ? 278  LEU B CD2 1 
ATOM   5733 N N   . ASP B 1 355 ? 63.909  22.400  -4.044  1.00 62.98  ? 279  ASP B N   1 
ATOM   5734 C CA  . ASP B 1 355 ? 62.651  22.230  -3.302  1.00 63.40  ? 279  ASP B CA  1 
ATOM   5735 C C   . ASP B 1 355 ? 62.308  23.506  -2.530  1.00 69.54  ? 279  ASP B C   1 
ATOM   5736 O O   . ASP B 1 355 ? 61.159  23.946  -2.557  1.00 71.30  ? 279  ASP B O   1 
ATOM   5737 C CB  . ASP B 1 355 ? 62.736  21.037  -2.334  1.00 64.31  ? 279  ASP B CB  1 
ATOM   5738 C CG  . ASP B 1 355 ? 61.505  20.831  -1.455  1.00 74.07  ? 279  ASP B CG  1 
ATOM   5739 O OD1 . ASP B 1 355 ? 60.372  20.963  -1.972  1.00 74.96  ? 279  ASP B OD1 1 
ATOM   5740 O OD2 . ASP B 1 355 ? 61.674  20.451  -0.280  1.00 79.56  ? 279  ASP B OD2 1 
ATOM   5741 N N   . ALA B 1 356 ? 63.309  24.099  -1.846  1.00 65.08  ? 280  ALA B N   1 
ATOM   5742 C CA  . ALA B 1 356 ? 63.150  25.338  -1.087  1.00 65.29  ? 280  ALA B CA  1 
ATOM   5743 C C   . ALA B 1 356 ? 62.695  26.475  -1.996  1.00 71.45  ? 280  ALA B C   1 
ATOM   5744 O O   . ALA B 1 356 ? 61.805  27.237  -1.601  1.00 72.70  ? 280  ALA B O   1 
ATOM   5745 C CB  . ALA B 1 356 ? 64.451  25.706  -0.401  1.00 65.53  ? 280  ALA B CB  1 
ATOM   5746 N N   . LEU B 1 357 ? 63.269  26.564  -3.234  1.00 67.67  ? 281  LEU B N   1 
ATOM   5747 C CA  . LEU B 1 357 ? 62.912  27.596  -4.224  1.00 68.34  ? 281  LEU B CA  1 
ATOM   5748 C C   . LEU B 1 357 ? 61.463  27.413  -4.697  1.00 72.73  ? 281  LEU B C   1 
ATOM   5749 O O   . LEU B 1 357 ? 60.794  28.403  -4.977  1.00 73.44  ? 281  LEU B O   1 
ATOM   5750 C CB  . LEU B 1 357 ? 63.871  27.584  -5.434  1.00 68.07  ? 281  LEU B CB  1 
ATOM   5751 C CG  . LEU B 1 357 ? 65.341  27.958  -5.166  1.00 70.62  ? 281  LEU B CG  1 
ATOM   5752 C CD1 . LEU B 1 357 ? 66.189  27.705  -6.377  1.00 69.68  ? 281  LEU B CD1 1 
ATOM   5753 C CD2 . LEU B 1 357 ? 65.477  29.400  -4.722  1.00 72.43  ? 281  LEU B CD2 1 
ATOM   5754 N N   . ALA B 1 358 ? 60.973  26.154  -4.747  1.00 68.35  ? 282  ALA B N   1 
ATOM   5755 C CA  . ALA B 1 358 ? 59.590  25.851  -5.112  1.00 68.56  ? 282  ALA B CA  1 
ATOM   5756 C C   . ALA B 1 358 ? 58.621  26.386  -4.043  1.00 74.72  ? 282  ALA B C   1 
ATOM   5757 O O   . ALA B 1 358 ? 57.597  26.972  -4.400  1.00 76.08  ? 282  ALA B O   1 
ATOM   5758 C CB  . ALA B 1 358 ? 59.409  24.359  -5.299  1.00 68.37  ? 282  ALA B CB  1 
ATOM   5759 N N   . TRP B 1 359 ? 58.971  26.239  -2.739  1.00 71.17  ? 283  TRP B N   1 
ATOM   5760 C CA  . TRP B 1 359 ? 58.162  26.758  -1.629  1.00 71.74  ? 283  TRP B CA  1 
ATOM   5761 C C   . TRP B 1 359 ? 58.231  28.286  -1.559  1.00 78.01  ? 283  TRP B C   1 
ATOM   5762 O O   . TRP B 1 359 ? 57.261  28.909  -1.128  1.00 80.35  ? 283  TRP B O   1 
ATOM   5763 C CB  . TRP B 1 359 ? 58.581  26.164  -0.276  1.00 69.53  ? 283  TRP B CB  1 
ATOM   5764 C CG  . TRP B 1 359 ? 58.253  24.710  -0.120  1.00 69.73  ? 283  TRP B CG  1 
ATOM   5765 C CD1 . TRP B 1 359 ? 59.121  23.660  -0.178  1.00 71.56  ? 283  TRP B CD1 1 
ATOM   5766 C CD2 . TRP B 1 359 ? 56.944  24.141  0.031   1.00 69.93  ? 283  TRP B CD2 1 
ATOM   5767 N NE1 . TRP B 1 359 ? 58.440  22.474  -0.025  1.00 70.77  ? 283  TRP B NE1 1 
ATOM   5768 C CE2 . TRP B 1 359 ? 57.100  22.741  0.096   1.00 72.86  ? 283  TRP B CE2 1 
ATOM   5769 C CE3 . TRP B 1 359 ? 55.650  24.683  0.131   1.00 72.22  ? 283  TRP B CE3 1 
ATOM   5770 C CZ2 . TRP B 1 359 ? 56.018  21.878  0.267   1.00 72.54  ? 283  TRP B CZ2 1 
ATOM   5771 C CZ3 . TRP B 1 359 ? 54.577  23.825  0.290   1.00 73.83  ? 283  TRP B CZ3 1 
ATOM   5772 C CH2 . TRP B 1 359 ? 54.765  22.444  0.365   1.00 73.71  ? 283  TRP B CH2 1 
ATOM   5773 N N   . MET B 1 360 ? 59.355  28.889  -1.994  1.00 73.92  ? 284  MET B N   1 
ATOM   5774 C CA  . MET B 1 360 ? 59.530  30.348  -2.028  1.00 75.15  ? 284  MET B CA  1 
ATOM   5775 C C   . MET B 1 360 ? 58.765  30.984  -3.210  1.00 78.37  ? 284  MET B C   1 
ATOM   5776 O O   . MET B 1 360 ? 58.639  32.209  -3.275  1.00 79.47  ? 284  MET B O   1 
ATOM   5777 C CB  . MET B 1 360 ? 61.016  30.714  -2.119  1.00 77.78  ? 284  MET B CB  1 
ATOM   5778 C CG  . MET B 1 360 ? 61.784  30.406  -0.861  1.00 81.54  ? 284  MET B CG  1 
ATOM   5779 S SD  . MET B 1 360 ? 63.549  30.730  -1.036  1.00 86.65  ? 284  MET B SD  1 
ATOM   5780 C CE  . MET B 1 360 ? 64.095  30.324  0.583   1.00 82.87  ? 284  MET B CE  1 
ATOM   5781 N N   . GLY B 1 361 ? 58.274  30.148  -4.123  1.00 72.91  ? 285  GLY B N   1 
ATOM   5782 C CA  . GLY B 1 361 ? 57.531  30.583  -5.297  1.00 73.21  ? 285  GLY B CA  1 
ATOM   5783 C C   . GLY B 1 361 ? 58.408  30.904  -6.484  1.00 76.22  ? 285  GLY B C   1 
ATOM   5784 O O   . GLY B 1 361 ? 57.924  31.457  -7.472  1.00 77.72  ? 285  GLY B O   1 
ATOM   5785 N N   . VAL B 1 362 ? 59.703  30.556  -6.397  1.00 70.73  ? 286  VAL B N   1 
ATOM   5786 C CA  . VAL B 1 362 ? 60.696  30.789  -7.445  1.00 70.76  ? 286  VAL B CA  1 
ATOM   5787 C C   . VAL B 1 362 ? 60.462  29.766  -8.561  1.00 76.08  ? 286  VAL B C   1 
ATOM   5788 O O   . VAL B 1 362 ? 60.394  30.147  -9.729  1.00 76.98  ? 286  VAL B O   1 
ATOM   5789 C CB  . VAL B 1 362 ? 62.147  30.730  -6.879  1.00 73.42  ? 286  VAL B CB  1 
ATOM   5790 C CG1 . VAL B 1 362 ? 63.183  30.959  -7.971  1.00 73.79  ? 286  VAL B CG1 1 
ATOM   5791 C CG2 . VAL B 1 362 ? 62.338  31.737  -5.747  1.00 73.48  ? 286  VAL B CG2 1 
ATOM   5792 N N   . ILE B 1 363 ? 60.316  28.474  -8.196  1.00 73.11  ? 287  ILE B N   1 
ATOM   5793 C CA  . ILE B 1 363 ? 60.054  27.399  -9.156  1.00 73.47  ? 287  ILE B CA  1 
ATOM   5794 C C   . ILE B 1 363 ? 58.533  27.107  -9.164  1.00 80.21  ? 287  ILE B C   1 
ATOM   5795 O O   . ILE B 1 363 ? 57.999  26.657  -8.157  1.00 79.08  ? 287  ILE B O   1 
ATOM   5796 C CB  . ILE B 1 363 ? 60.893  26.109  -8.867  1.00 74.49  ? 287  ILE B CB  1 
ATOM   5797 C CG1 . ILE B 1 363 ? 62.419  26.428  -8.686  1.00 73.78  ? 287  ILE B CG1 1 
ATOM   5798 C CG2 . ILE B 1 363 ? 60.625  25.029  -9.937  1.00 75.24  ? 287  ILE B CG2 1 
ATOM   5799 C CD1 . ILE B 1 363 ? 63.439  25.183  -8.759  1.00 81.19  ? 287  ILE B CD1 1 
ATOM   5800 N N   . ASN B 1 364 ? 57.837  27.378  -10.278 1.00 80.13  ? 288  ASN B N   1 
ATOM   5801 C CA  . ASN B 1 364 ? 56.394  27.108  -10.359 1.00 81.80  ? 288  ASN B CA  1 
ATOM   5802 C C   . ASN B 1 364 ? 56.078  26.157  -11.539 1.00 87.69  ? 288  ASN B C   1 
ATOM   5803 O O   . ASN B 1 364 ? 54.953  26.153  -12.052 1.00 89.10  ? 288  ASN B O   1 
ATOM   5804 C CB  . ASN B 1 364 ? 55.598  28.415  -10.485 1.00 84.91  ? 288  ASN B CB  1 
ATOM   5805 C CG  . ASN B 1 364 ? 55.580  29.237  -9.218  1.00 108.35 ? 288  ASN B CG  1 
ATOM   5806 O OD1 . ASN B 1 364 ? 55.505  28.711  -8.098  1.00 98.06  ? 288  ASN B OD1 1 
ATOM   5807 N ND2 . ASN B 1 364 ? 55.508  30.549  -9.371  1.00 104.82 ? 288  ASN B ND2 1 
ATOM   5808 N N   . SER B 1 365 ? 57.057  25.315  -11.913 1.00 83.88  ? 289  SER B N   1 
ATOM   5809 C CA  . SER B 1 365 ? 56.934  24.326  -12.976 1.00 85.07  ? 289  SER B CA  1 
ATOM   5810 C C   . SER B 1 365 ? 56.773  22.939  -12.372 1.00 90.03  ? 289  SER B C   1 
ATOM   5811 O O   . SER B 1 365 ? 57.669  22.480  -11.672 1.00 88.28  ? 289  SER B O   1 
ATOM   5812 C CB  . SER B 1 365 ? 58.151  24.388  -13.894 1.00 89.28  ? 289  SER B CB  1 
ATOM   5813 O OG  . SER B 1 365 ? 58.094  23.410  -14.919 1.00 100.30 ? 289  SER B OG  1 
ATOM   5814 N N   . CYS B 1 366 ? 55.629  22.275  -12.624 1.00 89.77  ? 290  CYS B N   1 
ATOM   5815 C CA  . CYS B 1 366 ? 55.348  20.934  -12.101 1.00 90.02  ? 290  CYS B CA  1 
ATOM   5816 C C   . CYS B 1 366 ? 56.235  19.884  -12.794 1.00 88.91  ? 290  CYS B C   1 
ATOM   5817 O O   . CYS B 1 366 ? 56.457  18.825  -12.207 1.00 86.35  ? 290  CYS B O   1 
ATOM   5818 C CB  . CYS B 1 366 ? 53.872  20.585  -12.253 1.00 93.90  ? 290  CYS B CB  1 
ATOM   5819 S SG  . CYS B 1 366 ? 52.773  21.551  -11.189 1.00 99.52  ? 290  CYS B SG  1 
ATOM   5820 N N   . GLU B 1 367 ? 56.741  20.169  -14.022 1.00 84.44  ? 291  GLU B N   1 
ATOM   5821 C CA  . GLU B 1 367 ? 57.653  19.266  -14.734 1.00 83.53  ? 291  GLU B CA  1 
ATOM   5822 C C   . GLU B 1 367 ? 58.927  19.075  -13.919 1.00 84.57  ? 291  GLU B C   1 
ATOM   5823 O O   . GLU B 1 367 ? 59.323  17.943  -13.655 1.00 84.15  ? 291  GLU B O   1 
ATOM   5824 C CB  . GLU B 1 367 ? 58.006  19.751  -16.158 1.00 86.57  ? 291  GLU B CB  1 
ATOM   5825 C CG  . GLU B 1 367 ? 56.885  19.827  -17.188 1.00 100.04 ? 291  GLU B CG  1 
ATOM   5826 C CD  . GLU B 1 367 ? 56.001  21.062  -17.187 1.00 129.92 ? 291  GLU B CD  1 
ATOM   5827 O OE1 . GLU B 1 367 ? 55.794  21.619  -18.289 1.00 131.94 ? 291  GLU B OE1 1 
ATOM   5828 O OE2 . GLU B 1 367 ? 55.613  21.543  -16.101 1.00 128.64 ? 291  GLU B OE2 1 
ATOM   5829 N N   . VAL B 1 368 ? 59.521  20.208  -13.473 1.00 78.98  ? 292  VAL B N   1 
ATOM   5830 C CA  . VAL B 1 368 ? 60.737  20.313  -12.659 1.00 76.42  ? 292  VAL B CA  1 
ATOM   5831 C C   . VAL B 1 368 ? 60.491  19.662  -11.289 1.00 78.41  ? 292  VAL B C   1 
ATOM   5832 O O   . VAL B 1 368 ? 61.281  18.814  -10.867 1.00 77.17  ? 292  VAL B O   1 
ATOM   5833 C CB  . VAL B 1 368 ? 61.171  21.807  -12.514 1.00 80.12  ? 292  VAL B CB  1 
ATOM   5834 C CG1 . VAL B 1 368 ? 62.392  21.958  -11.610 1.00 78.25  ? 292  VAL B CG1 1 
ATOM   5835 C CG2 . VAL B 1 368 ? 61.431  22.445  -13.876 1.00 81.56  ? 292  VAL B CG2 1 
ATOM   5836 N N   . ILE B 1 369 ? 59.376  20.033  -10.620 1.00 74.43  ? 293  ILE B N   1 
ATOM   5837 C CA  . ILE B 1 369 ? 58.989  19.526  -9.298  1.00 73.06  ? 293  ILE B CA  1 
ATOM   5838 C C   . ILE B 1 369 ? 58.827  17.977  -9.365  1.00 77.68  ? 293  ILE B C   1 
ATOM   5839 O O   . ILE B 1 369 ? 59.271  17.288  -8.442  1.00 76.97  ? 293  ILE B O   1 
ATOM   5840 C CB  . ILE B 1 369 ? 57.700  20.240  -8.805  1.00 76.45  ? 293  ILE B CB  1 
ATOM   5841 C CG1 . ILE B 1 369 ? 57.984  21.760  -8.619  1.00 76.62  ? 293  ILE B CG1 1 
ATOM   5842 C CG2 . ILE B 1 369 ? 57.184  19.624  -7.488  1.00 75.73  ? 293  ILE B CG2 1 
ATOM   5843 C CD1 . ILE B 1 369 ? 56.766  22.637  -8.374  1.00 86.57  ? 293  ILE B CD1 1 
ATOM   5844 N N   . ALA B 1 370 ? 58.281  17.440  -10.477 1.00 74.78  ? 294  ALA B N   1 
ATOM   5845 C CA  . ALA B 1 370 ? 58.140  15.991  -10.668 1.00 74.12  ? 294  ALA B CA  1 
ATOM   5846 C C   . ALA B 1 370 ? 59.515  15.306  -10.763 1.00 75.29  ? 294  ALA B C   1 
ATOM   5847 O O   . ALA B 1 370 ? 59.691  14.204  -10.226 1.00 74.11  ? 294  ALA B O   1 
ATOM   5848 C CB  . ALA B 1 370 ? 57.329  15.706  -11.921 1.00 76.78  ? 294  ALA B CB  1 
ATOM   5849 N N   . VAL B 1 371 ? 60.493  15.964  -11.435 1.00 70.69  ? 295  VAL B N   1 
ATOM   5850 C CA  . VAL B 1 371 ? 61.853  15.428  -11.573 1.00 69.09  ? 295  VAL B CA  1 
ATOM   5851 C C   . VAL B 1 371 ? 62.441  15.275  -10.162 1.00 71.59  ? 295  VAL B C   1 
ATOM   5852 O O   . VAL B 1 371 ? 62.864  14.174  -9.805  1.00 70.66  ? 295  VAL B O   1 
ATOM   5853 C CB  . VAL B 1 371 ? 62.749  16.297  -12.503 1.00 72.63  ? 295  VAL B CB  1 
ATOM   5854 C CG1 . VAL B 1 371 ? 64.181  15.778  -12.541 1.00 71.42  ? 295  VAL B CG1 1 
ATOM   5855 C CG2 . VAL B 1 371 ? 62.174  16.371  -13.916 1.00 74.16  ? 295  VAL B CG2 1 
ATOM   5856 N N   . ILE B 1 372 ? 62.353  16.355  -9.338  1.00 67.39  ? 296  ILE B N   1 
ATOM   5857 C CA  . ILE B 1 372 ? 62.841  16.389  -7.956  1.00 66.00  ? 296  ILE B CA  1 
ATOM   5858 C C   . ILE B 1 372 ? 62.201  15.243  -7.143  1.00 72.40  ? 296  ILE B C   1 
ATOM   5859 O O   . ILE B 1 372 ? 62.926  14.557  -6.437  1.00 72.21  ? 296  ILE B O   1 
ATOM   5860 C CB  . ILE B 1 372 ? 62.577  17.766  -7.276  1.00 68.49  ? 296  ILE B CB  1 
ATOM   5861 C CG1 . ILE B 1 372 ? 63.099  18.954  -8.145  1.00 68.84  ? 296  ILE B CG1 1 
ATOM   5862 C CG2 . ILE B 1 372 ? 63.194  17.793  -5.866  1.00 67.58  ? 296  ILE B CG2 1 
ATOM   5863 C CD1 . ILE B 1 372 ? 62.697  20.402  -7.657  1.00 66.45  ? 296  ILE B CD1 1 
ATOM   5864 N N   . ASP B 1 373 ? 60.872  15.016  -7.271  1.00 71.48  ? 297  ASP B N   1 
ATOM   5865 C CA  . ASP B 1 373 ? 60.140  13.976  -6.540  1.00 72.38  ? 297  ASP B CA  1 
ATOM   5866 C C   . ASP B 1 373 ? 60.623  12.551  -6.867  1.00 78.30  ? 297  ASP B C   1 
ATOM   5867 O O   . ASP B 1 373 ? 60.719  11.733  -5.950  1.00 77.32  ? 297  ASP B O   1 
ATOM   5868 C CB  . ASP B 1 373 ? 58.637  14.045  -6.827  1.00 76.01  ? 297  ASP B CB  1 
ATOM   5869 C CG  . ASP B 1 373 ? 57.895  15.202  -6.177  1.00 95.28  ? 297  ASP B CG  1 
ATOM   5870 O OD1 . ASP B 1 373 ? 58.540  15.992  -5.439  1.00 95.83  ? 297  ASP B OD1 1 
ATOM   5871 O OD2 . ASP B 1 373 ? 56.654  15.275  -6.341  1.00 106.70 ? 297  ASP B OD2 1 
ATOM   5872 N N   . LEU B 1 374 ? 60.886  12.233  -8.145  1.00 76.99  ? 298  LEU B N   1 
ATOM   5873 C CA  . LEU B 1 374 ? 61.299  10.869  -8.480  1.00 77.56  ? 298  LEU B CA  1 
ATOM   5874 C C   . LEU B 1 374 ? 62.813  10.696  -8.247  1.00 78.82  ? 298  LEU B C   1 
ATOM   5875 O O   . LEU B 1 374 ? 63.248  9.575   -8.000  1.00 79.08  ? 298  LEU B O   1 
ATOM   5876 C CB  . LEU B 1 374 ? 60.913  10.476  -9.932  1.00 79.98  ? 298  LEU B CB  1 
ATOM   5877 C CG  . LEU B 1 374 ? 61.418  11.304  -11.137 1.00 86.61  ? 298  LEU B CG  1 
ATOM   5878 C CD1 . LEU B 1 374 ? 62.862  10.929  -11.524 1.00 86.47  ? 298  LEU B CD1 1 
ATOM   5879 C CD2 . LEU B 1 374 ? 60.563  11.011  -12.366 1.00 91.71  ? 298  LEU B CD2 1 
ATOM   5880 N N   . ALA B 1 375 ? 63.597  11.785  -8.291  1.00 72.78  ? 299  ALA B N   1 
ATOM   5881 C CA  . ALA B 1 375 ? 65.041  11.718  -8.080  1.00 70.60  ? 299  ALA B CA  1 
ATOM   5882 C C   . ALA B 1 375 ? 65.392  11.638  -6.598  1.00 72.05  ? 299  ALA B C   1 
ATOM   5883 O O   . ALA B 1 375 ? 66.432  11.078  -6.248  1.00 70.89  ? 299  ALA B O   1 
ATOM   5884 C CB  . ALA B 1 375 ? 65.712  12.933  -8.694  1.00 71.22  ? 299  ALA B CB  1 
ATOM   5885 N N   . LEU B 1 376 ? 64.525  12.189  -5.731  1.00 67.88  ? 300  LEU B N   1 
ATOM   5886 C CA  . LEU B 1 376 ? 64.755  12.306  -4.291  1.00 66.62  ? 300  LEU B CA  1 
ATOM   5887 C C   . LEU B 1 376 ? 64.943  10.913  -3.605  1.00 68.04  ? 300  LEU B C   1 
ATOM   5888 O O   . LEU B 1 376 ? 65.903  10.806  -2.850  1.00 66.40  ? 300  LEU B O   1 
ATOM   5889 C CB  . LEU B 1 376 ? 63.603  13.065  -3.621  1.00 67.26  ? 300  LEU B CB  1 
ATOM   5890 C CG  . LEU B 1 376 ? 63.862  13.664  -2.240  1.00 71.89  ? 300  LEU B CG  1 
ATOM   5891 C CD1 . LEU B 1 376 ? 65.025  14.672  -2.266  1.00 71.47  ? 300  LEU B CD1 1 
ATOM   5892 C CD2 . LEU B 1 376 ? 62.628  14.360  -1.742  1.00 76.44  ? 300  LEU B CD2 1 
ATOM   5893 N N   . PRO B 1 377 ? 64.130  9.836   -3.840  1.00 64.50  ? 301  PRO B N   1 
ATOM   5894 C CA  . PRO B 1 377 ? 64.406  8.553   -3.152  1.00 63.80  ? 301  PRO B CA  1 
ATOM   5895 C C   . PRO B 1 377 ? 65.798  7.993   -3.485  1.00 66.83  ? 301  PRO B C   1 
ATOM   5896 O O   . PRO B 1 377 ? 66.404  7.348   -2.636  1.00 66.09  ? 301  PRO B O   1 
ATOM   5897 C CB  . PRO B 1 377 ? 63.305  7.618   -3.679  1.00 66.45  ? 301  PRO B CB  1 
ATOM   5898 C CG  . PRO B 1 377 ? 62.231  8.512   -4.141  1.00 71.27  ? 301  PRO B CG  1 
ATOM   5899 C CD  . PRO B 1 377 ? 62.926  9.721   -4.688  1.00 66.61  ? 301  PRO B CD  1 
ATOM   5900 N N   . PHE B 1 378 ? 66.312  8.267   -4.701  1.00 63.71  ? 302  PHE B N   1 
ATOM   5901 C CA  . PHE B 1 378 ? 67.640  7.832   -5.136  1.00 63.34  ? 302  PHE B CA  1 
ATOM   5902 C C   . PHE B 1 378 ? 68.743  8.674   -4.474  1.00 67.05  ? 302  PHE B C   1 
ATOM   5903 O O   . PHE B 1 378 ? 69.750  8.116   -4.039  1.00 66.55  ? 302  PHE B O   1 
ATOM   5904 C CB  . PHE B 1 378 ? 67.771  7.908   -6.660  1.00 65.56  ? 302  PHE B CB  1 
ATOM   5905 C CG  . PHE B 1 378 ? 66.877  6.957   -7.418  1.00 67.94  ? 302  PHE B CG  1 
ATOM   5906 C CD1 . PHE B 1 378 ? 67.319  5.686   -7.760  1.00 71.16  ? 302  PHE B CD1 1 
ATOM   5907 C CD2 . PHE B 1 378 ? 65.612  7.351   -7.839  1.00 70.15  ? 302  PHE B CD2 1 
ATOM   5908 C CE1 . PHE B 1 378 ? 66.504  4.819   -8.496  1.00 73.10  ? 302  PHE B CE1 1 
ATOM   5909 C CE2 . PHE B 1 378 ? 64.799  6.483   -8.571  1.00 73.65  ? 302  PHE B CE2 1 
ATOM   5910 C CZ  . PHE B 1 378 ? 65.252  5.226   -8.899  1.00 72.24  ? 302  PHE B CZ  1 
ATOM   5911 N N   . ALA B 1 379 ? 68.551  10.013  -4.394  1.00 63.16  ? 303  ALA B N   1 
ATOM   5912 C CA  . ALA B 1 379 ? 69.508  10.944  -3.781  1.00 62.02  ? 303  ALA B CA  1 
ATOM   5913 C C   . ALA B 1 379 ? 69.653  10.682  -2.284  1.00 67.20  ? 303  ALA B C   1 
ATOM   5914 O O   . ALA B 1 379 ? 70.740  10.891  -1.737  1.00 67.62  ? 303  ALA B O   1 
ATOM   5915 C CB  . ALA B 1 379 ? 69.073  12.371  -4.012  1.00 62.50  ? 303  ALA B CB  1 
ATOM   5916 N N   . ILE B 1 380 ? 68.557  10.218  -1.630  1.00 64.01  ? 304  ILE B N   1 
ATOM   5917 C CA  . ILE B 1 380 ? 68.499  9.846   -0.211  1.00 63.84  ? 304  ILE B CA  1 
ATOM   5918 C C   . ILE B 1 380 ? 69.343  8.572   0.002   1.00 68.58  ? 304  ILE B C   1 
ATOM   5919 O O   . ILE B 1 380 ? 70.034  8.470   1.014   1.00 68.68  ? 304  ILE B O   1 
ATOM   5920 C CB  . ILE B 1 380 ? 67.013  9.660   0.267   1.00 67.05  ? 304  ILE B CB  1 
ATOM   5921 C CG1 . ILE B 1 380 ? 66.279  11.031  0.296   1.00 67.25  ? 304  ILE B CG1 1 
ATOM   5922 C CG2 . ILE B 1 380 ? 66.941  8.987   1.654   1.00 67.36  ? 304  ILE B CG2 1 
ATOM   5923 C CD1 . ILE B 1 380 ? 64.759  10.990  0.620   1.00 73.56  ? 304  ILE B CD1 1 
ATOM   5924 N N   . LEU B 1 381 ? 69.317  7.633   -0.964  1.00 65.27  ? 305  LEU B N   1 
ATOM   5925 C CA  . LEU B 1 381 ? 70.081  6.386   -0.887  1.00 64.99  ? 305  LEU B CA  1 
ATOM   5926 C C   . LEU B 1 381 ? 71.608  6.666   -0.894  1.00 68.40  ? 305  LEU B C   1 
ATOM   5927 O O   . LEU B 1 381 ? 72.323  6.033   -0.120  1.00 68.86  ? 305  LEU B O   1 
ATOM   5928 C CB  . LEU B 1 381 ? 69.706  5.450   -2.045  1.00 65.37  ? 305  LEU B CB  1 
ATOM   5929 C CG  . LEU B 1 381 ? 70.304  4.046   -2.023  1.00 69.53  ? 305  LEU B CG  1 
ATOM   5930 C CD1 . LEU B 1 381 ? 69.802  3.254   -0.823  1.00 69.60  ? 305  LEU B CD1 1 
ATOM   5931 C CD2 . LEU B 1 381 ? 69.956  3.311   -3.284  1.00 71.97  ? 305  LEU B CD2 1 
ATOM   5932 N N   . LEU B 1 382 ? 72.092  7.623   -1.732  1.00 63.61  ? 306  LEU B N   1 
ATOM   5933 C CA  . LEU B 1 382 ? 73.514  8.001   -1.796  1.00 63.36  ? 306  LEU B CA  1 
ATOM   5934 C C   . LEU B 1 382 ? 74.009  8.565   -0.454  1.00 67.30  ? 306  LEU B C   1 
ATOM   5935 O O   . LEU B 1 382 ? 75.183  8.403   -0.127  1.00 68.52  ? 306  LEU B O   1 
ATOM   5936 C CB  . LEU B 1 382 ? 73.796  9.022   -2.905  1.00 63.86  ? 306  LEU B CB  1 
ATOM   5937 C CG  . LEU B 1 382 ? 73.695  8.543   -4.354  1.00 69.40  ? 306  LEU B CG  1 
ATOM   5938 C CD1 . LEU B 1 382 ? 73.841  9.711   -5.312  1.00 69.76  ? 306  LEU B CD1 1 
ATOM   5939 C CD2 . LEU B 1 382 ? 74.752  7.485   -4.668  1.00 72.43  ? 306  LEU B CD2 1 
ATOM   5940 N N   . GLY B 1 383 ? 73.114  9.196   0.305   1.00 62.09  ? 307  GLY B N   1 
ATOM   5941 C CA  . GLY B 1 383 ? 73.407  9.708   1.637   1.00 60.94  ? 307  GLY B CA  1 
ATOM   5942 C C   . GLY B 1 383 ? 73.752  8.575   2.580   1.00 63.30  ? 307  GLY B C   1 
ATOM   5943 O O   . GLY B 1 383 ? 74.755  8.651   3.293   1.00 63.54  ? 307  GLY B O   1 
ATOM   5944 N N   . PHE B 1 384 ? 72.944  7.484   2.549   1.00 58.53  ? 308  PHE B N   1 
ATOM   5945 C CA  . PHE B 1 384 ? 73.185  6.263   3.331   1.00 58.33  ? 308  PHE B CA  1 
ATOM   5946 C C   . PHE B 1 384 ? 74.405  5.501   2.807   1.00 61.91  ? 308  PHE B C   1 
ATOM   5947 O O   . PHE B 1 384 ? 75.059  4.805   3.577   1.00 62.03  ? 308  PHE B O   1 
ATOM   5948 C CB  . PHE B 1 384 ? 71.962  5.323   3.325   1.00 60.24  ? 308  PHE B CB  1 
ATOM   5949 C CG  . PHE B 1 384 ? 70.744  5.793   4.078   1.00 61.63  ? 308  PHE B CG  1 
ATOM   5950 C CD1 . PHE B 1 384 ? 70.645  5.614   5.451   1.00 65.03  ? 308  PHE B CD1 1 
ATOM   5951 C CD2 . PHE B 1 384 ? 69.641  6.297   3.402   1.00 63.61  ? 308  PHE B CD2 1 
ATOM   5952 C CE1 . PHE B 1 384 ? 69.499  6.012   6.146   1.00 66.31  ? 308  PHE B CE1 1 
ATOM   5953 C CE2 . PHE B 1 384 ? 68.485  6.673   4.096   1.00 66.66  ? 308  PHE B CE2 1 
ATOM   5954 C CZ  . PHE B 1 384 ? 68.426  6.536   5.463   1.00 65.18  ? 308  PHE B CZ  1 
ATOM   5955 N N   . THR B 1 385 ? 74.694  5.621   1.492   1.00 58.02  ? 309  THR B N   1 
ATOM   5956 C CA  . THR B 1 385 ? 75.813  4.954   0.826   1.00 58.31  ? 309  THR B CA  1 
ATOM   5957 C C   . THR B 1 385 ? 77.136  5.538   1.358   1.00 63.72  ? 309  THR B C   1 
ATOM   5958 O O   . THR B 1 385 ? 78.132  4.816   1.392   1.00 64.37  ? 309  THR B O   1 
ATOM   5959 C CB  . THR B 1 385 ? 75.682  5.092   -0.702  1.00 63.54  ? 309  THR B CB  1 
ATOM   5960 O OG1 . THR B 1 385 ? 74.414  4.569   -1.086  1.00 65.38  ? 309  THR B OG1 1 
ATOM   5961 C CG2 . THR B 1 385 ? 76.764  4.347   -1.467  1.00 59.92  ? 309  THR B CG2 1 
ATOM   5962 N N   . ASN B 1 386 ? 77.134  6.809   1.838   1.00 59.96  ? 310  ASN B N   1 
ATOM   5963 C CA  . ASN B 1 386 ? 78.326  7.435   2.431   1.00 59.66  ? 310  ASN B CA  1 
ATOM   5964 C C   . ASN B 1 386 ? 78.753  6.664   3.692   1.00 64.47  ? 310  ASN B C   1 
ATOM   5965 O O   . ASN B 1 386 ? 79.943  6.607   3.991   1.00 66.21  ? 310  ASN B O   1 
ATOM   5966 C CB  . ASN B 1 386 ? 78.073  8.912   2.756   1.00 57.34  ? 310  ASN B CB  1 
ATOM   5967 C CG  . ASN B 1 386 ? 79.285  9.687   3.240   1.00 77.18  ? 310  ASN B CG  1 
ATOM   5968 O OD1 . ASN B 1 386 ? 79.261  10.318  4.301   1.00 72.46  ? 310  ASN B OD1 1 
ATOM   5969 N ND2 . ASN B 1 386 ? 80.384  9.629   2.503   1.00 69.23  ? 310  ASN B ND2 1 
ATOM   5970 N N   . SER B 1 387 ? 77.786  6.023   4.391   1.00 59.63  ? 311  SER B N   1 
ATOM   5971 C CA  . SER B 1 387 ? 78.032  5.222   5.595   1.00 59.39  ? 311  SER B CA  1 
ATOM   5972 C C   . SER B 1 387 ? 78.670  3.865   5.230   1.00 63.78  ? 311  SER B C   1 
ATOM   5973 O O   . SER B 1 387 ? 79.176  3.169   6.117   1.00 64.10  ? 311  SER B O   1 
ATOM   5974 C CB  . SER B 1 387 ? 76.736  5.009   6.370   1.00 61.67  ? 311  SER B CB  1 
ATOM   5975 O OG  . SER B 1 387 ? 76.174  6.245   6.777   1.00 69.68  ? 311  SER B OG  1 
ATOM   5976 N N   . CYS B 1 388 ? 78.645  3.498   3.924   1.00 59.84  ? 312  CYS B N   1 
ATOM   5977 C CA  . CYS B 1 388 ? 79.270  2.277   3.391   1.00 60.01  ? 312  CYS B CA  1 
ATOM   5978 C C   . CYS B 1 388 ? 80.707  2.574   3.002   1.00 61.55  ? 312  CYS B C   1 
ATOM   5979 O O   . CYS B 1 388 ? 81.548  1.676   3.001   1.00 62.13  ? 312  CYS B O   1 
ATOM   5980 C CB  . CYS B 1 388 ? 78.484  1.728   2.202   1.00 60.93  ? 312  CYS B CB  1 
ATOM   5981 S SG  . CYS B 1 388 ? 76.729  1.432   2.530   1.00 65.16  ? 312  CYS B SG  1 
ATOM   5982 N N   . VAL B 1 389 ? 80.972  3.840   2.641   1.00 56.01  ? 313  VAL B N   1 
ATOM   5983 C CA  . VAL B 1 389 ? 82.265  4.336   2.187   1.00 56.10  ? 313  VAL B CA  1 
ATOM   5984 C C   . VAL B 1 389 ? 83.178  4.615   3.401   1.00 61.68  ? 313  VAL B C   1 
ATOM   5985 O O   . VAL B 1 389 ? 84.355  4.268   3.347   1.00 62.53  ? 313  VAL B O   1 
ATOM   5986 C CB  . VAL B 1 389 ? 82.090  5.611   1.306   1.00 59.43  ? 313  VAL B CB  1 
ATOM   5987 C CG1 . VAL B 1 389 ? 83.437  6.156   0.836   1.00 59.97  ? 313  VAL B CG1 1 
ATOM   5988 C CG2 . VAL B 1 389 ? 81.195  5.333   0.103   1.00 58.61  ? 313  VAL B CG2 1 
ATOM   5989 N N   . ASN B 1 390 ? 82.633  5.208   4.495   1.00 58.33  ? 314  ASN B N   1 
ATOM   5990 C CA  . ASN B 1 390 ? 83.387  5.577   5.710   1.00 58.67  ? 314  ASN B CA  1 
ATOM   5991 C C   . ASN B 1 390 ? 84.327  4.439   6.189   1.00 63.80  ? 314  ASN B C   1 
ATOM   5992 O O   . ASN B 1 390 ? 85.497  4.750   6.404   1.00 63.92  ? 314  ASN B O   1 
ATOM   5993 C CB  . ASN B 1 390 ? 82.458  5.977   6.847   1.00 57.15  ? 314  ASN B CB  1 
ATOM   5994 C CG  . ASN B 1 390 ? 81.693  7.236   6.565   1.00 69.41  ? 314  ASN B CG  1 
ATOM   5995 O OD1 . ASN B 1 390 ? 81.938  7.941   5.579   1.00 63.21  ? 314  ASN B OD1 1 
ATOM   5996 N ND2 . ASN B 1 390 ? 80.787  7.577   7.448   1.00 61.24  ? 314  ASN B ND2 1 
ATOM   5997 N N   . PRO B 1 391 ? 83.916  3.137   6.290   1.00 61.27  ? 315  PRO B N   1 
ATOM   5998 C CA  . PRO B 1 391 ? 84.883  2.097   6.698   1.00 62.01  ? 315  PRO B CA  1 
ATOM   5999 C C   . PRO B 1 391 ? 86.159  2.086   5.842   1.00 66.90  ? 315  PRO B C   1 
ATOM   6000 O O   . PRO B 1 391 ? 87.255  1.975   6.391   1.00 68.26  ? 315  PRO B O   1 
ATOM   6001 C CB  . PRO B 1 391 ? 84.098  0.802   6.487   1.00 63.79  ? 315  PRO B CB  1 
ATOM   6002 C CG  . PRO B 1 391 ? 82.699  1.181   6.731   1.00 67.64  ? 315  PRO B CG  1 
ATOM   6003 C CD  . PRO B 1 391 ? 82.568  2.549   6.112   1.00 62.52  ? 315  PRO B CD  1 
ATOM   6004 N N   . PHE B 1 392 ? 86.021  2.243   4.511   1.00 62.35  ? 316  PHE B N   1 
ATOM   6005 C CA  . PHE B 1 392 ? 87.140  2.231   3.568   1.00 62.55  ? 316  PHE B CA  1 
ATOM   6006 C C   . PHE B 1 392 ? 87.973  3.520   3.642   1.00 67.04  ? 316  PHE B C   1 
ATOM   6007 O O   . PHE B 1 392 ? 89.168  3.462   3.374   1.00 67.86  ? 316  PHE B O   1 
ATOM   6008 C CB  . PHE B 1 392 ? 86.635  2.032   2.131   1.00 64.01  ? 316  PHE B CB  1 
ATOM   6009 C CG  . PHE B 1 392 ? 86.011  0.676   1.890   1.00 66.09  ? 316  PHE B CG  1 
ATOM   6010 C CD1 . PHE B 1 392 ? 84.653  0.466   2.115   1.00 69.00  ? 316  PHE B CD1 1 
ATOM   6011 C CD2 . PHE B 1 392 ? 86.782  -0.394  1.448   1.00 69.62  ? 316  PHE B CD2 1 
ATOM   6012 C CE1 . PHE B 1 392 ? 84.084  -0.797  1.925   1.00 70.44  ? 316  PHE B CE1 1 
ATOM   6013 C CE2 . PHE B 1 392 ? 86.213  -1.660  1.263   1.00 73.02  ? 316  PHE B CE2 1 
ATOM   6014 C CZ  . PHE B 1 392 ? 84.868  -1.852  1.498   1.00 70.67  ? 316  PHE B CZ  1 
ATOM   6015 N N   . LEU B 1 393 ? 87.367  4.664   4.007   1.00 63.38  ? 317  LEU B N   1 
ATOM   6016 C CA  . LEU B 1 393 ? 88.076  5.947   4.075   1.00 63.39  ? 317  LEU B CA  1 
ATOM   6017 C C   . LEU B 1 393 ? 88.875  6.144   5.350   1.00 68.69  ? 317  LEU B C   1 
ATOM   6018 O O   . LEU B 1 393 ? 89.884  6.848   5.307   1.00 69.28  ? 317  LEU B O   1 
ATOM   6019 C CB  . LEU B 1 393 ? 87.101  7.128   3.979   1.00 62.59  ? 317  LEU B CB  1 
ATOM   6020 C CG  . LEU B 1 393 ? 86.378  7.381   2.682   1.00 66.96  ? 317  LEU B CG  1 
ATOM   6021 C CD1 . LEU B 1 393 ? 85.472  8.583   2.822   1.00 66.80  ? 317  LEU B CD1 1 
ATOM   6022 C CD2 . LEU B 1 393 ? 87.355  7.630   1.543   1.00 70.31  ? 317  LEU B CD2 1 
ATOM   6023 N N   . TYR B 1 394 ? 88.395  5.628   6.494   1.00 66.28  ? 318  TYR B N   1 
ATOM   6024 C CA  . TYR B 1 394 ? 89.038  5.934   7.766   1.00 67.98  ? 318  TYR B CA  1 
ATOM   6025 C C   . TYR B 1 394 ? 89.629  4.688   8.457   1.00 74.02  ? 318  TYR B C   1 
ATOM   6026 O O   . TYR B 1 394 ? 90.812  4.722   8.765   1.00 74.20  ? 318  TYR B O   1 
ATOM   6027 C CB  . TYR B 1 394 ? 88.038  6.612   8.711   1.00 69.05  ? 318  TYR B CB  1 
ATOM   6028 C CG  . TYR B 1 394 ? 87.484  7.890   8.127   1.00 70.95  ? 318  TYR B CG  1 
ATOM   6029 C CD1 . TYR B 1 394 ? 88.257  9.044   8.069   1.00 73.94  ? 318  TYR B CD1 1 
ATOM   6030 C CD2 . TYR B 1 394 ? 86.198  7.940   7.600   1.00 70.84  ? 318  TYR B CD2 1 
ATOM   6031 C CE1 . TYR B 1 394 ? 87.778  10.207  7.472   1.00 74.51  ? 318  TYR B CE1 1 
ATOM   6032 C CE2 . TYR B 1 394 ? 85.697  9.107   7.022   1.00 71.48  ? 318  TYR B CE2 1 
ATOM   6033 C CZ  . TYR B 1 394 ? 86.494  10.239  6.959   1.00 81.78  ? 318  TYR B CZ  1 
ATOM   6034 O OH  . TYR B 1 394 ? 86.027  11.397  6.394   1.00 86.70  ? 318  TYR B OH  1 
ATOM   6035 N N   . CYS B 1 395 ? 88.835  3.625   8.729   1.00 72.09  ? 319  CYS B N   1 
ATOM   6036 C CA  . CYS B 1 395 ? 89.334  2.432   9.435   1.00 73.66  ? 319  CYS B CA  1 
ATOM   6037 C C   . CYS B 1 395 ? 90.287  1.638   8.549   1.00 78.34  ? 319  CYS B C   1 
ATOM   6038 O O   . CYS B 1 395 ? 91.382  1.324   9.005   1.00 79.82  ? 319  CYS B O   1 
ATOM   6039 C CB  . CYS B 1 395 ? 88.187  1.543   9.912   1.00 74.05  ? 319  CYS B CB  1 
ATOM   6040 S SG  . CYS B 1 395 ? 88.718  0.075   10.844  1.00 79.52  ? 319  CYS B SG  1 
ATOM   6041 N N   . PHE B 1 396 ? 89.877  1.296   7.304   1.00 74.40  ? 320  PHE B N   1 
ATOM   6042 C CA  . PHE B 1 396 ? 90.669  0.448   6.402   1.00 75.10  ? 320  PHE B CA  1 
ATOM   6043 C C   . PHE B 1 396 ? 91.858  1.222   5.771   1.00 83.21  ? 320  PHE B C   1 
ATOM   6044 O O   . PHE B 1 396 ? 92.532  0.685   4.887   1.00 84.62  ? 320  PHE B O   1 
ATOM   6045 C CB  . PHE B 1 396 ? 89.787  -0.150  5.274   1.00 75.38  ? 320  PHE B CB  1 
ATOM   6046 C CG  . PHE B 1 396 ? 88.553  -0.947  5.665   1.00 76.07  ? 320  PHE B CG  1 
ATOM   6047 C CD1 . PHE B 1 396 ? 88.400  -1.448  6.955   1.00 79.62  ? 320  PHE B CD1 1 
ATOM   6048 C CD2 . PHE B 1 396 ? 87.599  -1.286  4.717   1.00 77.24  ? 320  PHE B CD2 1 
ATOM   6049 C CE1 . PHE B 1 396 ? 87.262  -2.179  7.311   1.00 80.08  ? 320  PHE B CE1 1 
ATOM   6050 C CE2 . PHE B 1 396 ? 86.465  -2.028  5.070   1.00 79.60  ? 320  PHE B CE2 1 
ATOM   6051 C CZ  . PHE B 1 396 ? 86.308  -2.475  6.364   1.00 78.05  ? 320  PHE B CZ  1 
ATOM   6052 N N   . VAL B 1 397 ? 92.145  2.443   6.254   1.00 81.34  ? 321  VAL B N   1 
ATOM   6053 C CA  . VAL B 1 397 ? 93.233  3.282   5.747   1.00 82.60  ? 321  VAL B CA  1 
ATOM   6054 C C   . VAL B 1 397 ? 94.055  3.861   6.922   1.00 90.02  ? 321  VAL B C   1 
ATOM   6055 O O   . VAL B 1 397 ? 95.263  3.994   6.787   1.00 91.14  ? 321  VAL B O   1 
ATOM   6056 C CB  . VAL B 1 397 ? 92.667  4.406   4.841   1.00 85.39  ? 321  VAL B CB  1 
ATOM   6057 C CG1 . VAL B 1 397 ? 93.550  5.645   4.821   1.00 85.99  ? 321  VAL B CG1 1 
ATOM   6058 C CG2 . VAL B 1 397 ? 92.403  3.890   3.433   1.00 84.69  ? 321  VAL B CG2 1 
ATOM   6059 N N   . GLY B 1 398 ? 93.400  4.164   8.042   1.00 88.25  ? 322  GLY B N   1 
ATOM   6060 C CA  . GLY B 1 398 ? 94.005  4.750   9.239   1.00 90.16  ? 322  GLY B CA  1 
ATOM   6061 C C   . GLY B 1 398 ? 95.309  4.138   9.712   1.00 97.14  ? 322  GLY B C   1 
ATOM   6062 O O   . GLY B 1 398 ? 96.198  4.857   10.182  1.00 97.70  ? 322  GLY B O   1 
ATOM   6063 N N   . ASN B 1 399 ? 95.433  2.806   9.576   1.00 95.33  ? 323  ASN B N   1 
ATOM   6064 C CA  . ASN B 1 399 ? 96.620  2.033   9.963   1.00 97.60  ? 323  ASN B CA  1 
ATOM   6065 C C   . ASN B 1 399 ? 97.809  2.370   9.026   1.00 103.42 ? 323  ASN B C   1 
ATOM   6066 O O   . ASN B 1 399 ? 98.959  2.422   9.478   1.00 105.40 ? 323  ASN B O   1 
ATOM   6067 C CB  . ASN B 1 399 ? 96.269  0.526   9.910   1.00 98.24  ? 323  ASN B CB  1 
ATOM   6068 C CG  . ASN B 1 399 ? 97.270  -0.468  10.475  1.00 122.11 ? 323  ASN B CG  1 
ATOM   6069 O OD1 . ASN B 1 399 ? 96.876  -1.495  11.039  1.00 117.27 ? 323  ASN B OD1 1 
ATOM   6070 N ND2 . ASN B 1 399 ? 98.570  -0.203  10.372  1.00 114.86 ? 323  ASN B ND2 1 
ATOM   6071 N N   . ARG B 1 400 ? 97.507  2.641   7.736   1.00 98.29  ? 324  ARG B N   1 
ATOM   6072 C CA  . ARG B 1 400 ? 98.473  2.917   6.672   1.00 98.27  ? 324  ARG B CA  1 
ATOM   6073 C C   . ARG B 1 400 ? 98.713  4.444   6.519   1.00 101.36 ? 324  ARG B C   1 
ATOM   6074 O O   . ARG B 1 400 ? 99.814  4.845   6.149   1.00 102.96 ? 324  ARG B O   1 
ATOM   6075 C CB  . ARG B 1 400 ? 97.946  2.301   5.363   1.00 96.76  ? 324  ARG B CB  1 
ATOM   6076 C CG  . ARG B 1 400 ? 98.946  2.249   4.222   1.00 104.84 ? 324  ARG B CG  1 
ATOM   6077 C CD  . ARG B 1 400 ? 98.556  1.237   3.156   1.00 107.88 ? 324  ARG B CD  1 
ATOM   6078 N NE  . ARG B 1 400 ? 97.270  1.533   2.525   1.00 110.16 ? 324  ARG B NE  1 
ATOM   6079 C CZ  . ARG B 1 400 ? 97.132  2.232   1.405   1.00 120.56 ? 324  ARG B CZ  1 
ATOM   6080 N NH1 . ARG B 1 400 ? 98.199  2.720   0.783   1.00 105.42 ? 324  ARG B NH1 1 
ATOM   6081 N NH2 . ARG B 1 400 ? 95.926  2.457   0.902   1.00 106.48 ? 324  ARG B NH2 1 
ATOM   6082 N N   . PHE B 1 401 ? 97.708  5.279   6.833   1.00 95.55  ? 325  PHE B N   1 
ATOM   6083 C CA  . PHE B 1 401 ? 97.806  6.744   6.777   1.00 94.95  ? 325  PHE B CA  1 
ATOM   6084 C C   . PHE B 1 401 ? 98.767  7.245   7.847   1.00 101.47 ? 325  PHE B C   1 
ATOM   6085 O O   . PHE B 1 401 ? 99.478  8.222   7.623   1.00 101.62 ? 325  PHE B O   1 
ATOM   6086 C CB  . PHE B 1 401 ? 96.406  7.383   6.962   1.00 94.51  ? 325  PHE B CB  1 
ATOM   6087 C CG  . PHE B 1 401 ? 96.340  8.896   6.879   1.00 95.41  ? 325  PHE B CG  1 
ATOM   6088 C CD1 . PHE B 1 401 ? 96.076  9.531   5.671   1.00 97.27  ? 325  PHE B CD1 1 
ATOM   6089 C CD2 . PHE B 1 401 ? 96.477  9.680   8.019   1.00 97.41  ? 325  PHE B CD2 1 
ATOM   6090 C CE1 . PHE B 1 401 ? 96.001  10.928  5.596   1.00 97.86  ? 325  PHE B CE1 1 
ATOM   6091 C CE2 . PHE B 1 401 ? 96.404  11.076  7.942   1.00 99.83  ? 325  PHE B CE2 1 
ATOM   6092 C CZ  . PHE B 1 401 ? 96.167  11.689  6.732   1.00 97.12  ? 325  PHE B CZ  1 
ATOM   6093 N N   . GLN B 1 402 ? 98.768  6.573   9.017   1.00 100.14 ? 326  GLN B N   1 
ATOM   6094 C CA  . GLN B 1 402 ? 99.583  6.918   10.183  1.00 102.51 ? 326  GLN B CA  1 
ATOM   6095 C C   . GLN B 1 402 ? 101.067 6.659   9.925   1.00 108.50 ? 326  GLN B C   1 
ATOM   6096 O O   . GLN B 1 402 ? 101.894 7.503   10.273  1.00 109.50 ? 326  GLN B O   1 
ATOM   6097 C CB  . GLN B 1 402 ? 99.124  6.121   11.416  1.00 104.24 ? 326  GLN B CB  1 
ATOM   6098 N N   . GLN B 1 403 ? 101.407 5.509   9.322   1.00 105.61 ? 327  GLN B N   1 
ATOM   6099 C CA  . GLN B 1 403 ? 102.797 5.175   9.040   1.00 107.87 ? 327  GLN B CA  1 
ATOM   6100 C C   . GLN B 1 403 ? 103.355 6.017   7.888   1.00 113.13 ? 327  GLN B C   1 
ATOM   6101 O O   . GLN B 1 403 ? 104.556 6.285   7.887   1.00 114.87 ? 327  GLN B O   1 
ATOM   6102 C CB  . GLN B 1 403 ? 102.966 3.685   8.725   1.00 109.23 ? 327  GLN B CB  1 
ATOM   6103 C CG  . GLN B 1 403 ? 103.072 2.816   9.985   1.00 129.20 ? 327  GLN B CG  1 
ATOM   6104 C CD  . GLN B 1 403 ? 104.342 3.062   10.802  1.00 149.91 ? 327  GLN B CD  1 
ATOM   6105 O OE1 . GLN B 1 403 ? 105.385 3.504   10.294  1.00 144.82 ? 327  GLN B OE1 1 
ATOM   6106 N NE2 . GLN B 1 403 ? 104.306 2.694   12.072  1.00 143.75 ? 327  GLN B NE2 1 
ATOM   6107 N N   . LYS B 1 404 ? 102.508 6.470   6.943   1.00 108.47 ? 328  LYS B N   1 
ATOM   6108 C CA  . LYS B 1 404 ? 103.001 7.289   5.829   1.00 108.93 ? 328  LYS B CA  1 
ATOM   6109 C C   . LYS B 1 404 ? 103.138 8.771   6.247   1.00 115.40 ? 328  LYS B C   1 
ATOM   6110 O O   . LYS B 1 404 ? 103.879 9.514   5.597   1.00 115.98 ? 328  LYS B O   1 
ATOM   6111 C CB  . LYS B 1 404 ? 102.096 7.165   4.591   1.00 108.57 ? 328  LYS B CB  1 
ATOM   6112 C CG  . LYS B 1 404 ? 102.215 5.799   3.911   1.00 111.65 ? 328  LYS B CG  1 
ATOM   6113 C CD  . LYS B 1 404 ? 101.331 5.673   2.689   1.00 113.06 ? 328  LYS B CD  1 
ATOM   6114 C CE  . LYS B 1 404 ? 101.659 4.431   1.896   1.00 116.32 ? 328  LYS B CE  1 
ATOM   6115 N NZ  . LYS B 1 404 ? 101.504 3.176   2.673   1.00 121.19 ? 328  LYS B NZ  1 
ATOM   6116 N N   . LEU B 1 405 ? 102.465 9.188   7.338   1.00 113.13 ? 329  LEU B N   1 
ATOM   6117 C CA  . LEU B 1 405 ? 102.560 10.561  7.841   1.00 114.49 ? 329  LEU B CA  1 
ATOM   6118 C C   . LEU B 1 405 ? 103.796 10.688  8.757   1.00 122.05 ? 329  LEU B C   1 
ATOM   6119 O O   . LEU B 1 405 ? 104.429 11.745  8.795   1.00 123.25 ? 329  LEU B O   1 
ATOM   6120 C CB  . LEU B 1 405 ? 101.264 10.969  8.578   1.00 113.11 ? 329  LEU B CB  1 
ATOM   6121 C CG  . LEU B 1 405 ? 101.138 12.441  9.018   1.00 118.61 ? 329  LEU B CG  1 
ATOM   6122 C CD1 . LEU B 1 405 ? 101.281 13.398  7.846   1.00 118.69 ? 329  LEU B CD1 1 
ATOM   6123 C CD2 . LEU B 1 405 ? 99.828  12.690  9.712   1.00 119.69 ? 329  LEU B CD2 1 
ATOM   6124 N N   . ARG B 1 406 ? 104.158 9.595   9.457   1.00 119.91 ? 330  ARG B N   1 
ATOM   6125 C CA  . ARG B 1 406 ? 105.343 9.548   10.317  1.00 122.71 ? 330  ARG B CA  1 
ATOM   6126 C C   . ARG B 1 406 ? 106.620 9.380   9.467   1.00 129.13 ? 330  ARG B C   1 
ATOM   6127 O O   . ARG B 1 406 ? 107.712 9.720   9.933   1.00 131.61 ? 330  ARG B O   1 
ATOM   6128 C CB  . ARG B 1 406 ? 105.225 8.412   11.344  1.00 123.05 ? 330  ARG B CB  1 
ATOM   6129 N N   . SER B 1 407 ? 106.476 8.871   8.220   1.00 124.73 ? 331  SER B N   1 
ATOM   6130 C CA  . SER B 1 407 ? 107.586 8.677   7.280   1.00 126.13 ? 331  SER B CA  1 
ATOM   6131 C C   . SER B 1 407 ? 108.058 10.017  6.693   1.00 130.91 ? 331  SER B C   1 
ATOM   6132 O O   . SER B 1 407 ? 109.266 10.239  6.586   1.00 132.70 ? 331  SER B O   1 
ATOM   6133 C CB  . SER B 1 407 ? 107.184 7.730   6.153   1.00 128.28 ? 331  SER B CB  1 
ATOM   6134 O OG  . SER B 1 407 ? 106.916 6.423   6.630   1.00 136.78 ? 331  SER B OG  1 
ATOM   6135 N N   . VAL B 1 408 ? 107.109 10.904  6.315   1.00 125.87 ? 332  VAL B N   1 
ATOM   6136 C CA  . VAL B 1 408 ? 107.420 12.225  5.750   1.00 126.72 ? 332  VAL B CA  1 
ATOM   6137 C C   . VAL B 1 408 ? 107.916 13.168  6.877   1.00 133.10 ? 332  VAL B C   1 
ATOM   6138 O O   . VAL B 1 408 ? 108.705 14.077  6.603   1.00 134.87 ? 332  VAL B O   1 
ATOM   6139 C CB  . VAL B 1 408 ? 106.232 12.868  4.968   1.00 128.07 ? 332  VAL B CB  1 
ATOM   6140 C CG1 . VAL B 1 408 ? 105.972 12.149  3.649   1.00 126.56 ? 332  VAL B CG1 1 
ATOM   6141 C CG2 . VAL B 1 408 ? 104.962 12.951  5.805   1.00 125.76 ? 332  VAL B CG2 1 
ATOM   6142 N N   . PHE B 1 409 ? 107.470 12.937  8.131   1.00 129.25 ? 333  PHE B N   1 
ATOM   6143 C CA  . PHE B 1 409 ? 107.863 13.740  9.290   1.00 130.94 ? 333  PHE B CA  1 
ATOM   6144 C C   . PHE B 1 409 ? 109.257 13.314  9.804   1.00 136.92 ? 333  PHE B C   1 
ATOM   6145 O O   . PHE B 1 409 ? 110.128 14.174  9.963   1.00 138.75 ? 333  PHE B O   1 
ATOM   6146 C CB  . PHE B 1 409 ? 106.815 13.619  10.407  1.00 131.37 ? 333  PHE B CB  1 
ATOM   6147 N N   . ARG B 1 410 ? 109.459 11.985  10.045  1.00 132.91 ? 334  ARG B N   1 
ATOM   6148 C CA  . ARG B 1 410 ? 110.701 11.348  10.523  1.00 162.32 ? 334  ARG B CA  1 
ATOM   6149 C C   . ARG B 1 410 ? 111.206 12.009  11.812  1.00 190.06 ? 334  ARG B C   1 
ATOM   6150 O O   . ARG B 1 410 ? 112.043 11.440  12.514  1.00 149.95 ? 334  ARG B O   1 
ATOM   6151 C CB  . ARG B 1 410 ? 111.805 11.395  9.452   1.00 164.25 ? 334  ARG B CB  1 
HETATM 6152 N N1  . 8ES C 2 .   ? 77.243  -2.606  37.295  1.00 121.80 ? 1501 8ES A N1  1 
HETATM 6153 N N3  . 8ES C 2 .   ? 82.588  -2.298  32.946  1.00 127.96 ? 1501 8ES A N3  1 
HETATM 6154 C C4  . 8ES C 2 .   ? 74.145  -3.788  38.050  1.00 119.07 ? 1501 8ES A C4  1 
HETATM 6155 C C5  . 8ES C 2 .   ? 78.551  -2.538  37.749  1.00 122.73 ? 1501 8ES A C5  1 
HETATM 6156 C C6  . 8ES C 2 .   ? 76.606  -1.408  36.747  1.00 121.37 ? 1501 8ES A C6  1 
HETATM 6157 C C7  . 8ES C 2 .   ? 77.257  -0.983  35.418  1.00 121.42 ? 1501 8ES A C7  1 
HETATM 6158 C C8  . 8ES C 2 .   ? 77.275  0.301   35.115  1.00 121.70 ? 1501 8ES A C8  1 
HETATM 6159 C C10 . 8ES C 2 .   ? 78.457  -0.076  32.962  1.00 121.50 ? 1501 8ES A C10 1 
HETATM 6160 C C13 . 8ES C 2 .   ? 81.315  -0.654  32.217  1.00 126.02 ? 1501 8ES A C13 1 
HETATM 6161 C C15 . 8ES C 2 .   ? 80.228  1.597   29.362  1.00 122.03 ? 1501 8ES A C15 1 
HETATM 6162 C C17 . 8ES C 2 .   ? 78.337  1.307   30.842  1.00 121.97 ? 1501 8ES A C17 1 
HETATM 6163 C C20 . 8ES C 2 .   ? 79.078  -6.159  38.667  1.00 123.29 ? 1501 8ES A C20 1 
HETATM 6164 C C21 . 8ES C 2 .   ? 80.422  -6.124  39.085  1.00 125.33 ? 1501 8ES A C21 1 
HETATM 6165 C C22 . 8ES C 2 .   ? 81.168  -4.918  39.074  1.00 126.86 ? 1501 8ES A C22 1 
HETATM 6166 C C24 . 8ES C 2 .   ? 83.645  -5.232  38.601  1.00 132.72 ? 1501 8ES A C24 1 
HETATM 6167 C C26 . 8ES C 2 .   ? 82.504  -5.138  36.210  1.00 130.97 ? 1501 8ES A C26 1 
HETATM 6168 C C28 . 8ES C 2 .   ? 83.605  -6.832  34.857  1.00 131.91 ? 1501 8ES A C28 1 
HETATM 6169 O O1  . 8ES C 2 .   ? 84.765  -5.168  38.985  1.00 134.76 ? 1501 8ES A O1  1 
HETATM 6170 C C25 . 8ES C 2 .   ? 83.427  -5.697  37.155  1.00 132.76 ? 1501 8ES A C25 1 
HETATM 6171 S S   . 8ES C 2 .   ? 84.362  -6.917  36.396  1.00 134.49 ? 1501 8ES A S   1 
HETATM 6172 C C27 . 8ES C 2 .   ? 82.595  -5.817  34.853  1.00 130.25 ? 1501 8ES A C27 1 
HETATM 6173 N N6  . 8ES C 2 .   ? 82.553  -4.867  39.505  1.00 130.67 ? 1501 8ES A N6  1 
HETATM 6174 C C29 . 8ES C 2 .   ? 82.843  -4.417  40.863  1.00 132.92 ? 1501 8ES A C29 1 
HETATM 6175 C C30 . 8ES C 2 .   ? 82.316  -5.453  41.854  1.00 134.13 ? 1501 8ES A C30 1 
HETATM 6176 C C35 . 8ES C 2 .   ? 82.985  -6.827  41.930  1.00 135.70 ? 1501 8ES A C35 1 
HETATM 6177 C C34 . 8ES C 2 .   ? 82.536  -7.733  42.779  1.00 136.92 ? 1501 8ES A C34 1 
HETATM 6178 C C33 . 8ES C 2 .   ? 81.331  -7.418  43.673  1.00 136.53 ? 1501 8ES A C33 1 
HETATM 6179 C C32 . 8ES C 2 .   ? 80.752  -6.234  43.603  1.00 135.16 ? 1501 8ES A C32 1 
HETATM 6180 C C31 . 8ES C 2 .   ? 81.273  -5.181  42.616  1.00 133.92 ? 1501 8ES A C31 1 
HETATM 6181 C C1  . 8ES C 2 .   ? 78.480  -4.987  38.230  1.00 122.68 ? 1501 8ES A C1  1 
HETATM 6182 C C23 . 8ES C 2 .   ? 80.529  -3.753  38.635  1.00 125.13 ? 1501 8ES A C23 1 
HETATM 6183 C C   . 8ES C 2 .   ? 79.222  -3.781  38.220  1.00 123.50 ? 1501 8ES A C   1 
HETATM 6184 O O   . 8ES C 2 .   ? 79.286  -1.339  37.719  1.00 122.71 ? 1501 8ES A O   1 
HETATM 6185 C C2  . 8ES C 2 .   ? 76.557  -3.870  37.350  1.00 120.68 ? 1501 8ES A C2  1 
HETATM 6186 C C3  . 8ES C 2 .   ? 75.102  -4.009  36.881  1.00 118.45 ? 1501 8ES A C3  1 
HETATM 6187 N N   . 8ES C 2 .   ? 77.147  -5.022  37.784  1.00 121.64 ? 1501 8ES A N   1 
HETATM 6188 C C19 . 8ES C 2 .   ? 77.878  -1.998  34.434  1.00 121.55 ? 1501 8ES A C19 1 
HETATM 6189 C C18 . 8ES C 2 .   ? 78.425  -1.580  33.296  1.00 121.49 ? 1501 8ES A C18 1 
HETATM 6190 C C9  . 8ES C 2 .   ? 77.924  0.780   33.817  1.00 121.02 ? 1501 8ES A C9  1 
HETATM 6191 C C11 . 8ES C 2 .   ? 79.094  0.474   31.672  1.00 122.46 ? 1501 8ES A C11 1 
HETATM 6192 C C16 . 8ES C 2 .   ? 78.900  1.862   29.694  1.00 121.64 ? 1501 8ES A C16 1 
HETATM 6193 C C14 . 8ES C 2 .   ? 80.993  0.786   30.190  1.00 123.20 ? 1501 8ES A C14 1 
HETATM 6194 C C12 . 8ES C 2 .   ? 80.440  0.245   31.351  1.00 123.83 ? 1501 8ES A C12 1 
HETATM 6195 N N5  . 8ES C 2 .   ? 81.611  -0.478  33.592  1.00 128.46 ? 1501 8ES A N5  1 
HETATM 6196 N N4  . 8ES C 2 .   ? 82.401  -1.492  34.034  1.00 129.73 ? 1501 8ES A N4  1 
HETATM 6197 N N2  . 8ES C 2 .   ? 81.916  -1.787  31.823  1.00 125.80 ? 1501 8ES A N2  1 
HETATM 6198 N N1  . 8ES D 2 .   ? 67.348  11.891  4.696   1.00 61.37  ? 1201 8ES B N1  1 
HETATM 6199 N N3  . 8ES D 2 .   ? 62.793  15.036  8.809   1.00 69.16  ? 1201 8ES B N3  1 
HETATM 6200 C C4  . 8ES D 2 .   ? 70.086  9.902   4.296   1.00 59.24  ? 1201 8ES B C4  1 
HETATM 6201 C C5  . 8ES D 2 .   ? 66.014  12.042  4.338   1.00 61.93  ? 1201 8ES B C5  1 
HETATM 6202 C C6  . 8ES D 2 .   ? 68.248  13.045  4.647   1.00 61.13  ? 1201 8ES B C6  1 
HETATM 6203 C C7  . 8ES D 2 .   ? 67.873  14.094  5.712   1.00 60.64  ? 1201 8ES B C7  1 
HETATM 6204 C C8  . 8ES D 2 .   ? 68.128  15.361  5.450   1.00 60.02  ? 1201 8ES B C8  1 
HETATM 6205 C C10 . 8ES D 2 .   ? 67.200  16.135  7.629   1.00 62.64  ? 1201 8ES B C10 1 
HETATM 6206 C C13 . 8ES D 2 .   ? 64.413  16.542  8.696   1.00 68.47  ? 1201 8ES B C13 1 
HETATM 6207 C C15 . 8ES D 2 .   ? 66.266  19.456  10.268  1.00 65.49  ? 1201 8ES B C15 1 
HETATM 6208 C C17 . 8ES D 2 .   ? 67.851  18.202  8.951   1.00 64.13  ? 1201 8ES B C17 1 
HETATM 6209 C C20 . 8ES D 2 .   ? 64.778  8.550   5.090   1.00 62.04  ? 1201 8ES B C20 1 
HETATM 6210 C C21 . 8ES D 2 .   ? 63.407  8.685   4.796   1.00 63.60  ? 1201 8ES B C21 1 
HETATM 6211 C C22 . 8ES D 2 .   ? 62.861  9.917   4.348   1.00 64.41  ? 1201 8ES B C22 1 
HETATM 6212 C C24 . 8ES D 2 .   ? 60.448  10.297  5.093   1.00 67.46  ? 1201 8ES B C24 1 
HETATM 6213 C C26 . 8ES D 2 .   ? 61.954  11.136  7.114   1.00 66.79  ? 1201 8ES B C26 1 
HETATM 6214 C C28 . 8ES D 2 .   ? 60.804  10.403  9.131   1.00 69.99  ? 1201 8ES B C28 1 
HETATM 6215 O O1  . 8ES D 2 .   ? 59.297  10.401  4.811   1.00 70.63  ? 1201 8ES B O1  1 
HETATM 6216 C C25 . 8ES D 2 .   ? 60.816  10.436  6.575   1.00 68.34  ? 1201 8ES B C25 1 
HETATM 6217 S S   . 8ES D 2 .   ? 59.819  9.836   7.841   1.00 71.29  ? 1201 8ES B S   1 
HETATM 6218 C C27 . 8ES D 2 .   ? 61.950  11.109  8.633   1.00 67.89  ? 1201 8ES B C27 1 
HETATM 6219 N N6  . 8ES D 2 .   ? 61.441  10.060  4.041   1.00 64.45  ? 1201 8ES B N6  1 
HETATM 6220 C C29 . 8ES D 2 .   ? 61.020  9.960   2.652   1.00 64.07  ? 1201 8ES B C29 1 
HETATM 6221 C C30 . 8ES D 2 .   ? 61.236  8.533   2.155   1.00 63.37  ? 1201 8ES B C30 1 
HETATM 6222 C C35 . 8ES D 2 .   ? 60.347  7.416   2.716   1.00 64.34  ? 1201 8ES B C35 1 
HETATM 6223 C C34 . 8ES D 2 .   ? 60.525  6.176   2.299   1.00 64.40  ? 1201 8ES B C34 1 
HETATM 6224 C C33 . 8ES D 2 .   ? 61.624  5.867   1.272   1.00 61.91  ? 1201 8ES B C33 1 
HETATM 6225 C C32 . 8ES D 2 .   ? 62.389  6.838   0.792   1.00 59.35  ? 1201 8ES B C32 1 
HETATM 6226 C C31 . 8ES D 2 .   ? 62.197  8.274   1.277   1.00 59.65  ? 1201 8ES B C31 1 
HETATM 6227 C C1  . 8ES D 2 .   ? 65.613  9.647   4.944   1.00 61.46  ? 1201 8ES B C1  1 
HETATM 6228 C C23 . 8ES D 2 .   ? 63.736  11.001  4.205   1.00 64.18  ? 1201 8ES B C23 1 
HETATM 6229 C C   . 8ES D 2 .   ? 65.078  10.881  4.494   1.00 62.84  ? 1201 8ES B C   1 
HETATM 6230 O O   . 8ES D 2 .   ? 65.504  13.281  3.907   1.00 61.46  ? 1201 8ES B O   1 
HETATM 6231 C C2  . 8ES D 2 .   ? 67.808  10.598  5.135   1.00 61.18  ? 1201 8ES B C2  1 
HETATM 6232 C C3  . 8ES D 2 .   ? 69.280  10.364  5.511   1.00 60.32  ? 1201 8ES B C3  1 
HETATM 6233 N N   . 8ES D 2 .   ? 66.980  9.518   5.266   1.00 61.19  ? 1201 8ES B N   1 
HETATM 6234 C C19 . 8ES D 2 .   ? 67.232  13.718  7.068   1.00 61.50  ? 1201 8ES B C19 1 
HETATM 6235 C C18 . 8ES D 2 .   ? 66.928  14.657  7.960   1.00 61.78  ? 1201 8ES B C18 1 
HETATM 6236 C C9  . 8ES D 2 .   ? 67.750  16.439  6.464   1.00 62.10  ? 1201 8ES B C9  1 
HETATM 6237 C C11 . 8ES D 2 .   ? 66.855  17.286  8.598   1.00 64.30  ? 1201 8ES B C11 1 
HETATM 6238 C C16 . 8ES D 2 .   ? 67.560  19.278  9.785   1.00 65.53  ? 1201 8ES B C16 1 
HETATM 6239 C C14 . 8ES D 2 .   ? 65.257  18.575  9.901   1.00 65.00  ? 1201 8ES B C14 1 
HETATM 6240 C C12 . 8ES D 2 .   ? 65.543  17.507  9.052   1.00 66.36  ? 1201 8ES B C12 1 
HETATM 6241 N N5  . 8ES D 2 .   ? 63.964  16.198  7.395   1.00 69.87  ? 1201 8ES B N5  1 
HETATM 6242 N N4  . 8ES D 2 .   ? 62.958  15.278  7.472   1.00 69.78  ? 1201 8ES B N4  1 
HETATM 6243 N N2  . 8ES D 2 .   ? 63.690  15.814  9.564   1.00 68.08  ? 1201 8ES B N2  1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ALA A 1   ? 2.3731 2.3423 1.9228 -0.1955 0.1373  -0.1174 1001 ALA A N   
2    C CA  . ALA A 1   ? 2.3442 2.3842 1.8963 -0.2121 0.0941  -0.1028 1001 ALA A CA  
3    C C   . ALA A 1   ? 2.3643 2.4351 1.9363 -0.1866 0.0922  -0.0747 1001 ALA A C   
4    O O   . ALA A 1   ? 2.3315 2.4602 1.9161 -0.1893 0.0610  -0.0535 1001 ALA A O   
5    C CB  . ALA A 1   ? 2.4355 2.4744 1.9074 -0.2613 0.0867  -0.1281 1001 ALA A CB  
6    N N   . ASP A 2   ? 2.3296 2.3629 1.9081 -0.1604 0.1284  -0.0714 1002 ASP A N   
7    C CA  . ASP A 2   ? 2.3055 2.3613 1.9079 -0.1370 0.1344  -0.0457 1002 ASP A CA  
8    C C   . ASP A 2   ? 2.2630 2.3605 1.9536 -0.1110 0.1140  -0.0197 1002 ASP A C   
9    O O   . ASP A 2   ? 2.2224 2.3146 1.9534 -0.1005 0.1115  -0.0234 1002 ASP A O   
10   C CB  . ASP A 2   ? 2.3768 2.3807 1.9575 -0.1203 0.1842  -0.0518 1002 ASP A CB  
11   C CG  . ASP A 2   ? 2.4863 2.5103 2.0919 -0.0982 0.1978  -0.0261 1002 ASP A CG  
12   O OD1 . ASP A 2   ? 2.4806 2.5453 2.0875 -0.1037 0.1744  -0.0082 1002 ASP A OD1 
13   O OD2 . ASP A 2   ? 2.5670 2.5649 2.1869 -0.0754 0.2362  -0.0223 1002 ASP A OD2 
14   N N   . LEU A 3   ? 2.1874 2.3217 1.9028 -0.1019 0.1022  0.0058  1003 LEU A N   
15   C CA  . LEU A 3   ? 2.1102 2.2765 1.8997 -0.0836 0.0861  0.0273  1003 LEU A CA  
16   C C   . LEU A 3   ? 2.1173 2.2733 1.9567 -0.0626 0.1066  0.0283  1003 LEU A C   
17   O O   . LEU A 3   ? 2.0632 2.2341 1.9517 -0.0547 0.0919  0.0304  1003 LEU A O   
18   C CB  . LEU A 3   ? 2.1117 2.3043 1.9076 -0.0796 0.0814  0.0538  1003 LEU A CB  
19   C CG  . LEU A 3   ? 2.1163 2.3313 1.9796 -0.0663 0.0694  0.0742  1003 LEU A CG  
20   C CD1 . LEU A 3   ? 2.0838 2.3173 1.9665 -0.0690 0.0402  0.0752  1003 LEU A CD1 
21   C CD2 . LEU A 3   ? 2.1681 2.3946 2.0308 -0.0618 0.0762  0.1008  1003 LEU A CD2 
22   N N   . GLU A 4   ? 2.0986 2.2342 1.9245 -0.0534 0.1407  0.0288  1004 GLU A N   
23   C CA  . GLU A 4   ? 2.0719 2.2102 1.9471 -0.0314 0.1629  0.0356  1004 GLU A CA  
24   C C   . GLU A 4   ? 2.0979 2.2168 1.9788 -0.0232 0.1674  0.0222  1004 GLU A C   
25   O O   . GLU A 4   ? 2.0501 2.1938 1.9874 -0.0071 0.1633  0.0317  1004 GLU A O   
26   C CB  . GLU A 4   ? 2.1427 2.2615 1.9945 -0.0219 0.2040  0.0409  1004 GLU A CB  
27   C CG  . GLU A 4   ? 2.2761 2.4106 2.1849 0.0036  0.2299  0.0549  1004 GLU A CG  
28   C CD  . GLU A 4   ? 2.6469 2.7616 2.5365 0.0177  0.2770  0.0626  1004 GLU A CD  
29   O OE1 . GLU A 4   ? 2.5902 2.7232 2.5289 0.0419  0.3013  0.0775  1004 GLU A OE1 
30   O OE2 . GLU A 4   ? 2.6575 2.7414 2.4817 0.0058  0.2909  0.0553  1004 GLU A OE2 
31   N N   . ASP A 5   ? 2.0904 2.1656 1.9103 -0.0366 0.1764  0.0005  1005 ASP A N   
32   C CA  . ASP A 5   ? 2.0940 2.1364 1.9077 -0.0313 0.1879  -0.0130 1005 ASP A CA  
33   C C   . ASP A 5   ? 2.0620 2.1305 1.9079 -0.0370 0.1509  -0.0137 1005 ASP A C   
34   O O   . ASP A 5   ? 2.0382 2.1014 1.9103 -0.0215 0.1560  -0.0121 1005 ASP A O   
35   C CB  . ASP A 5   ? 2.2027 2.1836 1.9343 -0.0528 0.2116  -0.0398 1005 ASP A CB  
36   C CG  . ASP A 5   ? 2.4122 2.3542 2.1010 -0.0458 0.2562  -0.0424 1005 ASP A CG  
37   O OD1 . ASP A 5   ? 2.4060 2.3616 2.1387 -0.0152 0.2795  -0.0215 1005 ASP A OD1 
38   O OD2 . ASP A 5   ? 2.5646 2.4634 2.1752 -0.0717 0.2700  -0.0659 1005 ASP A OD2 
39   N N   . ASN A 6   ? 1.9764 2.0736 1.8200 -0.0559 0.1167  -0.0127 1006 ASN A N   
40   C CA  . ASN A 6   ? 1.9169 2.0394 1.7911 -0.0596 0.0848  -0.0111 1006 ASN A CA  
41   C C   . ASN A 6   ? 1.8974 2.0537 1.8359 -0.0397 0.0742  0.0055  1006 ASN A C   
42   O O   . ASN A 6   ? 1.8663 2.0299 1.8301 -0.0330 0.0629  0.0047  1006 ASN A O   
43   C CB  . ASN A 6   ? 1.9083 2.0553 1.7645 -0.0805 0.0570  -0.0091 1006 ASN A CB  
44   C CG  . ASN A 6   ? 2.1767 2.3048 1.9711 -0.1086 0.0580  -0.0279 1006 ASN A CG  
45   O OD1 . ASN A 6   ? 2.1007 2.1862 1.8641 -0.1166 0.0791  -0.0481 1006 ASN A OD1 
46   N ND2 . ASN A 6   ? 2.0837 2.2450 1.8590 -0.1256 0.0357  -0.0209 1006 ASN A ND2 
47   N N   . TRP A 7   ? 1.8299 2.0061 1.7920 -0.0329 0.0799  0.0195  1007 TRP A N   
48   C CA  . TRP A 7   ? 1.7781 1.9879 1.7985 -0.0218 0.0718  0.0317  1007 TRP A CA  
49   C C   . TRP A 7   ? 1.7924 2.0072 1.8362 -0.0023 0.0886  0.0347  1007 TRP A C   
50   O O   . TRP A 7   ? 1.7534 1.9987 1.8375 0.0045  0.0746  0.0401  1007 TRP A O   
51   C CB  . TRP A 7   ? 1.7651 1.9940 1.8059 -0.0247 0.0768  0.0455  1007 TRP A CB  
52   C CG  . TRP A 7   ? 1.7711 2.0053 1.8115 -0.0368 0.0577  0.0509  1007 TRP A CG  
53   C CD1 . TRP A 7   ? 1.8352 2.0609 1.8409 -0.0443 0.0586  0.0574  1007 TRP A CD1 
54   C CD2 . TRP A 7   ? 1.7401 1.9866 1.8119 -0.0402 0.0374  0.0521  1007 TRP A CD2 
55   N NE1 . TRP A 7   ? 1.8148 2.0491 1.8352 -0.0479 0.0423  0.0675  1007 TRP A NE1 
56   C CE2 . TRP A 7   ? 1.8006 2.0418 1.8598 -0.0461 0.0313  0.0624  1007 TRP A CE2 
57   C CE3 . TRP A 7   ? 1.7298 1.9909 1.8357 -0.0384 0.0260  0.0465  1007 TRP A CE3 
58   C CZ2 . TRP A 7   ? 1.7783 2.0193 1.8592 -0.0480 0.0195  0.0666  1007 TRP A CZ2 
59   C CZ3 . TRP A 7   ? 1.7365 1.9964 1.8569 -0.0450 0.0116  0.0458  1007 TRP A CZ3 
60   C CH2 . TRP A 7   ? 1.7577 2.0034 1.8668 -0.0488 0.0112  0.0557  1007 TRP A CH2 
61   N N   . GLU A 8   ? 1.7649 1.9486 1.7797 0.0076  0.1203  0.0322  1008 GLU A N   
62   C CA  . GLU A 8   ? 1.7572 1.9411 1.7918 0.0329  0.1435  0.0407  1008 GLU A CA  
63   C C   . GLU A 8   ? 1.7547 1.9230 1.7823 0.0362  0.1334  0.0330  1008 GLU A C   
64   O O   . GLU A 8   ? 1.7258 1.9223 1.7898 0.0555  0.1311  0.0461  1008 GLU A O   
65   C CB  . GLU A 8   ? 1.8376 1.9785 1.8362 0.0440  0.1882  0.0398  1008 GLU A CB  
66   C CG  . GLU A 8   ? 1.9925 2.1347 2.0171 0.0782  0.2207  0.0569  1008 GLU A CG  
67   C CD  . GLU A 8   ? 2.3457 2.4393 2.3366 0.0943  0.2737  0.0584  1008 GLU A CD  
68   O OE1 . GLU A 8   ? 2.3408 2.4099 2.2920 0.0779  0.2843  0.0475  1008 GLU A OE1 
69   O OE2 . GLU A 8   ? 2.2939 2.3757 2.2988 0.1263  0.3073  0.0737  1008 GLU A OE2 
70   N N   . THR A 9   ? 1.6967 1.8287 1.6800 0.0154  0.1248  0.0140  1009 THR A N   
71   C CA  . THR A 9   ? 1.6757 1.7910 1.6510 0.0136  0.1163  0.0059  1009 THR A CA  
72   C C   . THR A 9   ? 1.6344 1.7961 1.6516 0.0151  0.0816  0.0134  1009 THR A C   
73   O O   . THR A 9   ? 1.6165 1.7840 1.6487 0.0289  0.0794  0.0185  1009 THR A O   
74   C CB  . THR A 9   ? 1.8077 1.8855 1.7306 -0.0154 0.1137  -0.0155 1009 THR A CB  
75   O OG1 . THR A 9   ? 1.8645 1.8961 1.7401 -0.0215 0.1470  -0.0267 1009 THR A OG1 
76   C CG2 . THR A 9   ? 1.7918 1.8496 1.7073 -0.0203 0.1101  -0.0239 1009 THR A CG2 
77   N N   . LEU A 10  ? 1.5393 1.7295 1.5715 0.0019  0.0587  0.0150  1010 LEU A N   
78   C CA  . LEU A 10  ? 1.4851 1.7084 1.5498 0.0000  0.0316  0.0187  1010 LEU A CA  
79   C C   . LEU A 10  ? 1.5088 1.7700 1.6135 0.0153  0.0310  0.0304  1010 LEU A C   
80   O O   . LEU A 10  ? 1.4865 1.7648 1.6046 0.0199  0.0165  0.0308  1010 LEU A O   
81   C CB  . LEU A 10  ? 1.4706 1.7045 1.5397 -0.0156 0.0175  0.0199  1010 LEU A CB  
82   C CG  . LEU A 10  ? 1.5333 1.7522 1.5737 -0.0296 0.0079  0.0152  1010 LEU A CG  
83   C CD1 . LEU A 10  ? 1.5344 1.7629 1.5777 -0.0374 0.0032  0.0245  1010 LEU A CD1 
84   C CD2 . LEU A 10  ? 1.5438 1.7645 1.5900 -0.0300 -0.0083 0.0116  1010 LEU A CD2 
85   N N   . ASN A 11  ? 1.4663 1.7459 1.5894 0.0227  0.0470  0.0412  1011 ASN A N   
86   C CA  . ASN A 11  ? 1.4444 1.7771 1.6127 0.0348  0.0454  0.0564  1011 ASN A CA  
87   C C   . ASN A 11  ? 1.4773 1.8163 1.6499 0.0624  0.0585  0.0688  1011 ASN A C   
88   O O   . ASN A 11  ? 1.4510 1.8388 1.6529 0.0696  0.0429  0.0790  1011 ASN A O   
89   C CB  . ASN A 11  ? 1.4812 1.8350 1.6718 0.0358  0.0630  0.0681  1011 ASN A CB  
90   C CG  . ASN A 11  ? 1.8296 2.1828 2.0229 0.0113  0.0532  0.0622  1011 ASN A CG  
91   O OD1 . ASN A 11  ? 1.7461 2.1013 1.9427 -0.0062 0.0303  0.0531  1011 ASN A OD1 
92   N ND2 . ASN A 11  ? 1.7611 2.1091 1.9531 0.0117  0.0749  0.0695  1011 ASN A ND2 
93   N N   . ASP A 12  ? 1.4535 1.7423 1.5940 0.0767  0.0886  0.0682  1012 ASP A N   
94   C CA  . ASP A 12  ? 1.4676 1.7488 1.6087 0.1068  0.1103  0.0832  1012 ASP A CA  
95   C C   . ASP A 12  ? 1.4833 1.7610 1.6154 0.1066  0.0910  0.0788  1012 ASP A C   
96   O O   . ASP A 12  ? 1.4818 1.7882 1.6324 0.1315  0.0939  0.0986  1012 ASP A O   
97   C CB  . ASP A 12  ? 1.5480 1.7576 1.6475 0.1163  0.1532  0.0781  1012 ASP A CB  
98   C CG  . ASP A 12  ? 1.7179 1.9243 1.8219 0.1273  0.1850  0.0875  1012 ASP A CG  
99   O OD1 . ASP A 12  ? 1.6991 1.9621 1.8420 0.1238  0.1715  0.0979  1012 ASP A OD1 
100  O OD2 . ASP A 12  ? 1.8561 1.9994 1.9226 0.1374  0.2264  0.0833  1012 ASP A OD2 
101  N N   . ASN A 13  ? 1.4108 1.6578 1.5156 0.0813  0.0733  0.0566  1013 ASN A N   
102  C CA  . ASN A 13  ? 1.3872 1.6284 1.4828 0.0800  0.0578  0.0521  1013 ASN A CA  
103  C C   . ASN A 13  ? 1.3779 1.6758 1.5013 0.0764  0.0259  0.0558  1013 ASN A C   
104  O O   . ASN A 13  ? 1.3727 1.6813 1.4943 0.0864  0.0178  0.0609  1013 ASN A O   
105  C CB  . ASN A 13  ? 1.3888 1.5879 1.4527 0.0552  0.0517  0.0311  1013 ASN A CB  
106  C CG  . ASN A 13  ? 1.6822 1.8234 1.7094 0.0497  0.0807  0.0215  1013 ASN A CG  
107  O OD1 . ASN A 13  ? 1.6439 1.7642 1.6467 0.0244  0.0756  0.0054  1013 ASN A OD1 
108  N ND2 . ASN A 13  ? 1.5901 1.7047 1.6108 0.0724  0.1138  0.0319  1013 ASN A ND2 
109  N N   . LEU A 14  ? 1.2941 1.6252 1.4394 0.0607  0.0106  0.0527  1014 LEU A N   
110  C CA  . LEU A 14  ? 1.2646 1.6453 1.4324 0.0500  -0.0164 0.0517  1014 LEU A CA  
111  C C   . LEU A 14  ? 1.3046 1.7442 1.4977 0.0707  -0.0185 0.0732  1014 LEU A C   
112  O O   . LEU A 14  ? 1.2960 1.7713 1.4918 0.0658  -0.0404 0.0721  1014 LEU A O   
113  C CB  . LEU A 14  ? 1.2541 1.6510 1.4407 0.0266  -0.0248 0.0447  1014 LEU A CB  
114  C CG  . LEU A 14  ? 1.3071 1.6632 1.4743 0.0056  -0.0308 0.0279  1014 LEU A CG  
115  C CD1 . LEU A 14  ? 1.3092 1.6729 1.4936 -0.0108 -0.0280 0.0279  1014 LEU A CD1 
116  C CD2 . LEU A 14  ? 1.3299 1.6814 1.4870 -0.0048 -0.0491 0.0156  1014 LEU A CD2 
117  N N   . LYS A 15  ? 1.2616 1.7123 1.4709 0.0952  0.0062  0.0943  1015 LYS A N   
118  C CA  . LYS A 15  ? 1.2590 1.7729 1.4986 0.1233  0.0099  0.1245  1015 LYS A CA  
119  C C   . LYS A 15  ? 1.3041 1.8020 1.5215 0.1478  0.0156  0.1355  1015 LYS A C   
120  O O   . LYS A 15  ? 1.3076 1.8683 1.5426 0.1649  0.0041  0.1577  1015 LYS A O   
121  C CB  . LYS A 15  ? 1.3098 1.8279 1.5716 0.1479  0.0443  0.1467  1015 LYS A CB  
122  C CG  . LYS A 15  ? 1.5081 2.0360 1.7897 0.1270  0.0463  0.1390  1015 LYS A CG  
123  C CD  . LYS A 15  ? 1.6187 2.2309 1.9441 0.1035  0.0153  0.1414  1015 LYS A CD  
124  C CE  . LYS A 15  ? 1.7313 2.3442 2.0748 0.0819  0.0218  0.1345  1015 LYS A CE  
125  N NZ  . LYS A 15  ? 1.8465 2.4644 2.2103 0.1095  0.0592  0.1583  1015 LYS A NZ  
126  N N   . VAL A 16  ? 1.2518 1.6694 1.4304 0.1478  0.0334  0.1212  1016 VAL A N   
127  C CA  . VAL A 16  ? 1.2623 1.6494 1.4167 0.1679  0.0454  0.1297  1016 VAL A CA  
128  C C   . VAL A 16  ? 1.2903 1.7021 1.4340 0.1533  0.0120  0.1192  1016 VAL A C   
129  O O   . VAL A 16  ? 1.2980 1.7361 1.4384 0.1749  0.0101  0.1385  1016 VAL A O   
130  C CB  . VAL A 16  ? 1.3304 1.6263 1.4483 0.1624  0.0744  0.1134  1016 VAL A CB  
131  C CG1 . VAL A 16  ? 1.3541 1.6145 1.4491 0.1792  0.0898  0.1217  1016 VAL A CG1 
132  C CG2 . VAL A 16  ? 1.3580 1.6208 1.4754 0.1746  0.1116  0.1198  1016 VAL A CG2 
133  N N   . ILE A 17  ? 1.2217 1.6237 1.3579 0.1193  -0.0108 0.0912  1017 ILE A N   
134  C CA  . ILE A 17  ? 1.2099 1.6217 1.3305 0.1030  -0.0365 0.0765  1017 ILE A CA  
135  C C   . ILE A 17  ? 1.2717 1.7621 1.4076 0.1043  -0.0600 0.0879  1017 ILE A C   
136  O O   . ILE A 17  ? 1.2843 1.7897 1.4001 0.1102  -0.0707 0.0909  1017 ILE A O   
137  C CB  . ILE A 17  ? 1.2279 1.6111 1.3426 0.0704  -0.0483 0.0489  1017 ILE A CB  
138  C CG1 . ILE A 17  ? 1.2291 1.5509 1.3286 0.0668  -0.0300 0.0405  1017 ILE A CG1 
139  C CG2 . ILE A 17  ? 1.2416 1.6265 1.3376 0.0555  -0.0676 0.0334  1017 ILE A CG2 
140  C CD1 . ILE A 17  ? 1.3094 1.6106 1.4074 0.0415  -0.0383 0.0227  1017 ILE A CD1 
141  N N   . GLU A 18  ? 1.2209 1.7654 1.3912 0.0972  -0.0679 0.0949  1018 GLU A N   
142  C CA  . GLU A 18  ? 1.2245 1.8586 1.4153 0.0909  -0.0936 0.1056  1018 GLU A CA  
143  C C   . GLU A 18  ? 1.2898 1.9733 1.4843 0.1293  -0.0894 0.1419  1018 GLU A C   
144  O O   . GLU A 18  ? 1.2987 2.0424 1.4850 0.1249  -0.1143 0.1470  1018 GLU A O   
145  C CB  . GLU A 18  ? 1.2306 1.9157 1.4666 0.0774  -0.0969 0.1109  1018 GLU A CB  
146  C CG  . GLU A 18  ? 1.3566 2.0008 1.5919 0.0406  -0.0998 0.0806  1018 GLU A CG  
147  C CD  . GLU A 18  ? 1.6231 2.3122 1.9029 0.0268  -0.0984 0.0871  1018 GLU A CD  
148  O OE1 . GLU A 18  ? 1.5994 2.2407 1.8785 0.0110  -0.0872 0.0725  1018 GLU A OE1 
149  O OE2 . GLU A 18  ? 1.5277 2.3034 1.8452 0.0345  -0.1065 0.1111  1018 GLU A OE2 
150  N N   . LYS A 19  ? 1.2533 1.9087 1.4562 0.1668  -0.0555 0.1675  1019 LYS A N   
151  C CA  . LYS A 19  ? 1.2776 1.9693 1.4871 0.2118  -0.0406 0.2096  1019 LYS A CA  
152  C C   . LYS A 19  ? 1.3461 1.9626 1.5132 0.2310  -0.0191 0.2103  1019 LYS A C   
153  O O   . LYS A 19  ? 1.3694 1.9863 1.5373 0.2726  0.0069  0.2459  1019 LYS A O   
154  C CB  . LYS A 19  ? 1.3199 2.0219 1.5672 0.2443  -0.0072 0.2408  1019 LYS A CB  
155  C CG  . LYS A 19  ? 1.4598 2.2438 1.7570 0.2296  -0.0232 0.2471  1019 LYS A CG  
156  C CD  . LYS A 19  ? 1.5796 2.3652 1.9118 0.2662  0.0173  0.2793  1019 LYS A CD  
157  C CE  . LYS A 19  ? 1.6617 2.5321 2.0484 0.2515  0.0041  0.2877  1019 LYS A CE  
158  N NZ  . LYS A 19  ? 1.7699 2.6410 2.1906 0.2914  0.0489  0.3216  1019 LYS A NZ  
159  N N   . ALA A 20  ? 1.2912 1.8454 1.4244 0.2021  -0.0270 0.1744  1020 ALA A N   
160  C CA  . ALA A 20  ? 1.3049 1.7912 1.4026 0.2136  -0.0073 0.1726  1020 ALA A CA  
161  C C   . ALA A 20  ? 1.3647 1.8915 1.4407 0.2280  -0.0218 0.1887  1020 ALA A C   
162  O O   . ALA A 20  ? 1.3497 1.9372 1.4219 0.2090  -0.0564 0.1798  1020 ALA A O   
163  C CB  . ALA A 20  ? 1.2944 1.7156 1.3715 0.1795  -0.0111 0.1339  1020 ALA A CB  
164  N N   . ASP A 21  ? 1.3497 1.8386 1.4073 0.2594  0.0071  0.2115  1021 ASP A N   
165  C CA  . ASP A 21  ? 1.3755 1.8940 1.4069 0.2799  0.0012  0.2330  1021 ASP A CA  
166  C C   . ASP A 21  ? 1.4124 1.8692 1.4059 0.2612  0.0028  0.2066  1021 ASP A C   
167  O O   . ASP A 21  ? 1.4116 1.8984 1.3791 0.2481  -0.0226 0.1955  1021 ASP A O   
168  C CB  . ASP A 21  ? 1.4456 1.9590 1.4824 0.3318  0.0390  0.2819  1021 ASP A CB  
169  C CG  . ASP A 21  ? 1.6386 2.2147 1.7177 0.3604  0.0458  0.3173  1021 ASP A CG  
170  O OD1 . ASP A 21  ? 1.6286 2.2935 1.7318 0.3450  0.0092  0.3157  1021 ASP A OD1 
171  O OD2 . ASP A 21  ? 1.7728 2.3120 1.8610 0.3997  0.0904  0.3497  1021 ASP A OD2 
172  N N   . ASN A 22  ? 1.3601 1.7324 1.3499 0.2577  0.0341  0.1956  1022 ASN A N   
173  C CA  . ASN A 22  ? 1.3556 1.6714 1.3194 0.2420  0.0417  0.1759  1022 ASN A CA  
174  C C   . ASN A 22  ? 1.3568 1.6389 1.3292 0.2025  0.0314  0.1369  1022 ASN A C   
175  O O   . ASN A 22  ? 1.3315 1.6186 1.3262 0.1896  0.0258  0.1266  1022 ASN A O   
176  C CB  . ASN A 22  ? 1.3902 1.6427 1.3451 0.2642  0.0858  0.1958  1022 ASN A CB  
177  C CG  . ASN A 22  ? 1.6371 1.8414 1.6097 0.2652  0.1160  0.1962  1022 ASN A CG  
178  O OD1 . ASN A 22  ? 1.5046 1.6647 1.4805 0.2346  0.1201  0.1675  1022 ASN A OD1 
179  N ND2 . ASN A 22  ? 1.5955 1.8064 1.5766 0.3019  0.1410  0.2306  1022 ASN A ND2 
180  N N   . ALA A 23  ? 1.2965 1.5478 1.2517 0.1867  0.0311  0.1196  1023 ALA A N   
181  C CA  . ALA A 23  ? 1.2591 1.4854 1.2225 0.1552  0.0229  0.0902  1023 ALA A CA  
182  C C   . ALA A 23  ? 1.2974 1.4801 1.2765 0.1436  0.0432  0.0846  1023 ALA A C   
183  O O   . ALA A 23  ? 1.2677 1.4456 1.2592 0.1195  0.0326  0.0654  1023 ALA A O   
184  C CB  . ALA A 23  ? 1.2767 1.4856 1.2208 0.1501  0.0250  0.0826  1023 ALA A CB  
185  N N   . ALA A 24  ? 1.2807 1.4293 1.2550 0.1594  0.0742  0.1014  1024 ALA A N   
186  C CA  . ALA A 24  ? 1.2877 1.3877 1.2669 0.1439  0.0977  0.0927  1024 ALA A CA  
187  C C   . ALA A 24  ? 1.3229 1.4314 1.3141 0.1416  0.0946  0.0884  1024 ALA A C   
188  O O   . ALA A 24  ? 1.3116 1.3948 1.3041 0.1166  0.0983  0.0701  1024 ALA A O   
189  C CB  . ALA A 24  ? 1.3489 1.4006 1.3148 0.1613  0.1378  0.1110  1024 ALA A CB  
190  N N   . GLN A 25  ? 1.2746 1.4255 1.2746 0.1666  0.0871  0.1067  1025 GLN A N   
191  C CA  . GLN A 25  ? 1.2610 1.4295 1.2779 0.1677  0.0852  0.1069  1025 GLN A CA  
192  C C   . GLN A 25  ? 1.2570 1.4493 1.2849 0.1373  0.0543  0.0822  1025 GLN A C   
193  O O   . GLN A 25  ? 1.2476 1.4248 1.2804 0.1233  0.0592  0.0713  1025 GLN A O   
194  C CB  . GLN A 25  ? 1.2873 1.5127 1.3194 0.2012  0.0818  0.1370  1025 GLN A CB  
195  C CG  . GLN A 25  ? 1.5490 1.7538 1.5742 0.2405  0.1183  0.1708  1025 GLN A CG  
196  C CD  . GLN A 25  ? 1.8103 2.0878 1.8571 0.2761  0.1128  0.2069  1025 GLN A CD  
197  O OE1 . GLN A 25  ? 1.7853 2.0876 1.8256 0.3070  0.1185  0.2377  1025 GLN A OE1 
198  N NE2 . GLN A 25  ? 1.6866 2.0084 1.7613 0.2723  0.1001  0.2066  1025 GLN A NE2 
199  N N   . VAL A 26  ? 1.1857 1.4095 1.2129 0.1278  0.0264  0.0741  1026 VAL A N   
200  C CA  . VAL A 26  ? 1.1500 1.3896 1.1855 0.1020  0.0016  0.0535  1026 VAL A CA  
201  C C   . VAL A 26  ? 1.1973 1.3975 1.2289 0.0799  0.0076  0.0377  1026 VAL A C   
202  O O   . VAL A 26  ? 1.1769 1.3768 1.2168 0.0638  0.0020  0.0279  1026 VAL A O   
203  C CB  . VAL A 26  ? 1.1906 1.4589 1.2177 0.0983  -0.0208 0.0478  1026 VAL A CB  
204  C CG1 . VAL A 26  ? 1.1666 1.4386 1.2009 0.0734  -0.0382 0.0278  1026 VAL A CG1 
205  C CG2 . VAL A 26  ? 1.2015 1.5217 1.2296 0.1150  -0.0314 0.0637  1026 VAL A CG2 
206  N N   . LYS A 27  ? 1.1703 1.3435 1.1904 0.0791  0.0193  0.0379  1027 LYS A N   
207  C CA  . LYS A 27  ? 1.1672 1.3173 1.1876 0.0565  0.0233  0.0267  1027 LYS A CA  
208  C C   . LYS A 27  ? 1.2276 1.3535 1.2438 0.0425  0.0368  0.0201  1027 LYS A C   
209  O O   . LYS A 27  ? 1.2123 1.3431 1.2318 0.0207  0.0268  0.0094  1027 LYS A O   
210  C CB  . LYS A 27  ? 1.2218 1.3516 1.2344 0.0592  0.0385  0.0321  1027 LYS A CB  
211  C CG  . LYS A 27  ? 1.4358 1.5577 1.4559 0.0330  0.0398  0.0233  1027 LYS A CG  
212  C CD  . LYS A 27  ? 1.6191 1.7189 1.6355 0.0319  0.0608  0.0295  1027 LYS A CD  
213  C CE  . LYS A 27  ? 1.8523 1.9079 1.8527 0.0332  0.0905  0.0323  1027 LYS A CE  
214  N NZ  . LYS A 27  ? 2.0186 2.0487 2.0166 0.0283  0.1140  0.0383  1027 LYS A NZ  
215  N N   . ASP A 28  ? 1.2138 1.3120 1.2192 0.0567  0.0622  0.0281  1028 ASP A N   
216  C CA  . ASP A 28  ? 1.2410 1.3022 1.2323 0.0455  0.0842  0.0200  1028 ASP A CA  
217  C C   . ASP A 28  ? 1.2607 1.3437 1.2587 0.0397  0.0710  0.0143  1028 ASP A C   
218  O O   . ASP A 28  ? 1.2656 1.3344 1.2510 0.0149  0.0717  -0.0004 1028 ASP A O   
219  C CB  . ASP A 28  ? 1.3123 1.3371 1.2926 0.0721  0.1201  0.0355  1028 ASP A CB  
220  C CG  . ASP A 28  ? 1.5076 1.4783 1.4655 0.0625  0.1528  0.0257  1028 ASP A CG  
221  O OD1 . ASP A 28  ? 1.5372 1.4786 1.4759 0.0267  0.1564  0.0035  1028 ASP A OD1 
222  O OD2 . ASP A 28  ? 1.6148 1.5713 1.5722 0.0912  0.1782  0.0415  1028 ASP A OD2 
223  N N   . ALA A 29  ? 1.1815 1.3031 1.1985 0.0601  0.0587  0.0264  1029 ALA A N   
224  C CA  . ALA A 29  ? 1.1562 1.3021 1.1850 0.0560  0.0485  0.0242  1029 ALA A CA  
225  C C   . ALA A 29  ? 1.1685 1.3287 1.2005 0.0306  0.0245  0.0109  1029 ALA A C   
226  O O   . ALA A 29  ? 1.1728 1.3275 1.1983 0.0169  0.0261  0.0042  1029 ALA A O   
227  C CB  . ALA A 29  ? 1.1475 1.3412 1.2006 0.0772  0.0374  0.0400  1029 ALA A CB  
228  N N   . LEU A 30  ? 1.0897 1.2655 1.1289 0.0267  0.0064  0.0095  1030 LEU A N   
229  C CA  . LEU A 30  ? 1.0619 1.2504 1.1074 0.0099  -0.0114 0.0033  1030 LEU A CA  
230  C C   . LEU A 30  ? 1.1185 1.2935 1.1517 -0.0107 -0.0084 -0.0028 1030 LEU A C   
231  O O   . LEU A 30  ? 1.1072 1.2972 1.1442 -0.0229 -0.0198 -0.0030 1030 LEU A O   
232  C CB  . LEU A 30  ? 1.0498 1.2497 1.1025 0.0152  -0.0228 0.0047  1030 LEU A CB  
233  C CG  . LEU A 30  ? 1.1006 1.3208 1.1603 0.0248  -0.0329 0.0056  1030 LEU A CG  
234  C CD1 . LEU A 30  ? 1.1065 1.3252 1.1586 0.0313  -0.0359 0.0048  1030 LEU A CD1 
235  C CD2 . LEU A 30  ? 1.1166 1.3487 1.1881 0.0137  -0.0430 0.0013  1030 LEU A CD2 
236  N N   . THR A 31  ? 1.0990 1.2488 1.1176 -0.0161 0.0071  -0.0064 1031 THR A N   
237  C CA  . THR A 31  ? 1.1180 1.2606 1.1229 -0.0437 0.0089  -0.0152 1031 THR A CA  
238  C C   . THR A 31  ? 1.1998 1.3291 1.1820 -0.0576 0.0157  -0.0243 1031 THR A C   
239  O O   . THR A 31  ? 1.1993 1.3459 1.1727 -0.0803 0.0042  -0.0286 1031 THR A O   
240  C CB  . THR A 31  ? 1.2258 1.3389 1.2203 -0.0500 0.0278  -0.0189 1031 THR A CB  
241  O OG1 . THR A 31  ? 1.2028 1.3296 1.2160 -0.0342 0.0229  -0.0085 1031 THR A OG1 
242  C CG2 . THR A 31  ? 1.2168 1.3296 1.1988 -0.0866 0.0276  -0.0304 1031 THR A CG2 
243  N N   . LYS A 32  ? 1.1798 1.2836 1.1530 -0.0414 0.0352  -0.0240 1032 LYS A N   
244  C CA  . LYS A 32  ? 1.2076 1.2931 1.1576 -0.0484 0.0486  -0.0312 1032 LYS A CA  
245  C C   . LYS A 32  ? 1.2407 1.3634 1.2053 -0.0478 0.0283  -0.0248 1032 LYS A C   
246  O O   . LYS A 32  ? 1.2639 1.3855 1.2065 -0.0648 0.0282  -0.0309 1032 LYS A O   
247  C CB  . LYS A 32  ? 1.2581 1.3115 1.2037 -0.0232 0.0792  -0.0256 1032 LYS A CB  
248  C CG  . LYS A 32  ? 1.3978 1.4015 1.3246 -0.0209 0.1085  -0.0292 1032 LYS A CG  
249  C CD  . LYS A 32  ? 1.5205 1.5001 1.4504 0.0139  0.1406  -0.0142 1032 LYS A CD  
250  C CE  . LYS A 32  ? 1.6530 1.5774 1.5652 0.0214  0.1748  -0.0126 1032 LYS A CE  
251  N NZ  . LYS A 32  ? 1.7527 1.6600 1.6728 0.0633  0.2085  0.0104  1032 LYS A NZ  
252  N N   . MET A 33  ? 1.1608 1.3138 1.1585 -0.0306 0.0125  -0.0131 1033 MET A N   
253  C CA  . MET A 33  ? 1.1360 1.3174 1.1509 -0.0301 -0.0027 -0.0062 1033 MET A CA  
254  C C   . MET A 33  ? 1.1876 1.3868 1.2008 -0.0459 -0.0196 -0.0039 1033 MET A C   
255  O O   . MET A 33  ? 1.1862 1.3964 1.1957 -0.0515 -0.0234 0.0010  1033 MET A O   
256  C CB  . MET A 33  ? 1.1338 1.3360 1.1786 -0.0142 -0.0124 0.0009  1033 MET A CB  
257  C CG  . MET A 33  ? 1.1824 1.3892 1.2374 0.0027  -0.0006 0.0060  1033 MET A CG  
258  S SD  . MET A 33  ? 1.2091 1.4536 1.2948 0.0113  -0.0176 0.0115  1033 MET A SD  
259  C CE  . MET A 33  ? 1.1558 1.4108 1.2540 -0.0050 -0.0264 0.0102  1033 MET A CE  
260  N N   . ARG A 34  ? 1.1447 1.3510 1.1631 -0.0504 -0.0277 -0.0033 1034 ARG A N   
261  C CA  . ARG A 34  ? 1.1418 1.3764 1.1662 -0.0610 -0.0426 0.0056  1034 ARG A CA  
262  C C   . ARG A 34  ? 1.2429 1.4844 1.2379 -0.0850 -0.0439 0.0008  1034 ARG A C   
263  O O   . ARG A 34  ? 1.2413 1.5124 1.2364 -0.0903 -0.0556 0.0130  1034 ARG A O   
264  C CB  . ARG A 34  ? 1.1199 1.3653 1.1601 -0.0597 -0.0473 0.0094  1034 ARG A CB  
265  C CG  . ARG A 34  ? 1.1946 1.4763 1.2552 -0.0580 -0.0599 0.0274  1034 ARG A CG  
266  C CD  . ARG A 34  ? 1.2799 1.5774 1.3593 -0.0564 -0.0609 0.0338  1034 ARG A CD  
267  N NE  . ARG A 34  ? 1.3856 1.7156 1.4911 -0.0444 -0.0668 0.0565  1034 ARG A NE  
268  C CZ  . ARG A 34  ? 1.5893 1.9674 1.7052 -0.0537 -0.0776 0.0744  1034 ARG A CZ  
269  N NH1 . ARG A 34  ? 1.4443 1.8438 1.5408 -0.0822 -0.0870 0.0669  1034 ARG A NH1 
270  N NH2 . ARG A 34  ? 1.4336 1.8393 1.5773 -0.0345 -0.0775 0.1008  1034 ARG A NH2 
271  N N   . ALA A 35  ? 1.2445 1.4554 1.2101 -0.0993 -0.0291 -0.0165 1035 ALA A N   
272  C CA  . ALA A 35  ? 1.2935 1.4996 1.2182 -0.1279 -0.0260 -0.0287 1035 ALA A CA  
273  C C   . ALA A 35  ? 1.3777 1.5794 1.2847 -0.1230 -0.0208 -0.0262 1035 ALA A C   
274  O O   . ALA A 35  ? 1.3930 1.6202 1.2792 -0.1392 -0.0318 -0.0222 1035 ALA A O   
275  C CB  . ALA A 35  ? 1.3460 1.5027 1.2405 -0.1423 -0.0022 -0.0503 1035 ALA A CB  
276  N N   . ALA A 36  ? 1.3405 1.5167 1.2581 -0.0999 -0.0042 -0.0252 1036 ALA A N   
277  C CA  . ALA A 36  ? 1.3550 1.5265 1.2640 -0.0920 0.0059  -0.0208 1036 ALA A CA  
278  C C   . ALA A 36  ? 1.3943 1.6029 1.3266 -0.0857 -0.0120 -0.0012 1036 ALA A C   
279  O O   . ALA A 36  ? 1.4121 1.6246 1.3258 -0.0894 -0.0078 0.0041  1036 ALA A O   
280  C CB  . ALA A 36  ? 1.3549 1.5060 1.2838 -0.0679 0.0255  -0.0193 1036 ALA A CB  
281  N N   . ALA A 37  ? 1.3266 1.5562 1.2957 -0.0751 -0.0271 0.0100  1037 ALA A N   
282  C CA  . ALA A 37  ? 1.3150 1.5677 1.3064 -0.0667 -0.0371 0.0295  1037 ALA A CA  
283  C C   . ALA A 37  ? 1.4029 1.6877 1.3787 -0.0780 -0.0504 0.0433  1037 ALA A C   
284  O O   . ALA A 37  ? 1.4088 1.7069 1.3839 -0.0731 -0.0508 0.0611  1037 ALA A O   
285  C CB  . ALA A 37  ? 1.2931 1.5477 1.3203 -0.0529 -0.0429 0.0340  1037 ALA A CB  
286  N N   . LEU A 38  ? 1.3809 1.6827 1.3459 -0.0936 -0.0609 0.0376  1038 LEU A N   
287  C CA  . LEU A 38  ? 1.4012 1.7506 1.3543 -0.1078 -0.0779 0.0526  1038 LEU A CA  
288  C C   . LEU A 38  ? 1.5211 1.8711 1.4218 -0.1306 -0.0761 0.0432  1038 LEU A C   
289  O O   . LEU A 38  ? 1.5383 1.9314 1.4248 -0.1370 -0.0893 0.0621  1038 LEU A O   
290  C CB  . LEU A 38  ? 1.3935 1.7687 1.3575 -0.1220 -0.0899 0.0490  1038 LEU A CB  
291  C CG  . LEU A 38  ? 1.4076 1.7922 1.4192 -0.0999 -0.0919 0.0632  1038 LEU A CG  
292  C CD1 . LEU A 38  ? 1.4051 1.8073 1.4248 -0.1163 -0.0978 0.0556  1038 LEU A CD1 
293  C CD2 . LEU A 38  ? 1.4303 1.8536 1.4691 -0.0796 -0.0987 0.0980  1038 LEU A CD2 
294  N N   . ASP A 39  ? 1.5201 1.8219 1.3894 -0.1406 -0.0573 0.0161  1039 ASP A N   
295  C CA  . ASP A 39  ? 1.5853 1.8707 1.3960 -0.1618 -0.0469 0.0014  1039 ASP A CA  
296  C C   . ASP A 39  ? 1.6638 1.9465 1.4725 -0.1433 -0.0372 0.0181  1039 ASP A C   
297  O O   . ASP A 39  ? 1.7028 2.0039 1.4715 -0.1556 -0.0405 0.0244  1039 ASP A O   
298  C CB  . ASP A 39  ? 1.6393 1.8632 1.4216 -0.1718 -0.0207 -0.0302 1039 ASP A CB  
299  C CG  . ASP A 39  ? 1.8519 2.0416 1.5635 -0.1974 -0.0018 -0.0531 1039 ASP A CG  
300  O OD1 . ASP A 39  ? 1.8964 2.1090 1.5768 -0.2050 -0.0078 -0.0447 1039 ASP A OD1 
301  O OD2 . ASP A 39  ? 1.9551 2.0895 1.6396 -0.2077 0.0234  -0.0787 1039 ASP A OD2 
302  N N   . ALA A 40  ? 1.5966 1.8613 1.4483 -0.1162 -0.0262 0.0264  1040 ALA A N   
303  C CA  . ALA A 40  ? 1.6017 1.8631 1.4624 -0.1002 -0.0144 0.0428  1040 ALA A CA  
304  C C   . ALA A 40  ? 1.6657 1.9659 1.5409 -0.0923 -0.0292 0.0739  1040 ALA A C   
305  O O   . ALA A 40  ? 1.6848 1.9874 1.5471 -0.0870 -0.0201 0.0899  1040 ALA A O   
306  C CB  . ALA A 40  ? 1.5732 1.8138 1.4794 -0.0807 -0.0021 0.0413  1040 ALA A CB  
307  N N   . GLN A 41  ? 1.6122 1.9416 1.5144 -0.0890 -0.0481 0.0854  1041 GLN A N   
308  C CA  . GLN A 41  ? 1.6179 1.9854 1.5385 -0.0758 -0.0586 0.1203  1041 GLN A CA  
309  C C   . GLN A 41  ? 1.7490 2.1591 1.6247 -0.0896 -0.0701 0.1354  1041 GLN A C   
310  O O   . GLN A 41  ? 1.7646 2.1970 1.6418 -0.0748 -0.0688 0.1683  1041 GLN A O   
311  C CB  . GLN A 41  ? 1.6020 1.9916 1.5596 -0.0687 -0.0722 0.1277  1041 GLN A CB  
312  C CG  . GLN A 41  ? 1.7404 2.1632 1.7262 -0.0464 -0.0754 0.1681  1041 GLN A CG  
313  C CD  . GLN A 41  ? 1.9264 2.3718 1.9483 -0.0372 -0.0841 0.1768  1041 GLN A CD  
314  O OE1 . GLN A 41  ? 1.8393 2.2906 1.8612 -0.0528 -0.0937 0.1553  1041 GLN A OE1 
315  N NE2 . GLN A 41  ? 1.8345 2.2927 1.8872 -0.0104 -0.0771 0.2117  1041 GLN A NE2 
316  N N   . LYS A 42  ? 1.7564 2.1757 1.5889 -0.1194 -0.0795 0.1110  1042 LYS A N   
317  C CA  . LYS A 42  ? 1.8190 2.2815 1.5970 -0.1430 -0.0937 0.1164  1042 LYS A CA  
318  C C   . LYS A 42  ? 1.9502 2.3823 1.6785 -0.1450 -0.0738 0.1118  1042 LYS A C   
319  O O   . LYS A 42  ? 1.9876 2.4584 1.6750 -0.1528 -0.0826 0.1299  1042 LYS A O   
320  C CB  . LYS A 42  ? 1.8717 2.3428 1.6169 -0.1817 -0.1063 0.0841  1042 LYS A CB  
321  C CG  . LYS A 42  ? 1.9706 2.4815 1.7631 -0.1833 -0.1259 0.0911  1042 LYS A CG  
322  C CD  . LYS A 42  ? 2.1153 2.6276 1.8760 -0.2265 -0.1339 0.0567  1042 LYS A CD  
323  N N   . ALA A 43  ? 1.9311 2.2999 1.6640 -0.1368 -0.0464 0.0905  1043 ALA A N   
324  C CA  . ALA A 43  ? 1.9858 2.3209 1.6793 -0.1355 -0.0207 0.0857  1043 ALA A CA  
325  C C   . ALA A 43  ? 2.0738 2.4221 1.7886 -0.1103 -0.0130 0.1236  1043 ALA A C   
326  O O   . ALA A 43  ? 2.0283 2.3893 1.7986 -0.0897 -0.0187 0.1470  1043 ALA A O   
327  C CB  . ALA A 43  ? 1.9796 2.2557 1.6877 -0.1289 0.0064  0.0593  1043 ALA A CB  
328  N N   . THR A 44  ? 2.1137 2.4526 1.7806 -0.1125 0.0045  0.1290  1044 THR A N   
329  C CA  . THR A 44  ? 2.1340 2.4784 1.8136 -0.0905 0.0185  0.1653  1044 THR A CA  
330  C C   . THR A 44  ? 2.2194 2.5136 1.9087 -0.0824 0.0542  0.1539  1044 THR A C   
331  O O   . THR A 44  ? 2.2533 2.5208 1.8951 -0.0948 0.0714  0.1293  1044 THR A O   
332  C CB  . THR A 44  ? 2.2962 2.6832 1.9129 -0.0977 0.0086  0.1892  1044 THR A CB  
333  O OG1 . THR A 44  ? 2.2902 2.7368 1.9062 -0.1067 -0.0267 0.2009  1044 THR A OG1 
334  C CG2 . THR A 44  ? 2.2891 2.6804 1.9183 -0.0719 0.0260  0.2328  1044 THR A CG2 
335  N N   . PRO A 45  ? 2.1666 2.4482 1.9175 -0.0631 0.0681  0.1715  1045 PRO A N   
336  C CA  . PRO A 45  ? 2.1743 2.4227 1.9455 -0.0577 0.0999  0.1633  1045 PRO A CA  
337  C C   . PRO A 45  ? 2.3155 2.5562 2.0376 -0.0564 0.1265  0.1769  1045 PRO A C   
338  O O   . PRO A 45  ? 2.3500 2.6126 2.0329 -0.0552 0.1198  0.2016  1045 PRO A O   
339  C CB  . PRO A 45  ? 2.1522 2.3977 1.9962 -0.0453 0.1036  0.1806  1045 PRO A CB  
340  C CG  . PRO A 45  ? 2.2077 2.4751 2.0532 -0.0374 0.0861  0.2086  1045 PRO A CG  
341  C CD  . PRO A 45  ? 2.1537 2.4487 1.9592 -0.0478 0.0579  0.1974  1045 PRO A CD  
342  N N   . PRO A 46  ? 2.3058 2.5195 2.0302 -0.0541 0.1585  0.1649  1046 PRO A N   
343  C CA  . PRO A 46  ? 2.3743 2.5775 2.0509 -0.0512 0.1889  0.1784  1046 PRO A CA  
344  C C   . PRO A 46  ? 2.4507 2.6662 2.1507 -0.0393 0.1976  0.2190  1046 PRO A C   
345  O O   . PRO A 46  ? 2.5015 2.7236 2.1455 -0.0373 0.2061  0.2398  1046 PRO A O   
346  C CB  . PRO A 46  ? 2.3925 2.5704 2.0944 -0.0453 0.2231  0.1631  1046 PRO A CB  
347  C CG  . PRO A 46  ? 2.3734 2.5592 2.1538 -0.0424 0.2088  0.1533  1046 PRO A CG  
348  C CD  . PRO A 46  ? 2.2895 2.4868 2.0608 -0.0511 0.1700  0.1429  1046 PRO A CD  
349  N N   . LYS A 47  ? 2.3736 2.5895 2.1520 -0.0330 0.1971  0.2298  1047 LYS A N   
350  C CA  . LYS A 47  ? 2.3875 2.6036 2.1956 -0.0234 0.2081  0.2664  1047 LYS A CA  
351  C C   . LYS A 47  ? 2.4543 2.6909 2.2455 -0.0172 0.1795  0.2855  1047 LYS A C   
352  O O   . LYS A 47  ? 2.4140 2.6637 2.2093 -0.0227 0.1501  0.2660  1047 LYS A O   
353  C CB  . LYS A 47  ? 2.3749 2.5788 2.2674 -0.0264 0.2195  0.2630  1047 LYS A CB  
354  C CG  . LYS A 47  ? 2.5628 2.7522 2.4885 -0.0214 0.2375  0.2961  1047 LYS A CG  
355  C CD  . LYS A 47  ? 2.6366 2.8141 2.6392 -0.0343 0.2445  0.2840  1047 LYS A CD  
356  C CE  . LYS A 47  ? 2.7888 2.9385 2.8194 -0.0337 0.2672  0.3128  1047 LYS A CE  
357  N NZ  . LYS A 47  ? 2.8680 3.0044 2.9668 -0.0549 0.2734  0.2954  1047 LYS A NZ  
358  N N   . LEU A 48  ? 2.4705 2.7136 2.2432 -0.0037 0.1901  0.3269  1048 LEU A N   
359  C CA  . LEU A 48  ? 2.4912 2.7645 2.2462 0.0092  0.1681  0.3581  1048 LEU A CA  
360  C C   . LEU A 48  ? 2.5615 2.8753 2.2575 -0.0040 0.1328  0.3384  1048 LEU A C   
361  O O   . LEU A 48  ? 2.5252 2.8679 2.2337 -0.0037 0.1029  0.3385  1048 LEU A O   
362  C CB  . LEU A 48  ? 2.4528 2.7156 2.2731 0.0202  0.1619  0.3693  1048 LEU A CB  
363  C CG  . LEU A 48  ? 2.4463 2.6992 2.3135 0.0090  0.1431  0.3315  1048 LEU A CG  
364  C CD1 . LEU A 48  ? 2.4322 2.6958 2.3252 0.0237  0.1274  0.3500  1048 LEU A CD1 
365  C CD2 . LEU A 48  ? 2.4499 2.6637 2.3705 -0.0014 0.1656  0.3110  1048 LEU A CD2 
366  N N   . GLU A 49  ? 2.5741 2.8867 2.2043 -0.0178 0.1404  0.3208  1049 GLU A N   
367  C CA  . GLU A 49  ? 2.6035 2.9436 2.1644 -0.0390 0.1145  0.2963  1049 GLU A CA  
368  C C   . GLU A 49  ? 2.7085 3.1068 2.2196 -0.0345 0.0932  0.3347  1049 GLU A C   
369  O O   . GLU A 49  ? 2.6979 3.1435 2.2031 -0.0437 0.0572  0.3341  1049 GLU A O   
370  C CB  . GLU A 49  ? 2.6661 2.9714 2.1698 -0.0544 0.1398  0.2638  1049 GLU A CB  
371  C CG  . GLU A 49  ? 2.8482 3.1654 2.2711 -0.0833 0.1204  0.2302  1049 GLU A CG  
372  C CD  . GLU A 49  ? 3.1511 3.4213 2.5087 -0.0970 0.1531  0.1972  1049 GLU A CD  
373  O OE1 . GLU A 49  ? 3.1504 3.4219 2.4277 -0.1248 0.1426  0.1688  1049 GLU A OE1 
374  O OE2 . GLU A 49  ? 3.0346 3.2670 2.4202 -0.0812 0.1914  0.2001  1049 GLU A OE2 
375  N N   . ASP A 50  ? 2.7236 3.1245 2.2025 -0.0195 0.1158  0.3721  1050 ASP A N   
376  C CA  . ASP A 50  ? 2.7798 3.2427 2.2112 -0.0098 0.0982  0.4180  1050 ASP A CA  
377  C C   . ASP A 50  ? 2.7935 3.2712 2.2967 0.0239  0.0988  0.4686  1050 ASP A C   
378  O O   . ASP A 50  ? 2.8152 3.2801 2.3271 0.0501  0.1275  0.5139  1050 ASP A O   
379  C CB  . ASP A 50  ? 2.8909 3.3473 2.2470 -0.0074 0.1253  0.4362  1050 ASP A CB  
380  C CG  . ASP A 50  ? 3.1100 3.3943 2.3678 -0.0143 0.0994  0.3949  1050 ASP A CG  
381  O OD1 . ASP A 50  ? 3.0982 3.3998 2.3711 -0.0064 0.0645  0.4039  1050 ASP A OD1 
382  O OD2 . ASP A 50  ? 3.2670 3.3649 2.4296 -0.0274 0.1144  0.3451  1050 ASP A OD2 
383  N N   . LYS A 51  ? 2.6934 3.1900 2.2477 0.0235  0.0723  0.4594  1051 LYS A N   
384  C CA  . LYS A 51  ? 2.6607 3.1631 2.2843 0.0543  0.0746  0.4993  1051 LYS A CA  
385  C C   . LYS A 51  ? 2.6903 3.2687 2.3184 0.0536  0.0323  0.5111  1051 LYS A C   
386  O O   . LYS A 51  ? 2.6642 3.2615 2.2764 0.0231  0.0039  0.4674  1051 LYS A O   
387  C CB  . LYS A 51  ? 2.6296 3.0607 2.3266 0.0541  0.0953  0.4692  1051 LYS A CB  
388  C CG  . LYS A 51  ? 2.7843 3.1959 2.5488 0.0835  0.1097  0.5033  1051 LYS A CG  
389  C CD  . LYS A 51  ? 2.9774 3.2717 2.7256 0.0864  0.1369  0.4979  1051 LYS A CD  
390  C CE  . LYS A 51  ? 3.1159 3.2971 2.8602 0.0513  0.1577  0.4350  1051 LYS A CE  
391  N NZ  . LYS A 51  ? 3.2818 3.3336 2.9948 0.0195  0.1591  0.3907  1051 LYS A NZ  
392  N N   . SER A 52  ? 2.6742 3.2965 2.3268 0.0883  0.0314  0.5727  1052 SER A N   
393  C CA  . SER A 52  ? 2.6632 3.3063 2.3190 0.0884  -0.0084 0.5671  1052 SER A CA  
394  C C   . SER A 52  ? 2.6396 3.3213 2.3728 0.0888  -0.0137 0.5623  1052 SER A C   
395  O O   . SER A 52  ? 2.5999 3.2012 2.3791 0.0985  0.0163  0.5467  1052 SER A O   
396  C CB  . SER A 52  ? 2.7455 3.2448 2.3801 0.1085  -0.0103 0.5537  1052 SER A CB  
397  O OG  . SER A 52  ? 2.8472 3.2398 2.5259 0.1212  0.0211  0.5429  1052 SER A OG  
398  N N   . PRO A 53  ? 2.5763 3.3259 2.3129 0.0705  -0.0531 0.5495  1053 PRO A N   
399  C CA  . PRO A 53  ? 2.5113 3.2341 2.3067 0.0670  -0.0576 0.5189  1053 PRO A CA  
400  C C   . PRO A 53  ? 2.5463 3.2593 2.4101 0.1125  -0.0365 0.5653  1053 PRO A C   
401  O O   . PRO A 53  ? 2.4953 3.1531 2.4057 0.1154  -0.0241 0.5398  1053 PRO A O   
402  C CB  . PRO A 53  ? 2.5267 3.3341 2.3031 0.0350  -0.1030 0.5017  1053 PRO A CB  
403  C CG  . PRO A 53  ? 2.6414 3.3855 2.3213 0.0152  -0.1204 0.4622  1053 PRO A CG  
404  C CD  . PRO A 53  ? 2.6301 3.3391 2.2929 0.0471  -0.0955 0.5022  1053 PRO A CD  
405  N N   . ASP A 54  ? 2.5554 3.2566 2.4062 0.1419  -0.0324 0.6029  1054 ASP A N   
406  C CA  . ASP A 54  ? 2.5579 3.1825 2.4477 0.1770  -0.0123 0.6160  1054 ASP A CA  
407  C C   . ASP A 54  ? 2.6114 3.1425 2.5192 0.1938  0.0386  0.6235  1054 ASP A C   
408  O O   . ASP A 54  ? 2.6143 3.0746 2.5499 0.2161  0.0611  0.6295  1054 ASP A O   
409  C CB  . ASP A 54  ? 2.6306 3.1805 2.4676 0.1801  -0.0404 0.5953  1054 ASP A CB  
410  C CG  . ASP A 54  ? 2.7740 3.2783 2.5700 0.1524  -0.0963 0.5244  1054 ASP A CG  
411  O OD1 . ASP A 54  ? 2.7584 3.3196 2.5502 0.1267  -0.1141 0.5031  1054 ASP A OD1 
412  O OD2 . ASP A 54  ? 2.8832 3.3008 2.6518 0.1577  -0.1206 0.4957  1054 ASP A OD2 
413  N N   . SER A 55  ? 2.5692 3.1469 2.4762 0.1908  0.0641  0.6502  1055 SER A N   
414  C CA  . SER A 55  ? 2.5821 3.0583 2.5039 0.1980  0.1119  0.6457  1055 SER A CA  
415  C C   . SER A 55  ? 2.5724 2.9713 2.5445 0.1901  0.1280  0.6038  1055 SER A C   
416  O O   . SER A 55  ? 2.5102 2.9234 2.4889 0.1652  0.0990  0.5578  1055 SER A O   
417  C CB  . SER A 55  ? 2.6429 3.0964 2.5182 0.1674  0.1141  0.6132  1055 SER A CB  
418  O OG  . SER A 55  ? 2.7888 3.1544 2.6802 0.1704  0.1591  0.6114  1055 SER A OG  
419  N N   . PRO A 56  ? 2.5520 2.8669 2.5556 0.2083  0.1753  0.6180  1056 PRO A N   
420  C CA  . PRO A 56  ? 2.5140 2.7582 2.5570 0.1971  0.1896  0.5766  1056 PRO A CA  
421  C C   . PRO A 56  ? 2.4933 2.7093 2.5318 0.1516  0.1746  0.5071  1056 PRO A C   
422  O O   . PRO A 56  ? 2.4398 2.6364 2.5005 0.1379  0.1645  0.4685  1056 PRO A O   
423  C CB  . PRO A 56  ? 2.5998 2.7562 2.6630 0.2181  0.2472  0.6051  1056 PRO A CB  
424  C CG  . PRO A 56  ? 2.7097 2.8847 2.7412 0.2428  0.2486  0.6525  1056 PRO A CG  
425  C CD  . PRO A 56  ? 2.6435 2.9226 2.6454 0.2397  0.2201  0.6738  1056 PRO A CD  
426  N N   . GLU A 57  ? 2.4488 2.6642 2.4598 0.1314  0.1756  0.4946  1057 GLU A N   
427  C CA  . GLU A 57  ? 2.3984 2.5947 2.4095 0.0939  0.1650  0.4364  1057 GLU A CA  
428  C C   . GLU A 57  ? 2.3890 2.6447 2.3767 0.0769  0.1203  0.4052  1057 GLU A C   
429  O O   . GLU A 57  ? 2.3442 2.5853 2.3419 0.0532  0.1094  0.3584  1057 GLU A O   
430  C CB  . GLU A 57  ? 2.4422 2.6165 2.4374 0.0806  0.1876  0.4356  1057 GLU A CB  
431  C CG  . GLU A 57  ? 2.6125 2.8233 2.5628 0.0966  0.1920  0.4787  1057 GLU A CG  
432  C CD  . GLU A 57  ? 2.8664 3.0576 2.8212 0.1304  0.2261  0.5396  1057 GLU A CD  
433  O OE1 . GLU A 57  ? 2.7657 2.9039 2.7597 0.1425  0.2524  0.5489  1057 GLU A OE1 
434  O OE2 . GLU A 57  ? 2.8197 3.0441 2.7350 0.1450  0.2303  0.5784  1057 GLU A OE2 
435  N N   . MET A 58  ? 2.3438 2.6667 2.3016 0.0880  0.0959  0.4321  1058 MET A N   
436  C CA  . MET A 58  ? 2.3008 2.6769 2.2353 0.0679  0.0563  0.4036  1058 MET A CA  
437  C C   . MET A 58  ? 2.2847 2.6713 2.2560 0.0735  0.0411  0.3954  1058 MET A C   
438  O O   . MET A 58  ? 2.2407 2.6366 2.2100 0.0517  0.0189  0.3557  1058 MET A O   
439  C CB  . MET A 58  ? 2.3690 2.8187 2.2536 0.0690  0.0346  0.4325  1058 MET A CB  
440  C CG  . MET A 58  ? 2.4518 2.8955 2.2826 0.0519  0.0414  0.4212  1058 MET A CG  
441  S SD  . MET A 58  ? 2.4771 2.8971 2.2814 0.0124  0.0303  0.3518  1058 MET A SD  
442  C CE  . MET A 58  ? 2.4285 2.9193 2.2048 -0.0075 -0.0144 0.3392  1058 MET A CE  
443  N N   . LYS A 59  ? 2.2366 2.6177 2.2405 0.1048  0.0576  0.4350  1059 LYS A N   
444  C CA  . LYS A 59  ? 2.1970 2.5821 2.2379 0.1161  0.0517  0.4332  1059 LYS A CA  
445  C C   . LYS A 59  ? 2.1935 2.5035 2.2592 0.1021  0.0670  0.3879  1059 LYS A C   
446  O O   . LYS A 59  ? 2.1502 2.4643 2.2319 0.0959  0.0527  0.3634  1059 LYS A O   
447  C CB  . LYS A 59  ? 2.2673 2.6648 2.3339 0.1591  0.0727  0.4940  1059 LYS A CB  
448  C CG  . LYS A 59  ? 2.4524 2.9493 2.5020 0.1749  0.0493  0.5439  1059 LYS A CG  
449  C CD  . LYS A 59  ? 2.6048 3.1194 2.6887 0.2244  0.0729  0.6100  1059 LYS A CD  
450  C CE  . LYS A 59  ? 2.7111 3.1735 2.7194 0.1962  0.0158  0.5460  1059 LYS A CE  
451  N NZ  . LYS A 59  ? 2.8378 3.1844 2.8237 0.2017  0.0074  0.5090  1059 LYS A NZ  
452  N N   . ASP A 60  ? 2.1522 2.3995 2.2198 0.0945  0.0950  0.3772  1060 ASP A N   
453  C CA  . ASP A 60  ? 2.1219 2.3075 2.2099 0.0749  0.1074  0.3343  1060 ASP A CA  
454  C C   . ASP A 60  ? 2.0951 2.3008 2.1718 0.0456  0.0794  0.2874  1060 ASP A C   
455  O O   . ASP A 60  ? 2.0576 2.2435 2.1504 0.0340  0.0735  0.2543  1060 ASP A O   
456  C CB  . ASP A 60  ? 2.1865 2.3129 2.2809 0.0696  0.1437  0.3392  1060 ASP A CB  
457  C CG  . ASP A 60  ? 2.3013 2.3730 2.4168 0.0432  0.1555  0.2963  1060 ASP A CG  
458  O OD1 . ASP A 60  ? 2.2921 2.3485 2.4200 0.0405  0.1491  0.2738  1060 ASP A OD1 
459  O OD2 . ASP A 60  ? 2.3848 2.4299 2.5049 0.0251  0.1735  0.2883  1060 ASP A OD2 
460  N N   . PHE A 61  ? 2.0336 2.2756 2.0790 0.0354  0.0655  0.2864  1061 PHE A N   
461  C CA  . PHE A 61  ? 1.9897 2.2453 2.0191 0.0119  0.0465  0.2472  1061 PHE A CA  
462  C C   . PHE A 61  ? 1.9872 2.2705 2.0174 0.0082  0.0200  0.2300  1061 PHE A C   
463  O O   . PHE A 61  ? 1.9530 2.2216 1.9931 -0.0044 0.0137  0.1961  1061 PHE A O   
464  C CB  . PHE A 61  ? 2.0360 2.3173 2.0221 0.0045  0.0438  0.2534  1061 PHE A CB  
465  C CG  . PHE A 61  ? 2.0359 2.3230 1.9995 -0.0163 0.0317  0.2156  1061 PHE A CG  
466  C CD1 . PHE A 61  ? 2.0649 2.3238 2.0409 -0.0260 0.0467  0.1924  1061 PHE A CD1 
467  C CD2 . PHE A 61  ? 2.0633 2.3847 1.9936 -0.0266 0.0084  0.2055  1061 PHE A CD2 
468  C CE1 . PHE A 61  ? 2.0668 2.3268 2.0232 -0.0388 0.0421  0.1629  1061 PHE A CE1 
469  C CE2 . PHE A 61  ? 2.0946 2.4076 2.0004 -0.0448 0.0051  0.1707  1061 PHE A CE2 
470  C CZ  . PHE A 61  ? 2.0616 2.3416 1.9801 -0.0474 0.0240  0.1516  1061 PHE A CZ  
471  N N   . ARG A 62  ? 1.9342 2.2628 1.9561 0.0193  0.0052  0.2562  1062 ARG A N   
472  C CA  . ARG A 62  ? 1.8936 2.2551 1.9203 0.0140  -0.0184 0.2443  1062 ARG A CA  
473  C C   . ARG A 62  ? 1.8902 2.2235 1.9565 0.0280  -0.0095 0.2417  1062 ARG A C   
474  O O   . ARG A 62  ? 1.8570 2.1969 1.9309 0.0202  -0.0228 0.2195  1062 ARG A O   
475  C CB  . ARG A 62  ? 1.9194 2.3514 1.9303 0.0183  -0.0381 0.2762  1062 ARG A CB  
476  C CG  . ARG A 62  ? 2.0914 2.5531 2.0501 -0.0023 -0.0500 0.2720  1062 ARG A CG  
477  C CD  . ARG A 62  ? 2.2720 2.8154 2.2122 -0.0043 -0.0745 0.3023  1062 ARG A CD  
478  N NE  . ARG A 62  ? 2.4362 3.0085 2.3998 0.0302  -0.0655 0.3585  1062 ARG A NE  
479  C CZ  . ARG A 62  ? 2.6709 3.2524 2.6111 0.0434  -0.0545 0.3921  1062 ARG A CZ  
480  N NH1 . ARG A 62  ? 2.5260 3.0916 2.4168 0.0233  -0.0521 0.3730  1062 ARG A NH1 
481  N NH2 . ARG A 62  ? 2.5390 3.1434 2.5038 0.0796  -0.0420 0.4475  1062 ARG A NH2 
482  N N   . HIS A 63  ? 1.8403 2.1349 1.9273 0.0474  0.0170  0.2627  1063 HIS A N   
483  C CA  . HIS A 63  ? 1.8210 2.0749 1.9363 0.0592  0.0328  0.2575  1063 HIS A CA  
484  C C   . HIS A 63  ? 1.7995 2.0140 1.9171 0.0370  0.0317  0.2106  1063 HIS A C   
485  O O   . HIS A 63  ? 1.7804 1.9825 1.9088 0.0379  0.0293  0.1938  1063 HIS A O   
486  C CB  . HIS A 63  ? 1.8806 2.0902 2.0094 0.0817  0.0682  0.2888  1063 HIS A CB  
487  C CG  . HIS A 63  ? 1.9397 2.0948 2.0880 0.0915  0.0909  0.2800  1063 HIS A CG  
488  N ND1 . HIS A 63  ? 1.9687 2.1402 2.1335 0.1175  0.0951  0.3032  1063 HIS A ND1 
489  C CD2 . HIS A 63  ? 1.9795 2.0660 2.1301 0.0766  0.1117  0.2503  1063 HIS A CD2 
490  C CE1 . HIS A 63  ? 1.9847 2.0887 2.1560 0.1194  0.1211  0.2851  1063 HIS A CE1 
491  N NE2 . HIS A 63  ? 1.9982 2.0499 2.1590 0.0925  0.1303  0.2514  1063 HIS A NE2 
492  N N   . GLY A 64  ? 1.7163 1.9180 1.8241 0.0189  0.0338  0.1933  1064 GLY A N   
493  C CA  . GLY A 64  ? 1.6739 1.8549 1.7869 -0.0013 0.0307  0.1552  1064 GLY A CA  
494  C C   . GLY A 64  ? 1.6436 1.8506 1.7499 -0.0080 0.0075  0.1324  1064 GLY A C   
495  O O   . GLY A 64  ? 1.6202 1.8123 1.7353 -0.0151 0.0046  0.1079  1064 GLY A O   
496  N N   . PHE A 65  ? 1.5652 1.8109 1.6529 -0.0077 -0.0081 0.1406  1065 PHE A N   
497  C CA  . PHE A 65  ? 1.5260 1.7905 1.6048 -0.0162 -0.0256 0.1204  1065 PHE A CA  
498  C C   . PHE A 65  ? 1.5404 1.8144 1.6348 -0.0054 -0.0312 0.1270  1065 PHE A C   
499  O O   . PHE A 65  ? 1.5201 1.7940 1.6151 -0.0108 -0.0391 0.1074  1065 PHE A O   
500  C CB  . PHE A 65  ? 1.5560 1.8512 1.6036 -0.0277 -0.0369 0.1211  1065 PHE A CB  
501  C CG  . PHE A 65  ? 1.5850 1.8654 1.6140 -0.0375 -0.0274 0.1088  1065 PHE A CG  
502  C CD1 . PHE A 65  ? 1.6086 1.8731 1.6361 -0.0447 -0.0246 0.0828  1065 PHE A CD1 
503  C CD2 . PHE A 65  ? 1.6409 1.9256 1.6544 -0.0363 -0.0184 0.1271  1065 PHE A CD2 
504  C CE1 . PHE A 65  ? 1.6335 1.8873 1.6490 -0.0491 -0.0112 0.0758  1065 PHE A CE1 
505  C CE2 . PHE A 65  ? 1.6902 1.9613 1.6878 -0.0434 -0.0054 0.1173  1065 PHE A CE2 
506  C CZ  . PHE A 65  ? 1.6504 1.9069 1.6509 -0.0493 -0.0013 0.0919  1065 PHE A CZ  
507  N N   . ASP A 66  ? 1.4859 1.7657 1.5946 0.0129  -0.0228 0.1571  1066 ASP A N   
508  C CA  . ASP A 66  ? 1.4646 1.7516 1.5929 0.0280  -0.0214 0.1672  1066 ASP A CA  
509  C C   . ASP A 66  ? 1.4608 1.6957 1.5971 0.0296  -0.0072 0.1442  1066 ASP A C   
510  O O   . ASP A 66  ? 1.4386 1.6740 1.5808 0.0333  -0.0098 0.1352  1066 ASP A O   
511  C CB  . ASP A 66  ? 1.5200 1.8285 1.6641 0.0529  -0.0108 0.2114  1066 ASP A CB  
512  C CG  . ASP A 66  ? 1.6914 2.0723 1.8291 0.0510  -0.0312 0.2379  1066 ASP A CG  
513  O OD1 . ASP A 66  ? 1.6857 2.0990 1.8087 0.0282  -0.0535 0.2186  1066 ASP A OD1 
514  O OD2 . ASP A 66  ? 1.8039 2.2111 1.9518 0.0724  -0.0237 0.2796  1066 ASP A OD2 
515  N N   . ILE A 67  ? 1.4019 1.5948 1.5355 0.0231  0.0071  0.1332  1067 ILE A N   
516  C CA  . ILE A 67  ? 1.3951 1.5432 1.5292 0.0153  0.0174  0.1065  1067 ILE A CA  
517  C C   . ILE A 67  ? 1.3837 1.5479 1.5097 -0.0006 -0.0020 0.0773  1067 ILE A C   
518  O O   . ILE A 67  ? 1.3727 1.5255 1.4959 -0.0010 -0.0036 0.0605  1067 ILE A O   
519  C CB  . ILE A 67  ? 1.4670 1.5731 1.6024 0.0055  0.0376  0.1033  1067 ILE A CB  
520  C CG1 . ILE A 67  ? 1.5143 1.5973 1.6565 0.0259  0.0635  0.1379  1067 ILE A CG1 
521  C CG2 . ILE A 67  ? 1.4886 1.5550 1.6197 -0.0115 0.0447  0.0709  1067 ILE A CG2 
522  C CD1 . ILE A 67  ? 1.6591 1.6939 1.8024 0.0147  0.0891  0.1377  1067 ILE A CD1 
523  N N   . LEU A 68  ? 1.3019 1.4910 1.4218 -0.0109 -0.0134 0.0741  1068 LEU A N   
524  C CA  . LEU A 68  ? 1.2626 1.4657 1.3759 -0.0210 -0.0256 0.0532  1068 LEU A CA  
525  C C   . LEU A 68  ? 1.2570 1.4751 1.3642 -0.0161 -0.0358 0.0495  1068 LEU A C   
526  O O   . LEU A 68  ? 1.2418 1.4556 1.3472 -0.0172 -0.0393 0.0336  1068 LEU A O   
527  C CB  . LEU A 68  ? 1.2622 1.4812 1.3672 -0.0283 -0.0268 0.0560  1068 LEU A CB  
528  C CG  . LEU A 68  ? 1.3097 1.5377 1.4103 -0.0341 -0.0306 0.0395  1068 LEU A CG  
529  C CD1 . LEU A 68  ? 1.3092 1.5349 1.4275 -0.0396 -0.0286 0.0281  1068 LEU A CD1 
530  C CD2 . LEU A 68  ? 1.3516 1.5876 1.4381 -0.0382 -0.0250 0.0442  1068 LEU A CD2 
531  N N   . VAL A 69  ? 1.1871 1.4274 1.2923 -0.0120 -0.0405 0.0661  1069 VAL A N   
532  C CA  . VAL A 69  ? 1.1624 1.4207 1.2661 -0.0121 -0.0486 0.0642  1069 VAL A CA  
533  C C   . VAL A 69  ? 1.1849 1.4283 1.3012 0.0010  -0.0416 0.0644  1069 VAL A C   
534  O O   . VAL A 69  ? 1.1722 1.4154 1.2860 0.0009  -0.0439 0.0539  1069 VAL A O   
535  C CB  . VAL A 69  ? 1.2168 1.5145 1.3180 -0.0169 -0.0576 0.0828  1069 VAL A CB  
536  C CG1 . VAL A 69  ? 1.2087 1.5292 1.3163 -0.0207 -0.0642 0.0826  1069 VAL A CG1 
537  C CG2 . VAL A 69  ? 1.2232 1.5288 1.2992 -0.0334 -0.0624 0.0763  1069 VAL A CG2 
538  N N   . GLY A 70  ? 1.1353 1.3595 1.2612 0.0125  -0.0287 0.0759  1070 GLY A N   
539  C CA  . GLY A 70  ? 1.1395 1.3376 1.2701 0.0253  -0.0150 0.0744  1070 GLY A CA  
540  C C   . GLY A 70  ? 1.1680 1.3413 1.2835 0.0173  -0.0159 0.0461  1070 GLY A C   
541  O O   . GLY A 70  ? 1.1565 1.3282 1.2677 0.0232  -0.0148 0.0404  1070 GLY A O   
542  N N   . GLN A 71  ? 1.1166 1.2784 1.2249 0.0033  -0.0190 0.0304  1071 GLN A N   
543  C CA  . GLN A 71  ? 1.1090 1.2632 1.2047 -0.0066 -0.0244 0.0068  1071 GLN A CA  
544  C C   . GLN A 71  ? 1.1103 1.2912 1.2015 -0.0047 -0.0372 0.0031  1071 GLN A C   
545  O O   . GLN A 71  ? 1.1093 1.2890 1.1887 -0.0043 -0.0403 -0.0089 1071 GLN A O   
546  C CB  . GLN A 71  ? 1.1349 1.2870 1.2335 -0.0238 -0.0261 -0.0034 1071 GLN A CB  
547  C CG  . GLN A 71  ? 1.3389 1.4523 1.4380 -0.0306 -0.0082 -0.0043 1071 GLN A CG  
548  C CD  . GLN A 71  ? 1.5581 1.6738 1.6648 -0.0527 -0.0090 -0.0141 1071 GLN A CD  
549  O OE1 . GLN A 71  ? 1.4834 1.6323 1.6019 -0.0565 -0.0191 -0.0094 1071 GLN A OE1 
550  N NE2 . GLN A 71  ? 1.4716 1.5479 1.5721 -0.0683 0.0064  -0.0267 1071 GLN A NE2 
551  N N   . ILE A 72  ? 1.0314 1.2329 1.1275 -0.0045 -0.0421 0.0134  1072 ILE A N   
552  C CA  . ILE A 72  ? 1.0043 1.2184 1.0935 -0.0038 -0.0466 0.0106  1072 ILE A CA  
553  C C   . ILE A 72  ? 1.0369 1.2495 1.1256 0.0042  -0.0431 0.0144  1072 ILE A C   
554  O O   . ILE A 72  ? 1.0320 1.2423 1.1120 0.0081  -0.0418 0.0090  1072 ILE A O   
555  C CB  . ILE A 72  ? 1.0343 1.2606 1.1206 -0.0121 -0.0483 0.0157  1072 ILE A CB  
556  C CG1 . ILE A 72  ? 1.0389 1.2661 1.1254 -0.0171 -0.0472 0.0126  1072 ILE A CG1 
557  C CG2 . ILE A 72  ? 1.0393 1.2649 1.1144 -0.0142 -0.0457 0.0112  1072 ILE A CG2 
558  C CD1 . ILE A 72  ? 1.1253 1.3576 1.2006 -0.0254 -0.0447 0.0161  1072 ILE A CD1 
559  N N   . ASP A 73  ? 0.9869 1.2031 1.0873 0.0092  -0.0388 0.0276  1073 ASP A N   
560  C CA  . ASP A 73  ? 0.9852 1.2067 1.0928 0.0183  -0.0324 0.0359  1073 ASP A CA  
561  C C   . ASP A 73  ? 1.0670 1.2611 1.1622 0.0289  -0.0224 0.0261  1073 ASP A C   
562  O O   . ASP A 73  ? 1.0618 1.2558 1.1529 0.0353  -0.0171 0.0262  1073 ASP A O   
563  C CB  . ASP A 73  ? 1.0061 1.2492 1.1356 0.0246  -0.0292 0.0589  1073 ASP A CB  
564  C CG  . ASP A 73  ? 1.0744 1.3548 1.2099 0.0102  -0.0421 0.0684  1073 ASP A CG  
565  O OD1 . ASP A 73  ? 1.0592 1.3418 1.1814 -0.0051 -0.0485 0.0554  1073 ASP A OD1 
566  O OD2 . ASP A 73  ? 1.1426 1.4499 1.2937 0.0146  -0.0436 0.0903  1073 ASP A OD2 
567  N N   . ASP A 74  ? 1.0543 1.2232 1.1394 0.0277  -0.0184 0.0161  1074 ASP A N   
568  C CA  . ASP A 74  ? 1.0861 1.2265 1.1483 0.0303  -0.0100 0.0005  1074 ASP A CA  
569  C C   . ASP A 74  ? 1.1186 1.2713 1.1631 0.0255  -0.0221 -0.0122 1074 ASP A C   
570  O O   . ASP A 74  ? 1.1395 1.2822 1.1628 0.0314  -0.0173 -0.0191 1074 ASP A O   
571  C CB  . ASP A 74  ? 1.1488 1.2575 1.2020 0.0216  -0.0021 -0.0107 1074 ASP A CB  
572  C CG  . ASP A 74  ? 1.3477 1.4318 1.4137 0.0335  0.0191  0.0052  1074 ASP A CG  
573  O OD1 . ASP A 74  ? 1.3470 1.4391 1.4262 0.0519  0.0296  0.0238  1074 ASP A OD1 
574  O OD2 . ASP A 74  ? 1.4729 1.5279 1.5357 0.0255  0.0289  0.0002  1074 ASP A OD2 
575  N N   . ALA A 75  ? 1.0375 1.2126 1.0900 0.0179  -0.0348 -0.0117 1075 ALA A N   
576  C CA  . ALA A 75  ? 1.0219 1.2143 1.0643 0.0191  -0.0431 -0.0157 1075 ALA A CA  
577  C C   . ALA A 75  ? 1.0415 1.2366 1.0826 0.0299  -0.0370 -0.0058 1075 ALA A C   
578  O O   . ALA A 75  ? 1.0422 1.2398 1.0673 0.0389  -0.0358 -0.0058 1075 ALA A O   
579  C CB  . ALA A 75  ? 1.0152 1.2266 1.0702 0.0111  -0.0514 -0.0150 1075 ALA A CB  
580  N N   . LEU A 76  ? 0.9774 1.1739 1.0338 0.0270  -0.0328 0.0031  1076 LEU A N   
581  C CA  . LEU A 76  ? 0.9699 1.1662 1.0272 0.0293  -0.0245 0.0102  1076 LEU A CA  
582  C C   . LEU A 76  ? 1.0314 1.2204 1.0843 0.0400  -0.0145 0.0141  1076 LEU A C   
583  O O   . LEU A 76  ? 1.0308 1.2149 1.0766 0.0456  -0.0054 0.0184  1076 LEU A O   
584  C CB  . LEU A 76  ? 0.9597 1.1670 1.0325 0.0153  -0.0255 0.0159  1076 LEU A CB  
585  C CG  . LEU A 76  ? 1.0158 1.2217 1.0826 0.0038  -0.0274 0.0112  1076 LEU A CG  
586  C CD1 . LEU A 76  ? 1.0114 1.2336 1.0859 -0.0138 -0.0330 0.0144  1076 LEU A CD1 
587  C CD2 . LEU A 76  ? 1.0581 1.2455 1.1115 0.0058  -0.0140 0.0094  1076 LEU A CD2 
588  N N   . LYS A 77  ? 1.0020 1.1846 1.0572 0.0443  -0.0116 0.0137  1077 LYS A N   
589  C CA  . LYS A 77  ? 1.0221 1.1913 1.0693 0.0571  0.0031  0.0164  1077 LYS A CA  
590  C C   . LYS A 77  ? 1.0922 1.2494 1.1053 0.0643  0.0046  0.0071  1077 LYS A C   
591  O O   . LYS A 77  ? 1.0977 1.2517 1.1028 0.0741  0.0162  0.0140  1077 LYS A O   
592  C CB  . LYS A 77  ? 1.0726 1.2253 1.1224 0.0609  0.0106  0.0152  1077 LYS A CB  
593  C CG  . LYS A 77  ? 1.3058 1.4330 1.3417 0.0762  0.0328  0.0160  1077 LYS A CG  
594  C CD  . LYS A 77  ? 1.4415 1.5873 1.5066 0.0886  0.0475  0.0384  1077 LYS A CD  
595  C CE  . LYS A 77  ? 1.6090 1.7252 1.6620 0.1078  0.0756  0.0414  1077 LYS A CE  
596  N NZ  . LYS A 77  ? 1.7451 1.8302 1.7950 0.1131  0.0883  0.0391  1077 LYS A NZ  
597  N N   . LEU A 78  ? 1.0543 1.2113 1.0487 0.0580  -0.0078 -0.0065 1078 LEU A N   
598  C CA  . LEU A 78  ? 1.0764 1.2372 1.0374 0.0618  -0.0129 -0.0140 1078 LEU A CA  
599  C C   . LEU A 78  ? 1.1327 1.3116 1.0952 0.0714  -0.0143 -0.0005 1078 LEU A C   
600  O O   . LEU A 78  ? 1.1565 1.3364 1.0942 0.0839  -0.0089 0.0048  1078 LEU A O   
601  C CB  . LEU A 78  ? 1.0826 1.2524 1.0334 0.0461  -0.0288 -0.0301 1078 LEU A CB  
602  C CG  . LEU A 78  ? 1.1604 1.2990 1.1010 0.0344  -0.0215 -0.0464 1078 LEU A CG  
603  C CD1 . LEU A 78  ? 1.1599 1.3084 1.1044 0.0130  -0.0356 -0.0598 1078 LEU A CD1 
604  C CD2 . LEU A 78  ? 1.2381 1.3492 1.1360 0.0380  -0.0084 -0.0586 1078 LEU A CD2 
605  N N   . ALA A 79  ? 1.0706 1.2585 1.0581 0.0670  -0.0175 0.0061  1079 ALA A N   
606  C CA  . ALA A 79  ? 1.0722 1.2644 1.0609 0.0767  -0.0109 0.0191  1079 ALA A CA  
607  C C   . ALA A 79  ? 1.1437 1.3169 1.1300 0.0843  0.0089  0.0294  1079 ALA A C   
608  O O   . ALA A 79  ? 1.1536 1.3230 1.1253 0.0995  0.0197  0.0414  1079 ALA A O   
609  C CB  . ALA A 79  ? 1.0606 1.2544 1.0703 0.0670  -0.0125 0.0193  1079 ALA A CB  
610  N N   . ASN A 80  ? 1.1023 1.2680 1.1054 0.0746  0.0150  0.0281  1080 ASN A N   
611  C CA  . ASN A 80  ? 1.1163 1.2717 1.1257 0.0763  0.0339  0.0381  1080 ASN A CA  
612  C C   . ASN A 80  ? 1.1795 1.3277 1.1660 0.0934  0.0446  0.0423  1080 ASN A C   
613  O O   . ASN A 80  ? 1.1918 1.3302 1.1770 0.0998  0.0635  0.0537  1080 ASN A O   
614  C CB  . ASN A 80  ? 1.1496 1.3164 1.1904 0.0600  0.0337  0.0390  1080 ASN A CB  
615  C CG  . ASN A 80  ? 1.6483 1.8217 1.7039 0.0396  0.0259  0.0350  1080 ASN A CG  
616  O OD1 . ASN A 80  ? 1.6174 1.7749 1.6637 0.0350  0.0331  0.0335  1080 ASN A OD1 
617  N ND2 . ASN A 80  ? 1.6033 1.7983 1.6801 0.0275  0.0152  0.0350  1080 ASN A ND2 
618  N N   . GLU A 81  ? 1.1360 1.2854 1.1008 0.0981  0.0350  0.0317  1081 GLU A N   
619  C CA  . GLU A 81  ? 1.1700 1.3083 1.1005 0.1118  0.0455  0.0310  1081 GLU A CA  
620  C C   . GLU A 81  ? 1.2528 1.4006 1.1478 0.1238  0.0400  0.0356  1081 GLU A C   
621  O O   . GLU A 81  ? 1.2870 1.4290 1.1457 0.1359  0.0487  0.0376  1081 GLU A O   
622  C CB  . GLU A 81  ? 1.2018 1.3287 1.1181 0.1069  0.0423  0.0140  1081 GLU A CB  
623  C CG  . GLU A 81  ? 1.3015 1.4210 1.2513 0.1052  0.0546  0.0185  1081 GLU A CG  
624  C CD  . GLU A 81  ? 1.5637 1.6604 1.5017 0.1037  0.0598  0.0051  1081 GLU A CD  
625  O OE1 . GLU A 81  ? 1.5777 1.6725 1.5470 0.1078  0.0720  0.0152  1081 GLU A OE1 
626  O OE2 . GLU A 81  ? 1.4601 1.5419 1.3583 0.0974  0.0529  -0.0143 1081 GLU A OE2 
627  N N   . GLY A 82  ? 1.1977 1.3629 1.1034 0.1227  0.0279  0.0404  1082 GLY A N   
628  C CA  . GLY A 82  ? 1.2194 1.4062 1.1011 0.1382  0.0222  0.0526  1082 GLY A CA  
629  C C   . GLY A 82  ? 1.2901 1.5076 1.1492 0.1305  -0.0029 0.0389  1082 GLY A C   
630  O O   . GLY A 82  ? 1.3177 1.5645 1.1481 0.1423  -0.0109 0.0486  1082 GLY A O   
631  N N   . LYS A 83  ? 1.2338 1.4476 1.1054 0.1090  -0.0149 0.0175  1083 LYS A N   
632  C CA  . LYS A 83  ? 1.2505 1.4874 1.1040 0.0919  -0.0367 -0.0011 1083 LYS A CA  
633  C C   . LYS A 83  ? 1.2822 1.5518 1.1695 0.0840  -0.0531 0.0024  1083 LYS A C   
634  O O   . LYS A 83  ? 1.2473 1.5041 1.1601 0.0685  -0.0551 -0.0085 1083 LYS A O   
635  C CB  . LYS A 83  ? 1.2936 1.4933 1.1366 0.0745  -0.0306 -0.0256 1083 LYS A CB  
636  C CG  . LYS A 83  ? 1.4498 1.6154 1.2593 0.0852  -0.0090 -0.0278 1083 LYS A CG  
637  C CD  . LYS A 83  ? 1.5418 1.6645 1.3458 0.0742  0.0051  -0.0470 1083 LYS A CD  
638  C CE  . LYS A 83  ? 1.6552 1.7433 1.4282 0.0887  0.0321  -0.0467 1083 LYS A CE  
639  N NZ  . LYS A 83  ? 1.7533 1.7950 1.5241 0.0840  0.0532  -0.0608 1083 LYS A NZ  
640  N N   . VAL A 84  ? 1.2619 1.5753 1.1505 0.0984  -0.0615 0.0220  1084 VAL A N   
641  C CA  . VAL A 84  ? 1.2409 1.5907 1.1640 0.0991  -0.0711 0.0330  1084 VAL A CA  
642  C C   . VAL A 84  ? 1.2954 1.6780 1.2240 0.0708  -0.0948 0.0132  1084 VAL A C   
643  O O   . VAL A 84  ? 1.2589 1.6327 1.2173 0.0574  -0.0951 0.0057  1084 VAL A O   
644  C CB  . VAL A 84  ? 1.3080 1.7001 1.2310 0.1284  -0.0693 0.0654  1084 VAL A CB  
645  C CG1 . VAL A 84  ? 1.2835 1.7057 1.2467 0.1350  -0.0700 0.0807  1084 VAL A CG1 
646  C CG2 . VAL A 84  ? 1.3182 1.6704 1.2304 0.1539  -0.0415 0.0842  1084 VAL A CG2 
647  N N   . LYS A 85  ? 1.2942 1.7158 1.1920 0.0593  -0.1138 0.0050  1085 LYS A N   
648  C CA  . LYS A 85  ? 1.3085 1.7656 1.2073 0.0251  -0.1366 -0.0162 1085 LYS A CA  
649  C C   . LYS A 85  ? 1.3691 1.7660 1.2667 -0.0021 -0.1279 -0.0470 1085 LYS A C   
650  O O   . LYS A 85  ? 1.3562 1.7674 1.2744 -0.0278 -0.1376 -0.0596 1085 LYS A O   
651  C CB  . LYS A 85  ? 1.3928 1.8961 1.2456 0.0119  -0.1572 -0.0243 1085 LYS A CB  
652  C CG  . LYS A 85  ? 1.5223 2.1193 1.3869 0.0297  -0.1767 0.0084  1085 LYS A CG  
653  C CD  . LYS A 85  ? 1.5865 2.1830 1.4581 0.0785  -0.1581 0.0485  1085 LYS A CD  
654  C CE  . LYS A 85  ? 1.6500 2.3415 1.5394 0.1008  -0.1735 0.0867  1085 LYS A CE  
655  N NZ  . LYS A 85  ? 1.7149 2.3932 1.6098 0.1505  -0.1475 0.1275  1085 LYS A NZ  
656  N N   . GLU A 86  ? 1.3454 1.6781 1.2232 0.0058  -0.1069 -0.0548 1086 GLU A N   
657  C CA  . GLU A 86  ? 1.3521 1.6260 1.2315 -0.0100 -0.0924 -0.0751 1086 GLU A CA  
658  C C   . GLU A 86  ? 1.3612 1.6263 1.2892 -0.0047 -0.0860 -0.0629 1086 GLU A C   
659  O O   . GLU A 86  ? 1.3575 1.6056 1.2998 -0.0236 -0.0845 -0.0747 1086 GLU A O   
660  C CB  . GLU A 86  ? 1.3951 1.6142 1.2449 0.0029  -0.0694 -0.0797 1086 GLU A CB  
661  C CG  . GLU A 86  ? 1.6205 1.8334 1.4108 -0.0029 -0.0692 -0.0955 1086 GLU A CG  
662  C CD  . GLU A 86  ? 2.0174 2.2692 1.7839 0.0178  -0.0766 -0.0771 1086 GLU A CD  
663  O OE1 . GLU A 86  ? 2.0962 2.3234 1.8149 0.0234  -0.0645 -0.0841 1086 GLU A OE1 
664  O OE2 . GLU A 86  ? 1.9487 2.2475 1.7446 0.0332  -0.0879 -0.0521 1086 GLU A OE2 
665  N N   . ALA A 87  ? 1.2880 1.5605 1.2364 0.0195  -0.0798 -0.0398 1087 ALA A N   
666  C CA  . ALA A 87  ? 1.2474 1.5128 1.2322 0.0234  -0.0735 -0.0291 1087 ALA A CA  
667  C C   . ALA A 87  ? 1.2894 1.5928 1.2992 0.0134  -0.0859 -0.0265 1087 ALA A C   
668  O O   . ALA A 87  ? 1.2641 1.5558 1.2950 0.0033  -0.0828 -0.0290 1087 ALA A O   
669  C CB  . ALA A 87  ? 1.2407 1.5004 1.2313 0.0456  -0.0614 -0.0100 1087 ALA A CB  
670  N N   . GLN A 88  ? 1.2628 1.6174 1.2712 0.0173  -0.0992 -0.0184 1088 GLN A N   
671  C CA  . GLN A 88  ? 1.2492 1.6544 1.2871 0.0094  -0.1107 -0.0117 1088 GLN A CA  
672  C C   . GLN A 88  ? 1.3222 1.7292 1.3625 -0.0258 -0.1210 -0.0349 1088 GLN A C   
673  O O   . GLN A 88  ? 1.2962 1.7213 1.3675 -0.0367 -0.1223 -0.0325 1088 GLN A O   
674  C CB  . GLN A 88  ? 1.2766 1.7477 1.3149 0.0247  -0.1229 0.0080  1088 GLN A CB  
675  C CG  . GLN A 88  ? 1.4194 1.8847 1.4609 0.0622  -0.1054 0.0361  1088 GLN A CG  
676  C CD  . GLN A 88  ? 1.6179 2.1496 1.6612 0.0850  -0.1133 0.0637  1088 GLN A CD  
677  O OE1 . GLN A 88  ? 1.5676 2.1582 1.6020 0.0717  -0.1372 0.0612  1088 GLN A OE1 
678  N NE2 . GLN A 88  ? 1.4902 2.0129 1.5417 0.1196  -0.0915 0.0918  1088 GLN A NE2 
679  N N   . ALA A 89  ? 1.3301 1.7104 1.3352 -0.0438 -0.1233 -0.0577 1089 ALA A N   
680  C CA  . ALA A 89  ? 1.3645 1.7268 1.3628 -0.0801 -0.1254 -0.0839 1089 ALA A CA  
681  C C   . ALA A 89  ? 1.4133 1.7154 1.4258 -0.0811 -0.1050 -0.0868 1089 ALA A C   
682  O O   . ALA A 89  ? 1.4117 1.7087 1.4411 -0.1041 -0.1031 -0.0952 1089 ALA A O   
683  C CB  . ALA A 89  ? 1.4302 1.7702 1.3773 -0.0966 -0.1270 -0.1084 1089 ALA A CB  
684  N N   . ALA A 90  ? 1.3676 1.6292 1.3746 -0.0566 -0.0896 -0.0771 1090 ALA A N   
685  C CA  . ALA A 90  ? 1.3598 1.5771 1.3808 -0.0520 -0.0722 -0.0724 1090 ALA A CA  
686  C C   . ALA A 90  ? 1.3912 1.6310 1.4467 -0.0482 -0.0742 -0.0564 1090 ALA A C   
687  O O   . ALA A 90  ? 1.3822 1.6014 1.4512 -0.0563 -0.0653 -0.0553 1090 ALA A O   
688  C CB  . ALA A 90  ? 1.3619 1.5506 1.3726 -0.0286 -0.0594 -0.0630 1090 ALA A CB  
689  N N   . ALA A 91  ? 1.3451 1.6239 1.4119 -0.0343 -0.0820 -0.0428 1091 ALA A N   
690  C CA  . ALA A 91  ? 1.3274 1.6244 1.4199 -0.0283 -0.0794 -0.0285 1091 ALA A CA  
691  C C   . ALA A 91  ? 1.4108 1.7387 1.5260 -0.0476 -0.0854 -0.0312 1091 ALA A C   
692  O O   . ALA A 91  ? 1.3898 1.7222 1.5248 -0.0468 -0.0784 -0.0218 1091 ALA A O   
693  C CB  . ALA A 91  ? 1.3238 1.6438 1.4174 -0.0063 -0.0787 -0.0136 1091 ALA A CB  
694  N N   . GLU A 92  ? 1.4148 1.7654 1.5250 -0.0679 -0.0975 -0.0449 1092 GLU A N   
695  C CA  . GLU A 92  ? 1.4311 1.8185 1.5661 -0.0934 -0.1044 -0.0493 1092 GLU A CA  
696  C C   . GLU A 92  ? 1.5094 1.8482 1.6464 -0.1146 -0.0904 -0.0606 1092 GLU A C   
697  O O   . GLU A 92  ? 1.5068 1.8652 1.6705 -0.1325 -0.0884 -0.0590 1092 GLU A O   
698  C CB  . GLU A 92  ? 1.4798 1.9137 1.6049 -0.1141 -0.1244 -0.0620 1092 GLU A CB  
699  C CG  . GLU A 92  ? 1.6206 2.1418 1.7821 -0.1150 -0.1392 -0.0450 1092 GLU A CG  
700  C CD  . GLU A 92  ? 1.8597 2.4185 2.0368 -0.0750 -0.1373 -0.0146 1092 GLU A CD  
701  O OE1 . GLU A 92  ? 1.7972 2.3160 1.9512 -0.0479 -0.1273 -0.0087 1092 GLU A OE1 
702  O OE2 . GLU A 92  ? 1.7576 2.3879 1.9714 -0.0712 -0.1437 0.0045  1092 GLU A OE2 
703  N N   . GLN A 93  ? 1.4869 1.7638 1.5991 -0.1089 -0.0772 -0.0673 1093 GLN A N   
704  C CA  . GLN A 93  ? 1.5105 1.7352 1.6232 -0.1195 -0.0581 -0.0704 1093 GLN A CA  
705  C C   . GLN A 93  ? 1.5368 1.7607 1.6698 -0.1028 -0.0491 -0.0479 1093 GLN A C   
706  O O   . GLN A 93  ? 1.5470 1.7420 1.6872 -0.1106 -0.0339 -0.0436 1093 GLN A O   
707  C CB  . GLN A 93  ? 1.5583 1.7237 1.6413 -0.1118 -0.0435 -0.0782 1093 GLN A CB  
708  C CG  . GLN A 93  ? 1.8147 1.9626 1.8663 -0.1339 -0.0449 -0.1057 1093 GLN A CG  
709  C CD  . GLN A 93  ? 2.0992 2.1817 2.1208 -0.1219 -0.0228 -0.1113 1093 GLN A CD  
710  O OE1 . GLN A 93  ? 2.0125 2.0826 2.0391 -0.0916 -0.0142 -0.0917 1093 GLN A OE1 
711  N NE2 . GLN A 93  ? 2.0710 2.1138 2.0594 -0.1466 -0.0124 -0.1388 1093 GLN A NE2 
712  N N   . LEU A 94  ? 1.4673 1.7187 1.6046 -0.0808 -0.0558 -0.0338 1094 LEU A N   
713  C CA  . LEU A 94  ? 1.4503 1.7026 1.5966 -0.0683 -0.0480 -0.0164 1094 LEU A CA  
714  C C   . LEU A 94  ? 1.5189 1.7957 1.6899 -0.0811 -0.0439 -0.0116 1094 LEU A C   
715  O O   . LEU A 94  ? 1.5131 1.7775 1.6873 -0.0788 -0.0322 0.0000  1094 LEU A O   
716  C CB  . LEU A 94  ? 1.4253 1.6931 1.5640 -0.0479 -0.0520 -0.0086 1094 LEU A CB  
717  C CG  . LEU A 94  ? 1.4795 1.7267 1.5981 -0.0354 -0.0535 -0.0097 1094 LEU A CG  
718  C CD1 . LEU A 94  ? 1.4673 1.7276 1.5796 -0.0211 -0.0545 -0.0052 1094 LEU A CD1 
719  C CD2 . LEU A 94  ? 1.5120 1.7351 1.6252 -0.0321 -0.0462 -0.0010 1094 LEU A CD2 
720  N N   . LYS A 95  ? 1.4934 1.8110 1.6823 -0.0953 -0.0536 -0.0185 1095 LYS A N   
721  C CA  . LYS A 95  ? 1.4992 1.8531 1.7204 -0.1103 -0.0503 -0.0130 1095 LYS A CA  
722  C C   . LYS A 95  ? 1.5921 1.9113 1.8183 -0.1341 -0.0367 -0.0182 1095 LYS A C   
723  O O   . LYS A 95  ? 1.5887 1.9121 1.8328 -0.1364 -0.0235 -0.0058 1095 LYS A O   
724  C CB  . LYS A 95  ? 1.5323 1.9493 1.7740 -0.1234 -0.0677 -0.0180 1095 LYS A CB  
725  C CG  . LYS A 95  ? 1.6780 2.1325 1.9191 -0.0950 -0.0760 -0.0053 1095 LYS A CG  
726  C CD  . LYS A 95  ? 1.7935 2.3234 2.0577 -0.1054 -0.0945 -0.0033 1095 LYS A CD  
727  C CE  . LYS A 95  ? 1.8898 2.4547 2.1541 -0.0714 -0.0980 0.0157  1095 LYS A CE  
728  N NZ  . LYS A 95  ? 1.9943 2.6471 2.2839 -0.0783 -0.1179 0.0245  1095 LYS A NZ  
729  N N   . THR A 96  ? 1.5889 1.8668 1.7958 -0.1498 -0.0349 -0.0355 1096 THR A N   
730  C CA  . THR A 96  ? 1.6326 1.8606 1.8385 -0.1708 -0.0149 -0.0409 1096 THR A CA  
731  C C   . THR A 96  ? 1.6895 1.8823 1.8901 -0.1473 0.0035  -0.0178 1096 THR A C   
732  O O   . THR A 96  ? 1.7060 1.8820 1.9191 -0.1572 0.0217  -0.0083 1096 THR A O   
733  C CB  . THR A 96  ? 1.7727 1.9529 1.9497 -0.1850 -0.0112 -0.0639 1096 THR A CB  
734  O OG1 . THR A 96  ? 1.7747 1.9967 1.9486 -0.2063 -0.0326 -0.0847 1096 THR A OG1 
735  C CG2 . THR A 96  ? 1.8084 1.9257 1.9816 -0.2084 0.0165  -0.0714 1096 THR A CG2 
736  N N   . THR A 97  ? 1.6314 1.8192 1.8134 -0.1181 -0.0018 -0.0074 1097 THR A N   
737  C CA  . THR A 97  ? 1.6298 1.8001 1.8029 -0.0968 0.0089  0.0155  1097 THR A CA  
738  C C   . THR A 97  ? 1.6748 1.8788 1.8579 -0.0929 0.0094  0.0283  1097 THR A C   
739  O O   . THR A 97  ? 1.6823 1.8741 1.8621 -0.0879 0.0233  0.0461  1097 THR A O   
740  C CB  . THR A 97  ? 1.7048 1.8709 1.8580 -0.0745 -0.0001 0.0194  1097 THR A CB  
741  O OG1 . THR A 97  ? 1.7080 1.8423 1.8519 -0.0767 0.0038  0.0072  1097 THR A OG1 
742  C CG2 . THR A 97  ? 1.6879 1.8485 1.8315 -0.0563 0.0065  0.0439  1097 THR A CG2 
743  N N   . ARG A 98  ? 1.6216 1.8667 1.8153 -0.0931 -0.0024 0.0216  1098 ARG A N   
744  C CA  . ARG A 98  ? 1.6159 1.8889 1.8176 -0.0862 0.0036  0.0328  1098 ARG A CA  
745  C C   . ARG A 98  ? 1.6950 1.9782 1.9247 -0.1041 0.0180  0.0387  1098 ARG A C   
746  O O   . ARG A 98  ? 1.6983 1.9836 1.9269 -0.0979 0.0327  0.0534  1098 ARG A O   
747  C CB  . ARG A 98  ? 1.6037 1.9141 1.8126 -0.0766 -0.0069 0.0282  1098 ARG A CB  
748  C CG  . ARG A 98  ? 1.7519 2.0779 1.9606 -0.0625 0.0065  0.0402  1098 ARG A CG  
749  C CD  . ARG A 98  ? 1.9075 2.2818 2.1553 -0.0651 0.0123  0.0473  1098 ARG A CD  
750  N NE  . ARG A 98  ? 2.0436 2.4553 2.3054 -0.0555 0.0001  0.0459  1098 ARG A NE  
751  C CZ  . ARG A 98  ? 2.2599 2.7053 2.5423 -0.0704 -0.0183 0.0382  1098 ARG A CZ  
752  N NH1 . ARG A 98  ? 2.1122 2.5976 2.4041 -0.0574 -0.0290 0.0423  1098 ARG A NH1 
753  N NH2 . ARG A 98  ? 2.1169 2.5549 2.4075 -0.0991 -0.0240 0.0268  1098 ARG A NH2 
754  N N   . ASN A 99  ? 1.6722 1.9597 1.9235 -0.1294 0.0154  0.0263  1099 ASN A N   
755  C CA  . ASN A 99  ? 1.6962 1.9936 1.9782 -0.1540 0.0298  0.0294  1099 ASN A CA  
756  C C   . ASN A 99  ? 1.7780 2.0198 2.0470 -0.1555 0.0533  0.0411  1099 ASN A C   
757  O O   . ASN A 99  ? 1.7913 2.0360 2.0785 -0.1646 0.0721  0.0538  1099 ASN A O   
758  C CB  . ASN A 99  ? 1.7372 2.0559 2.0407 -0.1879 0.0187  0.0083  1099 ASN A CB  
759  C CG  . ASN A 99  ? 2.0711 2.4586 2.3924 -0.1864 -0.0048 0.0032  1099 ASN A CG  
760  O OD1 . ASN A 99  ? 1.9892 2.4094 2.3152 -0.1591 -0.0073 0.0179  1099 ASN A OD1 
761  N ND2 . ASN A 99  ? 2.0005 2.4096 2.3285 -0.2157 -0.0204 -0.0169 1099 ASN A ND2 
762  N N   . ALA A 100 ? 1.7424 1.9367 1.9820 -0.1433 0.0547  0.0412  1100 ALA A N   
763  C CA  . ALA A 100 ? 2.0942 2.2379 2.3205 -0.1361 0.0783  0.0596  1100 ALA A CA  
764  C C   . ALA A 100 ? 2.5110 2.6661 2.7207 -0.1115 0.0831  0.0856  1100 ALA A C   
765  O O   . ALA A 100 ? 2.0783 2.2048 2.2775 -0.1024 0.1026  0.1082  1100 ALA A O   
766  C CB  . ALA A 100 ? 2.1193 2.2191 2.3240 -0.1256 0.0792  0.0558  1100 ALA A CB  
767  N N   . HIS A 119 ? 2.0949 3.3045 1.5595 0.5542  -0.1199 0.0815  43   HIS A N   
768  C CA  . HIS A 119 ? 2.0886 3.2537 1.5479 0.5706  -0.0901 0.1121  43   HIS A CA  
769  C C   . HIS A 119 ? 2.1697 3.2720 1.5797 0.5962  -0.0650 0.1306  43   HIS A C   
770  O O   . HIS A 119 ? 2.2219 3.3265 1.5806 0.6311  -0.0703 0.1286  43   HIS A O   
771  C CB  . HIS A 119 ? 2.1125 3.3125 1.5625 0.6034  -0.0947 0.1218  43   HIS A CB  
772  C CG  . HIS A 119 ? 2.1632 3.3134 1.6017 0.6215  -0.0648 0.1526  43   HIS A CG  
773  N ND1 . HIS A 119 ? 2.2315 3.3080 1.6226 0.6436  -0.0460 0.1698  43   HIS A ND1 
774  C CD2 . HIS A 119 ? 2.1484 3.2830 1.6221 0.6038  -0.0521 0.1656  43   HIS A CD2 
775  C CE1 . HIS A 119 ? 2.2244 3.2914 1.6128 0.6646  -0.0206 0.1968  43   HIS A CE1 
776  N NE2 . HIS A 119 ? 2.1753 3.2568 1.6164 0.6311  -0.0252 0.1931  43   HIS A NE2 
777  N N   . LEU A 120 ? 2.1036 3.1506 1.5293 0.5802  -0.0371 0.1496  44   LEU A N   
778  C CA  . LEU A 120 ? 2.1326 3.1187 1.5205 0.6011  -0.0084 0.1711  44   LEU A CA  
779  C C   . LEU A 120 ? 2.1566 3.1057 1.5447 0.6147  0.0186  0.2007  44   LEU A C   
780  O O   . LEU A 120 ? 2.1082 3.0544 1.5403 0.5886  0.0225  0.2055  44   LEU A O   
781  C CB  . LEU A 120 ? 2.1173 3.0685 1.5222 0.5702  0.0023  0.1679  44   LEU A CB  
782  C CG  . LEU A 120 ? 2.1880 3.1586 1.5805 0.5592  -0.0195 0.1409  44   LEU A CG  
783  C CD1 . LEU A 120 ? 2.1748 3.1088 1.5874 0.5283  -0.0064 0.1403  44   LEU A CD1 
784  C CD2 . LEU A 120 ? 2.2842 3.2505 1.6105 0.6019  -0.0231 0.1396  44   LEU A CD2 
785  N N   . ASP A 121 ? 2.1402 3.0577 1.4760 0.6562  0.0372  0.2202  45   ASP A N   
786  C CA  . ASP A 121 ? 2.1403 3.0153 1.4669 0.6726  0.0650  0.2493  45   ASP A CA  
787  C C   . ASP A 121 ? 2.1362 2.9565 1.4908 0.6457  0.0930  0.2666  45   ASP A C   
788  O O   . ASP A 121 ? 2.1215 2.9094 1.4880 0.6432  0.1121  0.2869  45   ASP A O   
789  C CB  . ASP A 121 ? 2.2351 3.0895 1.4932 0.7258  0.0782  0.2646  45   ASP A CB  
790  C CG  . ASP A 121 ? 2.3517 3.1679 1.6171 0.6842  0.0420  0.2329  45   ASP A CG  
791  O OD1 . ASP A 121 ? 2.3264 3.1998 1.6221 0.6732  0.0168  0.2167  45   ASP A OD1 
792  O OD2 . ASP A 121 ? 2.4391 3.1699 1.6839 0.6608  0.0402  0.2268  45   ASP A OD2 
793  N N   . ALA A 122 ? 2.0609 2.8710 1.4251 0.6262  0.0948  0.2584  46   ALA A N   
794  C CA  . ALA A 122 ? 2.0260 2.7914 1.4188 0.6011  0.1195  0.2728  46   ALA A CA  
795  C C   . ALA A 122 ? 1.9845 2.7554 1.4399 0.5590  0.1144  0.2693  46   ALA A C   
796  O O   . ALA A 122 ? 1.9685 2.7009 1.4466 0.5458  0.1366  0.2884  46   ALA A O   
797  C CB  . ALA A 122 ? 2.0413 2.8022 1.4259 0.5933  0.1184  0.2615  46   ALA A CB  
798  N N   . ILE A 123 ? 1.8807 2.6990 1.3634 0.5383  0.0856  0.2452  47   ILE A N   
799  C CA  . ILE A 123 ? 1.8115 2.6380 1.3499 0.5001  0.0783  0.2391  47   ILE A CA  
800  C C   . ILE A 123 ? 1.8448 2.6460 1.3916 0.5055  0.0924  0.2604  47   ILE A C   
801  O O   . ILE A 123 ? 1.8187 2.5847 1.3950 0.4836  0.1080  0.2724  47   ILE A O   
802  C CB  . ILE A 123 ? 1.8178 2.7022 1.3762 0.4842  0.0462  0.2110  47   ILE A CB  
803  C CG1 . ILE A 123 ? 1.8205 2.7209 1.3765 0.4695  0.0327  0.1888  47   ILE A CG1 
804  C CG2 . ILE A 123 ? 1.7733 2.6661 1.3823 0.4526  0.0399  0.2075  47   ILE A CG2 
805  C CD1 . ILE A 123 ? 1.8793 2.7480 1.4646 0.4370  0.0444  0.1886  47   ILE A CD1 
806  N N   . PRO A 124 ? 1.8169 2.6310 1.3368 0.5346  0.0886  0.2664  48   PRO A N   
807  C CA  . PRO A 124 ? 1.8130 2.5947 1.3378 0.5379  0.1031  0.2866  48   PRO A CA  
808  C C   . PRO A 124 ? 1.8771 2.5964 1.3895 0.5435  0.1352  0.3127  48   PRO A C   
809  O O   . PRO A 124 ? 1.8547 2.5400 1.3877 0.5294  0.1472  0.3266  48   PRO A O   
810  C CB  . PRO A 124 ? 1.8682 2.6746 1.3535 0.5761  0.0947  0.2884  48   PRO A CB  
811  C CG  . PRO A 124 ? 1.9149 2.7836 1.4002 0.5777  0.0667  0.2624  48   PRO A CG  
812  C CD  . PRO A 124 ? 1.8610 2.7207 1.3463 0.5649  0.0693  0.2543  48   PRO A CD  
813  N N   . ILE A 125 ? 1.8704 2.5740 1.3507 0.5624  0.1491  0.3192  49   ILE A N   
814  C CA  . ILE A 125 ? 1.8988 2.5463 1.3694 0.5677  0.1818  0.3447  49   ILE A CA  
815  C C   . ILE A 125 ? 1.9113 2.5430 1.4355 0.5263  0.1886  0.3446  49   ILE A C   
816  O O   . ILE A 125 ? 1.9017 2.4980 1.4506 0.5104  0.2043  0.3607  49   ILE A O   
817  C CB  . ILE A 125 ? 1.9927 2.6288 1.4098 0.6037  0.1957  0.3521  49   ILE A CB  
818  C CG1 . ILE A 125 ? 2.0418 2.6949 1.4024 0.6484  0.1877  0.3516  49   ILE A CG1 
819  C CG2 . ILE A 125 ? 2.0345 2.6133 1.4463 0.6070  0.2326  0.3799  49   ILE A CG2 
820  C CD1 . ILE A 125 ? 2.1608 2.7839 1.4989 0.6695  0.2019  0.3722  49   ILE A CD1 
821  N N   . LEU A 126 ? 1.8410 2.4989 1.3819 0.5092  0.1756  0.3258  50   LEU A N   
822  C CA  . LEU A 126 ? 1.7974 2.4461 1.3851 0.4732  0.1797  0.3230  50   LEU A CA  
823  C C   . LEU A 126 ? 1.7896 2.4377 1.4268 0.4405  0.1708  0.3198  50   LEU A C   
824  O O   . LEU A 126 ? 1.7674 2.3900 1.4398 0.4173  0.1835  0.3294  50   LEU A O   
825  C CB  . LEU A 126 ? 1.7823 2.4628 1.3710 0.4636  0.1620  0.2992  50   LEU A CB  
826  C CG  . LEU A 126 ? 1.8767 2.5422 1.4363 0.4792  0.1770  0.3038  50   LEU A CG  
827  C CD1 . LEU A 126 ? 1.9413 2.5935 1.4419 0.5232  0.1897  0.3172  50   LEU A CD1 
828  C CD2 . LEU A 126 ? 1.8909 2.5860 1.4496 0.4672  0.1556  0.2773  50   LEU A CD2 
829  N N   . TYR A 127 ? 1.7209 2.3973 1.3600 0.4402  0.1493  0.3070  51   TYR A N   
830  C CA  . TYR A 127 ? 1.6756 2.3505 1.3543 0.4140  0.1399  0.3036  51   TYR A CA  
831  C C   . TYR A 127 ? 1.7475 2.3750 1.4273 0.4165  0.1594  0.3278  51   TYR A C   
832  O O   . TYR A 127 ? 1.7174 2.3260 1.4354 0.3891  0.1602  0.3301  51   TYR A O   
833  C CB  . TYR A 127 ? 1.6693 2.3866 1.3439 0.4189  0.1151  0.2865  51   TYR A CB  
834  C CG  . TYR A 127 ? 1.6449 2.4040 1.3434 0.3967  0.0932  0.2603  51   TYR A CG  
835  C CD1 . TYR A 127 ? 1.6798 2.4570 1.3636 0.3999  0.0889  0.2482  51   TYR A CD1 
836  C CD2 . TYR A 127 ? 1.6116 2.3924 1.3411 0.3759  0.0762  0.2472  51   TYR A CD2 
837  C CE1 . TYR A 127 ? 1.6568 2.4679 1.3598 0.3782  0.0692  0.2237  51   TYR A CE1 
838  C CE2 . TYR A 127 ? 1.5913 2.4085 1.3412 0.3553  0.0577  0.2235  51   TYR A CE2 
839  C CZ  . TYR A 127 ? 1.6860 2.5180 1.4226 0.3557  0.0540  0.2115  51   TYR A CZ  
840  O OH  . TYR A 127 ? 1.6630 2.5264 1.4172 0.3340  0.0364  0.1878  51   TYR A OH  
841  N N   . TYR A 128 ? 1.7538 2.3595 1.3904 0.4489  0.1752  0.3454  52   TYR A N   
842  C CA  . TYR A 128 ? 1.7763 2.3315 1.4095 0.4513  0.1957  0.3689  52   TYR A CA  
843  C C   . TYR A 128 ? 1.8261 2.3457 1.4794 0.4371  0.2204  0.3852  52   TYR A C   
844  O O   . TYR A 128 ? 1.8213 2.3034 1.4963 0.4210  0.2324  0.3994  52   TYR A O   
845  C CB  . TYR A 128 ? 1.8473 2.3872 1.4242 0.4918  0.2060  0.3829  52   TYR A CB  
846  C CG  . TYR A 128 ? 1.8683 2.4229 1.4326 0.5024  0.1891  0.3769  52   TYR A CG  
847  C CD1 . TYR A 128 ? 1.8976 2.4149 1.4702 0.4928  0.1938  0.3878  52   TYR A CD1 
848  C CD2 . TYR A 128 ? 1.8787 2.4828 1.4194 0.5247  0.1695  0.3615  52   TYR A CD2 
849  C CE1 . TYR A 128 ? 1.9102 2.4386 1.4676 0.5056  0.1799  0.3837  52   TYR A CE1 
850  C CE2 . TYR A 128 ? 1.8899 2.5107 1.4199 0.5369  0.1557  0.3578  52   TYR A CE2 
851  C CZ  . TYR A 128 ? 1.9935 2.5752 1.5303 0.5284  0.1618  0.3695  52   TYR A CZ  
852  O OH  . TYR A 128 ? 2.0198 2.6162 1.5432 0.5429  0.1495  0.3669  52   TYR A OH  
853  N N   . ILE A 129 ? 1.7863 2.3177 1.4330 0.4430  0.2278  0.3832  53   ILE A N   
854  C CA  . ILE A 129 ? 1.7926 2.2966 1.4596 0.4317  0.2524  0.3991  53   ILE A CA  
855  C C   . ILE A 129 ? 1.7881 2.2949 1.5168 0.3901  0.2442  0.3917  53   ILE A C   
856  O O   . ILE A 129 ? 1.7870 2.2625 1.5446 0.3734  0.2600  0.4078  53   ILE A O   
857  C CB  . ILE A 129 ? 1.8529 2.3699 1.4931 0.4510  0.2607  0.3973  53   ILE A CB  
858  C CG1 . ILE A 129 ? 1.9170 2.4275 1.4924 0.4952  0.2693  0.4056  53   ILE A CG1 
859  C CG2 . ILE A 129 ? 1.8663 2.3587 1.5324 0.4388  0.2871  0.4144  53   ILE A CG2 
860  C CD1 . ILE A 129 ? 2.0608 2.5829 1.5991 0.5197  0.2741  0.4017  53   ILE A CD1 
861  N N   . ILE A 130 ? 1.6933 2.2369 1.4412 0.3738  0.2191  0.3673  54   ILE A N   
862  C CA  . ILE A 130 ? 1.6366 2.1854 1.4374 0.3377  0.2087  0.3575  54   ILE A CA  
863  C C   . ILE A 130 ? 1.6628 2.1910 1.4844 0.3227  0.2022  0.3614  54   ILE A C   
864  O O   . ILE A 130 ? 1.6345 2.1471 1.4978 0.2963  0.2039  0.3648  54   ILE A O   
865  C CB  . ILE A 130 ? 1.6395 2.2297 1.4461 0.3280  0.1844  0.3301  54   ILE A CB  
866  C CG1 . ILE A 130 ? 1.6626 2.2674 1.4440 0.3428  0.1900  0.3254  54   ILE A CG1 
867  C CG2 . ILE A 130 ? 1.6013 2.1953 1.4572 0.2933  0.1727  0.3188  54   ILE A CG2 
868  C CD1 . ILE A 130 ? 1.7531 2.3388 1.5516 0.3365  0.2130  0.3391  54   ILE A CD1 
869  N N   . PHE A 131 ? 1.6356 2.1618 1.4255 0.3415  0.1955  0.3621  55   PHE A N   
870  C CA  . PHE A 131 ? 1.6307 2.1327 1.4293 0.3328  0.1899  0.3665  55   PHE A CA  
871  C C   . PHE A 131 ? 1.6983 2.1506 1.5082 0.3250  0.2120  0.3897  55   PHE A C   
872  O O   . PHE A 131 ? 1.6678 2.1020 1.5138 0.2987  0.2070  0.3897  55   PHE A O   
873  C CB  . PHE A 131 ? 1.6782 2.1875 1.4330 0.3612  0.1821  0.3653  55   PHE A CB  
874  C CG  . PHE A 131 ? 1.7140 2.1877 1.4646 0.3597  0.1816  0.3747  55   PHE A CG  
875  C CD1 . PHE A 131 ? 1.7234 2.2025 1.4988 0.3403  0.1622  0.3621  55   PHE A CD1 
876  C CD2 . PHE A 131 ? 1.7930 2.2241 1.5103 0.3792  0.2013  0.3961  55   PHE A CD2 
877  C CE1 . PHE A 131 ? 1.7538 2.1953 1.5208 0.3402  0.1616  0.3706  55   PHE A CE1 
878  C CE2 . PHE A 131 ? 1.8488 2.2414 1.5577 0.3778  0.2009  0.4043  55   PHE A CE2 
879  C CZ  . PHE A 131 ? 1.7927 2.1909 1.5257 0.3588  0.1803  0.3913  55   PHE A CZ  
880  N N   . VAL A 132 ? 1.7021 2.1314 1.4799 0.3480  0.2359  0.4091  56   VAL A N   
881  C CA  . VAL A 132 ? 1.7315 2.1113 1.5159 0.3421  0.2595  0.4327  56   VAL A CA  
882  C C   . VAL A 132 ? 1.7497 2.1282 1.5868 0.3135  0.2700  0.4377  56   VAL A C   
883  O O   . VAL A 132 ? 1.7411 2.0925 1.6127 0.2889  0.2730  0.4454  56   VAL A O   
884  C CB  . VAL A 132 ? 1.8412 2.1951 1.5725 0.3771  0.2846  0.4527  56   VAL A CB  
885  C CG1 . VAL A 132 ? 1.8482 2.2267 1.5591 0.3979  0.2951  0.4528  56   VAL A CG1 
886  C CG2 . VAL A 132 ? 1.8785 2.1774 1.6170 0.3684  0.3104  0.4775  56   VAL A CG2 
887  N N   . ILE A 133 ? 1.6846 2.0928 1.5276 0.3168  0.2740  0.4325  57   ILE A N   
888  C CA  . ILE A 133 ? 1.6591 2.0708 1.5497 0.2939  0.2846  0.4376  57   ILE A CA  
889  C C   . ILE A 133 ? 1.6483 2.0708 1.5887 0.2601  0.2620  0.4221  57   ILE A C   
890  O O   . ILE A 133 ? 1.6403 2.0441 1.6222 0.2365  0.2683  0.4316  57   ILE A O   
891  C CB  . ILE A 133 ? 1.6950 2.1354 1.5733 0.3081  0.2912  0.4330  57   ILE A CB  
892  C CG1 . ILE A 133 ? 1.7570 2.1799 1.5866 0.3424  0.3172  0.4516  57   ILE A CG1 
893  C CG2 . ILE A 133 ? 1.6761 2.1254 1.6057 0.2842  0.2988  0.4356  57   ILE A CG2 
894  C CD1 . ILE A 133 ? 1.8625 2.3076 1.6681 0.3621  0.3238  0.4475  57   ILE A CD1 
895  N N   . GLY A 134 ? 1.5609 2.0122 1.4955 0.2588  0.2363  0.3990  58   GLY A N   
896  C CA  . GLY A 134 ? 1.5081 1.9699 1.4814 0.2313  0.2141  0.3825  58   GLY A CA  
897  C C   . GLY A 134 ? 1.5484 1.9795 1.5350 0.2170  0.2059  0.3859  58   GLY A C   
898  O O   . GLY A 134 ? 1.5135 1.9408 1.5411 0.1911  0.1956  0.3803  58   GLY A O   
899  N N   . PHE A 135 ? 1.5371 1.9445 1.4858 0.2353  0.2095  0.3945  59   PHE A N   
900  C CA  . PHE A 135 ? 1.5441 1.9159 1.4962 0.2248  0.2020  0.3981  59   PHE A CA  
901  C C   . PHE A 135 ? 1.6070 1.9420 1.5890 0.2062  0.2190  0.4167  59   PHE A C   
902  O O   . PHE A 135 ? 1.5834 1.9004 1.5969 0.1820  0.2076  0.4136  59   PHE A O   
903  C CB  . PHE A 135 ? 1.6038 1.9592 1.5020 0.2527  0.2026  0.4028  59   PHE A CB  
904  C CG  . PHE A 135 ? 1.6288 1.9566 1.5224 0.2458  0.1871  0.3990  59   PHE A CG  
905  C CD1 . PHE A 135 ? 1.7034 1.9787 1.5984 0.2361  0.1960  0.4140  59   PHE A CD1 
906  C CD2 . PHE A 135 ? 1.6294 1.9817 1.5150 0.2495  0.1644  0.3807  59   PHE A CD2 
907  C CE1 . PHE A 135 ? 1.7230 1.9681 1.6088 0.2310  0.1810  0.4100  59   PHE A CE1 
908  C CE2 . PHE A 135 ? 1.6705 1.9949 1.5483 0.2458  0.1513  0.3781  59   PHE A CE2 
909  C CZ  . PHE A 135 ? 1.6824 1.9519 1.5583 0.2374  0.1591  0.3925  59   PHE A CZ  
910  N N   . LEU A 136 ? 1.5989 1.9244 1.5727 0.2172  0.2462  0.4357  60   LEU A N   
911  C CA  . LEU A 136 ? 1.6240 1.9171 1.6270 0.2005  0.2668  0.4561  60   LEU A CA  
912  C C   . LEU A 136 ? 1.6404 1.9549 1.7069 0.1712  0.2642  0.4527  60   LEU A C   
913  O O   . LEU A 136 ? 1.6451 1.9362 1.7493 0.1470  0.2677  0.4618  60   LEU A O   
914  C CB  . LEU A 136 ? 1.6712 1.9501 1.6443 0.2239  0.2991  0.4779  60   LEU A CB  
915  C CG  . LEU A 136 ? 1.7893 2.0213 1.7121 0.2442  0.3133  0.4935  60   LEU A CG  
916  C CD1 . LEU A 136 ? 1.7901 2.0270 1.6635 0.2675  0.2938  0.4798  60   LEU A CD1 
917  C CD2 . LEU A 136 ? 1.8672 2.0870 1.7619 0.2680  0.3466  0.5148  60   LEU A CD2 
918  N N   . VAL A 137 ? 1.5560 1.9137 1.6337 0.1732  0.2575  0.4395  61   VAL A N   
919  C CA  . VAL A 137 ? 1.5158 1.8954 1.6499 0.1493  0.2555  0.4364  61   VAL A CA  
920  C C   . VAL A 137 ? 1.5231 1.9020 1.6878 0.1244  0.2265  0.4189  61   VAL A C   
921  O O   . VAL A 137 ? 1.5107 1.8892 1.7255 0.1000  0.2246  0.4216  61   VAL A O   
922  C CB  . VAL A 137 ? 1.5384 1.9581 1.6706 0.1602  0.2592  0.4287  61   VAL A CB  
923  C CG1 . VAL A 137 ? 1.5726 1.9891 1.6819 0.1823  0.2900  0.4485  61   VAL A CG1 
924  C CG2 . VAL A 137 ? 1.5098 1.9529 1.6092 0.1723  0.2370  0.4053  61   VAL A CG2 
925  N N   . ASN A 138 ? 1.4509 1.8291 1.5855 0.1317  0.2047  0.4023  62   ASN A N   
926  C CA  . ASN A 138 ? 1.4164 1.7884 1.5713 0.1126  0.1785  0.3866  62   ASN A CA  
927  C C   . ASN A 138 ? 1.5054 1.8301 1.6607 0.1021  0.1767  0.3965  62   ASN A C   
928  O O   . ASN A 138 ? 1.4822 1.7944 1.6642 0.0816  0.1585  0.3881  62   ASN A O   
929  C CB  . ASN A 138 ? 1.3573 1.7478 1.4812 0.1248  0.1585  0.3663  62   ASN A CB  
930  C CG  . ASN A 138 ? 1.4074 1.8399 1.5388 0.1263  0.1539  0.3518  62   ASN A CG  
931  O OD1 . ASN A 138 ? 1.2510 1.6965 1.4199 0.1087  0.1476  0.3446  62   ASN A OD1 
932  N ND2 . ASN A 138 ? 1.2886 1.7423 1.3827 0.1471  0.1540  0.3450  62   ASN A ND2 
933  N N   . ILE A 139 ? 1.5207 1.8161 1.6442 0.1167  0.1961  0.4144  63   ILE A N   
934  C CA  . ILE A 139 ? 1.5652 1.8089 1.6834 0.1077  0.1987  0.4261  63   ILE A CA  
935  C C   . ILE A 139 ? 1.6311 1.8656 1.8078 0.0770  0.2046  0.4355  63   ILE A C   
936  O O   . ILE A 139 ? 1.6347 1.8386 1.8288 0.0565  0.1907  0.4331  63   ILE A O   
937  C CB  . ILE A 139 ? 1.6556 1.8699 1.7219 0.1334  0.2217  0.4442  63   ILE A CB  
938  C CG1 . ILE A 139 ? 1.6670 1.8764 1.6763 0.1595  0.2089  0.4346  63   ILE A CG1 
939  C CG2 . ILE A 139 ? 1.7151 1.8754 1.7876 0.1194  0.2368  0.4635  63   ILE A CG2 
940  C CD1 . ILE A 139 ? 1.7764 1.9515 1.7757 0.1505  0.1852  0.4248  63   ILE A CD1 
941  N N   . VAL A 140 ? 1.5908 1.8534 1.7978 0.0744  0.2240  0.4455  64   VAL A N   
942  C CA  . VAL A 140 ? 1.5970 1.8607 1.8647 0.0470  0.2326  0.4562  64   VAL A CA  
943  C C   . VAL A 140 ? 1.6090 1.8934 1.9225 0.0234  0.2041  0.4373  64   VAL A C   
944  O O   . VAL A 140 ? 1.6105 1.8789 1.9653 -0.0028 0.1971  0.4401  64   VAL A O   
945  C CB  . VAL A 140 ? 1.6507 1.9435 1.9353 0.0554  0.2619  0.4719  64   VAL A CB  
946  C CG1 . VAL A 140 ? 1.6502 1.9503 2.0029 0.0272  0.2719  0.4842  64   VAL A CG1 
947  C CG2 . VAL A 140 ? 1.6957 1.9648 1.9311 0.0812  0.2902  0.4906  64   VAL A CG2 
948  N N   . VAL A 141 ? 1.5303 1.8473 1.8336 0.0329  0.1873  0.4178  65   VAL A N   
949  C CA  . VAL A 141 ? 1.4912 1.8285 1.8300 0.0158  0.1620  0.3993  65   VAL A CA  
950  C C   . VAL A 141 ? 1.5599 1.8611 1.8900 0.0045  0.1356  0.3876  65   VAL A C   
951  O O   . VAL A 141 ? 1.5479 1.8437 1.9193 -0.0186 0.1206  0.3829  65   VAL A O   
952  C CB  . VAL A 141 ? 1.4992 1.8756 1.8211 0.0312  0.1549  0.3827  65   VAL A CB  
953  C CG1 . VAL A 141 ? 1.4602 1.8522 1.8116 0.0162  0.1298  0.3633  65   VAL A CG1 
954  C CG2 . VAL A 141 ? 1.4927 1.9002 1.8208 0.0423  0.1793  0.3933  65   VAL A CG2 
955  N N   . VAL A 142 ? 1.5411 1.8188 1.8171 0.0224  0.1296  0.3828  66   VAL A N   
956  C CA  . VAL A 142 ? 1.5554 1.7958 1.8133 0.0172  0.1063  0.3725  66   VAL A CA  
957  C C   . VAL A 142 ? 1.6609 1.8560 1.9376 -0.0035 0.1078  0.3848  66   VAL A C   
958  O O   . VAL A 142 ? 1.6513 1.8295 1.9516 -0.0231 0.0860  0.3753  66   VAL A O   
959  C CB  . VAL A 142 ? 1.6188 1.8451 1.8136 0.0440  0.1048  0.3691  66   VAL A CB  
960  C CG1 . VAL A 142 ? 1.6394 1.8196 1.8108 0.0411  0.0850  0.3627  66   VAL A CG1 
961  C CG2 . VAL A 142 ? 1.5757 1.8465 1.7564 0.0598  0.0988  0.3540  66   VAL A CG2 
962  N N   . THR A 143 ? 1.6736 1.8479 1.9387 0.0007  0.1333  0.4055  67   THR A N   
963  C CA  . THR A 143 ? 1.7255 1.8526 2.0042 -0.0192 0.1388  0.4190  67   THR A CA  
964  C C   . THR A 143 ? 1.7766 1.9221 2.1288 -0.0512 0.1366  0.4216  67   THR A C   
965  O O   . THR A 143 ? 1.8016 1.9112 2.1750 -0.0749 0.1289  0.4249  67   THR A O   
966  C CB  . THR A 143 ? 1.8665 1.9685 2.1132 -0.0047 0.1705  0.4414  67   THR A CB  
967  O OG1 . THR A 143 ? 1.8341 1.9787 2.1006 0.0030  0.1944  0.4519  67   THR A OG1 
968  C CG2 . THR A 143 ? 1.8649 1.9418 2.0382 0.0265  0.1714  0.4403  67   THR A CG2 
969  N N   . LEU A 144 ? 1.7021 1.9029 2.0918 -0.0513 0.1431  0.4202  68   LEU A N   
970  C CA  . LEU A 144 ? 1.6895 1.9189 2.1506 -0.0773 0.1420  0.4228  68   LEU A CA  
971  C C   . LEU A 144 ? 1.7318 1.9582 2.2181 -0.0959 0.1064  0.4026  68   LEU A C   
972  O O   . LEU A 144 ? 1.7382 1.9526 2.2689 -0.1229 0.0976  0.4050  68   LEU A O   
973  C CB  . LEU A 144 ? 1.6522 1.9394 2.1338 -0.0655 0.1578  0.4251  68   LEU A CB  
974  C CG  . LEU A 144 ? 1.6935 2.0214 2.2480 -0.0858 0.1608  0.4295  68   LEU A CG  
975  C CD1 . LEU A 144 ? 1.6829 2.0510 2.2431 -0.0694 0.1892  0.4417  68   LEU A CD1 
976  C CD2 . LEU A 144 ? 1.6871 2.0360 2.2692 -0.0970 0.1285  0.4073  68   LEU A CD2 
977  N N   . PHE A 145 ? 1.6719 1.9088 2.1292 -0.0811 0.0864  0.3828  69   PHE A N   
978  C CA  . PHE A 145 ? 1.6563 1.8919 2.1275 -0.0917 0.0534  0.3620  69   PHE A CA  
979  C C   . PHE A 145 ? 1.7640 1.9425 2.2243 -0.1066 0.0332  0.3583  69   PHE A C   
980  O O   . PHE A 145 ? 1.7570 1.9328 2.2501 -0.1252 0.0087  0.3468  69   PHE A O   
981  C CB  . PHE A 145 ? 1.6450 1.8945 2.0733 -0.0683 0.0425  0.3448  69   PHE A CB  
982  C CG  . PHE A 145 ? 1.6416 1.8904 2.0762 -0.0737 0.0114  0.3231  69   PHE A CG  
983  C CD1 . PHE A 145 ? 1.6406 1.9316 2.1106 -0.0774 0.0045  0.3132  69   PHE A CD1 
984  C CD2 . PHE A 145 ? 1.6879 1.8916 2.0876 -0.0718 -0.0098 0.3130  69   PHE A CD2 
985  C CE1 . PHE A 145 ? 1.6348 1.9221 2.1063 -0.0799 -0.0230 0.2935  69   PHE A CE1 
986  C CE2 . PHE A 145 ? 1.7063 1.9063 2.1082 -0.0743 -0.0373 0.2936  69   PHE A CE2 
987  C CZ  . PHE A 145 ? 1.6439 1.8857 2.0814 -0.0782 -0.0436 0.2838  69   PHE A CZ  
988  N N   . CYS A 146 ? 1.7704 1.9023 2.1812 -0.0966 0.0420  0.3669  70   CYS A N   
989  C CA  . CYS A 146 ? 1.8142 1.8856 2.2009 -0.1058 0.0224  0.3619  70   CYS A CA  
990  C C   . CYS A 146 ? 1.9255 1.9645 2.3457 -0.1342 0.0290  0.3762  70   CYS A C   
991  O O   . CYS A 146 ? 1.9319 1.9535 2.3823 -0.1580 0.0050  0.3671  70   CYS A O   
992  C CB  . CYS A 146 ? 1.8401 1.8747 2.1523 -0.0787 0.0275  0.3634  70   CYS A CB  
993  S SG  . CYS A 146 ? 1.8385 1.9057 2.1120 -0.0489 0.0166  0.3455  70   CYS A SG  
994  N N   . CYS A 147 ? 1.9257 1.9522 2.3366 -0.1313 0.0602  0.3976  71   CYS A N   
995  C CA  . CYS A 147 ? 1.9827 1.9688 2.4156 -0.1571 0.0695  0.4124  71   CYS A CA  
996  C C   . CYS A 147 ? 2.0237 2.0553 2.5349 -0.1812 0.0847  0.4243  71   CYS A C   
997  O O   . CYS A 147 ? 2.0573 2.0641 2.6045 -0.2104 0.0861  0.4330  71   CYS A O   
998  C CB  . CYS A 147 ? 2.0368 1.9775 2.4120 -0.1395 0.0967  0.4302  71   CYS A CB  
999  S SG  . CYS A 147 ? 2.1139 1.9971 2.3976 -0.1111 0.0812  0.4197  71   CYS A SG  
1000 N N   . GLN A 148 ? 1.9318 2.0276 2.4694 -0.1697 0.0961  0.4250  72   GLN A N   
1001 C CA  . GLN A 148 ? 1.9175 2.0577 2.5270 -0.1888 0.1135  0.4385  72   GLN A CA  
1002 C C   . GLN A 148 ? 1.9122 2.1128 2.5744 -0.1951 0.0937  0.4235  72   GLN A C   
1003 O O   . GLN A 148 ? 1.8887 2.1365 2.6055 -0.2029 0.1104  0.4345  72   GLN A O   
1004 C CB  . GLN A 148 ? 1.9332 2.0936 2.5293 -0.1684 0.1541  0.4596  72   GLN A CB  
1005 C CG  . GLN A 148 ? 2.0897 2.1939 2.6417 -0.1627 0.1793  0.4784  72   GLN A CG  
1006 C CD  . GLN A 148 ? 2.2538 2.3775 2.8032 -0.1465 0.2207  0.5016  72   GLN A CD  
1007 O OE1 . GLN A 148 ? 2.2136 2.3049 2.7047 -0.1237 0.2414  0.5127  72   GLN A OE1 
1008 N NE2 . GLN A 148 ? 2.0984 2.2747 2.7085 -0.1558 0.2340  0.5098  72   GLN A NE2 
1009 N N   . LYS A 149 ? 1.8452 2.0422 2.4913 -0.1915 0.0596  0.3997  73   LYS A N   
1010 C CA  . LYS A 149 ? 1.7962 2.0439 2.4875 -0.1965 0.0404  0.3852  73   LYS A CA  
1011 C C   . LYS A 149 ? 1.8518 2.0717 2.5355 -0.2057 -0.0005 0.3623  73   LYS A C   
1012 O O   . LYS A 149 ? 1.8641 2.0744 2.5915 -0.2331 -0.0181 0.3598  73   LYS A O   
1013 C CB  . LYS A 149 ? 1.7790 2.0698 2.4475 -0.1677 0.0510  0.3805  73   LYS A CB  
1014 C CG  . LYS A 149 ? 1.8779 2.2229 2.5944 -0.1712 0.0384  0.3696  73   LYS A CG  
1015 C CD  . LYS A 149 ? 1.9320 2.3131 2.6211 -0.1438 0.0487  0.3639  73   LYS A CD  
1016 C CE  . LYS A 149 ? 2.0017 2.3610 2.6288 -0.1243 0.0315  0.3449  73   LYS A CE  
1017 N NZ  . LYS A 149 ? 2.0744 2.4236 2.7093 -0.1327 -0.0034 0.3241  73   LYS A NZ  
1018 N N   . GLY A 150 ? 1.7973 2.0047 2.4260 -0.1828 -0.0148 0.3461  74   GLY A N   
1019 C CA  . GLY A 150 ? 1.7997 1.9789 2.4107 -0.1848 -0.0512 0.3244  74   GLY A CA  
1020 C C   . GLY A 150 ? 1.8041 2.0040 2.3832 -0.1604 -0.0620 0.3072  74   GLY A C   
1021 O O   . GLY A 150 ? 1.7657 2.0051 2.3400 -0.1438 -0.0425 0.3109  74   GLY A O   
1022 N N   . PRO A 151 ? 1.7571 1.9292 2.3132 -0.1578 -0.0931 0.2877  75   PRO A N   
1023 C CA  . PRO A 151 ? 1.7121 1.9004 2.2362 -0.1349 -0.1014 0.2718  75   PRO A CA  
1024 C C   . PRO A 151 ? 1.6981 1.9281 2.2658 -0.1398 -0.1169 0.2591  75   PRO A C   
1025 O O   . PRO A 151 ? 1.6761 1.9048 2.2191 -0.1260 -0.1327 0.2423  75   PRO A O   
1026 C CB  . PRO A 151 ? 1.7663 1.8959 2.2364 -0.1269 -0.1236 0.2600  75   PRO A CB  
1027 C CG  . PRO A 151 ? 1.8751 1.9609 2.3621 -0.1512 -0.1369 0.2642  75   PRO A CG  
1028 C CD  . PRO A 151 ? 1.8188 1.9385 2.3703 -0.1740 -0.1208 0.2795  75   PRO A CD  
1029 N N   . LYS A 152 ? 1.6174 1.8852 2.2488 -0.1578 -0.1102 0.2680  76   LYS A N   
1030 C CA  . LYS A 152 ? 1.5693 1.8807 2.2460 -0.1615 -0.1228 0.2584  76   LYS A CA  
1031 C C   . LYS A 152 ? 1.5467 1.9062 2.2211 -0.1429 -0.1002 0.2610  76   LYS A C   
1032 O O   . LYS A 152 ? 1.5398 1.9025 2.1870 -0.1311 -0.0745 0.2720  76   LYS A O   
1033 C CB  . LYS A 152 ? 1.6072 1.9403 2.3563 -0.1891 -0.1265 0.2673  76   LYS A CB  
1034 C CG  . LYS A 152 ? 1.7485 2.0363 2.5044 -0.2098 -0.1565 0.2593  76   LYS A CG  
1035 C CD  . LYS A 152 ? 1.8474 2.1578 2.6792 -0.2408 -0.1603 0.2684  76   LYS A CD  
1036 C CE  . LYS A 152 ? 1.9648 2.2759 2.8171 -0.2544 -0.1282 0.2931  76   LYS A CE  
1037 N NZ  . LYS A 152 ? 2.1018 2.3454 2.9014 -0.2563 -0.1258 0.2973  76   LYS A NZ  
1038 N N   . LYS A 153 ? 1.4473 1.8405 2.1456 -0.1388 -0.1115 0.2495  77   LYS A N   
1039 C CA  . LYS A 153 ? 1.3944 1.8291 2.0897 -0.1214 -0.0959 0.2478  77   LYS A CA  
1040 C C   . LYS A 153 ? 1.3920 1.8059 2.0216 -0.0996 -0.0962 0.2351  77   LYS A C   
1041 O O   . LYS A 153 ? 1.4022 1.7765 1.9906 -0.0963 -0.1001 0.2335  77   LYS A O   
1042 C CB  . LYS A 153 ? 1.4190 1.8898 2.1371 -0.1208 -0.0619 0.2684  77   LYS A CB  
1043 C CG  . LYS A 153 ? 1.6112 2.1138 2.4010 -0.1407 -0.0572 0.2823  77   LYS A CG  
1044 C CD  . LYS A 153 ? 1.7285 2.2713 2.5383 -0.1343 -0.0223 0.3016  77   LYS A CD  
1045 C CE  . LYS A 153 ? 1.8446 2.4216 2.6452 -0.1146 -0.0160 0.2943  77   LYS A CE  
1046 N NZ  . LYS A 153 ? 1.9667 2.5764 2.7772 -0.1053 0.0180  0.3127  77   LYS A NZ  
1047 N N   . VAL A 154 ? 1.2936 1.7336 1.9137 -0.0849 -0.0920 0.2262  78   VAL A N   
1048 C CA  . VAL A 154 ? 1.2656 1.6891 1.8287 -0.0666 -0.0922 0.2134  78   VAL A CA  
1049 C C   . VAL A 154 ? 1.2685 1.7083 1.8075 -0.0560 -0.0635 0.2236  78   VAL A C   
1050 O O   . VAL A 154 ? 1.2658 1.6842 1.7604 -0.0470 -0.0603 0.2212  78   VAL A O   
1051 C CB  . VAL A 154 ? 1.2963 1.7306 1.8554 -0.0566 -0.1045 0.1964  78   VAL A CB  
1052 C CG1 . VAL A 154 ? 1.2826 1.6989 1.7848 -0.0400 -0.1027 0.1839  78   VAL A CG1 
1053 C CG2 . VAL A 154 ? 1.3087 1.7269 1.8894 -0.0647 -0.1345 0.1858  78   VAL A CG2 
1054 N N   . SER A 155 ? 1.1897 1.6674 1.7575 -0.0560 -0.0431 0.2351  79   SER A N   
1055 C CA  . SER A 155 ? 1.1671 1.6617 1.7137 -0.0450 -0.0162 0.2449  79   SER A CA  
1056 C C   . SER A 155 ? 1.1948 1.6697 1.7254 -0.0469 -0.0050 0.2586  79   SER A C   
1057 O O   . SER A 155 ? 1.1830 1.6572 1.6752 -0.0341 0.0085  0.2601  79   SER A O   
1058 C CB  . SER A 155 ? 1.2094 1.7440 1.7933 -0.0449 0.0023  0.2565  79   SER A CB  
1059 O OG  . SER A 155 ? 1.3545 1.8982 1.9901 -0.0608 0.0044  0.2714  79   SER A OG  
1060 N N   . SER A 156 ? 1.1478 1.6053 1.7061 -0.0627 -0.0112 0.2679  80   SER A N   
1061 C CA  . SER A 156 ? 1.1601 1.5921 1.7032 -0.0654 -0.0008 0.2818  80   SER A CA  
1062 C C   . SER A 156 ? 1.1924 1.5881 1.6801 -0.0548 -0.0114 0.2721  80   SER A C   
1063 O O   . SER A 156 ? 1.2017 1.5829 1.6601 -0.0473 0.0022  0.2821  80   SER A O   
1064 C CB  . SER A 156 ? 1.2289 1.6466 1.8151 -0.0874 -0.0080 0.2913  80   SER A CB  
1065 O OG  . SER A 156 ? 1.3214 1.7764 1.9631 -0.0973 0.0044  0.3029  80   SER A OG  
1066 N N   . ILE A 157 ? 1.1229 1.5043 1.5952 -0.0525 -0.0346 0.2536  81   ILE A N   
1067 C CA  . ILE A 157 ? 1.1189 1.4680 1.5406 -0.0412 -0.0448 0.2444  81   ILE A CA  
1068 C C   . ILE A 157 ? 1.1396 1.5094 1.5258 -0.0233 -0.0294 0.2419  81   ILE A C   
1069 O O   . ILE A 157 ? 1.1519 1.5065 1.5009 -0.0127 -0.0241 0.2451  81   ILE A O   
1070 C CB  . ILE A 157 ? 1.1539 1.4811 1.5694 -0.0424 -0.0723 0.2261  81   ILE A CB  
1071 C CG1 . ILE A 157 ? 1.1740 1.4877 1.6308 -0.0613 -0.0908 0.2261  81   ILE A CG1 
1072 C CG2 . ILE A 157 ? 1.1758 1.4670 1.5392 -0.0298 -0.0813 0.2189  81   ILE A CG2 
1073 C CD1 . ILE A 157 ? 1.2953 1.5762 1.7592 -0.0749 -0.0918 0.2390  81   ILE A CD1 
1074 N N   . TYR A 158 ? 1.0574 1.4619 1.4547 -0.0197 -0.0219 0.2366  82   TYR A N   
1075 C CA  . TYR A 158 ? 1.0350 1.4602 1.4011 -0.0052 -0.0083 0.2329  82   TYR A CA  
1076 C C   . TYR A 158 ? 1.0923 1.5277 1.4509 0.0007  0.0139  0.2498  82   TYR A C   
1077 O O   . TYR A 158 ? 1.0949 1.5338 1.4173 0.0137  0.0207  0.2484  82   TYR A O   
1078 C CB  . TYR A 158 ? 1.0231 1.4769 1.4006 -0.0035 -0.0052 0.2236  82   TYR A CB  
1079 C CG  . TYR A 158 ? 1.0330 1.4763 1.4150 -0.0065 -0.0252 0.2072  82   TYR A CG  
1080 C CD1 . TYR A 158 ? 1.0543 1.4800 1.4013 0.0007  -0.0360 0.1928  82   TYR A CD1 
1081 C CD2 . TYR A 158 ? 1.0356 1.4896 1.4558 -0.0144 -0.0314 0.2062  82   TYR A CD2 
1082 C CE1 . TYR A 158 ? 1.0556 1.4679 1.4024 0.0003  -0.0527 0.1783  82   TYR A CE1 
1083 C CE2 . TYR A 158 ? 1.0395 1.4829 1.4599 -0.0142 -0.0497 0.1908  82   TYR A CE2 
1084 C CZ  . TYR A 158 ? 1.1196 1.5399 1.5014 -0.0065 -0.0599 0.1769  82   TYR A CZ  
1085 O OH  . TYR A 158 ? 1.1134 1.5194 1.4917 -0.0042 -0.0766 0.1625  82   TYR A OH  
1086 N N   . ILE A 159 ? 1.0492 1.4892 1.4421 -0.0085 0.0251  0.2661  83   ILE A N   
1087 C CA  . ILE A 159 ? 1.0575 1.5021 1.4444 -0.0026 0.0483  0.2846  83   ILE A CA  
1088 C C   . ILE A 159 ? 1.1051 1.5183 1.4549 0.0046  0.0470  0.2890  83   ILE A C   
1089 O O   . ILE A 159 ? 1.1028 1.5220 1.4197 0.0202  0.0604  0.2939  83   ILE A O   
1090 C CB  . ILE A 159 ? 1.1115 1.5625 1.5471 -0.0165 0.0600  0.3020  83   ILE A CB  
1091 C CG1 . ILE A 159 ? 1.0976 1.5823 1.5726 -0.0219 0.0617  0.2993  83   ILE A CG1 
1092 C CG2 . ILE A 159 ? 1.1465 1.5969 1.5722 -0.0088 0.0864  0.3225  83   ILE A CG2 
1093 C CD1 . ILE A 159 ? 1.2137 1.7278 1.6726 -0.0068 0.0782  0.2984  83   ILE A CD1 
1094 N N   . PHE A 160 ? 1.0590 1.4380 1.4122 -0.0053 0.0304  0.2871  84   PHE A N   
1095 C CA  . PHE A 160 ? 1.0779 1.4209 1.3947 0.0018  0.0282  0.2917  84   PHE A CA  
1096 C C   . PHE A 160 ? 1.1113 1.4590 1.3817 0.0208  0.0236  0.2801  84   PHE A C   
1097 O O   . PHE A 160 ? 1.1278 1.4719 1.3646 0.0360  0.0347  0.2876  84   PHE A O   
1098 C CB  . PHE A 160 ? 1.1177 1.4209 1.4455 -0.0129 0.0083  0.2889  84   PHE A CB  
1099 C CG  . PHE A 160 ? 1.1739 1.4335 1.4613 -0.0051 0.0067  0.2947  84   PHE A CG  
1100 C CD1 . PHE A 160 ? 1.2521 1.4892 1.5377 -0.0081 0.0222  0.3131  84   PHE A CD1 
1101 C CD2 . PHE A 160 ? 1.2030 1.4416 1.4524 0.0063  -0.0091 0.2827  84   PHE A CD2 
1102 C CE1 . PHE A 160 ? 1.3031 1.4959 1.5462 0.0012  0.0217  0.3188  84   PHE A CE1 
1103 C CE2 . PHE A 160 ? 1.2756 1.4730 1.4844 0.0164  -0.0097 0.2890  84   PHE A CE2 
1104 C CZ  . PHE A 160 ? 1.2894 1.4631 1.4938 0.0141  0.0053  0.3067  84   PHE A CZ  
1105 N N   . ASN A 161 ? 1.0247 1.3821 1.2944 0.0205  0.0082  0.2622  85   ASN A N   
1106 C CA  . ASN A 161 ? 1.0010 1.3663 1.2339 0.0354  0.0035  0.2503  85   ASN A CA  
1107 C C   . ASN A 161 ? 1.0319 1.4338 1.2512 0.0472  0.0200  0.2516  85   ASN A C   
1108 O O   . ASN A 161 ? 1.0301 1.4381 1.2159 0.0617  0.0215  0.2490  85   ASN A O   
1109 C CB  . ASN A 161 ? 0.9707 1.3371 1.2098 0.0306  -0.0135 0.2323  85   ASN A CB  
1110 C CG  . ASN A 161 ? 1.1676 1.4939 1.4054 0.0249  -0.0328 0.2280  85   ASN A CG  
1111 O OD1 . ASN A 161 ? 1.0704 1.3709 1.2759 0.0345  -0.0389 0.2275  85   ASN A OD1 
1112 N ND2 . ASN A 161 ? 1.0523 1.3733 1.3225 0.0110  -0.0440 0.2233  85   ASN A ND2 
1113 N N   . LEU A 162 ? 0.9767 1.4031 1.2211 0.0419  0.0320  0.2559  86   LEU A N   
1114 C CA  . LEU A 162 ? 0.9693 1.4266 1.1991 0.0534  0.0477  0.2576  86   LEU A CA  
1115 C C   . LEU A 162 ? 1.0523 1.5023 1.2607 0.0659  0.0625  0.2741  86   LEU A C   
1116 O O   . LEU A 162 ? 1.0513 1.5162 1.2277 0.0816  0.0674  0.2721  86   LEU A O   
1117 C CB  . LEU A 162 ? 0.9555 1.4353 1.2152 0.0464  0.0575  0.2592  86   LEU A CB  
1118 C CG  . LEU A 162 ? 1.0143 1.5217 1.2575 0.0585  0.0741  0.2613  86   LEU A CG  
1119 C CD1 . LEU A 162 ? 1.0064 1.5292 1.2181 0.0667  0.0668  0.2442  86   LEU A CD1 
1120 C CD2 . LEU A 162 ? 1.0309 1.5552 1.3031 0.0527  0.0837  0.2644  86   LEU A CD2 
1121 N N   . ALA A 163 ? 1.0326 1.4582 1.2576 0.0588  0.0690  0.2900  87   ALA A N   
1122 C CA  . ALA A 163 ? 1.0579 1.4685 1.2619 0.0701  0.0851  0.3076  87   ALA A CA  
1123 C C   . ALA A 163 ? 1.1100 1.5018 1.2718 0.0847  0.0775  0.3052  87   ALA A C   
1124 O O   . ALA A 163 ? 1.1162 1.5135 1.2459 0.1035  0.0890  0.3123  87   ALA A O   
1125 C CB  . ALA A 163 ? 1.0896 1.4741 1.3239 0.0551  0.0922  0.3235  87   ALA A CB  
1126 N N   . VAL A 164 ? 1.0622 1.4331 1.2221 0.0783  0.0581  0.2950  88   VAL A N   
1127 C CA  . VAL A 164 ? 1.0769 1.4300 1.1972 0.0932  0.0501  0.2923  88   VAL A CA  
1128 C C   . VAL A 164 ? 1.1178 1.5095 1.2147 0.1090  0.0492  0.2809  88   VAL A C   
1129 O O   . VAL A 164 ? 1.1359 1.5321 1.1991 0.1286  0.0552  0.2861  88   VAL A O   
1130 C CB  . VAL A 164 ? 1.1235 1.4437 1.2473 0.0832  0.0299  0.2837  88   VAL A CB  
1131 C CG1 . VAL A 164 ? 1.1275 1.4371 1.2102 0.1012  0.0217  0.2788  88   VAL A CG1 
1132 C CG2 . VAL A 164 ? 1.1519 1.4299 1.2919 0.0689  0.0294  0.2953  88   VAL A CG2 
1133 N N   . ALA A 165 ? 1.0434 1.4633 1.1585 0.1005  0.0423  0.2657  89   ALA A N   
1134 C CA  . ALA A 165 ? 1.0243 1.4811 1.1226 0.1105  0.0407  0.2532  89   ALA A CA  
1135 C C   . ALA A 165 ? 1.0937 1.5754 1.1763 0.1242  0.0562  0.2607  89   ALA A C   
1136 O O   . ALA A 165 ? 1.0884 1.5915 1.1441 0.1398  0.0555  0.2565  89   ALA A O   
1137 C CB  . ALA A 165 ? 1.0009 1.4753 1.1221 0.0963  0.0332  0.2373  89   ALA A CB  
1138 N N   . ASP A 166 ? 1.0679 1.5473 1.1673 0.1196  0.0703  0.2722  90   ASP A N   
1139 C CA  . ASP A 166 ? 1.0833 1.5801 1.1656 0.1344  0.0869  0.2813  90   ASP A CA  
1140 C C   . ASP A 166 ? 1.1742 1.6534 1.2243 0.1535  0.0950  0.2956  90   ASP A C   
1141 O O   . ASP A 166 ? 1.1808 1.6805 1.2003 0.1731  0.0987  0.2949  90   ASP A O   
1142 C CB  . ASP A 166 ? 1.1071 1.6024 1.2169 0.1252  0.1018  0.2919  90   ASP A CB  
1143 C CG  . ASP A 166 ? 1.1934 1.7103 1.3274 0.1127  0.0981  0.2795  90   ASP A CG  
1144 O OD1 . ASP A 166 ? 1.1695 1.7105 1.2881 0.1169  0.0913  0.2641  90   ASP A OD1 
1145 O OD2 . ASP A 166 ? 1.2892 1.8003 1.4563 0.0999  0.1042  0.2863  90   ASP A OD2 
1146 N N   . LEU A 167 ? 1.1538 1.5939 1.2093 0.1480  0.0973  0.3082  91   LEU A N   
1147 C CA  . LEU A 167 ? 1.1947 1.6071 1.2180 0.1648  0.1063  0.3234  91   LEU A CA  
1148 C C   . LEU A 167 ? 1.2620 1.6866 1.2479 0.1852  0.0964  0.3156  91   LEU A C   
1149 O O   . LEU A 167 ? 1.2824 1.7161 1.2347 0.2085  0.1055  0.3226  91   LEU A O   
1150 C CB  . LEU A 167 ? 1.2144 1.5793 1.2527 0.1497  0.1045  0.3328  91   LEU A CB  
1151 C CG  . LEU A 167 ? 1.3247 1.6490 1.3339 0.1620  0.1178  0.3517  91   LEU A CG  
1152 C CD1 . LEU A 167 ? 1.3481 1.6714 1.3606 0.1659  0.1426  0.3690  91   LEU A CD1 
1153 C CD2 . LEU A 167 ? 1.3779 1.6546 1.4005 0.1440  0.1099  0.3556  91   LEU A CD2 
1154 N N   . LEU A 168 ? 1.1978 1.6260 1.1904 0.1774  0.0780  0.3011  92   LEU A N   
1155 C CA  . LEU A 168 ? 1.1948 1.6374 1.1583 0.1948  0.0682  0.2937  92   LEU A CA  
1156 C C   . LEU A 168 ? 1.2417 1.7371 1.1972 0.2052  0.0671  0.2824  92   LEU A C   
1157 O O   . LEU A 168 ? 1.2509 1.7649 1.1776 0.2262  0.0651  0.2819  92   LEU A O   
1158 C CB  . LEU A 168 ? 1.1727 1.6032 1.1473 0.1832  0.0510  0.2820  92   LEU A CB  
1159 C CG  . LEU A 168 ? 1.2487 1.6242 1.2228 0.1757  0.0471  0.2903  92   LEU A CG  
1160 C CD1 . LEU A 168 ? 1.2257 1.5922 1.2108 0.1649  0.0298  0.2767  92   LEU A CD1 
1161 C CD2 . LEU A 168 ? 1.3239 1.6705 1.2564 0.1981  0.0535  0.3044  92   LEU A CD2 
1162 N N   . LEU A 169 ? 1.1805 1.6998 1.1607 0.1909  0.0677  0.2732  93   LEU A N   
1163 C CA  . LEU A 169 ? 1.1692 1.7344 1.1419 0.1974  0.0658  0.2612  93   LEU A CA  
1164 C C   . LEU A 169 ? 1.2640 1.8381 1.2074 0.2203  0.0788  0.2724  93   LEU A C   
1165 O O   . LEU A 169 ? 1.2643 1.8706 1.1847 0.2373  0.0743  0.2662  93   LEU A O   
1166 C CB  . LEU A 169 ? 1.1430 1.7211 1.1446 0.1769  0.0649  0.2501  93   LEU A CB  
1167 C CG  . LEU A 169 ? 1.1945 1.8139 1.1884 0.1797  0.0623  0.2358  93   LEU A CG  
1168 C CD1 . LEU A 169 ? 1.1807 1.8279 1.1691 0.1801  0.0474  0.2197  93   LEU A CD1 
1169 C CD2 . LEU A 169 ? 1.2160 1.8372 1.2338 0.1614  0.0646  0.2283  93   LEU A CD2 
1170 N N   . LEU A 170 ? 1.2496 1.7951 1.1943 0.2212  0.0951  0.2894  94   LEU A N   
1171 C CA  . LEU A 170 ? 1.2821 1.8264 1.1971 0.2440  0.1112  0.3032  94   LEU A CA  
1172 C C   . LEU A 170 ? 1.3672 1.8970 1.2455 0.2681  0.1129  0.3135  94   LEU A C   
1173 O O   . LEU A 170 ? 1.3850 1.9258 1.2297 0.2934  0.1207  0.3195  94   LEU A O   
1174 C CB  . LEU A 170 ? 1.2980 1.8126 1.2293 0.2356  0.1302  0.3200  94   LEU A CB  
1175 C CG  . LEU A 170 ? 1.3317 1.8617 1.2937 0.2184  0.1333  0.3138  94   LEU A CG  
1176 C CD1 . LEU A 170 ? 1.3431 1.8436 1.3333 0.2045  0.1485  0.3299  94   LEU A CD1 
1177 C CD2 . LEU A 170 ? 1.3673 1.9272 1.3061 0.2347  0.1387  0.3091  94   LEU A CD2 
1178 N N   . ALA A 171 ? 1.3305 1.8350 1.2117 0.2624  0.1049  0.3147  95   ALA A N   
1179 C CA  . ALA A 171 ? 1.3625 1.8481 1.2070 0.2855  0.1060  0.3243  95   ALA A CA  
1180 C C   . ALA A 171 ? 1.4107 1.9423 1.2324 0.3064  0.0940  0.3128  95   ALA A C   
1181 O O   . ALA A 171 ? 1.4357 1.9601 1.2225 0.3314  0.0959  0.3211  95   ALA A O   
1182 C CB  . ALA A 171 ? 1.3734 1.8177 1.2272 0.2721  0.0992  0.3269  95   ALA A CB  
1183 N N   . THR A 172 ? 1.3345 1.9132 1.1757 0.2964  0.0822  0.2942  96   THR A N   
1184 C CA  . THR A 172 ? 1.3222 1.9504 1.1492 0.3122  0.0699  0.2820  96   THR A CA  
1185 C C   . THR A 172 ? 1.3953 2.0554 1.1991 0.3322  0.0745  0.2813  96   THR A C   
1186 O O   . THR A 172 ? 1.3947 2.0953 1.1807 0.3510  0.0654  0.2742  96   THR A O   
1187 C CB  . THR A 172 ? 1.3161 1.9760 1.1757 0.2893  0.0541  0.2613  96   THR A CB  
1188 O OG1 . THR A 172 ? 1.2696 1.9398 1.1511 0.2701  0.0554  0.2522  96   THR A OG1 
1189 C CG2 . THR A 172 ? 1.2539 1.8839 1.1310 0.2738  0.0481  0.2607  96   THR A CG2 
1190 N N   . LEU A 173 ? 1.3675 2.0098 1.1709 0.3295  0.0885  0.2891  97   LEU A N   
1191 C CA  . LEU A 173 ? 1.3877 2.0515 1.1653 0.3494  0.0945  0.2896  97   LEU A CA  
1192 C C   . LEU A 173 ? 1.4887 2.1559 1.2199 0.3872  0.0986  0.3003  97   LEU A C   
1193 O O   . LEU A 173 ? 1.4904 2.1993 1.2027 0.4047  0.0903  0.2907  97   LEU A O   
1194 C CB  . LEU A 173 ? 1.4002 2.0334 1.1823 0.3433  0.1134  0.3016  97   LEU A CB  
1195 C CG  . LEU A 173 ? 1.4233 2.0662 1.2412 0.3150  0.1102  0.2895  97   LEU A CG  
1196 C CD1 . LEU A 173 ? 1.4381 2.0476 1.2652 0.3091  0.1309  0.3051  97   LEU A CD1 
1197 C CD2 . LEU A 173 ? 1.4472 2.1351 1.2558 0.3193  0.0987  0.2710  97   LEU A CD2 
1198 N N   . PRO A 174 ? 1.4825 2.1087 1.1927 0.4013  0.1094  0.3185  98   PRO A N   
1199 C CA  . PRO A 174 ? 1.5252 2.1564 1.1871 0.4403  0.1132  0.3278  98   PRO A CA  
1200 C C   . PRO A 174 ? 1.5694 2.2578 1.2271 0.4531  0.0925  0.3123  98   PRO A C   
1201 O O   . PRO A 174 ? 1.5936 2.3106 1.2179 0.4838  0.0903  0.3123  98   PRO A O   
1202 C CB  . PRO A 174 ? 1.5758 2.1490 1.2221 0.4455  0.1258  0.3470  98   PRO A CB  
1203 C CG  . PRO A 174 ? 1.6160 2.1495 1.2973 0.4128  0.1348  0.3520  98   PRO A CG  
1204 C CD  . PRO A 174 ? 1.5052 2.0766 1.2306 0.3839  0.1186  0.3312  98   PRO A CD  
1205 N N   . LEU A 175 ? 1.4880 2.1951 1.1806 0.4296  0.0774  0.2989  99   LEU A N   
1206 C CA  . LEU A 175 ? 1.4688 2.2328 1.1665 0.4367  0.0587  0.2842  99   LEU A CA  
1207 C C   . LEU A 175 ? 1.5150 2.3360 1.2213 0.4338  0.0462  0.2656  99   LEU A C   
1208 O O   . LEU A 175 ? 1.5197 2.3870 1.2081 0.4572  0.0363  0.2599  99   LEU A O   
1209 C CB  . LEU A 175 ? 1.4305 2.1942 1.1641 0.4105  0.0487  0.2756  99   LEU A CB  
1210 C CG  . LEU A 175 ? 1.5034 2.2164 1.2279 0.4135  0.0553  0.2900  99   LEU A CG  
1211 C CD1 . LEU A 175 ? 1.4676 2.1790 1.2286 0.3854  0.0453  0.2793  99   LEU A CD1 
1212 C CD2 . LEU A 175 ? 1.5666 2.2884 1.2521 0.4508  0.0558  0.3000  99   LEU A CD2 
1213 N N   . TRP A 176 ? 1.4603 2.2787 1.1933 0.4055  0.0459  0.2554  100  TRP A N   
1214 C CA  . TRP A 176 ? 1.4528 2.3188 1.1930 0.3990  0.0332  0.2360  100  TRP A CA  
1215 C C   . TRP A 176 ? 1.5526 2.4249 1.2520 0.4291  0.0387  0.2413  100  TRP A C   
1216 O O   . TRP A 176 ? 1.5585 2.4792 1.2496 0.4380  0.0242  0.2265  100  TRP A O   
1217 C CB  . TRP A 176 ? 1.4088 2.2633 1.1822 0.3634  0.0333  0.2251  100  TRP A CB  
1218 C CG  . TRP A 176 ? 1.3896 2.2236 1.1987 0.3353  0.0319  0.2231  100  TRP A CG  
1219 C CD1 . TRP A 176 ? 1.4169 2.2052 1.2443 0.3155  0.0427  0.2306  100  TRP A CD1 
1220 C CD2 . TRP A 176 ? 1.3671 2.2205 1.1929 0.3296  0.0208  0.2168  100  TRP A CD2 
1221 N NE1 . TRP A 176 ? 1.3830 2.1621 1.2371 0.2963  0.0366  0.2264  100  TRP A NE1 
1222 C CE2 . TRP A 176 ? 1.3962 2.2119 1.2481 0.3054  0.0245  0.2190  100  TRP A CE2 
1223 C CE3 . TRP A 176 ? 1.3812 2.2824 1.2036 0.3431  0.0082  0.2095  100  TRP A CE3 
1224 C CZ2 . TRP A 176 ? 1.3676 2.1873 1.2377 0.2956  0.0167  0.2142  100  TRP A CZ2 
1225 C CZ3 . TRP A 176 ? 1.3782 2.2856 1.2218 0.3327  0.0021  0.2060  100  TRP A CZ3 
1226 C CH2 . TRP A 176 ? 1.3666 2.2319 1.2321 0.3096  0.0065  0.2081  100  TRP A CH2 
1227 N N   . ALA A 177 ? 1.5427 2.3658 1.2154 0.4456  0.0593  0.2624  101  ALA A N   
1228 C CA  . ALA A 177 ? 1.5868 2.4077 1.2145 0.4787  0.0679  0.2706  101  ALA A CA  
1229 C C   . ALA A 177 ? 1.6616 2.5131 1.2555 0.5152  0.0599  0.2727  101  ALA A C   
1230 O O   . ALA A 177 ? 1.6792 2.5631 1.2449 0.5392  0.0524  0.2660  101  ALA A O   
1231 C CB  . ALA A 177 ? 1.6264 2.3841 1.2378 0.4846  0.0947  0.2941  101  ALA A CB  
1232 N N   . THR A 178 ? 1.6143 2.4566 1.2103 0.5202  0.0603  0.2812  102  THR A N   
1233 C CA  . THR A 178 ? 1.6354 2.5059 1.2010 0.5557  0.0538  0.2849  102  THR A CA  
1234 C C   . THR A 178 ? 1.6614 2.6093 1.2503 0.5506  0.0275  0.2616  102  THR A C   
1235 O O   . THR A 178 ? 1.6767 2.6679 1.2402 0.5796  0.0173  0.2566  102  THR A O   
1236 C CB  . THR A 178 ? 1.7164 2.5474 1.2774 0.5601  0.0632  0.3011  102  THR A CB  
1237 O OG1 . THR A 178 ? 1.7331 2.4928 1.2743 0.5618  0.0870  0.3216  102  THR A OG1 
1238 C CG2 . THR A 178 ? 1.7231 2.5802 1.2502 0.5993  0.0584  0.3068  102  THR A CG2 
1239 N N   . TYR A 179 ? 1.5807 2.5455 1.2181 0.5134  0.0169  0.2473  103  TYR A N   
1240 C CA  . TYR A 179 ? 1.5531 2.5876 1.2207 0.5005  -0.0061 0.2249  103  TYR A CA  
1241 C C   . TYR A 179 ? 1.6156 2.6875 1.2752 0.5021  -0.0183 0.2081  103  TYR A C   
1242 O O   . TYR A 179 ? 1.6113 2.7451 1.2705 0.5143  -0.0366 0.1950  103  TYR A O   
1243 C CB  . TYR A 179 ? 1.5208 2.5488 1.2374 0.4583  -0.0096 0.2152  103  TYR A CB  
1244 C CG  . TYR A 179 ? 1.5122 2.6040 1.2651 0.4374  -0.0300 0.1920  103  TYR A CG  
1245 C CD1 . TYR A 179 ? 1.5360 2.6803 1.2969 0.4509  -0.0415 0.1887  103  TYR A CD1 
1246 C CD2 . TYR A 179 ? 1.4910 2.5850 1.2740 0.4012  -0.0355 0.1751  103  TYR A CD2 
1247 C CE1 . TYR A 179 ? 1.5193 2.7216 1.3184 0.4285  -0.0584 0.1684  103  TYR A CE1 
1248 C CE2 . TYR A 179 ? 1.4730 2.6194 1.2902 0.3788  -0.0521 0.1544  103  TYR A CE2 
1249 C CZ  . TYR A 179 ? 1.5624 2.7637 1.3893 0.3914  -0.0634 0.1511  103  TYR A CZ  
1250 O OH  . TYR A 179 ? 1.5383 2.7920 1.4022 0.3672  -0.0784 0.1313  103  TYR A OH  
1251 N N   . TYR A 180 ? 1.5861 2.6204 1.2364 0.4927  -0.0079 0.2096  104  TYR A N   
1252 C CA  . TYR A 180 ? 1.6036 2.6621 1.2380 0.4969  -0.0175 0.1953  104  TYR A CA  
1253 C C   . TYR A 180 ? 1.7156 2.7867 1.2980 0.5438  -0.0175 0.2031  104  TYR A C   
1254 O O   . TYR A 180 ? 1.7229 2.8413 1.2936 0.5544  -0.0359 0.1867  104  TYR A O   
1255 C CB  . TYR A 180 ? 1.6149 2.6244 1.2504 0.4778  -0.0030 0.1981  104  TYR A CB  
1256 C CG  . TYR A 180 ? 1.6533 2.6800 1.2695 0.4810  -0.0120 0.1832  104  TYR A CG  
1257 C CD1 . TYR A 180 ? 1.6507 2.7058 1.2946 0.4499  -0.0287 0.1594  104  TYR A CD1 
1258 C CD2 . TYR A 180 ? 1.7117 2.7194 1.2787 0.5150  -0.0021 0.1935  104  TYR A CD2 
1259 C CE1 . TYR A 180 ? 1.6814 2.7460 1.3032 0.4525  -0.0373 0.1451  104  TYR A CE1 
1260 C CE2 . TYR A 180 ? 1.7457 2.7646 1.2902 0.5198  -0.0106 0.1798  104  TYR A CE2 
1261 C CZ  . TYR A 180 ? 1.8104 2.8567 1.3819 0.4880  -0.0287 0.1553  104  TYR A CZ  
1262 O OH  . TYR A 180 ? 1.8472 2.8991 1.3920 0.4929  -0.0376 0.1412  104  TYR A OH  
1263 N N   . SER A 181 ? 1.7129 2.7394 1.2624 0.5718  0.0029  0.2277  105  SER A N   
1264 C CA  . SER A 181 ? 1.7696 2.7970 1.2636 0.6200  0.0075  0.2389  105  SER A CA  
1265 C C   . SER A 181 ? 1.8304 2.9256 1.3199 0.6435  -0.0140 0.2293  105  SER A C   
1266 O O   . SER A 181 ? 1.8661 2.9922 1.3205 0.6753  -0.0240 0.2241  105  SER A O   
1267 C CB  . SER A 181 ? 1.8452 2.8060 1.3094 0.6397  0.0352  0.2675  105  SER A CB  
1268 O OG  . SER A 181 ? 1.9537 2.8557 1.4197 0.6227  0.0563  0.2781  105  SER A OG  
1269 N N   . TYR A 182 ? 1.7509 2.8707 1.2755 0.6293  -0.0214 0.2271  106  TYR A N   
1270 C CA  . TYR A 182 ? 1.7501 2.9391 1.2781 0.6495  -0.0406 0.2192  106  TYR A CA  
1271 C C   . TYR A 182 ? 1.7604 3.0208 1.3311 0.6215  -0.0681 0.1902  106  TYR A C   
1272 O O   . TYR A 182 ? 1.7431 3.0640 1.3398 0.6215  -0.0840 0.1815  106  TYR A O   
1273 C CB  . TYR A 182 ? 1.7553 2.9347 1.2970 0.6510  -0.0333 0.2324  106  TYR A CB  
1274 C CG  . TYR A 182 ? 1.8292 2.9479 1.3212 0.6858  -0.0101 0.2595  106  TYR A CG  
1275 C CD1 . TYR A 182 ? 1.9007 3.0403 1.3478 0.7348  -0.0109 0.2687  106  TYR A CD1 
1276 C CD2 . TYR A 182 ? 1.8400 2.8805 1.3302 0.6695  0.0124  0.2757  106  TYR A CD2 
1277 C CE1 . TYR A 182 ? 1.9596 3.0381 1.3568 0.7672  0.0119  0.2939  106  TYR A CE1 
1278 C CE2 . TYR A 182 ? 1.8968 2.8778 1.3411 0.6990  0.0341  0.3002  106  TYR A CE2 
1279 C CZ  . TYR A 182 ? 2.0387 3.0365 1.4348 0.7478  0.0346  0.3095  106  TYR A CZ  
1280 O OH  . TYR A 182 ? 2.1015 3.0354 1.4480 0.7772  0.0574  0.3339  106  TYR A OH  
1281 N N   . ARG A 183 ? 1.7060 2.9592 1.2805 0.6002  -0.0729 0.1760  107  ARG A N   
1282 C CA  . ARG A 183 ? 1.6789 2.9863 1.2865 0.5712  -0.0973 0.1478  107  ARG A CA  
1283 C C   . ARG A 183 ? 1.6751 3.0130 1.3417 0.5343  -0.1051 0.1380  107  ARG A C   
1284 O O   . ARG A 183 ? 1.6590 3.0668 1.3523 0.5282  -0.1265 0.1212  107  ARG A O   
1285 C CB  . ARG A 183 ? 1.7151 3.0890 1.3011 0.6005  -0.1210 0.1340  107  ARG A CB  
1286 N N   . TYR A 184 ? 1.6004 2.8843 1.2867 0.5101  -0.0871 0.1490  108  TYR A N   
1287 C CA  . TYR A 184 ? 1.5503 2.8421 1.2865 0.4752  -0.0885 0.1435  108  TYR A CA  
1288 C C   . TYR A 184 ? 1.5996 2.9367 1.3477 0.4932  -0.0940 0.1491  108  TYR A C   
1289 O O   . TYR A 184 ? 1.5655 2.9532 1.3549 0.4723  -0.1070 0.1353  108  TYR A O   
1290 C CB  . TYR A 184 ? 1.5353 2.8597 1.3082 0.4356  -0.1047 0.1172  108  TYR A CB  
1291 C CG  . TYR A 184 ? 1.5575 2.8341 1.3188 0.4177  -0.0977 0.1126  108  TYR A CG  
1292 C CD1 . TYR A 184 ? 1.5598 2.7788 1.3367 0.3922  -0.0812 0.1198  108  TYR A CD1 
1293 C CD2 . TYR A 184 ? 1.5956 2.8847 1.3290 0.4280  -0.1079 0.1011  108  TYR A CD2 
1294 C CE1 . TYR A 184 ? 1.5736 2.7510 1.3403 0.3782  -0.0734 0.1171  108  TYR A CE1 
1295 C CE2 . TYR A 184 ? 1.6138 2.8576 1.3337 0.4142  -0.0998 0.0982  108  TYR A CE2 
1296 C CZ  . TYR A 184 ? 1.6821 2.8716 1.4199 0.3895  -0.0820 0.1067  108  TYR A CZ  
1297 O OH  . TYR A 184 ? 1.7065 2.8545 1.4321 0.3777  -0.0733 0.1049  108  TYR A OH  
1298 N N   . ASP A 185 ? 1.5884 2.9015 1.2994 0.5316  -0.0816 0.1709  109  ASP A N   
1299 C CA  . ASP A 185 ? 1.5871 2.9311 1.3009 0.5540  -0.0826 0.1806  109  ASP A CA  
1300 C C   . ASP A 185 ? 1.6266 2.9024 1.3355 0.5513  -0.0618 0.2007  109  ASP A C   
1301 O O   . ASP A 185 ? 1.6529 2.8704 1.3207 0.5738  -0.0450 0.2196  109  ASP A O   
1302 C CB  . ASP A 185 ? 1.6567 3.0325 1.3267 0.6045  -0.0873 0.1882  109  ASP A CB  
1303 C CG  . ASP A 185 ? 1.8050 3.2346 1.4825 0.6290  -0.0935 0.1936  109  ASP A CG  
1304 O OD1 . ASP A 185 ? 1.7723 3.2338 1.4965 0.6039  -0.0991 0.1863  109  ASP A OD1 
1305 O OD2 . ASP A 185 ? 1.9314 3.3783 1.5692 0.6739  -0.0940 0.2035  109  ASP A OD2 
1306 N N   . TRP A 186 ? 1.5393 2.8183 1.2898 0.5218  -0.0626 0.1960  110  TRP A N   
1307 C CA  . TRP A 186 ? 1.5272 2.7426 1.2765 0.5153  -0.0461 0.2119  110  TRP A CA  
1308 C C   . TRP A 186 ? 1.6051 2.8198 1.3236 0.5558  -0.0397 0.2306  110  TRP A C   
1309 O O   . TRP A 186 ? 1.5867 2.8589 1.3214 0.5663  -0.0487 0.2274  110  TRP A O   
1310 C CB  . TRP A 186 ? 1.4639 2.6865 1.2632 0.4753  -0.0501 0.2001  110  TRP A CB  
1311 C CG  . TRP A 186 ? 1.4669 2.6192 1.2654 0.4646  -0.0354 0.2135  110  TRP A CG  
1312 C CD1 . TRP A 186 ? 1.5058 2.6454 1.3009 0.4771  -0.0299 0.2254  110  TRP A CD1 
1313 C CD2 . TRP A 186 ? 1.4593 2.5430 1.2569 0.4422  -0.0247 0.2170  110  TRP A CD2 
1314 N NE1 . TRP A 186 ? 1.4962 2.5624 1.2884 0.4618  -0.0184 0.2342  110  TRP A NE1 
1315 C CE2 . TRP A 186 ? 1.5077 2.5408 1.3036 0.4399  -0.0153 0.2294  110  TRP A CE2 
1316 C CE3 . TRP A 186 ? 1.4729 2.5336 1.2708 0.4246  -0.0224 0.2110  110  TRP A CE3 
1317 C CZ2 . TRP A 186 ? 1.4936 2.4580 1.2916 0.4190  -0.0055 0.2349  110  TRP A CZ2 
1318 C CZ3 . TRP A 186 ? 1.4851 2.4800 1.2868 0.4048  -0.0108 0.2178  110  TRP A CZ3 
1319 C CH2 . TRP A 186 ? 1.4907 2.4397 1.2939 0.4014  -0.0033 0.2291  110  TRP A CH2 
1320 N N   . LEU A 187 ? 1.6056 2.7562 1.2776 0.5799  -0.0234 0.2503  111  LEU A N   
1321 C CA  . LEU A 187 ? 1.6469 2.7808 1.2774 0.6216  -0.0141 0.2702  111  LEU A CA  
1322 C C   . LEU A 187 ? 1.7074 2.7630 1.3291 0.6134  0.0016  0.2859  111  LEU A C   
1323 O O   . LEU A 187 ? 1.7470 2.7469 1.3222 0.6399  0.0162  0.3051  111  LEU A O   
1324 C CB  . LEU A 187 ? 1.7004 2.8176 1.2767 0.6590  -0.0068 0.2811  111  LEU A CB  
1325 C CG  . LEU A 187 ? 1.7707 2.9594 1.3439 0.6749  -0.0230 0.2669  111  LEU A CG  
1326 C CD1 . LEU A 187 ? 1.8249 2.9773 1.3428 0.7064  -0.0120 0.2784  111  LEU A CD1 
1327 C CD2 . LEU A 187 ? 1.8021 3.0725 1.3833 0.7003  -0.0382 0.2623  111  LEU A CD2 
1328 N N   . PHE A 188 ? 1.6263 2.6760 1.2904 0.5772  -0.0017 0.2772  112  PHE A N   
1329 C CA  . PHE A 188 ? 1.6273 2.6046 1.2866 0.5660  0.0096  0.2887  112  PHE A CA  
1330 C C   . PHE A 188 ? 1.6262 2.6270 1.3150 0.5561  0.0037  0.2842  112  PHE A C   
1331 O O   . PHE A 188 ? 1.6183 2.5626 1.3054 0.5454  0.0104  0.2911  112  PHE A O   
1332 C CB  . PHE A 188 ? 1.6374 2.5631 1.3156 0.5283  0.0144  0.2841  112  PHE A CB  
1333 C CG  . PHE A 188 ? 1.6917 2.5850 1.3429 0.5354  0.0239  0.2909  112  PHE A CG  
1334 C CD1 . PHE A 188 ? 1.7767 2.5970 1.3898 0.5492  0.0404  0.3105  112  PHE A CD1 
1335 C CD2 . PHE A 188 ? 1.7138 2.6454 1.3775 0.5265  0.0173  0.2778  112  PHE A CD2 
1336 C CE1 . PHE A 188 ? 1.8187 2.6079 1.4086 0.5551  0.0519  0.3182  112  PHE A CE1 
1337 C CE2 . PHE A 188 ? 1.7805 2.6796 1.4177 0.5346  0.0281  0.2854  112  PHE A CE2 
1338 C CZ  . PHE A 188 ? 1.7956 2.6248 1.3975 0.5488  0.0462  0.3061  112  PHE A CZ  
1339 N N   . GLY A 189 ? 1.5460 2.6288 1.2609 0.5602  -0.0084 0.2729  113  GLY A N   
1340 C CA  . GLY A 189 ? 1.5130 2.6261 1.2582 0.5522  -0.0123 0.2690  113  GLY A CA  
1341 C C   . GLY A 189 ? 1.5059 2.6266 1.3016 0.5057  -0.0183 0.2511  113  GLY A C   
1342 O O   . GLY A 189 ? 1.4895 2.5627 1.2898 0.4797  -0.0155 0.2469  113  GLY A O   
1343 N N   . PRO A 190 ? 1.4338 2.6123 1.2681 0.4947  -0.0251 0.2412  114  PRO A N   
1344 C CA  . PRO A 190 ? 1.3908 2.5759 1.2709 0.4507  -0.0296 0.2236  114  PRO A CA  
1345 C C   . PRO A 190 ? 1.4350 2.5429 1.3142 0.4314  -0.0207 0.2282  114  PRO A C   
1346 O O   . PRO A 190 ? 1.4002 2.4997 1.3098 0.3960  -0.0230 0.2147  114  PRO A O   
1347 C CB  . PRO A 190 ? 1.3947 2.6571 1.3105 0.4502  -0.0358 0.2163  114  PRO A CB  
1348 C CG  . PRO A 190 ? 1.4791 2.7937 1.3742 0.4907  -0.0395 0.2249  114  PRO A CG  
1349 C CD  . PRO A 190 ? 1.4616 2.7072 1.3011 0.5218  -0.0286 0.2451  114  PRO A CD  
1350 N N   . VAL A 191 ? 1.4188 2.4694 1.2616 0.4547  -0.0113 0.2465  115  VAL A N   
1351 C CA  . VAL A 191 ? 1.4142 2.3891 1.2518 0.4394  -0.0050 0.2510  115  VAL A CA  
1352 C C   . VAL A 191 ? 1.4563 2.3791 1.2903 0.4176  -0.0037 0.2481  115  VAL A C   
1353 O O   . VAL A 191 ? 1.4233 2.3179 1.2801 0.3870  -0.0047 0.2392  115  VAL A O   
1354 C CB  . VAL A 191 ? 1.5050 2.4316 1.3002 0.4718  0.0033  0.2709  115  VAL A CB  
1355 C CG1 . VAL A 191 ? 1.5068 2.3512 1.2938 0.4556  0.0072  0.2742  115  VAL A CG1 
1356 C CG2 . VAL A 191 ? 1.5054 2.4857 1.3060 0.4945  0.0037  0.2748  115  VAL A CG2 
1357 N N   . MET A 192 ? 1.4374 2.3517 1.2441 0.4341  -0.0010 0.2555  116  MET A N   
1358 C CA  . MET A 192 ? 1.4352 2.3036 1.2381 0.4168  0.0027  0.2553  116  MET A CA  
1359 C C   . MET A 192 ? 1.4212 2.3309 1.2589 0.3886  -0.0045 0.2365  116  MET A C   
1360 O O   . MET A 192 ? 1.4147 2.2897 1.2588 0.3682  -0.0017 0.2339  116  MET A O   
1361 C CB  . MET A 192 ? 1.5130 2.3568 1.2727 0.4457  0.0106  0.2708  116  MET A CB  
1362 C CG  . MET A 192 ? 1.6078 2.3956 1.3283 0.4701  0.0191  0.2893  116  MET A CG  
1363 S SD  . MET A 192 ? 1.7298 2.4744 1.3955 0.5017  0.0319  0.3088  116  MET A SD  
1364 C CE  . MET A 192 ? 1.7323 2.4142 1.3551 0.5269  0.0392  0.3270  116  MET A CE  
1365 N N   . CYS A 193 ? 1.3299 2.3121 1.1908 0.3866  -0.0138 0.2235  117  CYS A N   
1366 C CA  . CYS A 193 ? 1.2845 2.3050 1.1771 0.3585  -0.0218 0.2039  117  CYS A CA  
1367 C C   . CYS A 193 ? 1.2989 2.2906 1.2211 0.3238  -0.0211 0.1945  117  CYS A C   
1368 O O   . CYS A 193 ? 1.2850 2.2656 1.2216 0.2989  -0.0222 0.1840  117  CYS A O   
1369 C CB  . CYS A 193 ? 1.2731 2.3771 1.1824 0.3654  -0.0327 0.1928  117  CYS A CB  
1370 S SG  . CYS A 193 ? 1.2870 2.4376 1.2343 0.3285  -0.0441 0.1666  117  CYS A SG  
1371 N N   . LYS A 194 ? 1.2382 2.2122 1.1645 0.3255  -0.0183 0.1996  118  LYS A N   
1372 C CA  . LYS A 194 ? 1.2073 2.1486 1.1554 0.2982  -0.0170 0.1925  118  LYS A CA  
1373 C C   . LYS A 194 ? 1.2763 2.1402 1.2088 0.2929  -0.0113 0.2017  118  LYS A C   
1374 O O   . LYS A 194 ? 1.2556 2.0938 1.2063 0.2666  -0.0117 0.1930  118  LYS A O   
1375 C CB  . LYS A 194 ? 1.2237 2.1775 1.1797 0.3050  -0.0158 0.1947  118  LYS A CB  
1376 C CG  . LYS A 194 ? 1.2770 2.3096 1.2585 0.3041  -0.0209 0.1847  118  LYS A CG  
1377 C CD  . LYS A 194 ? 1.3400 2.3818 1.3316 0.3096  -0.0167 0.1883  118  LYS A CD  
1378 C CE  . LYS A 194 ? 1.4105 2.5341 1.4349 0.3047  -0.0208 0.1781  118  LYS A CE  
1379 N NZ  . LYS A 194 ? 1.4567 2.6019 1.5145 0.2674  -0.0255 0.1576  118  LYS A NZ  
1380 N N   . VAL A 195 ? 1.2676 2.0942 1.1665 0.3178  -0.0062 0.2191  119  VAL A N   
1381 C CA  . VAL A 195 ? 1.2775 2.0302 1.1615 0.3133  -0.0015 0.2289  119  VAL A CA  
1382 C C   . VAL A 195 ? 1.3177 2.0571 1.2073 0.2985  0.0011  0.2269  119  VAL A C   
1383 O O   . VAL A 195 ? 1.2966 2.0066 1.2051 0.2738  0.0006  0.2210  119  VAL A O   
1384 C CB  . VAL A 195 ? 1.3665 2.0804 1.2097 0.3438  0.0040  0.2480  119  VAL A CB  
1385 C CG1 . VAL A 195 ? 1.3821 2.0201 1.2122 0.3355  0.0080  0.2570  119  VAL A CG1 
1386 C CG2 . VAL A 195 ? 1.3693 2.0896 1.2046 0.3596  0.0029  0.2511  119  VAL A CG2 
1387 N N   . PHE A 196 ? 1.2908 2.0512 1.1631 0.3151  0.0043  0.2324  120  PHE A N   
1388 C CA  . PHE A 196 ? 1.2900 2.0361 1.1642 0.3048  0.0092  0.2328  120  PHE A CA  
1389 C C   . PHE A 196 ? 1.2855 2.0669 1.1902 0.2795  0.0036  0.2144  120  PHE A C   
1390 O O   . PHE A 196 ? 1.2689 2.0280 1.1833 0.2631  0.0076  0.2129  120  PHE A O   
1391 C CB  . PHE A 196 ? 1.3484 2.1048 1.1910 0.3322  0.0153  0.2438  120  PHE A CB  
1392 C CG  . PHE A 196 ? 1.4118 2.1199 1.2194 0.3554  0.0238  0.2634  120  PHE A CG  
1393 C CD1 . PHE A 196 ? 1.4723 2.1164 1.2748 0.3459  0.0322  0.2742  120  PHE A CD1 
1394 C CD2 . PHE A 196 ? 1.4651 2.1915 1.2438 0.3873  0.0238  0.2714  120  PHE A CD2 
1395 C CE1 . PHE A 196 ? 1.5274 2.1218 1.2952 0.3654  0.0402  0.2918  120  PHE A CE1 
1396 C CE2 . PHE A 196 ? 1.5456 2.2216 1.2863 0.4099  0.0326  0.2897  120  PHE A CE2 
1397 C CZ  . PHE A 196 ? 1.5422 2.1502 1.2766 0.3980  0.0408  0.2995  120  PHE A CZ  
1398 N N   . GLY A 197 ? 1.2117 2.0454 1.1317 0.2759  -0.0047 0.2010  121  GLY A N   
1399 C CA  . GLY A 197 ? 1.1765 2.0404 1.1234 0.2505  -0.0103 0.1822  121  GLY A CA  
1400 C C   . GLY A 197 ? 1.1853 2.0099 1.1530 0.2239  -0.0088 0.1768  121  GLY A C   
1401 O O   . GLY A 197 ? 1.1670 1.9842 1.1462 0.2053  -0.0078 0.1690  121  GLY A O   
1402 N N   . SER A 198 ? 1.1240 1.9200 1.0930 0.2246  -0.0086 0.1817  122  SER A N   
1403 C CA  . SER A 198 ? 1.0984 1.8536 1.0833 0.2034  -0.0085 0.1773  122  SER A CA  
1404 C C   . SER A 198 ? 1.1521 1.8530 1.1303 0.2013  -0.0038 0.1885  122  SER A C   
1405 O O   . SER A 198 ? 1.1300 1.8074 1.1251 0.1812  -0.0039 0.1827  122  SER A O   
1406 C CB  . SER A 198 ? 1.1301 1.8739 1.1147 0.2080  -0.0105 0.1785  122  SER A CB  
1407 O OG  . SER A 198 ? 1.2242 2.0202 1.2220 0.2058  -0.0134 0.1679  122  SER A OG  
1408 N N   . PHE A 199 ? 1.1301 1.8114 1.0841 0.2218  0.0009  0.2047  123  PHE A N   
1409 C CA  . PHE A 199 ? 1.1404 1.7715 1.0889 0.2194  0.0067  0.2167  123  PHE A CA  
1410 C C   . PHE A 199 ? 1.1767 1.8182 1.1377 0.2074  0.0118  0.2137  123  PHE A C   
1411 O O   . PHE A 199 ? 1.1742 1.7831 1.1484 0.1932  0.0151  0.2170  123  PHE A O   
1412 C CB  . PHE A 199 ? 1.1995 1.8091 1.1153 0.2452  0.0123  0.2345  123  PHE A CB  
1413 C CG  . PHE A 199 ? 1.2416 1.7961 1.1514 0.2418  0.0192  0.2481  123  PHE A CG  
1414 C CD1 . PHE A 199 ? 1.2872 1.7908 1.1971 0.2345  0.0154  0.2520  123  PHE A CD1 
1415 C CD2 . PHE A 199 ? 1.2909 1.8432 1.1926 0.2472  0.0296  0.2575  123  PHE A CD2 
1416 C CE1 . PHE A 199 ? 1.3248 1.7789 1.2321 0.2289  0.0208  0.2641  123  PHE A CE1 
1417 C CE2 . PHE A 199 ? 1.3522 1.8545 1.2513 0.2426  0.0376  0.2711  123  PHE A CE2 
1418 C CZ  . PHE A 199 ? 1.3344 1.7892 1.2381 0.2321  0.0326  0.2739  123  PHE A CZ  
1419 N N   . LEU A 200 ? 1.1235 1.8116 1.0803 0.2137  0.0118  0.2072  124  LEU A N   
1420 C CA  . LEU A 200 ? 1.1141 1.8160 1.0775 0.2053  0.0161  0.2026  124  LEU A CA  
1421 C C   . LEU A 200 ? 1.1398 1.8398 1.1302 0.1786  0.0127  0.1882  124  LEU A C   
1422 O O   . LEU A 200 ? 1.1417 1.8188 1.1428 0.1675  0.0185  0.1911  124  LEU A O   
1423 C CB  . LEU A 200 ? 1.1184 1.8716 1.0675 0.2193  0.0131  0.1960  124  LEU A CB  
1424 C CG  . LEU A 200 ? 1.1689 1.9420 1.1208 0.2109  0.0146  0.1867  124  LEU A CG  
1425 C CD1 . LEU A 200 ? 1.1950 1.9413 1.1332 0.2204  0.0274  0.2015  124  LEU A CD1 
1426 C CD2 . LEU A 200 ? 1.1923 2.0186 1.1338 0.2208  0.0062  0.1753  124  LEU A CD2 
1427 N N   . THR A 201 ? 1.0658 1.7908 1.0668 0.1693  0.0045  0.1734  125  THR A N   
1428 C CA  . THR A 201 ? 1.0367 1.7614 1.0585 0.1458  0.0017  0.1582  125  THR A CA  
1429 C C   . THR A 201 ? 1.0667 1.7438 1.1013 0.1347  0.0024  0.1624  125  THR A C   
1430 O O   . THR A 201 ? 1.0487 1.7134 1.0975 0.1189  0.0040  0.1563  125  THR A O   
1431 C CB  . THR A 201 ? 1.1376 1.8976 1.1651 0.1412  -0.0054 0.1443  125  THR A CB  
1432 O OG1 . THR A 201 ? 1.1504 1.9561 1.1670 0.1532  -0.0082 0.1414  125  THR A OG1 
1433 C CG2 . THR A 201 ? 1.1045 1.8654 1.1488 0.1175  -0.0069 0.1276  125  THR A CG2 
1434 N N   . LEU A 202 ? 1.0228 1.6728 1.0502 0.1446  0.0006  0.1729  126  LEU A N   
1435 C CA  . LEU A 202 ? 1.0115 1.6150 1.0478 0.1362  -0.0016 0.1767  126  LEU A CA  
1436 C C   . LEU A 202 ? 1.0496 1.6298 1.0964 0.1288  0.0040  0.1846  126  LEU A C   
1437 O O   . LEU A 202 ? 1.0351 1.6027 1.1007 0.1129  0.0028  0.1783  126  LEU A O   
1438 C CB  . LEU A 202 ? 1.0299 1.6078 1.0484 0.1521  -0.0044 0.1878  126  LEU A CB  
1439 C CG  . LEU A 202 ? 1.0904 1.6193 1.1118 0.1464  -0.0104 0.1896  126  LEU A CG  
1440 C CD1 . LEU A 202 ? 1.1157 1.6250 1.1125 0.1650  -0.0130 0.1984  126  LEU A CD1 
1441 C CD2 . LEU A 202 ? 1.1249 1.6192 1.1579 0.1366  -0.0091 0.1973  126  LEU A CD2 
1442 N N   . ASN A 203 ? 1.0108 1.5867 1.0453 0.1413  0.0112  0.1990  127  ASN A N   
1443 C CA  . ASN A 203 ? 1.0081 1.5633 1.0530 0.1359  0.0194  0.2098  127  ASN A CA  
1444 C C   . ASN A 203 ? 1.0339 1.6145 1.0894 0.1281  0.0256  0.2033  127  ASN A C   
1445 O O   . ASN A 203 ? 1.0295 1.5952 1.1029 0.1182  0.0312  0.2081  127  ASN A O   
1446 C CB  . ASN A 203 ? 1.0256 1.5677 1.0498 0.1532  0.0277  0.2273  127  ASN A CB  
1447 C CG  . ASN A 203 ? 1.2679 1.7745 1.2785 0.1606  0.0229  0.2354  127  ASN A CG  
1448 O OD1 . ASN A 203 ? 1.1586 1.6302 1.1825 0.1486  0.0173  0.2361  127  ASN A OD1 
1449 N ND2 . ASN A 203 ? 1.2065 1.7194 1.1879 0.1819  0.0247  0.2420  127  ASN A ND2 
1450 N N   . MET A 204 ? 0.9751 1.5935 1.0200 0.1321  0.0242  0.1921  128  MET A N   
1451 C CA  . MET A 204 ? 0.9593 1.5975 1.0088 0.1248  0.0288  0.1840  128  MET A CA  
1452 C C   . MET A 204 ? 0.9952 1.6211 1.0665 0.1054  0.0257  0.1734  128  MET A C   
1453 O O   . MET A 204 ? 0.9958 1.6130 1.0788 0.0988  0.0326  0.1764  128  MET A O   
1454 C CB  . MET A 204 ? 0.9843 1.6632 1.0175 0.1309  0.0249  0.1718  128  MET A CB  
1455 C CG  . MET A 204 ? 1.0250 1.7179 1.0572 0.1239  0.0289  0.1627  128  MET A CG  
1456 S SD  . MET A 204 ? 1.0743 1.8115 1.0925 0.1224  0.0201  0.1426  128  MET A SD  
1457 C CE  . MET A 204 ? 1.0084 1.7443 1.0449 0.1039  0.0111  0.1280  128  MET A CE  
1458 N N   . PHE A 205 ? 0.9334 1.5581 1.0087 0.0980  0.0163  0.1619  129  PHE A N   
1459 C CA  . PHE A 205 ? 0.9132 1.5229 1.0046 0.0821  0.0130  0.1515  129  PHE A CA  
1460 C C   . PHE A 205 ? 0.9556 1.5300 1.0638 0.0780  0.0123  0.1613  129  PHE A C   
1461 O O   . PHE A 205 ? 0.9457 1.5107 1.0694 0.0678  0.0139  0.1580  129  PHE A O   
1462 C CB  . PHE A 205 ? 0.9249 1.5398 1.0137 0.0773  0.0052  0.1381  129  PHE A CB  
1463 C CG  . PHE A 205 ? 0.9366 1.5852 1.0175 0.0728  0.0053  0.1237  129  PHE A CG  
1464 C CD1 . PHE A 205 ? 0.9691 1.6194 1.0527 0.0602  0.0084  0.1121  129  PHE A CD1 
1465 C CD2 . PHE A 205 ? 0.9651 1.6428 1.0363 0.0803  0.0015  0.1208  129  PHE A CD2 
1466 C CE1 . PHE A 205 ? 0.9804 1.6581 1.0554 0.0537  0.0076  0.0976  129  PHE A CE1 
1467 C CE2 . PHE A 205 ? 1.0001 1.7108 1.0677 0.0732  0.0000  0.1062  129  PHE A CE2 
1468 C CZ  . PHE A 205 ? 0.9733 1.6821 1.0422 0.0590  0.0027  0.0943  129  PHE A CZ  
1469 N N   . ALA A 206 ? 0.9192 1.4742 1.0239 0.0860  0.0099  0.1736  130  ALA A N   
1470 C CA  . ALA A 206 ? 0.9268 1.4478 1.0484 0.0802  0.0076  0.1825  130  ALA A CA  
1471 C C   . ALA A 206 ? 0.9987 1.5219 1.1371 0.0759  0.0181  0.1920  130  ALA A C   
1472 O O   . ALA A 206 ? 0.9884 1.4963 1.1502 0.0654  0.0163  0.1932  130  ALA A O   
1473 C CB  . ALA A 206 ? 0.9562 1.4537 1.0651 0.0901  0.0042  0.1940  130  ALA A CB  
1474 N N   . SER A 207 ? 0.9768 1.5218 1.1032 0.0849  0.0291  0.1978  131  SER A N   
1475 C CA  . SER A 207 ? 0.9841 1.5335 1.1228 0.0837  0.0419  0.2075  131  SER A CA  
1476 C C   . SER A 207 ? 1.0146 1.5756 1.1650 0.0740  0.0431  0.1959  131  SER A C   
1477 O O   . SER A 207 ? 1.0045 1.5559 1.1795 0.0658  0.0458  0.2002  131  SER A O   
1478 C CB  . SER A 207 ? 1.0532 1.6199 1.1688 0.0992  0.0531  0.2159  131  SER A CB  
1479 O OG  . SER A 207 ? 1.1840 1.7537 1.3083 0.1003  0.0677  0.2262  131  SER A OG  
1480 N N   . ILE A 208 ? 0.9542 1.5351 1.0871 0.0747  0.0403  0.1808  132  ILE A N   
1481 C CA  . ILE A 208 ? 0.9354 1.5242 1.0702 0.0669  0.0421  0.1682  132  ILE A CA  
1482 C C   . ILE A 208 ? 0.9563 1.5254 1.1114 0.0552  0.0345  0.1614  132  ILE A C   
1483 O O   . ILE A 208 ? 0.9482 1.5154 1.1146 0.0505  0.0393  0.1598  132  ILE A O   
1484 C CB  . ILE A 208 ? 0.9719 1.5823 1.0825 0.0678  0.0382  0.1520  132  ILE A CB  
1485 C CG1 . ILE A 208 ? 0.9942 1.6260 1.0834 0.0815  0.0437  0.1577  132  ILE A CG1 
1486 C CG2 . ILE A 208 ? 0.9734 1.5852 1.0811 0.0588  0.0404  0.1381  132  ILE A CG2 
1487 C CD1 . ILE A 208 ? 1.0827 1.7409 1.1505 0.0825  0.0374  0.1423  132  ILE A CD1 
1488 N N   . PHE A 209 ? 0.8963 1.4499 1.0535 0.0527  0.0230  0.1581  133  PHE A N   
1489 C CA  . PHE A 209 ? 0.8763 1.4091 1.0479 0.0443  0.0146  0.1510  133  PHE A CA  
1490 C C   . PHE A 209 ? 0.9386 1.4567 1.1380 0.0407  0.0144  0.1631  133  PHE A C   
1491 O O   . PHE A 209 ? 0.9354 1.4472 1.1502 0.0350  0.0123  0.1583  133  PHE A O   
1492 C CB  . PHE A 209 ? 0.8900 1.4076 1.0520 0.0448  0.0029  0.1441  133  PHE A CB  
1493 C CG  . PHE A 209 ? 0.8980 1.4321 1.0388 0.0463  0.0026  0.1319  133  PHE A CG  
1494 C CD1 . PHE A 209 ? 0.9324 1.4821 1.0656 0.0409  0.0081  0.1199  133  PHE A CD1 
1495 C CD2 . PHE A 209 ? 0.9193 1.4502 1.0484 0.0521  -0.0037 0.1315  133  PHE A CD2 
1496 C CE1 . PHE A 209 ? 0.9397 1.5055 1.0571 0.0391  0.0073  0.1080  133  PHE A CE1 
1497 C CE2 . PHE A 209 ? 0.9480 1.4982 1.0630 0.0521  -0.0036 0.1206  133  PHE A CE2 
1498 C CZ  . PHE A 209 ? 0.9200 1.4884 1.0310 0.0443  0.0015  0.1086  133  PHE A CZ  
1499 N N   . PHE A 210 ? 0.9116 1.4249 1.1179 0.0441  0.0172  0.1787  134  PHE A N   
1500 C CA  . PHE A 210 ? 0.9198 1.4215 1.1568 0.0379  0.0177  0.1906  134  PHE A CA  
1501 C C   . PHE A 210 ? 0.9806 1.5024 1.2328 0.0377  0.0329  0.1976  134  PHE A C   
1502 O O   . PHE A 210 ? 0.9742 1.4940 1.2569 0.0310  0.0330  0.2029  134  PHE A O   
1503 C CB  . PHE A 210 ? 0.9598 1.4448 1.1987 0.0397  0.0173  0.2053  134  PHE A CB  
1504 C CG  . PHE A 210 ? 0.9851 1.4419 1.2153 0.0388  0.0011  0.2004  134  PHE A CG  
1505 C CD1 . PHE A 210 ? 1.0219 1.4578 1.2721 0.0296  -0.0126 0.1958  134  PHE A CD1 
1506 C CD2 . PHE A 210 ? 1.0198 1.4697 1.2210 0.0490  -0.0004 0.2019  134  PHE A CD2 
1507 C CE1 . PHE A 210 ? 1.0426 1.4480 1.2797 0.0308  -0.0278 0.1913  134  PHE A CE1 
1508 C CE2 . PHE A 210 ? 1.0644 1.4853 1.2539 0.0506  -0.0141 0.1986  134  PHE A CE2 
1509 C CZ  . PHE A 210 ? 1.0409 1.4377 1.2471 0.0414  -0.0278 0.1932  134  PHE A CZ  
1510 N N   . ILE A 211 ? 0.9483 1.4897 1.1787 0.0458  0.0445  0.1965  135  ILE A N   
1511 C CA  . ILE A 211 ? 0.9499 1.5075 1.1859 0.0487  0.0594  0.2014  135  ILE A CA  
1512 C C   . ILE A 211 ? 0.9775 1.5348 1.2205 0.0432  0.0551  0.1883  135  ILE A C   
1513 O O   . ILE A 211 ? 0.9824 1.5450 1.2475 0.0421  0.0623  0.1946  135  ILE A O   
1514 C CB  . ILE A 211 ? 1.0023 1.5764 1.2055 0.0601  0.0699  0.2008  135  ILE A CB  
1515 C CG1 . ILE A 211 ? 1.0263 1.5997 1.2219 0.0691  0.0768  0.2164  135  ILE A CG1 
1516 C CG2 . ILE A 211 ? 1.0130 1.5991 1.2138 0.0647  0.0840  0.2024  135  ILE A CG2 
1517 C CD1 . ILE A 211 ? 1.1218 1.7112 1.2816 0.0828  0.0833  0.2145  135  ILE A CD1 
1518 N N   . THR A 212 ? 0.9107 1.4614 1.1347 0.0405  0.0444  0.1709  136  THR A N   
1519 C CA  . THR A 212 ? 0.8954 1.4397 1.1177 0.0366  0.0403  0.1568  136  THR A CA  
1520 C C   . THR A 212 ? 0.9560 1.4868 1.2094 0.0313  0.0307  0.1595  136  THR A C   
1521 O O   . THR A 212 ? 0.9551 1.4874 1.2196 0.0312  0.0332  0.1570  136  THR A O   
1522 C CB  . THR A 212 ? 0.8873 1.4258 1.0820 0.0346  0.0325  0.1397  136  THR A CB  
1523 O OG1 . THR A 212 ? 0.8633 1.4185 1.0334 0.0385  0.0395  0.1370  136  THR A OG1 
1524 C CG2 . THR A 212 ? 0.8384 1.3652 1.0261 0.0311  0.0302  0.1250  136  THR A CG2 
1525 N N   . CYS A 213 ? 0.9143 1.4316 1.1801 0.0278  0.0195  0.1647  137  CYS A N   
1526 C CA  . CYS A 213 ? 0.9090 1.4123 1.2040 0.0220  0.0074  0.1666  137  CYS A CA  
1527 C C   . CYS A 213 ? 0.9572 1.4764 1.2877 0.0197  0.0162  0.1805  137  CYS A C   
1528 O O   . CYS A 213 ? 0.9502 1.4705 1.3026 0.0174  0.0108  0.1777  137  CYS A O   
1529 C CB  . CYS A 213 ? 0.9206 1.4035 1.2166 0.0192  -0.0051 0.1704  137  CYS A CB  
1530 S SG  . CYS A 213 ? 0.9684 1.4302 1.2288 0.0231  -0.0174 0.1546  137  CYS A SG  
1531 N N   . MET A 214 ? 0.9226 1.4549 1.2581 0.0216  0.0306  0.1959  138  MET A N   
1532 C CA  . MET A 214 ? 0.9251 1.4743 1.2947 0.0202  0.0432  0.2121  138  MET A CA  
1533 C C   . MET A 214 ? 0.9719 1.5381 1.3448 0.0257  0.0527  0.2088  138  MET A C   
1534 O O   . MET A 214 ? 0.9713 1.5488 1.3803 0.0228  0.0540  0.2159  138  MET A O   
1535 C CB  . MET A 214 ? 0.9662 1.5233 1.3292 0.0251  0.0605  0.2284  138  MET A CB  
1536 C CG  . MET A 214 ? 1.0216 1.5613 1.3887 0.0201  0.0553  0.2376  138  MET A CG  
1537 S SD  . MET A 214 ? 1.0767 1.6064 1.4957 0.0040  0.0443  0.2466  138  MET A SD  
1538 C CE  . MET A 214 ? 1.0359 1.5966 1.4949 0.0037  0.0659  0.2638  138  MET A CE  
1539 N N   . SER A 215 ? 0.9248 1.4927 1.2603 0.0337  0.0593  0.1982  139  SER A N   
1540 C CA  . SER A 215 ? 0.9247 1.5026 1.2541 0.0407  0.0694  0.1944  139  SER A CA  
1541 C C   . SER A 215 ? 0.9650 1.5342 1.3044 0.0384  0.0565  0.1823  139  SER A C   
1542 O O   . SER A 215 ? 0.9624 1.5431 1.3191 0.0430  0.0627  0.1861  139  SER A O   
1543 C CB  . SER A 215 ? 0.9757 1.5517 1.2587 0.0476  0.0772  0.1841  139  SER A CB  
1544 O OG  . SER A 215 ? 1.0836 1.6689 1.3554 0.0530  0.0893  0.1954  139  SER A OG  
1545 N N   . VAL A 216 ? 0.9139 1.4630 1.2420 0.0332  0.0392  0.1689  140  VAL A N   
1546 C CA  . VAL A 216 ? 0.9067 1.4423 1.2388 0.0330  0.0256  0.1567  140  VAL A CA  
1547 C C   . VAL A 216 ? 0.9606 1.5036 1.3406 0.0279  0.0155  0.1663  140  VAL A C   
1548 O O   . VAL A 216 ? 0.9518 1.4994 1.3475 0.0316  0.0113  0.1630  140  VAL A O   
1549 C CB  . VAL A 216 ? 0.9519 1.4619 1.2552 0.0305  0.0120  0.1411  140  VAL A CB  
1550 C CG1 . VAL A 216 ? 0.9495 1.4414 1.2564 0.0320  -0.0029 0.1299  140  VAL A CG1 
1551 C CG2 . VAL A 216 ? 0.9511 1.4580 1.2126 0.0332  0.0216  0.1305  140  VAL A CG2 
1552 N N   . ASP A 217 ? 0.9314 1.4760 1.3341 0.0197  0.0121  0.1783  141  ASP A N   
1553 C CA  . ASP A 217 ? 0.9381 1.4890 1.3882 0.0111  0.0021  0.1878  141  ASP A CA  
1554 C C   . ASP A 217 ? 1.0013 1.5842 1.4876 0.0131  0.0173  0.2021  141  ASP A C   
1555 O O   . ASP A 217 ? 0.9908 1.5857 1.5122 0.0111  0.0085  0.2025  141  ASP A O   
1556 C CB  . ASP A 217 ? 0.9678 1.5073 1.4267 0.0015  -0.0022 0.1974  141  ASP A CB  
1557 C CG  . ASP A 217 ? 1.1009 1.6424 1.6077 -0.0106 -0.0145 0.2056  141  ASP A CG  
1558 O OD1 . ASP A 217 ? 1.0982 1.6221 1.6097 -0.0143 -0.0366 0.1945  141  ASP A OD1 
1559 O OD2 . ASP A 217 ? 1.2013 1.7605 1.7402 -0.0167 -0.0019 0.2230  141  ASP A OD2 
1560 N N   . ARG A 218 ? 0.9737 1.5713 1.4509 0.0186  0.0399  0.2139  142  ARG A N   
1561 C CA  . ARG A 218 ? 0.9793 1.6064 1.4856 0.0236  0.0583  0.2292  142  ARG A CA  
1562 C C   . ARG A 218 ? 1.0389 1.6743 1.5381 0.0349  0.0597  0.2202  142  ARG A C   
1563 O O   . ARG A 218 ? 1.0395 1.6992 1.5776 0.0369  0.0634  0.2292  142  ARG A O   
1564 C CB  . ARG A 218 ? 0.9850 1.6197 1.4719 0.0309  0.0824  0.2422  142  ARG A CB  
1565 C CG  . ARG A 218 ? 1.0884 1.7212 1.5921 0.0224  0.0875  0.2580  142  ARG A CG  
1566 C CD  . ARG A 218 ? 1.1852 1.8266 1.6688 0.0336  0.1129  0.2715  142  ARG A CD  
1567 N NE  . ARG A 218 ? 1.2965 1.9359 1.7977 0.0276  0.1219  0.2895  142  ARG A NE  
1568 C CZ  . ARG A 218 ? 1.5011 2.1455 1.9884 0.0376  0.1447  0.3046  142  ARG A CZ  
1569 N NH1 . ARG A 218 ? 1.3668 2.0186 1.8221 0.0538  0.1593  0.3033  142  ARG A NH1 
1570 N NH2 . ARG A 218 ? 1.3389 1.9772 1.8407 0.0322  0.1532  0.3210  142  ARG A NH2 
1571 N N   . TYR A 219 ? 0.9975 1.6127 1.4479 0.0422  0.0571  0.2027  143  TYR A N   
1572 C CA  . TYR A 219 ? 1.0019 1.6162 1.4357 0.0539  0.0591  0.1925  143  TYR A CA  
1573 C C   . TYR A 219 ? 1.0556 1.6707 1.5188 0.0521  0.0396  0.1861  143  TYR A C   
1574 O O   . TYR A 219 ? 1.0568 1.6910 1.5403 0.0609  0.0437  0.1900  143  TYR A O   
1575 C CB  . TYR A 219 ? 1.0235 1.6109 1.3986 0.0584  0.0597  0.1745  143  TYR A CB  
1576 C CG  . TYR A 219 ? 1.0603 1.6370 1.4129 0.0694  0.0599  0.1618  143  TYR A CG  
1577 C CD1 . TYR A 219 ? 1.1003 1.6866 1.4406 0.0827  0.0781  0.1666  143  TYR A CD1 
1578 C CD2 . TYR A 219 ? 1.0730 1.6255 1.4106 0.0683  0.0432  0.1452  143  TYR A CD2 
1579 C CE1 . TYR A 219 ? 1.1292 1.7017 1.4446 0.0943  0.0793  0.1554  143  TYR A CE1 
1580 C CE2 . TYR A 219 ? 1.0977 1.6363 1.4107 0.0799  0.0448  0.1340  143  TYR A CE2 
1581 C CZ  . TYR A 219 ? 1.2155 1.7638 1.5170 0.0927  0.0629  0.1390  143  TYR A CZ  
1582 O OH  . TYR A 219 ? 1.2499 1.7807 1.5226 0.1057  0.0657  0.1283  143  TYR A OH  
1583 N N   . GLN A 220 ? 1.0110 1.6060 1.4758 0.0423  0.0183  0.1769  144  GLN A N   
1584 C CA  . GLN A 220 ? 1.0085 1.5983 1.4954 0.0408  -0.0041 0.1686  144  GLN A CA  
1585 C C   . GLN A 220 ? 1.0726 1.6951 1.6237 0.0338  -0.0081 0.1837  144  GLN A C   
1586 O O   . GLN A 220 ? 1.0666 1.6974 1.6428 0.0363  -0.0233 0.1789  144  GLN A O   
1587 C CB  . GLN A 220 ? 1.0205 1.5777 1.4891 0.0327  -0.0237 0.1572  144  GLN A CB  
1588 C CG  . GLN A 220 ? 1.0618 1.6028 1.5357 0.0350  -0.0480 0.1442  144  GLN A CG  
1589 C CD  . GLN A 220 ? 1.2416 1.7458 1.6879 0.0307  -0.0644 0.1331  144  GLN A CD  
1590 O OE1 . GLN A 220 ? 1.1796 1.6611 1.6117 0.0367  -0.0811 0.1198  144  GLN A OE1 
1591 N NE2 . GLN A 220 ? 1.1488 1.6446 1.5819 0.0231  -0.0586 0.1383  144  GLN A NE2 
1592 N N   . SER A 221 ? 1.0439 1.6856 1.6211 0.0257  0.0063  0.2019  145  SER A N   
1593 C CA  . SER A 221 ? 1.0498 1.7246 1.6903 0.0169  0.0074  0.2187  145  SER A CA  
1594 C C   . SER A 221 ? 1.1065 1.8168 1.7662 0.0303  0.0260  0.2289  145  SER A C   
1595 O O   . SER A 221 ? 1.1022 1.8442 1.8157 0.0272  0.0219  0.2376  145  SER A O   
1596 C CB  . SER A 221 ? 1.1066 1.7826 1.7623 0.0041  0.0183  0.2350  145  SER A CB  
1597 O OG  . SER A 221 ? 1.2417 1.8848 1.8801 -0.0068 0.0015  0.2270  145  SER A OG  
1598 N N   . VAL A 222 ? 1.0702 1.7752 1.6856 0.0454  0.0464  0.2281  146  VAL A N   
1599 C CA  . VAL A 222 ? 1.0762 1.8078 1.6969 0.0618  0.0670  0.2378  146  VAL A CA  
1600 C C   . VAL A 222 ? 1.1429 1.8733 1.7540 0.0754  0.0556  0.2236  146  VAL A C   
1601 O O   . VAL A 222 ? 1.1375 1.9010 1.7921 0.0807  0.0547  0.2315  146  VAL A O   
1602 C CB  . VAL A 222 ? 1.1313 1.8511 1.7016 0.0730  0.0918  0.2411  146  VAL A CB  
1603 C CG1 . VAL A 222 ? 1.1401 1.8772 1.7015 0.0936  0.1118  0.2476  146  VAL A CG1 
1604 C CG2 . VAL A 222 ? 1.1296 1.8552 1.7122 0.0641  0.1055  0.2580  146  VAL A CG2 
1605 N N   . ILE A 223 ? 1.1171 1.8104 1.6718 0.0816  0.0480  0.2036  147  ILE A N   
1606 C CA  . ILE A 223 ? 1.1300 1.8128 1.6627 0.0968  0.0400  0.1892  147  ILE A CA  
1607 C C   . ILE A 223 ? 1.1846 1.8785 1.7614 0.0915  0.0127  0.1842  147  ILE A C   
1608 O O   . ILE A 223 ? 1.1856 1.8983 1.7780 0.1053  0.0096  0.1835  147  ILE A O   
1609 C CB  . ILE A 223 ? 1.1809 1.8172 1.6437 0.1009  0.0391  0.1694  147  ILE A CB  
1610 C CG1 . ILE A 223 ? 1.2066 1.8260 1.6382 0.1190  0.0359  0.1554  147  ILE A CG1 
1611 C CG2 . ILE A 223 ? 1.1842 1.7936 1.6366 0.0851  0.0213  0.1591  147  ILE A CG2 
1612 C CD1 . ILE A 223 ? 1.3632 1.9951 1.7796 0.1393  0.0577  0.1620  147  ILE A CD1 
1613 N N   . TYR A 224 ? 1.1415 1.8248 1.7377 0.0730  -0.0069 0.1813  148  TYR A N   
1614 C CA  . TYR A 224 ? 1.1425 1.8333 1.7788 0.0665  -0.0349 0.1759  148  TYR A CA  
1615 C C   . TYR A 224 ? 1.2096 1.9289 1.9093 0.0459  -0.0386 0.1924  148  TYR A C   
1616 O O   . TYR A 224 ? 1.2049 1.9027 1.9017 0.0299  -0.0463 0.1920  148  TYR A O   
1617 C CB  . TYR A 224 ? 1.1578 1.8027 1.7559 0.0642  -0.0577 0.1559  148  TYR A CB  
1618 C CG  . TYR A 224 ? 1.1860 1.7986 1.7212 0.0820  -0.0524 0.1400  148  TYR A CG  
1619 C CD1 . TYR A 224 ? 1.2234 1.8371 1.7512 0.1003  -0.0591 0.1312  148  TYR A CD1 
1620 C CD2 . TYR A 224 ? 1.1945 1.7737 1.6774 0.0801  -0.0421 0.1331  148  TYR A CD2 
1621 C CE1 . TYR A 224 ? 1.2482 1.8273 1.7154 0.1163  -0.0522 0.1172  148  TYR A CE1 
1622 C CE2 . TYR A 224 ? 1.2157 1.7641 1.6427 0.0938  -0.0360 0.1188  148  TYR A CE2 
1623 C CZ  . TYR A 224 ? 1.3173 1.8632 1.7351 0.1117  -0.0402 0.1110  148  TYR A CZ  
1624 O OH  . TYR A 224 ? 1.3341 1.8446 1.6942 0.1248  -0.0327 0.0972  148  TYR A OH  
1625 N N   . PRO A 225 ? 1.1835 1.9508 1.9403 0.0465  -0.0313 0.2078  149  PRO A N   
1626 C CA  . PRO A 225 ? 1.1866 1.9805 2.0050 0.0251  -0.0312 0.2249  149  PRO A CA  
1627 C C   . PRO A 225 ? 1.2566 2.0396 2.1052 0.0064  -0.0643 0.2160  149  PRO A C   
1628 O O   . PRO A 225 ? 1.2540 2.0381 2.1343 -0.0146 -0.0657 0.2261  149  PRO A O   
1629 C CB  . PRO A 225 ? 1.2071 2.0567 2.0791 0.0329  -0.0173 0.2412  149  PRO A CB  
1630 C CG  . PRO A 225 ? 1.2628 2.1092 2.0876 0.0602  -0.0010 0.2365  149  PRO A CG  
1631 C CD  . PRO A 225 ? 1.2080 2.0072 1.9745 0.0671  -0.0199 0.2120  149  PRO A CD  
1632 N N   . PHE A 226 ? 1.2271 1.9963 2.0628 0.0148  -0.0903 0.1972  150  PHE A N   
1633 C CA  . PHE A 226 ? 1.7242 2.4774 2.5797 0.0008  -0.1247 0.1857  150  PHE A CA  
1634 C C   . PHE A 226 ? 2.1126 2.8118 2.9230 -0.0093 -0.1326 0.1773  150  PHE A C   
1635 O O   . PHE A 226 ? 1.6007 2.2700 2.3525 0.0014  -0.1195 0.1716  150  PHE A O   
1636 C CB  . PHE A 226 ? 1.7557 2.5060 2.6001 0.0183  -0.1481 0.1677  150  PHE A CB  
1637 C CG  . PHE A 226 ? 1.7783 2.4919 2.5489 0.0416  -0.1417 0.1529  150  PHE A CG  
1638 C CD1 . PHE A 226 ? 1.8271 2.4873 2.5462 0.0428  -0.1574 0.1360  150  PHE A CD1 
1639 C CD2 . PHE A 226 ? 1.8024 2.5335 2.5552 0.0629  -0.1201 0.1559  150  PHE A CD2 
1640 C CE1 . PHE A 226 ? 1.8432 2.4697 2.4973 0.0628  -0.1501 0.1230  150  PHE A CE1 
1641 C CE2 . PHE A 226 ? 1.8449 2.5386 2.5292 0.0825  -0.1138 0.1419  150  PHE A CE2 
1642 C CZ  . PHE A 226 ? 1.8288 2.4715 2.4662 0.0814  -0.1286 0.1256  150  PHE A CZ  
1643 N N   . PRO A 233 ? 1.3291 1.6901 1.8780 -0.0450 -0.2107 0.1343  157  PRO A N   
1644 C CA  . PRO A 233 ? 1.3575 1.6783 1.8962 -0.0557 -0.2248 0.1363  157  PRO A CA  
1645 C C   . PRO A 233 ? 1.4252 1.6992 1.8994 -0.0408 -0.2280 0.1275  157  PRO A C   
1646 O O   . PRO A 233 ? 1.4330 1.6808 1.8858 -0.0443 -0.2237 0.1346  157  PRO A O   
1647 C CB  . PRO A 233 ? 1.4015 1.7157 1.9729 -0.0652 -0.2565 0.1277  157  PRO A CB  
1648 C CG  . PRO A 233 ? 1.4395 1.7806 2.0206 -0.0520 -0.2617 0.1170  157  PRO A CG  
1649 C CD  . PRO A 233 ? 1.3502 1.7320 1.9372 -0.0462 -0.2296 0.1271  157  PRO A CD  
1650 N N   . TRP A 234 ? 1.3788 1.6420 1.8214 -0.0231 -0.2342 0.1129  158  TRP A N   
1651 C CA  . TRP A 234 ? 1.3849 1.6061 1.7684 -0.0073 -0.2366 0.1041  158  TRP A CA  
1652 C C   . TRP A 234 ? 1.3821 1.6175 1.7391 0.0000  -0.2078 0.1102  158  TRP A C   
1653 O O   . TRP A 234 ? 1.3927 1.6038 1.7167 0.0041  -0.2031 0.1135  158  TRP A O   
1654 C CB  . TRP A 234 ? 1.3804 1.5849 1.7425 0.0089  -0.2525 0.0869  158  TRP A CB  
1655 C CG  . TRP A 234 ? 1.4261 1.5748 1.7386 0.0217  -0.2692 0.0769  158  TRP A CG  
1656 C CD1 . TRP A 234 ? 1.4984 1.6109 1.8061 0.0225  -0.2992 0.0680  158  TRP A CD1 
1657 C CD2 . TRP A 234 ? 1.4267 1.5491 1.6875 0.0356  -0.2567 0.0760  158  TRP A CD2 
1658 N NE1 . TRP A 234 ? 1.5173 1.5794 1.7694 0.0383  -0.3052 0.0616  158  TRP A NE1 
1659 C CE2 . TRP A 234 ? 1.5141 1.5830 1.7387 0.0464  -0.2787 0.0671  158  TRP A CE2 
1660 C CE3 . TRP A 234 ? 1.4185 1.5585 1.6604 0.0404  -0.2296 0.0814  158  TRP A CE3 
1661 C CZ2 . TRP A 234 ? 1.5172 1.5514 1.6890 0.0626  -0.2721 0.0652  158  TRP A CZ2 
1662 C CZ3 . TRP A 234 ? 1.4475 1.5566 1.6411 0.0544  -0.2246 0.0787  158  TRP A CZ3 
1663 C CH2 . TRP A 234 ? 1.4910 1.5484 1.6506 0.0658  -0.2446 0.0715  158  TRP A CH2 
1664 N N   . GLN A 235 ? 1.2774 1.5530 1.6491 0.0020  -0.1892 0.1119  159  GLN A N   
1665 C CA  . GLN A 235 ? 1.2367 1.5305 1.5858 0.0085  -0.1636 0.1148  159  GLN A CA  
1666 C C   . GLN A 235 ? 1.2415 1.5353 1.5814 0.0035  -0.1500 0.1277  159  GLN A C   
1667 O O   . GLN A 235 ? 1.2334 1.5267 1.5409 0.0118  -0.1368 0.1266  159  GLN A O   
1668 C CB  . GLN A 235 ? 1.2309 1.5683 1.6068 0.0072  -0.1473 0.1180  159  GLN A CB  
1669 C CG  . GLN A 235 ? 1.4367 1.8069 1.8621 -0.0067 -0.1404 0.1332  159  GLN A CG  
1670 C CD  . GLN A 235 ? 1.6843 2.0946 2.1303 -0.0042 -0.1231 0.1367  159  GLN A CD  
1671 O OE1 . GLN A 235 ? 1.6194 2.0334 2.0572 0.0057  -0.1249 0.1264  159  GLN A OE1 
1672 N NE2 . GLN A 235 ? 1.5930 2.0318 2.0660 -0.0120 -0.1061 0.1523  159  GLN A NE2 
1673 N N   . ALA A 236 ? 1.1641 1.4567 1.5308 -0.0092 -0.1538 0.1394  160  ALA A N   
1674 C CA  . ALA A 236 ? 1.1453 1.4351 1.5020 -0.0123 -0.1405 0.1527  160  ALA A CA  
1675 C C   . ALA A 236 ? 1.1690 1.4163 1.4811 -0.0033 -0.1490 0.1494  160  ALA A C   
1676 O O   . ALA A 236 ? 1.1598 1.4093 1.4473 0.0031  -0.1346 0.1557  160  ALA A O   
1677 C CB  . ALA A 236 ? 1.1672 1.4631 1.5645 -0.0288 -0.1413 0.1661  160  ALA A CB  
1678 N N   . SER A 237 ? 1.1144 1.3236 1.4143 -0.0009 -0.1725 0.1396  161  SER A N   
1679 C CA  . SER A 237 ? 1.1209 1.2847 1.3759 0.0097  -0.1814 0.1371  161  SER A CA  
1680 C C   . SER A 237 ? 1.1121 1.2757 1.3273 0.0273  -0.1718 0.1295  161  SER A C   
1681 O O   . SER A 237 ? 1.1265 1.2605 1.3038 0.0386  -0.1733 0.1299  161  SER A O   
1682 C CB  . SER A 237 ? 1.1964 1.3180 1.4475 0.0087  -0.2098 0.1277  161  SER A CB  
1683 O OG  . SER A 237 ? 1.3013 1.4263 1.5540 0.0155  -0.2201 0.1136  161  SER A OG  
1684 N N   . TYR A 238 ? 0.9996 1.1951 1.2231 0.0295  -0.1612 0.1231  162  TYR A N   
1685 C CA  . TYR A 238 ? 0.9638 1.1624 1.1556 0.0424  -0.1509 0.1151  162  TYR A CA  
1686 C C   . TYR A 238 ? 0.9798 1.2198 1.1743 0.0408  -0.1271 0.1210  162  TYR A C   
1687 O O   . TYR A 238 ? 0.9739 1.2151 1.1404 0.0496  -0.1178 0.1200  162  TYR A O   
1688 C CB  . TYR A 238 ? 0.9562 1.1523 1.1493 0.0467  -0.1578 0.1013  162  TYR A CB  
1689 C CG  . TYR A 238 ? 0.9372 1.1414 1.1043 0.0562  -0.1432 0.0934  162  TYR A CG  
1690 C CD1 . TYR A 238 ? 0.9719 1.1463 1.1005 0.0694  -0.1447 0.0877  162  TYR A CD1 
1691 C CD2 . TYR A 238 ? 0.9151 1.1546 1.0953 0.0519  -0.1273 0.0915  162  TYR A CD2 
1692 C CE1 . TYR A 238 ? 0.9611 1.1436 1.0690 0.0758  -0.1299 0.0810  162  TYR A CE1 
1693 C CE2 . TYR A 238 ? 0.9144 1.1587 1.0706 0.0579  -0.1138 0.0837  162  TYR A CE2 
1694 C CZ  . TYR A 238 ? 1.0016 1.2186 1.1237 0.0687  -0.1149 0.0784  162  TYR A CZ  
1695 O OH  . TYR A 238 ? 0.9838 1.2063 1.0855 0.0723  -0.1004 0.0710  162  TYR A OH  
1696 N N   . ILE A 239 ? 0.9041 1.1782 1.1314 0.0306  -0.1176 0.1268  163  ILE A N   
1697 C CA  . ILE A 239 ? 0.8719 1.1836 1.1004 0.0298  -0.0965 0.1310  163  ILE A CA  
1698 C C   . ILE A 239 ? 0.9205 1.2364 1.1374 0.0318  -0.0877 0.1430  163  ILE A C   
1699 O O   . ILE A 239 ? 0.9107 1.2415 1.1062 0.0383  -0.0768 0.1414  163  ILE A O   
1700 C CB  . ILE A 239 ? 0.8920 1.2343 1.1560 0.0210  -0.0889 0.1351  163  ILE A CB  
1701 C CG1 . ILE A 239 ? 0.8873 1.2283 1.1545 0.0234  -0.0944 0.1222  163  ILE A CG1 
1702 C CG2 . ILE A 239 ? 0.8824 1.2591 1.1446 0.0210  -0.0676 0.1413  163  ILE A CG2 
1703 C CD1 . ILE A 239 ? 0.9697 1.3363 1.2693 0.0181  -0.0895 0.1255  163  ILE A CD1 
1704 N N   . VAL A 240 ? 0.8851 1.1874 1.1145 0.0265  -0.0924 0.1547  164  VAL A N   
1705 C CA  . VAL A 240 ? 0.8902 1.1922 1.1048 0.0307  -0.0832 0.1671  164  VAL A CA  
1706 C C   . VAL A 240 ? 0.9319 1.2212 1.1058 0.0452  -0.0837 0.1623  164  VAL A C   
1707 O O   . VAL A 240 ? 0.9026 1.2184 1.0640 0.0514  -0.0702 0.1647  164  VAL A O   
1708 C CB  . VAL A 240 ? 0.9672 1.2426 1.1942 0.0232  -0.0902 0.1788  164  VAL A CB  
1709 C CG1 . VAL A 240 ? 0.9805 1.2491 1.1837 0.0310  -0.0799 0.1914  164  VAL A CG1 
1710 C CG2 . VAL A 240 ? 0.9588 1.2540 1.2303 0.0085  -0.0864 0.1855  164  VAL A CG2 
1711 N N   . PRO A 241 ? 0.9107 1.1638 1.0641 0.0517  -0.0983 0.1550  165  PRO A N   
1712 C CA  . PRO A 241 ? 0.9145 1.1604 1.0318 0.0667  -0.0957 0.1522  165  PRO A CA  
1713 C C   . PRO A 241 ? 0.9499 1.2289 1.0634 0.0690  -0.0847 0.1427  165  PRO A C   
1714 O O   . PRO A 241 ? 0.9513 1.2489 1.0476 0.0772  -0.0751 0.1446  165  PRO A O   
1715 C CB  . PRO A 241 ? 0.9581 1.1561 1.0566 0.0729  -0.1134 0.1458  165  PRO A CB  
1716 C CG  . PRO A 241 ? 1.0280 1.2046 1.1497 0.0610  -0.1270 0.1484  165  PRO A CG  
1717 C CD  . PRO A 241 ? 0.9461 1.1626 1.1064 0.0473  -0.1180 0.1496  165  PRO A CD  
1718 N N   . LEU A 242 ? 0.8887 1.1755 1.0181 0.0616  -0.0858 0.1325  166  LEU A N   
1719 C CA  . LEU A 242 ? 0.8648 1.1767 0.9893 0.0615  -0.0753 0.1224  166  LEU A CA  
1720 C C   . LEU A 242 ? 0.8981 1.2529 1.0295 0.0578  -0.0599 0.1271  166  LEU A C   
1721 O O   . LEU A 242 ? 0.8862 1.2620 1.0050 0.0603  -0.0513 0.1215  166  LEU A O   
1722 C CB  . LEU A 242 ? 0.8565 1.1638 0.9950 0.0553  -0.0791 0.1122  166  LEU A CB  
1723 C CG  . LEU A 242 ? 0.9006 1.2247 1.0310 0.0542  -0.0681 0.1006  166  LEU A CG  
1724 C CD1 . LEU A 242 ? 0.9084 1.2128 1.0109 0.0632  -0.0683 0.0930  166  LEU A CD1 
1725 C CD2 . LEU A 242 ? 0.9357 1.2561 1.0803 0.0496  -0.0706 0.0936  166  LEU A CD2 
1726 N N   . VAL A 243 ? 0.8489 1.2160 1.0000 0.0522  -0.0565 0.1373  167  VAL A N   
1727 C CA  . VAL A 243 ? 0.8378 1.2416 0.9926 0.0510  -0.0424 0.1424  167  VAL A CA  
1728 C C   . VAL A 243 ? 0.9205 1.3317 1.0539 0.0616  -0.0389 0.1492  167  VAL A C   
1729 O O   . VAL A 243 ? 0.9120 1.3530 1.0357 0.0645  -0.0308 0.1454  167  VAL A O   
1730 C CB  . VAL A 243 ? 0.8795 1.2921 1.0601 0.0439  -0.0376 0.1528  167  VAL A CB  
1731 C CG1 . VAL A 243 ? 0.8707 1.3164 1.0482 0.0464  -0.0228 0.1589  167  VAL A CG1 
1732 C CG2 . VAL A 243 ? 0.8659 1.2784 1.0680 0.0357  -0.0398 0.1462  167  VAL A CG2 
1733 N N   . TRP A 244 ? 0.9055 1.2888 1.0298 0.0681  -0.0458 0.1584  168  TRP A N   
1734 C CA  . TRP A 244 ? 0.9197 1.3073 1.0203 0.0816  -0.0423 0.1658  168  TRP A CA  
1735 C C   . TRP A 244 ? 0.9647 1.3605 1.0467 0.0894  -0.0429 0.1564  168  TRP A C   
1736 O O   . TRP A 244 ? 0.9665 1.3895 1.0359 0.0983  -0.0363 0.1586  168  TRP A O   
1737 C CB  . TRP A 244 ? 0.9346 1.2832 1.0243 0.0875  -0.0492 0.1773  168  TRP A CB  
1738 C CG  . TRP A 244 ? 0.9578 1.3032 1.0631 0.0813  -0.0442 0.1898  168  TRP A CG  
1739 C CD1 . TRP A 244 ? 1.0021 1.3253 1.1308 0.0686  -0.0504 0.1928  168  TRP A CD1 
1740 C CD2 . TRP A 244 ? 0.9592 1.3273 1.0599 0.0873  -0.0308 0.2009  168  TRP A CD2 
1741 N NE1 . TRP A 244 ? 1.0059 1.3352 1.1459 0.0654  -0.0401 0.2064  168  TRP A NE1 
1742 C CE2 . TRP A 244 ? 1.0217 1.3762 1.1423 0.0778  -0.0275 0.2117  168  TRP A CE2 
1743 C CE3 . TRP A 244 ? 0.9723 1.3711 1.0535 0.1006  -0.0216 0.2029  168  TRP A CE3 
1744 C CZ2 . TRP A 244 ? 1.0230 1.3895 1.1413 0.0824  -0.0134 0.2251  168  TRP A CZ2 
1745 C CZ3 . TRP A 244 ? 1.0009 1.4120 1.0783 0.1063  -0.0098 0.2152  168  TRP A CZ3 
1746 C CH2 . TRP A 244 ? 1.0214 1.4147 1.1157 0.0978  -0.0048 0.2265  168  TRP A CH2 
1747 N N   . CYS A 245 ? 0.9099 1.2843 0.9909 0.0865  -0.0501 0.1461  169  CYS A N   
1748 C CA  . CYS A 245 ? 0.9019 1.2805 0.9673 0.0929  -0.0487 0.1375  169  CYS A CA  
1749 C C   . CYS A 245 ? 0.9292 1.3525 1.0021 0.0858  -0.0381 0.1291  169  CYS A C   
1750 O O   . CYS A 245 ? 0.9236 1.3714 0.9867 0.0923  -0.0330 0.1282  169  CYS A O   
1751 C CB  . CYS A 245 ? 0.9095 1.2510 0.9708 0.0919  -0.0575 0.1289  169  CYS A CB  
1752 S SG  . CYS A 245 ? 0.9570 1.2987 0.9988 0.0999  -0.0526 0.1195  169  CYS A SG  
1753 N N   . MET A 246 ? 0.8732 1.3075 0.9634 0.0729  -0.0350 0.1232  170  MET A N   
1754 C CA  . MET A 246 ? 0.8612 1.3315 0.9556 0.0647  -0.0258 0.1140  170  MET A CA  
1755 C C   . MET A 246 ? 0.9145 1.4219 1.0070 0.0689  -0.0201 0.1205  170  MET A C   
1756 O O   . MET A 246 ? 0.9050 1.4447 0.9947 0.0659  -0.0151 0.1129  170  MET A O   
1757 C CB  . MET A 246 ? 0.8836 1.3509 0.9919 0.0531  -0.0237 0.1079  170  MET A CB  
1758 C CG  . MET A 246 ? 0.9324 1.3678 1.0396 0.0503  -0.0285 0.0989  170  MET A CG  
1759 S SD  . MET A 246 ? 0.9791 1.4115 1.0998 0.0403  -0.0254 0.0920  170  MET A SD  
1760 C CE  . MET A 246 ? 0.9369 1.3676 1.0800 0.0405  -0.0299 0.1070  170  MET A CE  
1761 N N   . ALA A 247 ? 0.8832 1.3847 0.9756 0.0763  -0.0212 0.1343  171  ALA A N   
1762 C CA  . ALA A 247 ? 0.8840 1.4151 0.9696 0.0846  -0.0158 0.1422  171  ALA A CA  
1763 C C   . ALA A 247 ? 0.9563 1.5022 1.0253 0.0978  -0.0169 0.1436  171  ALA A C   
1764 O O   . ALA A 247 ? 0.9424 1.5277 1.0077 0.1011  -0.0133 0.1407  171  ALA A O   
1765 C CB  . ALA A 247 ? 0.9033 1.4162 0.9913 0.0892  -0.0148 0.1573  171  ALA A CB  
1766 N N   . CYS A 248 ? 0.9379 1.4526 0.9967 0.1061  -0.0225 0.1477  172  CYS A N   
1767 C CA  . CYS A 248 ? 0.9505 1.4743 0.9924 0.1213  -0.0228 0.1508  172  CYS A CA  
1768 C C   . CYS A 248 ? 0.9705 1.5265 1.0179 0.1155  -0.0197 0.1380  172  CYS A C   
1769 O O   . CYS A 248 ? 0.9654 1.5555 1.0073 0.1250  -0.0172 0.1394  172  CYS A O   
1770 C CB  . CYS A 248 ? 0.9815 1.4572 1.0087 0.1308  -0.0292 0.1570  172  CYS A CB  
1771 S SG  . CYS A 248 ? 1.0624 1.4973 1.0806 0.1371  -0.0331 0.1726  172  CYS A SG  
1772 N N   . LEU A 249 ? 0.9001 1.4450 0.9580 0.1003  -0.0195 0.1260  173  LEU A N   
1773 C CA  . LEU A 249 ? 0.8729 1.4418 0.9358 0.0919  -0.0149 0.1134  173  LEU A CA  
1774 C C   . LEU A 249 ? 0.9103 1.5266 0.9827 0.0821  -0.0110 0.1061  173  LEU A C   
1775 O O   . LEU A 249 ? 0.9021 1.5534 0.9780 0.0796  -0.0081 0.0996  173  LEU A O   
1776 C CB  . LEU A 249 ? 0.8632 1.3994 0.9292 0.0804  -0.0147 0.1033  173  LEU A CB  
1777 C CG  . LEU A 249 ? 0.9220 1.4082 0.9760 0.0899  -0.0203 0.1075  173  LEU A CG  
1778 C CD1 . LEU A 249 ? 0.9158 1.3729 0.9719 0.0798  -0.0204 0.0968  173  LEU A CD1 
1779 C CD2 . LEU A 249 ? 0.9631 1.4495 1.0034 0.1044  -0.0183 0.1118  173  LEU A CD2 
1780 N N   . SER A 250 ? 0.8679 1.4856 0.9445 0.0769  -0.0109 0.1074  174  SER A N   
1781 C CA  . SER A 250 ? 0.8643 1.5207 0.9445 0.0698  -0.0082 0.1008  174  SER A CA  
1782 C C   . SER A 250 ? 0.9282 1.6233 1.0019 0.0840  -0.0096 0.1076  174  SER A C   
1783 O O   . SER A 250 ? 0.9244 1.6601 1.0003 0.0794  -0.0096 0.0991  174  SER A O   
1784 C CB  . SER A 250 ? 0.9053 1.5477 0.9884 0.0649  -0.0064 0.1034  174  SER A CB  
1785 O OG  . SER A 250 ? 0.9985 1.6100 1.0878 0.0534  -0.0055 0.0970  174  SER A OG  
1786 N N   . SER A 251 ? 0.8938 1.5745 0.9574 0.1020  -0.0112 0.1224  175  SER A N   
1787 C CA  . SER A 251 ? 0.8996 1.6106 0.9522 0.1202  -0.0118 0.1312  175  SER A CA  
1788 C C   . SER A 251 ? 0.9346 1.6661 0.9849 0.1303  -0.0129 0.1315  175  SER A C   
1789 O O   . SER A 251 ? 0.9461 1.6967 0.9845 0.1499  -0.0135 0.1411  175  SER A O   
1790 C CB  . SER A 251 ? 0.9674 1.6473 1.0064 0.1351  -0.0110 0.1481  175  SER A CB  
1791 O OG  . SER A 251 ? 1.0908 1.7271 1.1242 0.1398  -0.0131 0.1549  175  SER A OG  
1792 N N   . LEU A 252 ? 0.8638 1.5910 0.9241 0.1187  -0.0119 0.1218  176  LEU A N   
1793 C CA  . LEU A 252 ? 0.8529 1.6011 0.9140 0.1275  -0.0105 0.1226  176  LEU A CA  
1794 C C   . LEU A 252 ? 0.9012 1.7127 0.9770 0.1203  -0.0106 0.1123  176  LEU A C   
1795 O O   . LEU A 252 ? 0.8985 1.7461 0.9720 0.1368  -0.0116 0.1186  176  LEU A O   
1796 C CB  . LEU A 252 ? 0.8467 1.5600 0.9097 0.1206  -0.0075 0.1184  176  LEU A CB  
1797 C CG  . LEU A 252 ? 0.9139 1.5673 0.9603 0.1314  -0.0098 0.1284  176  LEU A CG  
1798 C CD1 . LEU A 252 ? 0.9163 1.5349 0.9644 0.1215  -0.0078 0.1206  176  LEU A CD1 
1799 C CD2 . LEU A 252 ? 0.9483 1.5972 0.9757 0.1572  -0.0102 0.1431  176  LEU A CD2 
1800 N N   . PRO A 253 ? 0.8573 1.6847 0.9469 0.0971  -0.0104 0.0966  177  PRO A N   
1801 C CA  . PRO A 253 ? 0.8511 1.7395 0.9548 0.0890  -0.0128 0.0858  177  PRO A CA  
1802 C C   . PRO A 253 ? 0.9126 1.8384 1.0081 0.1058  -0.0189 0.0917  177  PRO A C   
1803 O O   . PRO A 253 ? 0.9084 1.8895 1.0140 0.1053  -0.0234 0.0851  177  PRO A O   
1804 C CB  . PRO A 253 ? 0.8677 1.7494 0.9788 0.0624  -0.0119 0.0692  177  PRO A CB  
1805 C CG  . PRO A 253 ? 0.9237 1.7461 1.0296 0.0565  -0.0066 0.0705  177  PRO A CG  
1806 C CD  . PRO A 253 ? 0.8735 1.6648 0.9653 0.0777  -0.0084 0.0875  177  PRO A CD  
1807 N N   . THR A 254 ? 0.8826 1.7775 0.9595 0.1215  -0.0190 0.1046  178  THR A N   
1808 C CA  . THR A 254 ? 0.8931 1.8107 0.9551 0.1421  -0.0224 0.1135  178  THR A CA  
1809 C C   . THR A 254 ? 0.9503 1.8867 1.0048 0.1671  -0.0224 0.1258  178  THR A C   
1810 O O   . THR A 254 ? 0.9549 1.9420 1.0085 0.1800  -0.0268 0.1258  178  THR A O   
1811 C CB  . THR A 254 ? 1.0166 1.8873 1.0624 0.1474  -0.0193 0.1237  178  THR A CB  
1812 O OG1 . THR A 254 ? 1.0372 1.8889 1.0913 0.1253  -0.0179 0.1131  178  THR A OG1 
1813 C CG2 . THR A 254 ? 1.0000 1.8882 1.0269 0.1686  -0.0203 0.1331  178  THR A CG2 
1814 N N   . PHE A 255 ? 0.9043 1.7996 0.9516 0.1751  -0.0180 0.1360  179  PHE A N   
1815 C CA  . PHE A 255 ? 0.9149 1.8163 0.9493 0.2011  -0.0164 0.1494  179  PHE A CA  
1816 C C   . PHE A 255 ? 0.9582 1.9159 1.0127 0.2002  -0.0165 0.1429  179  PHE A C   
1817 O O   . PHE A 255 ? 0.9685 1.9581 1.0160 0.2238  -0.0165 0.1522  179  PHE A O   
1818 C CB  . PHE A 255 ? 0.9466 1.7825 0.9665 0.2066  -0.0125 0.1593  179  PHE A CB  
1819 C CG  . PHE A 255 ? 0.9937 1.8168 0.9879 0.2373  -0.0104 0.1763  179  PHE A CG  
1820 C CD1 . PHE A 255 ? 1.0395 1.8836 1.0352 0.2499  -0.0074 0.1796  179  PHE A CD1 
1821 C CD2 . PHE A 255 ? 1.0462 1.8317 1.0131 0.2539  -0.0100 0.1898  179  PHE A CD2 
1822 C CE1 . PHE A 255 ? 1.0783 1.9076 1.0458 0.2809  -0.0046 0.1960  179  PHE A CE1 
1823 C CE2 . PHE A 255 ? 1.1135 1.8811 1.0513 0.2830  -0.0074 0.2055  179  PHE A CE2 
1824 C CZ  . PHE A 255 ? 1.0930 1.8822 1.0298 0.2973  -0.0050 0.2085  179  PHE A CZ  
1825 N N   . TYR A 256 ? 0.8887 1.8588 0.9682 0.1735  -0.0155 0.1278  180  TYR A N   
1826 C CA  . TYR A 256 ? 0.8761 1.8976 0.9790 0.1689  -0.0137 0.1218  180  TYR A CA  
1827 C C   . TYR A 256 ? 0.9366 2.0311 1.0573 0.1633  -0.0216 0.1113  180  TYR A C   
1828 O O   . TYR A 256 ? 0.9352 2.0842 1.0759 0.1657  -0.0216 0.1096  180  TYR A O   
1829 C CB  . TYR A 256 ? 0.8710 1.8719 0.9917 0.1422  -0.0075 0.1103  180  TYR A CB  
1830 C CG  . TYR A 256 ? 0.8883 1.8158 0.9921 0.1442  -0.0019 0.1168  180  TYR A CG  
1831 C CD1 . TYR A 256 ? 0.9263 1.8241 1.0096 0.1697  0.0011  0.1328  180  TYR A CD1 
1832 C CD2 . TYR A 256 ? 0.8849 1.7742 0.9929 0.1207  0.0004  0.1058  180  TYR A CD2 
1833 C CE1 . TYR A 256 ? 0.9302 1.7599 0.9966 0.1715  0.0037  0.1372  180  TYR A CE1 
1834 C CE2 . TYR A 256 ? 0.8974 1.7226 0.9907 0.1233  0.0037  0.1105  180  TYR A CE2 
1835 C CZ  . TYR A 256 ? 0.9841 1.7800 1.0572 0.1481  0.0045  0.1257  180  TYR A CZ  
1836 O OH  . TYR A 256 ? 0.9920 1.7237 1.0491 0.1507  0.0053  0.1290  180  TYR A OH  
1837 N N   . PHE A 257 ? 0.8961 1.9931 1.0102 0.1560  -0.0285 0.1039  181  PHE A N   
1838 C CA  . PHE A 257 ? 0.8956 2.0586 1.0240 0.1498  -0.0382 0.0917  181  PHE A CA  
1839 C C   . PHE A 257 ? 0.9751 2.1566 1.0802 0.1766  -0.0452 0.0999  181  PHE A C   
1840 O O   . PHE A 257 ? 0.9740 2.2188 1.0879 0.1851  -0.0536 0.0957  181  PHE A O   
1841 C CB  . PHE A 257 ? 0.9105 2.0681 1.0496 0.1172  -0.0412 0.0723  181  PHE A CB  
1842 C CG  . PHE A 257 ? 0.9186 2.0680 1.0809 0.0905  -0.0343 0.0622  181  PHE A CG  
1843 C CD1 . PHE A 257 ? 0.9518 2.1585 1.1437 0.0767  -0.0361 0.0519  181  PHE A CD1 
1844 C CD2 . PHE A 257 ? 0.9375 2.0222 1.0921 0.0796  -0.0255 0.0631  181  PHE A CD2 
1845 C CE1 . PHE A 257 ? 0.9560 2.1514 1.1676 0.0524  -0.0271 0.0437  181  PHE A CE1 
1846 C CE2 . PHE A 257 ? 0.9662 2.0395 1.1377 0.0576  -0.0176 0.0544  181  PHE A CE2 
1847 C CZ  . PHE A 257 ? 0.9410 2.0678 1.1399 0.0442  -0.0173 0.0453  181  PHE A CZ  
1848 N N   . ARG A 258 ? 0.9583 2.0872 1.0346 0.1904  -0.0415 0.1117  182  ARG A N   
1849 C CA  . ARG A 258 ? 0.9824 2.1238 1.0329 0.2178  -0.0454 0.1210  182  ARG A CA  
1850 C C   . ARG A 258 ? 1.0617 2.2343 1.1045 0.2490  -0.0451 0.1344  182  ARG A C   
1851 O O   . ARG A 258 ? 1.0627 2.2046 1.0997 0.2589  -0.0374 0.1465  182  ARG A O   
1852 C CB  . ARG A 258 ? 0.9960 2.0717 1.0193 0.2249  -0.0387 0.1326  182  ARG A CB  
1853 C CG  . ARG A 258 ? 1.1168 2.1751 1.1411 0.2036  -0.0398 0.1214  182  ARG A CG  
1854 C CD  . ARG A 258 ? 1.2811 2.3826 1.2948 0.2129  -0.0482 0.1147  182  ARG A CD  
1855 N NE  . ARG A 258 ? 1.4374 2.5244 1.4497 0.1937  -0.0492 0.1031  182  ARG A NE  
1856 C CZ  . ARG A 258 ? 1.7407 2.8541 1.7391 0.1999  -0.0562 0.0960  182  ARG A CZ  
1857 N NH1 . ARG A 258 ? 1.6613 2.8180 1.6468 0.2251  -0.0635 0.0993  182  ARG A NH1 
1858 N NH2 . ARG A 258 ? 1.6071 2.7019 1.6013 0.1833  -0.0559 0.0861  182  ARG A NH2 
1859 N N   . ASP A 259 ? 1.0365 2.2728 1.0797 0.2642  -0.0543 0.1311  183  ASP A N   
1860 C CA  . ASP A 259 ? 1.0494 2.3271 1.0858 0.2966  -0.0553 0.1428  183  ASP A CA  
1861 C C   . ASP A 259 ? 1.1123 2.4447 1.1373 0.3162  -0.0666 0.1393  183  ASP A C   
1862 O O   . ASP A 259 ? 1.1054 2.4615 1.1403 0.2979  -0.0763 0.1228  183  ASP A O   
1863 C CB  . ASP A 259 ? 1.0573 2.3808 1.1300 0.2863  -0.0549 0.1379  183  ASP A CB  
1864 C CG  . ASP A 259 ? 1.2033 2.5590 1.2689 0.3210  -0.0519 0.1535  183  ASP A CG  
1865 O OD1 . ASP A 259 ? 1.2359 2.5476 1.2640 0.3502  -0.0449 0.1717  183  ASP A OD1 
1866 O OD2 . ASP A 259 ? 1.2548 2.6739 1.3528 0.3174  -0.0546 0.1485  183  ASP A OD2 
1867 N N   . VAL A 260 ? 1.0792 2.4281 1.0795 0.3551  -0.0656 0.1547  184  VAL A N   
1868 C CA  . VAL A 260 ? 1.0916 2.4925 1.0760 0.3806  -0.0763 0.1532  184  VAL A CA  
1869 C C   . VAL A 260 ? 1.1203 2.6140 1.1441 0.3743  -0.0897 0.1393  184  VAL A C   
1870 O O   . VAL A 260 ? 1.1091 2.6320 1.1535 0.3797  -0.0861 0.1450  184  VAL A O   
1871 C CB  . VAL A 260 ? 1.1736 2.5527 1.1129 0.4266  -0.0686 0.1757  184  VAL A CB  
1872 C CG1 . VAL A 260 ? 1.1947 2.6401 1.1202 0.4579  -0.0803 0.1745  184  VAL A CG1 
1873 C CG2 . VAL A 260 ? 1.1875 2.4809 1.0895 0.4301  -0.0570 0.1872  184  VAL A CG2 
1874 N N   . ARG A 261 ? 1.0746 2.6130 1.1091 0.3617  -0.1052 0.1208  185  ARG A N   
1875 C CA  . ARG A 261 ? 1.0643 2.6940 1.1376 0.3521  -0.1213 0.1046  185  ARG A CA  
1876 C C   . ARG A 261 ? 1.1546 2.8292 1.2083 0.3723  -0.1385 0.0965  185  ARG A C   
1877 O O   . ARG A 261 ? 1.1654 2.8006 1.1900 0.3708  -0.1402 0.0923  185  ARG A O   
1878 C CB  . ARG A 261 ? 1.0185 2.6555 1.1343 0.3023  -0.1250 0.0836  185  ARG A CB  
1879 C CG  . ARG A 261 ? 1.0732 2.6705 1.2099 0.2816  -0.1089 0.0895  185  ARG A CG  
1880 C CD  . ARG A 261 ? 1.1248 2.7682 1.2862 0.2956  -0.1036 0.0998  185  ARG A CD  
1881 N NE  . ARG A 261 ? 1.1218 2.7150 1.2930 0.2809  -0.0868 0.1073  185  ARG A NE  
1882 C CZ  . ARG A 261 ? 1.2520 2.8532 1.4612 0.2447  -0.0837 0.0950  185  ARG A CZ  
1883 N NH1 . ARG A 261 ? 1.1205 2.6706 1.3318 0.2365  -0.0679 0.1031  185  ARG A NH1 
1884 N NH2 . ARG A 261 ? 1.0289 2.6858 1.2717 0.2166  -0.0962 0.0741  185  ARG A NH2 
1885 N N   . THR A 262 ? 1.1310 2.8889 1.2003 0.3927  -0.1510 0.0946  186  THR A N   
1886 C CA  . THR A 262 ? 1.1614 2.9706 1.2122 0.4164  -0.1697 0.0866  186  THR A CA  
1887 C C   . THR A 262 ? 1.2062 3.0453 1.2807 0.3795  -0.1885 0.0585  186  THR A C   
1888 O O   . THR A 262 ? 1.1799 3.0630 1.3042 0.3451  -0.1955 0.0433  186  THR A O   
1889 C CB  . THR A 262 ? 1.2882 3.1822 1.3526 0.4492  -0.1781 0.0929  186  THR A CB  
1890 O OG1 . THR A 262 ? 1.2769 3.2397 1.4033 0.4191  -0.1860 0.0795  186  THR A OG1 
1891 C CG2 . THR A 262 ? 1.2843 3.1455 1.3191 0.4887  -0.1591 0.1211  186  THR A CG2 
1892 N N   . ILE A 263 ? 1.1904 2.9994 1.2264 0.3864  -0.1950 0.0523  187  ILE A N   
1893 C CA  . ILE A 263 ? 1.1963 3.0231 1.2420 0.3565  -0.2131 0.0262  187  ILE A CA  
1894 C C   . ILE A 263 ? 1.2807 3.1921 1.3257 0.3796  -0.2385 0.0147  187  ILE A C   
1895 O O   . ILE A 263 ? 1.3097 3.2124 1.3075 0.4156  -0.2432 0.0198  187  ILE A O   
1896 C CB  . ILE A 263 ? 1.2484 2.9910 1.2513 0.3517  -0.2044 0.0267  187  ILE A CB  
1897 C CG1 . ILE A 263 ? 1.2302 2.8908 1.2323 0.3355  -0.1791 0.0414  187  ILE A CG1 
1898 C CG2 . ILE A 263 ? 1.2617 3.0147 1.2697 0.3209  -0.2219 -0.0001 187  ILE A CG2 
1899 C CD1 . ILE A 263 ? 1.2858 2.9439 1.3369 0.2891  -0.1745 0.0309  187  ILE A CD1 
1900 N N   . GLU A 264 ? 1.2310 3.2254 1.3293 0.3602  -0.2538 0.0003  188  GLU A N   
1901 C CA  . GLU A 264 ? 1.2460 3.3377 1.3595 0.3772  -0.2801 -0.0120 188  GLU A CA  
1902 C C   . GLU A 264 ? 1.3425 3.4374 1.4166 0.3888  -0.3018 -0.0285 188  GLU A C   
1903 O O   . GLU A 264 ? 1.3690 3.5047 1.4168 0.4313  -0.3140 -0.0245 188  GLU A O   
1904 C CB  . GLU A 264 ? 1.2384 3.4041 1.4220 0.3355  -0.2931 -0.0312 188  GLU A CB  
1905 N N   . TYR A 265 ? 1.3109 3.3617 1.3770 0.3544  -0.3061 -0.0464 189  TYR A N   
1906 C CA  . TYR A 265 ? 1.3530 3.4039 1.3800 0.3639  -0.3271 -0.0634 189  TYR A CA  
1907 C C   . TYR A 265 ? 1.4263 3.4047 1.3820 0.4066  -0.3122 -0.0442 189  TYR A C   
1908 O O   . TYR A 265 ? 1.4652 3.4344 1.3799 0.4209  -0.3260 -0.0548 189  TYR A O   
1909 C CB  . TYR A 265 ? 1.3721 3.3976 1.4111 0.3137  -0.3360 -0.0889 189  TYR A CB  
1910 C CG  . TYR A 265 ? 1.3783 3.3093 1.4070 0.2889  -0.3095 -0.0803 189  TYR A CG  
1911 C CD1 . TYR A 265 ? 1.3642 3.2852 1.4392 0.2519  -0.2951 -0.0788 189  TYR A CD1 
1912 C CD2 . TYR A 265 ? 1.4123 3.2663 1.3860 0.3013  -0.2998 -0.0751 189  TYR A CD2 
1913 C CE1 . TYR A 265 ? 1.3605 3.1972 1.4259 0.2300  -0.2726 -0.0722 189  TYR A CE1 
1914 C CE2 . TYR A 265 ? 1.4062 3.1788 1.3736 0.2788  -0.2766 -0.0675 189  TYR A CE2 
1915 C CZ  . TYR A 265 ? 1.4602 3.2250 1.4733 0.2434  -0.2640 -0.0666 189  TYR A CZ  
1916 O OH  . TYR A 265 ? 1.4456 3.1324 1.4518 0.2230  -0.2426 -0.0598 189  TYR A OH  
1917 N N   . LEU A 266 ? 1.3632 3.2913 1.3035 0.4274  -0.2847 -0.0162 190  LEU A N   
1918 C CA  . LEU A 266 ? 1.3862 3.2466 1.2629 0.4669  -0.2679 0.0043  190  LEU A CA  
1919 C C   . LEU A 266 ? 1.4446 3.3217 1.3036 0.5146  -0.2583 0.0284  190  LEU A C   
1920 O O   . LEU A 266 ? 1.4767 3.3167 1.2800 0.5555  -0.2494 0.0436  190  LEU A O   
1921 C CB  . LEU A 266 ? 1.3664 3.1304 1.2319 0.4456  -0.2411 0.0161  190  LEU A CB  
1922 C CG  . LEU A 266 ? 1.4177 3.1442 1.2847 0.4064  -0.2447 -0.0028 190  LEU A CG  
1923 C CD1 . LEU A 266 ? 1.3933 3.0341 1.2565 0.3883  -0.2173 0.0117  190  LEU A CD1 
1924 C CD2 . LEU A 266 ? 1.4919 3.2092 1.3089 0.4274  -0.2574 -0.0124 190  LEU A CD2 
1925 N N   . GLY A 267 ? 1.3679 3.2982 1.2719 0.5097  -0.2588 0.0321  191  GLY A N   
1926 C CA  . GLY A 267 ? 1.3695 3.3181 1.2607 0.5527  -0.2489 0.0549  191  GLY A CA  
1927 C C   . GLY A 267 ? 1.4215 3.2769 1.2743 0.5693  -0.2183 0.0821  191  GLY A C   
1928 O O   . GLY A 267 ? 1.4397 3.2787 1.2470 0.6158  -0.2093 0.1011  191  GLY A O   
1929 N N   . VAL A 268 ? 1.3522 3.1445 1.2218 0.5314  -0.2023 0.0835  192  VAL A N   
1930 C CA  . VAL A 268 ? 1.3514 3.0510 1.1883 0.5399  -0.1750 0.1065  192  VAL A CA  
1931 C C   . VAL A 268 ? 1.3589 3.0325 1.2359 0.5073  -0.1610 0.1118  192  VAL A C   
1932 O O   . VAL A 268 ? 1.3245 3.0315 1.2499 0.4685  -0.1701 0.0944  192  VAL A O   
1933 C CB  . VAL A 268 ? 1.4148 3.0511 1.2196 0.5296  -0.1704 0.1019  192  VAL A CB  
1934 C CG1 . VAL A 268 ? 1.3792 3.0039 1.2221 0.4762  -0.1748 0.0822  192  VAL A CG1 
1935 C CG2 . VAL A 268 ? 1.4288 2.9772 1.1908 0.5491  -0.1442 0.1270  192  VAL A CG2 
1936 N N   . ASN A 269 ? 1.3156 2.9286 1.1701 0.5240  -0.1391 0.1355  193  ASN A N   
1937 C CA  . ASN A 269 ? 1.2786 2.8563 1.1625 0.4971  -0.1254 0.1415  193  ASN A CA  
1938 C C   . ASN A 269 ? 1.3250 2.8193 1.1989 0.4708  -0.1125 0.1427  193  ASN A C   
1939 O O   . ASN A 269 ? 1.3418 2.7707 1.1760 0.4895  -0.0973 0.1600  193  ASN A O   
1940 C CB  . ASN A 269 ? 1.2969 2.8594 1.1640 0.5289  -0.1115 0.1649  193  ASN A CB  
1941 C CG  . ASN A 269 ? 1.5757 3.2245 1.4614 0.5518  -0.1224 0.1647  193  ASN A CG  
1942 O OD1 . ASN A 269 ? 1.5717 3.2940 1.4690 0.5582  -0.1416 0.1504  193  ASN A OD1 
1943 N ND2 . ASN A 269 ? 1.4277 3.0693 1.3151 0.5668  -0.1105 0.1810  193  ASN A ND2 
1944 N N   . ALA A 270 ? 1.2608 2.7589 1.1704 0.4276  -0.1185 0.1239  194  ALA A N   
1945 C CA  . ALA A 270 ? 1.2529 2.6815 1.1575 0.4010  -0.1084 0.1222  194  ALA A CA  
1946 C C   . ALA A 270 ? 1.2884 2.6770 1.2199 0.3739  -0.0963 0.1263  194  ALA A C   
1947 O O   . ALA A 270 ? 1.2575 2.6840 1.2257 0.3580  -0.1005 0.1193  194  ALA A O   
1948 C CB  . ALA A 270 ? 1.2578 2.7097 1.1756 0.3738  -0.1228 0.0983  194  ALA A CB  
1949 N N   . CYS A 271 ? 1.2653 2.5770 1.1783 0.3693  -0.0810 0.1379  195  CYS A N   
1950 C CA  . CYS A 271 ? 1.2477 2.5103 1.1799 0.3445  -0.0700 0.1417  195  CYS A CA  
1951 C C   . CYS A 271 ? 1.2670 2.5303 1.2282 0.3038  -0.0751 0.1215  195  CYS A C   
1952 O O   . CYS A 271 ? 1.2718 2.4927 1.2217 0.2921  -0.0704 0.1196  195  CYS A O   
1953 C CB  . CYS A 271 ? 1.2736 2.4588 1.1751 0.3566  -0.0539 0.1612  195  CYS A CB  
1954 S SG  . CYS A 271 ? 1.3022 2.4217 1.2235 0.3273  -0.0427 0.1650  195  CYS A SG  
1955 N N   . ILE A 272 ? 1.1907 2.5062 1.1875 0.2837  -0.0848 0.1060  196  ILE A N   
1956 C CA  . ILE A 272 ? 1.1663 2.4864 1.1880 0.2454  -0.0903 0.0851  196  ILE A CA  
1957 C C   . ILE A 272 ? 1.1766 2.4656 1.2248 0.2184  -0.0809 0.0840  196  ILE A C   
1958 O O   . ILE A 272 ? 1.1617 2.4292 1.2100 0.2296  -0.0717 0.0986  196  ILE A O   
1959 C CB  . ILE A 272 ? 1.2078 2.6066 1.2518 0.2363  -0.1085 0.0654  196  ILE A CB  
1960 C CG1 . ILE A 272 ? 1.1959 2.6491 1.2738 0.2366  -0.1107 0.0662  196  ILE A CG1 
1961 C CG2 . ILE A 272 ? 1.2512 2.6804 1.2662 0.2631  -0.1202 0.0638  196  ILE A CG2 
1962 C CD1 . ILE A 272 ? 1.2756 2.8048 1.3875 0.2169  -0.1274 0.0449  196  ILE A CD1 
1963 N N   . MET A 273 ? 1.1177 2.4035 1.1850 0.1841  -0.0837 0.0659  197  MET A N   
1964 C CA  . MET A 273 ? 1.0954 2.3549 1.1868 0.1555  -0.0760 0.0606  197  MET A CA  
1965 C C   . MET A 273 ? 1.1380 2.4603 1.2648 0.1418  -0.0824 0.0492  197  MET A C   
1966 O O   . MET A 273 ? 1.1286 2.4778 1.2731 0.1153  -0.0903 0.0297  197  MET A O   
1967 C CB  . MET A 273 ? 1.1247 2.3438 1.2109 0.1295  -0.0743 0.0481  197  MET A CB  
1968 C CG  . MET A 273 ? 1.1541 2.3270 1.2539 0.1057  -0.0636 0.0462  197  MET A CG  
1969 S SD  . MET A 273 ? 1.2009 2.3024 1.2848 0.1207  -0.0497 0.0679  197  MET A SD  
1970 C CE  . MET A 273 ? 1.1424 2.2033 1.2435 0.0886  -0.0419 0.0576  197  MET A CE  
1971 N N   . ALA A 274 ? 1.1012 2.4490 1.2368 0.1617  -0.0791 0.0621  198  ALA A N   
1972 C CA  . ALA A 274 ? 1.1003 2.5160 1.2707 0.1561  -0.0836 0.0561  198  ALA A CA  
1973 C C   . ALA A 274 ? 1.1637 2.5702 1.3650 0.1210  -0.0762 0.0454  198  ALA A C   
1974 O O   . ALA A 274 ? 1.1505 2.5451 1.3628 0.1241  -0.0647 0.0554  198  ALA A O   
1975 C CB  . ALA A 274 ? 1.1114 2.5433 1.2770 0.1901  -0.0781 0.0762  198  ALA A CB  
1976 N N   . PHE A 275 ? 1.1436 2.5582 1.3574 0.0892  -0.0828 0.0247  199  PHE A N   
1977 C CA  . PHE A 275 ? 1.1428 2.5516 1.3846 0.0543  -0.0758 0.0125  199  PHE A CA  
1978 C C   . PHE A 275 ? 1.2105 2.6971 1.4933 0.0461  -0.0800 0.0067  199  PHE A C   
1979 O O   . PHE A 275 ? 1.2130 2.7616 1.5014 0.0636  -0.0929 0.0070  199  PHE A O   
1980 C CB  . PHE A 275 ? 1.1745 2.5587 1.4098 0.0237  -0.0808 -0.0075 199  PHE A CB  
1981 C CG  . PHE A 275 ? 1.2011 2.5159 1.4003 0.0284  -0.0769 -0.0038 199  PHE A CG  
1982 C CD1 . PHE A 275 ? 1.2334 2.4818 1.4227 0.0271  -0.0621 0.0058  199  PHE A CD1 
1983 C CD2 . PHE A 275 ? 1.2436 2.5591 1.4211 0.0294  -0.0879 -0.0128 199  PHE A CD2 
1984 C CE1 . PHE A 275 ? 1.2472 2.4368 1.4091 0.0284  -0.0586 0.0082  199  PHE A CE1 
1985 C CE2 . PHE A 275 ? 1.2838 2.5374 1.4315 0.0318  -0.0824 -0.0094 199  PHE A CE2 
1986 C CZ  . PHE A 275 ? 1.2486 2.4419 1.3912 0.0301  -0.0677 0.0009  199  PHE A CZ  
1987 N N   . PRO A 276 ? 1.1789 2.6679 1.4919 0.0194  -0.0696 0.0006  200  PRO A N   
1988 C CA  . PRO A 276 ? 1.1833 2.7532 1.5407 0.0088  -0.0736 -0.0056 200  PRO A CA  
1989 C C   . PRO A 276 ? 1.2637 2.8892 1.6332 -0.0086 -0.0947 -0.0268 200  PRO A C   
1990 O O   . PRO A 276 ? 1.2647 2.8562 1.6209 -0.0332 -0.0992 -0.0430 200  PRO A O   
1991 C CB  . PRO A 276 ? 1.1995 2.7435 1.5797 -0.0210 -0.0563 -0.0098 200  PRO A CB  
1992 C CG  . PRO A 276 ? 1.2495 2.7031 1.5950 -0.0128 -0.0424 0.0008  200  PRO A CG  
1993 C CD  . PRO A 276 ? 1.1967 2.6180 1.5057 -0.0021 -0.0537 -0.0012 200  PRO A CD  
1994 N N   . PRO A 277 ? 1.2422 2.9489 1.6304 0.0079  -0.1093 -0.0266 201  PRO A N   
1995 C CA  . PRO A 277 ? 1.2611 3.0185 1.6557 -0.0057 -0.1327 -0.0477 201  PRO A CA  
1996 C C   . PRO A 277 ? 1.3226 3.0981 1.7515 -0.0547 -0.1358 -0.0713 201  PRO A C   
1997 O O   . PRO A 277 ? 1.3307 3.1035 1.7480 -0.0740 -0.1512 -0.0914 201  PRO A O   
1998 C CB  . PRO A 277 ? 1.2871 3.1327 1.7020 0.0227  -0.1449 -0.0406 201  PRO A CB  
1999 C CG  . PRO A 277 ? 1.3270 3.1792 1.7610 0.0384  -0.1258 -0.0199 201  PRO A CG  
2000 C CD  . PRO A 277 ? 1.2598 3.0144 1.6602 0.0421  -0.1060 -0.0073 201  PRO A CD  
2001 N N   . GLU A 278 ? 1.2749 3.0632 1.7424 -0.0745 -0.1201 -0.0687 202  GLU A N   
2002 C CA  . GLU A 278 ? 1.2811 3.0819 1.7823 -0.1225 -0.1190 -0.0894 202  GLU A CA  
2003 C C   . GLU A 278 ? 1.3297 3.0393 1.7967 -0.1468 -0.1108 -0.0999 202  GLU A C   
2004 O O   . GLU A 278 ? 1.3482 3.0547 1.8259 -0.1855 -0.1150 -0.1212 202  GLU A O   
2005 C CB  . GLU A 278 ? 1.2878 3.1191 1.8359 -0.1341 -0.0999 -0.0805 202  GLU A CB  
2006 C CG  . GLU A 278 ? 1.4103 3.1751 1.9417 -0.1179 -0.0730 -0.0591 202  GLU A CG  
2007 C CD  . GLU A 278 ? 1.6238 3.3837 2.1335 -0.0688 -0.0681 -0.0334 202  GLU A CD  
2008 O OE1 . GLU A 278 ? 1.5556 3.3694 2.0638 -0.0420 -0.0843 -0.0293 202  GLU A OE1 
2009 O OE2 . GLU A 278 ? 1.4961 3.1989 1.9902 -0.0568 -0.0479 -0.0175 202  GLU A OE2 
2010 N N   . LYS A 279 ? 1.2582 2.8944 1.6837 -0.1227 -0.0993 -0.0845 203  LYS A N   
2011 C CA  . LYS A 279 ? 1.2530 2.8013 1.6426 -0.1361 -0.0902 -0.0895 203  LYS A CA  
2012 C C   . LYS A 279 ? 1.2822 2.7905 1.6253 -0.1045 -0.0964 -0.0801 203  LYS A C   
2013 O O   . LYS A 279 ? 1.2645 2.7156 1.5849 -0.0859 -0.0827 -0.0637 203  LYS A O   
2014 C CB  . LYS A 279 ? 1.2721 2.7671 1.6652 -0.1419 -0.0646 -0.0783 203  LYS A CB  
2015 N N   . TYR A 280 ? 1.2357 2.7762 1.5654 -0.0969 -0.1171 -0.0898 204  TYR A N   
2016 C CA  . TYR A 280 ? 1.2266 2.7334 1.5133 -0.0656 -0.1216 -0.0797 204  TYR A CA  
2017 C C   . TYR A 280 ? 1.3028 2.7505 1.5549 -0.0815 -0.1234 -0.0929 204  TYR A C   
2018 O O   . TYR A 280 ? 1.2888 2.6775 1.5086 -0.0648 -0.1145 -0.0812 204  TYR A O   
2019 C CB  . TYR A 280 ? 1.2352 2.8085 1.5207 -0.0391 -0.1411 -0.0786 204  TYR A CB  
2020 C CG  . TYR A 280 ? 1.2349 2.7764 1.4797 0.0005  -0.1399 -0.0608 204  TYR A CG  
2021 C CD1 . TYR A 280 ? 1.2400 2.7803 1.4828 0.0322  -0.1298 -0.0374 204  TYR A CD1 
2022 C CD2 . TYR A 280 ? 1.2563 2.7662 1.4628 0.0065  -0.1476 -0.0669 204  TYR A CD2 
2023 C CE1 . TYR A 280 ? 1.2442 2.7503 1.4490 0.0663  -0.1272 -0.0209 204  TYR A CE1 
2024 C CE2 . TYR A 280 ? 1.2658 2.7449 1.4363 0.0417  -0.1440 -0.0495 204  TYR A CE2 
2025 C CZ  . TYR A 280 ? 1.3198 2.7965 1.4903 0.0702  -0.1337 -0.0268 204  TYR A CZ  
2026 O OH  . TYR A 280 ? 1.3116 2.7544 1.4463 0.1029  -0.1289 -0.0095 204  TYR A OH  
2027 N N   . ALA A 281 ? 1.2917 2.7555 1.5503 -0.1132 -0.1348 -0.1169 205  ALA A N   
2028 C CA  . ALA A 281 ? 1.3147 2.7251 1.5378 -0.1281 -0.1374 -0.1311 205  ALA A CA  
2029 C C   . ALA A 281 ? 1.3646 2.6967 1.5746 -0.1418 -0.1158 -0.1270 205  ALA A C   
2030 O O   . ALA A 281 ? 1.3688 2.6449 1.5420 -0.1370 -0.1123 -0.1269 205  ALA A O   
2031 C CB  . ALA A 281 ? 1.3521 2.7970 1.5866 -0.1609 -0.1543 -0.1582 205  ALA A CB  
2032 N N   . GLN A 282 ? 1.3130 2.6421 1.5521 -0.1574 -0.1011 -0.1235 206  GLN A N   
2033 C CA  . GLN A 282 ? 1.3075 2.5649 1.5349 -0.1687 -0.0806 -0.1196 206  GLN A CA  
2034 C C   . GLN A 282 ? 1.3323 2.5455 1.5385 -0.1360 -0.0702 -0.0966 206  GLN A C   
2035 O O   . GLN A 282 ? 1.3358 2.4857 1.5143 -0.1356 -0.0614 -0.0947 206  GLN A O   
2036 C CB  . GLN A 282 ? 1.3212 2.5871 1.5834 -0.1921 -0.0668 -0.1216 206  GLN A CB  
2037 C CG  . GLN A 282 ? 1.5550 2.8907 1.8600 -0.1847 -0.0676 -0.1127 206  GLN A CG  
2038 C CD  . GLN A 282 ? 1.8097 3.2228 2.1460 -0.2039 -0.0851 -0.1294 206  GLN A CD  
2039 O OE1 . GLN A 282 ? 1.7653 3.2111 2.0910 -0.1957 -0.1054 -0.1373 206  GLN A OE1 
2040 N NE2 . GLN A 282 ? 1.6943 3.1449 2.0725 -0.2257 -0.0777 -0.1328 206  GLN A NE2 
2041 N N   . TRP A 283 ? 1.2600 2.5077 1.4791 -0.1089 -0.0717 -0.0797 207  TRP A N   
2042 C CA  . TRP A 283 ? 1.2358 2.4479 1.4378 -0.0784 -0.0636 -0.0578 207  TRP A CA  
2043 C C   . TRP A 283 ? 1.2747 2.4630 1.4425 -0.0596 -0.0701 -0.0539 207  TRP A C   
2044 O O   . TRP A 283 ? 1.2647 2.3978 1.4130 -0.0491 -0.0603 -0.0427 207  TRP A O   
2045 C CB  . TRP A 283 ? 1.2078 2.4659 1.4287 -0.0543 -0.0649 -0.0423 207  TRP A CB  
2046 C CG  . TRP A 283 ? 1.2078 2.4586 1.4506 -0.0587 -0.0504 -0.0345 207  TRP A CG  
2047 C CD1 . TRP A 283 ? 1.2443 2.5410 1.5217 -0.0746 -0.0479 -0.0402 207  TRP A CD1 
2048 C CD2 . TRP A 283 ? 1.1958 2.3864 1.4259 -0.0482 -0.0357 -0.0203 207  TRP A CD2 
2049 N NE1 . TRP A 283 ? 1.2281 2.4956 1.5127 -0.0716 -0.0311 -0.0288 207  TRP A NE1 
2050 C CE2 . TRP A 283 ? 1.2410 2.4421 1.4954 -0.0555 -0.0245 -0.0173 207  TRP A CE2 
2051 C CE3 . TRP A 283 ? 1.2082 2.3379 1.4095 -0.0331 -0.0313 -0.0097 207  TRP A CE3 
2052 C CZ2 . TRP A 283 ? 1.2262 2.3756 1.4723 -0.0463 -0.0101 -0.0049 207  TRP A CZ2 
2053 C CZ3 . TRP A 283 ? 1.2185 2.3005 1.4153 -0.0262 -0.0187 0.0018  207  TRP A CZ3 
2054 C CH2 . TRP A 283 ? 1.2234 2.3134 1.4401 -0.0321 -0.0087 0.0037  207  TRP A CH2 
2055 N N   . SER A 284 ? 1.2336 2.4635 1.3943 -0.0546 -0.0862 -0.0625 208  SER A N   
2056 C CA  . SER A 284 ? 1.2396 2.4501 1.3659 -0.0348 -0.0915 -0.0585 208  SER A CA  
2057 C C   . SER A 284 ? 1.2907 2.4415 1.3925 -0.0504 -0.0849 -0.0667 208  SER A C   
2058 O O   . SER A 284 ? 1.2802 2.3911 1.3571 -0.0331 -0.0789 -0.0553 208  SER A O   
2059 C CB  . SER A 284 ? 1.3030 2.5712 1.4256 -0.0279 -0.1111 -0.0690 208  SER A CB  
2060 O OG  . SER A 284 ? 1.4054 2.7305 1.5490 -0.0095 -0.1168 -0.0600 208  SER A OG  
2061 N N   . ALA A 285 ? 1.2592 2.4026 1.3681 -0.0826 -0.0845 -0.0855 209  ALA A N   
2062 C CA  . ALA A 285 ? 1.2732 2.3591 1.3572 -0.0986 -0.0773 -0.0948 209  ALA A CA  
2063 C C   . ALA A 285 ? 1.3015 2.3316 1.3857 -0.0981 -0.0586 -0.0825 209  ALA A C   
2064 O O   . ALA A 285 ? 1.3028 2.2830 1.3625 -0.0950 -0.0511 -0.0800 209  ALA A O   
2065 C CB  . ALA A 285 ? 1.3057 2.4016 1.3956 -0.1332 -0.0829 -0.1191 209  ALA A CB  
2066 N N   . GLY A 286 ? 1.2363 2.2766 1.3475 -0.0994 -0.0517 -0.0749 210  GLY A N   
2067 C CA  . GLY A 286 ? 1.2164 2.2073 1.3287 -0.0978 -0.0361 -0.0641 210  GLY A CA  
2068 C C   . GLY A 286 ? 1.2402 2.2040 1.3409 -0.0697 -0.0320 -0.0436 210  GLY A C   
2069 O O   . GLY A 286 ? 1.2337 2.1460 1.3203 -0.0686 -0.0230 -0.0392 210  GLY A O   
2070 N N   . ILE A 287 ? 1.1814 2.1795 1.2878 -0.0466 -0.0386 -0.0308 211  ILE A N   
2071 C CA  . ILE A 287 ? 1.1690 2.1435 1.2650 -0.0202 -0.0350 -0.0105 211  ILE A CA  
2072 C C   . ILE A 287 ? 1.2503 2.2030 1.3205 -0.0124 -0.0360 -0.0094 211  ILE A C   
2073 O O   . ILE A 287 ? 1.2437 2.1589 1.3052 -0.0001 -0.0288 0.0042  211  ILE A O   
2074 C CB  . ILE A 287 ? 1.1979 2.2144 1.3031 0.0025  -0.0407 0.0021  211  ILE A CB  
2075 C CG1 . ILE A 287 ? 1.1908 2.2252 1.3205 -0.0026 -0.0370 0.0034  211  ILE A CG1 
2076 C CG2 . ILE A 287 ? 1.1995 2.1899 1.2898 0.0295  -0.0373 0.0226  211  ILE A CG2 
2077 C CD1 . ILE A 287 ? 1.2564 2.2374 1.3881 -0.0044 -0.0245 0.0116  211  ILE A CD1 
2078 N N   . ALA A 288 ? 1.2344 2.2084 1.2925 -0.0203 -0.0444 -0.0239 212  ALA A N   
2079 C CA  . ALA A 288 ? 1.2506 2.2019 1.2808 -0.0124 -0.0439 -0.0235 212  ALA A CA  
2080 C C   . ALA A 288 ? 1.3027 2.1988 1.3233 -0.0248 -0.0322 -0.0257 212  ALA A C   
2081 O O   . ALA A 288 ? 1.3018 2.1677 1.3080 -0.0116 -0.0254 -0.0145 212  ALA A O   
2082 C CB  . ALA A 288 ? 1.2849 2.2691 1.3014 -0.0185 -0.0569 -0.0404 212  ALA A CB  
2083 N N   . LEU A 289 ? 1.2564 2.1398 1.2855 -0.0490 -0.0289 -0.0392 213  LEU A N   
2084 C CA  . LEU A 289 ? 1.2561 2.0870 1.2751 -0.0595 -0.0173 -0.0418 213  LEU A CA  
2085 C C   . LEU A 289 ? 1.2686 2.0701 1.2984 -0.0467 -0.0085 -0.0240 213  LEU A C   
2086 O O   . LEU A 289 ? 1.2725 2.0354 1.2915 -0.0428 -0.0006 -0.0186 213  LEU A O   
2087 C CB  . LEU A 289 ? 1.2691 2.0925 1.2925 -0.0873 -0.0148 -0.0600 213  LEU A CB  
2088 C CG  . LEU A 289 ? 1.3681 2.1842 1.3683 -0.1061 -0.0181 -0.0804 213  LEU A CG  
2089 C CD1 . LEU A 289 ? 1.3889 2.1544 1.3592 -0.1013 -0.0092 -0.0791 213  LEU A CD1 
2090 C CD2 . LEU A 289 ? 1.4153 2.2777 1.4110 -0.1043 -0.0336 -0.0885 213  LEU A CD2 
2091 N N   . MET A 290 ? 1.1887 2.0093 1.2389 -0.0391 -0.0104 -0.0146 214  MET A N   
2092 C CA  . MET A 290 ? 1.1630 1.9573 1.2221 -0.0260 -0.0049 0.0020  214  MET A CA  
2093 C C   . MET A 290 ? 1.1846 1.9667 1.2346 -0.0067 -0.0038 0.0173  214  MET A C   
2094 O O   . MET A 290 ? 1.1724 1.9189 1.2236 -0.0023 0.0023  0.0264  214  MET A O   
2095 C CB  . MET A 290 ? 1.1831 2.0037 1.2600 -0.0188 -0.0083 0.0087  214  MET A CB  
2096 C CG  . MET A 290 ? 1.2197 2.0113 1.3017 -0.0043 -0.0047 0.0252  214  MET A CG  
2097 S SD  . MET A 290 ? 1.2670 2.0879 1.3625 0.0083  -0.0081 0.0341  214  MET A SD  
2098 C CE  . MET A 290 ? 1.2194 1.9922 1.3117 0.0245  -0.0050 0.0519  214  MET A CE  
2099 N N   . LYS A 291 ? 1.1307 1.9428 1.1716 0.0046  -0.0095 0.0198  215  LYS A N   
2100 C CA  . LYS A 291 ? 1.1255 1.9288 1.1556 0.0236  -0.0066 0.0348  215  LYS A CA  
2101 C C   . LYS A 291 ? 1.1613 1.9315 1.1786 0.0195  0.0014  0.0334  215  LYS A C   
2102 O O   . LYS A 291 ? 1.1483 1.8938 1.1684 0.0291  0.0084  0.0478  215  LYS A O   
2103 C CB  . LYS A 291 ? 1.1725 2.0147 1.1900 0.0368  -0.0141 0.0348  215  LYS A CB  
2104 C CG  . LYS A 291 ? 1.3027 2.1818 1.3315 0.0455  -0.0216 0.0382  215  LYS A CG  
2105 C CD  . LYS A 291 ? 1.4018 2.3209 1.4163 0.0597  -0.0302 0.0365  215  LYS A CD  
2106 C CE  . LYS A 291 ? 1.4911 2.4493 1.5164 0.0711  -0.0372 0.0408  215  LYS A CE  
2107 N NZ  . LYS A 291 ? 1.5856 2.5836 1.5951 0.0883  -0.0463 0.0397  215  LYS A NZ  
2108 N N   . ASN A 292 ? 1.1151 1.8845 1.1188 0.0048  0.0004  0.0161  216  ASN A N   
2109 C CA  . ASN A 292 ? 1.1145 1.8533 1.1002 0.0017  0.0082  0.0127  216  ASN A CA  
2110 C C   . ASN A 292 ? 1.1257 1.8263 1.1210 -0.0048 0.0168  0.0156  216  ASN A C   
2111 O O   . ASN A 292 ? 1.1218 1.8001 1.1149 0.0042  0.0248  0.0264  216  ASN A O   
2112 C CB  . ASN A 292 ? 1.1180 1.8629 1.0833 -0.0136 0.0036  -0.0085 216  ASN A CB  
2113 C CG  . ASN A 292 ? 1.2429 2.0225 1.1928 -0.0066 -0.0066 -0.0139 216  ASN A CG  
2114 O OD1 . ASN A 292 ? 1.1896 1.9832 1.1286 -0.0211 -0.0147 -0.0326 216  ASN A OD1 
2115 N ND2 . ASN A 292 ? 1.0414 1.8345 0.9888 0.0158  -0.0067 0.0017  216  ASN A ND2 
2116 N N   . ILE A 293 ? 1.0547 1.7489 1.0606 -0.0194 0.0157  0.0062  217  ILE A N   
2117 C CA  . ILE A 293 ? 1.0383 1.6955 1.0495 -0.0250 0.0228  0.0064  217  ILE A CA  
2118 C C   . ILE A 293 ? 1.0558 1.7017 1.0864 -0.0115 0.0237  0.0247  217  ILE A C   
2119 O O   . ILE A 293 ? 1.0510 1.6724 1.0828 -0.0062 0.0295  0.0321  217  ILE A O   
2120 C CB  . ILE A 293 ? 1.0753 1.7293 1.0905 -0.0425 0.0223  -0.0079 217  ILE A CB  
2121 C CG1 . ILE A 293 ? 1.1050 1.7681 1.1024 -0.0595 0.0211  -0.0270 217  ILE A CG1 
2122 C CG2 . ILE A 293 ? 1.0795 1.6921 1.0957 -0.0451 0.0297  -0.0076 217  ILE A CG2 
2123 C CD1 . ILE A 293 ? 1.2077 1.8753 1.2125 -0.0790 0.0213  -0.0408 217  ILE A CD1 
2124 N N   . LEU A 294 ? 0.9882 1.6514 1.0334 -0.0061 0.0177  0.0316  218  LEU A N   
2125 C CA  . LEU A 294 ? 0.9674 1.6157 1.0281 0.0047  0.0169  0.0470  218  LEU A CA  
2126 C C   . LEU A 294 ? 1.0115 1.6624 1.0745 0.0191  0.0188  0.0634  218  LEU A C   
2127 O O   . LEU A 294 ? 0.9966 1.6257 1.0713 0.0241  0.0207  0.0747  218  LEU A O   
2128 C CB  . LEU A 294 ? 0.9583 1.6233 1.0279 0.0077  0.0107  0.0491  218  LEU A CB  
2129 C CG  . LEU A 294 ? 1.0050 1.6485 1.0858 0.0170  0.0083  0.0617  218  LEU A CG  
2130 C CD1 . LEU A 294 ? 1.0060 1.6135 1.0894 0.0100  0.0102  0.0563  218  LEU A CD1 
2131 C CD2 . LEU A 294 ? 1.0201 1.6834 1.1036 0.0231  0.0035  0.0642  218  LEU A CD2 
2132 N N   . GLY A 295 ? 0.9785 1.6554 1.0303 0.0257  0.0183  0.0647  219  GLY A N   
2133 C CA  . GLY A 295 ? 0.9791 1.6587 1.0297 0.0409  0.0222  0.0810  219  GLY A CA  
2134 C C   . GLY A 295 ? 1.0317 1.7024 1.0719 0.0441  0.0311  0.0839  219  GLY A C   
2135 O O   . GLY A 295 ? 1.0333 1.7022 1.0751 0.0566  0.0371  0.0995  219  GLY A O   
2136 N N   . PHE A 296 ? 0.9838 1.6467 1.0113 0.0338  0.0334  0.0697  220  PHE A N   
2137 C CA  . PHE A 296 ? 0.9875 1.6398 1.0013 0.0394  0.0430  0.0730  220  PHE A CA  
2138 C C   . PHE A 296 ? 1.0257 1.6522 1.0356 0.0290  0.0479  0.0633  220  PHE A C   
2139 O O   . PHE A 296 ? 1.0114 1.6209 1.0310 0.0340  0.0558  0.0735  220  PHE A O   
2140 C CB  . PHE A 296 ? 1.0308 1.7025 1.0167 0.0448  0.0415  0.0661  220  PHE A CB  
2141 C CG  . PHE A 296 ? 1.0672 1.7272 1.0342 0.0554  0.0525  0.0722  220  PHE A CG  
2142 C CD1 . PHE A 296 ? 1.1064 1.7675 1.0772 0.0726  0.0612  0.0922  220  PHE A CD1 
2143 C CD2 . PHE A 296 ? 1.1106 1.7567 1.0527 0.0492  0.0552  0.0584  220  PHE A CD2 
2144 C CE1 . PHE A 296 ? 1.1416 1.7921 1.0944 0.0842  0.0735  0.0994  220  PHE A CE1 
2145 C CE2 . PHE A 296 ? 1.1700 1.8035 1.0909 0.0617  0.0664  0.0649  220  PHE A CE2 
2146 C CZ  . PHE A 296 ? 1.1505 1.7876 1.0778 0.0797  0.0759  0.0859  220  PHE A CZ  
2147 N N   . ILE A 297 ? 0.9920 1.6157 0.9879 0.0149  0.0439  0.0441  221  ILE A N   
2148 C CA  . ILE A 297 ? 1.0074 1.6029 0.9912 0.0059  0.0497  0.0332  221  ILE A CA  
2149 C C   . ILE A 297 ? 1.0535 1.6269 1.0591 0.0069  0.0526  0.0410  221  ILE A C   
2150 O O   . ILE A 297 ? 1.0582 1.6153 1.0632 0.0136  0.0608  0.0476  221  ILE A O   
2151 C CB  . ILE A 297 ? 1.0593 1.6539 1.0280 -0.0120 0.0450  0.0119  221  ILE A CB  
2152 C CG1 . ILE A 297 ? 1.0894 1.7089 1.0381 -0.0149 0.0388  0.0017  221  ILE A CG1 
2153 C CG2 . ILE A 297 ? 1.0825 1.6413 1.0341 -0.0202 0.0529  0.0012  221  ILE A CG2 
2154 C CD1 . ILE A 297 ? 1.2486 1.8603 1.1669 -0.0055 0.0443  0.0018  221  ILE A CD1 
2155 N N   . ILE A 298 ? 0.9924 1.5658 1.0162 0.0019  0.0456  0.0404  222  ILE A N   
2156 C CA  . ILE A 298 ? 0.9743 1.5252 1.0158 0.0034  0.0454  0.0458  222  ILE A CA  
2157 C C   . ILE A 298 ? 1.0139 1.5666 1.0765 0.0156  0.0476  0.0650  222  ILE A C   
2158 O O   . ILE A 298 ? 1.0091 1.5457 1.0765 0.0187  0.0529  0.0683  222  ILE A O   
2159 C CB  . ILE A 298 ? 0.9944 1.5438 1.0474 -0.0015 0.0372  0.0426  222  ILE A CB  
2160 C CG1 . ILE A 298 ? 1.0060 1.5514 1.0420 -0.0151 0.0381  0.0244  222  ILE A CG1 
2161 C CG2 . ILE A 298 ? 0.9873 1.5123 1.0568 0.0029  0.0347  0.0491  222  ILE A CG2 
2162 C CD1 . ILE A 298 ? 1.1156 1.6619 1.1608 -0.0190 0.0326  0.0216  222  ILE A CD1 
2163 N N   . PRO A 299 ? 0.9645 1.5358 1.0394 0.0226  0.0449  0.0782  223  PRO A N   
2164 C CA  . PRO A 299 ? 0.9603 1.5300 1.0569 0.0313  0.0488  0.0964  223  PRO A CA  
2165 C C   . PRO A 299 ? 1.0252 1.5947 1.1153 0.0376  0.0611  0.1017  223  PRO A C   
2166 O O   . PRO A 299 ? 1.0212 1.5838 1.1317 0.0412  0.0654  0.1122  223  PRO A O   
2167 C CB  . PRO A 299 ? 0.9795 1.5668 1.0805 0.0379  0.0462  0.1076  223  PRO A CB  
2168 C CG  . PRO A 299 ? 1.0381 1.6425 1.1170 0.0356  0.0423  0.0956  223  PRO A CG  
2169 C CD  . PRO A 299 ? 0.9776 1.5712 1.0484 0.0236  0.0387  0.0779  223  PRO A CD  
2170 N N   . LEU A 300 ? 0.9942 1.5708 1.0557 0.0391  0.0662  0.0941  224  LEU A N   
2171 C CA  . LEU A 300 ? 1.0069 1.5799 1.0556 0.0476  0.0789  0.0989  224  LEU A CA  
2172 C C   . LEU A 300 ? 1.0379 1.5892 1.0848 0.0447  0.0830  0.0923  224  LEU A C   
2173 O O   . LEU A 300 ? 1.0369 1.5852 1.0927 0.0535  0.0928  0.1034  224  LEU A O   
2174 C CB  . LEU A 300 ? 1.0327 1.6137 1.0453 0.0503  0.0811  0.0900  224  LEU A CB  
2175 C CG  . LEU A 300 ? 1.1166 1.6927 1.1071 0.0630  0.0947  0.0961  224  LEU A CG  
2176 C CD1 . LEU A 300 ? 1.1394 1.6920 1.1068 0.0599  0.1003  0.0840  224  LEU A CD1 
2177 C CD2 . LEU A 300 ? 1.1301 1.7133 1.1440 0.0765  0.1057  0.1199  224  LEU A CD2 
2178 N N   . ILE A 301 ? 0.9802 1.5166 1.0167 0.0338  0.0765  0.0756  225  ILE A N   
2179 C CA  . ILE A 301 ? 0.9783 1.4904 1.0091 0.0328  0.0804  0.0687  225  ILE A CA  
2180 C C   . ILE A 301 ? 1.0040 1.5159 1.0703 0.0393  0.0798  0.0830  225  ILE A C   
2181 O O   . ILE A 301 ? 1.0106 1.5172 1.0788 0.0477  0.0886  0.0888  225  ILE A O   
2182 C CB  . ILE A 301 ? 1.0177 1.5118 1.0333 0.0203  0.0743  0.0500  225  ILE A CB  
2183 C CG1 . ILE A 301 ? 1.0461 1.5396 1.0270 0.0116  0.0760  0.0346  225  ILE A CG1 
2184 C CG2 . ILE A 301 ? 1.0329 1.4990 1.0439 0.0227  0.0784  0.0453  225  ILE A CG2 
2185 C CD1 . ILE A 301 ? 1.1519 1.6309 1.1193 -0.0037 0.0719  0.0163  225  ILE A CD1 
2186 N N   . PHE A 302 ? 0.9292 1.4486 1.0232 0.0361  0.0694  0.0893  226  PHE A N   
2187 C CA  . PHE A 302 ? 0.9091 1.4290 1.0391 0.0394  0.0655  0.1018  226  PHE A CA  
2188 C C   . PHE A 302 ? 0.9727 1.5093 1.1224 0.0480  0.0758  0.1202  226  PHE A C   
2189 O O   . PHE A 302 ? 0.9810 1.5170 1.1494 0.0529  0.0796  0.1267  226  PHE A O   
2190 C CB  . PHE A 302 ? 0.9112 1.4327 1.0597 0.0343  0.0524  0.1048  226  PHE A CB  
2191 C CG  . PHE A 302 ? 0.9199 1.4222 1.0591 0.0284  0.0423  0.0907  226  PHE A CG  
2192 C CD1 . PHE A 302 ? 0.9583 1.4589 1.0718 0.0225  0.0417  0.0776  226  PHE A CD1 
2193 C CD2 . PHE A 302 ? 0.9346 1.4214 1.0919 0.0292  0.0329  0.0911  226  PHE A CD2 
2194 C CE1 . PHE A 302 ? 0.9667 1.4490 1.0721 0.0178  0.0349  0.0662  226  PHE A CE1 
2195 C CE2 . PHE A 302 ? 0.9673 1.4332 1.1123 0.0263  0.0248  0.0790  226  PHE A CE2 
2196 C CZ  . PHE A 302 ? 0.9488 1.4122 1.0681 0.0209  0.0272  0.0674  226  PHE A CZ  
2197 N N   . ILE A 303 ? 0.9310 1.4830 1.0761 0.0511  0.0811  0.1290  227  ILE A N   
2198 C CA  . ILE A 303 ? 0.9372 1.5039 1.0990 0.0600  0.0935  0.1483  227  ILE A CA  
2199 C C   . ILE A 303 ? 1.0111 1.5758 1.1576 0.0697  0.1081  0.1493  227  ILE A C   
2200 O O   . ILE A 303 ? 1.0028 1.5755 1.1756 0.0760  0.1167  0.1636  227  ILE A O   
2201 C CB  . ILE A 303 ? 0.9830 1.5619 1.1326 0.0638  0.0966  0.1553  227  ILE A CB  
2202 C CG1 . ILE A 303 ? 0.9737 1.5528 1.1369 0.0568  0.0832  0.1559  227  ILE A CG1 
2203 C CG2 . ILE A 303 ? 1.0036 1.5942 1.1667 0.0746  0.1126  0.1764  227  ILE A CG2 
2204 C CD1 . ILE A 303 ? 1.0784 1.6684 1.2246 0.0619  0.0839  0.1599  227  ILE A CD1 
2205 N N   . ALA A 304 ? 0.9920 1.5454 1.0965 0.0706  0.1108  0.1343  228  ALA A N   
2206 C CA  . ALA A 304 ? 1.0133 1.5582 1.0934 0.0811  0.1247  0.1336  228  ALA A CA  
2207 C C   . ALA A 304 ? 1.0463 1.5806 1.1394 0.0830  0.1253  0.1318  228  ALA A C   
2208 O O   . ALA A 304 ? 1.0544 1.5938 1.1556 0.0951  0.1379  0.1436  228  ALA A O   
2209 C CB  . ALA A 304 ? 1.0456 1.5757 1.0759 0.0785  0.1245  0.1154  228  ALA A CB  
2210 N N   . THR A 305 ? 0.9752 1.4954 1.0700 0.0732  0.1125  0.1180  229  THR A N   
2211 C CA  . THR A 305 ? 0.9672 1.4749 1.0705 0.0766  0.1110  0.1144  229  THR A CA  
2212 C C   . THR A 305 ? 1.0043 1.5327 1.1586 0.0808  0.1095  0.1320  229  THR A C   
2213 O O   . THR A 305 ? 1.0087 1.5395 1.1727 0.0910  0.1162  0.1374  229  THR A O   
2214 C CB  . THR A 305 ? 1.0139 1.5006 1.1062 0.0660  0.0978  0.0968  229  THR A CB  
2215 O OG1 . THR A 305 ? 0.9880 1.4588 1.0374 0.0597  0.1002  0.0811  229  THR A OG1 
2216 C CG2 . THR A 305 ? 0.9990 1.4689 1.0934 0.0723  0.0962  0.0919  229  THR A CG2 
2217 N N   . CYS A 306 ? 0.9390 1.4826 1.1254 0.0732  0.1015  0.1415  230  CYS A N   
2218 C CA  . CYS A 306 ? 0.9246 1.4871 1.1615 0.0736  0.0993  0.1579  230  CYS A CA  
2219 C C   . CYS A 306 ? 1.0031 1.5863 1.2529 0.0843  0.1183  0.1767  230  CYS A C   
2220 O O   . CYS A 306 ? 0.9925 1.5926 1.2819 0.0875  0.1209  0.1894  230  CYS A O   
2221 C CB  . CYS A 306 ? 0.9080 1.4742 1.1690 0.0623  0.0864  0.1621  230  CYS A CB  
2222 S SG  . CYS A 306 ? 0.9432 1.4857 1.1970 0.0527  0.0643  0.1439  230  CYS A SG  
2223 N N   . TYR A 307 ? 0.9942 1.5764 1.2108 0.0907  0.1315  0.1786  231  TYR A N   
2224 C CA  . TYR A 307 ? 1.0193 1.6171 1.2415 0.1039  0.1517  0.1969  231  TYR A CA  
2225 C C   . TYR A 307 ? 1.1115 1.7065 1.3236 0.1173  0.1625  0.1967  231  TYR A C   
2226 O O   . TYR A 307 ? 1.0998 1.7152 1.3484 0.1246  0.1715  0.2130  231  TYR A O   
2227 C CB  . TYR A 307 ? 1.0564 1.6502 1.2397 0.1098  0.1616  0.1979  231  TYR A CB  
2228 C CG  . TYR A 307 ? 1.1076 1.7093 1.2824 0.1278  0.1844  0.2140  231  TYR A CG  
2229 C CD1 . TYR A 307 ? 1.1286 1.7524 1.3443 0.1328  0.1972  0.2380  231  TYR A CD1 
2230 C CD2 . TYR A 307 ? 1.1491 1.7340 1.2733 0.1399  0.1941  0.2057  231  TYR A CD2 
2231 C CE1 . TYR A 307 ? 1.1620 1.7932 1.3705 0.1511  0.2204  0.2545  231  TYR A CE1 
2232 C CE2 . TYR A 307 ? 1.1879 1.7769 1.3000 0.1592  0.2159  0.2211  231  TYR A CE2 
2233 C CZ  . TYR A 307 ? 1.2805 1.8937 1.4353 0.1656  0.2296  0.2461  231  TYR A CZ  
2234 O OH  . TYR A 307 ? 1.3344 1.9518 1.4772 0.1862  0.2532  0.2629  231  TYR A OH  
2235 N N   . PHE A 308 ? 1.1132 1.6831 1.2761 0.1207  0.1623  0.1788  232  PHE A N   
2236 C CA  . PHE A 308 ? 1.1466 1.7068 1.2894 0.1355  0.1733  0.1772  232  PHE A CA  
2237 C C   . PHE A 308 ? 1.2038 1.7691 1.3802 0.1348  0.1634  0.1754  232  PHE A C   
2238 O O   . PHE A 308 ? 1.2124 1.7821 1.3911 0.1497  0.1733  0.1813  232  PHE A O   
2239 C CB  . PHE A 308 ? 1.1976 1.7239 1.2758 0.1369  0.1750  0.1573  232  PHE A CB  
2240 C CG  . PHE A 308 ? 1.2410 1.7627 1.2830 0.1406  0.1842  0.1583  232  PHE A CG  
2241 C CD1 . PHE A 308 ? 1.3092 1.8322 1.3324 0.1597  0.2039  0.1713  232  PHE A CD1 
2242 C CD2 . PHE A 308 ? 1.2656 1.7815 1.2896 0.1268  0.1729  0.1460  232  PHE A CD2 
2243 C CE1 . PHE A 308 ? 1.3443 1.8603 1.3299 0.1651  0.2110  0.1715  232  PHE A CE1 
2244 C CE2 . PHE A 308 ? 1.3230 1.8361 1.3126 0.1316  0.1791  0.1458  232  PHE A CE2 
2245 C CZ  . PHE A 308 ? 1.3263 1.8377 1.2951 0.1508  0.1976  0.1580  232  PHE A CZ  
2246 N N   . GLY A 309 ? 1.1500 1.7159 1.3521 0.1196  0.1441  0.1687  233  GLY A N   
2247 C CA  . GLY A 309 ? 1.1407 1.7118 1.3766 0.1183  0.1311  0.1667  233  GLY A CA  
2248 C C   . GLY A 309 ? 1.2006 1.8080 1.4959 0.1213  0.1345  0.1878  233  GLY A C   
2249 O O   . GLY A 309 ? 1.2012 1.8207 1.5200 0.1298  0.1329  0.1908  233  GLY A O   
2250 N N   . ILE A 310 ? 1.1604 1.7858 1.4801 0.1148  0.1400  0.2028  234  ILE A N   
2251 C CA  . ILE A 310 ? 1.1569 1.8169 1.5338 0.1153  0.1473  0.2251  234  ILE A CA  
2252 C C   . ILE A 310 ? 1.2357 1.9095 1.6043 0.1353  0.1721  0.2389  234  ILE A C   
2253 O O   . ILE A 310 ? 1.2358 1.9353 1.6427 0.1430  0.1767  0.2501  234  ILE A O   
2254 C CB  . ILE A 310 ? 1.1882 1.8555 1.5862 0.1022  0.1471  0.2363  234  ILE A CB  
2255 C CG1 . ILE A 310 ? 1.1749 1.8294 1.5858 0.0843  0.1221  0.2248  234  ILE A CG1 
2256 C CG2 . ILE A 310 ? 1.1989 1.8999 1.6516 0.1033  0.1610  0.2617  234  ILE A CG2 
2257 C CD1 . ILE A 310 ? 1.2658 1.9185 1.6846 0.0727  0.1207  0.2328  234  ILE A CD1 
2258 N N   . ARG A 311 ? 1.2138 1.8700 1.5302 0.1447  0.1870  0.2370  235  ARG A N   
2259 C CA  . ARG A 311 ? 1.2398 1.8997 1.5333 0.1662  0.2115  0.2486  235  ARG A CA  
2260 C C   . ARG A 311 ? 1.3042 1.9626 1.5905 0.1812  0.2141  0.2441  235  ARG A C   
2261 O O   . ARG A 311 ? 1.3145 1.9934 1.6154 0.1985  0.2322  0.2609  235  ARG A O   
2262 C CB  . ARG A 311 ? 1.2666 1.8968 1.4935 0.1709  0.2189  0.2389  235  ARG A CB  
2263 C CG  . ARG A 311 ? 1.4407 2.0654 1.6305 0.1941  0.2436  0.2489  235  ARG A CG  
2264 C CD  . ARG A 311 ? 1.6014 2.1968 1.7285 0.1948  0.2451  0.2368  235  ARG A CD  
2265 N NE  . ARG A 311 ? 1.7579 2.3389 1.8377 0.2177  0.2663  0.2426  235  ARG A NE  
2266 C CZ  . ARG A 311 ? 1.9621 2.5121 1.9879 0.2271  0.2688  0.2279  235  ARG A CZ  
2267 N NH1 . ARG A 311 ? 1.7875 2.3182 1.8007 0.2152  0.2526  0.2068  235  ARG A NH1 
2268 N NH2 . ARG A 311 ? 1.8276 2.3618 1.8081 0.2491  0.2883  0.2343  235  ARG A NH2 
2269 N N   . LYS A 312 ? 1.2577 1.8925 1.5224 0.1760  0.1970  0.2228  236  LYS A N   
2270 C CA  . LYS A 312 ? 1.2665 1.8945 1.5191 0.1909  0.1975  0.2163  236  LYS A CA  
2271 C C   . LYS A 312 ? 1.2909 1.9595 1.6107 0.1944  0.1932  0.2301  236  LYS A C   
2272 O O   . LYS A 312 ? 1.2958 1.9805 1.6208 0.2146  0.2073  0.2406  236  LYS A O   
2273 C CB  . LYS A 312 ? 1.3003 1.8916 1.5168 0.1822  0.1796  0.1906  236  LYS A CB  
2274 C CG  . LYS A 312 ? 1.5031 2.0804 1.6996 0.1988  0.1799  0.1822  236  LYS A CG  
2275 C CD  . LYS A 312 ? 1.6383 2.1809 1.8075 0.1895  0.1619  0.1590  236  LYS A CD  
2276 C CE  . LYS A 312 ? 1.7319 2.2910 1.9519 0.1740  0.1386  0.1571  236  LYS A CE  
2277 N NZ  . LYS A 312 ? 1.8457 2.3687 2.0355 0.1681  0.1235  0.1358  236  LYS A NZ  
2278 N N   . HIS A 313 ? 1.2234 1.9080 1.5931 0.1751  0.1729  0.2294  237  HIS A N   
2279 C CA  . HIS A 313 ? 1.2084 1.9300 1.6446 0.1733  0.1620  0.2382  237  HIS A CA  
2280 C C   . HIS A 313 ? 1.2529 2.0199 1.7413 0.1792  0.1809  0.2655  237  HIS A C   
2281 O O   . HIS A 313 ? 1.2439 2.0463 1.7809 0.1856  0.1789  0.2747  237  HIS A O   
2282 C CB  . HIS A 313 ? 1.1961 1.9159 1.6647 0.1494  0.1359  0.2302  237  HIS A CB  
2283 C CG  . HIS A 313 ? 1.2297 1.9772 1.7555 0.1463  0.1176  0.2316  237  HIS A CG  
2284 N ND1 . HIS A 313 ? 1.2418 2.0309 1.8377 0.1361  0.1168  0.2498  237  HIS A ND1 
2285 C CD2 . HIS A 313 ? 1.2529 1.9906 1.7732 0.1521  0.0994  0.2164  237  HIS A CD2 
2286 C CE1 . HIS A 313 ? 1.2268 2.0323 1.8594 0.1351  0.0961  0.2441  237  HIS A CE1 
2287 N NE2 . HIS A 313 ? 1.2379 2.0132 1.8256 0.1460  0.0849  0.2242  237  HIS A NE2 
2288 N N   . LEU A 314 ? 1.2139 1.9808 1.6923 0.1782  0.1995  0.2785  238  LEU A N   
2289 C CA  . LEU A 314 ? 1.2157 2.0222 1.7405 0.1844  0.2208  0.3058  238  LEU A CA  
2290 C C   . LEU A 314 ? 1.2875 2.0965 1.7799 0.2135  0.2477  0.3162  238  LEU A C   
2291 O O   . LEU A 314 ? 1.2900 2.1389 1.8284 0.2240  0.2629  0.3373  238  LEU A O   
2292 C CB  . LEU A 314 ? 1.2147 2.0198 1.7469 0.1712  0.2295  0.3177  238  LEU A CB  
2293 C CG  . LEU A 314 ? 1.2508 2.0665 1.8354 0.1440  0.2110  0.3194  238  LEU A CG  
2294 C CD1 . LEU A 314 ? 1.2432 2.1049 1.9086 0.1374  0.2081  0.3347  238  LEU A CD1 
2295 C CD2 . LEU A 314 ? 1.2634 2.0482 1.8247 0.1294  0.1825  0.2945  238  LEU A CD2 
2296 N N   . LEU A 315 ? 1.2582 2.0253 1.6734 0.2263  0.2541  0.3022  239  LEU A N   
2297 C CA  . LEU A 315 ? 1.2879 2.0505 1.6647 0.2554  0.2795  0.3113  239  LEU A CA  
2298 C C   . LEU A 315 ? 1.3403 2.1142 1.7237 0.2728  0.2770  0.3082  239  LEU A C   
2299 O O   . LEU A 315 ? 1.3585 2.1489 1.7398 0.2979  0.2989  0.3240  239  LEU A O   
2300 C CB  . LEU A 315 ? 1.3172 2.0282 1.6066 0.2629  0.2867  0.2968  239  LEU A CB  
2301 C CG  . LEU A 315 ? 1.3790 2.0775 1.6482 0.2543  0.2934  0.3008  239  LEU A CG  
2302 C CD1 . LEU A 315 ? 1.4110 2.0607 1.5945 0.2621  0.2972  0.2837  239  LEU A CD1 
2303 C CD2 . LEU A 315 ? 1.4229 2.1521 1.7227 0.2669  0.3191  0.3303  239  LEU A CD2 
2304 N N   . LYS A 316 ? 1.2723 2.0371 1.6619 0.2620  0.2513  0.2888  240  LYS A N   
2305 C CA  . LYS A 316 ? 1.2744 2.0488 1.6688 0.2796  0.2465  0.2846  240  LYS A CA  
2306 C C   . LYS A 316 ? 1.3100 2.1488 1.7920 0.2812  0.2464  0.3054  240  LYS A C   
2307 O O   . LYS A 316 ? 1.3196 2.1819 1.8111 0.3052  0.2565  0.3144  240  LYS A O   
2308 C CB  . LYS A 316 ? 1.2926 2.0345 1.6633 0.2694  0.2199  0.2578  240  LYS A CB  
2309 C CG  . LYS A 316 ? 1.3910 2.1441 1.8108 0.2406  0.1926  0.2507  240  LYS A CG  
2310 C CD  . LYS A 316 ? 1.4816 2.1996 1.8724 0.2350  0.1686  0.2252  240  LYS A CD  
2311 C CE  . LYS A 316 ? 1.5774 2.2382 1.8905 0.2319  0.1712  0.2062  240  LYS A CE  
2312 N NZ  . LYS A 316 ? 1.6399 2.2682 1.9293 0.2269  0.1504  0.1838  240  LYS A NZ  
2313 N N   . THR A 317 ? 1.2383 2.1052 1.7832 0.2559  0.2361  0.3137  241  THR A N   
2314 C CA  . THR A 317 ? 1.2202 2.1486 1.8530 0.2518  0.2365  0.3342  241  THR A CA  
2315 C C   . THR A 317 ? 1.2826 2.2348 1.9251 0.2666  0.2709  0.3615  241  THR A C   
2316 O O   . THR A 317 ? 1.2847 2.2244 1.9178 0.2564  0.2825  0.3694  241  THR A O   
2317 C CB  . THR A 317 ? 1.2877 2.2274 1.9752 0.2183  0.2127  0.3309  241  THR A CB  
2318 N N   . ASN A 318 ? 1.2438 2.2259 1.8966 0.2942  0.2887  0.3756  242  ASN A N   
2319 C CA  . ASN A 318 ? 1.2597 2.2610 1.9131 0.3145  0.3243  0.4022  242  ASN A CA  
2320 C C   . ASN A 318 ? 1.2819 2.3313 2.0177 0.2961  0.3334  0.4270  242  ASN A C   
2321 O O   . ASN A 318 ? 1.2561 2.3589 2.0728 0.2868  0.3246  0.4366  242  ASN A O   
2322 C CB  . ASN A 318 ? 1.2880 2.3144 1.9394 0.3489  0.3396  0.4122  242  ASN A CB  
2323 C CG  . ASN A 318 ? 1.5687 2.6125 2.2147 0.3748  0.3782  0.4403  242  ASN A CG  
2324 O OD1 . ASN A 318 ? 1.4646 2.5568 2.1524 0.3953  0.3927  0.4594  242  ASN A OD1 
2325 N ND2 . ASN A 318 ? 1.5060 2.5139 2.1039 0.3751  0.3959  0.4447  242  ASN A ND2 
2326 N N   . SER A 319 ? 1.2440 2.2721 1.9558 0.2916  0.3516  0.4368  243  SER A N   
2327 C CA  . SER A 319 ? 1.2342 2.2944 2.0064 0.2772  0.3672  0.4616  243  SER A CA  
2328 C C   . SER A 319 ? 1.3105 2.3757 2.0597 0.3060  0.4078  0.4873  243  SER A C   
2329 O O   . SER A 319 ? 1.3281 2.3480 1.9940 0.3266  0.4193  0.4799  243  SER A O   
2330 C CB  . SER A 319 ? 1.2633 2.2899 2.0225 0.2488  0.3531  0.4509  243  SER A CB  
2331 N N   . TYR A 320 ? 1.2691 2.3887 2.0908 0.3086  0.4299  0.5173  244  TYR A N   
2332 C CA  . TYR A 320 ? 1.3071 2.4359 2.1113 0.3399  0.4708  0.5445  244  TYR A CA  
2333 C C   . TYR A 320 ? 1.3658 2.5345 2.2410 0.3295  0.4959  0.5767  244  TYR A C   
2334 O O   . TYR A 320 ? 1.3900 2.5432 2.2314 0.3484  0.5281  0.5955  244  TYR A O   
2335 C CB  . TYR A 320 ? 1.3385 2.4995 2.1493 0.3711  0.4811  0.5520  244  TYR A CB  
2336 C CG  . TYR A 320 ? 1.3293 2.5488 2.2260 0.3579  0.4593  0.5506  244  TYR A CG  
2337 C CD1 . TYR A 320 ? 1.3366 2.5412 2.2176 0.3506  0.4243  0.5214  244  TYR A CD1 
2338 C CD2 . TYR A 320 ? 1.3294 2.6196 2.3216 0.3545  0.4744  0.5787  244  TYR A CD2 
2339 C CE1 . TYR A 320 ? 1.3208 2.5781 2.2767 0.3409  0.4025  0.5190  244  TYR A CE1 
2340 C CE2 . TYR A 320 ? 1.3138 2.6607 2.3862 0.3423  0.4521  0.5763  244  TYR A CE2 
2341 C CZ  . TYR A 320 ? 1.3820 2.7116 2.4342 0.3365  0.4152  0.5459  244  TYR A CZ  
2342 O OH  . TYR A 320 ? 1.3610 2.7449 2.4882 0.3266  0.3912  0.5422  244  TYR A OH  
2343 N N   . GLY A 321 ? 1.3005 2.5171 2.2693 0.3008  0.4819  0.5828  245  GLY A N   
2344 C CA  . GLY A 321 ? 1.3033 2.5580 2.3453 0.2871  0.5052  0.6130  245  GLY A CA  
2345 C C   . GLY A 321 ? 1.3540 2.5751 2.3925 0.2568  0.4968  0.6081  245  GLY A C   
2346 O O   . GLY A 321 ? 1.3686 2.5349 2.3290 0.2649  0.5021  0.6000  245  GLY A O   
2347 N N   . LYS A 322 ? 1.2882 2.5420 2.4111 0.2220  0.4829  0.6129  246  LYS A N   
2348 C CA  . LYS A 322 ? 1.2760 2.5003 2.4047 0.1901  0.4716  0.6080  246  LYS A CA  
2349 C C   . LYS A 322 ? 1.2993 2.4735 2.3677 0.1793  0.4332  0.5714  246  LYS A C   
2350 O O   . LYS A 322 ? 1.2950 2.4227 2.3171 0.1702  0.4294  0.5630  246  LYS A O   
2351 C CB  . LYS A 322 ? 1.2927 2.5670 2.5301 0.1560  0.4649  0.6215  246  LYS A CB  
2352 C CG  . LYS A 322 ? 1.4533 2.6995 2.7067 0.1201  0.4528  0.6182  246  LYS A CG  
2353 C CD  . LYS A 322 ? 1.5228 2.7390 2.7593 0.0966  0.4056  0.5838  246  LYS A CD  
2354 C CE  . LYS A 322 ? 1.6218 2.8093 2.8722 0.0638  0.3955  0.5823  246  LYS A CE  
2355 N NZ  . LYS A 322 ? 1.6973 2.8543 2.9273 0.0445  0.3511  0.5500  246  LYS A NZ  
2356 N N   . ASN A 323 ? 1.2372 2.4213 2.3037 0.1834  0.4067  0.5506  247  ASN A N   
2357 C CA  . ASN A 323 ? 1.2175 2.3594 2.2311 0.1761  0.3711  0.5162  247  ASN A CA  
2358 C C   . ASN A 323 ? 1.2794 2.3634 2.1904 0.1964  0.3795  0.5040  247  ASN A C   
2359 O O   . ASN A 323 ? 1.2696 2.3119 2.1361 0.1844  0.3554  0.4796  247  ASN A O   
2360 C CB  . ASN A 323 ? 1.2235 2.3908 2.2534 0.1847  0.3497  0.5018  247  ASN A CB  
2361 C CG  . ASN A 323 ? 1.5351 2.7614 2.6650 0.1649  0.3351  0.5093  247  ASN A CG  
2362 O OD1 . ASN A 323 ? 1.4599 2.6992 2.6471 0.1350  0.3291  0.5169  247  ASN A OD1 
2363 N ND2 . ASN A 323 ? 1.4399 2.7009 2.5904 0.1808  0.3267  0.5055  247  ASN A ND2 
2364 N N   . ARG A 324 ? 1.2550 2.3368 2.1286 0.2272  0.4131  0.5207  248  ARG A N   
2365 C CA  . ARG A 324 ? 1.2723 2.3002 2.0483 0.2473  0.4216  0.5097  248  ARG A CA  
2366 C C   . ARG A 324 ? 1.3264 2.3232 2.0802 0.2340  0.4265  0.5127  248  ARG A C   
2367 O O   . ARG A 324 ? 1.3271 2.2778 2.0131 0.2336  0.4138  0.4921  248  ARG A O   
2368 C CB  . ARG A 324 ? 1.3074 2.3407 2.0502 0.2851  0.4558  0.5278  248  ARG A CB  
2369 C CG  . ARG A 324 ? 1.4506 2.4267 2.0888 0.3065  0.4597  0.5120  248  ARG A CG  
2370 C CD  . ARG A 324 ? 1.6063 2.5831 2.2071 0.3453  0.4916  0.5284  248  ARG A CD  
2371 N NE  . ARG A 324 ? 1.7506 2.6696 2.2494 0.3635  0.4906  0.5092  248  ARG A NE  
2372 C CZ  . ARG A 324 ? 1.9513 2.8467 2.4036 0.3720  0.4752  0.4865  248  ARG A CZ  
2373 N NH1 . ARG A 324 ? 1.7678 2.6921 2.2633 0.3670  0.4595  0.4802  248  ARG A NH1 
2374 N NH2 . ARG A 324 ? 1.8308 2.6721 2.1917 0.3857  0.4752  0.4697  248  ARG A NH2 
2375 N N   . ILE A 325 ? 1.2812 2.3042 2.0937 0.2230  0.4450  0.5383  249  ILE A N   
2376 C CA  . ILE A 325 ? 1.2840 2.2808 2.0834 0.2108  0.4524  0.5451  249  ILE A CA  
2377 C C   . ILE A 325 ? 1.2933 2.2710 2.1012 0.1787  0.4154  0.5215  249  ILE A C   
2378 O O   . ILE A 325 ? 1.2924 2.2293 2.0475 0.1753  0.4080  0.5096  249  ILE A O   
2379 C CB  . ILE A 325 ? 1.3377 2.3688 2.2031 0.2075  0.4844  0.5806  249  ILE A CB  
2380 C CG1 . ILE A 325 ? 1.3702 2.4241 2.2302 0.2421  0.5220  0.6051  249  ILE A CG1 
2381 C CG2 . ILE A 325 ? 1.3631 2.3621 2.2090 0.1977  0.4947  0.5887  249  ILE A CG2 
2382 C CD1 . ILE A 325 ? 1.4739 2.5705 2.4083 0.2406  0.5569  0.6428  249  ILE A CD1 
2383 N N   . THR A 326 ? 1.2147 2.2220 2.0858 0.1577  0.3914  0.5142  250  THR A N   
2384 C CA  . THR A 326 ? 1.1835 2.1747 2.0668 0.1286  0.3550  0.4922  250  THR A CA  
2385 C C   . THR A 326 ? 1.2060 2.1574 2.0152 0.1358  0.3312  0.4609  250  THR A C   
2386 O O   . THR A 326 ? 1.1922 2.1122 1.9778 0.1197  0.3102  0.4442  250  THR A O   
2387 C CB  . THR A 326 ? 1.2894 2.3244 2.2572 0.1088  0.3366  0.4931  250  THR A CB  
2388 O OG1 . THR A 326 ? 1.2930 2.3676 2.3308 0.1019  0.3614  0.5231  250  THR A OG1 
2389 C CG2 . THR A 326 ? 1.2605 2.2770 2.2429 0.0789  0.2996  0.4724  250  THR A CG2 
2390 N N   . ARG A 327 ? 1.1551 2.1066 1.9270 0.1602  0.3363  0.4540  251  ARG A N   
2391 C CA  . ARG A 327 ? 1.1443 2.0584 1.8467 0.1676  0.3172  0.4255  251  ARG A CA  
2392 C C   . ARG A 327 ? 1.2052 2.0760 1.8339 0.1747  0.3246  0.4190  251  ARG A C   
2393 O O   . ARG A 327 ? 1.1870 2.0267 1.7797 0.1635  0.3022  0.3966  251  ARG A O   
2394 C CB  . ARG A 327 ? 1.1463 2.0699 1.8274 0.1934  0.3251  0.4230  251  ARG A CB  
2395 C CG  . ARG A 327 ? 1.2463 2.1314 1.8612 0.1988  0.3052  0.3932  251  ARG A CG  
2396 C CD  . ARG A 327 ? 1.3550 2.2374 1.9307 0.2284  0.3200  0.3930  251  ARG A CD  
2397 N NE  . ARG A 327 ? 1.4760 2.3428 2.0039 0.2499  0.3495  0.4063  251  ARG A NE  
2398 C CZ  . ARG A 327 ? 1.7045 2.5617 2.1874 0.2786  0.3677  0.4092  251  ARG A CZ  
2399 N NH1 . ARG A 327 ? 1.5866 2.4495 2.0667 0.2899  0.3609  0.4005  251  ARG A NH1 
2400 N NH2 . ARG A 327 ? 1.5538 2.3932 1.9908 0.2980  0.3932  0.4210  251  ARG A NH2 
2401 N N   . ASP A 328 ? 1.1871 2.0568 1.7924 0.1950  0.3558  0.4383  252  ASP A N   
2402 C CA  . ASP A 328 ? 1.2058 2.0374 1.7392 0.2060  0.3642  0.4333  252  ASP A CA  
2403 C C   . ASP A 328 ? 1.2425 2.0595 1.7813 0.1864  0.3558  0.4332  252  ASP A C   
2404 O O   . ASP A 328 ? 1.2440 2.0284 1.7257 0.1871  0.3458  0.4168  252  ASP A O   
2405 C CB  . ASP A 328 ? 1.2660 2.1003 1.7759 0.2346  0.4004  0.4563  252  ASP A CB  
2406 C CG  . ASP A 328 ? 1.4128 2.2506 1.8962 0.2600  0.4112  0.4555  252  ASP A CG  
2407 O OD1 . ASP A 328 ? 1.3979 2.2436 1.8940 0.2550  0.3926  0.4404  252  ASP A OD1 
2408 O OD2 . ASP A 328 ? 1.5314 2.3616 1.9785 0.2865  0.4388  0.4702  252  ASP A OD2 
2409 N N   . GLN A 329 ? 1.1790 2.0193 1.7849 0.1686  0.3591  0.4505  253  GLN A N   
2410 C CA  . GLN A 329 ? 1.1702 1.9928 1.7788 0.1509  0.3520  0.4511  253  GLN A CA  
2411 C C   . GLN A 329 ? 1.1925 1.9955 1.7895 0.1311  0.3154  0.4231  253  GLN A C   
2412 O O   . GLN A 329 ? 1.1942 1.9705 1.7575 0.1258  0.3072  0.4149  253  GLN A O   
2413 C CB  . GLN A 329 ? 1.1876 2.0352 1.8691 0.1352  0.3651  0.4762  253  GLN A CB  
2414 C CG  . GLN A 329 ? 1.4145 2.2765 2.1041 0.1545  0.4051  0.5068  253  GLN A CG  
2415 C CD  . GLN A 329 ? 1.6512 2.5323 2.4084 0.1371  0.4207  0.5322  253  GLN A CD  
2416 O OE1 . GLN A 329 ? 1.6063 2.4751 2.3845 0.1128  0.4054  0.5283  253  GLN A OE1 
2417 N NE2 . GLN A 329 ? 1.5385 2.4463 2.3265 0.1504  0.4540  0.5598  253  GLN A NE2 
2418 N N   . VAL A 330 ? 1.1186 1.9342 1.7392 0.1234  0.2946  0.4086  254  VAL A N   
2419 C CA  . VAL A 330 ? 1.0876 1.8833 1.6939 0.1081  0.2614  0.3820  254  VAL A CA  
2420 C C   . VAL A 330 ? 1.1269 1.8915 1.6552 0.1216  0.2571  0.3619  254  VAL A C   
2421 O O   . VAL A 330 ? 1.1100 1.8504 1.6096 0.1120  0.2393  0.3457  254  VAL A O   
2422 C CB  . VAL A 330 ? 1.1169 1.9339 1.7677 0.0996  0.2421  0.3733  254  VAL A CB  
2423 C CG1 . VAL A 330 ? 1.0955 1.8873 1.7219 0.0886  0.2102  0.3454  254  VAL A CG1 
2424 C CG2 . VAL A 330 ? 1.1095 1.9582 1.8403 0.0823  0.2425  0.3910  254  VAL A CG2 
2425 N N   . LEU A 331 ? 1.0975 1.8624 1.5916 0.1441  0.2747  0.3642  255  LEU A N   
2426 C CA  . LEU A 331 ? 1.1085 1.8438 1.5284 0.1568  0.2728  0.3462  255  LEU A CA  
2427 C C   . LEU A 331 ? 1.1721 1.8890 1.5538 0.1603  0.2804  0.3493  255  LEU A C   
2428 O O   . LEU A 331 ? 1.1651 1.8583 1.4985 0.1585  0.2667  0.3295  255  LEU A O   
2429 C CB  . LEU A 331 ? 1.1315 1.8685 1.5232 0.1809  0.2914  0.3499  255  LEU A CB  
2430 C CG  . LEU A 331 ? 1.1797 1.9300 1.5925 0.1837  0.2842  0.3434  255  LEU A CG  
2431 C CD1 . LEU A 331 ? 1.2122 1.9636 1.5958 0.2110  0.3075  0.3521  255  LEU A CD1 
2432 C CD2 . LEU A 331 ? 1.1858 1.9117 1.5701 0.1730  0.2571  0.3144  255  LEU A CD2 
2433 N N   . LYS A 332 ? 1.1456 1.8741 1.5492 0.1656  0.3025  0.3744  256  LYS A N   
2434 C CA  . LYS A 332 ? 1.1635 1.8751 1.5322 0.1718  0.3116  0.3803  256  LYS A CA  
2435 C C   . LYS A 332 ? 1.1912 1.8911 1.5652 0.1515  0.2890  0.3690  256  LYS A C   
2436 O O   . LYS A 332 ? 1.1977 1.8783 1.5242 0.1557  0.2832  0.3586  256  LYS A O   
2437 C CB  . LYS A 332 ? 1.2208 1.9457 1.6151 0.1823  0.3423  0.4114  256  LYS A CB  
2438 C CG  . LYS A 332 ? 1.4786 2.2103 1.8544 0.2084  0.3692  0.4252  256  LYS A CG  
2439 C CD  . LYS A 332 ? 1.6554 2.3999 2.0588 0.2187  0.4017  0.4579  256  LYS A CD  
2440 C CE  . LYS A 332 ? 1.8021 2.5539 2.1889 0.2468  0.4309  0.4743  256  LYS A CE  
2441 N NZ  . LYS A 332 ? 1.8656 2.6448 2.2924 0.2461  0.4299  0.4751  256  LYS A NZ  
2442 N N   . MET A 333 ? 1.1167 1.8283 1.5467 0.1305  0.2754  0.3703  257  MET A N   
2443 C CA  . MET A 333 ? 1.0969 1.7948 1.5330 0.1117  0.2531  0.3598  257  MET A CA  
2444 C C   . MET A 333 ? 1.1313 1.8136 1.5313 0.1073  0.2277  0.3309  257  MET A C   
2445 O O   . MET A 333 ? 1.1140 1.7804 1.4946 0.0996  0.2126  0.3201  257  MET A O   
2446 C CB  . MET A 333 ? 1.1089 1.8211 1.6132 0.0911  0.2452  0.3687  257  MET A CB  
2447 C CG  . MET A 333 ? 1.1713 1.8973 1.7157 0.0905  0.2697  0.3973  257  MET A CG  
2448 S SD  . MET A 333 ? 1.2101 1.9540 1.8375 0.0629  0.2579  0.4056  257  MET A SD  
2449 C CE  . MET A 333 ? 1.1965 1.9536 1.8587 0.0656  0.2936  0.4402  257  MET A CE  
2450 N N   . ALA A 334 ? 1.0928 1.7790 1.4832 0.1131  0.2246  0.3195  258  ALA A N   
2451 C CA  . ALA A 334 ? 1.0833 1.7536 1.4396 0.1097  0.2043  0.2932  258  ALA A CA  
2452 C C   . ALA A 334 ? 1.1571 1.8107 1.4490 0.1218  0.2083  0.2820  258  ALA A C   
2453 O O   . ALA A 334 ? 1.1433 1.7825 1.4069 0.1148  0.1914  0.2629  258  ALA A O   
2454 C CB  . ALA A 334 ? 1.0859 1.7643 1.4555 0.1129  0.2022  0.2872  258  ALA A CB  
2455 N N   . ALA A 335 ? 1.1436 1.7994 1.4126 0.1402  0.2306  0.2939  259  ALA A N   
2456 C CA  . ALA A 335 ? 1.1661 1.8059 1.3728 0.1530  0.2343  0.2838  259  ALA A CA  
2457 C C   . ALA A 335 ? 1.2302 1.8655 1.4203 0.1531  0.2326  0.2869  259  ALA A C   
2458 O O   . ALA A 335 ? 1.2392 1.8632 1.3814 0.1583  0.2265  0.2730  259  ALA A O   
2459 C CB  . ALA A 335 ? 1.2049 1.8454 1.3904 0.1751  0.2587  0.2965  259  ALA A CB  
2460 N N   . ALA A 336 ? 1.1812 1.8252 1.4103 0.1476  0.2378  0.3050  260  ALA A N   
2461 C CA  . ALA A 336 ? 1.1878 1.8258 1.4019 0.1499  0.2385  0.3108  260  ALA A CA  
2462 C C   . ALA A 336 ? 1.2180 1.8486 1.4252 0.1352  0.2130  0.2921  260  ALA A C   
2463 O O   . ALA A 336 ? 1.2228 1.8478 1.3989 0.1410  0.2098  0.2890  260  ALA A O   
2464 C CB  . ALA A 336 ? 1.2022 1.8473 1.4592 0.1481  0.2545  0.3369  260  ALA A CB  
2465 N N   . VAL A 337 ? 1.1480 1.7790 1.3821 0.1184  0.1953  0.2801  261  VAL A N   
2466 C CA  . VAL A 337 ? 1.1281 1.7508 1.3558 0.1059  0.1726  0.2638  261  VAL A CA  
2467 C C   . VAL A 337 ? 1.1684 1.7859 1.3496 0.1085  0.1622  0.2407  261  VAL A C   
2468 O O   . VAL A 337 ? 1.1630 1.7777 1.3242 0.1058  0.1501  0.2305  261  VAL A O   
2469 C CB  . VAL A 337 ? 1.1566 1.7776 1.4262 0.0883  0.1567  0.2594  261  VAL A CB  
2470 C CG1 . VAL A 337 ? 1.1544 1.7796 1.4705 0.0819  0.1636  0.2804  261  VAL A CG1 
2471 C CG2 . VAL A 337 ? 1.1466 1.7698 1.4234 0.0860  0.1529  0.2486  261  VAL A CG2 
2472 N N   . VAL A 338 ? 1.1212 1.7370 1.2849 0.1138  0.1676  0.2329  262  VAL A N   
2473 C CA  . VAL A 338 ? 1.1195 1.7272 1.2398 0.1136  0.1586  0.2106  262  VAL A CA  
2474 C C   . VAL A 338 ? 1.1986 1.8072 1.2759 0.1282  0.1662  0.2114  262  VAL A C   
2475 O O   . VAL A 338 ? 1.1957 1.8045 1.2467 0.1250  0.1535  0.1964  262  VAL A O   
2476 C CB  . VAL A 338 ? 1.1681 1.7673 1.2802 0.1138  0.1611  0.2007  262  VAL A CB  
2477 C CG1 . VAL A 338 ? 1.1882 1.7910 1.3034 0.1293  0.1826  0.2176  262  VAL A CG1 
2478 C CG2 . VAL A 338 ? 1.1754 1.7620 1.2410 0.1112  0.1526  0.1773  262  VAL A CG2 
2479 N N   . LEU A 339 ? 1.1775 1.7878 1.2488 0.1450  0.1866  0.2294  263  LEU A N   
2480 C CA  . LEU A 339 ? 1.2047 1.8129 1.2319 0.1624  0.1946  0.2314  263  LEU A CA  
2481 C C   . LEU A 339 ? 1.2473 1.8619 1.2707 0.1638  0.1877  0.2347  263  LEU A C   
2482 O O   . LEU A 339 ? 1.2589 1.8744 1.2430 0.1703  0.1800  0.2227  263  LEU A O   
2483 C CB  . LEU A 339 ? 1.2315 1.8382 1.2557 0.1820  0.2204  0.2533  263  LEU A CB  
2484 C CG  . LEU A 339 ? 1.3154 1.9107 1.3053 0.1942  0.2303  0.2479  263  LEU A CG  
2485 C CD1 . LEU A 339 ? 1.2988 1.8909 1.3077 0.1820  0.2247  0.2379  263  LEU A CD1 
2486 C CD2 . LEU A 339 ? 1.3739 1.9688 1.3613 0.2162  0.2575  0.2726  263  LEU A CD2 
2487 N N   . ALA A 340 ? 1.1811 1.7995 1.2433 0.1579  0.1896  0.2499  264  ALA A N   
2488 C CA  . ALA A 340 ? 1.1791 1.7997 1.2362 0.1607  0.1845  0.2546  264  ALA A CA  
2489 C C   . ALA A 340 ? 1.2151 1.8403 1.2580 0.1503  0.1608  0.2323  264  ALA A C   
2490 O O   . ALA A 340 ? 1.2311 1.8619 1.2463 0.1595  0.1555  0.2286  264  ALA A O   
2491 C CB  . ALA A 340 ? 1.1760 1.7940 1.2774 0.1532  0.1902  0.2735  264  ALA A CB  
2492 N N   . PHE A 341 ? 1.1359 1.7597 1.1972 0.1327  0.1475  0.2178  265  PHE A N   
2493 C CA  . PHE A 341 ? 1.1136 1.7416 1.1654 0.1216  0.1272  0.1974  265  PHE A CA  
2494 C C   . PHE A 341 ? 1.1886 1.8224 1.1979 0.1263  0.1221  0.1796  265  PHE A C   
2495 O O   . PHE A 341 ? 1.1919 1.8371 1.1845 0.1262  0.1099  0.1691  265  PHE A O   
2496 C CB  . PHE A 341 ? 1.1054 1.7260 1.1849 0.1039  0.1175  0.1879  265  PHE A CB  
2497 C CG  . PHE A 341 ? 1.1015 1.7242 1.1775 0.0921  0.0990  0.1702  265  PHE A CG  
2498 C CD1 . PHE A 341 ? 1.1220 1.7440 1.2153 0.0883  0.0903  0.1750  265  PHE A CD1 
2499 C CD2 . PHE A 341 ? 1.1223 1.7449 1.1778 0.0846  0.0914  0.1494  265  PHE A CD2 
2500 C CE1 . PHE A 341 ? 1.1176 1.7417 1.2076 0.0795  0.0751  0.1602  265  PHE A CE1 
2501 C CE2 . PHE A 341 ? 1.1415 1.7670 1.1966 0.0735  0.0766  0.1345  265  PHE A CE2 
2502 C CZ  . PHE A 341 ? 1.1033 1.7308 1.1761 0.0720  0.0690  0.1405  265  PHE A CZ  
2503 N N   . ILE A 342 ? 1.1620 1.7881 1.1530 0.1313  0.1314  0.1766  266  ILE A N   
2504 C CA  . ILE A 342 ? 1.1835 1.8095 1.1312 0.1348  0.1267  0.1590  266  ILE A CA  
2505 C C   . ILE A 342 ? 1.2598 1.8947 1.1763 0.1542  0.1299  0.1652  266  ILE A C   
2506 O O   . ILE A 342 ? 1.2697 1.9163 1.1624 0.1533  0.1159  0.1497  266  ILE A O   
2507 C CB  . ILE A 342 ? 1.2392 1.8483 1.1718 0.1372  0.1374  0.1560  266  ILE A CB  
2508 C CG1 . ILE A 342 ? 1.2201 1.8198 1.1773 0.1196  0.1322  0.1469  266  ILE A CG1 
2509 C CG2 . ILE A 342 ? 1.2768 1.8803 1.1584 0.1422  0.1330  0.1386  266  ILE A CG2 
2510 C CD1 . ILE A 342 ? 1.3011 1.8828 1.2468 0.1233  0.1438  0.1459  266  ILE A CD1 
2511 N N   . ILE A 343 ? 1.2232 1.8537 1.1411 0.1717  0.1481  0.1877  267  ILE A N   
2512 C CA  . ILE A 343 ? 1.2534 1.8880 1.1381 0.1938  0.1536  0.1955  267  ILE A CA  
2513 C C   . ILE A 343 ? 1.3030 1.9541 1.1893 0.1934  0.1393  0.1923  267  ILE A C   
2514 O O   . ILE A 343 ? 1.3198 1.9813 1.1711 0.2050  0.1311  0.1835  267  ILE A O   
2515 C CB  . ILE A 343 ? 1.3077 1.9321 1.1997 0.2116  0.1791  0.2236  267  ILE A CB  
2516 C CG1 . ILE A 343 ? 1.3288 1.9396 1.2103 0.2179  0.1944  0.2269  267  ILE A CG1 
2517 C CG2 . ILE A 343 ? 1.3450 1.9706 1.2028 0.2362  0.1859  0.2338  267  ILE A CG2 
2518 C CD1 . ILE A 343 ? 1.4342 2.0379 1.3315 0.2331  0.2218  0.2557  267  ILE A CD1 
2519 N N   . CYS A 344 ? 1.2324 1.8855 1.1568 0.1810  0.1354  0.1986  268  CYS A N   
2520 C CA  . CYS A 344 ? 1.2241 1.8893 1.1498 0.1834  0.1248  0.1992  268  CYS A CA  
2521 C C   . CYS A 344 ? 1.2616 1.9447 1.1837 0.1694  0.1022  0.1751  268  CYS A C   
2522 O O   . CYS A 344 ? 1.2607 1.9611 1.1665 0.1783  0.0926  0.1710  268  CYS A O   
2523 C CB  . CYS A 344 ? 1.2071 1.8620 1.1707 0.1768  0.1305  0.2162  268  CYS A CB  
2524 S SG  . CYS A 344 ? 1.2791 1.9169 1.2501 0.1926  0.1577  0.2469  268  CYS A SG  
2525 N N   . TRP A 345 ? 1.2047 1.8842 1.1427 0.1490  0.0946  0.1604  269  TRP A N   
2526 C CA  . TRP A 345 ? 1.1930 1.8886 1.1316 0.1348  0.0759  0.1399  269  TRP A CA  
2527 C C   . TRP A 345 ? 1.2622 1.9639 1.1741 0.1279  0.0678  0.1176  269  TRP A C   
2528 O O   . TRP A 345 ? 1.2548 1.9770 1.1618 0.1203  0.0527  0.1017  269  TRP A O   
2529 C CB  . TRP A 345 ? 1.1484 1.8343 1.1215 0.1158  0.0713  0.1372  269  TRP A CB  
2530 C CG  . TRP A 345 ? 1.1502 1.8328 1.1461 0.1189  0.0717  0.1526  269  TRP A CG  
2531 C CD1 . TRP A 345 ? 1.1829 1.8469 1.2028 0.1193  0.0820  0.1703  269  TRP A CD1 
2532 C CD2 . TRP A 345 ? 1.1448 1.8425 1.1385 0.1238  0.0620  0.1525  269  TRP A CD2 
2533 N NE1 . TRP A 345 ? 1.1719 1.8338 1.2028 0.1222  0.0784  0.1799  269  TRP A NE1 
2534 C CE2 . TRP A 345 ? 1.1900 1.8716 1.2033 0.1267  0.0669  0.1700  269  TRP A CE2 
2535 C CE3 . TRP A 345 ? 1.1621 1.8864 1.1397 0.1261  0.0492  0.1392  269  TRP A CE3 
2536 C CZ2 . TRP A 345 ? 1.1780 1.8646 1.1903 0.1335  0.0605  0.1749  269  TRP A CZ2 
2537 C CZ3 . TRP A 345 ? 1.1755 1.9102 1.1558 0.1337  0.0432  0.1448  269  TRP A CZ3 
2538 C CH2 . TRP A 345 ? 1.1794 1.8931 1.1745 0.1381  0.0492  0.1626  269  TRP A CH2 
2539 N N   . LEU A 346 ? 1.2403 1.9245 1.1348 0.1303  0.0775  0.1163  270  LEU A N   
2540 C CA  . LEU A 346 ? 1.2593 1.9427 1.1243 0.1226  0.0696  0.0944  270  LEU A CA  
2541 C C   . LEU A 346 ? 1.3440 2.0511 1.1783 0.1326  0.0572  0.0840  270  LEU A C   
2542 O O   . LEU A 346 ? 1.3438 2.0645 1.1723 0.1175  0.0420  0.0629  270  LEU A O   
2543 C CB  . LEU A 346 ? 1.2835 1.9406 1.1276 0.1288  0.0837  0.0970  270  LEU A CB  
2544 C CG  . LEU A 346 ? 1.3686 2.0149 1.1771 0.1203  0.0771  0.0744  270  LEU A CG  
2545 C CD1 . LEU A 346 ? 1.3466 1.9912 1.1708 0.0940  0.0664  0.0556  270  LEU A CD1 
2546 C CD2 . LEU A 346 ? 1.4297 2.0472 1.2156 0.1312  0.0937  0.0810  270  LEU A CD2 
2547 N N   . PRO A 347 ? 1.3203 2.0342 1.1360 0.1570  0.0625  0.0977  271  PRO A N   
2548 C CA  . PRO A 347 ? 1.3402 2.0785 1.1255 0.1674  0.0481  0.0859  271  PRO A CA  
2549 C C   . PRO A 347 ? 1.3614 2.1330 1.1668 0.1549  0.0295  0.0738  271  PRO A C   
2550 O O   . PRO A 347 ? 1.3661 2.1585 1.1571 0.1471  0.0130  0.0531  271  PRO A O   
2551 C CB  . PRO A 347 ? 1.3835 2.1197 1.1525 0.1971  0.0602  0.1076  271  PRO A CB  
2552 C CG  . PRO A 347 ? 1.4407 2.1464 1.2186 0.2017  0.0826  0.1265  271  PRO A CG  
2553 C CD  . PRO A 347 ? 1.3467 2.0458 1.1658 0.1766  0.0821  0.1240  271  PRO A CD  
2554 N N   . PHE A 348 ? 1.2847 2.0608 1.1238 0.1521  0.0320  0.0862  272  PHE A N   
2555 C CA  . PHE A 348 ? 1.2610 2.0672 1.1197 0.1430  0.0171  0.0778  272  PHE A CA  
2556 C C   . PHE A 348 ? 1.2951 2.1070 1.1670 0.1147  0.0063  0.0555  272  PHE A C   
2557 O O   . PHE A 348 ? 1.2931 2.1370 1.1646 0.1078  -0.0092 0.0399  272  PHE A O   
2558 C CB  . PHE A 348 ? 1.2578 2.0575 1.1456 0.1459  0.0237  0.0962  272  PHE A CB  
2559 C CG  . PHE A 348 ? 1.2577 2.0851 1.1644 0.1380  0.0103  0.0888  272  PHE A CG  
2560 C CD1 . PHE A 348 ? 1.3090 2.1675 1.2051 0.1552  0.0019  0.0907  272  PHE A CD1 
2561 C CD2 . PHE A 348 ? 1.2589 2.0815 1.1919 0.1153  0.0067  0.0799  272  PHE A CD2 
2562 C CE1 . PHE A 348 ? 1.3045 2.1916 1.2182 0.1494  -0.0096 0.0844  272  PHE A CE1 
2563 C CE2 . PHE A 348 ? 1.2773 2.1259 1.2266 0.1093  -0.0040 0.0737  272  PHE A CE2 
2564 C CZ  . PHE A 348 ? 1.2630 2.1450 1.2038 0.1262  -0.0119 0.0763  272  PHE A CZ  
2565 N N   . HIS A 349 ? 1.2356 2.0177 1.1203 0.0991  0.0149  0.0547  273  HIS A N   
2566 C CA  . HIS A 349 ? 1.2180 1.9982 1.1141 0.0732  0.0082  0.0357  273  HIS A CA  
2567 C C   . HIS A 349 ? 1.2911 2.0710 1.1572 0.0642  0.0012  0.0149  273  HIS A C   
2568 O O   . HIS A 349 ? 1.2765 2.0654 1.1488 0.0427  -0.0080 -0.0037 273  HIS A O   
2569 C CB  . HIS A 349 ? 1.2052 1.9516 1.1204 0.0629  0.0197  0.0421  273  HIS A CB  
2570 C CG  . HIS A 349 ? 1.2163 1.9620 1.1616 0.0667  0.0225  0.0580  273  HIS A CG  
2571 N ND1 . HIS A 349 ? 1.2149 1.9727 1.1813 0.0551  0.0144  0.0521  273  HIS A ND1 
2572 C CD2 . HIS A 349 ? 1.2291 1.9629 1.1839 0.0813  0.0321  0.0792  273  HIS A CD2 
2573 C CE1 . HIS A 349 ? 1.1893 1.9391 1.1741 0.0637  0.0185  0.0692  273  HIS A CE1 
2574 N NE2 . HIS A 349 ? 1.2017 1.9371 1.1815 0.0781  0.0287  0.0855  273  HIS A NE2 
2575 N N   . VAL A 350 ? 1.2824 2.0518 1.1149 0.0806  0.0054  0.0176  274  VAL A N   
2576 C CA  . VAL A 350 ? 1.3164 2.0833 1.1143 0.0741  -0.0034 -0.0030 274  VAL A CA  
2577 C C   . VAL A 350 ? 1.3719 2.1832 1.1695 0.0705  -0.0239 -0.0178 274  VAL A C   
2578 O O   . VAL A 350 ? 1.3747 2.1960 1.1739 0.0476  -0.0357 -0.0393 274  VAL A O   
2579 C CB  . VAL A 350 ? 1.4035 2.1457 1.1609 0.0959  0.0064  0.0044  274  VAL A CB  
2580 C CG1 . VAL A 350 ? 1.4454 2.1897 1.1619 0.0934  -0.0072 -0.0175 274  VAL A CG1 
2581 C CG2 . VAL A 350 ? 1.3982 2.0995 1.1560 0.0953  0.0255  0.0146  274  VAL A CG2 
2582 N N   . LEU A 351 ? 1.3215 2.1600 1.1200 0.0928  -0.0273 -0.0055 275  LEU A N   
2583 C CA  . LEU A 351 ? 1.3232 2.2094 1.1225 0.0959  -0.0465 -0.0162 275  LEU A CA  
2584 C C   . LEU A 351 ? 1.3343 2.2490 1.1732 0.0735  -0.0549 -0.0246 275  LEU A C   
2585 O O   . LEU A 351 ? 1.3345 2.2857 1.1769 0.0621  -0.0721 -0.0427 275  LEU A O   
2586 C CB  . LEU A 351 ? 1.3290 2.2311 1.1201 0.1283  -0.0438 0.0032  275  LEU A CB  
2587 C CG  . LEU A 351 ? 1.4223 2.2992 1.1731 0.1554  -0.0335 0.0147  275  LEU A CG  
2588 C CD1 . LEU A 351 ? 1.4243 2.3113 1.1713 0.1853  -0.0270 0.0364  275  LEU A CD1 
2589 C CD2 . LEU A 351 ? 1.4931 2.3756 1.2033 0.1580  -0.0477 -0.0054 275  LEU A CD2 
2590 N N   . THR A 352 ? 1.2534 2.1516 1.1221 0.0677  -0.0430 -0.0114 276  THR A N   
2591 C CA  . THR A 352 ? 1.2182 2.1357 1.1228 0.0496  -0.0471 -0.0159 276  THR A CA  
2592 C C   . THR A 352 ? 1.2788 2.1886 1.1869 0.0184  -0.0513 -0.0382 276  THR A C   
2593 O O   . THR A 352 ? 1.2615 2.2035 1.1902 0.0019  -0.0613 -0.0506 276  THR A O   
2594 C CB  . THR A 352 ? 1.2716 2.1635 1.1988 0.0543  -0.0330 0.0042  276  THR A CB  
2595 O OG1 . THR A 352 ? 1.2599 2.1561 1.1814 0.0815  -0.0287 0.0242  276  THR A OG1 
2596 C CG2 . THR A 352 ? 1.2123 2.1187 1.1720 0.0394  -0.0358 0.0014  276  THR A CG2 
2597 N N   . PHE A 353 ? 1.2653 2.1322 1.1523 0.0111  -0.0425 -0.0427 277  PHE A N   
2598 C CA  . PHE A 353 ? 1.2819 2.1321 1.1642 -0.0171 -0.0442 -0.0635 277  PHE A CA  
2599 C C   . PHE A 353 ? 1.3870 2.2638 1.2495 -0.0258 -0.0617 -0.0851 277  PHE A C   
2600 O O   . PHE A 353 ? 1.3827 2.2721 1.2566 -0.0521 -0.0695 -0.1036 277  PHE A O   
2601 C CB  . PHE A 353 ? 1.3129 2.1081 1.1741 -0.0183 -0.0291 -0.0607 277  PHE A CB  
2602 C CG  . PHE A 353 ? 1.3493 2.1196 1.1992 -0.0454 -0.0288 -0.0814 277  PHE A CG  
2603 C CD1 . PHE A 353 ? 1.3684 2.1296 1.2430 -0.0654 -0.0237 -0.0855 277  PHE A CD1 
2604 C CD2 . PHE A 353 ? 1.4183 2.1682 1.2283 -0.0494 -0.0322 -0.0960 277  PHE A CD2 
2605 C CE1 . PHE A 353 ? 1.4021 2.1362 1.2633 -0.0902 -0.0215 -0.1041 277  PHE A CE1 
2606 C CE2 . PHE A 353 ? 1.4766 2.1979 1.2722 -0.0749 -0.0310 -0.1152 277  PHE A CE2 
2607 C CZ  . PHE A 353 ? 1.4320 2.1455 1.2537 -0.0955 -0.0250 -0.1189 277  PHE A CZ  
2608 N N   . LEU A 354 ? 1.3898 2.2754 1.2230 -0.0037 -0.0681 -0.0827 278  LEU A N   
2609 C CA  . LEU A 354 ? 1.4316 2.3446 1.2432 -0.0081 -0.0878 -0.1030 278  LEU A CA  
2610 C C   . LEU A 354 ? 1.4837 2.4588 1.3281 -0.0138 -0.1041 -0.1092 278  LEU A C   
2611 O O   . LEU A 354 ? 1.4953 2.4963 1.3433 -0.0354 -0.1200 -0.1313 278  LEU A O   
2612 C CB  . LEU A 354 ? 1.4657 2.3712 1.2355 0.0221  -0.0897 -0.0966 278  LEU A CB  
2613 C CG  . LEU A 354 ? 1.5524 2.4010 1.2836 0.0308  -0.0749 -0.0919 278  LEU A CG  
2614 C CD1 . LEU A 354 ? 1.5833 2.4294 1.2773 0.0651  -0.0744 -0.0811 278  LEU A CD1 
2615 C CD2 . LEU A 354 ? 1.6203 2.4409 1.3268 0.0052  -0.0802 -0.1162 278  LEU A CD2 
2616 N N   . ASP A 355 ? 1.4249 2.4230 1.2937 0.0050  -0.0995 -0.0894 279  ASP A N   
2617 C CA  . ASP A 355 ? 1.4116 2.4681 1.3131 0.0047  -0.1114 -0.0904 279  ASP A CA  
2618 C C   . ASP A 355 ? 1.4683 2.5354 1.4048 -0.0286 -0.1117 -0.1028 279  ASP A C   
2619 O O   . ASP A 355 ? 1.4669 2.5835 1.4234 -0.0419 -0.1268 -0.1169 279  ASP A O   
2620 C CB  . ASP A 355 ? 1.4047 2.4673 1.3192 0.0321  -0.1017 -0.0644 279  ASP A CB  
2621 C CG  . ASP A 355 ? 1.4902 2.6094 1.4357 0.0363  -0.1113 -0.0622 279  ASP A CG  
2622 O OD1 . ASP A 355 ? 1.5057 2.6743 1.4539 0.0330  -0.1298 -0.0775 279  ASP A OD1 
2623 O OD2 . ASP A 355 ? 1.5380 2.6528 1.5027 0.0458  -0.1008 -0.0445 279  ASP A OD2 
2624 N N   . ALA A 356 ? 1.4263 2.4474 1.3701 -0.0413 -0.0946 -0.0973 280  ALA A N   
2625 C CA  . ALA A 356 ? 1.4178 2.4364 1.3896 -0.0710 -0.0903 -0.1068 280  ALA A CA  
2626 C C   . ALA A 356 ? 1.5154 2.5372 1.4783 -0.1009 -0.1006 -0.1335 280  ALA A C   
2627 O O   . ALA A 356 ? 1.5069 2.5600 1.4990 -0.1240 -0.1059 -0.1451 280  ALA A O   
2628 C CB  . ALA A 356 ? 1.4110 2.3727 1.3819 -0.0732 -0.0705 -0.0956 280  ALA A CB  
2629 N N   . LEU A 357 ? 1.5177 2.5073 1.4398 -0.1000 -0.1033 -0.1430 281  LEU A N   
2630 C CA  . LEU A 357 ? 1.5576 2.5417 1.4623 -0.1273 -0.1142 -0.1693 281  LEU A CA  
2631 C C   . LEU A 357 ? 1.6238 2.6729 1.5395 -0.1312 -0.1387 -0.1841 281  LEU A C   
2632 O O   . LEU A 357 ? 1.6398 2.7031 1.5628 -0.1616 -0.1496 -0.2064 281  LEU A O   
2633 C CB  . LEU A 357 ? 1.5968 2.5262 1.4490 -0.1197 -0.1102 -0.1734 281  LEU A CB  
2634 C CG  . LEU A 357 ? 1.6505 2.5149 1.4881 -0.1185 -0.0873 -0.1628 281  LEU A CG  
2635 C CD1 . LEU A 357 ? 1.6916 2.5118 1.4774 -0.1028 -0.0837 -0.1629 281  LEU A CD1 
2636 C CD2 . LEU A 357 ? 1.6824 2.5213 1.5315 -0.1521 -0.0793 -0.1759 281  LEU A CD2 
2637 N N   . ALA A 358 ? 1.5715 2.6606 1.4895 -0.1009 -0.1473 -0.1717 282  ALA A N   
2638 C CA  . ALA A 358 ? 1.5836 2.7401 1.5136 -0.0991 -0.1712 -0.1836 282  ALA A CA  
2639 C C   . ALA A 358 ? 1.6091 2.8187 1.5939 -0.1192 -0.1743 -0.1865 282  ALA A C   
2640 O O   . ALA A 358 ? 1.6216 2.8752 1.6236 -0.1414 -0.1921 -0.2069 282  ALA A O   
2641 C CB  . ALA A 358 ? 1.5909 2.7693 1.5048 -0.0575 -0.1759 -0.1669 282  ALA A CB  
2642 N N   . TRP A 359 ? 1.5272 2.7305 1.5393 -0.1125 -0.1564 -0.1665 283  TRP A N   
2643 C CA  . TRP A 359 ? 1.4984 2.7455 1.5602 -0.1279 -0.1548 -0.1657 283  TRP A CA  
2644 C C   . TRP A 359 ? 1.5803 2.8074 1.6575 -0.1698 -0.1487 -0.1829 283  TRP A C   
2645 O O   . TRP A 359 ? 1.5715 2.8449 1.6889 -0.1902 -0.1527 -0.1903 283  TRP A O   
2646 C CB  . TRP A 359 ? 1.4370 2.6739 1.5153 -0.1064 -0.1374 -0.1395 283  TRP A CB  
2647 C CG  . TRP A 359 ? 1.4375 2.7003 1.5072 -0.0674 -0.1422 -0.1218 283  TRP A CG  
2648 C CD1 . TRP A 359 ? 1.4718 2.6949 1.5114 -0.0391 -0.1332 -0.1044 283  TRP A CD1 
2649 C CD2 . TRP A 359 ? 1.4316 2.7656 1.5210 -0.0520 -0.1570 -0.1203 283  TRP A CD2 
2650 N NE1 . TRP A 359 ? 1.4609 2.7212 1.4982 -0.0073 -0.1400 -0.0915 283  TRP A NE1 
2651 C CE2 . TRP A 359 ? 1.4785 2.8073 1.5440 -0.0130 -0.1552 -0.1012 283  TRP A CE2 
2652 C CE3 . TRP A 359 ? 1.4465 2.8498 1.5727 -0.0670 -0.1709 -0.1326 283  TRP A CE3 
2653 C CZ2 . TRP A 359 ? 1.4687 2.8555 1.5416 0.0135  -0.1665 -0.0939 283  TRP A CZ2 
2654 C CZ3 . TRP A 359 ? 1.4602 2.9263 1.5976 -0.0406 -0.1829 -0.1252 283  TRP A CZ3 
2655 C CH2 . TRP A 359 ? 1.4679 2.9239 1.5766 0.0002  -0.1806 -0.1061 283  TRP A CH2 
2656 N N   . MET A 360 ? 1.5687 2.7273 1.6138 -0.1817 -0.1377 -0.1885 284  MET A N   
2657 C CA  . MET A 360 ? 1.5899 2.7181 1.6398 -0.2199 -0.1299 -0.2050 284  MET A CA  
2658 C C   . MET A 360 ? 1.6996 2.8483 1.7408 -0.2469 -0.1501 -0.2330 284  MET A C   
2659 O O   . MET A 360 ? 1.7126 2.8502 1.7648 -0.2828 -0.1469 -0.2493 284  MET A O   
2660 C CB  . MET A 360 ? 1.6263 2.6721 1.6413 -0.2188 -0.1103 -0.1996 284  MET A CB  
2661 C CG  . MET A 360 ? 1.6342 2.6565 1.6619 -0.2002 -0.0910 -0.1756 284  MET A CG  
2662 S SD  . MET A 360 ? 1.6971 2.6301 1.6853 -0.1960 -0.0706 -0.1695 284  MET A SD  
2663 C CE  . MET A 360 ? 1.6076 2.5327 1.6218 -0.1760 -0.0548 -0.1437 284  MET A CE  
2664 N N   . GLY A 361 ? 1.6859 2.8615 1.7057 -0.2291 -0.1703 -0.2384 285  GLY A N   
2665 C CA  . GLY A 361 ? 1.7337 2.9300 1.7404 -0.2500 -0.1936 -0.2653 285  GLY A CA  
2666 C C   . GLY A 361 ? 1.8401 2.9673 1.7882 -0.2541 -0.1932 -0.2775 285  GLY A C   
2667 O O   . GLY A 361 ? 1.8784 3.0080 1.8092 -0.2759 -0.2111 -0.3021 285  GLY A O   
2668 N N   . VAL A 362 ? 1.7960 2.8617 1.7129 -0.2325 -0.1731 -0.2601 286  VAL A N   
2669 C CA  . VAL A 362 ? 1.8367 2.8329 1.6956 -0.2302 -0.1683 -0.2670 286  VAL A CA  
2670 C C   . VAL A 362 ? 1.9145 2.9243 1.7361 -0.2020 -0.1866 -0.2692 286  VAL A C   
2671 O O   . VAL A 362 ? 1.9619 2.9482 1.7431 -0.2117 -0.1994 -0.2892 286  VAL A O   
2672 C CB  . VAL A 362 ? 1.8652 2.7984 1.7094 -0.2154 -0.1402 -0.2463 286  VAL A CB  
2673 C CG1 . VAL A 362 ? 1.9090 2.7722 1.6931 -0.2119 -0.1340 -0.2529 286  VAL A CG1 
2674 C CG2 . VAL A 362 ? 1.8358 2.7567 1.7150 -0.2397 -0.1228 -0.2438 286  VAL A CG2 
2675 N N   . ILE A 363 ? 1.8496 2.8951 1.6820 -0.1668 -0.1879 -0.2491 287  ILE A N   
2676 C CA  . ILE A 363 ? 1.8791 2.9384 1.6755 -0.1365 -0.2037 -0.2492 287  ILE A CA  
2677 C C   . ILE A 363 ? 1.9366 3.0765 1.7624 -0.1395 -0.2304 -0.2613 287  ILE A C   
2678 O O   . ILE A 363 ? 1.8898 3.0815 1.7611 -0.1332 -0.2296 -0.2492 287  ILE A O   
2679 C CB  . ILE A 363 ? 1.8962 2.9368 1.6764 -0.0938 -0.1877 -0.2201 287  ILE A CB  
2680 C CG1 . ILE A 363 ? 1.8906 2.8603 1.6540 -0.0920 -0.1601 -0.2059 287  ILE A CG1 
2681 C CG2 . ILE A 363 ? 1.9430 2.9898 1.6788 -0.0624 -0.2018 -0.2211 287  ILE A CG2 
2682 C CD1 . ILE A 363 ? 2.0296 2.9342 1.7432 -0.1027 -0.1552 -0.2192 287  ILE A CD1 
2683 N N   . ASN A 364 ? 1.9531 3.1013 1.7509 -0.1499 -0.2546 -0.2864 288  ASN A N   
2684 C CA  . ASN A 364 ? 1.9731 3.1944 1.7903 -0.1567 -0.2856 -0.3050 288  ASN A CA  
2685 C C   . ASN A 364 ? 2.0568 3.2961 1.8343 -0.1152 -0.3024 -0.3020 288  ASN A C   
2686 O O   . ASN A 364 ? 2.0441 3.3543 1.8458 -0.1029 -0.3215 -0.3037 288  ASN A O   
2687 C CB  . ASN A 364 ? 2.0281 3.2416 1.8388 -0.2003 -0.3030 -0.3381 288  ASN A CB  
2688 C CG  . ASN A 364 ? 2.3454 3.4818 2.0869 -0.2014 -0.3029 -0.3508 288  ASN A CG  
2689 O OD1 . ASN A 364 ? 2.2552 3.3336 1.9554 -0.1740 -0.2836 -0.3336 288  ASN A OD1 
2690 N ND2 . ASN A 364 ? 2.2860 3.4169 2.0148 -0.2356 -0.3224 -0.3810 288  ASN A ND2 
2691 N N   . SER A 365 ? 2.0453 3.2208 1.7610 -0.0920 -0.2942 -0.2969 289  SER A N   
2692 C CA  . SER A 365 ? 2.0727 3.2525 1.7419 -0.0500 -0.3060 -0.2926 289  SER A CA  
2693 C C   . SER A 365 ? 2.0735 3.2828 1.7614 -0.0118 -0.2937 -0.2630 289  SER A C   
2694 O O   . SER A 365 ? 2.0251 3.2001 1.7219 -0.0028 -0.2657 -0.2390 289  SER A O   
2695 C CB  . SER A 365 ? 2.1557 3.2546 1.7571 -0.0357 -0.2944 -0.2912 289  SER A CB  
2696 N N   . CYS A 366 ? 2.0346 3.3078 1.7290 0.0099  -0.3152 -0.2652 290  CYS A N   
2697 C CA  . CYS A 366 ? 1.9941 3.2998 1.7037 0.0470  -0.3063 -0.2391 290  CYS A CA  
2698 C C   . CYS A 366 ? 2.0606 3.3160 1.7138 0.0910  -0.2907 -0.2186 290  CYS A C   
2699 O O   . CYS A 366 ? 2.0219 3.2811 1.6834 0.1195  -0.2740 -0.1923 290  CYS A O   
2700 C CB  . CYS A 366 ? 2.0038 3.3946 1.7356 0.0565  -0.3350 -0.2497 290  CYS A CB  
2701 S SG  . CYS A 366 ? 2.1298 3.5341 1.8030 0.0761  -0.3698 -0.2743 290  CYS A SG  
2702 N N   . GLU A 367 ? 2.0743 3.2825 1.6693 0.0971  -0.2959 -0.2304 291  GLU A N   
2703 C CA  . GLU A 367 ? 2.0992 3.2571 1.6378 0.1383  -0.2799 -0.2117 291  GLU A CA  
2704 C C   . GLU A 367 ? 2.1069 3.2169 1.6585 0.1426  -0.2432 -0.1829 291  GLU A C   
2705 O O   . GLU A 367 ? 2.0923 3.1968 1.6359 0.1770  -0.2270 -0.1573 291  GLU A O   
2706 C CB  . GLU A 367 ? 2.1830 3.2925 1.6576 0.1391  -0.2899 -0.2306 291  GLU A CB  
2707 C CG  . GLU A 367 ? 2.3670 3.5133 1.8102 0.1487  -0.3263 -0.2560 291  GLU A CG  
2708 C CD  . GLU A 367 ? 2.5897 3.5253 2.0641 0.0726  -0.3523 -0.2358 291  GLU A CD  
2709 O OE1 . GLU A 367 ? 2.5338 3.4801 1.9769 0.0764  -0.3818 -0.2517 291  GLU A OE1 
2710 O OE2 . GLU A 367 ? 2.4504 3.5243 1.9838 0.0564  -0.3519 -0.2618 291  GLU A OE2 
2711 N N   . VAL A 368 ? 2.0378 3.1146 1.6105 0.1075  -0.2303 -0.1870 292  VAL A N   
2712 C CA  . VAL A 368 ? 1.9915 3.0256 1.5805 0.1083  -0.1980 -0.1621 292  VAL A CA  
2713 C C   . VAL A 368 ? 1.9679 3.0430 1.6132 0.1086  -0.1908 -0.1448 292  VAL A C   
2714 O O   . VAL A 368 ? 1.9330 2.9833 1.5863 0.1242  -0.1672 -0.1193 292  VAL A O   
2715 C CB  . VAL A 368 ? 2.0389 3.0245 1.6301 0.0739  -0.1868 -0.1717 292  VAL A CB  
2716 C CG1 . VAL A 368 ? 2.0929 3.0220 1.6214 0.0823  -0.1847 -0.1798 292  VAL A CG1 
2717 C CG2 . VAL A 368 ? 2.0256 3.0430 1.6543 0.0312  -0.2035 -0.1960 292  VAL A CG2 
2718 N N   . ILE A 369 ? 1.9031 3.0404 1.5858 0.0926  -0.2110 -0.1585 293  ILE A N   
2719 C CA  . ILE A 369 ? 1.8488 3.0276 1.5813 0.0948  -0.2059 -0.1435 293  ILE A CA  
2720 C C   . ILE A 369 ? 1.8940 3.0901 1.6080 0.1405  -0.2035 -0.1228 293  ILE A C   
2721 O O   . ILE A 369 ? 1.8553 3.0516 1.5913 0.1535  -0.1871 -0.0999 293  ILE A O   
2722 C CB  . ILE A 369 ? 1.8759 3.1187 1.6527 0.0655  -0.2276 -0.1643 293  ILE A CB  
2723 C CG1 . ILE A 369 ? 1.8826 3.1012 1.6736 0.0198  -0.2274 -0.1844 293  ILE A CG1 
2724 C CG2 . ILE A 369 ? 1.8360 3.1206 1.6612 0.0713  -0.2208 -0.1472 293  ILE A CG2 
2725 C CD1 . ILE A 369 ? 1.9788 3.2572 1.8124 -0.0143 -0.2485 -0.2076 293  ILE A CD1 
2726 N N   . ALA A 370 ? 1.8866 3.0916 1.5560 0.1654  -0.2191 -0.1308 294  ALA A N   
2727 C CA  . ALA A 370 ? 1.8938 3.1095 1.5358 0.2113  -0.2166 -0.1126 294  ALA A CA  
2728 C C   . ALA A 370 ? 1.9276 3.0793 1.5419 0.2343  -0.1862 -0.0859 294  ALA A C   
2729 O O   . ALA A 370 ? 1.9123 3.0642 1.5225 0.2647  -0.1733 -0.0626 294  ALA A O   
2730 C CB  . ALA A 370 ? 1.9589 3.1983 1.5579 0.2302  -0.2427 -0.1311 294  ALA A CB  
2731 N N   . VAL A 371 ? 1.8845 2.9812 1.4802 0.2194  -0.1743 -0.0891 295  VAL A N   
2732 C CA  . VAL A 371 ? 1.8786 2.9152 1.4529 0.2360  -0.1448 -0.0654 295  VAL A CA  
2733 C C   . VAL A 371 ? 1.8581 2.8879 1.4795 0.2267  -0.1241 -0.0441 295  VAL A C   
2734 O O   . VAL A 371 ? 1.8482 2.8607 1.4642 0.2524  -0.1054 -0.0188 295  VAL A O   
2735 C CB  . VAL A 371 ? 1.9546 2.9395 1.4999 0.2206  -0.1390 -0.0762 295  VAL A CB  
2736 C CG1 . VAL A 371 ? 1.9465 2.8756 1.4807 0.2346  -0.1070 -0.0503 295  VAL A CG1 
2737 C CG2 . VAL A 371 ? 2.0150 2.9988 1.5055 0.2341  -0.1590 -0.0959 295  VAL A CG2 
2738 N N   . ILE A 372 ? 1.7637 2.8065 1.4297 0.1905  -0.1279 -0.0546 296  ILE A N   
2739 C CA  . ILE A 372 ? 1.7049 2.7412 1.4151 0.1791  -0.1115 -0.0379 296  ILE A CA  
2740 C C   . ILE A 372 ? 1.7404 2.8060 1.4612 0.2058  -0.1096 -0.0194 296  ILE A C   
2741 O O   . ILE A 372 ? 1.7169 2.7549 1.4444 0.2179  -0.0893 0.0042  296  ILE A O   
2742 C CB  . ILE A 372 ? 1.7095 2.7639 1.4617 0.1389  -0.1199 -0.0554 296  ILE A CB  
2743 C CG1 . ILE A 372 ? 1.7312 2.7502 1.4683 0.1126  -0.1201 -0.0737 296  ILE A CG1 
2744 C CG2 . ILE A 372 ? 1.6668 2.7126 1.4603 0.1309  -0.1038 -0.0379 296  ILE A CG2 
2745 C CD1 . ILE A 372 ? 1.7984 2.8337 1.5699 0.0725  -0.1293 -0.0939 296  ILE A CD1 
2746 N N   . ASP A 373 ? 1.7096 2.8295 1.4293 0.2161  -0.1309 -0.0300 297  ASP A N   
2747 C CA  . ASP A 373 ? 1.6985 2.8502 1.4242 0.2436  -0.1311 -0.0144 297  ASP A CA  
2748 C C   . ASP A 373 ? 1.7670 2.8845 1.4547 0.2820  -0.1135 0.0097  297  ASP A C   
2749 O O   . ASP A 373 ? 1.7433 2.8554 1.4414 0.2971  -0.1001 0.0309  297  ASP A O   
2750 C CB  . ASP A 373 ? 1.7399 2.9576 1.4641 0.2514  -0.1589 -0.0321 297  ASP A CB  
2751 C CG  . ASP A 373 ? 1.8342 3.0979 1.6023 0.2158  -0.1765 -0.0536 297  ASP A CG  
2752 O OD1 . ASP A 373 ? 1.8098 3.0537 1.6103 0.1860  -0.1660 -0.0537 297  ASP A OD1 
2753 O OD2 . ASP A 373 ? 1.9113 3.2327 1.6829 0.2190  -0.2002 -0.0695 297  ASP A OD2 
2754 N N   . LEU A 374 ? 1.7641 2.8571 1.4059 0.2984  -0.1128 0.0068  298  LEU A N   
2755 C CA  . LEU A 374 ? 1.7896 2.8502 1.3932 0.3363  -0.0943 0.0301  298  LEU A CA  
2756 C C   . LEU A 374 ? 1.8156 2.8169 1.4247 0.3290  -0.0655 0.0493  298  LEU A C   
2757 O O   . LEU A 374 ? 1.8182 2.7932 1.4155 0.3528  -0.0450 0.0740  298  LEU A O   
2758 C CB  . LEU A 374 ? 1.8505 2.9122 1.3980 0.3632  -0.1056 0.0203  298  LEU A CB  
2759 C CG  . LEU A 374 ? 1.9405 2.9794 1.4626 0.3481  -0.1132 0.0005  298  LEU A CG  
2760 C CD1 . LEU A 374 ? 1.9544 2.9296 1.4553 0.3550  -0.0846 0.0186  298  LEU A CD1 
2761 C CD2 . LEU A 374 ? 2.0283 3.0865 1.5003 0.3739  -0.1344 -0.0147 298  LEU A CD2 
2762 N N   . ALA A 375 ? 1.7462 2.7274 1.3738 0.2965  -0.0637 0.0382  299  ALA A N   
2763 C CA  . ALA A 375 ? 1.7273 2.6575 1.3627 0.2886  -0.0385 0.0543  299  ALA A CA  
2764 C C   . ALA A 375 ? 1.7149 2.6410 1.3996 0.2702  -0.0283 0.0667  299  ALA A C   
2765 O O   . ALA A 375 ? 1.7011 2.5895 1.3963 0.2682  -0.0072 0.0841  299  ALA A O   
2766 C CB  . ALA A 375 ? 1.7459 2.6544 1.3726 0.2660  -0.0413 0.0368  299  ALA A CB  
2767 N N   . LEU A 376 ? 1.6307 2.5957 1.3450 0.2578  -0.0433 0.0577  300  LEU A N   
2768 C CA  . LEU A 376 ? 1.5784 2.5407 1.3352 0.2419  -0.0364 0.0672  300  LEU A CA  
2769 C C   . LEU A 376 ? 1.6078 2.5522 1.3625 0.2666  -0.0196 0.0949  300  LEU A C   
2770 O O   . LEU A 376 ? 1.5826 2.4945 1.3590 0.2565  -0.0042 0.1086  300  LEU A O   
2771 C CB  . LEU A 376 ? 1.5574 2.5677 1.3417 0.2262  -0.0560 0.0511  300  LEU A CB  
2772 N N   . PRO A 377 ? 1.5724 2.5333 1.3001 0.2988  -0.0214 0.1040  301  PRO A N   
2773 C CA  . PRO A 377 ? 1.5665 2.5023 1.2903 0.3199  -0.0031 0.1307  301  PRO A CA  
2774 C C   . PRO A 377 ? 1.6042 2.4886 1.3203 0.3231  0.0213  0.1490  301  PRO A C   
2775 O O   . PRO A 377 ? 1.5836 2.4404 1.3143 0.3243  0.0372  0.1688  301  PRO A O   
2776 C CB  . PRO A 377 ? 1.6283 2.5884 1.3142 0.3560  -0.0095 0.1340  301  PRO A CB  
2777 C CG  . PRO A 377 ? 1.6873 2.6993 1.3745 0.3484  -0.0362 0.1079  301  PRO A CG  
2778 C CD  . PRO A 377 ? 1.6211 2.6227 1.3199 0.3178  -0.0403 0.0904  301  PRO A CD  
2779 N N   . PHE A 378 ? 1.5731 2.4447 1.2672 0.3239  0.0241  0.1424  302  PHE A N   
2780 C CA  . PHE A 378 ? 1.5783 2.4058 1.2663 0.3271  0.0478  0.1591  302  PHE A CA  
2781 C C   . PHE A 378 ? 1.5640 2.3728 1.2932 0.2946  0.0534  0.1576  302  PHE A C   
2782 O O   . PHE A 378 ? 1.5466 2.3253 1.2929 0.2929  0.0726  0.1771  302  PHE A O   
2783 C CB  . PHE A 378 ? 1.6466 2.4665 1.2920 0.3426  0.0487  0.1524  302  PHE A CB  
2784 C CG  . PHE A 378 ? 1.7188 2.5489 1.3176 0.3797  0.0466  0.1569  302  PHE A CG  
2785 C CD1 . PHE A 378 ? 1.7958 2.5951 1.3698 0.4082  0.0705  0.1823  302  PHE A CD1 
2786 C CD2 . PHE A 378 ? 1.7639 2.6342 1.3430 0.3867  0.0209  0.1358  302  PHE A CD2 
2787 C CE1 . PHE A 378 ? 1.8551 2.6605 1.3812 0.4454  0.0695  0.1867  302  PHE A CE1 
2788 C CE2 . PHE A 378 ? 1.8462 2.7266 1.3798 0.4237  0.0176  0.1394  302  PHE A CE2 
2789 C CZ  . PHE A 378 ? 1.8559 2.7019 1.3609 0.4540  0.0423  0.1649  302  PHE A CZ  
2790 N N   . ALA A 379 ? 1.4830 2.3097 1.2281 0.2688  0.0367  0.1345  303  ALA A N   
2791 C CA  . ALA A 379 ? 1.4390 2.2492 1.2187 0.2391  0.0400  0.1301  303  ALA A CA  
2792 C C   . ALA A 379 ? 1.4454 2.2506 1.2625 0.2290  0.0435  0.1416  303  ALA A C   
2793 O O   . ALA A 379 ? 1.4214 2.2015 1.2641 0.2139  0.0537  0.1486  303  ALA A O   
2794 C CB  . ALA A 379 ? 1.4378 2.2686 1.2211 0.2164  0.0212  0.1027  303  ALA A CB  
2795 N N   . ILE A 380 ? 1.3900 2.2186 1.2078 0.2390  0.0345  0.1434  304  ILE A N   
2796 C CA  . ILE A 380 ? 1.3573 2.1797 1.2018 0.2345  0.0365  0.1545  304  ILE A CA  
2797 C C   . ILE A 380 ? 1.4197 2.2062 1.2618 0.2487  0.0573  0.1807  304  ILE A C   
2798 O O   . ILE A 380 ? 1.3999 2.1641 1.2692 0.2365  0.0636  0.1905  304  ILE A O   
2799 C CB  . ILE A 380 ? 1.3911 2.2503 1.2307 0.2456  0.0217  0.1493  304  ILE A CB  
2800 C CG1 . ILE A 380 ? 1.3752 2.2710 1.2280 0.2255  0.0022  0.1239  304  ILE A CG1 
2801 C CG2 . ILE A 380 ? 1.3805 2.2258 1.2376 0.2476  0.0263  0.1643  304  ILE A CG2 
2802 C CD1 . ILE A 380 ? 1.4361 2.3778 1.2879 0.2354  -0.0136 0.1167  304  ILE A CD1 
2803 N N   . LEU A 381 ? 1.4068 2.1862 1.2160 0.2737  0.0681  0.1917  305  LEU A N   
2804 C CA  . LEU A 381 ? 1.4224 2.1676 1.2275 0.2876  0.0903  0.2174  305  LEU A CA  
2805 C C   . LEU A 381 ? 1.4662 2.1834 1.2980 0.2692  0.1045  0.2246  305  LEU A C   
2806 O O   . LEU A 381 ? 1.4567 2.1487 1.3101 0.2643  0.1169  0.2417  305  LEU A O   
2807 C CB  . LEU A 381 ? 1.4685 2.2124 1.2285 0.3200  0.0996  0.2264  305  LEU A CB  
2808 C CG  . LEU A 381 ? 1.5548 2.2633 1.3050 0.3379  0.1248  0.2543  305  LEU A CG  
2809 C CD1 . LEU A 381 ? 1.5524 2.2518 1.3097 0.3420  0.1255  0.2662  305  LEU A CD1 
2810 C CD2 . LEU A 381 ? 1.6376 2.3440 1.3393 0.3707  0.1341  0.2611  305  LEU A CD2 
2811 N N   . LEU A 382 ? 1.4235 2.1450 1.2538 0.2589  0.1020  0.2111  306  LEU A N   
2812 C CA  . LEU A 382 ? 1.4101 2.1095 1.2644 0.2433  0.1146  0.2165  306  LEU A CA  
2813 C C   . LEU A 382 ? 1.4169 2.1102 1.3146 0.2174  0.1085  0.2138  306  LEU A C   
2814 O O   . LEU A 382 ? 1.4034 2.0761 1.3274 0.2080  0.1207  0.2258  306  LEU A O   
2815 C CB  . LEU A 382 ? 1.4200 2.1243 1.2576 0.2391  0.1111  0.2004  306  LEU A CB  
2816 C CG  . LEU A 382 ? 1.5241 2.2251 1.3172 0.2647  0.1201  0.2041  306  LEU A CG  
2817 C CD1 . LEU A 382 ? 1.5357 2.2397 1.3094 0.2577  0.1121  0.1841  306  LEU A CD1 
2818 C CD2 . LEU A 382 ? 1.5687 2.2427 1.3625 0.2792  0.1475  0.2310  306  LEU A CD2 
2819 N N   . GLY A 383 ? 1.3471 2.0591 1.2516 0.2074  0.0899  0.1986  307  GLY A N   
2820 C CA  . GLY A 383 ? 1.3058 2.0112 1.2448 0.1864  0.0826  0.1952  307  GLY A CA  
2821 C C   . GLY A 383 ? 1.3408 2.0237 1.2953 0.1901  0.0915  0.2157  307  GLY A C   
2822 O O   . GLY A 383 ? 1.3198 1.9829 1.3043 0.1750  0.0953  0.2214  307  GLY A O   
2823 N N   . PHE A 384 ? 1.3098 1.9941 1.2416 0.2112  0.0950  0.2269  308  PHE A N   
2824 C CA  . PHE A 384 ? 1.3145 1.9723 1.2524 0.2174  0.1053  0.2475  308  PHE A CA  
2825 C C   . PHE A 384 ? 1.3636 1.9967 1.3106 0.2186  0.1267  0.2663  308  PHE A C   
2826 O O   . PHE A 384 ? 1.3538 1.9616 1.3227 0.2109  0.1343  0.2805  308  PHE A O   
2827 C CB  . PHE A 384 ? 1.3662 2.0303 1.2705 0.2428  0.1052  0.2546  308  PHE A CB  
2828 C CG  . PHE A 384 ? 1.3744 2.0617 1.2738 0.2440  0.0866  0.2416  308  PHE A CG  
2829 C CD1 . PHE A 384 ? 1.4037 2.0746 1.3172 0.2374  0.0819  0.2461  308  PHE A CD1 
2830 C CD2 . PHE A 384 ? 1.4054 2.1307 1.2839 0.2542  0.0744  0.2265  308  PHE A CD2 
2831 C CE1 . PHE A 384 ? 1.4047 2.0976 1.3127 0.2414  0.0670  0.2362  308  PHE A CE1 
2832 C CE2 . PHE A 384 ? 1.4295 2.1808 1.3069 0.2564  0.0588  0.2164  308  PHE A CE2 
2833 C CZ  . PHE A 384 ? 1.3925 2.1276 1.2846 0.2507  0.0562  0.2219  308  PHE A CZ  
2834 N N   . THR A 385 ? 1.3320 1.9721 1.2617 0.2286  0.1364  0.2665  309  THR A N   
2835 C CA  . THR A 385 ? 1.3459 1.9669 1.2822 0.2329  0.1592  0.2850  309  THR A CA  
2836 C C   . THR A 385 ? 1.3565 1.9685 1.3379 0.2077  0.1607  0.2852  309  THR A C   
2837 O O   . THR A 385 ? 1.3594 1.9538 1.3625 0.2049  0.1778  0.3037  309  THR A O   
2838 C CB  . THR A 385 ? 1.4736 2.1050 1.3754 0.2510  0.1665  0.2820  309  THR A CB  
2839 O OG1 . THR A 385 ? 1.4936 2.1352 1.3542 0.2750  0.1622  0.2805  309  THR A OG1 
2840 C CG2 . THR A 385 ? 1.4855 2.0978 1.3905 0.2594  0.1929  0.3030  309  THR A CG2 
2841 N N   . ASN A 386 ? 1.2727 1.8969 1.2694 0.1896  0.1430  0.2651  310  ASN A N   
2842 C CA  . ASN A 386 ? 1.2370 1.8535 1.2737 0.1678  0.1417  0.2632  310  ASN A CA  
2843 C C   . ASN A 386 ? 1.2562 1.8526 1.3232 0.1573  0.1421  0.2760  310  ASN A C   
2844 O O   . ASN A 386 ? 1.2449 1.8317 1.3465 0.1444  0.1481  0.2837  310  ASN A O   
2845 C CB  . ASN A 386 ? 1.2279 1.8575 1.2678 0.1531  0.1228  0.2390  310  ASN A CB  
2846 C CG  . ASN A 386 ? 1.5176 2.1398 1.5914 0.1344  0.1215  0.2352  310  ASN A CG  
2847 O OD1 . ASN A 386 ? 1.4472 2.0662 1.5379 0.1200  0.1075  0.2245  310  ASN A OD1 
2848 N ND2 . ASN A 386 ? 1.4091 2.0279 1.4929 0.1363  0.1368  0.2448  310  ASN A ND2 
2849 N N   . SER A 387 ? 1.2016 1.7912 1.2539 0.1643  0.1360  0.2789  311  SER A N   
2850 C CA  . SER A 387 ? 1.1906 1.7553 1.2624 0.1565  0.1355  0.2905  311  SER A CA  
2851 C C   . SER A 387 ? 1.2415 1.7863 1.3189 0.1629  0.1581  0.3151  311  SER A C   
2852 O O   . SER A 387 ? 1.2324 1.7534 1.3321 0.1524  0.1602  0.3263  311  SER A O   
2853 C CB  . SER A 387 ? 1.2364 1.7988 1.2838 0.1654  0.1233  0.2859  311  SER A CB  
2854 O OG  . SER A 387 ? 1.2841 1.8652 1.3303 0.1582  0.1043  0.2647  311  SER A OG  
2855 N N   . CYS A 388 ? 1.2151 1.7678 1.2712 0.1801  0.1752  0.3235  312  CYS A N   
2856 C CA  . CYS A 388 ? 1.2428 1.7783 1.3021 0.1884  0.2006  0.3478  312  CYS A CA  
2857 C C   . CYS A 388 ? 1.2806 1.8212 1.3785 0.1751  0.2118  0.3537  312  CYS A C   
2858 O O   . CYS A 388 ? 1.2932 1.8195 1.4154 0.1708  0.2301  0.3737  312  CYS A O   
2859 C CB  . CYS A 388 ? 1.2775 1.8168 1.2891 0.2175  0.2139  0.3542  312  CYS A CB  
2860 S SG  . CYS A 388 ? 1.3377 1.8795 1.3019 0.2376  0.1998  0.3462  312  CYS A SG  
2861 N N   . VAL A 389 ? 1.2082 1.7696 1.3104 0.1694  0.2016  0.3366  313  VAL A N   
2862 C CA  . VAL A 389 ? 1.1905 1.7608 1.3234 0.1602  0.2103  0.3392  313  VAL A CA  
2863 C C   . VAL A 389 ? 1.2143 1.7805 1.3974 0.1347  0.1991  0.3369  313  VAL A C   
2864 O O   . VAL A 389 ? 1.2071 1.7738 1.4276 0.1264  0.2118  0.3504  313  VAL A O   
2865 C CB  . VAL A 389 ? 1.2283 1.8172 1.3373 0.1661  0.2031  0.3204  313  VAL A CB  
2866 C CG1 . VAL A 389 ? 1.2160 1.8122 1.3522 0.1597  0.2130  0.3234  313  VAL A CG1 
2867 C CG2 . VAL A 389 ? 1.2577 1.8502 1.3155 0.1914  0.2112  0.3209  313  VAL A CG2 
2868 N N   . ASN A 390 ? 1.1596 1.7227 1.3433 0.1236  0.1755  0.3201  314  ASN A N   
2869 C CA  . ASN A 390 ? 1.1392 1.6960 1.3623 0.1018  0.1604  0.3141  314  ASN A CA  
2870 C C   . ASN A 390 ? 1.2190 1.7584 1.4801 0.0900  0.1690  0.3335  314  ASN A C   
2871 O O   . ASN A 390 ? 1.2013 1.7454 1.5041 0.0744  0.1656  0.3338  314  ASN A O   
2872 C CB  . ASN A 390 ? 1.1140 1.6637 1.3217 0.0972  0.1371  0.2968  314  ASN A CB  
2873 C CG  . ASN A 390 ? 1.3092 1.8762 1.4942 0.0998  0.1246  0.2748  314  ASN A CG  
2874 O OD1 . ASN A 390 ? 1.1763 1.7575 1.3605 0.1008  0.1293  0.2687  314  ASN A OD1 
2875 N ND2 . ASN A 390 ? 1.1893 1.7533 1.3568 0.0996  0.1084  0.2624  314  ASN A ND2 
2876 N N   . PRO A 391 ? 1.2129 1.7320 1.4623 0.0960  0.1795  0.3493  315  PRO A N   
2877 C CA  . PRO A 391 ? 1.2292 1.7297 1.5174 0.0805  0.1867  0.3661  315  PRO A CA  
2878 C C   . PRO A 391 ? 1.2921 1.8083 1.6205 0.0751  0.2065  0.3813  315  PRO A C   
2879 O O   . PRO A 391 ? 1.2851 1.8009 1.6616 0.0551  0.2026  0.3856  315  PRO A O   
2880 C CB  . PRO A 391 ? 1.2885 1.7635 1.5448 0.0934  0.1995  0.3809  315  PRO A CB  
2881 C CG  . PRO A 391 ? 1.3508 1.8388 1.5576 0.1186  0.2052  0.3762  315  PRO A CG  
2882 C CD  . PRO A 391 ? 1.2578 1.7683 1.4584 0.1163  0.1844  0.3521  315  PRO A CD  
2883 N N   . PHE A 392 ? 1.2563 1.7874 1.5649 0.0935  0.2269  0.3889  316  PHE A N   
2884 C CA  . PHE A 392 ? 1.2555 1.8029 1.5972 0.0930  0.2490  0.4050  316  PHE A CA  
2885 C C   . PHE A 392 ? 1.2609 1.8334 1.6303 0.0843  0.2380  0.3918  316  PHE A C   
2886 O O   . PHE A 392 ? 1.2501 1.8352 1.6694 0.0716  0.2440  0.4013  316  PHE A O   
2887 C CB  . PHE A 392 ? 1.3064 1.8571 1.6091 0.1195  0.2742  0.4167  316  PHE A CB  
2888 C CG  . PHE A 392 ? 1.3638 1.8900 1.6301 0.1345  0.2881  0.4303  316  PHE A CG  
2889 C CD1 . PHE A 392 ? 1.4305 1.9392 1.7193 0.1300  0.3104  0.4549  316  PHE A CD1 
2890 C CD2 . PHE A 392 ? 1.4001 1.9222 1.6085 0.1552  0.2814  0.4195  316  PHE A CD2 
2891 C CE1 . PHE A 392 ? 1.4808 1.9629 1.7309 0.1464  0.3255  0.4682  316  PHE A CE1 
2892 C CE2 . PHE A 392 ? 1.4727 1.9727 1.6440 0.1729  0.2949  0.4325  316  PHE A CE2 
2893 C CZ  . PHE A 392 ? 1.4786 1.9567 1.6687 0.1693  0.3176  0.4571  316  PHE A CZ  
2894 N N   . LEU A 393 ? 1.1942 1.7740 1.5305 0.0916  0.2223  0.3703  317  LEU A N   
2895 C CA  . LEU A 393 ? 1.1648 1.7630 1.5099 0.0886  0.2126  0.3550  317  LEU A CA  
2896 C C   . LEU A 393 ? 1.1850 1.7846 1.5734 0.0666  0.1915  0.3453  317  LEU A C   
2897 O O   . LEU A 393 ? 1.1592 1.7746 1.5647 0.0640  0.1875  0.3376  317  LEU A O   
2898 C CB  . LEU A 393 ? 1.1586 1.7564 1.4515 0.0998  0.1997  0.3338  317  LEU A CB  
2899 C CG  . LEU A 393 ? 1.2024 1.8134 1.4837 0.1027  0.1942  0.3173  317  LEU A CG  
2900 C CD1 . LEU A 393 ? 1.2206 1.8426 1.4987 0.1170  0.2178  0.3301  317  LEU A CD1 
2901 C CD2 . LEU A 393 ? 1.2357 1.8441 1.4682 0.1098  0.1808  0.2971  317  LEU A CD2 
2902 N N   . TYR A 394 ? 1.1459 1.7270 1.5485 0.0528  0.1782  0.3454  318  TYR A N   
2903 C CA  . TYR A 394 ? 1.1238 1.7025 1.5613 0.0339  0.1558  0.3347  318  TYR A CA  
2904 C C   . TYR A 394 ? 1.2071 1.7735 1.6877 0.0161  0.1551  0.3488  318  TYR A C   
2905 O O   . TYR A 394 ? 1.1902 1.7660 1.7153 0.0012  0.1447  0.3468  318  TYR A O   
2906 C CB  . TYR A 394 ? 1.1165 1.6791 1.5215 0.0331  0.1315  0.3131  318  TYR A CB  
2907 C CG  . TYR A 394 ? 1.1091 1.6826 1.4768 0.0451  0.1281  0.2961  318  TYR A CG  
2908 C CD1 . TYR A 394 ? 1.1103 1.6947 1.4880 0.0416  0.1190  0.2823  318  TYR A CD1 
2909 C CD2 . TYR A 394 ? 1.1245 1.6959 1.4456 0.0596  0.1328  0.2927  318  TYR A CD2 
2910 C CE1 . TYR A 394 ? 1.1088 1.6987 1.4507 0.0506  0.1167  0.2663  318  TYR A CE1 
2911 C CE2 . TYR A 394 ? 1.1249 1.7061 1.4136 0.0677  0.1286  0.2760  318  TYR A CE2 
2912 C CZ  . TYR A 394 ? 1.2037 1.7923 1.5025 0.0622  0.1211  0.2629  318  TYR A CZ  
2913 O OH  . TYR A 394 ? 1.2244 1.8184 1.4899 0.0684  0.1178  0.2462  318  TYR A OH  
2914 N N   . CYS A 395 ? 1.2096 1.7531 1.6755 0.0173  0.1639  0.3613  319  CYS A N   
2915 C CA  . CYS A 395 ? 1.2362 1.7611 1.7379 -0.0015 0.1622  0.3732  319  CYS A CA  
2916 C C   . CYS A 395 ? 1.3373 1.8770 1.8807 -0.0063 0.1888  0.3974  319  CYS A C   
2917 O O   . CYS A 395 ? 1.3344 1.8776 1.9305 -0.0270 0.1844  0.4036  319  CYS A O   
2918 C CB  . CYS A 395 ? 1.2624 1.7506 1.7262 0.0021  0.1598  0.3756  319  CYS A CB  
2919 S SG  . CYS A 395 ? 1.3413 1.7964 1.8403 -0.0217 0.1578  0.3896  319  CYS A SG  
2920 N N   . PHE A 396 ? 1.3360 1.8832 1.8560 0.0126  0.2162  0.4114  320  PHE A N   
2921 C CA  . PHE A 396 ? 1.3679 1.9259 1.9236 0.0104  0.2452  0.4369  320  PHE A CA  
2922 C C   . PHE A 396 ? 1.4390 2.0371 2.0280 0.0137  0.2541  0.4392  320  PHE A C   
2923 O O   . PHE A 396 ? 1.4318 2.0483 2.0810 -0.0042 0.2537  0.4465  320  PHE A O   
2924 C CB  . PHE A 396 ? 1.4211 1.9625 1.9323 0.0317  0.2726  0.4533  320  PHE A CB  
2925 C CG  . PHE A 396 ? 1.4583 1.9602 1.9329 0.0323  0.2662  0.4526  320  PHE A CG  
2926 C CD1 . PHE A 396 ? 1.5187 1.9942 2.0195 0.0137  0.2702  0.4660  320  PHE A CD1 
2927 C CD2 . PHE A 396 ? 1.4777 1.9686 1.8909 0.0520  0.2573  0.4394  320  PHE A CD2 
2928 C CE1 . PHE A 396 ? 1.5526 1.9876 2.0143 0.0164  0.2649  0.4656  320  PHE A CE1 
2929 C CE2 . PHE A 396 ? 1.5328 1.9890 1.9110 0.0554  0.2519  0.4396  320  PHE A CE2 
2930 C CZ  . PHE A 396 ? 1.5352 1.9617 1.9354 0.0387  0.2564  0.4530  320  PHE A CZ  
2931 N N   . VAL A 397 ? 1.4153 2.0265 1.9652 0.0363  0.2611  0.4326  321  VAL A N   
2932 C CA  . VAL A 397 ? 1.4124 2.0566 1.9823 0.0441  0.2713  0.4347  321  VAL A CA  
2933 C C   . VAL A 397 ? 1.4480 2.1074 2.0468 0.0301  0.2431  0.4148  321  VAL A C   
2934 O O   . VAL A 397 ? 1.4333 2.1214 2.0724 0.0279  0.2480  0.4196  321  VAL A O   
2935 C CB  . VAL A 397 ? 1.4705 2.1163 1.9814 0.0724  0.2844  0.4310  321  VAL A CB  
2936 C CG1 . VAL A 397 ? 1.4603 2.1348 1.9862 0.0825  0.2962  0.4340  321  VAL A CG1 
2937 C CG2 . VAL A 397 ? 1.5045 2.1334 1.9832 0.0889  0.3106  0.4500  321  VAL A CG2 
2938 N N   . GLY A 398 ? 1.4059 2.0455 1.9844 0.0220  0.2152  0.3943  322  GLY A N   
2939 C CA  . GLY A 398 ? 1.3848 2.0310 1.9818 0.0107  0.1877  0.3745  322  GLY A CA  
2940 C C   . GLY A 398 ? 1.4505 2.1057 2.1122 -0.0122 0.1765  0.3795  322  GLY A C   
2941 O O   . GLY A 398 ? 1.4265 2.0917 2.1079 -0.0191 0.1554  0.3648  322  GLY A O   
2942 N N   . ASN A 399 ? 1.4439 2.0943 2.1380 -0.0243 0.1900  0.3996  323  ASN A N   
2943 C CA  . ASN A 399 ? 1.4514 2.1114 2.2113 -0.0491 0.1796  0.4052  323  ASN A CA  
2944 C C   . ASN A 399 ? 1.5036 2.2095 2.3170 -0.0486 0.1926  0.4162  323  ASN A C   
2945 O O   . ASN A 399 ? 1.4884 2.2137 2.3536 -0.0647 0.1754  0.4118  323  ASN A O   
2946 C CB  . ASN A 399 ? 1.5059 2.1422 2.2807 -0.0636 0.1913  0.4232  323  ASN A CB  
2947 C CG  . ASN A 399 ? 1.8668 2.5076 2.7071 -0.0928 0.1771  0.4266  323  ASN A CG  
2948 O OD1 . ASN A 399 ? 1.7923 2.4279 2.6443 -0.1049 0.1455  0.4081  323  ASN A OD1 
2949 N ND2 . ASN A 399 ? 1.8048 2.4511 2.6861 -0.1051 0.1998  0.4502  323  ASN A ND2 
2950 N N   . ARG A 400 ? 1.4712 2.1944 2.2706 -0.0285 0.2228  0.4307  324  ARG A N   
2951 C CA  . ARG A 400 ? 1.4631 2.2297 2.3058 -0.0225 0.2394  0.4431  324  ARG A CA  
2952 C C   . ARG A 400 ? 1.4894 2.2722 2.3204 -0.0121 0.2214  0.4227  324  ARG A C   
2953 O O   . ARG A 400 ? 1.4741 2.2933 2.3503 -0.0120 0.2235  0.4275  324  ARG A O   
2954 C CB  . ARG A 400 ? 1.4801 2.2534 2.3022 -0.0010 0.2779  0.4649  324  ARG A CB  
2955 C CG  . ARG A 400 ? 1.6294 2.3859 2.4605 -0.0077 0.3015  0.4881  324  ARG A CG  
2956 C CD  . ARG A 400 ? 1.7880 2.5529 2.5992 0.0168  0.3404  0.5101  324  ARG A CD  
2957 N NE  . ARG A 400 ? 1.9171 2.6646 2.6513 0.0439  0.3417  0.4976  324  ARG A NE  
2958 C CZ  . ARG A 400 ? 2.1322 2.8817 2.8328 0.0700  0.3705  0.5110  324  ARG A CZ  
2959 N NH1 . ARG A 400 ? 2.0022 2.7706 2.7389 0.0745  0.4030  0.5389  324  ARG A NH1 
2960 N NH2 . ARG A 400 ? 1.9666 2.6992 2.5976 0.0918  0.3671  0.4966  324  ARG A NH2 
2961 N N   . PHE A 401 ? 1.4422 2.1978 2.2122 -0.0028 0.2045  0.4005  325  PHE A N   
2962 C CA  . PHE A 401 ? 1.4230 2.1838 2.1716 0.0068  0.1871  0.3790  325  PHE A CA  
2963 C C   . PHE A 401 ? 1.4868 2.2600 2.2841 -0.0106 0.1599  0.3687  325  PHE A C   
2964 O O   . PHE A 401 ? 1.4696 2.2644 2.2787 -0.0031 0.1537  0.3613  325  PHE A O   
2965 C CB  . PHE A 401 ? 1.4357 2.1620 2.1141 0.0151  0.1746  0.3586  325  PHE A CB  
2966 C CG  . PHE A 401 ? 1.4335 2.1591 2.0780 0.0273  0.1631  0.3377  325  PHE A CG  
2967 C CD1 . PHE A 401 ? 1.4520 2.1698 2.1017 0.0186  0.1348  0.3181  325  PHE A CD1 
2968 C CD2 . PHE A 401 ? 1.4606 2.1876 2.0618 0.0479  0.1804  0.3370  325  PHE A CD2 
2969 C CE1 . PHE A 401 ? 1.4510 2.1637 2.0661 0.0301  0.1264  0.2994  325  PHE A CE1 
2970 C CE2 . PHE A 401 ? 1.4836 2.2045 2.0501 0.0576  0.1706  0.3174  325  PHE A CE2 
2971 C CZ  . PHE A 401 ? 1.4425 2.1564 2.0169 0.0485  0.1447  0.2992  325  PHE A CZ  
2972 N N   . GLN A 402 ? 1.4703 2.2284 2.2943 -0.0326 0.1441  0.3689  326  GLN A N   
2973 C CA  . GLN A 402 ? 1.4692 2.2344 2.3406 -0.0518 0.1160  0.3598  326  GLN A CA  
2974 C C   . GLN A 402 ? 1.5296 2.3433 2.4733 -0.0577 0.1245  0.3748  326  GLN A C   
2975 O O   . GLN A 402 ? 1.5078 2.3436 2.4762 -0.0569 0.1067  0.3641  326  GLN A O   
2976 C CB  . GLN A 402 ? 1.5042 2.2371 2.3826 -0.0735 0.1031  0.3607  326  GLN A CB  
2977 C CG  . GLN A 402 ? 1.7290 2.4644 2.6566 -0.0959 0.0729  0.3521  326  GLN A CG  
2978 C CD  . GLN A 402 ? 2.0040 2.7070 2.9423 -0.1183 0.0648  0.3570  326  GLN A CD  
2979 O OE1 . GLN A 402 ? 1.9545 2.6385 2.9031 -0.1332 0.0348  0.3432  326  GLN A OE1 
2980 N NE2 . GLN A 402 ? 1.9240 2.6158 2.8558 -0.1200 0.0913  0.3764  326  GLN A NE2 
2981 N N   . GLN A 403 ? 1.5166 2.3469 2.4941 -0.0629 0.1521  0.4003  327  GLN A N   
2982 C CA  . GLN A 403 ? 1.5246 2.4031 2.5774 -0.0710 0.1649  0.4192  327  GLN A CA  
2983 C C   . GLN A 403 ? 1.5788 2.4951 2.6317 -0.0458 0.1823  0.4242  327  GLN A C   
2984 O O   . GLN A 403 ? 1.5652 2.5236 2.6734 -0.0487 0.1760  0.4266  327  GLN A O   
2985 C CB  . GLN A 403 ? 1.5674 2.4448 2.6454 -0.0815 0.1943  0.4462  327  GLN A CB  
2986 C CG  . GLN A 403 ? 1.7843 2.7111 2.9494 -0.0958 0.2089  0.4685  327  GLN A CG  
2987 C CD  . GLN A 403 ? 2.0376 2.9778 3.2679 -0.1264 0.1784  0.4610  327  GLN A CD  
2988 O OE1 . GLN A 403 ? 1.9920 2.8969 3.2029 -0.1399 0.1469  0.4410  327  GLN A OE1 
2989 N NE2 . GLN A 403 ? 1.9362 2.9273 3.2466 -0.1385 0.1881  0.4780  327  GLN A NE2 
2990 N N   . LYS A 404 ? 1.5505 2.4520 2.5417 -0.0209 0.2036  0.4259  328  LYS A N   
2991 C CA  . LYS A 404 ? 1.5512 2.4809 2.5332 0.0049  0.2232  0.4319  328  LYS A CA  
2992 C C   . LYS A 404 ? 1.5988 2.5245 2.5487 0.0174  0.1998  0.4066  328  LYS A C   
2993 O O   . LYS A 404 ? 1.5905 2.5409 2.5391 0.0374  0.2115  0.4098  328  LYS A O   
2994 C CB  . LYS A 404 ? 1.5986 2.5099 2.5238 0.0268  0.2547  0.4434  328  LYS A CB  
2995 C CG  . LYS A 404 ? 1.7947 2.7129 2.7493 0.0214  0.2852  0.4724  328  LYS A CG  
2996 C CD  . LYS A 404 ? 1.9195 2.8905 2.9506 0.0192  0.3045  0.4960  328  LYS A CD  
2997 C CE  . LYS A 404 ? 2.0689 3.0450 3.1313 0.0124  0.3363  0.5255  328  LYS A CE  
2998 N NZ  . LYS A 404 ? 2.1690 3.1102 3.1817 -0.0153 0.3261  0.4344  328  LYS A NZ  
2999 N N   . LEU A 405 ? 1.5597 2.4537 2.4839 0.0068  0.1686  0.3828  329  LEU A N   
3000 C CA  . LEU A 405 ? 1.5509 2.4377 2.4464 0.0172  0.1465  0.3591  329  LEU A CA  
3001 C C   . LEU A 405 ? 1.6132 2.5341 2.5730 0.0074  0.1255  0.3562  329  LEU A C   
3002 O O   . LEU A 405 ? 1.6002 2.5354 2.5547 0.0226  0.1184  0.3465  329  LEU A O   
3003 C CB  . LEU A 405 ? 1.5456 2.3837 2.3845 0.0123  0.1246  0.3362  329  LEU A CB  
3004 C CG  . LEU A 405 ? 1.5929 2.4137 2.3887 0.0244  0.1059  0.3116  329  LEU A CG  
3005 C CD1 . LEU A 405 ? 1.5992 2.4231 2.3522 0.0496  0.1275  0.3121  329  LEU A CD1 
3006 C CD2 . LEU A 405 ? 1.6204 2.3959 2.3676 0.0175  0.0874  0.2928  329  LEU A CD2 
3007 N N   . ARG A 406 ? 1.5910 2.5250 2.6112 -0.0177 0.1160  0.3649  330  ARG A N   
3008 C CA  . ARG A 406 ? 1.5918 2.5621 2.6810 -0.0306 0.0947  0.3632  330  ARG A CA  
3009 C C   . ARG A 406 ? 1.6602 2.6896 2.8066 -0.0218 0.1186  0.3856  330  ARG A C   
3010 O O   . ARG A 406 ? 1.6493 2.7178 2.8461 -0.0229 0.1035  0.3832  330  ARG A O   
3011 C CB  . ARG A 406 ? 1.6046 2.5635 2.7349 -0.0625 0.0762  0.3641  330  ARG A CB  
3012 N N   . SER A 407 ? 1.6397 2.6758 2.7765 -0.0109 0.1559  0.4075  331  SER A N   
3013 C CA  . SER A 407 ? 1.6481 2.7370 2.8319 0.0013  0.1845  0.4318  331  SER A CA  
3014 C C   . SER A 407 ? 1.7006 2.8033 2.8517 0.0331  0.1892  0.4248  331  SER A C   
3015 O O   . SER A 407 ? 1.6936 2.8463 2.8961 0.0404  0.1906  0.4327  331  SER A O   
3016 C CB  . SER A 407 ? 1.7130 2.7959 2.8863 0.0056  0.2232  0.4566  331  SER A CB  
3017 O OG  . SER A 407 ? 1.8393 2.9119 3.0474 -0.0228 0.2231  0.4665  331  SER A OG  
3018 N N   . VAL A 408 ? 1.6646 2.7230 2.7307 0.0518  0.1915  0.4099  332  VAL A N   
3019 C CA  . VAL A 408 ? 1.6666 2.7258 2.6888 0.0818  0.1966  0.4014  332  VAL A CA  
3020 C C   . VAL A 408 ? 1.7102 2.7726 2.7398 0.0811  0.1619  0.3784  332  VAL A C   
3021 O O   . VAL A 408 ? 1.7053 2.7853 2.7261 0.1039  0.1642  0.3754  332  VAL A O   
3022 C CB  . VAL A 408 ? 1.7253 2.7338 2.6546 0.0990  0.2091  0.3917  332  VAL A CB  
3023 C CG1 . VAL A 408 ? 1.7408 2.7515 2.6576 0.1099  0.2463  0.4154  332  VAL A CG1 
3024 C CG2 . VAL A 408 ? 1.7145 2.6736 2.6016 0.0825  0.1853  0.3699  332  VAL A CG2 
3025 N N   . PHE A 409 ? 1.6656 2.7091 2.7086 0.0568  0.1305  0.3629  333  PHE A N   
3026 C CA  . PHE A 409 ? 1.6584 2.7003 2.7067 0.0556  0.0958  0.3408  333  PHE A CA  
3027 C C   . PHE A 409 ? 1.7052 2.8060 2.8429 0.0457  0.0835  0.3499  333  PHE A C   
3028 O O   . PHE A 409 ? 1.6991 2.8246 2.8467 0.0624  0.0727  0.3428  333  PHE A O   
3029 C CB  . PHE A 409 ? 1.6776 2.6700 2.6962 0.0362  0.0680  0.3206  333  PHE A CB  
3030 N N   . ARG A 410 ? 1.6616 2.7847 2.8639 0.0189  0.0856  0.3658  334  ARG A N   
3031 C CA  . ARG A 410 ? 2.0261 3.2071 3.3228 0.0023  0.0746  0.3763  334  ARG A CA  
3032 C C   . ARG A 410 ? 2.2917 3.3360 3.4032 -0.0056 0.0279  0.1856  334  ARG A C   
3033 O O   . ARG A 410 ? 1.7798 2.9909 3.1597 -0.0266 0.0099  0.3529  334  ARG A O   
3034 C CB  . ARG A 410 ? 2.0323 3.2299 3.3133 0.0184  0.0988  0.3479  334  ARG A CB  
3035 N N   . ALA B 1   ? 1.2410 1.1602 1.7944 -0.0953 0.1995  0.1905  1001 ALA B N   
3036 C CA  . ALA B 1   ? 1.2406 1.1798 1.7163 -0.0562 0.2050  0.2123  1001 ALA B CA  
3037 C C   . ALA B 1   ? 1.2419 1.2487 1.7059 -0.0483 0.2096  0.2018  1001 ALA B C   
3038 O O   . ALA B 1   ? 1.2439 1.2714 1.6405 -0.0188 0.2084  0.2047  1001 ALA B O   
3039 C CB  . ALA B 1   ? 1.3276 1.2364 1.7813 -0.0427 0.2419  0.2704  1001 ALA B CB  
3040 N N   . ASP B 2   ? 1.1547 1.1971 1.6861 -0.0736 0.2136  0.1868  1002 ASP B N   
3041 C CA  . ASP B 2   ? 1.1183 1.2228 1.6535 -0.0633 0.2208  0.1758  1002 ASP B CA  
3042 C C   . ASP B 2   ? 1.1014 1.2166 1.6131 -0.0503 0.1819  0.1329  1002 ASP B C   
3043 O O   . ASP B 2   ? 1.0791 1.1734 1.6055 -0.0625 0.1510  0.1099  1002 ASP B O   
3044 C CB  . ASP B 2   ? 1.1374 1.2848 1.7670 -0.0940 0.2391  0.1816  1002 ASP B CB  
3045 C CG  . ASP B 2   ? 1.2196 1.4374 1.8693 -0.0797 0.2521  0.1749  1002 ASP B CG  
3046 O OD1 . ASP B 2   ? 1.2379 1.4645 1.8209 -0.0450 0.2650  0.1760  1002 ASP B OD1 
3047 O OD2 . ASP B 2   ? 1.2635 1.5302 1.9978 -0.1024 0.2520  0.1694  1002 ASP B OD2 
3048 N N   . LEU B 3   ? 1.0296 1.1737 1.5039 -0.0250 0.1865  0.1224  1003 LEU B N   
3049 C CA  . LEU B 3   ? 0.9759 1.1221 1.4289 -0.0119 0.1561  0.0874  1003 LEU B CA  
3050 C C   . LEU B 3   ? 0.9600 1.1327 1.4810 -0.0271 0.1366  0.0696  1003 LEU B C   
3051 O O   . LEU B 3   ? 0.9156 1.0741 1.4292 -0.0282 0.1050  0.0492  1003 LEU B O   
3052 C CB  . LEU B 3   ? 0.9959 1.1595 1.4044 0.0161  0.1724  0.0784  1003 LEU B CB  
3053 C CG  . LEU B 3   ? 1.0313 1.1835 1.4167 0.0295  0.1472  0.0445  1003 LEU B CG  
3054 C CD1 . LEU B 3   ? 1.0271 1.1443 1.3634 0.0277  0.1179  0.0332  1003 LEU B CD1 
3055 C CD2 . LEU B 3   ? 1.0963 1.2573 1.4459 0.0558  0.1693  0.0310  1003 LEU B CD2 
3056 N N   . GLU B 4   ? 0.9186 1.1380 1.5059 -0.0376 0.1556  0.0802  1004 GLU B N   
3057 C CA  . GLU B 4   ? 0.8836 1.1470 1.5412 -0.0510 0.1355  0.0669  1004 GLU B CA  
3058 C C   . GLU B 4   ? 0.9300 1.1724 1.6113 -0.0821 0.1062  0.0542  1004 GLU B C   
3059 O O   . GLU B 4   ? 0.9014 1.1602 1.5959 -0.0843 0.0739  0.0331  1004 GLU B O   
3060 C CB  . GLU B 4   ? 0.9112 1.2404 1.6429 -0.0581 0.1654  0.0855  1004 GLU B CB  
3061 C CG  . GLU B 4   ? 1.0190 1.4143 1.8319 -0.0702 0.1427  0.0747  1004 GLU B CG  
3062 C CD  . GLU B 4   ? 1.2804 1.7563 2.1839 -0.0817 0.1697  0.0944  1004 GLU B CD  
3063 O OE1 . GLU B 4   ? 1.2840 1.8259 2.2619 -0.0957 0.1461  0.0860  1004 GLU B OE1 
3064 O OE2 . GLU B 4   ? 1.1870 1.6678 2.0894 -0.0774 0.2140  0.1198  1004 GLU B OE2 
3065 N N   . ASP B 5   ? 0.9164 1.1196 1.5990 -0.1028 0.1199  0.0678  1005 ASP B N   
3066 C CA  . ASP B 5   ? 0.9244 1.0922 1.6271 -0.1315 0.0996  0.0526  1005 ASP B CA  
3067 C C   . ASP B 5   ? 0.9734 1.0937 1.6103 -0.1145 0.0739  0.0343  1005 ASP B C   
3068 O O   . ASP B 5   ? 0.9698 1.0799 1.6161 -0.1280 0.0475  0.0082  1005 ASP B O   
3069 C CB  . ASP B 5   ? 0.9967 1.1251 1.7220 -0.1537 0.1305  0.0792  1005 ASP B CB  
3070 C CG  . ASP B 5   ? 1.1035 1.2839 1.9067 -0.1773 0.1597  0.1010  1005 ASP B CG  
3071 O OD1 . ASP B 5   ? 1.0701 1.3197 1.9311 -0.1877 0.1455  0.0854  1005 ASP B OD1 
3072 O OD2 . ASP B 5   ? 1.2286 1.3852 2.0397 -0.1852 0.1973  0.1371  1005 ASP B OD2 
3073 N N   . ASN B 6   ? 0.9303 1.0286 1.5019 -0.0855 0.0814  0.0459  1006 ASN B N   
3074 C CA  . ASN B 6   ? 0.9130 0.9808 1.4315 -0.0693 0.0592  0.0325  1006 ASN B CA  
3075 C C   . ASN B 6   ? 0.9433 1.0416 1.4604 -0.0615 0.0334  0.0105  1006 ASN B C   
3076 O O   . ASN B 6   ? 0.9302 1.0163 1.4327 -0.0611 0.0117  -0.0058 1006 ASN B O   
3077 C CB  . ASN B 6   ? 0.9071 0.9568 1.3662 -0.0454 0.0707  0.0500  1006 ASN B CB  
3078 C CG  . ASN B 6   ? 1.2108 1.2242 1.6581 -0.0449 0.0915  0.0778  1006 ASN B CG  
3079 O OD1 . ASN B 6   ? 1.1738 1.1527 1.6492 -0.0604 0.0935  0.0794  1006 ASN B OD1 
3080 N ND2 . ASN B 6   ? 1.1373 1.1535 1.5366 -0.0242 0.1053  0.0992  1006 ASN B ND2 
3081 N N   . TRP B 7   ? 0.9030 1.0411 1.4369 -0.0525 0.0388  0.0126  1007 TRP B N   
3082 C CA  . TRP B 7   ? 0.8865 1.0515 1.4255 -0.0419 0.0176  0.0000  1007 TRP B CA  
3083 C C   . TRP B 7   ? 0.9206 1.1182 1.5031 -0.0598 -0.0045 -0.0133 1007 TRP B C   
3084 O O   . TRP B 7   ? 0.9070 1.1167 1.4771 -0.0523 -0.0279 -0.0234 1007 TRP B O   
3085 C CB  . TRP B 7   ? 0.8792 1.0718 1.4293 -0.0224 0.0320  0.0068  1007 TRP B CB  
3086 C CG  . TRP B 7   ? 0.9120 1.0708 1.4080 -0.0029 0.0404  0.0052  1007 TRP B CG  
3087 C CD1 . TRP B 7   ? 0.9790 1.1249 1.4451 0.0059  0.0643  0.0100  1007 TRP B CD1 
3088 C CD2 . TRP B 7   ? 0.9065 1.0412 1.3702 0.0061  0.0234  -0.0037 1007 TRP B CD2 
3089 N NE1 . TRP B 7   ? 0.9896 1.1061 1.4069 0.0182  0.0589  -0.0021 1007 TRP B NE1 
3090 C CE2 . TRP B 7   ? 0.9857 1.0930 1.4065 0.0161  0.0350  -0.0092 1007 TRP B CE2 
3091 C CE3 . TRP B 7   ? 0.9069 1.0438 1.3733 0.0059  0.0006  -0.0066 1007 TRP B CE3 
3092 C CZ2 . TRP B 7   ? 0.9849 1.0651 1.3769 0.0198  0.0231  -0.0198 1007 TRP B CZ2 
3093 C CZ3 . TRP B 7   ? 0.9311 1.0409 1.3676 0.0125  -0.0059 -0.0095 1007 TRP B CZ3 
3094 C CH2 . TRP B 7   ? 0.9635 1.0443 1.3689 0.0166  0.0046  -0.0172 1007 TRP B CH2 
3095 N N   . GLU B 8   ? 0.8828 1.0953 1.5144 -0.0853 0.0026  -0.0135 1008 GLU B N   
3096 C CA  . GLU B 8   ? 0.8874 1.1320 1.5619 -0.1096 -0.0222 -0.0344 1008 GLU B CA  
3097 C C   . GLU B 8   ? 0.9528 1.1480 1.5873 -0.1163 -0.0391 -0.0568 1008 GLU B C   
3098 O O   . GLU B 8   ? 0.9541 1.1728 1.5825 -0.1179 -0.0674 -0.0793 1008 GLU B O   
3099 C CB  . GLU B 8   ? 0.9270 1.1976 1.6738 -0.1416 -0.0076 -0.0296 1008 GLU B CB  
3100 C CG  . GLU B 8   ? 1.0907 1.4091 1.8927 -0.1726 -0.0381 -0.0571 1008 GLU B CG  
3101 C CD  . GLU B 8   ? 1.4786 1.8370 2.3699 -0.2107 -0.0254 -0.0523 1008 GLU B CD  
3102 O OE1 . GLU B 8   ? 1.4231 1.7891 2.3386 -0.2066 0.0116  -0.0203 1008 GLU B OE1 
3103 O OE2 . GLU B 8   ? 1.4791 1.8696 2.4180 -0.2452 -0.0529 -0.0816 1008 GLU B OE2 
3104 N N   . THR B 9   ? 0.9186 1.0498 1.5199 -0.1135 -0.0205 -0.0483 1009 THR B N   
3105 C CA  . THR B 9   ? 0.9343 1.0148 1.4978 -0.1111 -0.0291 -0.0656 1009 THR B CA  
3106 C C   . THR B 9   ? 0.9518 1.0449 1.4661 -0.0845 -0.0455 -0.0699 1009 THR B C   
3107 O O   . THR B 9   ? 0.9619 1.0517 1.4557 -0.0827 -0.0626 -0.0928 1009 THR B O   
3108 C CB  . THR B 9   ? 1.0519 1.0713 1.5978 -0.1064 -0.0026 -0.0448 1009 THR B CB  
3109 O OG1 . THR B 9   ? 1.0786 1.0884 1.6734 -0.1313 0.0181  -0.0317 1009 THR B OG1 
3110 C CG2 . THR B 9   ? 1.0794 1.0448 1.5954 -0.0991 -0.0068 -0.0606 1009 THR B CG2 
3111 N N   . LEU B 10  ? 0.8712 0.9786 1.3680 -0.0650 -0.0383 -0.0489 1010 LEU B N   
3112 C CA  . LEU B 10  ? 0.8426 0.9600 1.3043 -0.0447 -0.0492 -0.0467 1010 LEU B CA  
3113 C C   . LEU B 10  ? 0.8654 1.0286 1.3375 -0.0426 -0.0704 -0.0555 1010 LEU B C   
3114 O O   . LEU B 10  ? 0.8672 1.0353 1.3097 -0.0331 -0.0825 -0.0617 1010 LEU B O   
3115 C CB  . LEU B 10  ? 0.8270 0.9421 1.2759 -0.0308 -0.0363 -0.0279 1010 LEU B CB  
3116 C CG  . LEU B 10  ? 0.9015 0.9837 1.3222 -0.0256 -0.0222 -0.0181 1010 LEU B CG  
3117 C CD1 . LEU B 10  ? 0.9052 0.9902 1.3149 -0.0167 -0.0113 -0.0098 1010 LEU B CD1 
3118 C CD2 . LEU B 10  ? 0.9353 1.0049 1.3267 -0.0172 -0.0308 -0.0202 1010 LEU B CD2 
3119 N N   . ASN B 11  ? 0.7973 1.0017 1.3116 -0.0487 -0.0738 -0.0526 1011 ASN B N   
3120 C CA  . ASN B 11  ? 0.7817 1.0427 1.3098 -0.0415 -0.0960 -0.0543 1011 ASN B CA  
3121 C C   . ASN B 11  ? 0.8394 1.1231 1.3704 -0.0595 -0.1209 -0.0845 1011 ASN B C   
3122 O O   . ASN B 11  ? 0.8370 1.1588 1.3471 -0.0475 -0.1425 -0.0887 1011 ASN B O   
3123 C CB  . ASN B 11  ? 0.7520 1.0581 1.3313 -0.0375 -0.0906 -0.0394 1011 ASN B CB  
3124 C CG  . ASN B 11  ? 0.9279 1.2118 1.4968 -0.0141 -0.0684 -0.0169 1011 ASN B CG  
3125 O OD1 . ASN B 11  ? 0.8089 1.0711 1.3435 0.0039  -0.0691 -0.0072 1011 ASN B OD1 
3126 N ND2 . ASN B 11  ? 0.8295 1.1213 1.4309 -0.0141 -0.0472 -0.0091 1011 ASN B ND2 
3127 N N   . ASP B 12  ? 0.8193 1.0766 1.3718 -0.0872 -0.1172 -0.1059 1012 ASP B N   
3128 C CA  . ASP B 12  ? 0.8631 1.1303 1.4167 -0.1082 -0.1412 -0.1450 1012 ASP B CA  
3129 C C   . ASP B 12  ? 0.9374 1.1660 1.4244 -0.0922 -0.1442 -0.1621 1012 ASP B C   
3130 O O   . ASP B 12  ? 0.9626 1.2245 1.4227 -0.0890 -0.1686 -0.1869 1012 ASP B O   
3131 C CB  . ASP B 12  ? 0.9230 1.1596 1.5257 -0.1458 -0.1326 -0.1632 1012 ASP B CB  
3132 C CG  . ASP B 12  ? 1.1042 1.3968 1.7848 -0.1682 -0.1312 -0.1517 1012 ASP B CG  
3133 O OD1 . ASP B 12  ? 1.0868 1.4423 1.7832 -0.1486 -0.1358 -0.1287 1012 ASP B OD1 
3134 O OD2 . ASP B 12  ? 1.2174 1.4902 1.9476 -0.2039 -0.1225 -0.1630 1012 ASP B OD2 
3135 N N   . ASN B 13  ? 0.8777 1.0462 1.3371 -0.0790 -0.1194 -0.1472 1013 ASN B N   
3136 C CA  . ASN B 13  ? 0.8867 1.0257 1.2920 -0.0593 -0.1160 -0.1571 1013 ASN B CA  
3137 C C   . ASN B 13  ? 0.9036 1.0849 1.2738 -0.0333 -0.1222 -0.1371 1013 ASN B C   
3138 O O   . ASN B 13  ? 0.9236 1.1077 1.2508 -0.0180 -0.1246 -0.1488 1013 ASN B O   
3139 C CB  . ASN B 13  ? 0.8674 0.9463 1.2649 -0.0509 -0.0897 -0.1409 1013 ASN B CB  
3140 C CG  . ASN B 13  ? 1.0901 1.1115 1.5094 -0.0692 -0.0788 -0.1579 1013 ASN B CG  
3141 O OD1 . ASN B 13  ? 1.1039 1.0974 1.5121 -0.0749 -0.0847 -0.1941 1013 ASN B OD1 
3142 N ND2 . ASN B 13  ? 0.9103 0.9048 1.3541 -0.0746 -0.0589 -0.1309 1013 ASN B ND2 
3143 N N   . LEU B 14  ? 0.8230 1.0345 1.2124 -0.0269 -0.1214 -0.1061 1014 LEU B N   
3144 C CA  . LEU B 14  ? 0.8104 1.0534 1.1753 -0.0043 -0.1240 -0.0807 1014 LEU B CA  
3145 C C   . LEU B 14  ? 0.8957 1.1975 1.2440 0.0020  -0.1498 -0.0923 1014 LEU B C   
3146 O O   . LEU B 14  ? 0.9104 1.2348 1.2193 0.0225  -0.1512 -0.0780 1014 LEU B O   
3147 C CB  . LEU B 14  ? 0.7776 1.0224 1.1711 0.0014  -0.1137 -0.0486 1014 LEU B CB  
3148 C CG  . LEU B 14  ? 0.8317 1.0834 1.2081 0.0216  -0.1078 -0.0169 1014 LEU B CG  
3149 C CD1 . LEU B 14  ? 0.8276 1.0475 1.1778 0.0239  -0.0928 -0.0113 1014 LEU B CD1 
3150 C CD2 . LEU B 14  ? 0.8382 1.0809 1.2455 0.0268  -0.0976 0.0046  1014 LEU B CD2 
3151 N N   . LYS B 15  ? 0.8672 1.1990 1.2460 -0.0170 -0.1703 -0.1175 1015 LYS B N   
3152 C CA  . LYS B 15  ? 0.9045 1.3033 1.2697 -0.0155 -0.2025 -0.1371 1015 LYS B CA  
3153 C C   . LYS B 15  ? 1.0132 1.3973 1.3223 -0.0158 -0.2098 -0.1781 1015 LYS B C   
3154 O O   . LYS B 15  ? 1.0543 1.4882 1.3159 0.0022  -0.2273 -0.1828 1015 LYS B O   
3155 C CB  . LYS B 15  ? 0.9420 1.3826 1.3693 -0.0425 -0.2234 -0.1561 1015 LYS B CB  
3156 C CG  . LYS B 15  ? 1.0979 1.5687 1.5811 -0.0348 -0.2155 -0.1167 1015 LYS B CG  
3157 C CD  . LYS B 15  ? 1.2246 1.7447 1.7804 -0.0636 -0.2312 -0.1338 1015 LYS B CD  
3158 C CE  . LYS B 15  ? 1.2995 1.8489 1.9117 -0.0506 -0.2161 -0.0953 1015 LYS B CE  
3159 N NZ  . LYS B 15  ? 1.4136 2.0213 2.1069 -0.0797 -0.2268 -0.1082 1015 LYS B NZ  
3160 N N   . VAL B 16  ? 0.9764 1.2908 1.2876 -0.0317 -0.1938 -0.2056 1016 VAL B N   
3161 C CA  . VAL B 16  ? 1.0320 1.3135 1.2942 -0.0287 -0.1930 -0.2491 1016 VAL B CA  
3162 C C   . VAL B 16  ? 1.0793 1.3723 1.2801 0.0081  -0.1779 -0.2264 1016 VAL B C   
3163 O O   . VAL B 16  ? 1.1392 1.4561 1.2836 0.0221  -0.1873 -0.2545 1016 VAL B O   
3164 C CB  . VAL B 16  ? 1.0905 1.2847 1.3765 -0.0454 -0.1709 -0.2678 1016 VAL B CB  
3165 C CG1 . VAL B 16  ? 1.1614 1.3120 1.3978 -0.0351 -0.1651 -0.3128 1016 VAL B CG1 
3166 C CG2 . VAL B 16  ? 1.0917 1.2753 1.4434 -0.0850 -0.1804 -0.2842 1016 VAL B CG2 
3167 N N   . ILE B 17  ? 0.9636 1.2447 1.1768 0.0218  -0.1544 -0.1768 1017 ILE B N   
3168 C CA  . ILE B 17  ? 0.9522 1.2464 1.1268 0.0500  -0.1355 -0.1464 1017 ILE B CA  
3169 C C   . ILE B 17  ? 1.0484 1.4131 1.1847 0.0686  -0.1508 -0.1296 1017 ILE B C   
3170 O O   . ILE B 17  ? 1.0842 1.4713 1.1658 0.0909  -0.1425 -0.1310 1017 ILE B O   
3171 C CB  . ILE B 17  ? 0.9208 1.1910 1.1310 0.0502  -0.1138 -0.1008 1017 ILE B CB  
3172 C CG1 . ILE B 17  ? 0.9038 1.1143 1.1425 0.0375  -0.1001 -0.1129 1017 ILE B CG1 
3173 C CG2 . ILE B 17  ? 0.9205 1.2106 1.1052 0.0718  -0.0943 -0.0667 1017 ILE B CG2 
3174 C CD1 . ILE B 17  ? 0.9191 1.1107 1.1900 0.0337  -0.0855 -0.0777 1017 ILE B CD1 
3175 N N   . GLU B 18  ? 1.0075 1.4111 1.1713 0.0638  -0.1708 -0.1108 1018 GLU B N   
3176 C CA  . GLU B 18  ? 1.0431 1.5182 1.1745 0.0862  -0.1871 -0.0853 1018 GLU B CA  
3177 C C   . GLU B 18  ? 1.1690 1.6909 1.2404 0.0920  -0.2127 -0.1315 1018 GLU B C   
3178 O O   . GLU B 18  ? 1.2068 1.7789 1.2189 0.1200  -0.2137 -0.1128 1018 GLU B O   
3179 C CB  . GLU B 18  ? 1.0352 1.5440 1.2178 0.0828  -0.2051 -0.0602 1018 GLU B CB  
3180 C CG  . GLU B 18  ? 1.1347 1.5996 1.3681 0.0816  -0.1808 -0.0185 1018 GLU B CG  
3181 C CD  . GLU B 18  ? 1.4637 1.9595 1.7482 0.0850  -0.1931 0.0042  1018 GLU B CD  
3182 O OE1 . GLU B 18  ? 1.3608 1.8141 1.6916 0.0758  -0.1761 0.0147  1018 GLU B OE1 
3183 O OE2 . GLU B 18  ? 1.4777 2.0456 1.7564 0.0980  -0.2206 0.0082  1018 GLU B OE2 
3184 N N   . LYS B 19  ? 1.1554 1.6595 1.2413 0.0645  -0.2322 -0.1919 1019 LYS B N   
3185 C CA  . LYS B 19  ? 1.2411 1.7811 1.2752 0.0614  -0.2616 -0.2517 1019 LYS B CA  
3186 C C   . LYS B 19  ? 1.3404 1.8163 1.3308 0.0637  -0.2407 -0.2998 1019 LYS B C   
3187 O O   . LYS B 19  ? 1.4175 1.8951 1.3718 0.0539  -0.2616 -0.3655 1019 LYS B O   
3188 C CB  . LYS B 19  ? 1.2837 1.8455 1.3732 0.0237  -0.2986 -0.2919 1019 LYS B CB  
3189 C CG  . LYS B 19  ? 1.4558 2.0944 1.5919 0.0272  -0.3209 -0.2480 1019 LYS B CG  
3190 C CD  . LYS B 19  ? 1.5976 2.2690 1.8015 -0.0125 -0.3547 -0.2862 1019 LYS B CD  
3191 C CE  . LYS B 19  ? 1.7262 2.4820 1.9823 -0.0019 -0.3739 -0.2397 1019 LYS B CE  
3192 N NZ  . LYS B 19  ? 1.8634 2.6650 2.1987 -0.0423 -0.4047 -0.2734 1019 LYS B NZ  
3193 N N   . ALA B 20  ? 1.2562 1.6790 1.2511 0.0780  -0.2003 -0.2693 1020 ALA B N   
3194 C CA  . ALA B 20  ? 1.2975 1.6630 1.2599 0.0887  -0.1752 -0.3052 1020 ALA B CA  
3195 C C   . ALA B 20  ? 1.4234 1.8344 1.2973 0.1251  -0.1672 -0.3151 1020 ALA B C   
3196 O O   . ALA B 20  ? 1.4051 1.8786 1.2517 0.1479  -0.1624 -0.2648 1020 ALA B O   
3197 C CB  . ALA B 20  ? 1.2412 1.5540 1.2456 0.0935  -0.1388 -0.2646 1020 ALA B CB  
3198 N N   . ASP B 21  ? 1.4709 1.8457 1.2990 0.1324  -0.1620 -0.3793 1021 ASP B N   
3199 C CA  . ASP B 21  ? 1.5619 1.9741 1.2967 0.1702  -0.1502 -0.4021 1021 ASP B CA  
3200 C C   . ASP B 21  ? 1.6074 1.9866 1.3373 0.2016  -0.0997 -0.3797 1021 ASP B C   
3201 O O   . ASP B 21  ? 1.6059 2.0412 1.2984 0.2336  -0.0752 -0.3358 1021 ASP B O   
3202 C CB  . ASP B 21  ? 1.7027 2.0948 1.3858 0.1603  -0.1765 -0.4975 1021 ASP B CB  
3203 C CG  . ASP B 21  ? 1.8735 2.3114 1.5673 0.1251  -0.2318 -0.5290 1021 ASP B CG  
3204 O OD1 . ASP B 21  ? 1.8422 2.3620 1.5408 0.1287  -0.2514 -0.4770 1021 ASP B OD1 
3205 O OD2 . ASP B 21  ? 2.0224 2.4188 1.7180 0.0962  -0.2554 -0.6070 1021 ASP B OD2 
3206 N N   . ASN B 22  ? 1.5584 1.8511 1.3323 0.1931  -0.0830 -0.4047 1022 ASN B N   
3207 C CA  . ASN B 22  ? 1.5523 1.8140 1.3330 0.2244  -0.0379 -0.3883 1022 ASN B CA  
3208 C C   . ASN B 22  ? 1.4810 1.7187 1.3488 0.2103  -0.0243 -0.3275 1022 ASN B C   
3209 O O   . ASN B 22  ? 1.4162 1.6392 1.3356 0.1755  -0.0471 -0.3115 1022 ASN B O   
3210 C CB  . ASN B 22  ? 1.6654 1.8457 1.4241 0.2352  -0.0272 -0.4622 1022 ASN B CB  
3211 C CG  . ASN B 22  ? 1.9650 2.0617 1.7771 0.1938  -0.0494 -0.4986 1022 ASN B CG  
3212 O OD1 . ASN B 22  ? 1.8471 1.8923 1.7272 0.1830  -0.0369 -0.4679 1022 ASN B OD1 
3213 N ND2 . ASN B 22  ? 1.9318 2.0159 1.7135 0.1697  -0.0820 -0.5659 1022 ASN B ND2 
3214 N N   . ALA B 23  ? 1.4099 1.6516 1.2923 0.2393  0.0130  -0.2959 1023 ALA B N   
3215 C CA  . ALA B 23  ? 1.3123 1.5451 1.2684 0.2314  0.0262  -0.2419 1023 ALA B CA  
3216 C C   . ALA B 23  ? 1.3386 1.4877 1.3416 0.2140  0.0200  -0.2616 1023 ALA B C   
3217 O O   . ALA B 23  ? 1.2605 1.4022 1.3195 0.1957  0.0167  -0.2224 1023 ALA B O   
3218 C CB  . ALA B 23  ? 1.3256 1.5961 1.2850 0.2687  0.0651  -0.2124 1023 ALA B CB  
3219 N N   . ALA B 24  ? 1.3711 1.4547 1.3492 0.2200  0.0201  -0.3218 1024 ALA B N   
3220 C CA  . ALA B 24  ? 1.3753 1.3699 1.3966 0.2040  0.0188  -0.3384 1024 ALA B CA  
3221 C C   . ALA B 24  ? 1.3727 1.3557 1.4290 0.1547  -0.0133 -0.3363 1024 ALA B C   
3222 O O   . ALA B 24  ? 1.3376 1.2763 1.4451 0.1383  -0.0113 -0.3148 1024 ALA B O   
3223 C CB  . ALA B 24  ? 1.5027 1.4227 1.4889 0.2209  0.0294  -0.4062 1024 ALA B CB  
3224 N N   . GLN B 25  ? 1.3197 1.3512 1.3487 0.1347  -0.0415 -0.3544 1025 GLN B N   
3225 C CA  . GLN B 25  ? 1.2677 1.3080 1.3350 0.0921  -0.0717 -0.3496 1025 GLN B CA  
3226 C C   . GLN B 25  ? 1.2032 1.2765 1.3148 0.0854  -0.0686 -0.2832 1025 GLN B C   
3227 O O   . GLN B 25  ? 1.1582 1.2063 1.3191 0.0589  -0.0751 -0.2695 1025 GLN B O   
3228 C CB  . GLN B 25  ? 1.3181 1.4194 1.3453 0.0809  -0.1040 -0.3797 1025 GLN B CB  
3229 C CG  . GLN B 25  ? 1.6267 1.6977 1.6081 0.0778  -0.1166 -0.4588 1025 GLN B CG  
3230 C CD  . GLN B 25  ? 1.9193 2.0660 1.8607 0.0658  -0.1555 -0.4874 1025 GLN B CD  
3231 O OE1 . GLN B 25  ? 1.9668 2.1371 1.8336 0.0859  -0.1613 -0.5325 1025 GLN B OE1 
3232 N NE2 . GLN B 25  ? 1.7465 1.9411 1.7331 0.0379  -0.1825 -0.4599 1025 GLN B NE2 
3233 N N   . VAL B 26  ? 1.1150 1.2433 1.2094 0.1088  -0.0561 -0.2434 1026 VAL B N   
3234 C CA  . VAL B 26  ? 1.0210 1.1780 1.1529 0.1028  -0.0520 -0.1860 1026 VAL B CA  
3235 C C   . VAL B 26  ? 1.0340 1.1463 1.2065 0.1037  -0.0353 -0.1675 1026 VAL B C   
3236 O O   . VAL B 26  ? 0.9825 1.0835 1.1926 0.0835  -0.0415 -0.1455 1026 VAL B O   
3237 C CB  . VAL B 26  ? 1.0542 1.2748 1.1616 0.1243  -0.0394 -0.1506 1026 VAL B CB  
3238 C CG1 . VAL B 26  ? 0.9778 1.2161 1.1286 0.1121  -0.0362 -0.0984 1026 VAL B CG1 
3239 C CG2 . VAL B 26  ? 1.0935 1.3629 1.1512 0.1300  -0.0551 -0.1624 1026 VAL B CG2 
3240 N N   . LYS B 27  ? 1.0222 1.1129 1.1842 0.1313  -0.0136 -0.1765 1027 LYS B N   
3241 C CA  . LYS B 27  ? 1.0078 1.0658 1.2035 0.1418  0.0019  -0.1559 1027 LYS B CA  
3242 C C   . LYS B 27  ? 1.0758 1.0671 1.2978 0.1195  -0.0051 -0.1663 1027 LYS B C   
3243 O O   . LYS B 27  ? 1.0249 1.0108 1.2779 0.1119  -0.0041 -0.1339 1027 LYS B O   
3244 C CB  . LYS B 27  ? 1.0957 1.1418 1.2737 0.1823  0.0269  -0.1696 1027 LYS B CB  
3245 C CG  . LYS B 27  ? 1.2565 1.2837 1.4707 0.2026  0.0426  -0.1409 1027 LYS B CG  
3246 C CD  . LYS B 27  ? 1.4493 1.4525 1.6507 0.2487  0.0697  -0.1580 1027 LYS B CD  
3247 C CE  . LYS B 27  ? 1.7047 1.6145 1.8836 0.2510  0.0740  -0.2097 1027 LYS B CE  
3248 N NZ  . LYS B 27  ? 1.9310 1.8081 2.0976 0.3018  0.1044  -0.2274 1027 LYS B NZ  
3249 N N   . ASP B 28  ? 1.1080 1.0518 1.3171 0.1075  -0.0116 -0.2119 1028 ASP B N   
3250 C CA  . ASP B 28  ? 1.1394 1.0175 1.3795 0.0813  -0.0146 -0.2235 1028 ASP B CA  
3251 C C   . ASP B 28  ? 1.1327 1.0399 1.4051 0.0487  -0.0300 -0.1968 1028 ASP B C   
3252 O O   . ASP B 28  ? 1.1179 0.9956 1.4209 0.0400  -0.0214 -0.1710 1028 ASP B O   
3253 C CB  . ASP B 28  ? 1.2533 1.0883 1.4768 0.0661  -0.0237 -0.2848 1028 ASP B CB  
3254 C CG  . ASP B 28  ? 1.4927 1.2565 1.7580 0.0326  -0.0241 -0.2987 1028 ASP B CG  
3255 O OD1 . ASP B 28  ? 1.5163 1.2252 1.8075 0.0416  -0.0023 -0.2698 1028 ASP B OD1 
3256 O OD2 . ASP B 28  ? 1.6326 1.3963 1.9051 -0.0016 -0.0452 -0.3392 1028 ASP B OD2 
3257 N N   . ALA B 29  ? 1.0519 1.0191 1.3148 0.0357  -0.0502 -0.2003 1029 ALA B N   
3258 C CA  . ALA B 29  ? 0.9917 0.9914 1.2846 0.0118  -0.0629 -0.1774 1029 ALA B CA  
3259 C C   . ALA B 29  ? 0.9827 0.9951 1.2888 0.0207  -0.0516 -0.1314 1029 ALA B C   
3260 O O   . ALA B 29  ? 0.9641 0.9650 1.2980 0.0057  -0.0490 -0.1144 1029 ALA B O   
3261 C CB  . ALA B 29  ? 0.9897 1.0524 1.2656 0.0083  -0.0842 -0.1847 1029 ALA B CB  
3262 N N   . LEU B 30  ? 0.9114 0.9504 1.1987 0.0438  -0.0441 -0.1136 1030 LEU B N   
3263 C CA  . LEU B 30  ? 0.8617 0.9192 1.1618 0.0486  -0.0381 -0.0774 1030 LEU B CA  
3264 C C   . LEU B 30  ? 0.9254 0.9468 1.2381 0.0560  -0.0263 -0.0639 1030 LEU B C   
3265 O O   . LEU B 30  ? 0.8889 0.9215 1.2120 0.0515  -0.0268 -0.0401 1030 LEU B O   
3266 C CB  . LEU B 30  ? 0.8511 0.9512 1.1383 0.0670  -0.0324 -0.0637 1030 LEU B CB  
3267 C CG  . LEU B 30  ? 0.8930 1.0362 1.1679 0.0637  -0.0393 -0.0579 1030 LEU B CG  
3268 C CD1 . LEU B 30  ? 0.9002 1.0806 1.1606 0.0844  -0.0260 -0.0473 1030 LEU B CD1 
3269 C CD2 . LEU B 30  ? 0.8831 1.0380 1.1796 0.0463  -0.0463 -0.0346 1030 LEU B CD2 
3270 N N   . THR B 31  ? 0.9356 0.9130 1.2437 0.0702  -0.0152 -0.0784 1031 THR B N   
3271 C CA  . THR B 31  ? 0.9531 0.8916 1.2721 0.0837  -0.0015 -0.0586 1031 THR B CA  
3272 C C   . THR B 31  ? 0.9934 0.9005 1.3304 0.0585  -0.0007 -0.0507 1031 THR B C   
3273 O O   . THR B 31  ? 0.9777 0.8831 1.3191 0.0633  0.0057  -0.0200 1031 THR B O   
3274 C CB  . THR B 31  ? 1.1285 1.0178 1.4400 0.1091  0.0140  -0.0766 1031 THR B CB  
3275 O OG1 . THR B 31  ? 1.1251 1.0565 1.4204 0.1346  0.0171  -0.0823 1031 THR B OG1 
3276 C CG2 . THR B 31  ? 1.1719 1.0192 1.4957 0.1311  0.0306  -0.0475 1031 THR B CG2 
3277 N N   . LYS B 32  ? 0.9553 0.8483 1.3029 0.0319  -0.0077 -0.0777 1032 LYS B N   
3278 C CA  . LYS B 32  ? 0.9523 0.8287 1.3276 0.0043  -0.0050 -0.0711 1032 LYS B CA  
3279 C C   . LYS B 32  ? 0.9435 0.8703 1.3208 -0.0022 -0.0111 -0.0490 1032 LYS B C   
3280 O O   . LYS B 32  ? 0.9407 0.8607 1.3294 -0.0089 0.0000  -0.0264 1032 LYS B O   
3281 C CB  . LYS B 32  ? 1.0020 0.8683 1.3964 -0.0242 -0.0159 -0.1094 1032 LYS B CB  
3282 C CG  . LYS B 32  ? 1.0457 0.8480 1.4378 -0.0229 -0.0095 -0.1422 1032 LYS B CG  
3283 C CD  . LYS B 32  ? 1.0838 0.8901 1.4914 -0.0552 -0.0283 -0.1885 1032 LYS B CD  
3284 C CE  . LYS B 32  ? 1.2169 0.9535 1.6156 -0.0551 -0.0236 -0.2325 1032 LYS B CE  
3285 N NZ  . LYS B 32  ? 1.3681 1.1193 1.7774 -0.0897 -0.0489 -0.2861 1032 LYS B NZ  
3286 N N   . MET B 33  ? 0.8585 0.8325 1.2223 0.0021  -0.0254 -0.0543 1033 MET B N   
3287 C CA  . MET B 33  ? 0.8091 0.8209 1.1739 -0.0018 -0.0305 -0.0389 1033 MET B CA  
3288 C C   . MET B 33  ? 0.8418 0.8576 1.1925 0.0111  -0.0243 -0.0153 1033 MET B C   
3289 O O   . MET B 33  ? 0.8263 0.8504 1.1774 0.0055  -0.0211 -0.0046 1033 MET B O   
3290 C CB  . MET B 33  ? 0.8130 0.8630 1.1691 0.0009  -0.0440 -0.0461 1033 MET B CB  
3291 C CG  . MET B 33  ? 0.8660 0.9314 1.2319 -0.0103 -0.0560 -0.0661 1033 MET B CG  
3292 S SD  . MET B 33  ? 0.9065 1.0199 1.2572 -0.0009 -0.0690 -0.0613 1033 MET B SD  
3293 C CE  . MET B 33  ? 0.8307 0.9511 1.1985 -0.0027 -0.0638 -0.0359 1033 MET B CE  
3294 N N   . ARG B 34  ? 0.7948 0.8116 1.1330 0.0301  -0.0232 -0.0088 1034 ARG B N   
3295 C CA  . ARG B 34  ? 0.7806 0.8162 1.1083 0.0422  -0.0236 0.0124  1034 ARG B CA  
3296 C C   . ARG B 34  ? 0.8668 0.8760 1.1889 0.0461  -0.0115 0.0314  1034 ARG B C   
3297 O O   . ARG B 34  ? 0.8673 0.8967 1.1741 0.0475  -0.0136 0.0447  1034 ARG B O   
3298 C CB  . ARG B 34  ? 0.7512 0.8061 1.0775 0.0643  -0.0246 0.0183  1034 ARG B CB  
3299 C CG  . ARG B 34  ? 0.7611 0.8616 1.0852 0.0698  -0.0345 0.0349  1034 ARG B CG  
3300 C CD  . ARG B 34  ? 0.7773 0.9110 1.1118 0.0939  -0.0345 0.0458  1034 ARG B CD  
3301 N NE  . ARG B 34  ? 0.7623 0.9563 1.1056 0.0895  -0.0503 0.0556  1034 ARG B NE  
3302 C CZ  . ARG B 34  ? 0.9156 1.1348 1.2508 0.0994  -0.0597 0.0720  1034 ARG B CZ  
3303 N NH1 . ARG B 34  ? 0.7809 0.9660 1.0969 0.1179  -0.0504 0.0885  1034 ARG B NH1 
3304 N NH2 . ARG B 34  ? 0.7580 1.0385 1.1045 0.0893  -0.0791 0.0729  1034 ARG B NH2 
3305 N N   . ALA B 35  ? 0.8542 0.8169 1.1875 0.0461  0.0022  0.0318  1035 ALA B N   
3306 C CA  . ALA B 35  ? 0.8937 0.8241 1.2273 0.0479  0.0201  0.0567  1035 ALA B CA  
3307 C C   . ALA B 35  ? 0.9336 0.8767 1.2729 0.0265  0.0255  0.0584  1035 ALA B C   
3308 O O   . ALA B 35  ? 0.9439 0.8966 1.2643 0.0336  0.0353  0.0825  1035 ALA B O   
3309 C CB  . ALA B 35  ? 0.9549 0.8231 1.3090 0.0465  0.0350  0.0523  1035 ALA B CB  
3310 N N   . ALA B 36  ? 0.8666 0.8180 1.2298 0.0045  0.0190  0.0334  1036 ALA B N   
3311 C CA  . ALA B 36  ? 0.8503 0.8218 1.2296 -0.0122 0.0253  0.0335  1036 ALA B CA  
3312 C C   . ALA B 36  ? 0.8920 0.8984 1.2447 -0.0033 0.0197  0.0351  1036 ALA B C   
3313 O O   . ALA B 36  ? 0.8990 0.9161 1.2477 -0.0043 0.0338  0.0449  1036 ALA B O   
3314 C CB  . ALA B 36  ? 0.8391 0.8229 1.2525 -0.0319 0.0142  0.0074  1036 ALA B CB  
3315 N N   . ALA B 37  ? 0.8408 0.8635 1.1768 0.0045  0.0016  0.0242  1037 ALA B N   
3316 C CA  . ALA B 37  ? 0.8335 0.8796 1.1488 0.0074  -0.0059 0.0190  1037 ALA B CA  
3317 C C   . ALA B 37  ? 0.9207 0.9743 1.2000 0.0196  -0.0022 0.0335  1037 ALA B C   
3318 O O   . ALA B 37  ? 0.9292 0.9938 1.1871 0.0200  0.0008  0.0273  1037 ALA B O   
3319 C CB  . ALA B 37  ? 0.8180 0.8786 1.1353 0.0070  -0.0237 0.0076  1037 ALA B CB  
3320 N N   . LEU B 38  ? 0.9020 0.9509 1.1716 0.0332  -0.0021 0.0523  1038 LEU B N   
3321 C CA  . LEU B 38  ? 0.9393 1.0053 1.1715 0.0502  -0.0017 0.0726  1038 LEU B CA  
3322 C C   . LEU B 38  ? 1.0576 1.1079 1.2757 0.0544  0.0244  0.0960  1038 LEU B C   
3323 O O   . LEU B 38  ? 1.0876 1.1603 1.2632 0.0664  0.0273  0.1073  1038 LEU B O   
3324 C CB  . LEU B 38  ? 0.9498 1.0208 1.1825 0.0704  -0.0089 0.0920  1038 LEU B CB  
3325 C CG  . LEU B 38  ? 0.9703 1.0755 1.2161 0.0707  -0.0318 0.0770  1038 LEU B CG  
3326 C CD1 . LEU B 38  ? 0.9843 1.0917 1.2410 0.0958  -0.0310 0.0976  1038 LEU B CD1 
3327 C CD2 . LEU B 38  ? 0.9957 1.1491 1.2197 0.0647  -0.0528 0.0653  1038 LEU B CD2 
3328 N N   . ASP B 39  ? 1.0381 1.0551 1.2922 0.0429  0.0433  0.1026  1039 ASP B N   
3329 C CA  . ASP B 39  ? 1.0796 1.0828 1.3374 0.0404  0.0735  0.1285  1039 ASP B CA  
3330 C C   . ASP B 39  ? 1.1096 1.1399 1.3632 0.0323  0.0822  0.1134  1039 ASP B C   
3331 O O   . ASP B 39  ? 1.1521 1.1961 1.3764 0.0421  0.1037  0.1331  1039 ASP B O   
3332 C CB  . ASP B 39  ? 1.1190 1.0791 1.4298 0.0228  0.0871  0.1334  1039 ASP B CB  
3333 C CG  . ASP B 39  ? 1.3512 1.2906 1.6839 0.0132  0.1219  0.1660  1039 ASP B CG  
3334 O OD1 . ASP B 39  ? 1.3893 1.3562 1.6967 0.0206  0.1407  0.1855  1039 ASP B OD1 
3335 O OD2 . ASP B 39  ? 1.4539 1.3499 1.8314 -0.0039 0.1320  0.1693  1039 ASP B OD2 
3336 N N   . ALA B 40  ? 1.0079 1.0476 1.2869 0.0194  0.0673  0.0806  1040 ALA B N   
3337 C CA  . ALA B 40  ? 0.9902 1.0511 1.2714 0.0177  0.0755  0.0643  1040 ALA B CA  
3338 C C   . ALA B 40  ? 1.0514 1.1270 1.2749 0.0326  0.0688  0.0505  1040 ALA B C   
3339 O O   . ALA B 40  ? 1.0652 1.1530 1.2715 0.0401  0.0863  0.0433  1040 ALA B O   
3340 C CB  . ALA B 40  ? 0.9510 1.0152 1.2738 0.0057  0.0597  0.0399  1040 ALA B CB  
3341 N N   . GLN B 41  ? 1.0102 1.0882 1.2060 0.0369  0.0439  0.0443  1041 GLN B N   
3342 C CA  . GLN B 41  ? 1.0389 1.1352 1.1827 0.0446  0.0293  0.0255  1041 GLN B CA  
3343 C C   . GLN B 41  ? 1.1701 1.2847 1.2579 0.0631  0.0470  0.0448  1041 GLN B C   
3344 O O   . GLN B 41  ? 1.2021 1.3308 1.2426 0.0701  0.0471  0.0220  1041 GLN B O   
3345 C CB  . GLN B 41  ? 1.0340 1.1429 1.1769 0.0422  -0.0015 0.0217  1041 GLN B CB  
3346 C CG  . GLN B 41  ? 1.1019 1.2363 1.2050 0.0405  -0.0246 -0.0053 1041 GLN B CG  
3347 C CD  . GLN B 41  ? 1.2278 1.3904 1.3432 0.0364  -0.0540 -0.0041 1041 GLN B CD  
3348 O OE1 . GLN B 41  ? 1.1703 1.3365 1.3101 0.0448  -0.0545 0.0225  1041 GLN B OE1 
3349 N NE2 . GLN B 41  ? 1.0557 1.2416 1.1562 0.0239  -0.0782 -0.0342 1041 GLN B NE2 
3350 N N   . LYS B 42  ? 1.1660 1.2765 1.2572 0.0719  0.0640  0.0870  1042 LYS B N   
3351 C CA  . LYS B 42  ? 1.2406 1.3684 1.2800 0.0926  0.0861  0.1205  1042 LYS B CA  
3352 C C   . LYS B 42  ? 1.3538 1.4838 1.3952 0.0931  0.1250  0.1261  1042 LYS B C   
3353 O O   . LYS B 42  ? 1.4134 1.5680 1.3954 0.1123  0.1441  0.1391  1042 LYS B O   
3354 C CB  . LYS B 42  ? 1.2814 1.3920 1.3353 0.1021  0.0954  0.1702  1042 LYS B CB  
3355 C CG  . LYS B 42  ? 1.4038 1.5227 1.4544 0.1114  0.0621  0.1714  1042 LYS B CG  
3356 C CD  . LYS B 42  ? 1.5511 1.6412 1.6200 0.1266  0.0762  0.2203  1042 LYS B CD  
3357 N N   . ALA B 43  ? 1.2922 1.4054 1.4015 0.0742  0.1365  0.1171  1043 ALA B N   
3358 C CA  . ALA B 43  ? 1.3124 1.4387 1.4457 0.0731  0.1734  0.1239  1043 ALA B CA  
3359 C C   . ALA B 43  ? 1.4018 1.5462 1.4956 0.0873  0.1775  0.0858  1043 ALA B C   
3360 O O   . ALA B 43  ? 1.3877 1.5221 1.4609 0.0865  0.1475  0.0469  1043 ALA B O   
3361 C CB  . ALA B 43  ? 1.2654 1.3806 1.4873 0.0486  0.1742  0.1207  1043 ALA B CB  
3362 N N   . THR B 44  ? 1.4096 1.5782 1.4968 0.1002  0.2182  0.0975  1044 THR B N   
3363 C CA  . THR B 44  ? 1.4456 1.6268 1.4965 0.1196  0.2319  0.0611  1044 THR B CA  
3364 C C   . THR B 44  ? 1.4645 1.6583 1.5961 0.1159  0.2554  0.0594  1044 THR B C   
3365 O O   . THR B 44  ? 1.4526 1.6716 1.6367 0.1080  0.2851  0.0975  1044 THR B O   
3366 C CB  . THR B 44  ? 1.6328 1.8429 1.5977 0.1470  0.2624  0.0748  1044 THR B CB  
3367 O OG1 . THR B 44  ? 1.6633 1.8732 1.5604 0.1514  0.2344  0.0810  1044 THR B OG1 
3368 C CG2 . THR B 44  ? 1.6686 1.8857 1.5847 0.1711  0.2785  0.0285  1044 THR B CG2 
3369 N N   . PRO B 45  ? 1.4062 1.5850 1.5544 0.1211  0.2424  0.0186  1045 PRO B N   
3370 C CA  . PRO B 45  ? 1.3744 1.5746 1.6039 0.1230  0.2603  0.0212  1045 PRO B CA  
3371 C C   . PRO B 45  ? 1.4886 1.7333 1.7201 0.1478  0.3134  0.0351  1045 PRO B C   
3372 O O   . PRO B 45  ? 1.5532 1.8006 1.7040 0.1702  0.3348  0.0274  1045 PRO B O   
3373 C CB  . PRO B 45  ? 1.3862 1.5512 1.6142 0.1316  0.2370  -0.0218 1045 PRO B CB  
3374 C CG  . PRO B 45  ? 1.4929 1.6245 1.6311 0.1378  0.2216  -0.0543 1045 PRO B CG  
3375 C CD  . PRO B 45  ? 1.4350 1.5767 1.5380 0.1236  0.2094  -0.0278 1045 PRO B CD  
3376 N N   . PRO B 46  ? 1.4329 1.7217 1.7561 0.1454  0.3351  0.0552  1046 PRO B N   
3377 C CA  . PRO B 46  ? 1.4896 1.8328 1.8255 0.1705  0.3906  0.0724  1046 PRO B CA  
3378 C C   . PRO B 46  ? 1.6211 1.9495 1.8946 0.2138  0.4096  0.0306  1046 PRO B C   
3379 O O   . PRO B 46  ? 1.6878 2.0402 1.9065 0.2408  0.4522  0.0334  1046 PRO B O   
3380 C CB  . PRO B 46  ? 1.4568 1.8538 1.9164 0.1565  0.3960  0.0935  1046 PRO B CB  
3381 C CG  . PRO B 46  ? 1.4452 1.8083 1.9364 0.1382  0.3426  0.0728  1046 PRO B CG  
3382 C CD  . PRO B 46  ? 1.3811 1.6830 1.8000 0.1205  0.3095  0.0633  1046 PRO B CD  
3383 N N   . LYS B 47  ? 1.5753 1.8598 1.8545 0.2211  0.3799  -0.0082 1047 LYS B N   
3384 C CA  . LYS B 47  ? 1.6491 1.8949 1.8698 0.2579  0.3920  -0.0564 1047 LYS B CA  
3385 C C   . LYS B 47  ? 1.7614 1.9560 1.8724 0.2502  0.3670  -0.0894 1047 LYS B C   
3386 O O   . LYS B 47  ? 1.7132 1.8913 1.8185 0.2174  0.3275  -0.0790 1047 LYS B O   
3387 C CB  . LYS B 47  ? 1.6496 1.8644 1.9298 0.2673  0.3729  -0.0759 1047 LYS B CB  
3388 C CG  . LYS B 47  ? 1.7309 2.0149 2.1187 0.2821  0.3973  -0.0430 1047 LYS B CG  
3389 C CD  . LYS B 47  ? 1.8078 2.0686 2.2525 0.2991  0.3793  -0.0533 1047 LYS B CD  
3390 C CE  . LYS B 47  ? 1.8500 2.1981 2.4036 0.3158  0.3994  -0.0182 1047 LYS B CE  
3391 N NZ  . LYS B 47  ? 1.9106 2.2434 2.5176 0.3400  0.3823  -0.0203 1047 LYS B NZ  
3392 N N   . LEU B 48  ? 1.8237 2.0025 1.8473 0.2816  0.3911  -0.1288 1048 LEU B N   
3393 C CA  . LEU B 48  ? 1.8909 2.0400 1.8013 0.2780  0.3698  -0.1646 1048 LEU B CA  
3394 C C   . LEU B 48  ? 1.9107 2.1025 1.7949 0.2577  0.3624  -0.1155 1048 LEU B C   
3395 O O   . LEU B 48  ? 1.8857 2.0590 1.7337 0.2346  0.3197  -0.1207 1048 LEU B O   
3396 C CB  . LEU B 48  ? 1.8864 1.9642 1.7834 0.2560  0.3183  -0.2124 1048 LEU B CB  
3397 N N   . GLU B 49  ? 1.8691 2.1195 1.7802 0.2679  0.4075  -0.0638 1049 GLU B N   
3398 C CA  . GLU B 49  ? 1.8620 2.1481 1.7571 0.2542  0.4144  -0.0072 1049 GLU B CA  
3399 C C   . GLU B 49  ? 2.0132 2.3137 1.7773 0.2792  0.4247  -0.0187 1049 GLU B C   
3400 O O   . GLU B 49  ? 2.0156 2.3117 1.7286 0.2668  0.3921  -0.0071 1049 GLU B O   
3401 C CB  . GLU B 49  ? 1.8559 2.1971 1.8361 0.2527  0.4632  0.0513  1049 GLU B CB  
3402 C CG  . GLU B 49  ? 1.9979 2.3641 1.9755 0.2361  0.4771  0.1164  1049 GLU B CG  
3403 C CD  . GLU B 49  ? 2.2610 2.6797 2.3317 0.2259  0.5265  0.1746  1049 GLU B CD  
3404 O OE1 . GLU B 49  ? 2.2126 2.6455 2.2777 0.2150  0.5477  0.2315  1049 GLU B OE1 
3405 O OE2 . GLU B 49  ? 2.1607 2.6088 2.3134 0.2294  0.5454  0.1660  1049 GLU B OE2 
3406 N N   . ASP B 50  ? 2.0581 2.3807 1.7654 0.3180  0.4696  -0.0427 1050 ASP B N   
3407 C CA  . ASP B 50  ? 2.1793 2.5217 1.7488 0.3473  0.4811  -0.0628 1050 ASP B CA  
3408 C C   . ASP B 50  ? 2.2819 2.5698 1.7804 0.3467  0.4337  -0.1487 1050 ASP B C   
3409 O O   . ASP B 50  ? 2.3604 2.6300 1.8047 0.3755  0.4532  -0.2085 1050 ASP B O   
3410 C CB  . ASP B 50  ? 2.2889 2.6816 1.8276 0.3907  0.5544  -0.0522 1050 ASP B CB  
3411 N N   . LYS B 51  ? 2.1897 2.4492 1.6989 0.3116  0.3726  -0.1549 1051 LYS B N   
3412 C CA  . LYS B 51  ? 2.2159 2.4270 1.6831 0.2965  0.3199  -0.2279 1051 LYS B CA  
3413 C C   . LYS B 51  ? 2.2811 2.5176 1.6929 0.2781  0.2706  -0.2155 1051 LYS B C   
3414 O O   . LYS B 51  ? 2.2065 2.4654 1.6651 0.2635  0.2625  -0.1508 1051 LYS B O   
3415 C CB  . LYS B 51  ? 2.1494 2.3015 1.7261 0.2690  0.2960  -0.2443 1051 LYS B CB  
3416 C CG  . LYS B 51  ? 2.2963 2.3875 1.8520 0.2488  0.2494  -0.3177 1051 LYS B CG  
3417 C CD  . LYS B 51  ? 2.4933 2.5382 1.9954 0.2747  0.2713  -0.3928 1051 LYS B CD  
3418 C CE  . LYS B 51  ? 2.5423 2.5533 2.1261 0.2959  0.3122  -0.3887 1051 LYS B CE  
3419 N NZ  . LYS B 51  ? 2.7466 2.6976 2.2812 0.3239  0.3333  -0.4649 1051 LYS B NZ  
3420 N N   . SER B 52  ? 2.3408 2.5753 1.6564 0.2796  0.2372  -0.2791 1052 SER B N   
3421 C CA  . SER B 52  ? 2.3577 2.6307 1.6182 0.2656  0.1850  -0.2741 1052 SER B CA  
3422 C C   . SER B 52  ? 2.2946 2.5421 1.6508 0.2233  0.1356  -0.2629 1052 SER B C   
3423 O O   . SER B 52  ? 2.2366 2.4257 1.6664 0.2018  0.1285  -0.2948 1052 SER B O   
3424 C CB  . SER B 52  ? 2.5293 2.8086 1.6746 0.2715  0.1563  -0.3578 1052 SER B CB  
3425 O OG  . SER B 52  ? 2.6498 2.8560 1.8291 0.2475  0.1360  -0.4363 1052 SER B OG  
3426 N N   . PRO B 53  ? 2.2196 2.5108 1.5766 0.2150  0.1043  -0.2150 1053 PRO B N   
3427 C CA  . PRO B 53  ? 2.1152 2.3871 1.5617 0.1793  0.0623  -0.2058 1053 PRO B CA  
3428 C C   . PRO B 53  ? 2.1898 2.4468 1.6268 0.1500  0.0102  -0.2802 1053 PRO B C   
3429 O O   . PRO B 53  ? 2.1099 2.3348 1.6303 0.1186  -0.0136 -0.2866 1053 PRO B O   
3430 C CB  . PRO B 53  ? 2.1220 2.4492 1.5573 0.1891  0.0488  -0.1367 1053 PRO B CB  
3431 C CG  . PRO B 53  ? 2.2596 2.6248 1.6165 0.2280  0.0928  -0.0959 1053 PRO B CG  
3432 C CD  . PRO B 53  ? 2.2995 2.6597 1.5777 0.2422  0.1086  -0.1630 1053 PRO B CD  
3433 N N   . ASP B 54  ? 2.2587 2.5394 1.5944 0.1586  -0.0058 -0.3380 1054 ASP B N   
3434 C CA  . ASP B 54  ? 2.3032 2.5717 1.6253 0.1258  -0.0561 -0.4170 1054 ASP B CA  
3435 C C   . ASP B 54  ? 2.3648 2.5403 1.7188 0.1121  -0.0373 -0.4825 1054 ASP B C   
3436 O O   . ASP B 54  ? 2.4082 2.5527 1.7664 0.0791  -0.0731 -0.5504 1054 ASP B O   
3437 C CB  . ASP B 54  ? 2.4594 2.7945 1.6542 0.1399  -0.0843 -0.4582 1054 ASP B CB  
3438 C CG  . ASP B 54  ? 2.5835 3.0160 1.7415 0.1568  -0.1103 -0.3953 1054 ASP B CG  
3439 O OD1 . ASP B 54  ? 2.4957 2.9370 1.7074 0.1707  -0.0872 -0.3109 1054 ASP B OD1 
3440 O OD2 . ASP B 54  ? 2.7530 3.2528 1.8241 0.1593  -0.1518 -0.4303 1054 ASP B OD2 
3441 N N   . SER B 55  ? 2.2803 2.4130 1.6643 0.1371  0.0187  -0.4591 1055 SER B N   
3442 C CA  . SER B 55  ? 2.2934 2.3395 1.7138 0.1363  0.0445  -0.5069 1055 SER B CA  
3443 C C   . SER B 55  ? 2.2310 2.2241 1.7635 0.0966  0.0207  -0.5033 1055 SER B C   
3444 O O   . SER B 55  ? 2.1139 2.1365 1.7113 0.0835  0.0083  -0.4428 1055 SER B O   
3445 C CB  . SER B 55  ? 2.3253 2.3650 1.7607 0.1766  0.1084  -0.4679 1055 SER B CB  
3446 O OG  . SER B 55  ? 2.4781 2.4413 1.9448 0.1863  0.1366  -0.5104 1055 SER B OG  
3447 N N   . PRO B 56  ? 2.2279 2.1393 1.7827 0.0791  0.0172  -0.5656 1056 PRO B N   
3448 C CA  . PRO B 56  ? 2.1450 2.0089 1.8024 0.0419  -0.0027 -0.5555 1056 PRO B CA  
3449 C C   . PRO B 56  ? 2.0590 1.9119 1.8040 0.0562  0.0278  -0.4866 1056 PRO B C   
3450 O O   . PRO B 56  ? 1.9667 1.8200 1.7852 0.0295  0.0072  -0.4535 1056 PRO B O   
3451 C CB  . PRO B 56  ? 2.2743 2.0417 1.9278 0.0304  0.0012  -0.6329 1056 PRO B CB  
3452 C CG  . PRO B 56  ? 2.4687 2.2490 2.0067 0.0459  -0.0005 -0.6999 1056 PRO B CG  
3453 C CD  . PRO B 56  ? 2.3894 2.2448 1.8737 0.0915  0.0306  -0.6494 1056 PRO B CD  
3454 N N   . GLU B 57  ? 2.0037 1.8542 1.7429 0.0974  0.0756  -0.4665 1057 GLU B N   
3455 C CA  . GLU B 57  ? 1.8927 1.7450 1.7163 0.1098  0.1007  -0.4055 1057 GLU B CA  
3456 C C   . GLU B 57  ? 1.8189 1.7454 1.6603 0.1053  0.0927  -0.3392 1057 GLU B C   
3457 O O   . GLU B 57  ? 1.7147 1.6450 1.6316 0.0987  0.0940  -0.2945 1057 GLU B O   
3458 C CB  . GLU B 57  ? 1.9457 1.7816 1.7730 0.1539  0.1538  -0.4050 1057 GLU B CB  
3459 C CG  . GLU B 57  ? 2.1716 2.0393 1.9089 0.1882  0.1852  -0.4268 1057 GLU B CG  
3460 C CD  . GLU B 57  ? 2.5820 2.3992 2.2355 0.1953  0.1840  -0.5107 1057 GLU B CD  
3461 O OE1 . GLU B 57  ? 2.5558 2.3035 2.2263 0.1682  0.1573  -0.5569 1057 GLU B OE1 
3462 O OE2 . GLU B 57  ? 2.6044 2.4496 2.1750 0.2280  0.2127  -0.5315 1057 GLU B OE2 
3463 N N   . MET B 58  ? 1.7923 1.7740 1.5641 0.1096  0.0836  -0.3330 1058 MET B N   
3464 C CA  . MET B 58  ? 1.7074 1.7453 1.4978 0.1062  0.0766  -0.2700 1058 MET B CA  
3465 C C   . MET B 58  ? 1.6934 1.7417 1.5104 0.0732  0.0285  -0.2663 1058 MET B C   
3466 O O   . MET B 58  ? 1.6005 1.6671 1.4700 0.0656  0.0227  -0.2182 1058 MET B O   
3467 C CB  . MET B 58  ? 1.7912 1.8844 1.5016 0.1312  0.0933  -0.2497 1058 MET B CB  
3468 C CG  . MET B 58  ? 1.8454 1.9495 1.5590 0.1620  0.1488  -0.2219 1058 MET B CG  
3469 S SD  . MET B 58  ? 1.7738 1.8833 1.6027 0.1537  0.1690  -0.1543 1058 MET B SD  
3470 C CE  . MET B 58  ? 1.6942 1.8419 1.5154 0.1415  0.1469  -0.0991 1058 MET B CE  
3471 N N   . LYS B 59  ? 1.7000 1.7372 1.4860 0.0527  -0.0048 -0.3197 1059 LYS B N   
3472 C CA  . LYS B 59  ? 1.6530 1.7082 1.4750 0.0189  -0.0492 -0.3195 1059 LYS B CA  
3473 C C   . LYS B 59  ? 1.6109 1.6192 1.5249 -0.0016 -0.0481 -0.3072 1059 LYS B C   
3474 O O   . LYS B 59  ? 1.5341 1.5669 1.4966 -0.0190 -0.0687 -0.2772 1059 LYS B O   
3475 C CB  . LYS B 59  ? 1.7714 1.8341 1.5439 -0.0032 -0.0858 -0.3837 1059 LYS B CB  
3476 C CG  . LYS B 59  ? 1.9359 2.0673 1.6131 0.0159  -0.0993 -0.3899 1059 LYS B CG  
3477 C CD  . LYS B 59  ? 2.1140 2.2646 1.7484 -0.0120 -0.1449 -0.4579 1059 LYS B CD  
3478 C CE  . LYS B 59  ? 2.2981 2.5331 1.8353 0.0094  -0.1650 -0.4580 1059 LYS B CE  
3479 N NZ  . LYS B 59  ? 2.5041 2.7698 2.0003 -0.0211 -0.2164 -0.5301 1059 LYS B NZ  
3480 N N   . ASP B 60  ? 1.5771 1.5218 1.5125 0.0061  -0.0212 -0.3264 1060 ASP B N   
3481 C CA  . ASP B 60  ? 1.5162 1.4168 1.5308 -0.0048 -0.0151 -0.3089 1060 ASP B CA  
3482 C C   . ASP B 60  ? 1.4580 1.3891 1.5170 0.0090  -0.0009 -0.2482 1060 ASP B C   
3483 O O   . ASP B 60  ? 1.3940 1.3233 1.5092 -0.0054 -0.0112 -0.2224 1060 ASP B O   
3484 C CB  . ASP B 60  ? 1.6023 1.4294 1.6218 0.0097  0.0125  -0.3420 1060 ASP B CB  
3485 C CG  . ASP B 60  ? 1.6904 1.4705 1.7863 0.0053  0.0210  -0.3191 1060 ASP B CG  
3486 O OD1 . ASP B 60  ? 1.6533 1.4397 1.7923 -0.0231 -0.0018 -0.3001 1060 ASP B OD1 
3487 O OD2 . ASP B 60  ? 1.7858 1.5241 1.8967 0.0324  0.0513  -0.3210 1060 ASP B OD2 
3488 N N   . PHE B 61  ? 1.3971 1.3573 1.4302 0.0356  0.0239  -0.2270 1061 PHE B N   
3489 C CA  . PHE B 61  ? 1.3145 1.3028 1.3890 0.0447  0.0383  -0.1760 1061 PHE B CA  
3490 C C   . PHE B 61  ? 1.2972 1.3187 1.3851 0.0289  0.0131  -0.1466 1061 PHE B C   
3491 O O   . PHE B 61  ? 1.2298 1.2519 1.3702 0.0221  0.0100  -0.1205 1061 PHE B O   
3492 C CB  . PHE B 61  ? 1.3627 1.3776 1.4063 0.0706  0.0716  -0.1609 1061 PHE B CB  
3493 C CG  . PHE B 61  ? 1.3188 1.3619 1.4093 0.0729  0.0861  -0.1119 1061 PHE B CG  
3494 C CD1 . PHE B 61  ? 1.3219 1.3616 1.4749 0.0776  0.1023  -0.0986 1061 PHE B CD1 
3495 C CD2 . PHE B 61  ? 1.3328 1.4061 1.4067 0.0707  0.0833  -0.0796 1061 PHE B CD2 
3496 C CE1 . PHE B 61  ? 1.2845 1.3526 1.4846 0.0730  0.1114  -0.0609 1061 PHE B CE1 
3497 C CE2 . PHE B 61  ? 1.3235 1.4111 1.4450 0.0676  0.0973  -0.0399 1061 PHE B CE2 
3498 C CZ  . PHE B 61  ? 1.2634 1.3497 1.4480 0.0657  0.1100  -0.0342 1061 PHE B CZ  
3499 N N   . ARG B 62  ? 1.2760 1.3286 1.3148 0.0269  -0.0048 -0.1514 1062 ARG B N   
3500 C CA  . ARG B 62  ? 1.2303 1.3176 1.2812 0.0194  -0.0271 -0.1225 1062 ARG B CA  
3501 C C   . ARG B 62  ? 1.2399 1.3227 1.3318 -0.0061 -0.0551 -0.1356 1062 ARG B C   
3502 O O   . ARG B 62  ? 1.1865 1.2894 1.3120 -0.0101 -0.0653 -0.1083 1062 ARG B O   
3503 C CB  . ARG B 62  ? 1.2827 1.4141 1.2694 0.0312  -0.0382 -0.1182 1062 ARG B CB  
3504 C CG  . ARG B 62  ? 1.4588 1.6006 1.4062 0.0574  -0.0056 -0.0911 1062 ARG B CG  
3505 C CD  . ARG B 62  ? 1.7033 1.8930 1.5808 0.0744  -0.0161 -0.0778 1062 ARG B CD  
3506 N NE  . ARG B 62  ? 1.9449 2.1516 1.7629 0.0698  -0.0398 -0.1292 1062 ARG B NE  
3507 C CZ  . ARG B 62  ? 2.2072 2.4099 1.9609 0.0840  -0.0218 -0.1592 1062 ARG B CZ  
3508 N NH1 . ARG B 62  ? 2.0652 2.2552 1.8113 0.1051  0.0230  -0.1364 1062 ARG B NH1 
3509 N NH2 . ARG B 62  ? 2.0980 2.3123 1.7962 0.0763  -0.0478 -0.2145 1062 ARG B NH2 
3510 N N   . HIS B 63  ? 1.2264 1.2792 1.3186 -0.0227 -0.0633 -0.1765 1063 HIS B N   
3511 C CA  . HIS B 63  ? 1.2064 1.2513 1.3447 -0.0513 -0.0843 -0.1863 1063 HIS B CA  
3512 C C   . HIS B 63  ? 1.1702 1.1917 1.3667 -0.0509 -0.0702 -0.1566 1063 HIS B C   
3513 O O   . HIS B 63  ? 1.1305 1.1701 1.3656 -0.0652 -0.0826 -0.1396 1063 HIS B O   
3514 C CB  . HIS B 63  ? 1.2930 1.2972 1.4200 -0.0714 -0.0918 -0.2383 1063 HIS B CB  
3515 C CG  . HIS B 63  ? 1.3328 1.3248 1.5157 -0.1060 -0.1088 -0.2445 1063 HIS B CG  
3516 N ND1 . HIS B 63  ? 1.3598 1.4054 1.5556 -0.1318 -0.1409 -0.2509 1063 HIS B ND1 
3517 C CD2 . HIS B 63  ? 1.3546 1.2923 1.5861 -0.1170 -0.0955 -0.2401 1063 HIS B CD2 
3518 C CE1 . HIS B 63  ? 1.3509 1.3733 1.6064 -0.1613 -0.1437 -0.2503 1063 HIS B CE1 
3519 N NE2 . HIS B 63  ? 1.3546 1.3080 1.6299 -0.1528 -0.1161 -0.2422 1063 HIS B NE2 
3520 N N   . GLY B 64  ? 1.0942 1.0855 1.2950 -0.0323 -0.0445 -0.1497 1064 GLY B N   
3521 C CA  . GLY B 64  ? 1.0328 1.0119 1.2807 -0.0272 -0.0334 -0.1224 1064 GLY B CA  
3522 C C   . GLY B 64  ? 1.0039 1.0207 1.2685 -0.0251 -0.0394 -0.0897 1064 GLY B C   
3523 O O   . GLY B 64  ? 0.9652 0.9837 1.2639 -0.0296 -0.0423 -0.0726 1064 GLY B O   
3524 N N   . PHE B 65  ? 0.9359 0.9804 1.1729 -0.0161 -0.0395 -0.0805 1065 PHE B N   
3525 C CA  . PHE B 65  ? 0.8806 0.9488 1.1310 -0.0115 -0.0425 -0.0532 1065 PHE B CA  
3526 C C   . PHE B 65  ? 0.9104 1.0068 1.1674 -0.0206 -0.0635 -0.0500 1065 PHE B C   
3527 O O   . PHE B 65  ? 0.8718 0.9807 1.1505 -0.0169 -0.0649 -0.0318 1065 PHE B O   
3528 C CB  . PHE B 65  ? 0.9112 0.9886 1.1365 0.0033  -0.0293 -0.0376 1065 PHE B CB  
3529 C CG  . PHE B 65  ? 0.9222 0.9855 1.1606 0.0099  -0.0059 -0.0326 1065 PHE B CG  
3530 C CD1 . PHE B 65  ? 0.9216 0.9828 1.1996 0.0073  -0.0010 -0.0191 1065 PHE B CD1 
3531 C CD2 . PHE B 65  ? 0.9851 1.0448 1.1971 0.0191  0.0113  -0.0433 1065 PHE B CD2 
3532 C CE1 . PHE B 65  ? 0.9282 0.9908 1.2297 0.0102  0.0173  -0.0147 1065 PHE B CE1 
3533 C CE2 . PHE B 65  ? 1.0168 1.0764 1.2517 0.0263  0.0353  -0.0355 1065 PHE B CE2 
3534 C CZ  . PHE B 65  ? 0.9489 1.0134 1.2333 0.0201  0.0367  -0.0200 1065 PHE B CZ  
3535 N N   . ASP B 66  ? 0.8925 1.0027 1.1346 -0.0330 -0.0801 -0.0706 1066 ASP B N   
3536 C CA  . ASP B 66  ? 0.8770 1.0280 1.1393 -0.0452 -0.1015 -0.0675 1066 ASP B CA  
3537 C C   . ASP B 66  ? 0.8868 1.0275 1.1967 -0.0616 -0.0995 -0.0630 1066 ASP B C   
3538 O O   . ASP B 66  ? 0.8585 1.0344 1.1962 -0.0626 -0.1048 -0.0454 1066 ASP B O   
3539 C CB  . ASP B 66  ? 0.9473 1.1248 1.1862 -0.0598 -0.1243 -0.0954 1066 ASP B CB  
3540 C CG  . ASP B 66  ? 1.0694 1.2804 1.2566 -0.0394 -0.1312 -0.0903 1066 ASP B CG  
3541 O OD1 . ASP B 66  ? 1.0436 1.2650 1.2263 -0.0152 -0.1206 -0.0566 1066 ASP B OD1 
3542 O OD2 . ASP B 66  ? 1.1936 1.4239 1.3458 -0.0479 -0.1491 -0.1192 1066 ASP B OD2 
3543 N N   . ILE B 67  ? 0.8436 0.9372 1.1619 -0.0692 -0.0880 -0.0741 1067 ILE B N   
3544 C CA  . ILE B 67  ? 0.8226 0.9004 1.1804 -0.0796 -0.0811 -0.0612 1067 ILE B CA  
3545 C C   . ILE B 67  ? 0.8147 0.9025 1.1789 -0.0597 -0.0703 -0.0343 1067 ILE B C   
3546 O O   . ILE B 67  ? 0.7852 0.8950 1.1722 -0.0619 -0.0694 -0.0162 1067 ILE B O   
3547 C CB  . ILE B 67  ? 0.8998 0.9186 1.2624 -0.0859 -0.0701 -0.0766 1067 ILE B CB  
3548 C CG1 . ILE B 67  ? 0.9619 0.9611 1.3118 -0.1073 -0.0813 -0.1152 1067 ILE B CG1 
3549 C CG2 . ILE B 67  ? 0.9084 0.9101 1.3102 -0.0921 -0.0601 -0.0523 1067 ILE B CG2 
3550 C CD1 . ILE B 67  ? 1.1050 1.0314 1.4565 -0.1091 -0.0666 -0.1367 1067 ILE B CD1 
3551 N N   . LEU B 68  ? 0.7651 0.8405 1.1090 -0.0418 -0.0617 -0.0340 1068 LEU B N   
3552 C CA  . LEU B 68  ? 0.7359 0.8169 1.0846 -0.0274 -0.0546 -0.0187 1068 LEU B CA  
3553 C C   . LEU B 68  ? 0.7712 0.8810 1.1186 -0.0207 -0.0591 -0.0086 1068 LEU B C   
3554 O O   . LEU B 68  ? 0.7638 0.8837 1.1207 -0.0151 -0.0566 0.0005  1068 LEU B O   
3555 C CB  . LEU B 68  ? 0.7409 0.8075 1.0776 -0.0171 -0.0447 -0.0233 1068 LEU B CB  
3556 C CG  . LEU B 68  ? 0.7826 0.8546 1.1323 -0.0093 -0.0401 -0.0148 1068 LEU B CG  
3557 C CD1 . LEU B 68  ? 0.7801 0.8538 1.1490 -0.0068 -0.0410 -0.0085 1068 LEU B CD1 
3558 C CD2 . LEU B 68  ? 0.8241 0.8908 1.1727 -0.0051 -0.0286 -0.0169 1068 LEU B CD2 
3559 N N   . VAL B 69  ? 0.7309 0.8556 1.0636 -0.0171 -0.0648 -0.0096 1069 VAL B N   
3560 C CA  . VAL B 69  ? 0.7253 0.8750 1.0599 -0.0036 -0.0667 0.0030  1069 VAL B CA  
3561 C C   . VAL B 69  ? 0.7765 0.9633 1.1373 -0.0098 -0.0723 0.0094  1069 VAL B C   
3562 O O   . VAL B 69  ? 0.7692 0.9724 1.1383 0.0043  -0.0662 0.0193  1069 VAL B O   
3563 C CB  . VAL B 69  ? 0.7919 0.9540 1.1045 0.0072  -0.0716 0.0083  1069 VAL B CB  
3564 C CG1 . VAL B 69  ? 0.7890 0.9798 1.1101 0.0268  -0.0733 0.0254  1069 VAL B CG1 
3565 C CG2 . VAL B 69  ? 0.8026 0.9314 1.0936 0.0145  -0.0585 0.0106  1069 VAL B CG2 
3566 N N   . GLY B 70  ? 0.7439 0.9414 1.1194 -0.0315 -0.0810 0.0025  1070 GLY B N   
3567 C CA  . GLY B 70  ? 0.7403 0.9756 1.1519 -0.0450 -0.0835 0.0117  1070 GLY B CA  
3568 C C   . GLY B 70  ? 0.7800 1.0095 1.2038 -0.0415 -0.0679 0.0266  1070 GLY B C   
3569 O O   . GLY B 70  ? 0.7678 1.0380 1.2128 -0.0370 -0.0614 0.0422  1070 GLY B O   
3570 N N   . GLN B 71  ? 0.7434 0.9301 1.1526 -0.0398 -0.0610 0.0237  1071 GLN B N   
3571 C CA  . GLN B 71  ? 0.7417 0.9266 1.1519 -0.0320 -0.0493 0.0393  1071 GLN B CA  
3572 C C   . GLN B 71  ? 0.7868 0.9852 1.1756 -0.0080 -0.0452 0.0381  1071 GLN B C   
3573 O O   . GLN B 71  ? 0.7915 1.0134 1.1777 0.0022  -0.0361 0.0499  1071 GLN B O   
3574 C CB  . GLN B 71  ? 0.7683 0.9121 1.1725 -0.0333 -0.0468 0.0379  1071 GLN B CB  
3575 C CG  . GLN B 71  ? 1.0058 1.1201 1.4303 -0.0544 -0.0464 0.0355  1071 GLN B CG  
3576 C CD  . GLN B 71  ? 1.2696 1.3405 1.6903 -0.0471 -0.0407 0.0348  1071 GLN B CD  
3577 O OE1 . GLN B 71  ? 1.1949 1.2686 1.6027 -0.0280 -0.0394 0.0389  1071 GLN B OE1 
3578 N NE2 . GLN B 71  ? 1.2227 1.2538 1.6584 -0.0620 -0.0374 0.0274  1071 GLN B NE2 
3579 N N   . ILE B 72  ? 0.7283 0.9092 1.1005 0.0010  -0.0497 0.0234  1072 ILE B N   
3580 C CA  . ILE B 72  ? 0.7252 0.9022 1.0807 0.0201  -0.0454 0.0159  1072 ILE B CA  
3581 C C   . ILE B 72  ? 0.7752 0.9871 1.1382 0.0354  -0.0389 0.0240  1072 ILE B C   
3582 O O   . ILE B 72  ? 0.7960 1.0156 1.1467 0.0522  -0.0297 0.0204  1072 ILE B O   
3583 C CB  . ILE B 72  ? 0.7679 0.9120 1.1137 0.0219  -0.0475 0.0056  1072 ILE B CB  
3584 C CG1 . ILE B 72  ? 0.7628 0.8838 1.1077 0.0111  -0.0494 -0.0020 1072 ILE B CG1 
3585 C CG2 . ILE B 72  ? 0.8078 0.9364 1.1438 0.0396  -0.0407 -0.0019 1072 ILE B CG2 
3586 C CD1 . ILE B 72  ? 0.8235 0.9190 1.1654 0.0087  -0.0460 -0.0061 1072 ILE B CD1 
3587 N N   . ASP B 73  ? 0.7087 0.9483 1.0918 0.0310  -0.0441 0.0333  1073 ASP B N   
3588 C CA  . ASP B 73  ? 0.7032 0.9908 1.1053 0.0474  -0.0386 0.0452  1073 ASP B CA  
3589 C C   . ASP B 73  ? 0.7641 1.0924 1.1843 0.0446  -0.0263 0.0587  1073 ASP B C   
3590 O O   . ASP B 73  ? 0.7757 1.1360 1.1994 0.0686  -0.0120 0.0647  1073 ASP B O   
3591 C CB  . ASP B 73  ? 0.7165 1.0386 1.1407 0.0392  -0.0534 0.0520  1073 ASP B CB  
3592 C CG  . ASP B 73  ? 0.8167 1.1119 1.2179 0.0536  -0.0600 0.0490  1073 ASP B CG  
3593 O OD1 . ASP B 73  ? 0.8319 1.0911 1.2148 0.0763  -0.0483 0.0471  1073 ASP B OD1 
3594 O OD2 . ASP B 73  ? 0.8850 1.1991 1.2870 0.0436  -0.0760 0.0498  1073 ASP B OD2 
3595 N N   . ASP B 74  ? 0.7250 1.0488 1.1555 0.0192  -0.0275 0.0656  1074 ASP B N   
3596 C CA  . ASP B 74  ? 0.7361 1.0944 1.1832 0.0152  -0.0115 0.0873  1074 ASP B CA  
3597 C C   . ASP B 74  ? 0.8134 1.1646 1.2195 0.0407  0.0021  0.0848  1074 ASP B C   
3598 O O   . ASP B 74  ? 0.8388 1.2330 1.2460 0.0549  0.0210  0.1005  1074 ASP B O   
3599 C CB  . ASP B 74  ? 0.7652 1.1042 1.2331 -0.0168 -0.0141 0.0984  1074 ASP B CB  
3600 C CG  . ASP B 74  ? 0.8872 1.2374 1.3966 -0.0477 -0.0280 0.0945  1074 ASP B CG  
3601 O OD1 . ASP B 74  ? 0.8787 1.2810 1.4139 -0.0461 -0.0335 0.0952  1074 ASP B OD1 
3602 O OD2 . ASP B 74  ? 0.9790 1.2895 1.4973 -0.0728 -0.0332 0.0903  1074 ASP B OD2 
3603 N N   . ALA B 75  ? 0.7622 1.0661 1.1330 0.0459  -0.0076 0.0638  1075 ALA B N   
3604 C CA  . ALA B 75  ? 0.7811 1.0791 1.1099 0.0661  -0.0030 0.0511  1075 ALA B CA  
3605 C C   . ALA B 75  ? 0.8460 1.1422 1.1577 0.0919  0.0041  0.0295  1075 ALA B C   
3606 O O   . ALA B 75  ? 0.8871 1.1945 1.1654 0.1128  0.0144  0.0180  1075 ALA B O   
3607 C CB  . ALA B 75  ? 0.7876 1.0457 1.0994 0.0571  -0.0190 0.0355  1075 ALA B CB  
3608 N N   . LEU B 76  ? 0.7748 1.0544 1.1055 0.0935  -0.0004 0.0239  1076 LEU B N   
3609 C CA  . LEU B 76  ? 0.7958 1.0645 1.1183 0.1224  0.0096  0.0097  1076 LEU B CA  
3610 C C   . LEU B 76  ? 0.8573 1.1857 1.1962 0.1457  0.0294  0.0264  1076 LEU B C   
3611 O O   . LEU B 76  ? 0.8988 1.2231 1.2199 0.1783  0.0456  0.0120  1076 LEU B O   
3612 C CB  . LEU B 76  ? 0.7850 1.0241 1.1241 0.1212  0.0006  0.0108  1076 LEU B CB  
3613 C CG  . LEU B 76  ? 0.8535 1.0278 1.1751 0.1116  -0.0078 -0.0089 1076 LEU B CG  
3614 C CD1 . LEU B 76  ? 0.8501 1.0086 1.1864 0.1083  -0.0141 0.0046  1076 LEU B CD1 
3615 C CD2 . LEU B 76  ? 0.9341 1.0660 1.2318 0.1318  0.0028  -0.0368 1076 LEU B CD2 
3616 N N   . LYS B 77  ? 0.7810 1.1643 1.1582 0.1284  0.0301  0.0555  1077 LYS B N   
3617 C CA  . LYS B 77  ? 0.7893 1.2453 1.1965 0.1444  0.0509  0.0778  1077 LYS B CA  
3618 C C   . LYS B 77  ? 0.8740 1.3458 1.2428 0.1636  0.0738  0.0757  1077 LYS B C   
3619 O O   . LYS B 77  ? 0.9049 1.4046 1.2641 0.1996  0.0966  0.0712  1077 LYS B O   
3620 C CB  . LYS B 77  ? 0.7948 1.3010 1.2585 0.1099  0.0440  0.1067  1077 LYS B CB  
3621 C CG  . LYS B 77  ? 1.0934 1.6899 1.6080 0.1203  0.0645  0.1339  1077 LYS B CG  
3622 C CD  . LYS B 77  ? 1.2605 1.9074 1.8412 0.0760  0.0571  0.1599  1077 LYS B CD  
3623 C CE  . LYS B 77  ? 1.4323 2.0704 2.0136 0.0476  0.0695  0.1801  1077 LYS B CE  
3624 N NZ  . LYS B 77  ? 1.5224 2.0759 2.0557 0.0343  0.0541  0.1636  1077 LYS B NZ  
3625 N N   . LEU B 78  ? 0.8231 1.2750 1.1637 0.1446  0.0674  0.0772  1078 LEU B N   
3626 C CA  . LEU B 78  ? 0.8569 1.3282 1.1504 0.1612  0.0840  0.0789  1078 LEU B CA  
3627 C C   . LEU B 78  ? 0.9604 1.3947 1.1931 0.1906  0.0836  0.0335  1078 LEU B C   
3628 O O   . LEU B 78  ? 1.0116 1.4764 1.2056 0.2208  0.1057  0.0261  1078 LEU B O   
3629 C CB  . LEU B 78  ? 0.8439 1.3012 1.1274 0.1351  0.0718  0.0965  1078 LEU B CB  
3630 C CG  . LEU B 78  ? 0.8683 1.3488 1.2089 0.1039  0.0762  0.1390  1078 LEU B CG  
3631 C CD1 . LEU B 78  ? 0.8610 1.3009 1.1964 0.0814  0.0604  0.1486  1078 LEU B CD1 
3632 C CD2 . LEU B 78  ? 0.9177 1.4678 1.2753 0.1125  0.1093  0.1778  1078 LEU B CD2 
3633 N N   . ALA B 79  ? 0.9063 1.2751 1.1316 0.1810  0.0608  0.0017  1079 ALA B N   
3634 C CA  . ALA B 79  ? 0.9570 1.2776 1.1357 0.1989  0.0574  -0.0466 1079 ALA B CA  
3635 C C   . ALA B 79  ? 1.0641 1.3830 1.2402 0.2377  0.0821  -0.0620 1079 ALA B C   
3636 O O   . ALA B 79  ? 1.1307 1.4370 1.2565 0.2636  0.0935  -0.0978 1079 ALA B O   
3637 C CB  . ALA B 79  ? 0.9464 1.2017 1.1373 0.1745  0.0326  -0.0667 1079 ALA B CB  
3638 N N   . ASN B 80  ? 0.9994 1.3352 1.2285 0.2444  0.0898  -0.0359 1080 ASN B N   
3639 C CA  . ASN B 80  ? 1.0416 1.3841 1.2818 0.2874  0.1145  -0.0405 1080 ASN B CA  
3640 C C   . ASN B 80  ? 1.1171 1.5395 1.3521 0.3167  0.1465  -0.0244 1080 ASN B C   
3641 O O   . ASN B 80  ? 1.1717 1.5984 1.3973 0.3617  0.1732  -0.0389 1080 ASN B O   
3642 C CB  . ASN B 80  ? 1.0283 1.3812 1.3293 0.2859  0.1076  -0.0111 1080 ASN B CB  
3643 C CG  . ASN B 80  ? 1.3949 1.6698 1.6962 0.2683  0.0854  -0.0235 1080 ASN B CG  
3644 O OD1 . ASN B 80  ? 1.3708 1.5700 1.6390 0.2739  0.0853  -0.0589 1080 ASN B OD1 
3645 N ND2 . ASN B 80  ? 1.2850 1.5790 1.6256 0.2471  0.0680  0.0051  1080 ASN B ND2 
3646 N N   . GLU B 81  ? 1.0353 1.5182 1.2780 0.2937  0.1479  0.0079  1081 GLU B N   
3647 C CA  . GLU B 81  ? 1.0548 1.6200 1.2944 0.3166  0.1822  0.0322  1081 GLU B CA  
3648 C C   . GLU B 81  ? 1.1719 1.7281 1.3237 0.3361  0.1929  0.0024  1081 GLU B C   
3649 O O   . GLU B 81  ? 1.2151 1.8354 1.3448 0.3643  0.2266  0.0165  1081 GLU B O   
3650 C CB  . GLU B 81  ? 1.0147 1.6447 1.3101 0.2798  0.1820  0.0866  1081 GLU B CB  
3651 C CG  . GLU B 81  ? 1.0608 1.7244 1.4421 0.2635  0.1735  0.1127  1081 GLU B CG  
3652 C CD  . GLU B 81  ? 1.2697 1.9840 1.7132 0.2181  0.1685  0.1566  1081 GLU B CD  
3653 O OE1 . GLU B 81  ? 1.1230 1.8669 1.6340 0.1994  0.1544  0.1705  1081 GLU B OE1 
3654 O OE2 . GLU B 81  ? 1.2399 1.9616 1.6643 0.2006  0.1772  0.1766  1081 GLU B OE2 
3655 N N   . GLY B 82  ? 1.1345 1.6192 1.2380 0.3217  0.1643  -0.0388 1082 GLY B N   
3656 C CA  . GLY B 82  ? 1.2002 1.6780 1.2181 0.3350  0.1629  -0.0750 1082 GLY B CA  
3657 C C   . GLY B 82  ? 1.2269 1.7492 1.2249 0.3128  0.1535  -0.0396 1082 GLY B C   
3658 O O   . GLY B 82  ? 1.2924 1.8443 1.2179 0.3319  0.1600  -0.0515 1082 GLY B O   
3659 N N   . LYS B 83  ? 1.0891 1.6146 1.1482 0.2752  0.1387  0.0042  1083 LYS B N   
3660 C CA  . LYS B 83  ? 1.0630 1.6176 1.1181 0.2537  0.1316  0.0462  1083 LYS B CA  
3661 C C   . LYS B 83  ? 1.0871 1.5875 1.1316 0.2272  0.0906  0.0236  1083 LYS B C   
3662 O O   . LYS B 83  ? 1.0248 1.4932 1.1240 0.1966  0.0736  0.0374  1083 LYS B O   
3663 C CB  . LYS B 83  ? 1.0318 1.6199 1.1666 0.2295  0.1458  0.1053  1083 LYS B CB  
3664 C CG  . LYS B 83  ? 1.1694 1.8280 1.3297 0.2524  0.1873  0.1328  1083 LYS B CG  
3665 C CD  . LYS B 83  ? 1.2074 1.9004 1.4589 0.2193  0.1956  0.1842  1083 LYS B CD  
3666 C CE  . LYS B 83  ? 1.3036 2.0805 1.5936 0.2398  0.2367  0.2130  1083 LYS B CE  
3667 N NZ  . LYS B 83  ? 1.3738 2.1897 1.7632 0.1997  0.2402  0.2579  1083 LYS B NZ  
3668 N N   . VAL B 84  ? 1.0925 1.5883 1.0663 0.2400  0.0745  -0.0147 1084 VAL B N   
3669 C CA  . VAL B 84  ? 1.0742 1.5333 1.0382 0.2181  0.0349  -0.0431 1084 VAL B CA  
3670 C C   . VAL B 84  ? 1.0735 1.5527 1.0598 0.1995  0.0227  0.0079  1084 VAL B C   
3671 O O   . VAL B 84  ? 1.0101 1.4517 1.0467 0.1726  0.0047  0.0128  1084 VAL B O   
3672 C CB  . VAL B 84  ? 1.2055 1.6721 1.0889 0.2358  0.0190  -0.0990 1084 VAL B CB  
3673 C CG1 . VAL B 84  ? 1.1914 1.6268 1.0830 0.2078  -0.0235 -0.1319 1084 VAL B CG1 
3674 C CG2 . VAL B 84  ? 1.2588 1.6970 1.1148 0.2599  0.0376  -0.1510 1084 VAL B CG2 
3675 N N   . LYS B 85  ? 1.0681 1.6043 1.0141 0.2178  0.0352  0.0466  1085 LYS B N   
3676 C CA  . LYS B 85  ? 1.0540 1.6066 1.0152 0.2091  0.0287  0.1015  1085 LYS B CA  
3677 C C   . LYS B 85  ? 1.0347 1.5566 1.0785 0.1820  0.0420  0.1442  1085 LYS B C   
3678 O O   . LYS B 85  ? 1.0094 1.5095 1.0837 0.1667  0.0285  0.1691  1085 LYS B O   
3679 C CB  . LYS B 85  ? 1.1601 1.7799 1.0614 0.2390  0.0493  0.1450  1085 LYS B CB  
3680 C CG  . LYS B 85  ? 1.4861 2.1466 1.3006 0.2628  0.0225  0.1150  1085 LYS B CG  
3681 C CD  . LYS B 85  ? 1.7272 2.3831 1.4869 0.2746  0.0123  0.0346  1085 LYS B CD  
3682 C CE  . LYS B 85  ? 2.0158 2.7151 1.6949 0.2901  -0.0223 -0.0008 1085 LYS B CE  
3683 N NZ  . LYS B 85  ? 2.2281 2.9098 1.8559 0.2964  -0.0332 -0.0881 1085 LYS B NZ  
3684 N N   . GLU B 86  ? 0.9625 1.4853 1.0436 0.1771  0.0668  0.1491  1086 GLU B N   
3685 C CA  . GLU B 86  ? 0.9023 1.4027 1.0617 0.1475  0.0751  0.1786  1086 GLU B CA  
3686 C C   . GLU B 86  ? 0.8959 1.3377 1.0895 0.1247  0.0470  0.1423  1086 GLU B C   
3687 O O   . GLU B 86  ? 0.8546 1.2654 1.0916 0.1004  0.0393  0.1599  1086 GLU B O   
3688 C CB  . GLU B 86  ? 0.9130 1.4509 1.1058 0.1503  0.1061  0.1933  1086 GLU B CB  
3689 C CG  . GLU B 86  ? 1.0555 1.6594 1.2273 0.1706  0.1433  0.2380  1086 GLU B CG  
3690 C CD  . GLU B 86  ? 1.2322 1.8781 1.3223 0.2134  0.1572  0.2155  1086 GLU B CD  
3691 O OE1 . GLU B 86  ? 1.1023 1.8075 1.1912 0.2319  0.1954  0.2432  1086 GLU B OE1 
3692 O OE2 . GLU B 86  ? 1.1427 1.7633 1.1757 0.2272  0.1316  0.1644  1086 GLU B OE2 
3693 N N   . ALA B 87  ? 0.8512 1.2745 1.0235 0.1339  0.0352  0.0920  1087 ALA B N   
3694 C CA  . ALA B 87  ? 0.8102 1.1812 1.0082 0.1162  0.0134  0.0601  1087 ALA B CA  
3695 C C   . ALA B 87  ? 0.8648 1.2137 1.0567 0.1050  -0.0113 0.0539  1087 ALA B C   
3696 O O   . ALA B 87  ? 0.8296 1.1444 1.0587 0.0849  -0.0217 0.0546  1087 ALA B O   
3697 C CB  . ALA B 87  ? 0.8379 1.1907 1.0136 0.1316  0.0126  0.0148  1087 ALA B CB  
3698 N N   . GLN B 88  ? 0.8583 1.2353 1.0029 0.1205  -0.0205 0.0489  1088 GLN B N   
3699 C CA  . GLN B 88  ? 0.8549 1.2316 0.9970 0.1153  -0.0456 0.0474  1088 GLN B CA  
3700 C C   . GLN B 88  ? 0.9141 1.2870 1.0900 0.1092  -0.0392 0.0986  1088 GLN B C   
3701 O O   . GLN B 88  ? 0.9068 1.2606 1.1085 0.1004  -0.0545 0.0990  1088 GLN B O   
3702 C CB  . GLN B 88  ? 0.9272 1.3505 1.0073 0.1359  -0.0598 0.0312  1088 GLN B CB  
3703 C CG  . GLN B 88  ? 1.0521 1.4645 1.1000 0.1373  -0.0711 -0.0322 1088 GLN B CG  
3704 C CD  . GLN B 88  ? 1.3193 1.7805 1.2992 0.1551  -0.0894 -0.0589 1088 GLN B CD  
3705 O OE1 . GLN B 88  ? 1.3225 1.8380 1.2661 0.1748  -0.0890 -0.0239 1088 GLN B OE1 
3706 N NE2 . GLN B 88  ? 1.2214 1.6632 1.1795 0.1491  -0.1049 -0.1223 1088 GLN B NE2 
3707 N N   . ALA B 89  ? 0.8895 1.2774 1.0713 0.1133  -0.0135 0.1415  1089 ALA B N   
3708 C CA  . ALA B 89  ? 0.8890 1.2588 1.1086 0.1043  -0.0018 0.1904  1089 ALA B CA  
3709 C C   . ALA B 89  ? 0.9170 1.2349 1.1931 0.0755  -0.0018 0.1793  1089 ALA B C   
3710 O O   . ALA B 89  ? 0.9100 1.1922 1.2151 0.0667  -0.0047 0.1933  1089 ALA B O   
3711 C CB  . ALA B 89  ? 0.9338 1.3357 1.1480 0.1120  0.0286  0.2386  1089 ALA B CB  
3712 N N   . ALA B 90  ? 0.8666 1.1828 1.1550 0.0648  0.0016  0.1539  1090 ALA B N   
3713 C CA  . ALA B 90  ? 0.8373 1.1177 1.1688 0.0403  -0.0020 0.1397  1090 ALA B CA  
3714 C C   . ALA B 90  ? 0.8824 1.1280 1.2128 0.0365  -0.0221 0.1080  1090 ALA B C   
3715 O O   . ALA B 90  ? 0.8742 1.0848 1.2319 0.0207  -0.0253 0.1052  1090 ALA B O   
3716 C CB  . ALA B 90  ? 0.8328 1.1359 1.1734 0.0387  0.0052  0.1263  1090 ALA B CB  
3717 N N   . ALA B 91  ? 0.8467 1.1031 1.1460 0.0500  -0.0343 0.0827  1091 ALA B N   
3718 C CA  . ALA B 91  ? 0.8282 1.0617 1.1320 0.0448  -0.0507 0.0550  1091 ALA B CA  
3719 C C   . ALA B 91  ? 0.8845 1.1145 1.2013 0.0473  -0.0577 0.0708  1091 ALA B C   
3720 O O   . ALA B 91  ? 0.8639 1.0757 1.1992 0.0408  -0.0652 0.0562  1091 ALA B O   
3721 C CB  . ALA B 91  ? 0.8527 1.1002 1.1272 0.0534  -0.0612 0.0231  1091 ALA B CB  
3722 N N   . GLU B 92  ? 0.8766 1.1262 1.1856 0.0602  -0.0522 0.1052  1092 GLU B N   
3723 C CA  . GLU B 92  ? 0.8897 1.1371 1.2130 0.0710  -0.0562 0.1288  1092 GLU B CA  
3724 C C   . GLU B 92  ? 0.9296 1.1228 1.2908 0.0588  -0.0430 0.1396  1092 GLU B C   
3725 O O   . GLU B 92  ? 0.9369 1.1137 1.3174 0.0677  -0.0444 0.1466  1092 GLU B O   
3726 C CB  . GLU B 92  ? 0.9523 1.2373 1.2500 0.0937  -0.0523 0.1690  1092 GLU B CB  
3727 C CG  . GLU B 92  ? 1.1456 1.4763 1.4283 0.1154  -0.0744 0.1716  1092 GLU B CG  
3728 C CD  . GLU B 92  ? 1.5002 1.8723 1.7573 0.1132  -0.0996 0.1262  1092 GLU B CD  
3729 O OE1 . GLU B 92  ? 1.5345 1.8965 1.7746 0.1003  -0.0970 0.0929  1092 GLU B OE1 
3730 O OE2 . GLU B 92  ? 1.4074 1.8242 1.6638 0.1254  -0.1223 0.1247  1092 GLU B OE2 
3731 N N   . GLN B 93  ? 0.8789 1.0480 1.2517 0.0388  -0.0315 0.1359  1093 GLN B N   
3732 C CA  . GLN B 93  ? 0.8822 0.9998 1.2856 0.0214  -0.0230 0.1333  1093 GLN B CA  
3733 C C   . GLN B 93  ? 0.8946 0.9926 1.3007 0.0149  -0.0318 0.0960  1093 GLN B C   
3734 O O   . GLN B 93  ? 0.9063 0.9625 1.3280 0.0074  -0.0265 0.0870  1093 GLN B O   
3735 C CB  . GLN B 93  ? 0.9063 1.0209 1.3253 -0.0015 -0.0131 0.1389  1093 GLN B CB  
3736 C CG  . GLN B 93  ? 1.2590 1.3862 1.6862 0.0004  0.0042  0.1836  1093 GLN B CG  
3737 C CD  . GLN B 93  ? 1.6546 1.7894 2.1118 -0.0273 0.0148  0.1899  1093 GLN B CD  
3738 O OE1 . GLN B 93  ? 1.6087 1.7644 2.0700 -0.0397 0.0063  0.1629  1093 GLN B OE1 
3739 N NE2 . GLN B 93  ? 1.6282 1.7536 2.1108 -0.0362 0.0348  0.2308  1093 GLN B NE2 
3740 N N   . LEU B 94  ? 0.8074 0.9325 1.1966 0.0182  -0.0427 0.0744  1094 LEU B N   
3741 C CA  . LEU B 94  ? 0.7784 0.8911 1.1696 0.0135  -0.0469 0.0474  1094 LEU B CA  
3742 C C   . LEU B 94  ? 0.8159 0.9228 1.2232 0.0257  -0.0458 0.0497  1094 LEU B C   
3743 O O   . LEU B 94  ? 0.8046 0.8914 1.2189 0.0230  -0.0402 0.0345  1094 LEU B O   
3744 C CB  . LEU B 94  ? 0.7620 0.8979 1.1381 0.0132  -0.0552 0.0297  1094 LEU B CB  
3745 C CG  . LEU B 94  ? 0.8198 0.9623 1.1826 0.0088  -0.0535 0.0253  1094 LEU B CG  
3746 C CD1 . LEU B 94  ? 0.8224 0.9768 1.1698 0.0144  -0.0586 0.0084  1094 LEU B CD1 
3747 C CD2 . LEU B 94  ? 0.8599 0.9838 1.2277 -0.0020 -0.0508 0.0177  1094 LEU B CD2 
3748 N N   . LYS B 95  ? 0.7791 0.9108 1.1913 0.0428  -0.0500 0.0713  1095 LYS B N   
3749 C CA  . LYS B 95  ? 0.7868 0.9273 1.2220 0.0617  -0.0497 0.0813  1095 LYS B CA  
3750 C C   . LYS B 95  ? 0.8820 0.9682 1.3334 0.0672  -0.0318 0.0877  1095 LYS B C   
3751 O O   . LYS B 95  ? 0.8862 0.9648 1.3552 0.0775  -0.0246 0.0782  1095 LYS B O   
3752 C CB  . LYS B 95  ? 0.8280 1.0138 1.2602 0.0828  -0.0607 0.1094  1095 LYS B CB  
3753 C CG  . LYS B 95  ? 0.9398 1.1801 1.3521 0.0784  -0.0812 0.0936  1095 LYS B CG  
3754 C CD  . LYS B 95  ? 1.0687 1.3630 1.4698 0.1021  -0.0953 0.1202  1095 LYS B CD  
3755 C CE  . LYS B 95  ? 1.1684 1.5153 1.5436 0.0956  -0.1185 0.0941  1095 LYS B CE  
3756 N NZ  . LYS B 95  ? 1.3251 1.7366 1.6800 0.1205  -0.1369 0.1172  1095 LYS B NZ  
3757 N N   . THR B 96  ? 0.8789 0.9264 1.3266 0.0590  -0.0226 0.1014  1096 THR B N   
3758 C CA  . THR B 96  ? 0.9288 0.9104 1.3917 0.0576  -0.0058 0.1009  1096 THR B CA  
3759 C C   . THR B 96  ? 0.9917 0.9478 1.4463 0.0428  -0.0032 0.0593  1096 THR B C   
3760 O O   . THR B 96  ? 1.0249 0.9416 1.4872 0.0539  0.0097  0.0464  1096 THR B O   
3761 C CB  . THR B 96  ? 1.0581 1.0114 1.5252 0.0402  0.0015  0.1213  1096 THR B CB  
3762 O OG1 . THR B 96  ? 1.0817 1.0692 1.5461 0.0571  0.0013  0.1639  1096 THR B OG1 
3763 C CG2 . THR B 96  ? 1.1077 0.9825 1.5962 0.0340  0.0186  0.1190  1096 THR B CG2 
3764 N N   . THR B 97  ? 0.9189 0.9003 1.3542 0.0230  -0.0140 0.0402  1097 THR B N   
3765 C CA  . THR B 97  ? 0.9144 0.8849 1.3327 0.0118  -0.0137 0.0076  1097 THR B CA  
3766 C C   . THR B 97  ? 0.9600 0.9521 1.3799 0.0289  -0.0084 0.0008  1097 THR B C   
3767 O O   . THR B 97  ? 0.9834 0.9564 1.3931 0.0325  0.0026  -0.0195 1097 THR B O   
3768 C CB  . THR B 97  ? 0.9354 0.9325 1.3372 -0.0077 -0.0262 0.0006  1097 THR B CB  
3769 O OG1 . THR B 97  ? 0.9353 0.9265 1.3478 -0.0233 -0.0286 0.0118  1097 THR B OG1 
3770 C CG2 . THR B 97  ? 0.8943 0.8864 1.2729 -0.0162 -0.0279 -0.0263 1097 THR B CG2 
3771 N N   . ARG B 98  ? 0.8871 0.9236 1.3210 0.0382  -0.0156 0.0167  1098 ARG B N   
3772 C CA  . ARG B 98  ? 0.8724 0.9420 1.3230 0.0480  -0.0120 0.0136  1098 ARG B CA  
3773 C C   . ARG B 98  ? 0.9652 1.0267 1.4412 0.0737  0.0032  0.0204  1098 ARG B C   
3774 O O   . ARG B 98  ? 0.9617 1.0361 1.4491 0.0822  0.0170  0.0115  1098 ARG B O   
3775 C CB  . ARG B 98  ? 0.8284 0.9493 1.2911 0.0453  -0.0290 0.0226  1098 ARG B CB  
3776 C CG  . ARG B 98  ? 0.8525 1.0114 1.3412 0.0427  -0.0275 0.0158  1098 ARG B CG  
3777 C CD  . ARG B 98  ? 0.8940 1.1050 1.4230 0.0586  -0.0349 0.0291  1098 ARG B CD  
3778 N NE  . ARG B 98  ? 0.8665 1.1175 1.3937 0.0540  -0.0601 0.0324  1098 ARG B NE  
3779 C CZ  . ARG B 98  ? 0.9406 1.1997 1.4542 0.0696  -0.0705 0.0511  1098 ARG B CZ  
3780 N NH1 . ARG B 98  ? 0.7229 1.0263 1.2260 0.0674  -0.0935 0.0504  1098 ARG B NH1 
3781 N NH2 . ARG B 98  ? 0.7456 0.9672 1.2550 0.0880  -0.0567 0.0708  1098 ARG B NH2 
3782 N N   . ASN B 99  ? 0.9682 1.0072 1.4544 0.0889  0.0047  0.0395  1099 ASN B N   
3783 C CA  . ASN B 99  ? 1.0171 1.0385 1.5294 0.1204  0.0217  0.0502  1099 ASN B CA  
3784 C C   . ASN B 99  ? 1.1322 1.0872 1.6280 0.1215  0.0432  0.0218  1099 ASN B C   
3785 O O   . ASN B 99  ? 1.1601 1.1073 1.6719 0.1487  0.0631  0.0169  1099 ASN B O   
3786 C CB  . ASN B 99  ? 1.0710 1.0805 1.5967 0.1382  0.0189  0.0855  1099 ASN B CB  
3787 C CG  . ASN B 99  ? 1.3842 1.4669 1.9179 0.1443  -0.0033 0.1121  1099 ASN B CG  
3788 O OD1 . ASN B 99  ? 1.2340 1.3780 1.7740 0.1359  -0.0179 0.1012  1099 ASN B OD1 
3789 N ND2 . ASN B 99  ? 1.3573 1.4339 1.8893 0.1578  -0.0060 0.1473  1099 ASN B ND2 
3790 N N   . ALA B 100 ? 1.1087 1.0232 1.5723 0.0931  0.0385  0.0002  1100 ALA B N   
3791 C CA  . ALA B 100 ? 1.1602 1.0171 1.5983 0.0876  0.0518  -0.0362 1100 ALA B CA  
3792 C C   . ALA B 100 ? 1.2068 1.0937 1.6210 0.0905  0.0601  -0.0593 1100 ALA B C   
3793 O O   . ALA B 100 ? 1.2531 1.1044 1.6370 0.0927  0.0729  -0.0920 1100 ALA B O   
3794 C CB  . ALA B 100 ? 1.1790 1.0051 1.5974 0.0527  0.0377  -0.0503 1100 ALA B CB  
3795 N N   . TYR B 101 ? 1.1172 1.0688 1.5447 0.0903  0.0545  -0.0420 1101 TYR B N   
3796 C CA  . TYR B 101 ? 1.1120 1.0981 1.5274 0.0921  0.0665  -0.0508 1101 TYR B CA  
3797 C C   . TYR B 101 ? 1.1644 1.1883 1.6217 0.1207  0.0870  -0.0375 1101 TYR B C   
3798 O O   . TYR B 101 ? 1.1950 1.2237 1.6410 0.1352  0.1120  -0.0502 1101 TYR B O   
3799 C CB  . TYR B 101 ? 1.0808 1.1067 1.4919 0.0682  0.0494  -0.0398 1101 TYR B CB  
3800 C CG  . TYR B 101 ? 1.1107 1.1740 1.5241 0.0689  0.0650  -0.0361 1101 TYR B CG  
3801 C CD1 . TYR B 101 ? 1.1685 1.2218 1.5360 0.0660  0.0763  -0.0488 1101 TYR B CD1 
3802 C CD2 . TYR B 101 ? 1.0969 1.2105 1.5603 0.0711  0.0682  -0.0177 1101 TYR B CD2 
3803 C CE1 . TYR B 101 ? 1.1874 1.2738 1.5576 0.0678  0.0966  -0.0370 1101 TYR B CE1 
3804 C CE2 . TYR B 101 ? 1.1108 1.2580 1.5868 0.0670  0.0869  -0.0102 1101 TYR B CE2 
3805 C CZ  . TYR B 101 ? 1.2447 1.3751 1.6733 0.0664  0.1039  -0.0167 1101 TYR B CZ  
3806 O OH  . TYR B 101 ? 1.2729 1.4356 1.7143 0.0627  0.1271  -0.0011 1101 TYR B OH  
3807 N N   . ILE B 102 ? 1.0842 1.1458 1.5893 0.1298  0.0761  -0.0109 1102 ILE B N   
3808 C CA  . ILE B 102 ? 1.0766 1.1950 1.6347 0.1556  0.0898  0.0055  1102 ILE B CA  
3809 C C   . ILE B 102 ? 1.1757 1.2560 1.7393 0.1956  0.1193  -0.0017 1102 ILE B C   
3810 O O   . ILE B 102 ? 1.1851 1.3062 1.7788 0.2196  0.1437  0.0012  1102 ILE B O   
3811 C CB  . ILE B 102 ? 1.0816 1.2596 1.6865 0.1573  0.0643  0.0338  1102 ILE B CB  
3812 C CG1 . ILE B 102 ? 1.1133 1.2573 1.7148 0.1730  0.0518  0.0517  1102 ILE B CG1 
3813 C CG2 . ILE B 102 ? 1.0371 1.2510 1.6382 0.1208  0.0403  0.0321  1102 ILE B CG2 
3814 C CD1 . ILE B 102 ? 1.2639 1.3934 1.8979 0.2203  0.0708  0.0703  1102 ILE B CD1 
3815 N N   . GLN B 103 ? 1.1635 1.1636 1.7005 0.2017  0.1204  -0.0128 1103 GLN B N   
3816 C CA  . GLN B 103 ? 1.2288 1.1749 1.7696 0.2400  0.1501  -0.0247 1103 GLN B CA  
3817 C C   . GLN B 103 ? 1.3206 1.2110 1.8017 0.2336  0.1694  -0.0724 1103 GLN B C   
3818 O O   . GLN B 103 ? 1.3962 1.2230 1.8658 0.2607  0.1940  -0.0961 1103 GLN B O   
3819 C CB  . GLN B 103 ? 1.2839 1.1652 1.8373 0.2523  0.1449  -0.0081 1103 GLN B CB  
3820 C CG  . GLN B 103 ? 1.4006 1.2111 1.9152 0.2143  0.1288  -0.0244 1103 GLN B CG  
3821 C CD  . GLN B 103 ? 1.6475 1.3941 2.1837 0.2264  0.1308  0.0006  1103 GLN B CD  
3822 O OE1 . GLN B 103 ? 1.5885 1.3515 2.1654 0.2645  0.1380  0.0390  1103 GLN B OE1 
3823 N NE2 . GLN B 103 ? 1.5874 1.2657 2.1008 0.1934  0.1240  -0.0157 1103 GLN B NE2 
3824 N N   . LYS B 104 ? 1.2359 1.1530 1.6781 0.2024  0.1597  -0.0862 1104 LYS B N   
3825 C CA  . LYS B 104 ? 1.2870 1.1696 1.6645 0.1973  0.1728  -0.1282 1104 LYS B CA  
3826 C C   . LYS B 104 ? 1.3339 1.2823 1.6993 0.2033  0.1929  -0.1237 1104 LYS B C   
3827 O O   . LYS B 104 ? 1.3849 1.3391 1.7451 0.2364  0.2280  -0.1358 1104 LYS B O   
3828 C CB  . LYS B 104 ? 1.3072 1.1582 1.6404 0.1557  0.1422  -0.1463 1104 LYS B CB  
3829 C CG  . LYS B 104 ? 1.4964 1.2666 1.8261 0.1446  0.1315  -0.1662 1104 LYS B CG  
3830 C CD  . LYS B 104 ? 1.7270 1.4289 2.0121 0.1566  0.1508  -0.2193 1104 LYS B CD  
3831 C CE  . LYS B 104 ? 1.8900 1.5059 2.1747 0.1343  0.1387  -0.2448 1104 LYS B CE  
3832 N NZ  . LYS B 104 ? 2.0863 1.6329 2.3216 0.1416  0.1546  -0.3079 1104 LYS B NZ  
3833 N N   . TYR B 105 ? 1.2374 1.2329 1.6006 0.1734  0.1747  -0.1040 1105 TYR B N   
3834 C CA  . TYR B 105 ? 1.2339 1.2823 1.5825 0.1716  0.1937  -0.0936 1105 TYR B CA  
3835 C C   . TYR B 105 ? 1.2669 1.3885 1.6911 0.1787  0.2078  -0.0576 1105 TYR B C   
3836 O O   . TYR B 105 ? 1.2855 1.4495 1.7126 0.1902  0.2400  -0.0490 1105 TYR B O   
3837 C CB  . TYR B 105 ? 1.2095 1.2617 1.5214 0.1372  0.1685  -0.0881 1105 TYR B CB  
3838 C CG  . TYR B 105 ? 1.2628 1.2619 1.5093 0.1267  0.1500  -0.1227 1105 TYR B CG  
3839 C CD1 . TYR B 105 ? 1.3583 1.3473 1.5343 0.1372  0.1646  -0.1515 1105 TYR B CD1 
3840 C CD2 . TYR B 105 ? 1.2450 1.2096 1.5020 0.1064  0.1186  -0.1283 1105 TYR B CD2 
3841 C CE1 . TYR B 105 ? 1.4167 1.3644 1.5373 0.1242  0.1427  -0.1900 1105 TYR B CE1 
3842 C CE2 . TYR B 105 ? 1.2975 1.2205 1.5085 0.0919  0.1011  -0.1618 1105 TYR B CE2 
3843 C CZ  . TYR B 105 ? 1.4702 1.3860 1.6145 0.0989  0.1103  -0.1950 1105 TYR B CZ  
3844 O OH  . TYR B 105 ? 1.5475 1.4311 1.6496 0.0800  0.0873  -0.2332 1105 TYR B OH  
3845 N N   . LEU B 106 ? 1.1851 1.3286 1.6701 0.1712  0.1842  -0.0367 1106 LEU B N   
3846 C CA  . LEU B 106 ? 1.1469 1.3701 1.7109 0.1730  0.1893  -0.0073 1106 LEU B CA  
3847 C C   . LEU B 106 ? 1.2426 1.4956 1.8487 0.2172  0.2220  -0.0034 1106 LEU B C   
3848 O O   . LEU B 106 ? 1.2262 1.5553 1.8894 0.2229  0.2427  0.0164  1106 LEU B O   
3849 C CB  . LEU B 106 ? 1.0924 1.3352 1.6975 0.1549  0.1503  0.0083  1106 LEU B CB  
3850 N N   . GLY B 107 ? 1.2587 1.4504 1.8410 0.2479  0.2286  -0.0218 1107 GLY B N   
3851 C CA  . GLY B 107 ? 1.3133 1.5167 1.9309 0.2986  0.2622  -0.0207 1107 GLY B CA  
3852 C C   . GLY B 107 ? 1.4569 1.6083 2.0129 0.3266  0.3018  -0.0565 1107 GLY B C   
3853 O O   . GLY B 107 ? 1.4738 1.5923 1.9561 0.3050  0.3024  -0.0812 1107 GLY B O   
3854 N N   . SER B 108 ? 1.4781 1.6236 2.0613 0.3790  0.3348  -0.0606 1108 SER B N   
3855 C CA  . SER B 108 ? 1.5814 1.6746 2.1065 0.4149  0.3772  -0.1012 1108 SER B CA  
3856 C C   . SER B 108 ? 1.7103 1.6747 2.1728 0.4146  0.3648  -0.1452 1108 SER B C   
3857 O O   . SER B 108 ? 1.8077 1.7092 2.2346 0.4522  0.3976  -0.1838 1108 SER B O   
3858 C CB  . SER B 108 ? 1.6726 1.8153 2.2608 0.4756  0.4219  -0.0870 1108 SER B CB  
3859 O OG  . SER B 108 ? 1.7885 1.9187 2.4417 0.5044  0.4102  -0.0641 1108 SER B OG  
3860 N N   . GLY B 109 ? 1.6197 1.5473 2.0709 0.3705  0.3196  -0.1410 1109 GLY B N   
3861 C CA  . GLY B 109 ? 1.6714 1.4878 2.0767 0.3560  0.3031  -0.1768 1109 GLY B CA  
3862 C C   . GLY B 109 ? 1.7634 1.5409 2.0765 0.3356  0.3048  -0.2301 1109 GLY B C   
3863 O O   . GLY B 109 ? 1.8677 1.5655 2.1352 0.3539  0.3235  -0.2803 1109 GLY B O   
3864 N N   . SER B 110 ? 1.6412 1.4758 1.9252 0.2993  0.2850  -0.2200 1110 SER B N   
3865 C CA  . SER B 110 ? 1.6784 1.5040 1.8732 0.2834  0.2843  -0.2595 1110 SER B CA  
3866 C C   . SER B 110 ? 1.7039 1.6060 1.8848 0.3086  0.3222  -0.2453 1110 SER B C   
3867 O O   . SER B 110 ? 1.6457 1.6113 1.8195 0.2868  0.3153  -0.2159 1110 SER B O   
3868 C CB  . SER B 110 ? 1.6700 1.5035 1.8418 0.2320  0.2389  -0.2528 1110 SER B CB  
3869 O OG  . SER B 110 ? 1.8104 1.5736 1.9912 0.2090  0.2105  -0.2702 1110 SER B OG  
3870 N N   . CYS B 111 ? 1.0749 1.3086 1.4916 0.0404  -0.1443 0.1185  35   CYS B N   
3871 C CA  . CYS B 111 ? 1.0683 1.2792 1.4483 0.0471  -0.1426 0.1188  35   CYS B CA  
3872 C C   . CYS B 111 ? 1.1752 1.3754 1.5305 0.0355  -0.1536 0.1060  35   CYS B C   
3873 O O   . CYS B 111 ? 1.1872 1.3968 1.5295 0.0367  -0.1714 0.1045  35   CYS B O   
3874 C CB  . CYS B 111 ? 1.0353 1.2208 1.4075 0.0519  -0.1204 0.1205  35   CYS B CB  
3875 S SG  . CYS B 111 ? 1.0776 1.2338 1.4095 0.0579  -0.1149 0.1212  35   CYS B SG  
3876 N N   . SER B 112 ? 1.1577 1.3392 1.5072 0.0249  -0.1435 0.0963  36   SER B N   
3877 C CA  . SER B 112 ? 1.1773 1.3452 1.5056 0.0138  -0.1505 0.0836  36   SER B CA  
3878 C C   . SER B 112 ? 1.2582 1.4429 1.6085 0.0001  -0.1640 0.0759  36   SER B C   
3879 O O   . SER B 112 ? 1.2498 1.4549 1.6339 -0.0021 -0.1634 0.0807  36   SER B O   
3880 C CB  . SER B 112 ? 1.2059 1.3481 1.5217 0.0096  -0.1335 0.0782  36   SER B CB  
3881 N N   . GLN B 113 ? 1.2342 1.4093 1.5661 -0.0089 -0.1752 0.0640  37   GLN B N   
3882 C CA  . GLN B 113 ? 1.2358 1.4219 1.5861 -0.0233 -0.1892 0.0546  37   GLN B CA  
3883 C C   . GLN B 113 ? 1.2535 1.4364 1.6284 -0.0343 -0.1761 0.0534  37   GLN B C   
3884 O O   . GLN B 113 ? 1.2304 1.3975 1.5981 -0.0314 -0.1579 0.0560  37   GLN B O   
3885 C CB  . GLN B 113 ? 1.2758 1.4453 1.5950 -0.0286 -0.2012 0.0410  37   GLN B CB  
3886 N N   . LYS B 114 ? 1.2033 1.4022 1.6079 -0.0467 -0.1860 0.0497  38   LYS B N   
3887 C CA  . LYS B 114 ? 1.1790 1.3779 1.6098 -0.0576 -0.1750 0.0501  38   LYS B CA  
3888 C C   . LYS B 114 ? 1.2168 1.3869 1.6260 -0.0661 -0.1698 0.0400  38   LYS B C   
3889 O O   . LYS B 114 ? 1.2290 1.3844 1.6105 -0.0669 -0.1800 0.0302  38   LYS B O   
3890 C CB  . LYS B 114 ? 1.2113 1.4370 1.6830 -0.0686 -0.1882 0.0501  38   LYS B CB  
3891 N N   . PRO B 115 ? 1.1473 1.3095 1.5679 -0.0714 -0.1540 0.0425  39   PRO B N   
3892 C CA  . PRO B 115 ? 1.1429 1.2784 1.5442 -0.0782 -0.1490 0.0343  39   PRO B CA  
3893 C C   . PRO B 115 ? 1.1934 1.3235 1.5971 -0.0908 -0.1653 0.0227  39   PRO B C   
3894 O O   . PRO B 115 ? 1.1957 1.3016 1.5745 -0.0932 -0.1654 0.0136  39   PRO B O   
3895 C CB  . PRO B 115 ? 1.1511 1.2875 1.5724 -0.0814 -0.1318 0.0417  39   PRO B CB  
3896 C CG  . PRO B 115 ? 1.2005 1.3660 1.6578 -0.0808 -0.1312 0.0515  39   PRO B CG  
3897 C CD  . PRO B 115 ? 1.1486 1.3255 1.5978 -0.0698 -0.1393 0.0535  39   PRO B CD  
3898 N N   . SER B 116 ? 1.1447 1.2974 1.5800 -0.0988 -0.1790 0.0224  40   SER B N   
3899 C CA  . SER B 116 ? 1.1526 1.3032 1.5957 -0.1118 -0.1974 0.0097  40   SER B CA  
3900 C C   . SER B 116 ? 1.1994 1.3407 1.6054 -0.1059 -0.2136 -0.0019 40   SER B C   
3901 O O   . SER B 116 ? 1.2133 1.3350 1.6026 -0.1127 -0.2219 -0.0157 40   SER B O   
3902 C CB  . SER B 116 ? 1.1913 1.3730 1.6809 -0.1207 -0.2085 0.0132  40   SER B CB  
3903 O OG  . SER B 116 ? 1.2746 1.4655 1.7977 -0.1249 -0.1914 0.0254  40   SER B OG  
3904 N N   . ASP B 117 ? 1.1340 1.2876 1.5255 -0.0920 -0.2162 0.0044  41   ASP B N   
3905 C CA  . ASP B 117 ? 1.1385 1.2860 1.4924 -0.0828 -0.2290 -0.0026 41   ASP B CA  
3906 C C   . ASP B 117 ? 1.1417 1.2579 1.4539 -0.0761 -0.2166 -0.0064 41   ASP B C   
3907 O O   . ASP B 117 ? 1.1611 1.2651 1.4406 -0.0723 -0.2265 -0.0163 41   ASP B O   
3908 C CB  . ASP B 117 ? 1.1591 1.3289 1.5131 -0.0686 -0.2319 0.0092  41   ASP B CB  
3909 C CG  . ASP B 117 ? 1.2929 1.4975 1.6856 -0.0719 -0.2466 0.0136  41   ASP B CG  
3910 O OD1 . ASP B 117 ? 1.3009 1.5143 1.7227 -0.0869 -0.2572 0.0061  41   ASP B OD1 
3911 O OD2 . ASP B 117 ? 1.3718 1.5949 1.7668 -0.0594 -0.2482 0.0245  41   ASP B OD2 
3912 N N   . LYS B 118 ? 1.0362 1.1408 1.3494 -0.0738 -0.1954 0.0014  42   LYS B N   
3913 C CA  . LYS B 118 ? 1.0137 1.0921 1.2930 -0.0673 -0.1829 -0.0008 42   LYS B CA  
3914 C C   . LYS B 118 ? 1.0290 1.0886 1.3140 -0.0767 -0.1721 -0.0050 42   LYS B C   
3915 O O   . LYS B 118 ? 1.0224 1.0684 1.2960 -0.0719 -0.1561 -0.0009 42   LYS B O   
3916 C CB  . LYS B 118 ? 1.0171 1.0978 1.2892 -0.0542 -0.1680 0.0117  42   LYS B CB  
3917 C CG  . LYS B 118 ? 1.0511 1.1440 1.3528 -0.0547 -0.1550 0.0224  42   LYS B CG  
3918 C CD  . LYS B 118 ? 1.1517 1.2441 1.4445 -0.0416 -0.1424 0.0319  42   LYS B CD  
3919 C CE  . LYS B 118 ? 1.3002 1.4010 1.6169 -0.0406 -0.1283 0.0402  42   LYS B CE  
3920 N NZ  . LYS B 118 ? 1.4220 1.5484 1.7716 -0.0433 -0.1341 0.0459  42   LYS B NZ  
3921 N N   . HIS B 119 ? 0.9620 1.0199 1.2639 -0.0899 -0.1817 -0.0135 43   HIS B N   
3922 C CA  . HIS B 119 ? 0.9388 0.9779 1.2469 -0.0984 -0.1719 -0.0162 43   HIS B CA  
3923 C C   . HIS B 119 ? 0.9927 1.0052 1.2713 -0.0995 -0.1769 -0.0304 43   HIS B C   
3924 O O   . HIS B 119 ? 1.0225 1.0338 1.2954 -0.1040 -0.1941 -0.0426 43   HIS B O   
3925 C CB  . HIS B 119 ? 0.9397 0.9906 1.2888 -0.1125 -0.1755 -0.0147 43   HIS B CB  
3926 C CG  . HIS B 119 ? 0.9798 1.0108 1.3361 -0.1204 -0.1647 -0.0154 43   HIS B CG  
3927 N ND1 . HIS B 119 ? 1.0227 1.0329 1.3732 -0.1292 -0.1728 -0.0286 43   HIS B ND1 
3928 C CD2 . HIS B 119 ? 0.9853 1.0138 1.3520 -0.1195 -0.1466 -0.0043 43   HIS B CD2 
3929 C CE1 . HIS B 119 ? 1.0118 1.0074 1.3711 -0.1332 -0.1587 -0.0237 43   HIS B CE1 
3930 N NE2 . HIS B 119 ? 0.9939 1.0006 1.3621 -0.1273 -0.1430 -0.0088 43   HIS B NE2 
3931 N N   . LEU B 120 ? 0.9150 0.9066 1.1761 -0.0952 -0.1622 -0.0294 44   LEU B N   
3932 C CA  . LEU B 120 ? 0.9201 0.8850 1.1550 -0.0949 -0.1631 -0.0415 44   LEU B CA  
3933 C C   . LEU B 120 ? 0.9319 0.8804 1.1810 -0.1029 -0.1536 -0.0413 44   LEU B C   
3934 O O   . LEU B 120 ? 0.8929 0.8446 1.1537 -0.1012 -0.1392 -0.0297 44   LEU B O   
3935 C CB  . LEU B 120 ? 0.9201 0.8746 1.1203 -0.0809 -0.1540 -0.0401 44   LEU B CB  
3936 C CG  . LEU B 120 ? 0.9879 0.9531 1.1672 -0.0710 -0.1618 -0.0399 44   LEU B CG  
3937 C CD1 . LEU B 120 ? 0.9815 0.9363 1.1336 -0.0584 -0.1487 -0.0356 44   LEU B CD1 
3938 C CD2 . LEU B 120 ? 1.0577 1.0189 1.2211 -0.0734 -0.1805 -0.0545 44   LEU B CD2 
3939 N N   . ASP B 121 ? 0.9071 0.8373 1.1545 -0.1110 -0.1617 -0.0543 45   ASP B N   
3940 C CA  . ASP B 121 ? 0.9071 0.8182 1.1680 -0.1185 -0.1533 -0.0544 45   ASP B CA  
3941 C C   . ASP B 121 ? 0.9265 0.8178 1.1629 -0.1083 -0.1381 -0.0520 45   ASP B C   
3942 O O   . ASP B 121 ? 0.9211 0.8013 1.1687 -0.1107 -0.1270 -0.0461 45   ASP B O   
3943 C CB  . ASP B 121 ? 0.9704 0.8654 1.2364 -0.1299 -0.1674 -0.0710 45   ASP B CB  
3944 C CG  . ASP B 121 ? 1.1689 1.0838 1.4643 -0.1421 -0.1844 -0.0751 45   ASP B CG  
3945 O OD1 . ASP B 121 ? 1.1791 1.1209 1.4978 -0.1427 -0.1826 -0.0623 45   ASP B OD1 
3946 O OD2 . ASP B 121 ? 1.2705 1.1743 1.5677 -0.1510 -0.1994 -0.0915 45   ASP B OD2 
3947 N N   . ALA B 122 ? 0.8575 0.7455 1.0618 -0.0964 -0.1375 -0.0554 46   ALA B N   
3948 C CA  . ALA B 122 ? 0.8340 0.7066 1.0162 -0.0860 -0.1240 -0.0534 46   ALA B CA  
3949 C C   . ALA B 122 ? 0.8389 0.7226 1.0326 -0.0815 -0.1094 -0.0380 46   ALA B C   
3950 O O   . ALA B 122 ? 0.8263 0.6975 1.0163 -0.0777 -0.0985 -0.0348 46   ALA B O   
3951 C CB  . ALA B 122 ? 0.8484 0.7195 0.9984 -0.0749 -0.1264 -0.0588 46   ALA B CB  
3952 N N   . ILE B 123 ? 0.7727 0.6799 0.9799 -0.0811 -0.1098 -0.0291 47   ILE B N   
3953 C CA  . ILE B 123 ? 0.7440 0.6631 0.9606 -0.0764 -0.0975 -0.0166 47   ILE B CA  
3954 C C   . ILE B 123 ? 0.7933 0.7063 1.0273 -0.0814 -0.0890 -0.0104 47   ILE B C   
3955 O O   . ILE B 123 ? 0.7735 0.6787 0.9987 -0.0749 -0.0790 -0.0067 47   ILE B O   
3956 C CB  . ILE B 123 ? 0.7660 0.7099 0.9968 -0.0761 -0.1005 -0.0097 47   ILE B CB  
3957 C CG1 . ILE B 123 ? 0.7672 0.7164 0.9790 -0.0683 -0.1056 -0.0122 47   ILE B CG1 
3958 C CG2 . ILE B 123 ? 0.7570 0.7123 1.0006 -0.0728 -0.0885 0.0016  47   ILE B CG2 
3959 C CD1 . ILE B 123 ? 0.8520 0.7939 1.0434 -0.0576 -0.0953 -0.0103 47   ILE B CD1 
3960 N N   . PRO B 124 ? 0.7796 0.6955 1.0380 -0.0920 -0.0922 -0.0084 48   PRO B N   
3961 C CA  . PRO B 124 ? 0.7789 0.6878 1.0515 -0.0947 -0.0816 0.0001  48   PRO B CA  
3962 C C   . PRO B 124 ? 0.8542 0.7369 1.1125 -0.0923 -0.0773 -0.0045 48   PRO B C   
3963 O O   . PRO B 124 ? 0.8555 0.7330 1.1162 -0.0886 -0.0663 0.0044  48   PRO B O   
3964 C CB  . PRO B 124 ? 0.8065 0.7215 1.1089 -0.1076 -0.0873 0.0014  48   PRO B CB  
3965 C CG  . PRO B 124 ? 0.8565 0.7920 1.1645 -0.1093 -0.0983 -0.0018 48   PRO B CG  
3966 C CD  . PRO B 124 ? 0.8089 0.7369 1.0860 -0.1016 -0.1048 -0.0120 48   PRO B CD  
3967 N N   . ILE B 125 ? 0.8192 0.6857 1.0610 -0.0927 -0.0856 -0.0180 49   ILE B N   
3968 C CA  . ILE B 125 ? 0.8264 0.6669 1.0534 -0.0889 -0.0812 -0.0236 49   ILE B CA  
3969 C C   . ILE B 125 ? 0.8653 0.7071 1.0726 -0.0754 -0.0717 -0.0192 49   ILE B C   
3970 O O   . ILE B 125 ? 0.8702 0.7044 1.0784 -0.0707 -0.0618 -0.0122 49   ILE B O   
3971 C CB  . ILE B 125 ? 0.8852 0.7081 1.0983 -0.0924 -0.0929 -0.0410 49   ILE B CB  
3972 C CG1 . ILE B 125 ? 0.8983 0.7212 1.1349 -0.1073 -0.1045 -0.0470 49   ILE B CG1 
3973 C CG2 . ILE B 125 ? 0.9085 0.7034 1.1052 -0.0865 -0.0865 -0.0468 49   ILE B CG2 
3974 C CD1 . ILE B 125 ? 0.9685 0.7787 1.1915 -0.1117 -0.1202 -0.0666 49   ILE B CD1 
3975 N N   . LEU B 126 ? 0.8037 0.6564 0.9954 -0.0692 -0.0746 -0.0223 50   LEU B N   
3976 C CA  . LEU B 126 ? 0.7864 0.6425 0.9632 -0.0578 -0.0666 -0.0190 50   LEU B CA  
3977 C C   . LEU B 126 ? 0.8006 0.6698 0.9890 -0.0544 -0.0577 -0.0069 50   LEU B C   
3978 O O   . LEU B 126 ? 0.7900 0.6560 0.9715 -0.0465 -0.0504 -0.0040 50   LEU B O   
3979 C CB  . LEU B 126 ? 0.7845 0.6524 0.9490 -0.0537 -0.0711 -0.0219 50   LEU B CB  
3980 C CG  . LEU B 126 ? 0.8702 0.7249 1.0099 -0.0483 -0.0741 -0.0321 50   LEU B CG  
3981 C CD1 . LEU B 126 ? 0.9090 0.7472 1.0438 -0.0549 -0.0837 -0.0440 50   LEU B CD1 
3982 C CD2 . LEU B 126 ? 0.8818 0.7505 1.0118 -0.0438 -0.0771 -0.0311 50   LEU B CD2 
3983 N N   . TYR B 127 ? 0.7495 0.6339 0.9553 -0.0598 -0.0585 -0.0001 51   TYR B N   
3984 C CA  . TYR B 127 ? 0.7377 0.6349 0.9523 -0.0561 -0.0505 0.0105  51   TYR B CA  
3985 C C   . TYR B 127 ? 0.8001 0.6852 1.0180 -0.0548 -0.0433 0.0166  51   TYR B C   
3986 O O   . TYR B 127 ? 0.7987 0.6892 1.0129 -0.0470 -0.0367 0.0227  51   TYR B O   
3987 C CB  . TYR B 127 ? 0.7433 0.6585 0.9753 -0.0616 -0.0521 0.0161  51   TYR B CB  
3988 C CG  . TYR B 127 ? 0.7405 0.6722 0.9700 -0.0581 -0.0545 0.0151  51   TYR B CG  
3989 C CD1 . TYR B 127 ? 0.7606 0.6908 0.9798 -0.0576 -0.0617 0.0077  51   TYR B CD1 
3990 C CD2 . TYR B 127 ? 0.7342 0.6825 0.9722 -0.0552 -0.0495 0.0220  51   TYR B CD2 
3991 C CE1 . TYR B 127 ? 0.7443 0.6880 0.9625 -0.0538 -0.0628 0.0086  51   TYR B CE1 
3992 C CE2 . TYR B 127 ? 0.7304 0.6915 0.9681 -0.0519 -0.0511 0.0211  51   TYR B CE2 
3993 C CZ  . TYR B 127 ? 0.8059 0.7645 1.0349 -0.0514 -0.0576 0.0151  51   TYR B CZ  
3994 O OH  . TYR B 127 ? 0.8099 0.7797 1.0395 -0.0475 -0.0582 0.0159  51   TYR B OH  
3995 N N   . TYR B 128 ? 0.7696 0.6382 0.9947 -0.0618 -0.0449 0.0148  52   TYR B N   
3996 C CA  . TYR B 128 ? 0.7763 0.6304 1.0051 -0.0598 -0.0371 0.0218  52   TYR B CA  
3997 C C   . TYR B 128 ? 0.8627 0.7010 1.0744 -0.0509 -0.0345 0.0171  52   TYR B C   
3998 O O   . TYR B 128 ? 0.8644 0.6977 1.0753 -0.0440 -0.0269 0.0251  52   TYR B O   
3999 C CB  . TYR B 128 ? 0.7969 0.6368 1.0429 -0.0709 -0.0387 0.0219  52   TYR B CB  
4000 C CG  . TYR B 128 ? 0.7983 0.6523 1.0665 -0.0769 -0.0345 0.0338  52   TYR B CG  
4001 C CD1 . TYR B 128 ? 0.8227 0.6764 1.0964 -0.0722 -0.0230 0.0485  52   TYR B CD1 
4002 C CD2 . TYR B 128 ? 0.7950 0.6623 1.0792 -0.0867 -0.0415 0.0313  52   TYR B CD2 
4003 C CE1 . TYR B 128 ? 0.8170 0.6838 1.1101 -0.0765 -0.0171 0.0608  52   TYR B CE1 
4004 C CE2 . TYR B 128 ? 0.7974 0.6786 1.1044 -0.0917 -0.0361 0.0432  52   TYR B CE2 
4005 C CZ  . TYR B 128 ? 0.8997 0.7801 1.2105 -0.0865 -0.0230 0.0580  52   TYR B CZ  
4006 O OH  . TYR B 128 ? 0.9398 0.8342 1.2719 -0.0902 -0.0155 0.0711  52   TYR B OH  
4007 N N   . ILE B 129 ? 0.8364 0.6682 1.0342 -0.0498 -0.0400 0.0051  53   ILE B N   
4008 C CA  . ILE B 129 ? 0.8447 0.6629 1.0268 -0.0405 -0.0363 0.0004  53   ILE B CA  
4009 C C   . ILE B 129 ? 0.8922 0.7268 1.0708 -0.0303 -0.0307 0.0074  53   ILE B C   
4010 O O   . ILE B 129 ? 0.9028 0.7316 1.0799 -0.0225 -0.0246 0.0122  53   ILE B O   
4011 C CB  . ILE B 129 ? 0.8878 0.6972 1.0540 -0.0407 -0.0425 -0.0133 53   ILE B CB  
4012 C CG1 . ILE B 129 ? 0.9117 0.7044 1.0811 -0.0509 -0.0503 -0.0227 53   ILE B CG1 
4013 C CG2 . ILE B 129 ? 0.8952 0.6930 1.0461 -0.0296 -0.0363 -0.0167 53   ILE B CG2 
4014 C CD1 . ILE B 129 ? 0.9926 0.7778 1.1431 -0.0510 -0.0585 -0.0374 53   ILE B CD1 
4015 N N   . ILE B 130 ? 0.8267 0.6817 1.0060 -0.0305 -0.0332 0.0080  54   ILE B N   
4016 C CA  . ILE B 130 ? 0.8102 0.6817 0.9887 -0.0227 -0.0296 0.0123  54   ILE B CA  
4017 C C   . ILE B 130 ? 0.8754 0.7543 1.0618 -0.0200 -0.0256 0.0227  54   ILE B C   
4018 O O   . ILE B 130 ? 0.8736 0.7594 1.0580 -0.0117 -0.0225 0.0261  54   ILE B O   
4019 C CB  . ILE B 130 ? 0.8296 0.7178 1.0087 -0.0247 -0.0333 0.0096  54   ILE B CB  
4020 C CG1 . ILE B 130 ? 0.8442 0.7254 1.0124 -0.0254 -0.0366 0.0013  54   ILE B CG1 
4021 C CG2 . ILE B 130 ? 0.8145 0.7192 0.9962 -0.0184 -0.0305 0.0126  54   ILE B CG2 
4022 C CD1 . ILE B 130 ? 0.9173 0.7898 1.0743 -0.0171 -0.0318 -0.0024 54   ILE B CD1 
4023 N N   . PHE B 131 ? 0.8327 0.7104 1.0282 -0.0266 -0.0253 0.0280  55   PHE B N   
4024 C CA  . PHE B 131 ? 0.8284 0.7121 1.0294 -0.0234 -0.0199 0.0396  55   PHE B CA  
4025 C C   . PHE B 131 ? 0.8885 0.7589 1.0861 -0.0159 -0.0147 0.0453  55   PHE B C   
4026 O O   . PHE B 131 ? 0.8729 0.7535 1.0667 -0.0068 -0.0119 0.0518  55   PHE B O   
4027 C CB  . PHE B 131 ? 0.8544 0.7378 1.0688 -0.0326 -0.0190 0.0451  55   PHE B CB  
4028 C CG  . PHE B 131 ? 0.8798 0.7649 1.0992 -0.0289 -0.0110 0.0592  55   PHE B CG  
4029 C CD1 . PHE B 131 ? 0.9080 0.8125 1.1247 -0.0228 -0.0078 0.0659  55   PHE B CD1 
4030 C CD2 . PHE B 131 ? 0.9232 0.7895 1.1494 -0.0309 -0.0061 0.0659  55   PHE B CD2 
4031 C CE1 . PHE B 131 ? 0.9268 0.8335 1.1444 -0.0175 0.0005  0.0799  55   PHE B CE1 
4032 C CE2 . PHE B 131 ? 0.9669 0.8346 1.1971 -0.0263 0.0029  0.0812  55   PHE B CE2 
4033 C CZ  . PHE B 131 ? 0.9321 0.8207 1.1567 -0.0192 0.0062  0.0886  55   PHE B CZ  
4034 N N   . VAL B 132 ? 0.8717 0.7193 1.0707 -0.0192 -0.0138 0.0428  56   VAL B N   
4035 C CA  . VAL B 132 ? 0.8895 0.7210 1.0873 -0.0120 -0.0078 0.0491  56   VAL B CA  
4036 C C   . VAL B 132 ? 0.9314 0.7655 1.1191 -0.0008 -0.0076 0.0452  56   VAL B C   
4037 O O   . VAL B 132 ? 0.9318 0.7701 1.1184 0.0093  -0.0037 0.0539  56   VAL B O   
4038 C CB  . VAL B 132 ? 0.9655 0.7692 1.1693 -0.0194 -0.0068 0.0458  56   VAL B CB  
4039 C CG1 . VAL B 132 ? 0.9724 0.7656 1.1692 -0.0247 -0.0135 0.0295  56   VAL B CG1 
4040 C CG2 . VAL B 132 ? 0.9820 0.7670 1.1857 -0.0108 0.0008  0.0537  56   VAL B CG2 
4041 N N   . ILE B 133 ? 0.8762 0.7101 1.0575 -0.0021 -0.0114 0.0333  57   ILE B N   
4042 C CA  . ILE B 133 ? 0.8641 0.7020 1.0394 0.0077  -0.0099 0.0301  57   ILE B CA  
4043 C C   . ILE B 133 ? 0.8767 0.7404 1.0551 0.0138  -0.0110 0.0354  57   ILE B C   
4044 O O   . ILE B 133 ? 0.8704 0.7388 1.0498 0.0238  -0.0086 0.0407  57   ILE B O   
4045 C CB  . ILE B 133 ? 0.9035 0.7374 1.0710 0.0051  -0.0124 0.0179  57   ILE B CB  
4046 C CG1 . ILE B 133 ? 0.9337 0.7404 1.0949 0.0013  -0.0121 0.0104  57   ILE B CG1 
4047 C CG2 . ILE B 133 ? 0.9074 0.7504 1.0727 0.0149  -0.0092 0.0165  57   ILE B CG2 
4048 C CD1 . ILE B 133 ? 1.0625 0.8637 1.2110 -0.0002 -0.0149 -0.0018 57   ILE B CD1 
4049 N N   . GLY B 134 ? 0.8189 0.6983 0.9991 0.0080  -0.0150 0.0337  58   GLY B N   
4050 C CA  . GLY B 134 ? 0.8019 0.7044 0.9844 0.0123  -0.0172 0.0357  58   GLY B CA  
4051 C C   . GLY B 134 ? 0.8549 0.7649 1.0373 0.0187  -0.0157 0.0461  58   GLY B C   
4052 O O   . GLY B 134 ? 0.8452 0.7716 1.0274 0.0262  -0.0179 0.0473  58   GLY B O   
4053 N N   . PHE B 135 ? 0.8147 0.7135 0.9976 0.0158  -0.0120 0.0540  59   PHE B N   
4054 C CA  . PHE B 135 ? 0.8154 0.7202 0.9962 0.0229  -0.0087 0.0664  59   PHE B CA  
4055 C C   . PHE B 135 ? 0.8758 0.7745 1.0545 0.0342  -0.0062 0.0727  59   PHE B C   
4056 O O   . PHE B 135 ? 0.8806 0.7942 1.0550 0.0444  -0.0074 0.0789  59   PHE B O   
4057 C CB  . PHE B 135 ? 0.8463 0.7406 1.0317 0.0161  -0.0035 0.0748  59   PHE B CB  
4058 C CG  . PHE B 135 ? 0.8730 0.7794 1.0546 0.0225  0.0007  0.0876  59   PHE B CG  
4059 C CD1 . PHE B 135 ? 0.9298 0.8306 1.1075 0.0327  0.0062  0.1010  59   PHE B CD1 
4060 C CD2 . PHE B 135 ? 0.8864 0.8091 1.0672 0.0196  0.0001  0.0871  59   PHE B CD2 
4061 C CE1 . PHE B 135 ? 0.9476 0.8601 1.1184 0.0403  0.0108  0.1139  59   PHE B CE1 
4062 C CE2 . PHE B 135 ? 0.9317 0.8657 1.1058 0.0271  0.0051  0.0989  59   PHE B CE2 
4063 C CZ  . PHE B 135 ? 0.9258 0.8548 1.0938 0.0375  0.0104  0.1124  59   PHE B CZ  
4064 N N   . LEU B 136 ? 0.8353 0.7129 1.0164 0.0335  -0.0033 0.0702  60   LEU B N   
4065 C CA  . LEU B 136 ? 0.8456 0.7142 1.0264 0.0448  0.0004  0.0761  60   LEU B CA  
4066 C C   . LEU B 136 ? 0.8914 0.7772 1.0729 0.0536  -0.0037 0.0712  60   LEU B C   
4067 O O   . LEU B 136 ? 0.9018 0.7933 1.0838 0.0657  -0.0028 0.0793  60   LEU B O   
4068 C CB  . LEU B 136 ? 0.8619 0.7009 1.0447 0.0412  0.0051  0.0725  60   LEU B CB  
4069 C CG  . LEU B 136 ? 0.9396 0.7557 1.1265 0.0385  0.0117  0.0823  60   LEU B CG  
4070 C CD1 . LEU B 136 ? 0.9314 0.7522 1.1227 0.0275  0.0114  0.0860  60   LEU B CD1 
4071 C CD2 . LEU B 136 ? 0.9848 0.7710 1.1734 0.0346  0.0146  0.0743  60   LEU B CD2 
4072 N N   . VAL B 137 ? 0.8220 0.7166 1.0054 0.0480  -0.0077 0.0590  61   VAL B N   
4073 C CA  . VAL B 137 ? 0.8010 0.7127 0.9900 0.0551  -0.0106 0.0549  61   VAL B CA  
4074 C C   . VAL B 137 ? 0.8252 0.7636 1.0154 0.0599  -0.0173 0.0577  61   VAL B C   
4075 O O   . VAL B 137 ? 0.8350 0.7881 1.0310 0.0693  -0.0202 0.0593  61   VAL B O   
4076 C CB  . VAL B 137 ? 0.8322 0.7452 1.0244 0.0488  -0.0111 0.0431  61   VAL B CB  
4077 C CG1 . VAL B 137 ? 0.8355 0.7240 1.0235 0.0482  -0.0049 0.0394  61   VAL B CG1 
4078 C CG2 . VAL B 137 ? 0.8187 0.7385 1.0091 0.0379  -0.0151 0.0372  61   VAL B CG2 
4079 N N   . ASN B 138 ? 0.7447 0.6897 0.9295 0.0540  -0.0198 0.0579  62   ASN B N   
4080 C CA  . ASN B 138 ? 0.7256 0.6936 0.9074 0.0591  -0.0261 0.0590  62   ASN B CA  
4081 C C   . ASN B 138 ? 0.7817 0.7506 0.9556 0.0708  -0.0244 0.0730  62   ASN B C   
4082 O O   . ASN B 138 ? 0.7659 0.7551 0.9369 0.0799  -0.0307 0.0745  62   ASN B O   
4083 C CB  . ASN B 138 ? 0.6827 0.6563 0.8605 0.0505  -0.0278 0.0543  62   ASN B CB  
4084 C CG  . ASN B 138 ? 0.9395 0.9197 1.1252 0.0426  -0.0314 0.0415  62   ASN B CG  
4085 O OD1 . ASN B 138 ? 1.0091 1.0064 1.2009 0.0452  -0.0374 0.0349  62   ASN B OD1 
4086 N ND2 . ASN B 138 ? 0.7106 0.6786 0.8971 0.0328  -0.0284 0.0379  62   ASN B ND2 
4087 N N   . ILE B 139 ? 0.7521 0.6989 0.9235 0.0710  -0.0160 0.0832  63   ILE B N   
4088 C CA  . ILE B 139 ? 0.7716 0.7151 0.9369 0.0829  -0.0120 0.0991  63   ILE B CA  
4089 C C   . ILE B 139 ? 0.8338 0.7850 1.0040 0.0955  -0.0151 0.1010  63   ILE B C   
4090 O O   . ILE B 139 ? 0.8378 0.8031 1.0022 0.1084  -0.0182 0.1104  63   ILE B O   
4091 C CB  . ILE B 139 ? 0.8250 0.7399 0.9913 0.0786  -0.0016 0.1088  63   ILE B CB  
4092 C CG1 . ILE B 139 ? 0.8296 0.7425 0.9934 0.0684  0.0017  0.1110  63   ILE B CG1 
4093 C CG2 . ILE B 139 ? 0.8497 0.7567 1.0129 0.0925  0.0042  0.1262  63   ILE B CG2 
4094 C CD1 . ILE B 139 ? 0.9268 0.8601 1.0783 0.0760  0.0014  0.1206  63   ILE B CD1 
4095 N N   . VAL B 140 ? 0.7915 0.7357 0.9722 0.0927  -0.0144 0.0922  64   VAL B N   
4096 C CA  . VAL B 140 ? 0.7994 0.7522 0.9890 0.1040  -0.0163 0.0932  64   VAL B CA  
4097 C C   . VAL B 140 ? 0.8610 0.8473 1.0543 0.1089  -0.0279 0.0884  64   VAL B C   
4098 O O   . VAL B 140 ? 0.8715 0.8724 1.0648 0.1223  -0.0321 0.0966  64   VAL B O   
4099 C CB  . VAL B 140 ? 0.8377 0.7767 1.0368 0.0994  -0.0116 0.0839  64   VAL B CB  
4100 C CG1 . VAL B 140 ? 0.8328 0.7874 1.0451 0.1106  -0.0136 0.0838  64   VAL B CG1 
4101 C CG2 . VAL B 140 ? 0.8498 0.7549 1.0447 0.0970  -0.0016 0.0874  64   VAL B CG2 
4102 N N   . VAL B 141 ? 0.7973 0.7953 0.9936 0.0981  -0.0333 0.0753  65   VAL B N   
4103 C CA  . VAL B 141 ? 0.7769 0.8043 0.9790 0.0994  -0.0449 0.0669  65   VAL B CA  
4104 C C   . VAL B 141 ? 0.8445 0.8881 1.0332 0.1104  -0.0518 0.0747  65   VAL B C   
4105 O O   . VAL B 141 ? 0.8439 0.9102 1.0383 0.1198  -0.0612 0.0739  65   VAL B O   
4106 C CB  . VAL B 141 ? 0.7960 0.8255 0.9996 0.0853  -0.0471 0.0538  65   VAL B CB  
4107 C CG1 . VAL B 141 ? 0.7845 0.8413 0.9945 0.0857  -0.0591 0.0437  65   VAL B CG1 
4108 C CG2 . VAL B 141 ? 0.7792 0.7949 0.9936 0.0763  -0.0408 0.0472  65   VAL B CG2 
4109 N N   . VAL B 142 ? 0.8225 0.8552 0.9941 0.1097  -0.0468 0.0824  66   VAL B N   
4110 C CA  . VAL B 142 ? 0.8399 0.8849 0.9938 0.1205  -0.0504 0.0914  66   VAL B CA  
4111 C C   . VAL B 142 ? 0.9464 0.9913 1.0972 0.1371  -0.0487 0.1079  66   VAL B C   
4112 O O   . VAL B 142 ? 0.9590 1.0269 1.1040 0.1496  -0.0585 0.1103  66   VAL B O   
4113 C CB  . VAL B 142 ? 0.8825 0.9128 1.0227 0.1139  -0.0418 0.0967  66   VAL B CB  
4114 C CG1 . VAL B 142 ? 0.9076 0.9425 1.0284 0.1270  -0.0393 0.1125  66   VAL B CG1 
4115 C CG2 . VAL B 142 ? 0.8572 0.8949 0.9975 0.1021  -0.0458 0.0816  66   VAL B CG2 
4116 N N   . THR B 143 ? 0.9301 0.9492 1.0850 0.1378  -0.0370 0.1187  67   THR B N   
4117 C CA  . THR B 143 ? 0.9593 0.9742 1.1125 0.1540  -0.0334 0.1358  67   THR B CA  
4118 C C   . THR B 143 ? 1.0303 1.0618 1.1999 0.1628  -0.0409 0.1319  67   THR B C   
4119 O O   . THR B 143 ? 1.0434 1.0802 1.2125 0.1789  -0.0414 0.1452  67   THR B O   
4120 C CB  . THR B 143 ? 1.0567 1.0361 1.2120 0.1508  -0.0183 0.1463  67   THR B CB  
4121 O OG1 . THR B 143 ? 1.0641 1.0281 1.2334 0.1389  -0.0150 0.1336  67   THR B OG1 
4122 C CG2 . THR B 143 ? 1.0275 0.9926 1.1707 0.1441  -0.0101 0.1542  67   THR B CG2 
4123 N N   . LEU B 144 ? 0.9868 1.0279 1.1721 0.1530  -0.0463 0.1151  68   LEU B N   
4124 C CA  . LEU B 144 ? 0.9859 1.0444 1.1916 0.1595  -0.0521 0.1109  68   LEU B CA  
4125 C C   . LEU B 144 ? 1.0713 1.1651 1.2766 0.1714  -0.0676 0.1114  68   LEU B C   
4126 O O   . LEU B 144 ? 1.0740 1.1839 1.2943 0.1827  -0.0725 0.1151  68   LEU B O   
4127 C CB  . LEU B 144 ? 0.9594 1.0191 1.1816 0.1449  -0.0524 0.0939  68   LEU B CB  
4128 C CG  . LEU B 144 ? 1.0108 1.0756 1.2563 0.1488  -0.0502 0.0917  68   LEU B CG  
4129 C CD1 . LEU B 144 ? 1.0172 1.0498 1.2612 0.1511  -0.0351 0.0989  68   LEU B CD1 
4130 C CD2 . LEU B 144 ? 1.0389 1.1116 1.2995 0.1356  -0.0520 0.0762  68   LEU B CD2 
4131 N N   . PHE B 145 ? 1.0525 1.1589 1.2406 0.1695  -0.0757 0.1072  69   PHE B N   
4132 C CA  . PHE B 145 ? 1.0736 1.2125 1.2551 0.1812  -0.0918 0.1061  69   PHE B CA  
4133 C C   . PHE B 145 ? 1.1950 1.3344 1.3603 0.2012  -0.0901 0.1274  69   PHE B C   
4134 O O   . PHE B 145 ? 1.1998 1.3657 1.3685 0.2154  -0.1024 0.1306  69   PHE B O   
4135 C CB  . PHE B 145 ? 1.0879 1.2362 1.2523 0.1738  -0.0991 0.0944  69   PHE B CB  
4136 C CG  . PHE B 145 ? 1.0762 1.2248 1.2548 0.1555  -0.1014 0.0743  69   PHE B CG  
4137 C CD1 . PHE B 145 ? 1.1036 1.2780 1.3010 0.1523  -0.1159 0.0583  69   PHE B CD1 
4138 C CD2 . PHE B 145 ? 1.0895 1.2138 1.2623 0.1418  -0.0899 0.0716  69   PHE B CD2 
4139 C CE1 . PHE B 145 ? 1.0938 1.2668 1.3048 0.1359  -0.1169 0.0412  69   PHE B CE1 
4140 C CE2 . PHE B 145 ? 1.1045 1.2292 1.2892 0.1265  -0.0918 0.0547  69   PHE B CE2 
4141 C CZ  . PHE B 145 ? 1.0719 1.2198 1.2753 0.1238  -0.1045 0.0401  69   PHE B CZ  
4142 N N   . CYS B 146 ? 1.1972 1.3076 1.3465 0.2021  -0.0747 0.1426  70   CYS B N   
4143 C CA  . CYS B 146 ? 1.2393 1.3431 1.3731 0.2200  -0.0687 0.1659  70   CYS B CA  
4144 C C   . CYS B 146 ? 1.3263 1.4316 1.4782 0.2333  -0.0680 0.1756  70   CYS B C   
4145 O O   . CYS B 146 ? 1.3420 1.4696 1.4894 0.2516  -0.0773 0.1855  70   CYS B O   
4146 C CB  . CYS B 146 ? 1.2519 1.3207 1.3742 0.2140  -0.0505 0.1780  70   CYS B CB  
4147 S SG  . CYS B 146 ? 1.2955 1.3633 1.3969 0.2017  -0.0488 0.1713  70   CYS B SG  
4148 N N   . CYS B 147 ? 1.2924 1.3735 1.4632 0.2251  -0.0567 0.1731  71   CYS B N   
4149 C CA  . CYS B 147 ? 1.3078 1.3846 1.4966 0.2372  -0.0524 0.1819  71   CYS B CA  
4150 C C   . CYS B 147 ? 1.3636 1.4776 1.5740 0.2427  -0.0679 0.1718  71   CYS B C   
4151 O O   . CYS B 147 ? 1.3788 1.5013 1.6022 0.2585  -0.0684 0.1822  71   CYS B O   
4152 C CB  . CYS B 147 ? 1.3021 1.3429 1.5023 0.2264  -0.0365 0.1786  71   CYS B CB  
4153 S SG  . CYS B 147 ? 1.3138 1.3556 1.5291 0.2039  -0.0382 0.1530  71   CYS B SG  
4154 N N   . GLN B 148 ? 1.2962 1.4320 1.5130 0.2299  -0.0798 0.1523  72   GLN B N   
4155 C CA  . GLN B 148 ? 1.5925 1.7644 1.8339 0.2322  -0.0950 0.1413  72   GLN B CA  
4156 C C   . GLN B 148 ? 1.7372 1.9406 1.9676 0.2321  -0.1143 0.1313  72   GLN B C   
4157 O O   . GLN B 148 ? 1.1744 1.4103 1.4252 0.2329  -0.1297 0.1204  72   GLN B O   
4158 C CB  . GLN B 148 ? 1.5822 1.7493 1.8492 0.2159  -0.0901 0.1254  72   GLN B CB  
4159 C CG  . GLN B 148 ? 1.7549 1.8959 2.0348 0.2181  -0.0730 0.1324  72   GLN B CG  
4160 C CD  . GLN B 148 ? 1.9489 2.0862 2.2502 0.2036  -0.0674 0.1177  72   GLN B CD  
4161 O OE1 . GLN B 148 ? 1.8867 2.0135 2.2037 0.2076  -0.0566 0.1205  72   GLN B OE1 
4162 N NE2 . GLN B 148 ? 1.8142 1.9600 2.1165 0.1876  -0.0739 0.1022  72   GLN B NE2 
4163 N N   . LYS B 153 ? 1.2387 1.6045 1.5579 0.1452  -0.2363 -0.0426 77   LYS B N   
4164 C CA  . LYS B 153 ? 1.2118 1.5645 1.5574 0.1246  -0.2288 -0.0560 77   LYS B CA  
4165 C C   . LYS B 153 ? 1.2466 1.5762 1.5621 0.1167  -0.2232 -0.0651 77   LYS B C   
4166 O O   . LYS B 153 ? 1.2412 1.5490 1.5219 0.1224  -0.2105 -0.0524 77   LYS B O   
4167 C CB  . LYS B 153 ? 1.2250 1.5580 1.5920 0.1188  -0.2072 -0.0419 77   LYS B CB  
4168 C CG  . LYS B 153 ? 1.4729 1.8272 1.8762 0.1252  -0.2092 -0.0335 77   LYS B CG  
4169 C CD  . LYS B 153 ? 1.6216 2.0051 2.0736 0.1151  -0.2230 -0.0499 77   LYS B CD  
4170 C CE  . LYS B 153 ? 1.7626 2.1307 2.2411 0.0954  -0.2111 -0.0590 77   LYS B CE  
4171 N NZ  . LYS B 153 ? 1.8568 2.2033 2.3441 0.0939  -0.1873 -0.0432 77   LYS B NZ  
4172 N N   . VAL B 154 ? 1.1906 1.5252 1.5224 0.1035  -0.2324 -0.0872 78   VAL B N   
4173 C CA  . VAL B 154 ? 1.1811 1.4956 1.4924 0.0947  -0.2279 -0.0991 78   VAL B CA  
4174 C C   . VAL B 154 ? 1.1725 1.4545 1.4846 0.0849  -0.2036 -0.0877 78   VAL B C   
4175 O O   . VAL B 154 ? 1.1640 1.4250 1.4458 0.0850  -0.1936 -0.0844 78   VAL B O   
4176 C CB  . VAL B 154 ? 1.2373 1.5648 1.5750 0.0822  -0.2436 -0.1258 78   VAL B CB  
4177 C CG1 . VAL B 154 ? 1.2358 1.5405 1.5552 0.0734  -0.2373 -0.1381 78   VAL B CG1 
4178 C CG2 . VAL B 154 ? 1.2615 1.6222 1.5968 0.0920  -0.2700 -0.1392 78   VAL B CG2 
4179 N N   . SER B 155 ? 1.0888 1.3683 1.4354 0.0776  -0.1942 -0.0811 79   SER B N   
4180 C CA  . SER B 155 ? 1.0521 1.3036 1.4015 0.0692  -0.1727 -0.0707 79   SER B CA  
4181 C C   . SER B 155 ? 1.0707 1.3028 1.3864 0.0787  -0.1597 -0.0517 79   SER B C   
4182 O O   . SER B 155 ? 1.0573 1.2644 1.3604 0.0724  -0.1455 -0.0472 79   SER B O   
4183 C CB  . SER B 155 ? 1.0799 1.3367 1.4699 0.0634  -0.1662 -0.0663 79   SER B CB  
4184 O OG  . SER B 155 ? 1.1941 1.4669 1.5909 0.0758  -0.1692 -0.0547 79   SER B OG  
4185 N N   . SER B 156 ? 1.0152 1.2592 1.3177 0.0939  -0.1651 -0.0407 80   SER B N   
4186 C CA  . SER B 156 ? 1.0049 1.2315 1.2784 0.1039  -0.1534 -0.0217 80   SER B CA  
4187 C C   . SER B 156 ? 1.0322 1.2457 1.2693 0.1052  -0.1507 -0.0221 80   SER B C   
4188 O O   . SER B 156 ? 1.0361 1.2275 1.2547 0.1065  -0.1366 -0.0086 80   SER B O   
4189 C CB  . SER B 156 ? 1.0604 1.3051 1.3305 0.1209  -0.1611 -0.0102 80   SER B CB  
4190 O OG  . SER B 156 ? 1.1730 1.4294 1.4774 0.1212  -0.1614 -0.0076 80   SER B OG  
4191 N N   . ILE B 157 ? 0.9570 1.1838 1.1851 0.1047  -0.1639 -0.0379 81   ILE B N   
4192 C CA  . ILE B 157 ? 0.9476 1.1645 1.1416 0.1072  -0.1611 -0.0395 81   ILE B CA  
4193 C C   . ILE B 157 ? 0.9367 1.1292 1.1350 0.0927  -0.1470 -0.0423 81   ILE B C   
4194 O O   . ILE B 157 ? 0.9326 1.1081 1.1084 0.0940  -0.1353 -0.0327 81   ILE B O   
4195 C CB  . ILE B 157 ? 1.0108 1.2488 1.1928 0.1120  -0.1797 -0.0577 81   ILE B CB  
4196 C CG1 . ILE B 157 ? 1.0407 1.3081 1.2244 0.1257  -0.1976 -0.0574 81   ILE B CG1 
4197 C CG2 . ILE B 157 ? 1.0333 1.2619 1.1765 0.1177  -0.1750 -0.0577 81   ILE B CG2 
4198 C CD1 . ILE B 157 ? 1.1589 1.4273 1.3188 0.1436  -0.1927 -0.0334 81   ILE B CD1 
4199 N N   . TYR B 158 ? 0.8481 1.0395 1.0770 0.0794  -0.1474 -0.0538 82   TYR B N   
4200 C CA  . TYR B 158 ? 0.8134 0.9829 1.0482 0.0666  -0.1346 -0.0557 82   TYR B CA  
4201 C C   . TYR B 158 ? 0.8234 0.9731 1.0558 0.0656  -0.1185 -0.0379 82   TYR B C   
4202 O O   . TYR B 158 ? 0.8134 0.9445 1.0349 0.0603  -0.1078 -0.0342 82   TYR B O   
4203 C CB  . TYR B 158 ? 0.8138 0.9870 1.0827 0.0540  -0.1379 -0.0699 82   TYR B CB  
4204 C CG  . TYR B 158 ? 0.8536 1.0447 1.1297 0.0529  -0.1546 -0.0901 82   TYR B CG  
4205 C CD1 . TYR B 158 ? 0.8940 1.0792 1.1515 0.0518  -0.1569 -0.1020 82   TYR B CD1 
4206 C CD2 . TYR B 158 ? 0.8669 1.0799 1.1718 0.0519  -0.1677 -0.0987 82   TYR B CD2 
4207 C CE1 . TYR B 158 ? 0.9191 1.1185 1.1821 0.0508  -0.1728 -0.1230 82   TYR B CE1 
4208 C CE2 . TYR B 158 ? 0.8928 1.1219 1.2067 0.0495  -0.1847 -0.1196 82   TYR B CE2 
4209 C CZ  . TYR B 158 ? 0.9829 1.2040 1.2744 0.0490  -0.1874 -0.1324 82   TYR B CZ  
4210 O OH  . TYR B 158 ? 1.0099 1.2447 1.3088 0.0468  -0.2046 -0.1552 82   TYR B OH  
4211 N N   . ILE B 159 ? 0.7639 0.9178 1.0062 0.0713  -0.1174 -0.0274 83   ILE B N   
4212 C CA  . ILE B 159 ? 0.7448 0.8792 0.9840 0.0719  -0.1033 -0.0118 83   ILE B CA  
4213 C C   . ILE B 159 ? 0.7744 0.8955 0.9837 0.0777  -0.0966 -0.0004 83   ILE B C   
4214 O O   . ILE B 159 ? 0.7566 0.8570 0.9604 0.0715  -0.0851 0.0054  83   ILE B O   
4215 C CB  . ILE B 159 ? 0.7881 0.9315 1.0423 0.0801  -0.1043 -0.0034 83   ILE B CB  
4216 C CG1 . ILE B 159 ? 0.7823 0.9422 1.0708 0.0748  -0.1101 -0.0132 83   ILE B CG1 
4217 C CG2 . ILE B 159 ? 0.7918 0.9122 1.0405 0.0815  -0.0897 0.0110  83   ILE B CG2 
4218 C CD1 . ILE B 159 ? 0.8325 0.9792 1.1390 0.0622  -0.1000 -0.0171 83   ILE B CD1 
4219 N N   . PHE B 160 ? 0.7386 0.8727 0.9294 0.0897  -0.1041 0.0032  84   PHE B N   
4220 C CA  . PHE B 160 ? 0.7463 0.8705 0.9097 0.0969  -0.0970 0.0161  84   PHE B CA  
4221 C C   . PHE B 160 ? 0.7896 0.9030 0.9419 0.0887  -0.0910 0.0108  84   PHE B C   
4222 O O   . PHE B 160 ? 0.7865 0.8819 0.9315 0.0856  -0.0790 0.0212  84   PHE B O   
4223 C CB  . PHE B 160 ? 0.7907 0.9342 0.9354 0.1128  -0.1070 0.0200  84   PHE B CB  
4224 C CG  . PHE B 160 ? 0.8311 0.9651 0.9481 0.1218  -0.0979 0.0363  84   PHE B CG  
4225 C CD1 . PHE B 160 ? 0.8784 0.9998 0.9931 0.1283  -0.0883 0.0555  84   PHE B CD1 
4226 C CD2 . PHE B 160 ? 0.8705 1.0078 0.9647 0.1245  -0.0978 0.0329  84   PHE B CD2 
4227 C CE1 . PHE B 160 ? 0.9110 1.0225 1.0036 0.1358  -0.0783 0.0719  84   PHE B CE1 
4228 C CE2 . PHE B 160 ? 0.9262 1.0556 0.9969 0.1331  -0.0873 0.0498  84   PHE B CE2 
4229 C CZ  . PHE B 160 ? 0.9106 1.0272 0.9817 0.1382  -0.0775 0.0697  84   PHE B CZ  
4230 N N   . ASN B 161 ? 0.7262 0.8506 0.8800 0.0849  -0.0995 -0.0058 85   ASN B N   
4231 C CA  . ASN B 161 ? 0.7047 0.8208 0.8498 0.0785  -0.0943 -0.0122 85   ASN B CA  
4232 C C   . ASN B 161 ? 0.7153 0.8128 0.8765 0.0652  -0.0842 -0.0114 85   ASN B C   
4233 O O   . ASN B 161 ? 0.6973 0.7834 0.8501 0.0614  -0.0755 -0.0077 85   ASN B O   
4234 C CB  . ASN B 161 ? 0.6908 0.8209 0.8369 0.0777  -0.1061 -0.0317 85   ASN B CB  
4235 C CG  . ASN B 161 ? 0.9397 1.0870 1.0615 0.0917  -0.1160 -0.0342 85   ASN B CG  
4236 O OD1 . ASN B 161 ? 0.8457 0.9904 0.9414 0.0992  -0.1102 -0.0279 85   ASN B OD1 
4237 N ND2 . ASN B 161 ? 0.8280 0.9945 0.9584 0.0956  -0.1315 -0.0446 85   ASN B ND2 
4238 N N   . LEU B 162 ? 0.6604 0.7562 0.8445 0.0589  -0.0850 -0.0141 86   LEU B N   
4239 C CA  . LEU B 162 ? 0.6333 0.7122 0.8302 0.0480  -0.0757 -0.0125 86   LEU B CA  
4240 C C   . LEU B 162 ? 0.7069 0.7694 0.8942 0.0491  -0.0656 0.0028  86   LEU B C   
4241 O O   . LEU B 162 ? 0.6969 0.7458 0.8821 0.0423  -0.0581 0.0053  86   LEU B O   
4242 C CB  . LEU B 162 ? 0.6131 0.6957 0.8352 0.0431  -0.0780 -0.0182 86   LEU B CB  
4243 C CG  . LEU B 162 ? 0.6500 0.7161 0.8832 0.0337  -0.0684 -0.0160 86   LEU B CG  
4244 C CD1 . LEU B 162 ? 0.6489 0.7075 0.8808 0.0259  -0.0653 -0.0219 86   LEU B CD1 
4245 C CD2 . LEU B 162 ? 0.6415 0.7136 0.8987 0.0311  -0.0692 -0.0198 86   LEU B CD2 
4246 N N   . ALA B 163 ? 0.6829 0.7472 0.8655 0.0581  -0.0659 0.0127  87   ALA B N   
4247 C CA  . ALA B 163 ? 0.6890 0.7364 0.8645 0.0598  -0.0565 0.0269  87   ALA B CA  
4248 C C   . ALA B 163 ? 0.7636 0.8052 0.9224 0.0605  -0.0509 0.0343  87   ALA B C   
4249 O O   . ALA B 163 ? 0.7681 0.7930 0.9272 0.0545  -0.0425 0.0408  87   ALA B O   
4250 C CB  . ALA B 163 ? 0.7117 0.7634 0.8864 0.0711  -0.0583 0.0360  87   ALA B CB  
4251 N N   . VAL B 164 ? 0.7294 0.7856 0.8744 0.0679  -0.0555 0.0327  88   VAL B N   
4252 C CA  . VAL B 164 ? 0.7365 0.7903 0.8653 0.0702  -0.0488 0.0401  88   VAL B CA  
4253 C C   . VAL B 164 ? 0.7775 0.8243 0.9131 0.0586  -0.0445 0.0330  88   VAL B C   
4254 O O   . VAL B 164 ? 0.7882 0.8236 0.9234 0.0542  -0.0355 0.0419  88   VAL B O   
4255 C CB  . VAL B 164 ? 0.8047 0.8767 0.9139 0.0827  -0.0551 0.0383  88   VAL B CB  
4256 C CG1 . VAL B 164 ? 0.8130 0.8842 0.9064 0.0847  -0.0469 0.0433  88   VAL B CG1 
4257 C CG2 . VAL B 164 ? 0.8205 0.8989 0.9205 0.0960  -0.0578 0.0499  88   VAL B CG2 
4258 N N   . ALA B 165 ? 0.7042 0.7575 0.8486 0.0534  -0.0510 0.0176  89   ALA B N   
4259 C CA  . ALA B 165 ? 0.6832 0.7306 0.8353 0.0438  -0.0476 0.0110  89   ALA B CA  
4260 C C   . ALA B 165 ? 0.7223 0.7535 0.8861 0.0344  -0.0415 0.0166  89   ALA B C   
4261 O O   . ALA B 165 ? 0.7223 0.7471 0.8876 0.0288  -0.0359 0.0193  89   ALA B O   
4262 C CB  . ALA B 165 ? 0.6833 0.7385 0.8454 0.0406  -0.0553 -0.0053 89   ALA B CB  
4263 N N   . ASP B 166 ? 0.6633 0.6889 0.8351 0.0336  -0.0429 0.0180  90   ASP B N   
4264 C CA  . ASP B 166 ? 0.6518 0.6614 0.8312 0.0262  -0.0380 0.0217  90   ASP B CA  
4265 C C   . ASP B 166 ? 0.7332 0.7313 0.9064 0.0263  -0.0314 0.0339  90   ASP B C   
4266 O O   . ASP B 166 ? 0.7280 0.7162 0.9050 0.0186  -0.0276 0.0356  90   ASP B O   
4267 C CB  . ASP B 166 ? 0.6615 0.6684 0.8491 0.0275  -0.0399 0.0198  90   ASP B CB  
4268 C CG  . ASP B 166 ? 0.7094 0.7245 0.9094 0.0246  -0.0442 0.0089  90   ASP B CG  
4269 O OD1 . ASP B 166 ? 0.6757 0.6894 0.8801 0.0180  -0.0434 0.0033  90   ASP B OD1 
4270 O OD2 . ASP B 166 ? 0.7926 0.8145 1.0006 0.0287  -0.0473 0.0072  90   ASP B OD2 
4271 N N   . LEU B 167 ? 0.7212 0.7214 0.8863 0.0351  -0.0303 0.0428  91   LEU B N   
4272 C CA  . LEU B 167 ? 0.7443 0.7325 0.9057 0.0362  -0.0230 0.0563  91   LEU B CA  
4273 C C   . LEU B 167 ? 0.8225 0.8119 0.9818 0.0324  -0.0173 0.0612  91   LEU B C   
4274 O O   . LEU B 167 ? 0.8357 0.8124 1.0017 0.0257  -0.0117 0.0678  91   LEU B O   
4275 C CB  . LEU B 167 ? 0.7613 0.7548 0.9133 0.0491  -0.0233 0.0654  91   LEU B CB  
4276 C CG  . LEU B 167 ? 0.8330 0.8110 0.9840 0.0523  -0.0158 0.0802  91   LEU B CG  
4277 C CD1 . LEU B 167 ? 0.8301 0.7887 0.9921 0.0451  -0.0140 0.0776  91   LEU B CD1 
4278 C CD2 . LEU B 167 ? 0.8603 0.8465 1.0023 0.0669  -0.0178 0.0883  91   LEU B CD2 
4279 N N   . LEU B 168 ? 0.7746 0.7792 0.9266 0.0362  -0.0190 0.0569  92   LEU B N   
4280 C CA  . LEU B 168 ? 0.7753 0.7834 0.9263 0.0339  -0.0128 0.0609  92   LEU B CA  
4281 C C   . LEU B 168 ? 0.8208 0.8251 0.9853 0.0224  -0.0135 0.0532  92   LEU B C   
4282 O O   . LEU B 168 ? 0.8181 0.8209 0.9890 0.0175  -0.0075 0.0591  92   LEU B O   
4283 C CB  . LEU B 168 ? 0.7828 0.8075 0.9190 0.0436  -0.0140 0.0573  92   LEU B CB  
4284 C CG  . LEU B 168 ? 0.8564 0.8882 0.9747 0.0572  -0.0130 0.0666  92   LEU B CG  
4285 C CD1 . LEU B 168 ? 0.8652 0.9135 0.9668 0.0664  -0.0170 0.0583  92   LEU B CD1 
4286 C CD2 . LEU B 168 ? 0.8858 0.9103 1.0023 0.0591  -0.0008 0.0858  92   LEU B CD2 
4287 N N   . LEU B 169 ? 0.7670 0.7711 0.9370 0.0187  -0.0203 0.0412  93   LEU B N   
4288 C CA  . LEU B 169 ? 0.7516 0.7520 0.9327 0.0095  -0.0214 0.0348  93   LEU B CA  
4289 C C   . LEU B 169 ? 0.8066 0.7927 0.9954 0.0016  -0.0196 0.0399  93   LEU B C   
4290 O O   . LEU B 169 ? 0.8012 0.7862 0.9982 -0.0052 -0.0181 0.0410  93   LEU B O   
4291 C CB  . LEU B 169 ? 0.7423 0.7448 0.9270 0.0087  -0.0276 0.0229  93   LEU B CB  
4292 C CG  . LEU B 169 ? 0.7886 0.7874 0.9830 0.0011  -0.0285 0.0173  93   LEU B CG  
4293 C CD1 . LEU B 169 ? 0.7851 0.7913 0.9818 0.0006  -0.0262 0.0161  93   LEU B CD1 
4294 C CD2 . LEU B 169 ? 0.8148 0.8144 1.0140 0.0010  -0.0325 0.0085  93   LEU B CD2 
4295 N N   . LEU B 170 ? 0.7665 0.7422 0.9534 0.0029  -0.0201 0.0423  94   LEU B N   
4296 C CA  . LEU B 170 ? 0.7650 0.7243 0.9572 -0.0036 -0.0189 0.0451  94   LEU B CA  
4297 C C   . LEU B 170 ? 0.8610 0.8158 1.0576 -0.0062 -0.0129 0.0563  94   LEU B C   
4298 O O   . LEU B 170 ? 0.8748 0.8186 1.0803 -0.0146 -0.0128 0.0570  94   LEU B O   
4299 C CB  . LEU B 170 ? 0.7615 0.7105 0.9497 0.0007  -0.0198 0.0444  94   LEU B CB  
4300 C CG  . LEU B 170 ? 0.7920 0.7435 0.9800 0.0020  -0.0241 0.0347  94   LEU B CG  
4301 C CD1 . LEU B 170 ? 0.7927 0.7407 0.9781 0.0095  -0.0237 0.0362  94   LEU B CD1 
4302 C CD2 . LEU B 170 ? 0.8066 0.7488 0.9975 -0.0057 -0.0257 0.0284  94   LEU B CD2 
4303 N N   . ALA B 171 ? 0.8293 0.7935 1.0203 0.0011  -0.0079 0.0649  95   ALA B N   
4304 C CA  . ALA B 171 ? 0.8353 0.7972 1.0314 0.0001  0.0004  0.0782  95   ALA B CA  
4305 C C   . ALA B 171 ? 0.8675 0.8367 1.0762 -0.0078 0.0026  0.0787  95   ALA B C   
4306 O O   . ALA B 171 ? 0.8796 0.8471 1.0984 -0.0112 0.0098  0.0896  95   ALA B O   
4307 C CB  . ALA B 171 ? 0.8543 0.8260 1.0369 0.0125  0.0055  0.0874  95   ALA B CB  
4308 N N   . THR B 172 ? 0.7829 0.7605 0.9934 -0.0106 -0.0030 0.0680  96   THR B N   
4309 C CA  . THR B 172 ? 0.7656 0.7518 0.9894 -0.0169 -0.0016 0.0684  96   THR B CA  
4310 C C   . THR B 172 ? 0.8138 0.7907 1.0510 -0.0284 -0.0078 0.0636  96   THR B C   
4311 O O   . THR B 172 ? 0.7999 0.7834 1.0522 -0.0348 -0.0075 0.0658  96   THR B O   
4312 C CB  . THR B 172 ? 0.7891 0.7890 1.0078 -0.0122 -0.0035 0.0606  96   THR B CB  
4313 O OG1 . THR B 172 ? 0.7411 0.7367 0.9560 -0.0134 -0.0115 0.0491  96   THR B OG1 
4314 C CG2 . THR B 172 ? 0.7825 0.7924 0.9864 -0.0007 0.0014  0.0630  96   THR B CG2 
4315 N N   . LEU B 173 ? 0.7737 0.7365 1.0052 -0.0302 -0.0135 0.0570  97   LEU B N   
4316 C CA  . LEU B 173 ? 0.7661 0.7186 1.0046 -0.0394 -0.0203 0.0506  97   LEU B CA  
4317 C C   . LEU B 173 ? 0.8059 0.7530 1.0620 -0.0489 -0.0189 0.0567  97   LEU B C   
4318 O O   . LEU B 173 ? 0.7987 0.7490 1.0659 -0.0568 -0.0251 0.0523  97   LEU B O   
4319 C CB  . LEU B 173 ? 0.7732 0.7098 1.0001 -0.0375 -0.0238 0.0440  97   LEU B CB  
4320 C CG  . LEU B 173 ? 0.8269 0.7678 1.0427 -0.0320 -0.0273 0.0357  97   LEU B CG  
4321 C CD1 . LEU B 173 ? 0.8421 0.7695 1.0482 -0.0281 -0.0277 0.0320  97   LEU B CD1 
4322 C CD2 . LEU B 173 ? 0.8413 0.7862 1.0599 -0.0368 -0.0331 0.0291  97   LEU B CD2 
4323 N N   . PRO B 174 ? 0.7574 0.6978 1.0188 -0.0486 -0.0110 0.0674  98   PRO B N   
4324 C CA  . PRO B 174 ? 0.7602 0.6956 1.0436 -0.0593 -0.0094 0.0731  98   PRO B CA  
4325 C C   . PRO B 174 ? 0.7966 0.7517 1.0980 -0.0641 -0.0088 0.0766  98   PRO B C   
4326 O O   . PRO B 174 ? 0.7909 0.7458 1.1126 -0.0752 -0.0135 0.0750  98   PRO B O   
4327 C CB  . PRO B 174 ? 0.7932 0.7209 1.0775 -0.0550 0.0019  0.0870  98   PRO B CB  
4328 C CG  . PRO B 174 ? 0.8492 0.7708 1.1106 -0.0436 0.0021  0.0848  98   PRO B CG  
4329 C CD  . PRO B 174 ? 0.7784 0.7151 1.0275 -0.0385 -0.0036 0.0754  98   PRO B CD  
4330 N N   . LEU B 175 ? 0.7395 0.7121 1.0340 -0.0555 -0.0037 0.0801  99   LEU B N   
4331 C CA  . LEU B 175 ? 0.7267 0.7189 1.0369 -0.0573 -0.0014 0.0836  99   LEU B CA  
4332 C C   . LEU B 175 ? 0.7560 0.7539 1.0716 -0.0625 -0.0131 0.0726  99   LEU B C   
4333 O O   . LEU B 175 ? 0.7558 0.7633 1.0938 -0.0704 -0.0158 0.0746  99   LEU B O   
4334 C CB  . LEU B 175 ? 0.7256 0.7319 1.0227 -0.0450 0.0069  0.0877  99   LEU B CB  
4335 C CG  . LEU B 175 ? 0.8121 0.8186 1.1015 -0.0370 0.0195  0.1004  99   LEU B CG  
4336 C CD1 . LEU B 175 ? 0.8145 0.8338 1.0854 -0.0241 0.0241  0.0992  99   LEU B CD1 
4337 C CD2 . LEU B 175 ? 0.8777 0.8894 1.1913 -0.0427 0.0296  0.1149  99   LEU B CD2 
4338 N N   . TRP B 176 ? 0.6987 0.6921 0.9951 -0.0577 -0.0198 0.0621  100  TRP B N   
4339 C CA  . TRP B 176 ? 0.6908 0.6894 0.9888 -0.0603 -0.0297 0.0535  100  TRP B CA  
4340 C C   . TRP B 176 ? 0.7626 0.7512 1.0682 -0.0705 -0.0398 0.0478  100  TRP B C   
4341 O O   . TRP B 176 ? 0.7730 0.7707 1.0891 -0.0750 -0.0479 0.0445  100  TRP B O   
4342 C CB  . TRP B 176 ? 0.6624 0.6576 0.9392 -0.0523 -0.0322 0.0454  100  TRP B CB  
4343 C CG  . TRP B 176 ? 0.6655 0.6665 0.9318 -0.0425 -0.0242 0.0476  100  TRP B CG  
4344 C CD1 . TRP B 176 ? 0.7034 0.6967 0.9531 -0.0364 -0.0228 0.0445  100  TRP B CD1 
4345 C CD2 . TRP B 176 ? 0.6582 0.6738 0.9305 -0.0377 -0.0164 0.0537  100  TRP B CD2 
4346 N NE1 . TRP B 176 ? 0.6947 0.6974 0.9385 -0.0283 -0.0167 0.0465  100  TRP B NE1 
4347 C CE2 . TRP B 176 ? 0.7091 0.7244 0.9648 -0.0285 -0.0119 0.0521  100  TRP B CE2 
4348 C CE3 . TRP B 176 ? 0.6682 0.6981 0.9586 -0.0396 -0.0126 0.0600  100  TRP B CE3 
4349 C CZ2 . TRP B 176 ? 0.6970 0.7241 0.9500 -0.0208 -0.0042 0.0552  100  TRP B CZ2 
4350 C CZ3 . TRP B 176 ? 0.6856 0.7272 0.9746 -0.0315 -0.0032 0.0645  100  TRP B CZ3 
4351 C CH2 . TRP B 176 ? 0.6957 0.7350 0.9644 -0.0220 0.0008  0.0614  100  TRP B CH2 
4352 N N   . ALA B 177 ? 0.7158 0.6859 1.0166 -0.0737 -0.0398 0.0464  101  ALA B N   
4353 C CA  . ALA B 177 ? 0.7182 0.6758 1.0255 -0.0836 -0.0493 0.0392  101  ALA B CA  
4354 C C   . ALA B 177 ? 0.7565 0.7228 1.0943 -0.0945 -0.0503 0.0447  101  ALA B C   
4355 O O   . ALA B 177 ? 0.7615 0.7299 1.1101 -0.1028 -0.0620 0.0375  101  ALA B O   
4356 C CB  . ALA B 177 ? 0.7416 0.6756 1.0367 -0.0829 -0.0469 0.0367  101  ALA B CB  
4357 N N   . THR B 178 ? 0.7009 0.6741 1.0530 -0.0939 -0.0380 0.0580  102  THR B N   
4358 C CA  . THR B 178 ? 0.7041 0.6877 1.0894 -0.1037 -0.0355 0.0663  102  THR B CA  
4359 C C   . THR B 178 ? 0.7330 0.7423 1.1330 -0.1038 -0.0396 0.0670  102  THR B C   
4360 O O   . THR B 178 ? 0.7316 0.7496 1.1561 -0.1141 -0.0485 0.0646  102  THR B O   
4361 C CB  . THR B 178 ? 0.8290 0.8122 1.2210 -0.1001 -0.0185 0.0823  102  THR B CB  
4362 O OG1 . THR B 178 ? 0.8830 0.8420 1.2621 -0.0992 -0.0155 0.0821  102  THR B OG1 
4363 C CG2 . THR B 178 ? 0.8031 0.7973 1.2321 -0.1101 -0.0130 0.0932  102  THR B CG2 
4364 N N   . TYR B 179 ? 0.6737 0.6948 1.0592 -0.0922 -0.0339 0.0695  103  TYR B N   
4365 C CA  . TYR B 179 ? 0.6539 0.6976 1.0501 -0.0892 -0.0359 0.0706  103  TYR B CA  
4366 C C   . TYR B 179 ? 0.6855 0.7309 1.0813 -0.0937 -0.0529 0.0592  103  TYR B C   
4367 O O   . TYR B 179 ? 0.6779 0.7415 1.0969 -0.0980 -0.0588 0.0608  103  TYR B O   
4368 C CB  . TYR B 179 ? 0.6596 0.7081 1.0346 -0.0752 -0.0272 0.0720  103  TYR B CB  
4369 C CG  . TYR B 179 ? 0.6740 0.7418 1.0561 -0.0697 -0.0278 0.0724  103  TYR B CG  
4370 C CD1 . TYR B 179 ? 0.7023 0.7903 1.1108 -0.0703 -0.0210 0.0821  103  TYR B CD1 
4371 C CD2 . TYR B 179 ? 0.6752 0.7407 1.0376 -0.0620 -0.0320 0.0647  103  TYR B CD2 
4372 C CE1 . TYR B 179 ? 0.7034 0.8085 1.1185 -0.0635 -0.0201 0.0830  103  TYR B CE1 
4373 C CE2 . TYR B 179 ? 0.6781 0.7589 1.0470 -0.0556 -0.0309 0.0659  103  TYR B CE2 
4374 C CZ  . TYR B 179 ? 0.7439 0.8443 1.1386 -0.0560 -0.0252 0.0747  103  TYR B CZ  
4375 O OH  . TYR B 179 ? 0.7301 0.8450 1.1319 -0.0485 -0.0235 0.0761  103  TYR B OH  
4376 N N   . TYR B 180 ? 0.6296 0.6570 1.0001 -0.0922 -0.0607 0.0485  104  TYR B N   
4377 C CA  . TYR B 180 ? 0.6263 0.6532 0.9905 -0.0948 -0.0762 0.0380  104  TYR B CA  
4378 C C   . TYR B 180 ? 0.7158 0.7413 1.1009 -0.1083 -0.0877 0.0332  104  TYR B C   
4379 O O   . TYR B 180 ? 0.7170 0.7547 1.1110 -0.1117 -0.1009 0.0283  104  TYR B O   
4380 C CB  . TYR B 180 ? 0.6302 0.6376 0.9614 -0.0886 -0.0784 0.0291  104  TYR B CB  
4381 C CG  . TYR B 180 ? 0.6403 0.6465 0.9589 -0.0884 -0.0924 0.0193  104  TYR B CG  
4382 C CD1 . TYR B 180 ? 0.6514 0.6679 0.9603 -0.0798 -0.0939 0.0201  104  TYR B CD1 
4383 C CD2 . TYR B 180 ? 0.6614 0.6543 0.9754 -0.0957 -0.1035 0.0093  104  TYR B CD2 
4384 C CE1 . TYR B 180 ? 0.6511 0.6662 0.9454 -0.0778 -0.1055 0.0130  104  TYR B CE1 
4385 C CE2 . TYR B 180 ? 0.6764 0.6684 0.9744 -0.0937 -0.1163 0.0002  104  TYR B CE2 
4386 C CZ  . TYR B 180 ? 0.7277 0.7312 1.0148 -0.0843 -0.1169 0.0030  104  TYR B CZ  
4387 O OH  . TYR B 180 ? 0.7391 0.7418 1.0081 -0.0808 -0.1285 -0.0040 104  TYR B OH  
4388 N N   . SER B 181 ? 0.6965 0.7068 1.0899 -0.1157 -0.0830 0.0345  105  SER B N   
4389 C CA  . SER B 181 ? 0.7181 0.7229 1.1340 -0.1300 -0.0928 0.0290  105  SER B CA  
4390 C C   . SER B 181 ? 0.7853 0.8157 1.2410 -0.1383 -0.0956 0.0360  105  SER B C   
4391 O O   . SER B 181 ? 0.7891 0.8249 1.2617 -0.1484 -0.1112 0.0275  105  SER B O   
4392 C CB  . SER B 181 ? 0.7788 0.7613 1.1977 -0.1347 -0.0834 0.0322  105  SER B CB  
4393 O OG  . SER B 181 ? 0.9399 0.8986 1.3256 -0.1279 -0.0825 0.0247  105  SER B OG  
4394 N N   . TYR B 182 ? 0.7494 0.7965 1.2201 -0.1336 -0.0808 0.0509  106  TYR B N   
4395 C CA  . TYR B 182 ? 0.7516 0.8255 1.2622 -0.1397 -0.0802 0.0598  106  TYR B CA  
4396 C C   . TYR B 182 ? 0.7926 0.8901 1.3026 -0.1321 -0.0877 0.0587  106  TYR B C   
4397 O O   . TYR B 182 ? 0.7828 0.9049 1.3199 -0.1310 -0.0820 0.0690  106  TYR B O   
4398 C CB  . TYR B 182 ? 0.7682 0.8485 1.2943 -0.1368 -0.0588 0.0771  106  TYR B CB  
4399 C CG  . TYR B 182 ? 0.8251 0.8866 1.3633 -0.1459 -0.0511 0.0819  106  TYR B CG  
4400 C CD1 . TYR B 182 ? 0.8747 0.9426 1.4556 -0.1612 -0.0535 0.0855  106  TYR B CD1 
4401 C CD2 . TYR B 182 ? 0.8391 0.8772 1.3490 -0.1390 -0.0408 0.0839  106  TYR B CD2 
4402 C CE1 . TYR B 182 ? 0.9169 0.9653 1.5112 -0.1697 -0.0452 0.0910  106  TYR B CE1 
4403 C CE2 . TYR B 182 ? 0.8719 0.8914 1.3930 -0.1461 -0.0329 0.0899  106  TYR B CE2 
4404 C CZ  . TYR B 182 ? 1.0259 1.0495 1.5892 -0.1615 -0.0345 0.0937  106  TYR B CZ  
4405 O OH  . TYR B 182 ? 1.0936 1.0968 1.6701 -0.1686 -0.0254 0.1006  106  TYR B OH  
4406 N N   . ARG B 183 ? 0.7410 0.8308 1.2214 -0.1266 -0.1001 0.0470  107  ARG B N   
4407 C CA  . ARG B 183 ? 0.7195 0.8267 1.1939 -0.1183 -0.1083 0.0455  107  ARG B CA  
4408 C C   . ARG B 183 ? 0.7726 0.8951 1.2507 -0.1067 -0.0926 0.0578  107  ARG B C   
4409 O O   . ARG B 183 ? 0.7707 0.9177 1.2716 -0.1044 -0.0941 0.0638  107  ARG B O   
4410 C CB  . ARG B 183 ? 0.6738 0.8017 1.1769 -0.1271 -0.1263 0.0419  107  ARG B CB  
4411 C CG  . ARG B 183 ? 0.7289 0.8440 1.2168 -0.1335 -0.1466 0.0258  107  ARG B CG  
4412 C CD  . ARG B 183 ? 0.7997 0.8892 1.2854 -0.1446 -0.1472 0.0177  107  ARG B CD  
4413 N NE  . ARG B 183 ? 0.8360 0.9142 1.3061 -0.1497 -0.1673 0.0006  107  ARG B NE  
4414 C CZ  . ARG B 183 ? 0.9642 1.0168 1.4265 -0.1580 -0.1710 -0.0104 107  ARG B CZ  
4415 N NH1 . ARG B 183 ? 0.6810 0.7164 1.1498 -0.1618 -0.1556 -0.0045 107  ARG B NH1 
4416 N NH2 . ARG B 183 ? 0.8764 0.9195 1.3220 -0.1611 -0.1897 -0.0273 107  ARG B NH2 
4417 N N   . TYR B 184 ? 0.7373 0.8448 1.1920 -0.0988 -0.0781 0.0604  108  TYR B N   
4418 C CA  . TYR B 184 ? 0.7257 0.8407 1.1746 -0.0867 -0.0628 0.0685  108  TYR B CA  
4419 C C   . TYR B 184 ? 0.7802 0.9158 1.2628 -0.0885 -0.0512 0.0814  108  TYR B C   
4420 O O   . TYR B 184 ? 0.7604 0.9140 1.2528 -0.0802 -0.0450 0.0874  108  TYR B O   
4421 C CB  . TYR B 184 ? 0.7308 0.8532 1.1674 -0.0763 -0.0673 0.0657  108  TYR B CB  
4422 C CG  . TYR B 184 ? 0.7531 0.8556 1.1566 -0.0732 -0.0750 0.0555  108  TYR B CG  
4423 C CD1 . TYR B 184 ? 0.7717 0.8574 1.1488 -0.0662 -0.0658 0.0531  108  TYR B CD1 
4424 C CD2 . TYR B 184 ? 0.7690 0.8707 1.1677 -0.0767 -0.0913 0.0483  108  TYR B CD2 
4425 C CE1 . TYR B 184 ? 0.7864 0.8553 1.1366 -0.0634 -0.0713 0.0449  108  TYR B CE1 
4426 C CE2 . TYR B 184 ? 0.7835 0.8672 1.1511 -0.0727 -0.0962 0.0401  108  TYR B CE2 
4427 C CZ  . TYR B 184 ? 0.8725 0.9401 1.2176 -0.0663 -0.0854 0.0391  108  TYR B CZ  
4428 O OH  . TYR B 184 ? 0.9019 0.9537 1.2198 -0.0622 -0.0887 0.0323  108  TYR B OH  
4429 N N   . ASP B 185 ? 0.7543 0.8851 1.2534 -0.0982 -0.0462 0.0863  109  ASP B N   
4430 C CA  . ASP B 185 ? 0.7566 0.9043 1.2867 -0.0999 -0.0321 0.1004  109  ASP B CA  
4431 C C   . ASP B 185 ? 0.8382 0.9718 1.3502 -0.0941 -0.0146 0.1074  109  ASP B C   
4432 O O   . ASP B 185 ? 0.8488 0.9643 1.3572 -0.1010 -0.0138 0.1074  109  ASP B O   
4433 C CB  . ASP B 185 ? 0.7871 0.9437 1.3576 -0.1163 -0.0396 0.1028  109  ASP B CB  
4434 C CG  . ASP B 185 ? 0.8801 1.0609 1.4913 -0.1185 -0.0259 0.1186  109  ASP B CG  
4435 O OD1 . ASP B 185 ? 0.8609 1.0564 1.4703 -0.1059 -0.0128 0.1268  109  ASP B OD1 
4436 O OD2 . ASP B 185 ? 0.9757 1.1622 1.6230 -0.1328 -0.0293 0.1220  109  ASP B OD2 
4437 N N   . TRP B 186 ? 0.8014 0.9418 1.2991 -0.0803 -0.0014 0.1124  110  TRP B N   
4438 C CA  . TRP B 186 ? 0.8112 0.9413 1.2875 -0.0718 0.0143  0.1186  110  TRP B CA  
4439 C C   . TRP B 186 ? 0.8974 1.0360 1.4012 -0.0765 0.0288  0.1346  110  TRP B C   
4440 O O   . TRP B 186 ? 0.8886 1.0492 1.4169 -0.0740 0.0383  0.1445  110  TRP B O   
4441 C CB  . TRP B 186 ? 0.7850 0.9210 1.2391 -0.0558 0.0225  0.1170  110  TRP B CB  
4442 C CG  . TRP B 186 ? 0.8010 0.9259 1.2264 -0.0459 0.0348  0.1198  110  TRP B CG  
4443 C CD1 . TRP B 186 ? 0.8471 0.9803 1.2733 -0.0382 0.0525  0.1321  110  TRP B CD1 
4444 C CD2 . TRP B 186 ? 0.7972 0.9019 1.1895 -0.0423 0.0299  0.1108  110  TRP B CD2 
4445 N NE1 . TRP B 186 ? 0.8474 0.9672 1.2405 -0.0293 0.0576  0.1305  110  TRP B NE1 
4446 C CE2 . TRP B 186 ? 0.8585 0.9613 1.2323 -0.0321 0.0436  0.1175  110  TRP B CE2 
4447 C CE3 . TRP B 186 ? 0.8043 0.8935 1.1809 -0.0460 0.0156  0.0982  110  TRP B CE3 
4448 C CZ2 . TRP B 186 ? 0.8530 0.9403 1.1954 -0.0261 0.0418  0.1115  110  TRP B CZ2 
4449 C CZ3 . TRP B 186 ? 0.8252 0.8990 1.1727 -0.0402 0.0156  0.0929  110  TRP B CZ3 
4450 C CH2 . TRP B 186 ? 0.8442 0.9177 1.1759 -0.0307 0.0277  0.0992  110  TRP B CH2 
4451 N N   . LEU B 187 ? 0.8962 1.0172 1.3985 -0.0835 0.0308  0.1379  111  LEU B N   
4452 C CA  . LEU B 187 ? 0.9221 1.0466 1.4512 -0.0893 0.0451  0.1544  111  LEU B CA  
4453 C C   . LEU B 187 ? 1.0078 1.1212 1.5091 -0.0773 0.0622  0.1644  111  LEU B C   
4454 O O   . LEU B 187 ? 1.0220 1.1230 1.5302 -0.0822 0.0697  0.1742  111  LEU B O   
4455 C CB  . LEU B 187 ? 0.9325 1.0433 1.4847 -0.1072 0.0340  0.1509  111  LEU B CB  
4456 C CG  . LEU B 187 ? 0.9873 1.1087 1.5674 -0.1202 0.0148  0.1403  111  LEU B CG  
4457 C CD1 . LEU B 187 ? 0.9990 1.0999 1.5884 -0.1354 0.0021  0.1318  111  LEU B CD1 
4458 C CD2 . LEU B 187 ? 1.0246 1.1758 1.6494 -0.1247 0.0208  0.1517  111  LEU B CD2 
4459 N N   . PHE B 188 ? 0.9639 1.0817 1.4340 -0.0612 0.0680  0.1619  112  PHE B N   
4460 C CA  . PHE B 188 ? 0.9730 1.0827 1.4118 -0.0478 0.0815  0.1690  112  PHE B CA  
4461 C C   . PHE B 188 ? 1.0321 1.1603 1.4617 -0.0323 0.0969  0.1758  112  PHE B C   
4462 O O   . PHE B 188 ? 1.0416 1.1659 1.4413 -0.0190 0.1072  0.1801  112  PHE B O   
4463 C CB  . PHE B 188 ? 0.9904 1.0814 1.3912 -0.0425 0.0698  0.1543  112  PHE B CB  
4464 C CG  . PHE B 188 ? 1.0116 1.0821 1.4146 -0.0544 0.0567  0.1472  112  PHE B CG  
4465 C CD1 . PHE B 188 ? 1.0727 1.1262 1.4700 -0.0553 0.0623  0.1553  112  PHE B CD1 
4466 C CD2 . PHE B 188 ? 1.0229 1.0901 1.4307 -0.0628 0.0392  0.1322  112  PHE B CD2 
4467 C CE1 . PHE B 188 ? 1.0842 1.1170 1.4827 -0.0651 0.0510  0.1476  112  PHE B CE1 
4468 C CE2 . PHE B 188 ? 1.0615 1.1090 1.4682 -0.0723 0.0278  0.1245  112  PHE B CE2 
4469 C CZ  . PHE B 188 ? 1.0541 1.0841 1.4567 -0.0735 0.0339  0.1316  112  PHE B CZ  
4470 N N   . GLY B 189 ? 0.9813 1.1296 1.4357 -0.0334 0.0980  0.1763  113  GLY B N   
4471 C CA  . GLY B 189 ? 0.9866 1.1523 1.4348 -0.0186 0.1129  0.1816  113  GLY B CA  
4472 C C   . GLY B 189 ? 1.0380 1.2011 1.4553 -0.0073 0.1054  0.1649  113  GLY B C   
4473 O O   . GLY B 189 ? 1.0290 1.1748 1.4190 -0.0069 0.0936  0.1524  113  GLY B O   
4474 N N   . PRO B 190 ? 1.0010 1.1806 1.4226 0.0028  0.1132  0.1645  114  PRO B N   
4475 C CA  . PRO B 190 ? 0.9918 1.1669 1.3874 0.0127  0.1061  0.1478  114  PRO B CA  
4476 C C   . PRO B 190 ? 1.0345 1.1974 1.3861 0.0260  0.1101  0.1411  114  PRO B C   
4477 O O   . PRO B 190 ? 1.0236 1.1785 1.3539 0.0315  0.1014  0.1253  114  PRO B O   
4478 C CB  . PRO B 190 ? 1.0199 1.2156 1.4342 0.0212  0.1171  0.1520  114  PRO B CB  
4479 C CG  . PRO B 190 ? 1.0762 1.2890 1.5345 0.0109  0.1232  0.1684  114  PRO B CG  
4480 C CD  . PRO B 190 ? 1.0273 1.2303 1.4820 0.0046  0.1283  0.1789  114  PRO B CD  
4481 N N   . VAL B 191 ? 0.9951 1.1568 1.3340 0.0313  0.1228  0.1532  115  VAL B N   
4482 C CA  . VAL B 191 ? 1.0015 1.1540 1.2979 0.0448  0.1257  0.1479  115  VAL B CA  
4483 C C   . VAL B 191 ? 1.0270 1.1606 1.3069 0.0378  0.1079  0.1364  115  VAL B C   
4484 O O   . VAL B 191 ? 1.0280 1.1544 1.2807 0.0449  0.1000  0.1213  115  VAL B O   
4485 C CB  . VAL B 191 ? 1.0724 1.2304 1.3596 0.0538  0.1451  0.1668  115  VAL B CB  
4486 C CG1 . VAL B 191 ? 1.0859 1.2354 1.3269 0.0683  0.1453  0.1610  115  VAL B CG1 
4487 C CG2 . VAL B 191 ? 1.0818 1.2596 1.3845 0.0624  0.1644  0.1781  115  VAL B CG2 
4488 N N   . MET B 192 ? 0.9629 1.0888 1.2619 0.0235  0.1014  0.1424  116  MET B N   
4489 C CA  . MET B 192 ? 0.9528 1.0609 1.2386 0.0172  0.0863  0.1329  116  MET B CA  
4490 C C   . MET B 192 ? 0.9237 1.0274 1.2140 0.0107  0.0701  0.1159  116  MET B C   
4491 O O   . MET B 192 ? 0.9229 1.0133 1.1980 0.0086  0.0584  0.1055  116  MET B O   
4492 C CB  . MET B 192 ? 0.9994 1.0987 1.3036 0.0052  0.0861  0.1443  116  MET B CB  
4493 C CG  . MET B 192 ? 1.0932 1.1932 1.3903 0.0123  0.1022  0.1622  116  MET B CG  
4494 S SD  . MET B 192 ? 1.1793 1.2639 1.4966 -0.0009 0.1029  0.1754  116  MET B SD  
4495 C CE  . MET B 192 ? 1.1729 1.2638 1.4798 0.0128  0.1272  0.1997  116  MET B CE  
4496 N N   . CYS B 193 ? 0.8155 0.9309 1.1261 0.0090  0.0702  0.1141  117  CYS B N   
4497 C CA  . CYS B 193 ? 0.7683 0.8808 1.0819 0.0056  0.0571  0.1002  117  CYS B CA  
4498 C C   . CYS B 193 ? 0.8119 0.9191 1.0968 0.0171  0.0557  0.0868  117  CYS B C   
4499 O O   . CYS B 193 ? 0.7952 0.8919 1.0719 0.0144  0.0439  0.0747  117  CYS B O   
4500 C CB  . CYS B 193 ? 0.7459 0.8740 1.0893 0.0027  0.0589  0.1042  117  CYS B CB  
4501 S SG  . CYS B 193 ? 0.7678 0.8937 1.1145 0.0016  0.0451  0.0903  117  CYS B SG  
4502 N N   . LYS B 194 ? 0.7763 0.8902 1.0457 0.0301  0.0679  0.0888  118  LYS B N   
4503 C CA  . LYS B 194 ? 0.7782 0.8873 1.0196 0.0414  0.0665  0.0749  118  LYS B CA  
4504 C C   . LYS B 194 ? 0.8429 0.9419 1.0589 0.0434  0.0609  0.0712  118  LYS B C   
4505 O O   . LYS B 194 ? 0.8293 0.9204 1.0308 0.0452  0.0512  0.0566  118  LYS B O   
4506 C CB  . LYS B 194 ? 0.8220 0.9421 1.0533 0.0559  0.0814  0.0770  118  LYS B CB  
4507 C CG  . LYS B 194 ? 0.9423 1.0720 1.1946 0.0581  0.0870  0.0768  118  LYS B CG  
4508 C CD  . LYS B 194 ? 1.0281 1.1659 1.2651 0.0745  0.1019  0.0758  118  LYS B CD  
4509 C CE  . LYS B 194 ? 1.0747 1.2210 1.3323 0.0785  0.1077  0.0744  118  LYS B CE  
4510 N NZ  . LYS B 194 ? 1.1221 1.2571 1.3810 0.0759  0.0951  0.0583  118  LYS B NZ  
4511 N N   . VAL B 195 ? 0.8205 0.9206 1.0325 0.0440  0.0678  0.0852  119  VAL B N   
4512 C CA  . VAL B 195 ? 0.8328 0.9254 1.0203 0.0484  0.0642  0.0847  119  VAL B CA  
4513 C C   . VAL B 195 ? 0.8962 0.9757 1.0886 0.0376  0.0493  0.0777  119  VAL B C   
4514 O O   . VAL B 195 ? 0.8948 0.9693 1.0709 0.0409  0.0400  0.0648  119  VAL B O   
4515 C CB  . VAL B 195 ? 0.8884 0.9844 1.0726 0.0525  0.0770  0.1043  119  VAL B CB  
4516 C CG1 . VAL B 195 ? 0.8954 0.9835 1.0556 0.0576  0.0720  0.1049  119  VAL B CG1 
4517 C CG2 . VAL B 195 ? 0.9022 1.0116 1.0772 0.0656  0.0933  0.1115  119  VAL B CG2 
4518 N N   . PHE B 196 ? 0.8663 0.9409 1.0813 0.0250  0.0471  0.0853  120  PHE B N   
4519 C CA  . PHE B 196 ? 0.8659 0.9273 1.0833 0.0160  0.0346  0.0790  120  PHE B CA  
4520 C C   . PHE B 196 ? 0.8855 0.9446 1.1066 0.0126  0.0245  0.0641  120  PHE B C   
4521 O O   . PHE B 196 ? 0.8850 0.9348 1.0994 0.0101  0.0151  0.0558  120  PHE B O   
4522 C CB  . PHE B 196 ? 0.8964 0.9516 1.1351 0.0041  0.0345  0.0889  120  PHE B CB  
4523 C CG  . PHE B 196 ? 0.9481 1.0009 1.1843 0.0065  0.0442  0.1041  120  PHE B CG  
4524 C CD1 . PHE B 196 ? 1.0032 1.0461 1.2214 0.0111  0.0418  0.1051  120  PHE B CD1 
4525 C CD2 . PHE B 196 ? 0.9973 1.0577 1.2519 0.0041  0.0561  0.1188  120  PHE B CD2 
4526 C CE1 . PHE B 196 ? 1.0383 1.0779 1.2539 0.0147  0.0517  0.1210  120  PHE B CE1 
4527 C CE2 . PHE B 196 ? 1.0562 1.1130 1.3100 0.0065  0.0667  0.1348  120  PHE B CE2 
4528 C CZ  . PHE B 196 ? 1.0412 1.0868 1.2745 0.0122  0.0645  0.1361  120  PHE B CZ  
4529 N N   . GLY B 197 ? 0.8100 0.8775 1.0416 0.0136  0.0274  0.0618  121  GLY B N   
4530 C CA  . GLY B 197 ? 0.7864 0.8515 1.0215 0.0121  0.0199  0.0495  121  GLY B CA  
4531 C C   . GLY B 197 ? 0.8254 0.8863 1.0405 0.0196  0.0160  0.0366  121  GLY B C   
4532 O O   . GLY B 197 ? 0.8096 0.8626 1.0244 0.0160  0.0073  0.0274  121  GLY B O   
4533 N N   . SER B 198 ? 0.7916 0.8585 0.9900 0.0302  0.0226  0.0361  122  SER B N   
4534 C CA  . SER B 198 ? 0.7950 0.8603 0.9733 0.0381  0.0181  0.0228  122  SER B CA  
4535 C C   . SER B 198 ? 0.8588 0.9190 1.0258 0.0372  0.0108  0.0224  122  SER B C   
4536 O O   . SER B 198 ? 0.8525 0.9091 1.0138 0.0376  0.0020  0.0100  122  SER B O   
4537 C CB  . SER B 198 ? 0.8513 0.9254 1.0127 0.0509  0.0274  0.0228  122  SER B CB  
4538 O OG  . SER B 198 ? 0.9393 1.0186 1.1125 0.0530  0.0355  0.0238  122  SER B OG  
4539 N N   . PHE B 199 ? 0.8247 0.8848 0.9904 0.0362  0.0150  0.0365  123  PHE B N   
4540 C CA  . PHE B 199 ? 0.8252 0.8803 0.9813 0.0367  0.0097  0.0391  123  PHE B CA  
4541 C C   . PHE B 199 ? 0.8429 0.8881 1.0108 0.0270  0.0001  0.0329  123  PHE B C   
4542 O O   . PHE B 199 ? 0.8457 0.8882 1.0063 0.0286  -0.0070 0.0277  123  PHE B O   
4543 C CB  . PHE B 199 ? 0.8603 0.9148 1.0170 0.0370  0.0184  0.0571  123  PHE B CB  
4544 C CG  . PHE B 199 ? 0.8948 0.9437 1.0410 0.0398  0.0150  0.0622  123  PHE B CG  
4545 C CD1 . PHE B 199 ? 0.9574 1.0130 1.0805 0.0527  0.0156  0.0637  123  PHE B CD1 
4546 C CD2 . PHE B 199 ? 0.9199 0.9571 1.0787 0.0308  0.0117  0.0665  123  PHE B CD2 
4547 C CE1 . PHE B 199 ? 0.9803 1.0317 1.0948 0.0567  0.0128  0.0704  123  PHE B CE1 
4548 C CE2 . PHE B 199 ? 0.9690 1.0003 1.1194 0.0346  0.0100  0.0724  123  PHE B CE2 
4549 C CZ  . PHE B 199 ? 0.9624 1.0013 1.0917 0.0477  0.0105  0.0750  123  PHE B CZ  
4550 N N   . LEU B 200 ? 0.7610 0.8023 0.9469 0.0178  -0.0001 0.0337  124  LEU B N   
4551 C CA  . LEU B 200 ? 0.7348 0.7671 0.9303 0.0096  -0.0077 0.0282  124  LEU B CA  
4552 C C   . LEU B 200 ? 0.7928 0.8252 0.9859 0.0117  -0.0136 0.0144  124  LEU B C   
4553 O O   . LEU B 200 ? 0.8131 0.8408 1.0046 0.0105  -0.0195 0.0094  124  LEU B O   
4554 C CB  . LEU B 200 ? 0.7194 0.7503 0.9322 0.0013  -0.0067 0.0323  124  LEU B CB  
4555 C CG  . LEU B 200 ? 0.7566 0.7796 0.9769 -0.0054 -0.0138 0.0264  124  LEU B CG  
4556 C CD1 . LEU B 200 ? 0.7518 0.7641 0.9695 -0.0097 -0.0178 0.0281  124  LEU B CD1 
4557 C CD2 . LEU B 200 ? 0.7787 0.8049 1.0136 -0.0104 -0.0135 0.0296  124  LEU B CD2 
4558 N N   . THR B 201 ? 0.7249 0.7623 0.9196 0.0150  -0.0111 0.0084  125  THR B N   
4559 C CA  . THR B 201 ? 0.7083 0.7442 0.9049 0.0161  -0.0155 -0.0050 125  THR B CA  
4560 C C   . THR B 201 ? 0.7802 0.8195 0.9632 0.0223  -0.0205 -0.0140 125  THR B C   
4561 O O   . THR B 201 ? 0.7902 0.8267 0.9781 0.0201  -0.0270 -0.0236 125  THR B O   
4562 C CB  . THR B 201 ? 0.7055 0.7446 0.9072 0.0192  -0.0101 -0.0078 125  THR B CB  
4563 O OG1 . THR B 201 ? 0.6380 0.6775 0.8528 0.0142  -0.0065 0.0022  125  THR B OG1 
4564 C CG2 . THR B 201 ? 0.6710 0.7050 0.8791 0.0191  -0.0135 -0.0207 125  THR B CG2 
4565 N N   . LEU B 202 ? 0.7396 0.7860 0.9066 0.0302  -0.0175 -0.0099 126  LEU B N   
4566 C CA  . LEU B 202 ? 0.7396 0.7920 0.8905 0.0379  -0.0234 -0.0175 126  LEU B CA  
4567 C C   . LEU B 202 ? 0.7927 0.8427 0.9475 0.0344  -0.0311 -0.0172 126  LEU B C   
4568 O O   . LEU B 202 ? 0.7936 0.8453 0.9522 0.0339  -0.0393 -0.0293 126  LEU B O   
4569 C CB  . LEU B 202 ? 0.7487 0.8088 0.8800 0.0479  -0.0168 -0.0081 126  LEU B CB  
4570 C CG  . LEU B 202 ? 0.8153 0.8844 0.9236 0.0595  -0.0220 -0.0154 126  LEU B CG  
4571 C CD1 . LEU B 202 ? 0.8371 0.9129 0.9260 0.0701  -0.0120 -0.0042 126  LEU B CD1 
4572 C CD2 . LEU B 202 ? 0.8409 0.9116 0.9472 0.0597  -0.0313 -0.0151 126  LEU B CD2 
4573 N N   . ASN B 203 ? 0.7447 0.7904 0.9007 0.0318  -0.0281 -0.0037 127  ASN B N   
4574 C CA  . ASN B 203 ? 0.7356 0.7782 0.8947 0.0300  -0.0333 -0.0015 127  ASN B CA  
4575 C C   . ASN B 203 ? 0.7765 0.8116 0.9529 0.0211  -0.0366 -0.0073 127  ASN B C   
4576 O O   . ASN B 203 ? 0.7753 0.8107 0.9560 0.0209  -0.0419 -0.0105 127  ASN B O   
4577 C CB  . ASN B 203 ? 0.7136 0.7507 0.8696 0.0301  -0.0277 0.0141  127  ASN B CB  
4578 C CG  . ASN B 203 ? 0.8000 0.8443 0.9386 0.0402  -0.0234 0.0225  127  ASN B CG  
4579 O OD1 . ASN B 203 ? 0.6221 0.6750 0.7472 0.0493  -0.0285 0.0190  127  ASN B OD1 
4580 N ND2 . ASN B 203 ? 0.6864 0.7278 0.8256 0.0392  -0.0139 0.0348  127  ASN B ND2 
4581 N N   . MET B 204 ? 0.7239 0.7535 0.9103 0.0149  -0.0330 -0.0079 128  MET B N   
4582 C CA  . MET B 204 ? 0.7111 0.7339 0.9114 0.0081  -0.0350 -0.0122 128  MET B CA  
4583 C C   . MET B 204 ? 0.7790 0.8060 0.9854 0.0091  -0.0402 -0.0250 128  MET B C   
4584 O O   . MET B 204 ? 0.7815 0.8074 0.9966 0.0067  -0.0435 -0.0275 128  MET B O   
4585 C CB  . MET B 204 ? 0.7326 0.7506 0.9408 0.0033  -0.0307 -0.0095 128  MET B CB  
4586 C CG  . MET B 204 ? 0.7685 0.7794 0.9882 -0.0021 -0.0319 -0.0122 128  MET B CG  
4587 S SD  . MET B 204 ? 0.8100 0.8176 1.0390 -0.0052 -0.0284 -0.0104 128  MET B SD  
4588 C CE  . MET B 204 ? 0.7727 0.7855 1.0036 -0.0003 -0.0272 -0.0201 128  MET B CE  
4589 N N   . PHE B 205 ? 0.7391 0.7712 0.9423 0.0127  -0.0407 -0.0334 129  PHE B N   
4590 C CA  . PHE B 205 ? 0.7364 0.7718 0.9466 0.0131  -0.0466 -0.0478 129  PHE B CA  
4591 C C   . PHE B 205 ? 0.8136 0.8589 1.0175 0.0177  -0.0547 -0.0522 129  PHE B C   
4592 O O   . PHE B 205 ? 0.8203 0.8684 1.0377 0.0149  -0.0607 -0.0607 129  PHE B O   
4593 C CB  . PHE B 205 ? 0.7607 0.7969 0.9669 0.0167  -0.0450 -0.0570 129  PHE B CB  
4594 C CG  . PHE B 205 ? 0.7651 0.7922 0.9842 0.0123  -0.0389 -0.0561 129  PHE B CG  
4595 C CD1 . PHE B 205 ? 0.7971 0.8175 1.0348 0.0066  -0.0400 -0.0618 129  PHE B CD1 
4596 C CD2 . PHE B 205 ? 0.7766 0.8030 0.9907 0.0149  -0.0318 -0.0493 129  PHE B CD2 
4597 C CE1 . PHE B 205 ? 0.8005 0.8123 1.0491 0.0041  -0.0340 -0.0594 129  PHE B CE1 
4598 C CE2 . PHE B 205 ? 0.8084 0.8281 1.0350 0.0123  -0.0269 -0.0479 129  PHE B CE2 
4599 C CZ  . PHE B 205 ? 0.7833 0.7951 1.0258 0.0074  -0.0281 -0.0526 129  PHE B CZ  
4600 N N   . ALA B 206 ? 0.7667 0.8179 0.9523 0.0249  -0.0545 -0.0450 130  ALA B N   
4601 C CA  . ALA B 206 ? 0.7636 0.8254 0.9420 0.0310  -0.0626 -0.0471 130  ALA B CA  
4602 C C   . ALA B 206 ? 0.8005 0.8606 0.9935 0.0267  -0.0648 -0.0427 130  ALA B C   
4603 O O   . ALA B 206 ? 0.8136 0.8833 1.0135 0.0285  -0.0732 -0.0495 130  ALA B O   
4604 C CB  . ALA B 206 ? 0.7839 0.8502 0.9400 0.0402  -0.0596 -0.0365 130  ALA B CB  
4605 N N   . SER B 207 ? 0.7324 0.7810 0.9318 0.0210  -0.0575 -0.0328 131  SER B N   
4606 C CA  . SER B 207 ? 0.7159 0.7607 0.9276 0.0176  -0.0574 -0.0289 131  SER B CA  
4607 C C   . SER B 207 ? 0.7614 0.8073 0.9938 0.0118  -0.0598 -0.0388 131  SER B C   
4608 O O   . SER B 207 ? 0.7629 0.8172 1.0068 0.0126  -0.0651 -0.0428 131  SER B O   
4609 C CB  . SER B 207 ? 0.7292 0.7602 0.9391 0.0136  -0.0495 -0.0177 131  SER B CB  
4610 O OG  . SER B 207 ? 0.7773 0.8033 0.9963 0.0115  -0.0484 -0.0149 131  SER B OG  
4611 N N   . ILE B 208 ? 0.7052 0.7438 0.9441 0.0064  -0.0558 -0.0422 132  ILE B N   
4612 C CA  . ILE B 208 ? 0.6944 0.7308 0.9541 0.0005  -0.0555 -0.0494 132  ILE B CA  
4613 C C   . ILE B 208 ? 0.7462 0.7944 1.0166 0.0012  -0.0647 -0.0638 132  ILE B C   
4614 O O   . ILE B 208 ? 0.7422 0.7935 1.0341 -0.0030 -0.0665 -0.0681 132  ILE B O   
4615 C CB  . ILE B 208 ? 0.7250 0.7509 0.9864 -0.0032 -0.0492 -0.0489 132  ILE B CB  
4616 C CG1 . ILE B 208 ? 0.7222 0.7389 0.9747 -0.0044 -0.0426 -0.0361 132  ILE B CG1 
4617 C CG2 . ILE B 208 ? 0.7177 0.7397 1.0015 -0.0087 -0.0475 -0.0548 132  ILE B CG2 
4618 C CD1 . ILE B 208 ? 0.7843 0.7936 1.0370 -0.0064 -0.0375 -0.0336 132  ILE B CD1 
4619 N N   . PHE B 209 ? 0.7025 0.7575 0.9582 0.0067  -0.0705 -0.0712 133  PHE B N   
4620 C CA  . PHE B 209 ? 0.7053 0.7714 0.9686 0.0076  -0.0811 -0.0872 133  PHE B CA  
4621 C C   . PHE B 209 ? 0.7537 0.8346 1.0211 0.0111  -0.0899 -0.0871 133  PHE B C   
4622 O O   . PHE B 209 ? 0.7582 0.8482 1.0465 0.0076  -0.0978 -0.0981 133  PHE B O   
4623 C CB  . PHE B 209 ? 0.7452 0.8141 0.9880 0.0140  -0.0847 -0.0964 133  PHE B CB  
4624 C CG  . PHE B 209 ? 0.7645 0.8208 1.0047 0.0122  -0.0764 -0.0979 133  PHE B CG  
4625 C CD1 . PHE B 209 ? 0.7922 0.8377 1.0546 0.0042  -0.0717 -0.1005 133  PHE B CD1 
4626 C CD2 . PHE B 209 ? 0.8159 0.8725 1.0328 0.0197  -0.0736 -0.0978 133  PHE B CD2 
4627 C CE1 . PHE B 209 ? 0.8135 0.8480 1.0746 0.0039  -0.0642 -0.1011 133  PHE B CE1 
4628 C CE2 . PHE B 209 ? 0.8618 0.9084 1.0787 0.0191  -0.0659 -0.0996 133  PHE B CE2 
4629 C CZ  . PHE B 209 ? 0.8266 0.8621 1.0657 0.0114  -0.0616 -0.1011 133  PHE B CZ  
4630 N N   . PHE B 210 ? 0.7074 0.7910 0.9585 0.0177  -0.0883 -0.0744 134  PHE B N   
4631 C CA  . PHE B 210 ? 0.7017 0.7993 0.9580 0.0224  -0.0959 -0.0725 134  PHE B CA  
4632 C C   . PHE B 210 ? 0.7469 0.8422 1.0293 0.0161  -0.0913 -0.0676 134  PHE B C   
4633 O O   . PHE B 210 ? 0.7499 0.8593 1.0487 0.0174  -0.0984 -0.0706 134  PHE B O   
4634 C CB  . PHE B 210 ? 0.7241 0.8238 0.9560 0.0324  -0.0948 -0.0597 134  PHE B CB  
4635 C CG  . PHE B 210 ? 0.7533 0.8619 0.9608 0.0414  -0.1012 -0.0644 134  PHE B CG  
4636 C CD1 . PHE B 210 ? 0.8071 0.9341 1.0142 0.0472  -0.1155 -0.0759 134  PHE B CD1 
4637 C CD2 . PHE B 210 ? 0.7751 0.8751 0.9593 0.0454  -0.0931 -0.0562 134  PHE B CD2 
4638 C CE1 . PHE B 210 ? 0.8383 0.9738 1.0183 0.0573  -0.1214 -0.0804 134  PHE B CE1 
4639 C CE2 . PHE B 210 ? 0.8309 0.9395 0.9904 0.0554  -0.0971 -0.0592 134  PHE B CE2 
4640 C CZ  . PHE B 210 ? 0.8262 0.9519 0.9816 0.0619  -0.1112 -0.0714 134  PHE B CZ  
4641 N N   . ILE B 211 ? 0.6961 0.7753 0.9830 0.0099  -0.0798 -0.0607 135  ILE B N   
4642 C CA  . ILE B 211 ? 0.6831 0.7586 0.9923 0.0046  -0.0734 -0.0563 135  ILE B CA  
4643 C C   . ILE B 211 ? 0.7490 0.8325 1.0870 -0.0020 -0.0780 -0.0686 135  ILE B C   
4644 O O   . ILE B 211 ? 0.7492 0.8421 1.1110 -0.0037 -0.0789 -0.0686 135  ILE B O   
4645 C CB  . ILE B 211 ? 0.7104 0.7669 1.0126 0.0008  -0.0610 -0.0467 135  ILE B CB  
4646 C CG1 . ILE B 211 ? 0.7156 0.7643 0.9948 0.0059  -0.0572 -0.0354 135  ILE B CG1 
4647 C CG2 . ILE B 211 ? 0.7013 0.7539 1.0250 -0.0039 -0.0534 -0.0432 135  ILE B CG2 
4648 C CD1 . ILE B 211 ? 0.7879 0.8197 1.0575 0.0023  -0.0481 -0.0280 135  ILE B CD1 
4649 N N   . THR B 212 ? 0.7187 0.7982 1.0559 -0.0054 -0.0806 -0.0792 136  THR B N   
4650 C CA  . THR B 212 ? 0.7289 0.8123 1.0930 -0.0124 -0.0853 -0.0930 136  THR B CA  
4651 C C   . THR B 212 ? 0.8148 0.9195 1.1898 -0.0102 -0.1005 -0.1047 136  THR B C   
4652 O O   . THR B 212 ? 0.8153 0.9286 1.2228 -0.0164 -0.1038 -0.1111 136  THR B O   
4653 C CB  . THR B 212 ? 0.8020 0.8738 1.1572 -0.0144 -0.0841 -0.1013 136  THR B CB  
4654 O OG1 . THR B 212 ? 0.7267 0.7818 1.0734 -0.0156 -0.0712 -0.0892 136  THR B OG1 
4655 C CG2 . THR B 212 ? 0.7929 0.8647 1.1762 -0.0220 -0.0883 -0.1167 136  THR B CG2 
4656 N N   . CYS B 213 ? 0.7956 0.9099 1.1447 -0.0009 -0.1095 -0.1064 137  CYS B N   
4657 C CA  . CYS B 213 ? 0.8154 0.9520 1.1698 0.0036  -0.1256 -0.1165 137  CYS B CA  
4658 C C   . CYS B 213 ? 0.8634 1.0129 1.2416 0.0037  -0.1259 -0.1083 137  CYS B C   
4659 O O   . CYS B 213 ? 0.8668 1.0335 1.2728 0.0004  -0.1365 -0.1186 137  CYS B O   
4660 C CB  . CYS B 213 ? 0.8385 0.9812 1.1562 0.0156  -0.1322 -0.1151 137  CYS B CB  
4661 S SG  . CYS B 213 ? 0.9101 1.0445 1.2017 0.0179  -0.1347 -0.1288 137  CYS B SG  
4662 N N   . MET B 214 ? 0.8153 0.9564 1.1840 0.0074  -0.1143 -0.0907 138  MET B N   
4663 C CA  . MET B 214 ? 0.8147 0.9653 1.2029 0.0095  -0.1116 -0.0812 138  MET B CA  
4664 C C   . MET B 214 ? 0.8490 1.0030 1.2778 -0.0005 -0.1073 -0.0846 138  MET B C   
4665 O O   . MET B 214 ? 0.8387 1.0118 1.2943 0.0000  -0.1130 -0.0858 138  MET B O   
4666 C CB  . MET B 214 ? 0.8430 0.9777 1.2120 0.0141  -0.0978 -0.0636 138  MET B CB  
4667 C CG  . MET B 214 ? 0.9055 1.0395 1.2420 0.0250  -0.1007 -0.0562 138  MET B CG  
4668 S SD  . MET B 214 ? 0.9854 1.1463 1.3257 0.0365  -0.1154 -0.0567 138  MET B SD  
4669 C CE  . MET B 214 ? 0.9322 1.0998 1.3067 0.0357  -0.1085 -0.0488 138  MET B CE  
4670 N N   . SER B 215 ? 0.8009 0.9373 1.2356 -0.0090 -0.0968 -0.0849 139  SER B N   
4671 C CA  . SER B 215 ? 0.7928 0.9299 1.2658 -0.0184 -0.0899 -0.0857 139  SER B CA  
4672 C C   . SER B 215 ? 0.8422 0.9959 1.3466 -0.0252 -0.1039 -0.1034 139  SER B C   
4673 O O   . SER B 215 ? 0.8264 0.9933 1.3692 -0.0303 -0.1037 -0.1039 139  SER B O   
4674 C CB  . SER B 215 ? 0.8352 0.9488 1.3033 -0.0240 -0.0757 -0.0806 139  SER B CB  
4675 O OG  . SER B 215 ? 0.9528 1.0527 1.3954 -0.0186 -0.0642 -0.0656 139  SER B OG  
4676 N N   . VAL B 216 ? 0.8112 0.9650 1.2996 -0.0248 -0.1162 -0.1183 140  VAL B N   
4677 C CA  . VAL B 216 ? 0.8201 0.9882 1.3330 -0.0308 -0.1323 -0.1388 140  VAL B CA  
4678 C C   . VAL B 216 ? 0.8835 1.0807 1.4062 -0.0248 -0.1481 -0.1423 140  VAL B C   
4679 O O   . VAL B 216 ? 0.8823 1.0972 1.4439 -0.0316 -0.1579 -0.1531 140  VAL B O   
4680 C CB  . VAL B 216 ? 0.8794 1.0372 1.3657 -0.0298 -0.1397 -0.1538 140  VAL B CB  
4681 C CG1 . VAL B 216 ? 0.8959 1.0690 1.4013 -0.0341 -0.1591 -0.1777 140  VAL B CG1 
4682 C CG2 . VAL B 216 ? 0.8700 1.0012 1.3537 -0.0357 -0.1246 -0.1506 140  VAL B CG2 
4683 N N   . ASP B 217 ? 0.8443 1.0466 1.3343 -0.0120 -0.1500 -0.1320 141  ASP B N   
4684 C CA  . ASP B 217 ? 0.8459 1.0751 1.3404 -0.0034 -0.1640 -0.1320 141  ASP B CA  
4685 C C   . ASP B 217 ? 0.8817 1.1234 1.4148 -0.0056 -0.1574 -0.1214 141  ASP B C   
4686 O O   . ASP B 217 ? 0.8873 1.1553 1.4518 -0.0066 -0.1708 -0.1291 141  ASP B O   
4687 C CB  . ASP B 217 ? 0.8726 1.0995 1.3223 0.0112  -0.1641 -0.1206 141  ASP B CB  
4688 C CG  . ASP B 217 ? 1.0249 1.2791 1.4762 0.0222  -0.1789 -0.1193 141  ASP B CG  
4689 O OD1 . ASP B 217 ? 1.0576 1.3296 1.5055 0.0250  -0.1981 -0.1348 141  ASP B OD1 
4690 O OD2 . ASP B 217 ? 1.0770 1.3346 1.5316 0.0289  -0.1715 -0.1031 141  ASP B OD2 
4691 N N   . ARG B 218 ? 0.8159 1.0402 1.3470 -0.0059 -0.1370 -0.1043 142  ARG B N   
4692 C CA  . ARG B 218 ? 0.8018 1.0351 1.3665 -0.0069 -0.1270 -0.0931 142  ARG B CA  
4693 C C   . ARG B 218 ? 0.8802 1.1230 1.4952 -0.0203 -0.1275 -0.1023 142  ARG B C   
4694 O O   . ARG B 218 ? 0.8865 1.1520 1.5393 -0.0210 -0.1303 -0.1008 142  ARG B O   
4695 C CB  . ARG B 218 ? 0.7655 0.9753 1.3128 -0.0042 -0.1050 -0.0751 142  ARG B CB  
4696 C CG  . ARG B 218 ? 0.8211 1.0246 1.3313 0.0090  -0.1026 -0.0632 142  ARG B CG  
4697 C CD  . ARG B 218 ? 0.8992 1.0808 1.3976 0.0105  -0.0822 -0.0483 142  ARG B CD  
4698 N NE  . ARG B 218 ? 1.0026 1.1778 1.4723 0.0225  -0.0792 -0.0373 142  ARG B NE  
4699 C CZ  . ARG B 218 ? 1.1492 1.3053 1.6040 0.0260  -0.0637 -0.0256 142  ARG B CZ  
4700 N NH1 . ARG B 218 ? 0.9068 1.0498 1.3697 0.0196  -0.0498 -0.0224 142  ARG B NH1 
4701 N NH2 . ARG B 218 ? 1.0103 1.1597 1.4415 0.0364  -0.0620 -0.0171 142  ARG B NH2 
4702 N N   . TYR B 219 ? 0.8562 1.0820 1.4740 -0.0309 -0.1247 -0.1117 143  TYR B N   
4703 C CA  . TYR B 219 ? 0.8673 1.0980 1.5336 -0.0448 -0.1244 -0.1209 143  TYR B CA  
4704 C C   . TYR B 219 ? 0.9543 1.2139 1.6495 -0.0482 -0.1480 -0.1398 143  TYR B C   
4705 O O   . TYR B 219 ? 0.9502 1.2291 1.6949 -0.0550 -0.1493 -0.1409 143  TYR B O   
4706 C CB  . TYR B 219 ? 0.8914 1.0952 1.5495 -0.0534 -0.1173 -0.1272 143  TYR B CB  
4707 C CG  . TYR B 219 ? 0.9297 1.1362 1.6372 -0.0680 -0.1191 -0.1393 143  TYR B CG  
4708 C CD1 . TYR B 219 ? 0.9478 1.1530 1.6957 -0.0754 -0.1023 -0.1276 143  TYR B CD1 
4709 C CD2 . TYR B 219 ? 0.9598 1.1681 1.6730 -0.0742 -0.1363 -0.1624 143  TYR B CD2 
4710 C CE1 . TYR B 219 ? 0.9670 1.1740 1.7644 -0.0896 -0.1028 -0.1376 143  TYR B CE1 
4711 C CE2 . TYR B 219 ? 0.9830 1.1916 1.7444 -0.0887 -0.1382 -0.1748 143  TYR B CE2 
4712 C CZ  . TYR B 219 ? 1.0752 1.2830 1.8803 -0.0969 -0.1210 -0.1616 143  TYR B CZ  
4713 O OH  . TYR B 219 ? 1.1032 1.3102 1.9594 -0.1119 -0.1214 -0.1724 143  TYR B OH  
4714 N N   . GLN B 220 ? 0.9382 1.2020 1.6022 -0.0426 -0.1664 -0.1540 144  GLN B N   
4715 C CA  . GLN B 220 ? 0.9570 1.2477 1.6385 -0.0438 -0.1920 -0.1744 144  GLN B CA  
4716 C C   . GLN B 220 ? 1.0315 1.3547 1.7319 -0.0355 -0.2008 -0.1669 144  GLN B C   
4717 O O   . GLN B 220 ? 1.0342 1.3854 1.7678 -0.0392 -0.2201 -0.1812 144  GLN B O   
4718 C CB  . GLN B 220 ? 0.9872 1.2716 1.6197 -0.0361 -0.2060 -0.1877 144  GLN B CB  
4719 C CG  . GLN B 220 ? 1.1986 1.5052 1.8428 -0.0383 -0.2331 -0.2136 144  GLN B CG  
4720 C CD  . GLN B 220 ? 1.4123 1.7093 2.0058 -0.0303 -0.2436 -0.2268 144  GLN B CD  
4721 O OE1 . GLN B 220 ? 1.4096 1.7158 2.0066 -0.0333 -0.2632 -0.2511 144  GLN B OE1 
4722 N NE2 . GLN B 220 ? 1.2114 1.4887 1.7577 -0.0204 -0.2302 -0.2121 144  GLN B NE2 
4723 N N   . SER B 221 ? 0.9983 1.3177 1.6800 -0.0246 -0.1866 -0.1449 145  SER B N   
4724 C CA  . SER B 221 ? 1.0050 1.3516 1.7036 -0.0149 -0.1909 -0.1345 145  SER B CA  
4725 C C   . SER B 221 ? 1.0846 1.4430 1.8405 -0.0234 -0.1791 -0.1269 145  SER B C   
4726 O O   . SER B 221 ? 1.0822 1.4717 1.8724 -0.0203 -0.1882 -0.1258 145  SER B O   
4727 C CB  . SER B 221 ? 1.0375 1.3712 1.6924 0.0003  -0.1793 -0.1149 145  SER B CB  
4728 O OG  . SER B 221 ? 1.1583 1.4837 1.7632 0.0090  -0.1891 -0.1195 145  SER B OG  
4729 N N   . VAL B 222 ? 1.0664 1.4007 1.8326 -0.0333 -0.1582 -0.1206 146  VAL B N   
4730 C CA  . VAL B 222 ? 1.0722 1.4134 1.8896 -0.0411 -0.1424 -0.1109 146  VAL B CA  
4731 C C   . VAL B 222 ? 1.1756 1.5348 2.0490 -0.0572 -0.1553 -0.1289 146  VAL B C   
4732 O O   . VAL B 222 ? 1.1679 1.5581 2.0896 -0.0592 -0.1617 -0.1292 146  VAL B O   
4733 C CB  . VAL B 222 ? 1.1101 1.4176 1.9118 -0.0437 -0.1148 -0.0959 146  VAL B CB  
4734 C CG1 . VAL B 222 ? 1.1036 1.4165 1.9585 -0.0528 -0.0974 -0.0868 146  VAL B CG1 
4735 C CG2 . VAL B 222 ? 1.0997 1.3922 1.8543 -0.0288 -0.1025 -0.0788 146  VAL B CG2 
4736 N N   . ILE B 223 ? 1.1816 1.5214 2.0504 -0.0683 -0.1588 -0.1440 147  ILE B N   
4737 C CA  . ILE B 223 ? 1.2130 1.5628 2.1335 -0.0851 -0.1697 -0.1627 147  ILE B CA  
4738 C C   . ILE B 223 ? 1.3287 1.7145 2.2658 -0.0839 -0.2016 -0.1828 147  ILE B C   
4739 O O   . ILE B 223 ? 1.3342 1.7451 2.3311 -0.0945 -0.2102 -0.1909 147  ILE B O   
4740 C CB  . ILE B 223 ? 1.2650 1.5817 2.1685 -0.0946 -0.1663 -0.1747 147  ILE B CB  
4741 C CG1 . ILE B 223 ? 1.2891 1.6107 2.2506 -0.1133 -0.1742 -0.1933 147  ILE B CG1 
4742 C CG2 . ILE B 223 ? 1.2863 1.5905 2.1292 -0.0857 -0.1800 -0.1866 147  ILE B CG2 
4743 C CD1 . ILE B 223 ? 1.4067 1.7302 2.4287 -0.1247 -0.1529 -0.1786 147  ILE B CD1 
4744 N N   . TYR B 224 ? 1.3276 1.7174 2.2137 -0.0704 -0.2182 -0.1890 148  TYR B N   
4745 C CA  . TYR B 224 ? 1.3573 1.7818 2.2512 -0.0661 -0.2488 -0.2063 148  TYR B CA  
4746 C C   . TYR B 224 ? 1.4225 1.8655 2.2909 -0.0467 -0.2510 -0.1894 148  TYR B C   
4747 O O   . TYR B 224 ? 1.4214 1.8526 2.2316 -0.0332 -0.2533 -0.1857 148  TYR B O   
4748 C CB  . TYR B 224 ? 1.4003 1.8155 2.2572 -0.0662 -0.2692 -0.2311 148  TYR B CB  
4749 C CG  . TYR B 224 ? 1.4410 1.8342 2.3192 -0.0837 -0.2668 -0.2485 148  TYR B CG  
4750 C CD1 . TYR B 224 ? 1.4811 1.8923 2.4187 -0.0995 -0.2815 -0.2684 148  TYR B CD1 
4751 C CD2 . TYR B 224 ? 1.4530 1.8079 2.2918 -0.0841 -0.2514 -0.2465 148  TYR B CD2 
4752 C CE1 . TYR B 224 ? 1.5093 1.8975 2.4680 -0.1156 -0.2785 -0.2845 148  TYR B CE1 
4753 C CE2 . TYR B 224 ? 1.4774 1.8105 2.3357 -0.0988 -0.2484 -0.2617 148  TYR B CE2 
4754 C CZ  . TYR B 224 ? 1.5976 1.9460 2.5153 -0.1146 -0.2616 -0.2807 148  TYR B CZ  
4755 O OH  . TYR B 224 ? 1.6322 1.9566 2.5702 -0.1290 -0.2581 -0.2960 148  TYR B OH  
4756 N N   . PRO B 225 ? 1.3877 1.8596 2.3007 -0.0446 -0.2492 -0.1780 149  PRO B N   
4757 C CA  . PRO B 225 ? 1.3851 1.8719 2.2756 -0.0252 -0.2489 -0.1604 149  PRO B CA  
4758 C C   . PRO B 225 ? 1.4550 1.9651 2.3167 -0.0123 -0.2780 -0.1720 149  PRO B C   
4759 O O   . PRO B 225 ? 1.4495 1.9602 2.2733 0.0055  -0.2762 -0.1574 149  PRO B O   
4760 C CB  . PRO B 225 ? 1.3991 1.9152 2.3539 -0.0279 -0.2429 -0.1500 149  PRO B CB  
4761 C CG  . PRO B 225 ? 1.4481 1.9518 2.4479 -0.0478 -0.2281 -0.1534 149  PRO B CG  
4762 C CD  . PRO B 225 ? 1.4048 1.8947 2.3915 -0.0592 -0.2439 -0.1782 149  PRO B CD  
4763 N N   . PHE B 226 ? 1.4286 1.9573 2.3084 -0.0209 -0.3044 -0.1981 150  PHE B N   
4764 C CA  . PHE B 226 ? 1.7676 2.3211 2.6229 -0.0101 -0.3356 -0.2138 150  PHE B CA  
4765 C C   . PHE B 226 ? 2.0774 2.6741 2.9618 0.0017  -0.3489 -0.2048 150  PHE B C   
4766 O O   . PHE B 226 ? 1.5613 2.1581 2.4341 0.0156  -0.3343 -0.1807 150  PHE B O   
4767 C CB  . PHE B 226 ? 1.7988 2.3280 2.5758 0.0050  -0.3342 -0.2098 150  PHE B CB  
4768 N N   . TRP B 234 ? 1.6435 2.0357 1.8525 0.1154  -0.3413 -0.2292 158  TRP B N   
4769 C CA  . TRP B 234 ? 1.6630 2.0369 1.8359 0.1165  -0.3382 -0.2445 158  TRP B CA  
4770 C C   . TRP B 234 ? 1.6646 2.0046 1.8524 0.1004  -0.3149 -0.2428 158  TRP B C   
4771 O O   . TRP B 234 ? 1.6687 1.9887 1.8208 0.1052  -0.3021 -0.2412 158  TRP B O   
4772 C CB  . TRP B 234 ? 1.6861 2.0768 1.8616 0.1144  -0.3652 -0.2797 158  TRP B CB  
4773 C CG  . TRP B 234 ? 1.7438 2.1641 1.8840 0.1347  -0.3882 -0.2847 158  TRP B CG  
4774 C CD1 . TRP B 234 ? 1.7881 2.2420 1.9467 0.1410  -0.4086 -0.2828 158  TRP B CD1 
4775 C CD2 . TRP B 234 ? 1.7855 2.2058 1.8651 0.1526  -0.3937 -0.2929 158  TRP B CD2 
4776 N NE1 . TRP B 234 ? 1.8254 2.3005 1.9374 0.1620  -0.4275 -0.2888 158  TRP B NE1 
4777 C CE2 . TRP B 234 ? 1.8675 2.3221 1.9291 0.1696  -0.4183 -0.2952 158  TRP B CE2 
4778 C CE3 . TRP B 234 ? 1.8172 2.2124 1.8553 0.1570  -0.3792 -0.2972 158  TRP B CE3 
4779 C CZ2 . TRP B 234 ? 1.9065 2.3703 1.9072 0.1914  -0.4284 -0.3011 158  TRP B CZ2 
4780 C CZ3 . TRP B 234 ? 1.8829 2.2872 1.8626 0.1781  -0.3883 -0.3037 158  TRP B CZ3 
4781 C CH2 . TRP B 234 ? 1.9233 2.3611 1.8832 0.1952  -0.4126 -0.3056 158  TRP B CH2 
4782 N N   . GLN B 235 ? 1.5688 1.9033 1.8087 0.0823  -0.3091 -0.2427 159  GLN B N   
4783 C CA  . GLN B 235 ? 1.5282 1.8319 1.7834 0.0677  -0.2879 -0.2405 159  GLN B CA  
4784 C C   . GLN B 235 ? 1.5176 1.7993 1.7432 0.0741  -0.2630 -0.2133 159  GLN B C   
4785 O O   . GLN B 235 ? 1.5065 1.7645 1.7207 0.0696  -0.2488 -0.2144 159  GLN B O   
4786 C CB  . GLN B 235 ? 1.5187 1.8223 1.8330 0.0497  -0.2843 -0.2401 159  GLN B CB  
4787 C CG  . GLN B 235 ? 1.7342 2.0486 2.0685 0.0521  -0.2775 -0.2158 159  GLN B CG  
4788 C CD  . GLN B 235 ? 1.9744 2.2879 2.3648 0.0355  -0.2713 -0.2150 159  GLN B CD  
4789 O OE1 . GLN B 235 ? 1.9206 2.2381 2.3456 0.0225  -0.2806 -0.2351 159  GLN B OE1 
4790 N NE2 . GLN B 235 ? 1.8616 2.1709 2.2632 0.0362  -0.2557 -0.1915 159  GLN B NE2 
4791 N N   . ALA B 236 ? 1.4365 1.7262 1.6515 0.0847  -0.2583 -0.1898 160  ALA B N   
4792 C CA  . ALA B 236 ? 1.4042 1.6737 1.5962 0.0897  -0.2359 -0.1643 160  ALA B CA  
4793 C C   . ALA B 236 ? 1.4369 1.6999 1.5778 0.1034  -0.2316 -0.1618 160  ALA B C   
4794 O O   . ALA B 236 ? 1.4167 1.6578 1.5437 0.1018  -0.2125 -0.1497 160  ALA B O   
4795 C CB  . ALA B 236 ? 1.4041 1.6835 1.6020 0.0973  -0.2332 -0.1418 160  ALA B CB  
4796 N N   . SER B 237 ? 1.4023 1.6851 1.5156 0.1172  -0.2491 -0.1727 161  SER B N   
4797 C CA  . SER B 237 ? 1.4140 1.6932 1.4760 0.1328  -0.2448 -0.1695 161  SER B CA  
4798 C C   . SER B 237 ? 1.4397 1.7011 1.4912 0.1267  -0.2389 -0.1877 161  SER B C   
4799 O O   . SER B 237 ? 1.4550 1.7103 1.4663 0.1385  -0.2308 -0.1840 161  SER B O   
4800 C CB  . SER B 237 ? 1.4931 1.7998 1.5276 0.1502  -0.2664 -0.1772 161  SER B CB  
4801 O OG  . SER B 237 ? 1.6210 1.9424 1.6711 0.1444  -0.2893 -0.2080 161  SER B OG  
4802 N N   . TYR B 238 ? 1.3554 1.6077 1.4439 0.1090  -0.2409 -0.2053 162  TYR B N   
4803 C CA  . TYR B 238 ? 1.3456 1.5789 1.4295 0.1027  -0.2342 -0.2219 162  TYR B CA  
4804 C C   . TYR B 238 ? 1.3143 1.5238 1.4290 0.0868  -0.2145 -0.2114 162  TYR B C   
4805 O O   . TYR B 238 ? 1.3067 1.4976 1.4080 0.0863  -0.2003 -0.2107 162  TYR B O   
4806 C CB  . TYR B 238 ? 1.3884 1.6301 1.4853 0.0973  -0.2554 -0.2557 162  TYR B CB  
4807 C CG  . TYR B 238 ? 1.4640 1.7282 1.5247 0.1141  -0.2759 -0.2693 162  TYR B CG  
4808 C CD1 . TYR B 238 ? 1.5253 1.7845 1.5373 0.1285  -0.2732 -0.2766 162  TYR B CD1 
4809 C CD2 . TYR B 238 ? 1.4842 1.7759 1.5583 0.1167  -0.2979 -0.2745 162  TYR B CD2 
4810 C CE1 . TYR B 238 ? 1.5796 1.8599 1.5533 0.1460  -0.2917 -0.2881 162  TYR B CE1 
4811 C CE2 . TYR B 238 ? 1.5389 1.8531 1.5772 0.1337  -0.3180 -0.2861 162  TYR B CE2 
4812 C CZ  . TYR B 238 ? 1.6777 1.9857 1.6640 0.1485  -0.3150 -0.2931 162  TYR B CZ  
4813 O OH  . TYR B 238 ? 1.7450 2.0754 1.6922 0.1667  -0.3349 -0.3046 162  TYR B OH  
4814 N N   . ILE B 239 ? 1.2066 1.4175 1.3601 0.0755  -0.2129 -0.2019 163  ILE B N   
4815 C CA  . ILE B 239 ? 1.1526 1.3426 1.3331 0.0618  -0.1950 -0.1911 163  ILE B CA  
4816 C C   . ILE B 239 ? 1.1472 1.3248 1.3047 0.0679  -0.1759 -0.1651 163  ILE B C   
4817 O O   . ILE B 239 ? 1.1375 1.2964 1.2922 0.0635  -0.1616 -0.1615 163  ILE B O   
4818 C CB  . ILE B 239 ? 1.1663 1.3622 1.3927 0.0496  -0.1980 -0.1884 163  ILE B CB  
4819 C CG1 . ILE B 239 ? 1.1804 1.3841 1.4382 0.0395  -0.2138 -0.2148 163  ILE B CG1 
4820 C CG2 . ILE B 239 ? 1.1447 1.3194 1.3898 0.0392  -0.1779 -0.1724 163  ILE B CG2 
4821 C CD1 . ILE B 239 ? 1.2494 1.4636 1.5563 0.0280  -0.2179 -0.2134 163  ILE B CD1 
4822 N N   . VAL B 240 ? 1.0702 1.2583 1.2128 0.0781  -0.1760 -0.1473 164  VAL B N   
4823 C CA  . VAL B 240 ? 1.0442 1.2206 1.1684 0.0832  -0.1586 -0.1226 164  VAL B CA  
4824 C C   . VAL B 240 ? 1.0926 1.2589 1.1847 0.0898  -0.1487 -0.1228 164  VAL B C   
4825 O O   . VAL B 240 ? 1.0708 1.2200 1.1671 0.0837  -0.1329 -0.1125 164  VAL B O   
4826 C CB  . VAL B 240 ? 1.0953 1.2845 1.2061 0.0953  -0.1616 -0.1054 164  VAL B CB  
4827 C CG1 . VAL B 240 ? 1.0888 1.2645 1.1790 0.1008  -0.1437 -0.0816 164  VAL B CG1 
4828 C CG2 . VAL B 240 ? 1.0738 1.2706 1.2183 0.0890  -0.1669 -0.1018 164  VAL B CG2 
4829 N N   . PRO B 241 ? 1.0663 1.2426 1.1277 0.1020  -0.1571 -0.1348 165  PRO B N   
4830 C CA  . PRO B 241 ? 1.0677 1.2338 1.1013 0.1085  -0.1447 -0.1338 165  PRO B CA  
4831 C C   . PRO B 241 ? 1.0828 1.2325 1.1347 0.0968  -0.1383 -0.1472 165  PRO B C   
4832 O O   . PRO B 241 ? 1.0685 1.2056 1.1125 0.0971  -0.1224 -0.1381 165  PRO B O   
4833 C CB  . PRO B 241 ? 1.1301 1.3119 1.1287 0.1242  -0.1577 -0.1477 165  PRO B CB  
4834 C CG  . PRO B 241 ? 1.1926 1.3940 1.1954 0.1287  -0.1745 -0.1470 165  PRO B CG  
4835 C CD  . PRO B 241 ? 1.1084 1.3065 1.1573 0.1117  -0.1777 -0.1492 165  PRO B CD  
4836 N N   . LEU B 242 ? 1.0313 1.1816 1.1104 0.0864  -0.1503 -0.1675 166  LEU B N   
4837 C CA  . LEU B 242 ? 1.0236 1.1576 1.1237 0.0752  -0.1452 -0.1806 166  LEU B CA  
4838 C C   . LEU B 242 ? 1.0422 1.1610 1.1670 0.0639  -0.1295 -0.1626 166  LEU B C   
4839 O O   . LEU B 242 ? 1.0429 1.1467 1.1730 0.0596  -0.1186 -0.1638 166  LEU B O   
4840 C CB  . LEU B 242 ? 1.0338 1.1732 1.1608 0.0664  -0.1623 -0.2047 166  LEU B CB  
4841 C CG  . LEU B 242 ? 1.0997 1.2222 1.2496 0.0556  -0.1594 -0.2217 166  LEU B CG  
4842 C CD1 . LEU B 242 ? 1.1372 1.2529 1.2574 0.0653  -0.1581 -0.2375 166  LEU B CD1 
4843 C CD2 . LEU B 242 ? 1.1339 1.2627 1.3186 0.0447  -0.1753 -0.2408 166  LEU B CD2 
4844 N N   . VAL B 243 ? 0.9687 1.0916 1.1076 0.0600  -0.1286 -0.1464 167  VAL B N   
4845 C CA  . VAL B 243 ? 0.9328 1.0424 1.0916 0.0504  -0.1153 -0.1298 167  VAL B CA  
4846 C C   . VAL B 243 ? 0.9705 1.0718 1.1076 0.0560  -0.1002 -0.1126 167  VAL B C   
4847 O O   . VAL B 243 ? 0.9483 1.0362 1.0958 0.0494  -0.0891 -0.1071 167  VAL B O   
4848 C CB  . VAL B 243 ? 0.9657 1.0817 1.1425 0.0466  -0.1185 -0.1190 167  VAL B CB  
4849 C CG1 . VAL B 243 ? 0.9421 1.0439 1.1317 0.0391  -0.1046 -0.1019 167  VAL B CG1 
4850 C CG2 . VAL B 243 ? 0.9607 1.0852 1.1664 0.0393  -0.1312 -0.1347 167  VAL B CG2 
4851 N N   . TRP B 244 ? 0.9432 1.0533 1.0514 0.0683  -0.0999 -0.1041 168  TRP B N   
4852 C CA  . TRP B 244 ? 0.9434 1.0478 1.0329 0.0740  -0.0853 -0.0878 168  TRP B CA  
4853 C C   . TRP B 244 ? 1.0509 1.1506 1.1289 0.0776  -0.0794 -0.0982 168  TRP B C   
4854 O O   . TRP B 244 ? 1.0367 1.1295 1.1110 0.0782  -0.0656 -0.0865 168  TRP B O   
4855 C CB  . TRP B 244 ? 0.9324 1.0474 0.9955 0.0870  -0.0853 -0.0745 168  TRP B CB  
4856 C CG  . TRP B 244 ? 0.9210 1.0372 0.9948 0.0848  -0.0865 -0.0598 168  TRP B CG  
4857 C CD1 . TRP B 244 ? 0.9600 1.0879 1.0371 0.0880  -0.0993 -0.0629 168  TRP B CD1 
4858 C CD2 . TRP B 244 ? 0.8954 1.0001 0.9794 0.0790  -0.0747 -0.0408 168  TRP B CD2 
4859 N NE1 . TRP B 244 ? 0.9364 1.0600 1.0236 0.0858  -0.0947 -0.0460 168  TRP B NE1 
4860 C CE2 . TRP B 244 ? 0.9396 1.0479 1.0307 0.0798  -0.0800 -0.0332 168  TRP B CE2 
4861 C CE3 . TRP B 244 ? 0.8950 0.9872 0.9841 0.0731  -0.0609 -0.0302 168  TRP B CE3 
4862 C CZ2 . TRP B 244 ? 0.9147 1.0119 1.0157 0.0752  -0.0713 -0.0165 168  TRP B CZ2 
4863 C CZ3 . TRP B 244 ? 0.8961 0.9790 0.9956 0.0678  -0.0539 -0.0141 168  TRP B CZ3 
4864 C CH2 . TRP B 244 ? 0.9011 0.9852 1.0056 0.0688  -0.0588 -0.0080 168  TRP B CH2 
4865 N N   . CYS B 245 ? 1.0610 1.1643 1.1355 0.0798  -0.0901 -0.1208 169  CYS B N   
4866 C CA  . CYS B 245 ? 1.0910 1.1881 1.1552 0.0839  -0.0853 -0.1339 169  CYS B CA  
4867 C C   . CYS B 245 ? 1.1315 1.2130 1.2248 0.0717  -0.0779 -0.1358 169  CYS B C   
4868 O O   . CYS B 245 ? 1.1249 1.1991 1.2146 0.0740  -0.0652 -0.1305 169  CYS B O   
4869 C CB  . CYS B 245 ? 1.1315 1.2360 1.1825 0.0901  -0.1005 -0.1593 169  CYS B CB  
4870 S SG  . CYS B 245 ? 1.2134 1.3075 1.2503 0.0963  -0.0948 -0.1789 169  CYS B SG  
4871 N N   . MET B 246 ? 1.0792 1.1567 1.2022 0.0596  -0.0851 -0.1418 170  MET B N   
4872 C CA  . MET B 246 ? 1.0560 1.1189 1.2071 0.0485  -0.0783 -0.1419 170  MET B CA  
4873 C C   . MET B 246 ? 1.0541 1.1114 1.2108 0.0450  -0.0653 -0.1191 170  MET B C   
4874 O O   . MET B 246 ? 1.0353 1.0820 1.2043 0.0410  -0.0566 -0.1165 170  MET B O   
4875 C CB  . MET B 246 ? 1.0794 1.1410 1.2601 0.0374  -0.0877 -0.1507 170  MET B CB  
4876 C CG  . MET B 246 ? 1.1560 1.2210 1.3402 0.0376  -0.1011 -0.1760 170  MET B CG  
4877 S SD  . MET B 246 ? 1.2049 1.2698 1.4315 0.0230  -0.1105 -0.1845 170  MET B SD  
4878 C CE  . MET B 246 ? 1.1510 1.2345 1.3744 0.0250  -0.1176 -0.1706 170  MET B CE  
4879 N N   . ALA B 247 ? 0.9905 1.0546 1.1392 0.0466  -0.0646 -0.1033 171  ALA B N   
4880 C CA  . ALA B 247 ? 0.9676 1.0268 1.1208 0.0430  -0.0540 -0.0831 171  ALA B CA  
4881 C C   . ALA B 247 ? 1.0307 1.0903 1.1680 0.0503  -0.0429 -0.0750 171  ALA B C   
4882 O O   . ALA B 247 ? 1.0155 1.0697 1.1626 0.0461  -0.0338 -0.0635 171  ALA B O   
4883 C CB  . ALA B 247 ? 0.9680 1.0325 1.1178 0.0430  -0.0569 -0.0707 171  ALA B CB  
4884 N N   . CYS B 248 ? 1.0082 1.0756 1.1214 0.0617  -0.0438 -0.0814 172  CYS B N   
4885 C CA  . CYS B 248 ? 1.0178 1.0879 1.1136 0.0710  -0.0322 -0.0745 172  CYS B CA  
4886 C C   . CYS B 248 ? 1.0533 1.1158 1.1578 0.0707  -0.0261 -0.0842 172  CYS B C   
4887 O O   . CYS B 248 ? 1.0551 1.1167 1.1628 0.0722  -0.0139 -0.0730 172  CYS B O   
4888 C CB  . CYS B 248 ? 1.0580 1.1389 1.1224 0.0848  -0.0355 -0.0790 172  CYS B CB  
4889 S SG  . CYS B 248 ? 1.1354 1.2214 1.1755 0.0986  -0.0188 -0.0685 172  CYS B SG  
4890 N N   . LEU B 249 ? 0.9983 1.0554 1.1089 0.0689  -0.0343 -0.1046 173  LEU B N   
4891 C CA  . LEU B 249 ? 0.9950 1.0421 1.1153 0.0691  -0.0293 -0.1159 173  LEU B CA  
4892 C C   . LEU B 249 ? 0.9998 1.0375 1.1488 0.0586  -0.0238 -0.1059 173  LEU B C   
4893 O O   . LEU B 249 ? 0.9975 1.0298 1.1535 0.0608  -0.0145 -0.1042 173  LEU B O   
4894 C CB  . LEU B 249 ? 1.0128 1.0550 1.1346 0.0687  -0.0409 -0.1413 173  LEU B CB  
4895 C CG  . LEU B 249 ? 1.1061 1.1575 1.1982 0.0798  -0.0496 -0.1563 173  LEU B CG  
4896 C CD1 . LEU B 249 ? 1.1242 1.1706 1.2254 0.0757  -0.0636 -0.1821 173  LEU B CD1 
4897 C CD2 . LEU B 249 ? 1.1671 1.2205 1.2321 0.0943  -0.0385 -0.1566 173  LEU B CD2 
4898 N N   . SER B 250 ? 0.9184 0.9548 1.0832 0.0483  -0.0295 -0.0991 174  SER B N   
4899 C CA  . SER B 250 ? 0.8844 0.9127 1.0731 0.0390  -0.0256 -0.0893 174  SER B CA  
4900 C C   . SER B 250 ? 0.9073 0.9395 1.0956 0.0391  -0.0166 -0.0698 174  SER B C   
4901 O O   . SER B 250 ? 0.8721 0.8993 1.0770 0.0342  -0.0124 -0.0620 174  SER B O   
4902 C CB  . SER B 250 ? 0.9094 0.9361 1.1113 0.0298  -0.0337 -0.0886 174  SER B CB  
4903 O OG  . SER B 250 ? 1.0222 1.0465 1.2307 0.0281  -0.0423 -0.1064 174  SER B OG  
4904 N N   . SER B 251 ? 0.8828 0.9246 1.0533 0.0449  -0.0140 -0.0615 175  SER B N   
4905 C CA  . SER B 251 ? 0.8790 0.9257 1.0510 0.0444  -0.0058 -0.0432 175  SER B CA  
4906 C C   . SER B 251 ? 0.9472 0.9998 1.1115 0.0538  0.0054  -0.0403 175  SER B C   
4907 O O   . SER B 251 ? 0.9462 1.0050 1.1137 0.0539  0.0132  -0.0249 175  SER B O   
4908 C CB  . SER B 251 ? 0.9323 0.9841 1.0932 0.0442  -0.0082 -0.0334 175  SER B CB  
4909 O OG  . SER B 251 ? 1.1072 1.1658 1.2451 0.0541  -0.0098 -0.0392 175  SER B OG  
4910 N N   . LEU B 252 ? 0.9118 0.9622 1.0682 0.0617  0.0067  -0.0553 176  LEU B N   
4911 C CA  . LEU B 252 ? 0.9134 0.9686 1.0621 0.0724  0.0187  -0.0542 176  LEU B CA  
4912 C C   . LEU B 252 ? 0.9260 0.9799 1.0989 0.0692  0.0265  -0.0452 176  LEU B C   
4913 O O   . LEU B 252 ? 0.9162 0.9797 1.0911 0.0735  0.0371  -0.0323 176  LEU B O   
4914 C CB  . LEU B 252 ? 0.9370 0.9880 1.0691 0.0822  0.0173  -0.0750 176  LEU B CB  
4915 C CG  . LEU B 252 ? 1.0152 1.0719 1.1179 0.0900  0.0110  -0.0840 176  LEU B CG  
4916 C CD1 . LEU B 252 ? 1.0408 1.0910 1.1308 0.0972  0.0062  -0.1085 176  LEU B CD1 
4917 C CD2 . LEU B 252 ? 1.0623 1.1313 1.1448 0.1003  0.0220  -0.0691 176  LEU B CD2 
4918 N N   . PRO B 253 ? 0.8578 0.9017 1.0505 0.0620  0.0219  -0.0497 177  PRO B N   
4919 C CA  . PRO B 253 ? 0.8396 0.8846 1.0540 0.0606  0.0285  -0.0393 177  PRO B CA  
4920 C C   . PRO B 253 ? 0.8605 0.9160 1.0846 0.0545  0.0303  -0.0201 177  PRO B C   
4921 O O   . PRO B 253 ? 0.8513 0.9148 1.0893 0.0564  0.0376  -0.0099 177  PRO B O   
4922 C CB  . PRO B 253 ? 0.8514 0.8834 1.0814 0.0534  0.0216  -0.0456 177  PRO B CB  
4923 C CG  . PRO B 253 ? 0.9208 0.9440 1.1393 0.0540  0.0148  -0.0638 177  PRO B CG  
4924 C CD  . PRO B 253 ? 0.8711 0.9033 1.0688 0.0557  0.0114  -0.0630 177  PRO B CD  
4925 N N   . THR B 254 ? 0.7963 0.8521 1.0142 0.0475  0.0235  -0.0157 178  THR B N   
4926 C CA  . THR B 254 ? 0.7713 0.8342 0.9975 0.0409  0.0242  0.0004  178  THR B CA  
4927 C C   . THR B 254 ? 0.8315 0.9068 1.0528 0.0478  0.0354  0.0103  178  THR B C   
4928 O O   . THR B 254 ? 0.8280 0.9120 1.0666 0.0453  0.0408  0.0226  178  THR B O   
4929 C CB  . THR B 254 ? 0.8516 0.9093 1.0701 0.0338  0.0154  0.0007  178  THR B CB  
4930 O OG1 . THR B 254 ? 0.8734 0.9206 1.0961 0.0288  0.0069  -0.0086 178  THR B OG1 
4931 C CG2 . THR B 254 ? 0.8015 0.8626 1.0299 0.0260  0.0151  0.0150  178  THR B CG2 
4932 N N   . PHE B 255 ? 0.8047 0.8816 1.0030 0.0570  0.0390  0.0050  179  PHE B N   
4933 C CA  . PHE B 255 ? 0.8164 0.9047 1.0059 0.0657  0.0516  0.0151  179  PHE B CA  
4934 C C   . PHE B 255 ? 0.8808 0.9763 1.0804 0.0736  0.0633  0.0165  179  PHE B C   
4935 O O   . PHE B 255 ? 0.8803 0.9880 1.0862 0.0775  0.0754  0.0302  179  PHE B O   
4936 C CB  . PHE B 255 ? 0.8571 0.9449 1.0149 0.0759  0.0514  0.0070  179  PHE B CB  
4937 C CG  . PHE B 255 ? 0.8932 0.9923 1.0369 0.0871  0.0657  0.0183  179  PHE B CG  
4938 C CD1 . PHE B 255 ? 0.9263 1.0308 1.0717 0.0842  0.0706  0.0363  179  PHE B CD1 
4939 C CD2 . PHE B 255 ? 0.9401 1.0431 1.0676 0.1013  0.0750  0.0108  179  PHE B CD2 
4940 C CE1 . PHE B 255 ? 0.9568 1.0715 1.0900 0.0950  0.0858  0.0490  179  PHE B CE1 
4941 C CE2 . PHE B 255 ? 0.9983 1.1123 1.1111 0.1130  0.0901  0.0226  179  PHE B CE2 
4942 C CZ  . PHE B 255 ? 0.9707 1.0910 1.0870 0.1097  0.0958  0.0426  179  PHE B CZ  
4943 N N   . TYR B 256 ? 0.8481 0.9360 1.0510 0.0762  0.0605  0.0028  180  TYR B N   
4944 C CA  . TYR B 256 ? 0.8589 0.9509 1.0701 0.0856  0.0712  0.0014  180  TYR B CA  
4945 C C   . TYR B 256 ? 0.8866 0.9860 1.1305 0.0791  0.0729  0.0143  180  TYR B C   
4946 O O   . TYR B 256 ? 0.8946 1.0065 1.1505 0.0857  0.0849  0.0235  180  TYR B O   
4947 C CB  . TYR B 256 ? 0.8924 0.9702 1.0947 0.0908  0.0669  -0.0192 180  TYR B CB  
4948 C CG  . TYR B 256 ? 0.9506 1.0298 1.1519 0.1045  0.0795  -0.0246 180  TYR B CG  
4949 C CD1 . TYR B 256 ? 1.0051 1.0872 1.1796 0.1182  0.0882  -0.0316 180  TYR B CD1 
4950 C CD2 . TYR B 256 ? 0.9636 1.0404 1.1888 0.1052  0.0828  -0.0234 180  TYR B CD2 
4951 C CE1 . TYR B 256 ? 1.0411 1.1234 1.2131 0.1321  0.1009  -0.0375 180  TYR B CE1 
4952 C CE2 . TYR B 256 ? 0.9997 1.0768 1.2249 0.1190  0.0953  -0.0283 180  TYR B CE2 
4953 C CZ  . TYR B 256 ? 1.1270 1.2064 1.3255 0.1324  0.1047  -0.0360 180  TYR B CZ  
4954 O OH  . TYR B 256 ? 1.1640 1.2427 1.3608 0.1472  0.1181  -0.0418 180  TYR B OH  
4955 N N   . PHE B 257 ? 0.8148 0.9081 1.0730 0.0670  0.0610  0.0155  181  PHE B N   
4956 C CA  . PHE B 257 ? 0.7958 0.8967 1.0826 0.0619  0.0602  0.0261  181  PHE B CA  
4957 C C   . PHE B 257 ? 0.8203 0.9303 1.1206 0.0504  0.0558  0.0405  181  PHE B C   
4958 O O   . PHE B 257 ? 0.8124 0.9353 1.1372 0.0481  0.0578  0.0512  181  PHE B O   
4959 C CB  . PHE B 257 ? 0.8092 0.8975 1.1037 0.0583  0.0510  0.0186  181  PHE B CB  
4960 C CG  . PHE B 257 ? 0.8407 0.9185 1.1292 0.0685  0.0557  0.0052  181  PHE B CG  
4961 C CD1 . PHE B 257 ? 0.8839 0.9677 1.1862 0.0782  0.0657  0.0081  181  PHE B CD1 
4962 C CD2 . PHE B 257 ? 0.8723 0.9341 1.1439 0.0683  0.0501  -0.0107 181  PHE B CD2 
4963 C CE1 . PHE B 257 ? 0.9114 0.9828 1.2081 0.0882  0.0707  -0.0053 181  PHE B CE1 
4964 C CE2 . PHE B 257 ? 0.9247 0.9750 1.1927 0.0769  0.0541  -0.0247 181  PHE B CE2 
4965 C CZ  . PHE B 257 ? 0.9104 0.9641 1.1900 0.0869  0.0646  -0.0223 181  PHE B CZ  
4966 N N   . ARG B 258 ? 0.7516 0.8557 1.0384 0.0434  0.0498  0.0406  182  ARG B N   
4967 C CA  . ARG B 258 ? 0.7346 0.8447 1.0350 0.0325  0.0463  0.0531  182  ARG B CA  
4968 C C   . ARG B 258 ? 0.7858 0.9127 1.1000 0.0352  0.0589  0.0669  182  ARG B C   
4969 O O   . ARG B 258 ? 0.8040 0.9337 1.1028 0.0439  0.0697  0.0686  182  ARG B O   
4970 C CB  . ARG B 258 ? 0.7210 0.8204 1.0043 0.0264  0.0396  0.0511  182  ARG B CB  
4971 C CG  . ARG B 258 ? 0.7498 0.8359 1.0299 0.0189  0.0262  0.0430  182  ARG B CG  
4972 C CD  . ARG B 258 ? 0.6726 0.7615 0.9733 0.0090  0.0190  0.0494  182  ARG B CD  
4973 N NE  . ARG B 258 ? 0.6251 0.7015 0.9207 0.0038  0.0080  0.0422  182  ARG B NE  
4974 C CZ  . ARG B 258 ? 0.8639 0.9407 1.1715 -0.0030 0.0001  0.0450  182  ARG B CZ  
4975 N NH1 . ARG B 258 ? 0.7387 0.8287 1.0667 -0.0063 0.0001  0.0536  182  ARG B NH1 
4976 N NH2 . ARG B 258 ? 0.7621 0.8274 1.0621 -0.0060 -0.0080 0.0392  182  ARG B NH2 
4977 N N   . ASP B 259 ? 0.7135 0.8528 1.0573 0.0284  0.0577  0.0771  183  ASP B N   
4978 C CA  . ASP B 259 ? 0.7084 0.8658 1.0727 0.0292  0.0698  0.0917  183  ASP B CA  
4979 C C   . ASP B 259 ? 0.7332 0.9012 1.1307 0.0163  0.0618  0.1004  183  ASP B C   
4980 O O   . ASP B 259 ? 0.7145 0.8796 1.1191 0.0113  0.0488  0.0950  183  ASP B O   
4981 C CB  . ASP B 259 ? 0.7409 0.9099 1.1096 0.0433  0.0836  0.0926  183  ASP B CB  
4982 C CG  . ASP B 259 ? 0.8337 1.0212 1.2179 0.0477  0.1006  0.1078  183  ASP B CG  
4983 O OD1 . ASP B 259 ? 0.8223 1.0087 1.1991 0.0448  0.1059  0.1156  183  ASP B OD1 
4984 O OD2 . ASP B 259 ? 0.9199 1.1218 1.3211 0.0561  0.1104  0.1121  183  ASP B OD2 
4985 N N   . VAL B 260 ? 0.6874 0.8676 1.1051 0.0110  0.0693  0.1140  184  VAL B N   
4986 C CA  . VAL B 260 ? 0.6697 0.8617 1.1225 -0.0023 0.0614  0.1217  184  VAL B CA  
4987 C C   . VAL B 260 ? 0.7217 0.9359 1.2042 0.0023  0.0647  0.1270  184  VAL B C   
4988 O O   . VAL B 260 ? 0.7231 0.9503 1.2122 0.0127  0.0811  0.1343  184  VAL B O   
4989 C CB  . VAL B 260 ? 0.7173 0.9127 1.1842 -0.0107 0.0688  0.1343  184  VAL B CB  
4990 C CG1 . VAL B 260 ? 0.7066 0.9187 1.2169 -0.0238 0.0629  0.1426  184  VAL B CG1 
4991 C CG2 . VAL B 260 ? 0.7179 0.8908 1.1600 -0.0166 0.0622  0.1292  184  VAL B CG2 
4992 N N   . ARG B 261 ? 0.6791 0.8977 1.1775 -0.0040 0.0491  0.1233  185  ARG B N   
4993 C CA  . ARG B 261 ? 0.6791 0.9199 1.2081 0.0000  0.0487  0.1287  185  ARG B CA  
4994 C C   . ARG B 261 ? 0.7670 1.0196 1.3259 -0.0144 0.0317  0.1313  185  ARG B C   
4995 O O   . ARG B 261 ? 0.7537 0.9915 1.2989 -0.0232 0.0159  0.1229  185  ARG B O   
4996 C CB  . ARG B 261 ? 0.6415 0.8754 1.1545 0.0122  0.0466  0.1200  185  ARG B CB  
4997 C CG  . ARG B 261 ? 0.7068 0.9293 1.1920 0.0268  0.0619  0.1146  185  ARG B CG  
4998 C CD  . ARG B 261 ? 0.6523 0.8929 1.1524 0.0375  0.0818  0.1243  185  ARG B CD  
4999 N NE  . ARG B 261 ? 0.7254 0.9530 1.1932 0.0512  0.0950  0.1168  185  ARG B NE  
5000 C CZ  . ARG B 261 ? 0.9925 1.2132 1.4488 0.0640  0.0988  0.1080  185  ARG B CZ  
5001 N NH1 . ARG B 261 ? 0.8986 1.1070 1.3248 0.0754  0.1093  0.0992  185  ARG B NH1 
5002 N NH2 . ARG B 261 ? 0.8480 1.0733 1.3224 0.0658  0.0917  0.1076  185  ARG B NH2 
5003 N N   . THR B 262 ? 0.7571 1.0371 1.3573 -0.0165 0.0350  0.1426  186  THR B N   
5004 C CA  . THR B 262 ? 0.7625 1.0582 1.3964 -0.0304 0.0184  0.1450  186  THR B CA  
5005 C C   . THR B 262 ? 0.8232 1.1215 1.4543 -0.0270 0.0010  0.1381  186  THR B C   
5006 O O   . THR B 262 ? 0.8147 1.1225 1.4491 -0.0136 0.0063  0.1405  186  THR B O   
5007 C CB  . THR B 262 ? 0.9335 1.2605 1.6159 -0.0329 0.0283  0.1598  186  THR B CB  
5008 O OG1 . THR B 262 ? 1.0081 1.3532 1.7024 -0.0176 0.0378  0.1651  186  THR B OG1 
5009 C CG2 . THR B 262 ? 0.9137 1.2383 1.5996 -0.0355 0.0476  0.1693  186  THR B CG2 
5010 N N   . ILE B 263 ? 0.7972 1.0852 1.4196 -0.0379 -0.0189 0.1296  187  ILE B N   
5011 C CA  . ILE B 263 ? 0.7997 1.0897 1.4166 -0.0351 -0.0365 0.1240  187  ILE B CA  
5012 C C   . ILE B 263 ? 0.8745 1.1947 1.5348 -0.0431 -0.0500 0.1296  187  ILE B C   
5013 O O   . ILE B 263 ? 0.8730 1.1930 1.5427 -0.0579 -0.0644 0.1250  187  ILE B O   
5014 C CB  . ILE B 263 ? 0.8372 1.0989 1.4161 -0.0401 -0.0493 0.1114  187  ILE B CB  
5015 C CG1 . ILE B 263 ? 0.8400 1.0739 1.3811 -0.0343 -0.0356 0.1062  187  ILE B CG1 
5016 C CG2 . ILE B 263 ? 0.8481 1.1113 1.4177 -0.0351 -0.0655 0.1074  187  ILE B CG2 
5017 C CD1 . ILE B 263 ? 0.9312 1.1600 1.4561 -0.0175 -0.0223 0.1063  187  ILE B CD1 
5018 N N   . GLU B 264 ? 0.8453 1.1917 1.5341 -0.0333 -0.0445 0.1392  188  GLU B N   
5019 C CA  . GLU B 264 ? 0.8513 1.2331 1.5888 -0.0382 -0.0543 0.1470  188  GLU B CA  
5020 C C   . GLU B 264 ? 0.9156 1.3025 1.6567 -0.0487 -0.0827 0.1390  188  GLU B C   
5021 O O   . GLU B 264 ? 0.9105 1.3153 1.6861 -0.0630 -0.0933 0.1398  188  GLU B O   
5022 C CB  . GLU B 264 ? 0.8691 1.2727 1.6245 -0.0211 -0.0465 0.1564  188  GLU B CB  
5023 N N   . TYR B 265 ? 0.8877 1.2589 1.5938 -0.0418 -0.0948 0.1313  189  TYR B N   
5024 C CA  . TYR B 265 ? 0.9018 1.2782 1.6057 -0.0488 -0.1216 0.1237  189  TYR B CA  
5025 C C   . TYR B 265 ? 0.9468 1.3001 1.6316 -0.0651 -0.1313 0.1111  189  TYR B C   
5026 O O   . TYR B 265 ? 0.9598 1.3142 1.6387 -0.0716 -0.1536 0.1023  189  TYR B O   
5027 C CB  . TYR B 265 ? 0.9328 1.3004 1.6049 -0.0342 -0.1290 0.1219  189  TYR B CB  
5028 C CG  . TYR B 265 ? 0.9664 1.2973 1.5904 -0.0278 -0.1179 0.1159  189  TYR B CG  
5029 C CD1 . TYR B 265 ? 0.9917 1.3132 1.6061 -0.0146 -0.0972 0.1210  189  TYR B CD1 
5030 C CD2 . TYR B 265 ? 0.9830 1.2896 1.5721 -0.0341 -0.1288 0.1045  189  TYR B CD2 
5031 C CE1 . TYR B 265 ? 1.0070 1.2968 1.5812 -0.0095 -0.0885 0.1147  189  TYR B CE1 
5032 C CE2 . TYR B 265 ? 0.9951 1.2708 1.5443 -0.0283 -0.1187 0.0997  189  TYR B CE2 
5033 C CZ  . TYR B 265 ? 1.0954 1.3634 1.6386 -0.0167 -0.0992 0.1047  189  TYR B CZ  
5034 O OH  . TYR B 265 ? 1.1166 1.3558 1.6244 -0.0119 -0.0904 0.0992  189  TYR B OH  
5035 N N   . LEU B 266 ? 0.8778 1.2111 1.5531 -0.0708 -0.1151 0.1103  190  LEU B N   
5036 C CA  . LEU B 266 ? 0.8671 1.1776 1.5272 -0.0852 -0.1216 0.0998  190  LEU B CA  
5037 C C   . LEU B 266 ? 0.9053 1.2225 1.5999 -0.0983 -0.1117 0.1054  190  LEU B C   
5038 O O   . LEU B 266 ? 0.9110 1.2160 1.6080 -0.1129 -0.1200 0.0980  190  LEU B O   
5039 C CB  . LEU B 266 ? 0.8577 1.1326 1.4681 -0.0794 -0.1123 0.0932  190  LEU B CB  
5040 C CG  . LEU B 266 ? 0.9061 1.1676 1.4789 -0.0691 -0.1213 0.0866  190  LEU B CG  
5041 C CD1 . LEU B 266 ? 0.9022 1.1325 1.4351 -0.0640 -0.1088 0.0820  190  LEU B CD1 
5042 C CD2 . LEU B 266 ? 0.9281 1.1892 1.4939 -0.0767 -0.1457 0.0763  190  LEU B CD2 
5043 N N   . GLY B 267 ? 0.8395 1.1751 1.5605 -0.0922 -0.0932 0.1190  191  GLY B N   
5044 C CA  . GLY B 267 ? 0.8254 1.1695 1.5804 -0.1017 -0.0789 0.1284  191  GLY B CA  
5045 C C   . GLY B 267 ? 0.8407 1.1532 1.5674 -0.1058 -0.0667 0.1258  191  GLY B C   
5046 O O   . GLY B 267 ? 0.8421 1.1503 1.5888 -0.1200 -0.0657 0.1271  191  GLY B O   
5047 N N   . VAL B 268 ? 0.7610 1.0507 1.4422 -0.0931 -0.0577 0.1222  192  VAL B N   
5048 C CA  . VAL B 268 ? 0.7440 1.0037 1.3933 -0.0946 -0.0483 0.1187  192  VAL B CA  
5049 C C   . V