data_5UNH
# 
_entry.id   5UNH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5UNH         
WWPDB D_1000226118 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5UNF PDB . 
unspecified 5UNG PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5UNH 
_pdbx_database_status.recvd_initial_deposition_date   2017-01-30 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Zhang, H.'        1  ? 
'Han, G.W.'        2  ? 
'Batyuk, A.'       3  ? 
'Ishchenko, A.'    4  ? 
'White, K.L.'      5  ? 
'Patel, N.'        6  ? 
'Sadybekov, A.'    7  ? 
'Zamlynny, B.'     8  ? 
'Rudd, M.T.'       9  ? 
'Hollenstein, K.'  10 ? 
'Tolstikova, A.'   11 ? 
'White, T.A.'      12 ? 
'Hunter, M.S.'     13 ? 
'Weierstall, U.'   14 ? 
'Liu, W.'          15 ? 
'Babaoglu, K.'     16 ? 
'Moore, E.L.'      17 ? 
'Katz, R.D.'       18 ? 
'Shipman, J.M.'    19 ? 
'Garcia-Calvo, M.' 20 ? 
'Sharma, S.'       21 ? 
'Sheth, P.'        22 ? 
'Soisson, S.M.'    23 ? 
'Stevens, R.C.'    24 ? 
'Katritch, V.'     25 ? 
'Cherezov, V.'     26 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            544 
_citation.language                  ? 
_citation.page_first                327 
_citation.page_last                 332 
_citation.title                     'Structural basis for selectivity and diversity in angiotensin II receptors.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nature22035 
_citation.pdbx_database_id_PubMed   28379944 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhang, H.'        1  
primary 'Han, G.W.'        2  
primary 'Batyuk, A.'       3  
primary 'Ishchenko, A.'    4  
primary 'White, K.L.'      5  
primary 'Patel, N.'        6  
primary 'Sadybekov, A.'    7  
primary 'Zamlynny, B.'     8  
primary 'Rudd, M.T.'       9  
primary 'Hollenstein, K.'  10 
primary 'Tolstikova, A.'   11 
primary 'White, T.A.'      12 
primary 'Hunter, M.S.'     13 
primary 'Weierstall, U.'   14 
primary 'Liu, W.'          15 
primary 'Babaoglu, K.'     16 
primary 'Moore, E.L.'      17 
primary 'Katz, R.D.'       18 
primary 'Shipman, J.M.'    19 
primary 'Garcia-Calvo, M.' 20 
primary 'Sharma, S.'       21 
primary 'Sheth, P.'        22 
primary 'Soisson, S.M.'    23 
primary 'Stevens, R.C.'    24 
primary 'Katritch, V.'     25 
primary 'Cherezov, V.'     26 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   104.32 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5UNH 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     78.420 
_cell.length_a_esd                 ? 
_cell.length_b                     68.200 
_cell.length_b_esd                 ? 
_cell.length_c                     89.060 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5UNH 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Soluble cytochrome b562,Type-2 angiotensin II receptor' 46506.535 2 ? 
'M1007W, H1102I, R1106L,M1007W, H1102I, R1106L' 
;UNP P0ABE7 residues 23-128 and UNP P50052 35-335 linked via LINKER resdiues GSGS,UNP P0ABE7 residues 23-128 and UNP P50052 35-335 linked via LINKER resdiues GSGS
;
? 
2 non-polymer syn 
"N-[(furan-2-yl)methyl]-N-(4-oxo-2-propyl-3-{[2'-(2H-tetrazol-5-yl)[1,1'-biphenyl]-4-yl]methyl}-3,4-dihydroquinazolin-6-yl)benzamide" 
621.687   2 ? ?                                               ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Cytochrome b-562,Angiotensin II type-2 receptor,AT2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLAN
EGKVKEAQAAAEQLKTTRNAYIQKYLGSGSCSQKPSDKHLDAIPILYYIIFVIGFLVNIVVVTLFCCQKGPKKVSSIYIF
NLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIV
PLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSY
GKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNR
FQQKLRSVFRV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLAN
EGKVKEAQAAAEQLKTTRNAYIQKYLGSGSCSQKPSDKHLDAIPILYYIIFVIGFLVNIVVVTLFCCQKGPKKVSSIYIF
NLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIV
PLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSY
GKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNR
FQQKLRSVFRV
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ASP n 
1 3   LEU n 
1 4   GLU n 
1 5   ASP n 
1 6   ASN n 
1 7   TRP n 
1 8   GLU n 
1 9   THR n 
1 10  LEU n 
1 11  ASN n 
1 12  ASP n 
1 13  ASN n 
1 14  LEU n 
1 15  LYS n 
1 16  VAL n 
1 17  ILE n 
1 18  GLU n 
1 19  LYS n 
1 20  ALA n 
1 21  ASP n 
1 22  ASN n 
1 23  ALA n 
1 24  ALA n 
1 25  GLN n 
1 26  VAL n 
1 27  LYS n 
1 28  ASP n 
1 29  ALA n 
1 30  LEU n 
1 31  THR n 
1 32  LYS n 
1 33  MET n 
1 34  ARG n 
1 35  ALA n 
1 36  ALA n 
1 37  ALA n 
1 38  LEU n 
1 39  ASP n 
1 40  ALA n 
1 41  GLN n 
1 42  LYS n 
1 43  ALA n 
1 44  THR n 
1 45  PRO n 
1 46  PRO n 
1 47  LYS n 
1 48  LEU n 
1 49  GLU n 
1 50  ASP n 
1 51  LYS n 
1 52  SER n 
1 53  PRO n 
1 54  ASP n 
1 55  SER n 
1 56  PRO n 
1 57  GLU n 
1 58  MET n 
1 59  LYS n 
1 60  ASP n 
1 61  PHE n 
1 62  ARG n 
1 63  HIS n 
1 64  GLY n 
1 65  PHE n 
1 66  ASP n 
1 67  ILE n 
1 68  LEU n 
1 69  VAL n 
1 70  GLY n 
1 71  GLN n 
1 72  ILE n 
1 73  ASP n 
1 74  ASP n 
1 75  ALA n 
1 76  LEU n 
1 77  LYS n 
1 78  LEU n 
1 79  ALA n 
1 80  ASN n 
1 81  GLU n 
1 82  GLY n 
1 83  LYS n 
1 84  VAL n 
1 85  LYS n 
1 86  GLU n 
1 87  ALA n 
1 88  GLN n 
1 89  ALA n 
1 90  ALA n 
1 91  ALA n 
1 92  GLU n 
1 93  GLN n 
1 94  LEU n 
1 95  LYS n 
1 96  THR n 
1 97  THR n 
1 98  ARG n 
1 99  ASN n 
1 100 ALA n 
1 101 TYR n 
1 102 ILE n 
1 103 GLN n 
1 104 LYS n 
1 105 TYR n 
1 106 LEU n 
1 107 GLY n 
1 108 SER n 
1 109 GLY n 
1 110 SER n 
1 111 CYS n 
1 112 SER n 
1 113 GLN n 
1 114 LYS n 
1 115 PRO n 
1 116 SER n 
1 117 ASP n 
1 118 LYS n 
1 119 HIS n 
1 120 LEU n 
1 121 ASP n 
1 122 ALA n 
1 123 ILE n 
1 124 PRO n 
1 125 ILE n 
1 126 LEU n 
1 127 TYR n 
1 128 TYR n 
1 129 ILE n 
1 130 ILE n 
1 131 PHE n 
1 132 VAL n 
1 133 ILE n 
1 134 GLY n 
1 135 PHE n 
1 136 LEU n 
1 137 VAL n 
1 138 ASN n 
1 139 ILE n 
1 140 VAL n 
1 141 VAL n 
1 142 VAL n 
1 143 THR n 
1 144 LEU n 
1 145 PHE n 
1 146 CYS n 
1 147 CYS n 
1 148 GLN n 
1 149 LYS n 
1 150 GLY n 
1 151 PRO n 
1 152 LYS n 
1 153 LYS n 
1 154 VAL n 
1 155 SER n 
1 156 SER n 
1 157 ILE n 
1 158 TYR n 
1 159 ILE n 
1 160 PHE n 
1 161 ASN n 
1 162 LEU n 
1 163 ALA n 
1 164 VAL n 
1 165 ALA n 
1 166 ASP n 
1 167 LEU n 
1 168 LEU n 
1 169 LEU n 
1 170 LEU n 
1 171 ALA n 
1 172 THR n 
1 173 LEU n 
1 174 PRO n 
1 175 LEU n 
1 176 TRP n 
1 177 ALA n 
1 178 THR n 
1 179 TYR n 
1 180 TYR n 
1 181 SER n 
1 182 TYR n 
1 183 ARG n 
1 184 TYR n 
1 185 ASP n 
1 186 TRP n 
1 187 LEU n 
1 188 PHE n 
1 189 GLY n 
1 190 PRO n 
1 191 VAL n 
1 192 MET n 
1 193 CYS n 
1 194 LYS n 
1 195 VAL n 
1 196 PHE n 
1 197 GLY n 
1 198 SER n 
1 199 PHE n 
1 200 LEU n 
1 201 THR n 
1 202 LEU n 
1 203 ASN n 
1 204 MET n 
1 205 PHE n 
1 206 ALA n 
1 207 SER n 
1 208 ILE n 
1 209 PHE n 
1 210 PHE n 
1 211 ILE n 
1 212 THR n 
1 213 CYS n 
1 214 MET n 
1 215 SER n 
1 216 VAL n 
1 217 ASP n 
1 218 ARG n 
1 219 TYR n 
1 220 GLN n 
1 221 SER n 
1 222 VAL n 
1 223 ILE n 
1 224 TYR n 
1 225 PRO n 
1 226 PHE n 
1 227 LEU n 
1 228 SER n 
1 229 GLN n 
1 230 ARG n 
1 231 ARG n 
1 232 ASN n 
1 233 PRO n 
1 234 TRP n 
1 235 GLN n 
1 236 ALA n 
1 237 SER n 
1 238 TYR n 
1 239 ILE n 
1 240 VAL n 
1 241 PRO n 
1 242 LEU n 
1 243 VAL n 
1 244 TRP n 
1 245 CYS n 
1 246 MET n 
1 247 ALA n 
1 248 CYS n 
1 249 LEU n 
1 250 SER n 
1 251 SER n 
1 252 LEU n 
1 253 PRO n 
1 254 THR n 
1 255 PHE n 
1 256 TYR n 
1 257 PHE n 
1 258 ARG n 
1 259 ASP n 
1 260 VAL n 
1 261 ARG n 
1 262 THR n 
1 263 ILE n 
1 264 GLU n 
1 265 TYR n 
1 266 LEU n 
1 267 GLY n 
1 268 VAL n 
1 269 ASN n 
1 270 ALA n 
1 271 CYS n 
1 272 ILE n 
1 273 MET n 
1 274 ALA n 
1 275 PHE n 
1 276 PRO n 
1 277 PRO n 
1 278 GLU n 
1 279 LYS n 
1 280 TYR n 
1 281 ALA n 
1 282 GLN n 
1 283 TRP n 
1 284 SER n 
1 285 ALA n 
1 286 GLY n 
1 287 ILE n 
1 288 ALA n 
1 289 LEU n 
1 290 MET n 
1 291 LYS n 
1 292 ASN n 
1 293 ILE n 
1 294 LEU n 
1 295 GLY n 
1 296 PHE n 
1 297 ILE n 
1 298 ILE n 
1 299 PRO n 
1 300 LEU n 
1 301 ILE n 
1 302 PHE n 
1 303 ILE n 
1 304 ALA n 
1 305 THR n 
1 306 CYS n 
1 307 TYR n 
1 308 PHE n 
1 309 GLY n 
1 310 ILE n 
1 311 ARG n 
1 312 LYS n 
1 313 HIS n 
1 314 LEU n 
1 315 LEU n 
1 316 LYS n 
1 317 THR n 
1 318 ASN n 
1 319 SER n 
1 320 TYR n 
1 321 GLY n 
1 322 LYS n 
1 323 ASN n 
1 324 ARG n 
1 325 ILE n 
1 326 THR n 
1 327 ARG n 
1 328 ASP n 
1 329 GLN n 
1 330 VAL n 
1 331 LEU n 
1 332 LYS n 
1 333 MET n 
1 334 ALA n 
1 335 ALA n 
1 336 ALA n 
1 337 VAL n 
1 338 VAL n 
1 339 LEU n 
1 340 ALA n 
1 341 PHE n 
1 342 ILE n 
1 343 ILE n 
1 344 CYS n 
1 345 TRP n 
1 346 LEU n 
1 347 PRO n 
1 348 PHE n 
1 349 HIS n 
1 350 VAL n 
1 351 LEU n 
1 352 THR n 
1 353 PHE n 
1 354 LEU n 
1 355 ASP n 
1 356 ALA n 
1 357 LEU n 
1 358 ALA n 
1 359 TRP n 
1 360 MET n 
1 361 GLY n 
1 362 VAL n 
1 363 ILE n 
1 364 ASN n 
1 365 SER n 
1 366 CYS n 
1 367 GLU n 
1 368 VAL n 
1 369 ILE n 
1 370 ALA n 
1 371 VAL n 
1 372 ILE n 
1 373 ASP n 
1 374 LEU n 
1 375 ALA n 
1 376 LEU n 
1 377 PRO n 
1 378 PHE n 
1 379 ALA n 
1 380 ILE n 
1 381 LEU n 
1 382 LEU n 
1 383 GLY n 
1 384 PHE n 
1 385 THR n 
1 386 ASN n 
1 387 SER n 
1 388 CYS n 
1 389 VAL n 
1 390 ASN n 
1 391 PRO n 
1 392 PHE n 
1 393 LEU n 
1 394 TYR n 
1 395 CYS n 
1 396 PHE n 
1 397 VAL n 
1 398 GLY n 
1 399 ASN n 
1 400 ARG n 
1 401 PHE n 
1 402 GLN n 
1 403 GLN n 
1 404 LYS n 
1 405 LEU n 
1 406 ARG n 
1 407 SER n 
1 408 VAL n 
1 409 PHE n 
1 410 ARG n 
1 411 VAL n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   106 ?     ? cybC  ? ? ? ? ? ? 'Escherichia coli' 562  ? ? ? ? ? ? ? ? 'Spodoptera frugiperda' 
7108 ? ? ? ? ? ? sf9 ? ? ? ? ? ? ? ? ? ? ? pFastBac ? ? 
1 2 sample 'Biological sequence' 107 411 Human ? AGTR2 ? ? ? ? ? ? 'Homo sapiens'     9606 ? ? ? ? ? ? ? ? 'Spodoptera frugiperda' 
7108 ? ? ? ? ? ? sf9 ? ? ? ? ? ? ? ? ? ? ? pFastBac ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP C562_ECOLX  P0ABE7 ? 1 
;ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLAN
EGKVKEAQAAAEQLKTTRNAYHQKYR
;
23 
2 UNP AGTR2_HUMAN P50052 ? 1 
;CSQKPSDKHLDAIPILYYIIFVIGFLVNIVVVTLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGP
VMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIVPLVWCMACLSSLPTFYFRDVRTIEYLGVNA
CIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHV
LTFLDALAWMGVINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRV
;
35 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5UNH A 1   ? 106 ? P0ABE7 23 ? 128 ? 1001 1106 
2 2 5UNH A 111 ? 411 ? P50052 35 ? 335 ? 35   335  
3 1 5UNH B 1   ? 106 ? P0ABE7 23 ? 128 ? 1001 1106 
4 2 5UNH B 111 ? 411 ? P50052 35 ? 335 ? 35   335  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5UNH TRP A 7   ? UNP P0ABE7 MET 29  'engineered mutation' 1007 1  
1 5UNH ILE A 102 ? UNP P0ABE7 HIS 124 'engineered mutation' 1102 2  
1 5UNH LEU A 106 ? UNP P0ABE7 ARG 128 'engineered mutation' 1106 3  
1 5UNH GLY A 107 ? UNP P0ABE7 ?   ?   linker                1107 4  
1 5UNH SER A 108 ? UNP P0ABE7 ?   ?   linker                1108 5  
1 5UNH GLY A 109 ? UNP P0ABE7 ?   ?   linker                1109 6  
1 5UNH SER A 110 ? UNP P0ABE7 ?   ?   linker                1110 7  
3 5UNH TRP B 7   ? UNP P0ABE7 MET 29  'engineered mutation' 1007 8  
3 5UNH ILE B 102 ? UNP P0ABE7 HIS 124 'engineered mutation' 1102 9  
3 5UNH LEU B 106 ? UNP P0ABE7 ARG 128 'engineered mutation' 1106 10 
3 5UNH GLY B 107 ? UNP P0ABE7 ?   ?   linker                1107 11 
3 5UNH SER B 108 ? UNP P0ABE7 ?   ?   linker                1108 12 
3 5UNH GLY B 109 ? UNP P0ABE7 ?   ?   linker                1109 13 
3 5UNH SER B 110 ? UNP P0ABE7 ?   ?   linker                1110 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
8EM non-polymer         . 
"N-[(furan-2-yl)methyl]-N-(4-oxo-2-propyl-3-{[2'-(2H-tetrazol-5-yl)[1,1'-biphenyl]-4-yl]methyl}-3,4-dihydroquinazolin-6-yl)benzamide" 
? 'C37 H31 N7 O3'  621.687 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5UNH 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.48 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         50.42 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'LIPIDIC CUBIC PHASE' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'100 mM Tris-HCl, pH 8.0, 25 mM potassium formate, 25% (v/v) PEG400, and 0.3% (v/v) (+/-)-2-Methyl-2,4-pentanediol' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 S 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-12-04 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.033 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 23-ID-D' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.033 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-D 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            79.1 
_reflns.entry_id                         5UNH 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.90 
_reflns.d_resolution_low                 30.00 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       18479 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             91.0 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.5 
_reflns.pdbx_Rmerge_I_obs                0.13 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            5.8 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.90 
_reflns_shell.d_res_low                   3.06 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.8 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        83.2 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.44 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             2.5 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            0.32990 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            -2.02410 
_refine.aniso_B[2][2]                            -4.87500 
_refine.aniso_B[2][3]                            0.00000 
_refine.aniso_B[3][3]                            4.54510 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               100.39 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.922 
_refine.correlation_coeff_Fo_to_Fc_free          0.861 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5UNH 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.90 
_refine.ls_d_res_low                             30.00 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     18462 
_refine.ls_number_reflns_R_free                  906 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    90.3 
_refine.ls_percent_reflns_R_free                 4.910 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.218 
_refine.ls_R_factor_R_free                       0.259 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.216 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      '4YAY, 4ZUD' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.421 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_analyze.entry_id                        5UNH 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_coordinate_error_obs    0.47 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        5783 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         94 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               5877 
_refine_hist.d_res_high                       2.90 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.009 ? 6020 ? t_bond_d                  2.00  HARMONIC     
'X-RAY DIFFRACTION' ? 0.97  ? 8214 ? t_angle_deg               2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 2659 ? t_dihedral_angle_d        2.00  SINUSOIDAL   
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_incorr_chiral_ct        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_pseud_angle             ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 106  ? t_trig_c_planes           2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 971  ? t_gen_planes              5.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 6020 ? t_it                      20.00 HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_nbd                     ?     ?            
'X-RAY DIFFRACTION' ? 2.13  ? ?    ? t_omega_torsion           ?     ?            
'X-RAY DIFFRACTION' ? 3.18  ? ?    ? t_other_torsion           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_improper_torsion        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 822  ? t_chiral_improper_torsion 5.00  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_sum_occupancies         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_distance        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_angle           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_torsion         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 6972 ? t_ideal_dist_contact      4.00  SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.90 
_refine_ls_shell.d_res_low                        3.08 
_refine_ls_shell.number_reflns_all                2714 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             130 
_refine_ls_shell.number_reflns_R_work             2584 
_refine_ls_shell.percent_reflns_obs               82.73 
_refine_ls_shell.percent_reflns_R_free            4.79 
_refine_ls_shell.R_factor_all                     0.217 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.246 
_refine_ls_shell.R_factor_R_free_error            0.000 
_refine_ls_shell.R_factor_R_work                  0.216 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   9 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5UNH 
_struct.title                        
;Synchrotron structure of human angiotensin II type 2 receptor in complex with compound 2 (N-[(furan-2-yl)methyl]-N-(4-oxo-2-propyl-3-{[2'-(2H-tetrazol-5-yl)[1,1'- biphenyl]-4-yl]methyl}-3,4-dihydroquinazolin-6-yl)benzamide)
;
_struct.pdbx_descriptor              'Soluble cytochrome b562,Type-2 angiotensin II receptor' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5UNH 
_struct_keywords.text            
;human Angiotensin II receptor complex, GPCR signaling, GPCR, BRIL, membrane protein, LCP, Synchrotron, blood pressure regulation, compound 2 (cpd 2), SIGNALING PROTEIN
;
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.details                      'AUTHORS STATE THAT THE BIOLOGICAL UNIT IS UNKNOWN' 
_struct_biol.id                           1 
_struct_biol.pdbx_aggregation_state       ? 
_struct_biol.pdbx_assembly_method         ? 
_struct_biol.pdbx_formula_weight          ? 
_struct_biol.pdbx_formula_weight_method   ? 
_struct_biol.pdbx_parent_biol_id          ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 LEU A 3   ? ALA A 20  ? LEU A 1003 ALA A 1020 1 ? 18 
HELX_P HELX_P2  AA2 ASN A 22  ? LYS A 42  ? ASN A 1022 LYS A 1042 1 ? 21 
HELX_P HELX_P3  AA3 SER A 55  ? GLU A 81  ? SER A 1055 GLU A 1081 1 ? 27 
HELX_P HELX_P4  AA4 LYS A 83  ? LEU A 106 ? LYS A 1083 LEU A 1106 1 ? 24 
HELX_P HELX_P5  AA5 PRO A 115 ? HIS A 119 ? PRO A 39   HIS A 43   5 ? 5  
HELX_P HELX_P6  AA6 ASP A 121 ? LYS A 149 ? ASP A 45   LYS A 73   1 ? 29 
HELX_P HELX_P7  AA7 VAL A 154 ? ALA A 171 ? VAL A 78   ALA A 95   1 ? 18 
HELX_P HELX_P8  AA8 THR A 172 ? TYR A 180 ? THR A 96   TYR A 104  1 ? 9  
HELX_P HELX_P9  AA9 SER A 181 ? ARG A 183 ? SER A 105  ARG A 107  5 ? 3  
HELX_P HELX_P10 AB1 GLY A 189 ? TYR A 224 ? GLY A 113  TYR A 148  1 ? 36 
HELX_P HELX_P11 AB2 TYR A 238 ? SER A 251 ? TYR A 162  SER A 175  1 ? 14 
HELX_P HELX_P12 AB3 SER A 251 ? PHE A 257 ? SER A 175  PHE A 181  1 ? 7  
HELX_P HELX_P13 AB4 PRO A 276 ? GLU A 278 ? PRO A 200  GLU A 202  5 ? 3  
HELX_P HELX_P14 AB5 LYS A 279 ? PHE A 296 ? LYS A 203  PHE A 220  1 ? 18 
HELX_P HELX_P15 AB6 PHE A 296 ? LEU A 315 ? PHE A 220  LEU A 239  1 ? 20 
HELX_P HELX_P16 AB7 LYS A 322 ? GLY A 361 ? LYS A 246  GLY A 285  1 ? 40 
HELX_P HELX_P17 AB8 SER A 365 ? TYR A 394 ? SER A 289  TYR A 318  1 ? 30 
HELX_P HELX_P18 AB9 VAL A 397 ? PHE A 409 ? VAL A 321  PHE A 333  1 ? 13 
HELX_P HELX_P19 AC1 LEU B 3   ? ALA B 20  ? LEU B 1003 ALA B 1020 1 ? 18 
HELX_P HELX_P20 AC2 ASN B 22  ? GLN B 41  ? ASN B 1022 GLN B 1041 1 ? 20 
HELX_P HELX_P21 AC3 PRO B 56  ? GLU B 81  ? PRO B 1056 GLU B 1081 1 ? 26 
HELX_P HELX_P22 AC4 LYS B 83  ? TYR B 101 ? LYS B 1083 TYR B 1101 1 ? 19 
HELX_P HELX_P23 AC5 ASP B 121 ? CYS B 146 ? ASP B 45   CYS B 70   1 ? 26 
HELX_P HELX_P24 AC6 VAL B 154 ? ALA B 171 ? VAL B 78   ALA B 95   1 ? 18 
HELX_P HELX_P25 AC7 THR B 172 ? TYR B 182 ? THR B 96   TYR B 106  1 ? 11 
HELX_P HELX_P26 AC8 GLY B 189 ? TYR B 224 ? GLY B 113  TYR B 148  1 ? 36 
HELX_P HELX_P27 AC9 TYR B 238 ? SER B 251 ? TYR B 162  SER B 175  1 ? 14 
HELX_P HELX_P28 AD1 SER B 251 ? PHE B 257 ? SER B 175  PHE B 181  1 ? 7  
HELX_P HELX_P29 AD2 ALA B 281 ? PHE B 296 ? ALA B 205  PHE B 220  1 ? 16 
HELX_P HELX_P30 AD3 PHE B 296 ? LYS B 316 ? PHE B 220  LYS B 240  1 ? 21 
HELX_P HELX_P31 AD4 GLY B 321 ? GLY B 361 ? GLY B 245  GLY B 285  1 ? 41 
HELX_P HELX_P32 AD5 SER B 365 ? TYR B 394 ? SER B 289  TYR B 318  1 ? 30 
HELX_P HELX_P33 AD6 VAL B 397 ? ARG B 406 ? VAL B 321  ARG B 330  1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 193 SG ? ? ? 1_555 A CYS 271 SG ? ? A CYS 117 A CYS 195 1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf2 disulf ? ? B CYS 193 SG ? ? ? 1_555 B CYS 271 SG ? ? B CYS 117 B CYS 195 1_555 ? ? ? ? ? ? ? 2.038 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 258 ? ILE A 263 ? ARG A 182 ILE A 187 
AA1 2 VAL A 268 ? MET A 273 ? VAL A 192 MET A 197 
AA2 1 ARG B 258 ? ILE B 263 ? ARG B 182 ILE B 187 
AA2 2 VAL B 268 ? MET B 273 ? VAL B 192 MET B 197 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 261 ? N ARG A 185 O ALA A 270 ? O ALA A 194 
AA2 1 2 N ARG B 261 ? N ARG B 185 O ALA B 270 ? O ALA B 194 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A 8EM 1501 ? 14 'binding site for residue 8EM A 1501' 
AC2 Software B 8EM 1501 ? 14 'binding site for residue 8EM B 1501' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 14 TRP A 176 ? TRP A 100 . ? 1_555 ? 
2  AC1 14 TYR A 179 ? TYR A 103 . ? 1_555 ? 
3  AC1 14 LEU A 200 ? LEU A 124 . ? 1_555 ? 
4  AC1 14 THR A 201 ? THR A 125 . ? 1_555 ? 
5  AC1 14 MET A 204 ? MET A 128 . ? 1_555 ? 
6  AC1 14 PHE A 205 ? PHE A 129 . ? 1_555 ? 
7  AC1 14 THR A 254 ? THR A 178 . ? 1_555 ? 
8  AC1 14 ARG A 258 ? ARG A 182 . ? 1_555 ? 
9  AC1 14 CYS A 271 ? CYS A 195 . ? 1_555 ? 
10 AC1 14 LYS A 291 ? LYS A 215 . ? 1_555 ? 
11 AC1 14 TRP A 345 ? TRP A 269 . ? 1_555 ? 
12 AC1 14 PHE A 348 ? PHE A 272 . ? 1_555 ? 
13 AC1 14 GLY A 383 ? GLY A 307 . ? 1_555 ? 
14 AC1 14 PHE A 384 ? PHE A 308 . ? 1_555 ? 
15 AC2 14 TRP B 176 ? TRP B 100 . ? 1_555 ? 
16 AC2 14 TYR B 179 ? TYR B 103 . ? 1_555 ? 
17 AC2 14 LEU B 200 ? LEU B 124 . ? 1_555 ? 
18 AC2 14 THR B 201 ? THR B 125 . ? 1_555 ? 
19 AC2 14 MET B 204 ? MET B 128 . ? 1_555 ? 
20 AC2 14 PHE B 205 ? PHE B 129 . ? 1_555 ? 
21 AC2 14 THR B 254 ? THR B 178 . ? 1_555 ? 
22 AC2 14 ARG B 258 ? ARG B 182 . ? 1_555 ? 
23 AC2 14 CYS B 271 ? CYS B 195 . ? 1_555 ? 
24 AC2 14 MET B 273 ? MET B 197 . ? 1_555 ? 
25 AC2 14 TRP B 345 ? TRP B 269 . ? 1_555 ? 
26 AC2 14 PHE B 348 ? PHE B 272 . ? 1_555 ? 
27 AC2 14 ILE B 380 ? ILE B 304 . ? 1_555 ? 
28 AC2 14 GLY B 383 ? GLY B 307 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5UNH 
_atom_sites.fract_transf_matrix[1][1]   0.012752 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003255 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014663 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011588 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 1   ? 85.384  -44.863  -2.363  1.00 118.12 ? 1001 ALA A N   1 
ATOM   2    C CA  . ALA A 1 1   ? 84.440  -45.677  -3.128  1.00 114.75 ? 1001 ALA A CA  1 
ATOM   3    C C   . ALA A 1 1   ? 85.192  -46.646  -4.075  1.00 117.94 ? 1001 ALA A C   1 
ATOM   4    O O   . ALA A 1 1   ? 84.825  -46.801  -5.246  1.00 120.03 ? 1001 ALA A O   1 
ATOM   5    C CB  . ALA A 1 1   ? 83.489  -44.773  -3.911  1.00 119.16 ? 1001 ALA A CB  1 
ATOM   6    N N   . ASP A 1 2   ? 86.226  -47.318  -3.545  1.00 111.82 ? 1002 ASP A N   1 
ATOM   7    C CA  . ASP A 1 2   ? 87.087  -48.196  -4.331  1.00 112.68 ? 1002 ASP A CA  1 
ATOM   8    C C   . ASP A 1 2   ? 86.996  -49.685  -3.901  1.00 109.37 ? 1002 ASP A C   1 
ATOM   9    O O   . ASP A 1 2   ? 87.959  -50.439  -4.101  1.00 111.16 ? 1002 ASP A O   1 
ATOM   10   C CB  . ASP A 1 2   ? 88.534  -47.676  -4.213  1.00 119.96 ? 1002 ASP A CB  1 
ATOM   11   C CG  . ASP A 1 2   ? 89.546  -48.292  -5.156  1.00 139.66 ? 1002 ASP A CG  1 
ATOM   12   O OD1 . ASP A 1 2   ? 89.416  -48.087  -6.385  1.00 145.47 ? 1002 ASP A OD1 1 
ATOM   13   O OD2 . ASP A 1 2   ? 90.489  -48.954  -4.663  1.00 146.89 ? 1002 ASP A OD2 1 
ATOM   14   N N   . LEU A 1 3   ? 85.828  -50.122  -3.371  1.00 97.44  ? 1003 LEU A N   1 
ATOM   15   C CA  . LEU A 1 3   ? 85.571  -51.493  -2.900  1.00 91.64  ? 1003 LEU A CA  1 
ATOM   16   C C   . LEU A 1 3   ? 86.376  -51.781  -1.615  1.00 92.08  ? 1003 LEU A C   1 
ATOM   17   O O   . LEU A 1 3   ? 85.760  -52.053  -0.587  1.00 89.45  ? 1003 LEU A O   1 
ATOM   18   C CB  . LEU A 1 3   ? 85.832  -52.566  -3.984  1.00 92.76  ? 1003 LEU A CB  1 
ATOM   19   C CG  . LEU A 1 3   ? 85.646  -54.017  -3.553  1.00 94.59  ? 1003 LEU A CG  1 
ATOM   20   C CD1 . LEU A 1 3   ? 84.698  -54.722  -4.455  1.00 94.65  ? 1003 LEU A CD1 1 
ATOM   21   C CD2 . LEU A 1 3   ? 86.976  -54.751  -3.511  1.00 100.26 ? 1003 LEU A CD2 1 
ATOM   22   N N   . GLU A 1 4   ? 87.731  -51.751  -1.682  1.00 89.19  ? 1004 GLU A N   1 
ATOM   23   C CA  . GLU A 1 4   ? 88.650  -51.956  -0.551  1.00 88.37  ? 1004 GLU A CA  1 
ATOM   24   C C   . GLU A 1 4   ? 88.399  -50.882  0.523   1.00 89.80  ? 1004 GLU A C   1 
ATOM   25   O O   . GLU A 1 4   ? 88.361  -51.193  1.717   1.00 86.48  ? 1004 GLU A O   1 
ATOM   26   C CB  . GLU A 1 4   ? 90.116  -51.912  -1.046  1.00 94.57  ? 1004 GLU A CB  1 
ATOM   27   C CG  . GLU A 1 4   ? 91.165  -52.157  0.035   1.00 107.93 ? 1004 GLU A CG  1 
ATOM   28   C CD  . GLU A 1 4   ? 92.583  -51.679  -0.237  1.00 139.00 ? 1004 GLU A CD  1 
ATOM   29   O OE1 . GLU A 1 4   ? 93.528  -52.349  0.241   1.00 144.77 ? 1004 GLU A OE1 1 
ATOM   30   O OE2 . GLU A 1 4   ? 92.755  -50.621  -0.886  1.00 135.33 ? 1004 GLU A OE2 1 
ATOM   31   N N   . ASP A 1 5   ? 88.211  -49.623  0.065   1.00 88.87  ? 1005 ASP A N   1 
ATOM   32   C CA  . ASP A 1 5   ? 87.934  -48.427  0.860   1.00 90.02  ? 1005 ASP A CA  1 
ATOM   33   C C   . ASP A 1 5   ? 86.523  -48.475  1.410   1.00 88.93  ? 1005 ASP A C   1 
ATOM   34   O O   . ASP A 1 5   ? 86.260  -47.913  2.475   1.00 87.46  ? 1005 ASP A O   1 
ATOM   35   C CB  . ASP A 1 5   ? 88.133  -47.165  0.006   1.00 97.10  ? 1005 ASP A CB  1 
ATOM   36   C CG  . ASP A 1 5   ? 89.547  -46.967  -0.523  1.00 113.56 ? 1005 ASP A CG  1 
ATOM   37   O OD1 . ASP A 1 5   ? 90.508  -47.400  0.157   1.00 115.11 ? 1005 ASP A OD1 1 
ATOM   38   O OD2 . ASP A 1 5   ? 89.696  -46.339  -1.587  1.00 124.06 ? 1005 ASP A OD2 1 
ATOM   39   N N   . ASN A 1 6   ? 85.616  -49.147  0.675   1.00 84.00  ? 1006 ASN A N   1 
ATOM   40   C CA  . ASN A 1 6   ? 84.225  -49.374  1.072   1.00 80.76  ? 1006 ASN A CA  1 
ATOM   41   C C   . ASN A 1 6   ? 84.142  -50.486  2.118   1.00 83.28  ? 1006 ASN A C   1 
ATOM   42   O O   . ASN A 1 6   ? 83.295  -50.416  3.007   1.00 80.51  ? 1006 ASN A O   1 
ATOM   43   C CB  . ASN A 1 6   ? 83.357  -49.717  -0.132  1.00 78.85  ? 1006 ASN A CB  1 
ATOM   44   C CG  . ASN A 1 6   ? 82.883  -48.520  -0.907  1.00 97.67  ? 1006 ASN A CG  1 
ATOM   45   O OD1 . ASN A 1 6   ? 83.212  -48.363  -2.085  1.00 96.58  ? 1006 ASN A OD1 1 
ATOM   46   N ND2 . ASN A 1 6   ? 82.059  -47.685  -0.282  1.00 87.64  ? 1006 ASN A ND2 1 
ATOM   47   N N   . TRP A 1 7   ? 85.025  -51.499  2.021   1.00 82.58  ? 1007 TRP A N   1 
ATOM   48   C CA  . TRP A 1 7   ? 85.088  -52.592  2.984   1.00 82.28  ? 1007 TRP A CA  1 
ATOM   49   C C   . TRP A 1 7   ? 85.690  -52.103  4.295   1.00 89.34  ? 1007 TRP A C   1 
ATOM   50   O O   . TRP A 1 7   ? 85.256  -52.552  5.357   1.00 88.52  ? 1007 TRP A O   1 
ATOM   51   C CB  . TRP A 1 7   ? 85.854  -53.801  2.440   1.00 82.44  ? 1007 TRP A CB  1 
ATOM   52   C CG  . TRP A 1 7   ? 84.966  -54.808  1.773   1.00 82.14  ? 1007 TRP A CG  1 
ATOM   53   C CD1 . TRP A 1 7   ? 84.925  -55.108  0.443   1.00 86.13  ? 1007 TRP A CD1 1 
ATOM   54   C CD2 . TRP A 1 7   ? 83.953  -55.613  2.399   1.00 80.05  ? 1007 TRP A CD2 1 
ATOM   55   N NE1 . TRP A 1 7   ? 83.956  -56.054  0.201   1.00 84.60  ? 1007 TRP A NE1 1 
ATOM   56   C CE2 . TRP A 1 7   ? 83.352  -56.391  1.385   1.00 84.20  ? 1007 TRP A CE2 1 
ATOM   57   C CE3 . TRP A 1 7   ? 83.487  -55.747  3.722   1.00 80.31  ? 1007 TRP A CE3 1 
ATOM   58   C CZ2 . TRP A 1 7   ? 82.312  -57.291  1.650   1.00 82.46  ? 1007 TRP A CZ2 1 
ATOM   59   C CZ3 . TRP A 1 7   ? 82.449  -56.627  3.981   1.00 80.43  ? 1007 TRP A CZ3 1 
ATOM   60   C CH2 . TRP A 1 7   ? 81.882  -57.395  2.955   1.00 81.16  ? 1007 TRP A CH2 1 
ATOM   61   N N   . GLU A 1 8   ? 86.652  -51.149  4.227   1.00 89.59  ? 1008 GLU A N   1 
ATOM   62   C CA  . GLU A 1 8   ? 87.256  -50.522  5.407   1.00 92.47  ? 1008 GLU A CA  1 
ATOM   63   C C   . GLU A 1 8   ? 86.176  -49.812  6.214   1.00 93.49  ? 1008 GLU A C   1 
ATOM   64   O O   . GLU A 1 8   ? 86.179  -49.917  7.433   1.00 93.44  ? 1008 GLU A O   1 
ATOM   65   C CB  . GLU A 1 8   ? 88.372  -49.535  5.020   1.00 99.37  ? 1008 GLU A CB  1 
ATOM   66   C CG  . GLU A 1 8   ? 89.770  -50.016  5.369   1.00 121.33 ? 1008 GLU A CG  1 
ATOM   67   C CD  . GLU A 1 8   ? 90.134  -49.991  6.843   1.00 163.50 ? 1008 GLU A CD  1 
ATOM   68   O OE1 . GLU A 1 8   ? 90.702  -48.972  7.298   1.00 170.75 ? 1008 GLU A OE1 1 
ATOM   69   O OE2 . GLU A 1 8   ? 89.876  -51.001  7.539   1.00 164.48 ? 1008 GLU A OE2 1 
ATOM   70   N N   . THR A 1 9   ? 85.222  -49.146  5.519   1.00 87.91  ? 1009 THR A N   1 
ATOM   71   C CA  . THR A 1 9   ? 84.079  -48.435  6.106   1.00 86.46  ? 1009 THR A CA  1 
ATOM   72   C C   . THR A 1 9   ? 83.131  -49.440  6.787   1.00 84.26  ? 1009 THR A C   1 
ATOM   73   O O   . THR A 1 9   ? 82.722  -49.205  7.926   1.00 84.54  ? 1009 THR A O   1 
ATOM   74   C CB  . THR A 1 9   ? 83.351  -47.600  5.031   1.00 93.15  ? 1009 THR A CB  1 
ATOM   75   O OG1 . THR A 1 9   ? 84.311  -46.869  4.264   1.00 99.41  ? 1009 THR A OG1 1 
ATOM   76   C CG2 . THR A 1 9   ? 82.332  -46.640  5.625   1.00 90.94  ? 1009 THR A CG2 1 
ATOM   77   N N   . LEU A 1 10  ? 82.809  -50.560  6.098   1.00 75.78  ? 1010 LEU A N   1 
ATOM   78   C CA  . LEU A 1 10  ? 81.923  -51.612  6.609   1.00 71.95  ? 1010 LEU A CA  1 
ATOM   79   C C   . LEU A 1 10  ? 82.531  -52.323  7.815   1.00 76.15  ? 1010 LEU A C   1 
ATOM   80   O O   . LEU A 1 10  ? 81.803  -52.634  8.756   1.00 75.49  ? 1010 LEU A O   1 
ATOM   81   C CB  . LEU A 1 10  ? 81.585  -52.630  5.511   1.00 69.47  ? 1010 LEU A CB  1 
ATOM   82   C CG  . LEU A 1 10  ? 80.548  -52.170  4.481   1.00 72.89  ? 1010 LEU A CG  1 
ATOM   83   C CD1 . LEU A 1 10  ? 80.841  -52.743  3.121   1.00 72.95  ? 1010 LEU A CD1 1 
ATOM   84   C CD2 . LEU A 1 10  ? 79.143  -52.533  4.911   1.00 73.72  ? 1010 LEU A CD2 1 
ATOM   85   N N   . ASN A 1 11  ? 83.860  -52.546  7.802   1.00 74.19  ? 1011 ASN A N   1 
ATOM   86   C CA  . ASN A 1 11  ? 84.576  -53.209  8.893   1.00 76.01  ? 1011 ASN A CA  1 
ATOM   87   C C   . ASN A 1 11  ? 84.855  -52.246  10.053  1.00 83.71  ? 1011 ASN A C   1 
ATOM   88   O O   . ASN A 1 11  ? 84.890  -52.691  11.202  1.00 85.08  ? 1011 ASN A O   1 
ATOM   89   C CB  . ASN A 1 11  ? 85.875  -53.849  8.394   1.00 76.93  ? 1011 ASN A CB  1 
ATOM   90   C CG  . ASN A 1 11  ? 85.655  -55.054  7.508   1.00 85.58  ? 1011 ASN A CG  1 
ATOM   91   O OD1 . ASN A 1 11  ? 84.907  -55.978  7.846   1.00 79.88  ? 1011 ASN A OD1 1 
ATOM   92   N ND2 . ASN A 1 11  ? 86.317  -55.085  6.358   1.00 71.83  ? 1011 ASN A ND2 1 
ATOM   93   N N   . ASP A 1 12  ? 85.039  -50.939  9.759   1.00 82.56  ? 1012 ASP A N   1 
ATOM   94   C CA  . ASP A 1 12  ? 85.277  -49.903  10.771  1.00 87.32  ? 1012 ASP A CA  1 
ATOM   95   C C   . ASP A 1 12  ? 84.042  -49.743  11.651  1.00 90.03  ? 1012 ASP A C   1 
ATOM   96   O O   . ASP A 1 12  ? 84.156  -49.787  12.878  1.00 93.08  ? 1012 ASP A O   1 
ATOM   97   C CB  . ASP A 1 12  ? 85.648  -48.549  10.123  1.00 92.53  ? 1012 ASP A CB  1 
ATOM   98   C CG  . ASP A 1 12  ? 87.134  -48.208  10.080  1.00 115.28 ? 1012 ASP A CG  1 
ATOM   99   O OD1 . ASP A 1 12  ? 87.940  -49.085  9.682   1.00 116.76 ? 1012 ASP A OD1 1 
ATOM   100  O OD2 . ASP A 1 12  ? 87.485  -47.044  10.385  1.00 127.87 ? 1012 ASP A OD2 1 
ATOM   101  N N   . ASN A 1 13  ? 82.858  -49.605  11.014  1.00 81.95  ? 1013 ASN A N   1 
ATOM   102  C CA  . ASN A 1 13  ? 81.574  -49.428  11.685  1.00 80.43  ? 1013 ASN A CA  1 
ATOM   103  C C   . ASN A 1 13  ? 81.132  -50.697  12.414  1.00 81.94  ? 1013 ASN A C   1 
ATOM   104  O O   . ASN A 1 13  ? 80.388  -50.593  13.390  1.00 83.06  ? 1013 ASN A O   1 
ATOM   105  C CB  . ASN A 1 13  ? 80.514  -48.959  10.703  1.00 76.45  ? 1013 ASN A CB  1 
ATOM   106  C CG  . ASN A 1 13  ? 80.673  -47.500  10.369  1.00 98.88  ? 1013 ASN A CG  1 
ATOM   107  O OD1 . ASN A 1 13  ? 80.284  -46.620  11.139  1.00 97.09  ? 1013 ASN A OD1 1 
ATOM   108  N ND2 . ASN A 1 13  ? 81.300  -47.205  9.242   1.00 88.72  ? 1013 ASN A ND2 1 
ATOM   109  N N   . LEU A 1 14  ? 81.611  -51.881  11.979  1.00 75.85  ? 1014 LEU A N   1 
ATOM   110  C CA  . LEU A 1 14  ? 81.310  -53.149  12.651  1.00 75.16  ? 1014 LEU A CA  1 
ATOM   111  C C   . LEU A 1 14  ? 81.886  -53.138  14.073  1.00 82.95  ? 1014 LEU A C   1 
ATOM   112  O O   . LEU A 1 14  ? 81.213  -53.571  15.008  1.00 83.70  ? 1014 LEU A O   1 
ATOM   113  C CB  . LEU A 1 14  ? 81.856  -54.345  11.860  1.00 73.52  ? 1014 LEU A CB  1 
ATOM   114  C CG  . LEU A 1 14  ? 80.866  -55.046  10.935  1.00 75.06  ? 1014 LEU A CG  1 
ATOM   115  C CD1 . LEU A 1 14  ? 81.597  -55.858  9.889   1.00 74.57  ? 1014 LEU A CD1 1 
ATOM   116  C CD2 . LEU A 1 14  ? 79.902  -55.937  11.713  1.00 78.17  ? 1014 LEU A CD2 1 
ATOM   117  N N   . LYS A 1 15  ? 83.115  -52.590  14.228  1.00 82.04  ? 1015 LYS A N   1 
ATOM   118  C CA  . LYS A 1 15  ? 83.822  -52.436  15.504  1.00 86.91  ? 1015 LYS A CA  1 
ATOM   119  C C   . LYS A 1 15  ? 83.080  -51.432  16.384  1.00 91.78  ? 1015 LYS A C   1 
ATOM   120  O O   . LYS A 1 15  ? 82.967  -51.642  17.594  1.00 94.76  ? 1015 LYS A O   1 
ATOM   121  C CB  . LYS A 1 15  ? 85.277  -51.975  15.277  1.00 92.57  ? 1015 LYS A CB  1 
ATOM   122  C CG  . LYS A 1 15  ? 86.109  -52.889  14.375  1.00 102.96 ? 1015 LYS A CG  1 
ATOM   123  C CD  . LYS A 1 15  ? 87.564  -52.436  14.311  1.00 114.98 ? 1015 LYS A CD  1 
ATOM   124  C CE  . LYS A 1 15  ? 88.323  -53.048  13.161  1.00 116.24 ? 1015 LYS A CE  1 
ATOM   125  N NZ  . LYS A 1 15  ? 89.730  -52.567  13.145  1.00 126.46 ? 1015 LYS A NZ  1 
ATOM   126  N N   . VAL A 1 16  ? 82.558  -50.354  15.756  1.00 86.50  ? 1016 VAL A N   1 
ATOM   127  C CA  . VAL A 1 16  ? 81.797  -49.271  16.388  1.00 89.09  ? 1016 VAL A CA  1 
ATOM   128  C C   . VAL A 1 16  ? 80.520  -49.848  17.031  1.00 92.49  ? 1016 VAL A C   1 
ATOM   129  O O   . VAL A 1 16  ? 80.230  -49.508  18.178  1.00 97.15  ? 1016 VAL A O   1 
ATOM   130  C CB  . VAL A 1 16  ? 81.480  -48.121  15.383  1.00 91.12  ? 1016 VAL A CB  1 
ATOM   131  C CG1 . VAL A 1 16  ? 80.569  -47.060  15.996  1.00 93.94  ? 1016 VAL A CG1 1 
ATOM   132  C CG2 . VAL A 1 16  ? 82.758  -47.478  14.853  1.00 93.56  ? 1016 VAL A CG2 1 
ATOM   133  N N   . ILE A 1 17  ? 79.797  -50.746  16.316  1.00 83.48  ? 1017 ILE A N   1 
ATOM   134  C CA  . ILE A 1 17  ? 78.559  -51.380  16.795  1.00 82.36  ? 1017 ILE A CA  1 
ATOM   135  C C   . ILE A 1 17  ? 78.845  -52.196  18.078  1.00 93.39  ? 1017 ILE A C   1 
ATOM   136  O O   . ILE A 1 17  ? 78.057  -52.125  19.024  1.00 96.07  ? 1017 ILE A O   1 
ATOM   137  C CB  . ILE A 1 17  ? 77.865  -52.229  15.678  1.00 79.02  ? 1017 ILE A CB  1 
ATOM   138  C CG1 . ILE A 1 17  ? 77.339  -51.314  14.546  1.00 75.92  ? 1017 ILE A CG1 1 
ATOM   139  C CG2 . ILE A 1 17  ? 76.710  -53.082  16.238  1.00 79.33  ? 1017 ILE A CG2 1 
ATOM   140  C CD1 . ILE A 1 17  ? 77.218  -51.959  13.166  1.00 73.60  ? 1017 ILE A CD1 1 
ATOM   141  N N   . GLU A 1 18  ? 79.982  -52.911  18.126  1.00 93.49  ? 1018 GLU A N   1 
ATOM   142  C CA  . GLU A 1 18  ? 80.377  -53.717  19.284  1.00 99.87  ? 1018 GLU A CA  1 
ATOM   143  C C   . GLU A 1 18  ? 80.725  -52.861  20.512  1.00 113.12 ? 1018 GLU A C   1 
ATOM   144  O O   . GLU A 1 18  ? 80.421  -53.269  21.635  1.00 117.45 ? 1018 GLU A O   1 
ATOM   145  C CB  . GLU A 1 18  ? 81.564  -54.622  18.934  1.00 101.79 ? 1018 GLU A CB  1 
ATOM   146  C CG  . GLU A 1 18  ? 81.148  -55.995  18.436  1.00 112.30 ? 1018 GLU A CG  1 
ATOM   147  C CD  . GLU A 1 18  ? 80.808  -56.063  16.961  1.00 137.60 ? 1018 GLU A CD  1 
ATOM   148  O OE1 . GLU A 1 18  ? 81.730  -56.324  16.154  1.00 140.02 ? 1018 GLU A OE1 1 
ATOM   149  O OE2 . GLU A 1 18  ? 79.622  -55.857  16.609  1.00 131.57 ? 1018 GLU A OE2 1 
ATOM   150  N N   . LYS A 1 19  ? 81.352  -51.686  20.301  1.00 112.82 ? 1019 LYS A N   1 
ATOM   151  C CA  . LYS A 1 19  ? 81.756  -50.775  21.378  1.00 120.78 ? 1019 LYS A CA  1 
ATOM   152  C C   . LYS A 1 19  ? 80.662  -49.731  21.711  1.00 127.34 ? 1019 LYS A C   1 
ATOM   153  O O   . LYS A 1 19  ? 80.836  -48.948  22.650  1.00 134.21 ? 1019 LYS A O   1 
ATOM   154  C CB  . LYS A 1 19  ? 83.083  -50.074  21.023  1.00 126.01 ? 1019 LYS A CB  1 
ATOM   155  C CG  . LYS A 1 19  ? 84.325  -50.955  21.181  1.00 143.96 ? 1019 LYS A CG  1 
ATOM   156  C CD  . LYS A 1 19  ? 84.858  -50.973  22.619  1.00 162.29 ? 1019 LYS A CD  1 
ATOM   157  C CE  . LYS A 1 19  ? 86.007  -51.937  22.791  1.00 172.17 ? 1019 LYS A CE  1 
ATOM   158  N NZ  . LYS A 1 19  ? 86.425  -52.049  24.213  1.00 188.52 ? 1019 LYS A NZ  1 
ATOM   159  N N   . ALA A 1 20  ? 79.535  -49.739  20.967  1.00 118.86 ? 1020 ALA A N   1 
ATOM   160  C CA  . ALA A 1 20  ? 78.414  -48.817  21.182  1.00 120.22 ? 1020 ALA A CA  1 
ATOM   161  C C   . ALA A 1 20  ? 77.592  -49.211  22.408  1.00 128.92 ? 1020 ALA A C   1 
ATOM   162  O O   . ALA A 1 20  ? 77.446  -50.402  22.700  1.00 127.74 ? 1020 ALA A O   1 
ATOM   163  C CB  . ALA A 1 20  ? 77.521  -48.779  19.954  1.00 114.02 ? 1020 ALA A CB  1 
ATOM   164  N N   . ASP A 1 21  ? 77.048  -48.205  23.113  1.00 131.09 ? 1021 ASP A N   1 
ATOM   165  C CA  . ASP A 1 21  ? 76.234  -48.404  24.313  1.00 136.53 ? 1021 ASP A CA  1 
ATOM   166  C C   . ASP A 1 21  ? 74.764  -48.016  24.079  1.00 137.62 ? 1021 ASP A C   1 
ATOM   167  O O   . ASP A 1 21  ? 73.884  -48.559  24.753  1.00 139.18 ? 1021 ASP A O   1 
ATOM   168  C CB  . ASP A 1 21  ? 76.815  -47.608  25.495  1.00 148.66 ? 1021 ASP A CB  1 
ATOM   169  C CG  . ASP A 1 21  ? 78.121  -48.166  26.034  1.00 167.29 ? 1021 ASP A CG  1 
ATOM   170  O OD1 . ASP A 1 21  ? 79.159  -48.021  25.347  1.00 166.64 ? 1021 ASP A OD1 1 
ATOM   171  O OD2 . ASP A 1 21  ? 78.109  -48.724  27.153  1.00 180.45 ? 1021 ASP A OD2 1 
ATOM   172  N N   . ASN A 1 22  ? 74.503  -47.083  23.137  1.00 130.39 ? 1022 ASN A N   1 
ATOM   173  C CA  . ASN A 1 22  ? 73.154  -46.616  22.796  1.00 128.37 ? 1022 ASN A CA  1 
ATOM   174  C C   . ASN A 1 22  ? 72.750  -47.042  21.374  1.00 122.06 ? 1022 ASN A C   1 
ATOM   175  O O   . ASN A 1 22  ? 73.618  -47.278  20.531  1.00 117.22 ? 1022 ASN A O   1 
ATOM   176  C CB  . ASN A 1 22  ? 73.024  -45.093  22.961  1.00 135.86 ? 1022 ASN A CB  1 
ATOM   177  C CG  . ASN A 1 22  ? 74.145  -44.272  22.365  1.00 166.80 ? 1022 ASN A CG  1 
ATOM   178  O OD1 . ASN A 1 22  ? 75.287  -44.294  22.835  1.00 166.56 ? 1022 ASN A OD1 1 
ATOM   179  N ND2 . ASN A 1 22  ? 73.825  -43.473  21.360  1.00 157.79 ? 1022 ASN A ND2 1 
ATOM   180  N N   . ALA A 1 23  ? 71.425  -47.150  21.124  1.00 115.61 ? 1023 ALA A N   1 
ATOM   181  C CA  . ALA A 1 23  ? 70.847  -47.549  19.834  1.00 108.09 ? 1023 ALA A CA  1 
ATOM   182  C C   . ALA A 1 23  ? 71.047  -46.472  18.761  1.00 107.93 ? 1023 ALA A C   1 
ATOM   183  O O   . ALA A 1 23  ? 71.063  -46.802  17.574  1.00 101.97 ? 1023 ALA A O   1 
ATOM   184  C CB  . ALA A 1 23  ? 69.368  -47.861  19.993  1.00 109.50 ? 1023 ALA A CB  1 
ATOM   185  N N   . ALA A 1 24  ? 71.206  -45.195  19.178  1.00 108.60 ? 1024 ALA A N   1 
ATOM   186  C CA  . ALA A 1 24  ? 71.465  -44.058  18.288  1.00 108.36 ? 1024 ALA A CA  1 
ATOM   187  C C   . ALA A 1 24  ? 72.865  -44.175  17.680  1.00 109.42 ? 1024 ALA A C   1 
ATOM   188  O O   . ALA A 1 24  ? 73.066  -43.784  16.530  1.00 107.30 ? 1024 ALA A O   1 
ATOM   189  C CB  . ALA A 1 24  ? 71.329  -42.750  19.047  1.00 116.72 ? 1024 ALA A CB  1 
ATOM   190  N N   . GLN A 1 25  ? 73.821  -44.738  18.455  1.00 105.80 ? 1025 GLN A N   1 
ATOM   191  C CA  . GLN A 1 25  ? 75.199  -45.003  18.045  1.00 103.46 ? 1025 GLN A CA  1 
ATOM   192  C C   . GLN A 1 25  ? 75.238  -46.136  17.020  1.00 99.34  ? 1025 GLN A C   1 
ATOM   193  O O   . GLN A 1 25  ? 75.996  -46.067  16.051  1.00 96.68  ? 1025 GLN A O   1 
ATOM   194  C CB  . GLN A 1 25  ? 76.051  -45.382  19.267  1.00 109.17 ? 1025 GLN A CB  1 
ATOM   195  C CG  . GLN A 1 25  ? 77.050  -44.324  19.701  1.00 134.22 ? 1025 GLN A CG  1 
ATOM   196  C CD  . GLN A 1 25  ? 78.116  -44.923  20.582  1.00 156.93 ? 1025 GLN A CD  1 
ATOM   197  O OE1 . GLN A 1 25  ? 77.898  -45.208  21.764  1.00 156.49 ? 1025 GLN A OE1 1 
ATOM   198  N NE2 . GLN A 1 25  ? 79.295  -45.140  20.017  1.00 148.14 ? 1025 GLN A NE2 1 
ATOM   199  N N   . VAL A 1 26  ? 74.415  -47.180  17.250  1.00 92.64  ? 1026 VAL A N   1 
ATOM   200  C CA  . VAL A 1 26  ? 74.294  -48.383  16.419  1.00 86.32  ? 1026 VAL A CA  1 
ATOM   201  C C   . VAL A 1 26  ? 73.626  -48.034  15.074  1.00 86.99  ? 1026 VAL A C   1 
ATOM   202  O O   . VAL A 1 26  ? 74.139  -48.438  14.030  1.00 83.68  ? 1026 VAL A O   1 
ATOM   203  C CB  . VAL A 1 26  ? 73.536  -49.516  17.167  1.00 89.80  ? 1026 VAL A CB  1 
ATOM   204  C CG1 . VAL A 1 26  ? 73.338  -50.741  16.282  1.00 84.71  ? 1026 VAL A CG1 1 
ATOM   205  C CG2 . VAL A 1 26  ? 74.258  -49.909  18.453  1.00 93.73  ? 1026 VAL A CG2 1 
ATOM   206  N N   . LYS A 1 27  ? 72.505  -47.283  15.098  1.00 84.83  ? 1027 LYS A N   1 
ATOM   207  C CA  . LYS A 1 27  ? 71.777  -46.876  13.891  1.00 82.63  ? 1027 LYS A CA  1 
ATOM   208  C C   . LYS A 1 27  ? 72.656  -46.003  12.978  1.00 86.18  ? 1027 LYS A C   1 
ATOM   209  O O   . LYS A 1 27  ? 72.564  -46.120  11.757  1.00 82.35  ? 1027 LYS A O   1 
ATOM   210  C CB  . LYS A 1 27  ? 70.482  -46.130  14.257  1.00 88.67  ? 1027 LYS A CB  1 
ATOM   211  C CG  . LYS A 1 27  ? 69.467  -46.111  13.121  1.00 103.30 ? 1027 LYS A CG  1 
ATOM   212  C CD  . LYS A 1 27  ? 68.412  -45.036  13.286  1.00 117.70 ? 1027 LYS A CD  1 
ATOM   213  C CE  . LYS A 1 27  ? 67.789  -44.712  11.951  1.00 126.38 ? 1027 LYS A CE  1 
ATOM   214  N NZ  . LYS A 1 27  ? 66.592  -43.844  12.080  1.00 139.85 ? 1027 LYS A NZ  1 
ATOM   215  N N   . ASP A 1 28  ? 73.514  -45.150  13.580  1.00 87.42  ? 1028 ASP A N   1 
ATOM   216  C CA  . ASP A 1 28  ? 74.434  -44.244  12.889  1.00 89.40  ? 1028 ASP A CA  1 
ATOM   217  C C   . ASP A 1 28  ? 75.498  -45.016  12.093  1.00 89.37  ? 1028 ASP A C   1 
ATOM   218  O O   . ASP A 1 28  ? 75.802  -44.641  10.956  1.00 88.73  ? 1028 ASP A O   1 
ATOM   219  C CB  . ASP A 1 28  ? 75.106  -43.305  13.898  1.00 97.84  ? 1028 ASP A CB  1 
ATOM   220  C CG  . ASP A 1 28  ? 75.318  -41.907  13.363  1.00 119.82 ? 1028 ASP A CG  1 
ATOM   221  O OD1 . ASP A 1 28  ? 74.408  -41.061  13.535  1.00 125.82 ? 1028 ASP A OD1 1 
ATOM   222  O OD2 . ASP A 1 28  ? 76.388  -41.657  12.768  1.00 127.55 ? 1028 ASP A OD2 1 
ATOM   223  N N   . ALA A 1 29  ? 76.051  -46.095  12.688  1.00 82.83  ? 1029 ALA A N   1 
ATOM   224  C CA  . ALA A 1 29  ? 77.054  -46.949  12.059  1.00 78.86  ? 1029 ALA A CA  1 
ATOM   225  C C   . ALA A 1 29  ? 76.439  -47.795  10.944  1.00 76.60  ? 1029 ALA A C   1 
ATOM   226  O O   . ALA A 1 29  ? 77.076  -47.973  9.907   1.00 74.41  ? 1029 ALA A O   1 
ATOM   227  C CB  . ALA A 1 29  ? 77.709  -47.844  13.100  1.00 80.14  ? 1029 ALA A CB  1 
ATOM   228  N N   . LEU A 1 30  ? 75.195  -48.288  11.148  1.00 71.13  ? 1030 LEU A N   1 
ATOM   229  C CA  . LEU A 1 30  ? 74.459  -49.116  10.186  1.00 67.20  ? 1030 LEU A CA  1 
ATOM   230  C C   . LEU A 1 30  ? 74.049  -48.312  8.952   1.00 72.83  ? 1030 LEU A C   1 
ATOM   231  O O   . LEU A 1 30  ? 74.007  -48.869  7.852   1.00 70.94  ? 1030 LEU A O   1 
ATOM   232  C CB  . LEU A 1 30  ? 73.223  -49.763  10.835  1.00 66.65  ? 1030 LEU A CB  1 
ATOM   233  C CG  . LEU A 1 30  ? 73.489  -50.999  11.701  1.00 70.38  ? 1030 LEU A CG  1 
ATOM   234  C CD1 . LEU A 1 30  ? 72.369  -51.221  12.681  1.00 72.51  ? 1030 LEU A CD1 1 
ATOM   235  C CD2 . LEU A 1 30  ? 73.692  -52.252  10.846  1.00 69.92  ? 1030 LEU A CD2 1 
ATOM   236  N N   . THR A 1 31  ? 73.773  -47.007  9.129   1.00 73.23  ? 1031 THR A N   1 
ATOM   237  C CA  . THR A 1 31  ? 73.396  -46.099  8.040   1.00 75.13  ? 1031 THR A CA  1 
ATOM   238  C C   . THR A 1 31  ? 74.621  -45.876  7.129   1.00 79.79  ? 1031 THR A C   1 
ATOM   239  O O   . THR A 1 31  ? 74.478  -45.886  5.898   1.00 78.83  ? 1031 THR A O   1 
ATOM   240  C CB  . THR A 1 31  ? 72.819  -44.793  8.617   1.00 87.13  ? 1031 THR A CB  1 
ATOM   241  O OG1 . THR A 1 31  ? 71.667  -45.117  9.396   1.00 87.82  ? 1031 THR A OG1 1 
ATOM   242  C CG2 . THR A 1 31  ? 72.432  -43.778  7.536   1.00 88.03  ? 1031 THR A CG2 1 
ATOM   243  N N   . LYS A 1 32  ? 75.823  -45.711  7.744   1.00 77.89  ? 1032 LYS A N   1 
ATOM   244  C CA  . LYS A 1 32  ? 77.100  -45.525  7.038   1.00 78.26  ? 1032 LYS A CA  1 
ATOM   245  C C   . LYS A 1 32  ? 77.476  -46.810  6.285   1.00 78.36  ? 1032 LYS A C   1 
ATOM   246  O O   . LYS A 1 32  ? 78.111  -46.743  5.232   1.00 78.98  ? 1032 LYS A O   1 
ATOM   247  C CB  . LYS A 1 32  ? 78.228  -45.114  8.009   1.00 82.43  ? 1032 LYS A CB  1 
ATOM   248  C CG  . LYS A 1 32  ? 78.052  -43.739  8.646   1.00 90.22  ? 1032 LYS A CG  1 
ATOM   249  C CD  . LYS A 1 32  ? 79.331  -43.266  9.324   1.00 99.93  ? 1032 LYS A CD  1 
ATOM   250  C CE  . LYS A 1 32  ? 79.085  -42.201  10.363  1.00 107.13 ? 1032 LYS A CE  1 
ATOM   251  N NZ  . LYS A 1 32  ? 78.711  -42.786  11.679  1.00 109.00 ? 1032 LYS A NZ  1 
ATOM   252  N N   . MET A 1 33  ? 77.060  -47.969  6.824   1.00 71.05  ? 1033 MET A N   1 
ATOM   253  C CA  . MET A 1 33  ? 77.311  -49.276  6.233   1.00 68.23  ? 1033 MET A CA  1 
ATOM   254  C C   . MET A 1 33  ? 76.433  -49.498  5.020   1.00 71.60  ? 1033 MET A C   1 
ATOM   255  O O   . MET A 1 33  ? 76.951  -49.933  3.989   1.00 70.87  ? 1033 MET A O   1 
ATOM   256  C CB  . MET A 1 33  ? 77.070  -50.395  7.254   1.00 69.04  ? 1033 MET A CB  1 
ATOM   257  C CG  . MET A 1 33  ? 78.205  -50.596  8.212   1.00 73.60  ? 1033 MET A CG  1 
ATOM   258  S SD  . MET A 1 33  ? 77.788  -51.825  9.464   1.00 76.80  ? 1033 MET A SD  1 
ATOM   259  C CE  . MET A 1 33  ? 78.201  -53.341  8.564   1.00 71.15  ? 1033 MET A CE  1 
ATOM   260  N N   . ARG A 1 34  ? 75.100  -49.217  5.145   1.00 68.51  ? 1034 ARG A N   1 
ATOM   261  C CA  . ARG A 1 34  ? 74.112  -49.405  4.074   1.00 68.27  ? 1034 ARG A CA  1 
ATOM   262  C C   . ARG A 1 34  ? 74.509  -48.628  2.828   1.00 76.37  ? 1034 ARG A C   1 
ATOM   263  O O   . ARG A 1 34  ? 74.426  -49.180  1.731   1.00 76.86  ? 1034 ARG A O   1 
ATOM   264  C CB  . ARG A 1 34  ? 72.697  -49.015  4.511   1.00 66.69  ? 1034 ARG A CB  1 
ATOM   265  C CG  . ARG A 1 34  ? 71.634  -49.685  3.649   1.00 73.07  ? 1034 ARG A CG  1 
ATOM   266  C CD  . ARG A 1 34  ? 70.287  -48.988  3.664   1.00 77.25  ? 1034 ARG A CD  1 
ATOM   267  N NE  . ARG A 1 34  ? 69.211  -49.906  3.269   1.00 76.19  ? 1034 ARG A NE  1 
ATOM   268  C CZ  . ARG A 1 34  ? 68.715  -50.013  2.038   1.00 84.38  ? 1034 ARG A CZ  1 
ATOM   269  N NH1 . ARG A 1 34  ? 69.177  -49.248  1.058   1.00 70.89  ? 1034 ARG A NH1 1 
ATOM   270  N NH2 . ARG A 1 34  ? 67.751  -50.885  1.780   1.00 69.26  ? 1034 ARG A NH2 1 
ATOM   271  N N   . ALA A 1 35  ? 74.972  -47.371  3.001   1.00 75.55  ? 1035 ALA A N   1 
ATOM   272  C CA  . ALA A 1 35  ? 75.423  -46.521  1.905   1.00 78.86  ? 1035 ALA A CA  1 
ATOM   273  C C   . ALA A 1 35  ? 76.659  -47.124  1.225   1.00 81.85  ? 1035 ALA A C   1 
ATOM   274  O O   . ALA A 1 35  ? 76.676  -47.236  -0.001  1.00 83.07  ? 1035 ALA A O   1 
ATOM   275  C CB  . ALA A 1 35  ? 75.728  -45.126  2.421   1.00 83.58  ? 1035 ALA A CB  1 
ATOM   276  N N   . ALA A 1 36  ? 77.658  -47.564  2.031   1.00 76.38  ? 1036 ALA A N   1 
ATOM   277  C CA  . ALA A 1 36  ? 78.913  -48.174  1.575   1.00 75.26  ? 1036 ALA A CA  1 
ATOM   278  C C   . ALA A 1 36  ? 78.678  -49.504  0.847   1.00 77.62  ? 1036 ALA A C   1 
ATOM   279  O O   . ALA A 1 36  ? 79.358  -49.771  -0.144  1.00 78.53  ? 1036 ALA A O   1 
ATOM   280  C CB  . ALA A 1 36  ? 79.845  -48.386  2.754   1.00 74.87  ? 1036 ALA A CB  1 
ATOM   281  N N   . ALA A 1 37  ? 77.701  -50.309  1.314   1.00 72.10  ? 1037 ALA A N   1 
ATOM   282  C CA  . ALA A 1 37  ? 77.341  -51.597  0.720   1.00 70.51  ? 1037 ALA A CA  1 
ATOM   283  C C   . ALA A 1 37  ? 76.681  -51.405  -0.653  1.00 77.59  ? 1037 ALA A C   1 
ATOM   284  O O   . ALA A 1 37  ? 76.946  -52.182  -1.569  1.00 78.18  ? 1037 ALA A O   1 
ATOM   285  C CB  . ALA A 1 37  ? 76.419  -52.357  1.651   1.00 69.02  ? 1037 ALA A CB  1 
ATOM   286  N N   . LEU A 1 38  ? 75.847  -50.357  -0.799  1.00 77.06  ? 1038 LEU A N   1 
ATOM   287  C CA  . LEU A 1 38  ? 75.176  -50.015  -2.059  1.00 80.79  ? 1038 LEU A CA  1 
ATOM   288  C C   . LEU A 1 38  ? 76.179  -49.452  -3.066  1.00 90.34  ? 1038 LEU A C   1 
ATOM   289  O O   . LEU A 1 38  ? 76.054  -49.698  -4.273  1.00 93.92  ? 1038 LEU A O   1 
ATOM   290  C CB  . LEU A 1 38  ? 74.047  -48.997  -1.821  1.00 82.37  ? 1038 LEU A CB  1 
ATOM   291  C CG  . LEU A 1 38  ? 72.761  -49.529  -1.211  1.00 84.98  ? 1038 LEU A CG  1 
ATOM   292  C CD1 . LEU A 1 38  ? 72.030  -48.443  -0.486  1.00 86.23  ? 1038 LEU A CD1 1 
ATOM   293  C CD2 . LEU A 1 38  ? 71.860  -50.147  -2.266  1.00 90.50  ? 1038 LEU A CD2 1 
ATOM   294  N N   . ASP A 1 39  ? 77.170  -48.694  -2.558  1.00 87.27  ? 1039 ASP A N   1 
ATOM   295  C CA  . ASP A 1 39  ? 78.228  -48.067  -3.340  1.00 90.64  ? 1039 ASP A CA  1 
ATOM   296  C C   . ASP A 1 39  ? 79.254  -49.113  -3.813  1.00 92.55  ? 1039 ASP A C   1 
ATOM   297  O O   . ASP A 1 39  ? 79.901  -48.906  -4.844  1.00 96.59  ? 1039 ASP A O   1 
ATOM   298  C CB  . ASP A 1 39  ? 78.904  -46.949  -2.514  1.00 94.19  ? 1039 ASP A CB  1 
ATOM   299  C CG  . ASP A 1 39  ? 78.120  -45.633  -2.419  1.00 113.36 ? 1039 ASP A CG  1 
ATOM   300  O OD1 . ASP A 1 39  ? 77.173  -45.434  -3.224  1.00 117.01 ? 1039 ASP A OD1 1 
ATOM   301  O OD2 . ASP A 1 39  ? 78.438  -44.815  -1.527  1.00 122.68 ? 1039 ASP A OD2 1 
ATOM   302  N N   . ALA A 1 40  ? 79.373  -50.249  -3.090  1.00 83.43  ? 1040 ALA A N   1 
ATOM   303  C CA  . ALA A 1 40  ? 80.291  -51.343  -3.432  1.00 82.09  ? 1040 ALA A CA  1 
ATOM   304  C C   . ALA A 1 40  ? 79.669  -52.337  -4.427  1.00 86.93  ? 1040 ALA A C   1 
ATOM   305  O O   . ALA A 1 40  ? 80.415  -53.030  -5.121  1.00 87.69  ? 1040 ALA A O   1 
ATOM   306  C CB  . ALA A 1 40  ? 80.735  -52.070  -2.177  1.00 79.01  ? 1040 ALA A CB  1 
ATOM   307  N N   . GLN A 1 41  ? 78.316  -52.387  -4.516  1.00 84.08  ? 1041 GLN A N   1 
ATOM   308  C CA  . GLN A 1 41  ? 77.584  -53.263  -5.438  1.00 86.38  ? 1041 GLN A CA  1 
ATOM   309  C C   . GLN A 1 41  ? 77.818  -52.860  -6.904  1.00 96.75  ? 1041 GLN A C   1 
ATOM   310  O O   . GLN A 1 41  ? 77.844  -53.731  -7.774  1.00 98.96  ? 1041 GLN A O   1 
ATOM   311  C CB  . GLN A 1 41  ? 76.078  -53.260  -5.127  1.00 87.49  ? 1041 GLN A CB  1 
ATOM   312  C CG  . GLN A 1 41  ? 75.385  -54.585  -5.476  1.00 105.51 ? 1041 GLN A CG  1 
ATOM   313  C CD  . GLN A 1 41  ? 73.883  -54.475  -5.656  1.00 125.40 ? 1041 GLN A CD  1 
ATOM   314  O OE1 . GLN A 1 41  ? 73.135  -54.161  -4.725  1.00 116.39 ? 1041 GLN A OE1 1 
ATOM   315  N NE2 . GLN A 1 41  ? 73.399  -54.782  -6.854  1.00 124.56 ? 1041 GLN A NE2 1 
ATOM   316  N N   . LYS A 1 42  ? 77.988  -51.553  -7.174  1.00 97.06  ? 1042 LYS A N   1 
ATOM   317  C CA  . LYS A 1 42  ? 78.226  -51.037  -8.525  1.00 103.44 ? 1042 LYS A CA  1 
ATOM   318  C C   . LYS A 1 42  ? 79.686  -51.231  -8.984  1.00 110.15 ? 1042 LYS A C   1 
ATOM   319  O O   . LYS A 1 42  ? 79.959  -51.161  -10.189 1.00 115.20 ? 1042 LYS A O   1 
ATOM   320  C CB  . LYS A 1 42  ? 77.853  -49.554  -8.596  1.00 108.81 ? 1042 LYS A CB  1 
ATOM   321  C CG  . LYS A 1 42  ? 76.363  -49.295  -8.493  1.00 121.59 ? 1042 LYS A CG  1 
ATOM   322  C CD  . LYS A 1 42  ? 76.103  -47.831  -8.260  1.00 134.54 ? 1042 LYS A CD  1 
ATOM   323  C CE  . LYS A 1 42  ? 74.616  -47.574  -8.342  1.00 147.61 ? 1042 LYS A CE  1 
ATOM   324  N NZ  . LYS A 1 42  ? 74.291  -46.174  -8.739  1.00 160.34 ? 1042 LYS A NZ  1 
ATOM   325  N N   . ALA A 1 43  ? 80.611  -51.458  -8.024  1.00 103.52 ? 1043 ALA A N   1 
ATOM   326  C CA  . ALA A 1 43  ? 82.045  -51.646  -8.272  1.00 104.92 ? 1043 ALA A CA  1 
ATOM   327  C C   . ALA A 1 43  ? 82.364  -53.037  -8.845  1.00 110.27 ? 1043 ALA A C   1 
ATOM   328  O O   . ALA A 1 43  ? 81.610  -53.985  -8.630  1.00 107.79 ? 1043 ALA A O   1 
ATOM   329  C CB  . ALA A 1 43  ? 82.828  -51.421  -6.983  1.00 101.83 ? 1043 ALA A CB  1 
ATOM   330  N N   . THR A 1 44  ? 83.499  -53.149  -9.560  1.00 111.60 ? 1044 THR A N   1 
ATOM   331  C CA  . THR A 1 44  ? 83.984  -54.398  -10.163 1.00 114.06 ? 1044 THR A CA  1 
ATOM   332  C C   . THR A 1 44  ? 85.198  -54.921  -9.362  1.00 116.98 ? 1044 THR A C   1 
ATOM   333  O O   . THR A 1 44  ? 86.130  -54.142  -9.132  1.00 117.46 ? 1044 THR A O   1 
ATOM   334  C CB  . THR A 1 44  ? 84.336  -54.193  -11.654 1.00 129.78 ? 1044 THR A CB  1 
ATOM   335  O OG1 . THR A 1 44  ? 85.363  -53.205  -11.768 1.00 132.54 ? 1044 THR A OG1 1 
ATOM   336  C CG2 . THR A 1 44  ? 83.127  -53.798  -12.509 1.00 131.83 ? 1044 THR A CG2 1 
ATOM   337  N N   . PRO A 1 45  ? 85.233  -56.223  -8.954  1.00 112.65 ? 1045 PRO A N   1 
ATOM   338  C CA  . PRO A 1 45  ? 86.382  -56.728  -8.172  1.00 111.59 ? 1045 PRO A CA  1 
ATOM   339  C C   . PRO A 1 45  ? 87.756  -56.426  -8.797  1.00 121.96 ? 1045 PRO A C   1 
ATOM   340  O O   . PRO A 1 45  ? 87.859  -56.389  -10.027 1.00 126.13 ? 1045 PRO A O   1 
ATOM   341  C CB  . PRO A 1 45  ? 86.128  -58.236  -8.111  1.00 113.10 ? 1045 PRO A CB  1 
ATOM   342  C CG  . PRO A 1 45  ? 84.663  -58.359  -8.169  1.00 115.81 ? 1045 PRO A CG  1 
ATOM   343  C CD  . PRO A 1 45  ? 84.212  -57.279  -9.124  1.00 114.01 ? 1045 PRO A CD  1 
ATOM   344  N N   . PRO A 1 46  ? 88.826  -56.224  -7.976  1.00 119.70 ? 1046 PRO A N   1 
ATOM   345  C CA  . PRO A 1 46  ? 90.149  -55.888  -8.550  1.00 125.17 ? 1046 PRO A CA  1 
ATOM   346  C C   . PRO A 1 46  ? 90.854  -57.057  -9.271  1.00 135.00 ? 1046 PRO A C   1 
ATOM   347  O O   . PRO A 1 46  ? 92.074  -57.022  -9.473  1.00 138.82 ? 1046 PRO A O   1 
ATOM   348  C CB  . PRO A 1 46  ? 90.948  -55.404  -7.335  1.00 125.14 ? 1046 PRO A CB  1 
ATOM   349  C CG  . PRO A 1 46  ? 90.317  -56.067  -6.170  1.00 124.21 ? 1046 PRO A CG  1 
ATOM   350  C CD  . PRO A 1 46  ? 88.862  -56.215  -6.496  1.00 116.98 ? 1046 PRO A CD  1 
ATOM   351  N N   . LYS A 1 47  ? 90.076  -58.066  -9.699  1.00 132.67 ? 1047 LYS A N   1 
ATOM   352  C CA  . LYS A 1 47  ? 90.527  -59.239  -10.449 1.00 137.72 ? 1047 LYS A CA  1 
ATOM   353  C C   . LYS A 1 47  ? 89.480  -59.634  -11.512 1.00 146.15 ? 1047 LYS A C   1 
ATOM   354  O O   . LYS A 1 47  ? 89.849  -60.246  -12.516 1.00 151.85 ? 1047 LYS A O   1 
ATOM   355  C CB  . LYS A 1 47  ? 90.838  -60.417  -9.511  1.00 138.01 ? 1047 LYS A CB  1 
ATOM   356  C CG  . LYS A 1 47  ? 92.214  -60.337  -8.860  1.00 145.45 ? 1047 LYS A CG  1 
ATOM   357  C CD  . LYS A 1 47  ? 92.469  -61.527  -7.960  1.00 151.74 ? 1047 LYS A CD  1 
ATOM   358  C CE  . LYS A 1 47  ? 93.763  -61.404  -7.199  1.00 161.53 ? 1047 LYS A CE  1 
ATOM   359  N NZ  . LYS A 1 47  ? 93.834  -62.383  -6.081  1.00 168.29 ? 1047 LYS A NZ  1 
ATOM   360  N N   . LEU A 1 48  ? 88.188  -59.258  -11.308 1.00 140.37 ? 1048 LEU A N   1 
ATOM   361  C CA  . LEU A 1 48  ? 87.097  -59.532  -12.257 1.00 143.79 ? 1048 LEU A CA  1 
ATOM   362  C C   . LEU A 1 48  ? 86.905  -58.349  -13.235 1.00 152.35 ? 1048 LEU A C   1 
ATOM   363  O O   . LEU A 1 48  ? 85.805  -58.137  -13.755 1.00 152.98 ? 1048 LEU A O   1 
ATOM   364  C CB  . LEU A 1 48  ? 85.771  -59.862  -11.528 1.00 139.24 ? 1048 LEU A CB  1 
ATOM   365  C CG  . LEU A 1 48  ? 85.637  -61.232  -10.831 1.00 142.92 ? 1048 LEU A CG  1 
ATOM   366  C CD1 . LEU A 1 48  ? 84.235  -61.421  -10.283 1.00 139.83 ? 1048 LEU A CD1 1 
ATOM   367  C CD2 . LEU A 1 48  ? 85.938  -62.393  -11.778 1.00 152.63 ? 1048 LEU A CD2 1 
ATOM   368  N N   . GLU A 1 49  ? 87.999  -57.602  -13.495 1.00 152.61 ? 1049 GLU A N   1 
ATOM   369  C CA  . GLU A 1 49  ? 88.055  -56.449  -14.403 1.00 157.63 ? 1049 GLU A CA  1 
ATOM   370  C C   . GLU A 1 49  ? 87.834  -56.893  -15.846 1.00 170.20 ? 1049 GLU A C   1 
ATOM   371  O O   . GLU A 1 49  ? 87.156  -56.207  -16.610 1.00 173.58 ? 1049 GLU A O   1 
ATOM   372  C CB  . GLU A 1 49  ? 89.418  -55.729  -14.294 1.00 161.09 ? 1049 GLU A CB  1 
ATOM   373  C CG  . GLU A 1 49  ? 89.836  -55.322  -12.888 1.00 166.69 ? 1049 GLU A CG  1 
ATOM   374  C CD  . GLU A 1 49  ? 91.321  -55.061  -12.708 1.00 192.10 ? 1049 GLU A CD  1 
ATOM   375  O OE1 . GLU A 1 49  ? 91.669  -53.990  -12.161 1.00 188.26 ? 1049 GLU A OE1 1 
ATOM   376  O OE2 . GLU A 1 49  ? 92.137  -55.931  -13.092 1.00 188.42 ? 1049 GLU A OE2 1 
ATOM   377  N N   . ASP A 1 50  ? 88.418  -58.049  -16.204 1.00 170.63 ? 1050 ASP A N   1 
ATOM   378  C CA  . ASP A 1 50  ? 88.371  -58.656  -17.533 1.00 179.17 ? 1050 ASP A CA  1 
ATOM   379  C C   . ASP A 1 50  ? 86.980  -59.215  -17.868 1.00 183.56 ? 1050 ASP A C   1 
ATOM   380  O O   . ASP A 1 50  ? 86.574  -59.169  -19.032 1.00 190.40 ? 1050 ASP A O   1 
ATOM   381  C CB  . ASP A 1 50  ? 89.415  -59.790  -17.638 1.00 184.56 ? 1050 ASP A CB  1 
ATOM   382  C CG  . ASP A 1 50  ? 90.788  -59.474  -17.064 1.00 195.18 ? 1050 ASP A CG  1 
ATOM   383  O OD1 . ASP A 1 50  ? 91.442  -58.531  -17.567 1.00 199.82 ? 1050 ASP A OD1 1 
ATOM   384  O OD2 . ASP A 1 50  ? 91.224  -60.193  -16.137 1.00 197.60 ? 1050 ASP A OD2 1 
ATOM   385  N N   . LYS A 1 51  ? 86.267  -59.754  -16.854 1.00 173.21 ? 1051 LYS A N   1 
ATOM   386  C CA  . LYS A 1 51  ? 84.951  -60.391  -16.999 1.00 173.55 ? 1051 LYS A CA  1 
ATOM   387  C C   . LYS A 1 51  ? 83.808  -59.380  -17.174 1.00 176.67 ? 1051 LYS A C   1 
ATOM   388  O O   . LYS A 1 51  ? 83.791  -58.331  -16.524 1.00 170.96 ? 1051 LYS A O   1 
ATOM   389  C CB  . LYS A 1 51  ? 84.645  -61.315  -15.801 1.00 169.53 ? 1051 LYS A CB  1 
ATOM   390  C CG  . LYS A 1 51  ? 85.723  -62.361  -15.494 1.00 179.98 ? 1051 LYS A CG  1 
ATOM   391  C CD  . LYS A 1 51  ? 85.692  -63.570  -16.427 1.00 196.59 ? 1051 LYS A CD  1 
ATOM   392  C CE  . LYS A 1 51  ? 86.895  -64.467  -16.246 1.00 207.86 ? 1051 LYS A CE  1 
ATOM   393  N NZ  . LYS A 1 51  ? 88.134  -63.875  -16.821 1.00 217.93 ? 1051 LYS A NZ  1 
ATOM   394  N N   . SER A 1 52  ? 82.846  -59.737  -18.051 1.00 179.32 ? 1052 SER A N   1 
ATOM   395  C CA  . SER A 1 52  ? 81.631  -58.996  -18.407 1.00 180.86 ? 1052 SER A CA  1 
ATOM   396  C C   . SER A 1 52  ? 80.702  -58.797  -17.185 1.00 176.07 ? 1052 SER A C   1 
ATOM   397  O O   . SER A 1 52  ? 80.741  -59.627  -16.275 1.00 170.45 ? 1052 SER A O   1 
ATOM   398  C CB  . SER A 1 52  ? 80.880  -59.740  -19.511 1.00 193.78 ? 1052 SER A CB  1 
ATOM   399  O OG  . SER A 1 52  ? 80.537  -61.061  -19.120 1.00 202.39 ? 1052 SER A OG  1 
ATOM   400  N N   . PRO A 1 53  ? 79.849  -57.738  -17.143 1.00 171.92 ? 1053 PRO A N   1 
ATOM   401  C CA  . PRO A 1 53  ? 78.989  -57.531  -15.958 1.00 164.41 ? 1053 PRO A CA  1 
ATOM   402  C C   . PRO A 1 53  ? 77.820  -58.518  -15.821 1.00 169.07 ? 1053 PRO A C   1 
ATOM   403  O O   . PRO A 1 53  ? 77.283  -58.654  -14.720 1.00 162.41 ? 1053 PRO A O   1 
ATOM   404  C CB  . PRO A 1 53  ? 78.453  -56.103  -16.146 1.00 167.17 ? 1053 PRO A CB  1 
ATOM   405  C CG  . PRO A 1 53  ? 79.269  -55.499  -17.251 1.00 178.30 ? 1053 PRO A CG  1 
ATOM   406  C CD  . PRO A 1 53  ? 79.674  -56.642  -18.115 1.00 179.69 ? 1053 PRO A CD  1 
ATOM   407  N N   . ASP A 1 54  ? 77.420  -59.192  -16.916 1.00 173.83 ? 1054 ASP A N   1 
ATOM   408  C CA  . ASP A 1 54  ? 76.300  -60.137  -16.903 1.00 176.37 ? 1054 ASP A CA  1 
ATOM   409  C C   . ASP A 1 54  ? 76.747  -61.597  -16.656 1.00 180.36 ? 1054 ASP A C   1 
ATOM   410  O O   . ASP A 1 54  ? 75.898  -62.491  -16.613 1.00 183.31 ? 1054 ASP A O   1 
ATOM   411  C CB  . ASP A 1 54  ? 75.504  -60.034  -18.217 1.00 188.67 ? 1054 ASP A CB  1 
ATOM   412  C CG  . ASP A 1 54  ? 74.761  -58.721  -18.412 1.00 199.32 ? 1054 ASP A CG  1 
ATOM   413  O OD1 . ASP A 1 54  ? 74.516  -58.016  -17.404 1.00 192.06 ? 1054 ASP A OD1 1 
ATOM   414  O OD2 . ASP A 1 54  ? 74.387  -58.419  -19.564 1.00 215.01 ? 1054 ASP A OD2 1 
ATOM   415  N N   . SER A 1 55  ? 78.063  -61.827  -16.460 1.00 173.76 ? 1055 SER A N   1 
ATOM   416  C CA  . SER A 1 55  ? 78.656  -63.147  -16.200 1.00 174.02 ? 1055 SER A CA  1 
ATOM   417  C C   . SER A 1 55  ? 78.202  -63.722  -14.835 1.00 170.08 ? 1055 SER A C   1 
ATOM   418  O O   . SER A 1 55  ? 77.900  -62.930  -13.939 1.00 162.35 ? 1055 SER A O   1 
ATOM   419  C CB  . SER A 1 55  ? 80.180  -63.059  -16.248 1.00 176.62 ? 1055 SER A CB  1 
ATOM   420  O OG  . SER A 1 55  ? 80.689  -62.170  -15.267 1.00 177.52 ? 1055 SER A OG  1 
ATOM   421  N N   . PRO A 1 56  ? 78.171  -65.074  -14.636 1.00 168.73 ? 1056 PRO A N   1 
ATOM   422  C CA  . PRO A 1 56  ? 77.735  -65.620  -13.333 1.00 162.85 ? 1056 PRO A CA  1 
ATOM   423  C C   . PRO A 1 56  ? 78.647  -65.241  -12.160 1.00 156.81 ? 1056 PRO A C   1 
ATOM   424  O O   . PRO A 1 56  ? 78.193  -65.291  -11.016 1.00 151.13 ? 1056 PRO A O   1 
ATOM   425  C CB  . PRO A 1 56  ? 77.735  -67.135  -13.557 1.00 171.60 ? 1056 PRO A CB  1 
ATOM   426  C CG  . PRO A 1 56  ? 78.663  -67.355  -14.695 1.00 182.67 ? 1056 PRO A CG  1 
ATOM   427  C CD  . PRO A 1 56  ? 78.485  -66.163  -15.584 1.00 179.45 ? 1056 PRO A CD  1 
ATOM   428  N N   . GLU A 1 57  ? 79.914  -64.850  -12.437 1.00 151.73 ? 1057 GLU A N   1 
ATOM   429  C CA  . GLU A 1 57  ? 80.889  -64.409  -11.426 1.00 144.16 ? 1057 GLU A CA  1 
ATOM   430  C C   . GLU A 1 57  ? 80.514  -63.029  -10.880 1.00 139.75 ? 1057 GLU A C   1 
ATOM   431  O O   . GLU A 1 57  ? 80.677  -62.775  -9.682  1.00 132.87 ? 1057 GLU A O   1 
ATOM   432  C CB  . GLU A 1 57  ? 82.319  -64.366  -12.001 1.00 148.18 ? 1057 GLU A CB  1 
ATOM   433  C CG  . GLU A 1 57  ? 82.877  -65.711  -12.432 1.00 165.56 ? 1057 GLU A CG  1 
ATOM   434  C CD  . GLU A 1 57  ? 82.705  -66.032  -13.903 1.00 195.79 ? 1057 GLU A CD  1 
ATOM   435  O OE1 . GLU A 1 57  ? 83.263  -65.292  -14.746 1.00 192.05 ? 1057 GLU A OE1 1 
ATOM   436  O OE2 . GLU A 1 57  ? 82.040  -67.047  -14.214 1.00 196.81 ? 1057 GLU A OE2 1 
ATOM   437  N N   . MET A 1 58  ? 80.045  -62.133  -11.763 1.00 137.48 ? 1058 MET A N   1 
ATOM   438  C CA  . MET A 1 58  ? 79.628  -60.776  -11.413 1.00 132.42 ? 1058 MET A CA  1 
ATOM   439  C C   . MET A 1 58  ? 78.228  -60.770  -10.795 1.00 132.20 ? 1058 MET A C   1 
ATOM   440  O O   . MET A 1 58  ? 77.880  -59.827  -10.084 1.00 126.88 ? 1058 MET A O   1 
ATOM   441  C CB  . MET A 1 58  ? 79.663  -59.872  -12.652 1.00 139.80 ? 1058 MET A CB  1 
ATOM   442  C CG  . MET A 1 58  ? 81.051  -59.369  -12.998 1.00 144.41 ? 1058 MET A CG  1 
ATOM   443  S SD  . MET A 1 58  ? 81.628  -58.005  -11.955 1.00 142.01 ? 1058 MET A SD  1 
ATOM   444  C CE  . MET A 1 58  ? 80.596  -56.663  -12.561 1.00 141.15 ? 1058 MET A CE  1 
ATOM   445  N N   . LYS A 1 59  ? 77.431  -61.820  -11.067 1.00 131.72 ? 1059 LYS A N   1 
ATOM   446  C CA  . LYS A 1 59  ? 76.069  -61.957  -10.554 1.00 130.16 ? 1059 LYS A CA  1 
ATOM   447  C C   . LYS A 1 59  ? 76.056  -62.283  -9.051  1.00 126.67 ? 1059 LYS A C   1 
ATOM   448  O O   . LYS A 1 59  ? 75.281  -61.660  -8.324  1.00 122.57 ? 1059 LYS A O   1 
ATOM   449  C CB  . LYS A 1 59  ? 75.278  -63.012  -11.350 1.00 139.89 ? 1059 LYS A CB  1 
ATOM   450  C CG  . LYS A 1 59  ? 74.790  -62.524  -12.717 1.00 155.31 ? 1059 LYS A CG  1 
ATOM   451  C CD  . LYS A 1 59  ? 73.601  -61.559  -12.622 1.00 161.57 ? 1059 LYS A CD  1 
ATOM   452  C CE  . LYS A 1 59  ? 73.208  -61.003  -13.966 1.00 175.16 ? 1059 LYS A CE  1 
ATOM   453  N NZ  . LYS A 1 59  ? 72.124  -59.996  -13.844 1.00 180.98 ? 1059 LYS A NZ  1 
ATOM   454  N N   . ASP A 1 60  ? 76.914  -63.229  -8.584  1.00 121.67 ? 1060 ASP A N   1 
ATOM   455  C CA  . ASP A 1 60  ? 76.995  -63.617  -7.178  1.00 116.24 ? 1060 ASP A CA  1 
ATOM   456  C C   . ASP A 1 60  ? 77.603  -62.485  -6.359  1.00 110.33 ? 1060 ASP A C   1 
ATOM   457  O O   . ASP A 1 60  ? 77.223  -62.329  -5.197  1.00 105.81 ? 1060 ASP A O   1 
ATOM   458  C CB  . ASP A 1 60  ? 77.778  -64.925  -6.980  1.00 121.21 ? 1060 ASP A CB  1 
ATOM   459  C CG  . ASP A 1 60  ? 77.430  -65.637  -5.691  1.00 134.16 ? 1060 ASP A CG  1 
ATOM   460  O OD1 . ASP A 1 60  ? 77.961  -65.239  -4.630  1.00 130.07 ? 1060 ASP A OD1 1 
ATOM   461  O OD2 . ASP A 1 60  ? 76.598  -66.562  -5.735  1.00 146.80 ? 1060 ASP A OD2 1 
ATOM   462  N N   . PHE A 1 61  ? 78.501  -61.670  -6.970  1.00 104.55 ? 1061 PHE A N   1 
ATOM   463  C CA  . PHE A 1 61  ? 79.146  -60.513  -6.334  1.00 99.06  ? 1061 PHE A CA  1 
ATOM   464  C C   . PHE A 1 61  ? 78.117  -59.449  -5.936  1.00 99.35  ? 1061 PHE A C   1 
ATOM   465  O O   . PHE A 1 61  ? 78.178  -58.934  -4.820  1.00 94.04  ? 1061 PHE A O   1 
ATOM   466  C CB  . PHE A 1 61  ? 80.220  -59.885  -7.253  1.00 102.73 ? 1061 PHE A CB  1 
ATOM   467  C CG  . PHE A 1 61  ? 80.763  -58.568  -6.737  1.00 100.41 ? 1061 PHE A CG  1 
ATOM   468  C CD1 . PHE A 1 61  ? 81.790  -58.539  -5.802  1.00 100.32 ? 1061 PHE A CD1 1 
ATOM   469  C CD2 . PHE A 1 61  ? 80.216  -57.360  -7.153  1.00 102.32 ? 1061 PHE A CD2 1 
ATOM   470  C CE1 . PHE A 1 61  ? 82.265  -57.327  -5.303  1.00 98.69  ? 1061 PHE A CE1 1 
ATOM   471  C CE2 . PHE A 1 61  ? 80.681  -56.153  -6.640  1.00 102.59 ? 1061 PHE A CE2 1 
ATOM   472  C CZ  . PHE A 1 61  ? 81.710  -56.143  -5.730  1.00 97.99  ? 1061 PHE A CZ  1 
ATOM   473  N N   . ARG A 1 62  ? 77.227  -59.077  -6.877  1.00 99.31  ? 1062 ARG A N   1 
ATOM   474  C CA  . ARG A 1 62  ? 76.168  -58.090  -6.660  1.00 97.88  ? 1062 ARG A CA  1 
ATOM   475  C C   . ARG A 1 62  ? 75.091  -58.667  -5.748  1.00 99.72  ? 1062 ARG A C   1 
ATOM   476  O O   . ARG A 1 62  ? 74.446  -57.911  -5.022  1.00 96.54  ? 1062 ARG A O   1 
ATOM   477  C CB  . ARG A 1 62  ? 75.549  -57.629  -7.988  1.00 103.54 ? 1062 ARG A CB  1 
ATOM   478  C CG  . ARG A 1 62  ? 76.482  -56.789  -8.852  1.00 116.89 ? 1062 ARG A CG  1 
ATOM   479  C CD  . ARG A 1 62  ? 75.761  -56.141  -10.022 1.00 135.70 ? 1062 ARG A CD  1 
ATOM   480  N NE  . ARG A 1 62  ? 75.200  -57.123  -10.956 1.00 152.46 ? 1062 ARG A NE  1 
ATOM   481  C CZ  . ARG A 1 62  ? 75.823  -57.586  -12.036 1.00 170.97 ? 1062 ARG A CZ  1 
ATOM   482  N NH1 . ARG A 1 62  ? 77.047  -57.162  -12.337 1.00 158.05 ? 1062 ARG A NH1 1 
ATOM   483  N NH2 . ARG A 1 62  ? 75.233  -58.473  -12.822 1.00 162.63 ? 1062 ARG A NH2 1 
ATOM   484  N N   . HIS A 1 63  ? 74.913  -60.010  -5.780  1.00 98.36  ? 1063 HIS A N   1 
ATOM   485  C CA  . HIS A 1 63  ? 73.942  -60.732  -4.955  1.00 97.98  ? 1063 HIS A CA  1 
ATOM   486  C C   . HIS A 1 63  ? 74.396  -60.797  -3.482  1.00 94.68  ? 1063 HIS A C   1 
ATOM   487  O O   . HIS A 1 63  ? 73.560  -60.693  -2.581  1.00 93.20  ? 1063 HIS A O   1 
ATOM   488  C CB  . HIS A 1 63  ? 73.713  -62.146  -5.512  1.00 104.75 ? 1063 HIS A CB  1 
ATOM   489  C CG  . HIS A 1 63  ? 72.800  -62.985  -4.680  1.00 109.63 ? 1063 HIS A CG  1 
ATOM   490  N ND1 . HIS A 1 63  ? 71.426  -62.791  -4.694  1.00 114.02 ? 1063 HIS A ND1 1 
ATOM   491  C CD2 . HIS A 1 63  ? 73.092  -63.987  -3.823  1.00 111.58 ? 1063 HIS A CD2 1 
ATOM   492  C CE1 . HIS A 1 63  ? 70.929  -63.673  -3.844  1.00 114.67 ? 1063 HIS A CE1 1 
ATOM   493  N NE2 . HIS A 1 63  ? 71.890  -64.413  -3.290  1.00 113.64 ? 1063 HIS A NE2 1 
ATOM   494  N N   . GLY A 1 64  ? 75.703  -60.982  -3.271  1.00 87.27  ? 1064 GLY A N   1 
ATOM   495  C CA  . GLY A 1 64  ? 76.321  -61.046  -1.950  1.00 82.54  ? 1064 GLY A CA  1 
ATOM   496  C C   . GLY A 1 64  ? 76.120  -59.782  -1.138  1.00 81.29  ? 1064 GLY A C   1 
ATOM   497  O O   . GLY A 1 64  ? 76.045  -59.845  0.093   1.00 78.87  ? 1064 GLY A O   1 
ATOM   498  N N   . PHE A 1 65  ? 76.020  -58.625  -1.838  1.00 76.69  ? 1065 PHE A N   1 
ATOM   499  C CA  . PHE A 1 65  ? 75.782  -57.312  -1.253  1.00 73.84  ? 1065 PHE A CA  1 
ATOM   500  C C   . PHE A 1 65  ? 74.285  -57.090  -0.986  1.00 77.85  ? 1065 PHE A C   1 
ATOM   501  O O   . PHE A 1 65  ? 73.968  -56.358  -0.053  1.00 75.67  ? 1065 PHE A O   1 
ATOM   502  C CB  . PHE A 1 65  ? 76.368  -56.187  -2.123  1.00 76.76  ? 1065 PHE A CB  1 
ATOM   503  C CG  . PHE A 1 65  ? 77.835  -55.938  -1.845  1.00 77.64  ? 1065 PHE A CG  1 
ATOM   504  C CD1 . PHE A 1 65  ? 78.239  -55.255  -0.700  1.00 78.50  ? 1065 PHE A CD1 1 
ATOM   505  C CD2 . PHE A 1 65  ? 78.814  -56.403  -2.718  1.00 82.45  ? 1065 PHE A CD2 1 
ATOM   506  C CE1 . PHE A 1 65  ? 79.598  -55.053  -0.427  1.00 79.49  ? 1065 PHE A CE1 1 
ATOM   507  C CE2 . PHE A 1 65  ? 80.174  -56.194  -2.449  1.00 84.88  ? 1065 PHE A CE2 1 
ATOM   508  C CZ  . PHE A 1 65  ? 80.556  -55.525  -1.304  1.00 80.73  ? 1065 PHE A CZ  1 
ATOM   509  N N   . ASP A 1 66  ? 73.371  -57.732  -1.769  1.00 77.11  ? 1066 ASP A N   1 
ATOM   510  C CA  . ASP A 1 66  ? 71.912  -57.662  -1.556  1.00 78.14  ? 1066 ASP A CA  1 
ATOM   511  C C   . ASP A 1 66  ? 71.545  -58.363  -0.241  1.00 79.71  ? 1066 ASP A C   1 
ATOM   512  O O   . ASP A 1 66  ? 70.621  -57.933  0.453   1.00 79.77  ? 1066 ASP A O   1 
ATOM   513  C CB  . ASP A 1 66  ? 71.140  -58.298  -2.726  1.00 85.38  ? 1066 ASP A CB  1 
ATOM   514  C CG  . ASP A 1 66  ? 71.162  -57.513  -4.022  1.00 100.05 ? 1066 ASP A CG  1 
ATOM   515  O OD1 . ASP A 1 66  ? 70.823  -56.308  -3.996  1.00 101.31 ? 1066 ASP A OD1 1 
ATOM   516  O OD2 . ASP A 1 66  ? 71.451  -58.119  -5.073  1.00 109.10 ? 1066 ASP A OD2 1 
ATOM   517  N N   . ILE A 1 67  ? 72.296  -59.436  0.094   1.00 74.37  ? 1067 ILE A N   1 
ATOM   518  C CA  . ILE A 1 67  ? 72.186  -60.211  1.332   1.00 72.83  ? 1067 ILE A CA  1 
ATOM   519  C C   . ILE A 1 67  ? 72.651  -59.311  2.488   1.00 71.96  ? 1067 ILE A C   1 
ATOM   520  O O   . ILE A 1 67  ? 71.951  -59.177  3.496   1.00 71.55  ? 1067 ILE A O   1 
ATOM   521  C CB  . ILE A 1 67  ? 73.030  -61.525  1.224   1.00 77.29  ? 1067 ILE A CB  1 
ATOM   522  C CG1 . ILE A 1 67  ? 72.501  -62.457  0.119   1.00 82.75  ? 1067 ILE A CG1 1 
ATOM   523  C CG2 . ILE A 1 67  ? 73.120  -62.256  2.570   1.00 77.43  ? 1067 ILE A CG2 1 
ATOM   524  C CD1 . ILE A 1 67  ? 73.524  -63.472  -0.384  1.00 91.89  ? 1067 ILE A CD1 1 
ATOM   525  N N   . LEU A 1 68  ? 73.830  -58.682  2.301   1.00 65.60  ? 1068 LEU A N   1 
ATOM   526  C CA  . LEU A 1 68  ? 74.498  -57.777  3.228   1.00 63.20  ? 1068 LEU A CA  1 
ATOM   527  C C   . LEU A 1 68  ? 73.627  -56.552  3.556   1.00 68.35  ? 1068 LEU A C   1 
ATOM   528  O O   . LEU A 1 68  ? 73.544  -56.185  4.722   1.00 68.48  ? 1068 LEU A O   1 
ATOM   529  C CB  . LEU A 1 68  ? 75.829  -57.338  2.617   1.00 62.69  ? 1068 LEU A CB  1 
ATOM   530  C CG  . LEU A 1 68  ? 76.996  -57.219  3.571   1.00 66.82  ? 1068 LEU A CG  1 
ATOM   531  C CD1 . LEU A 1 68  ? 78.221  -57.890  2.996   1.00 68.05  ? 1068 LEU A CD1 1 
ATOM   532  C CD2 . LEU A 1 68  ? 77.289  -55.764  3.889   1.00 68.81  ? 1068 LEU A CD2 1 
ATOM   533  N N   . VAL A 1 69  ? 72.961  -55.946  2.542   1.00 65.53  ? 1069 VAL A N   1 
ATOM   534  C CA  . VAL A 1 69  ? 72.064  -54.794  2.707   1.00 65.43  ? 1069 VAL A CA  1 
ATOM   535  C C   . VAL A 1 69  ? 70.803  -55.261  3.447   1.00 71.31  ? 1069 VAL A C   1 
ATOM   536  O O   . VAL A 1 69  ? 70.328  -54.552  4.335   1.00 71.33  ? 1069 VAL A O   1 
ATOM   537  C CB  . VAL A 1 69  ? 71.731  -54.085  1.361   1.00 71.20  ? 1069 VAL A CB  1 
ATOM   538  C CG1 . VAL A 1 69  ? 70.648  -53.026  1.526   1.00 72.85  ? 1069 VAL A CG1 1 
ATOM   539  C CG2 . VAL A 1 69  ? 72.968  -53.460  0.745   1.00 70.40  ? 1069 VAL A CG2 1 
ATOM   540  N N   . GLY A 1 70  ? 70.309  -56.453  3.097   1.00 70.11  ? 1070 GLY A N   1 
ATOM   541  C CA  . GLY A 1 70  ? 69.146  -57.082  3.724   1.00 71.96  ? 1070 GLY A CA  1 
ATOM   542  C C   . GLY A 1 70  ? 69.331  -57.316  5.213   1.00 74.36  ? 1070 GLY A C   1 
ATOM   543  O O   . GLY A 1 70  ? 68.420  -57.056  6.006   1.00 74.05  ? 1070 GLY A O   1 
ATOM   544  N N   . GLN A 1 71  ? 70.540  -57.777  5.599   1.00 70.30  ? 1071 GLN A N   1 
ATOM   545  C CA  . GLN A 1 71  ? 70.946  -58.016  6.986   1.00 69.97  ? 1071 GLN A CA  1 
ATOM   546  C C   . GLN A 1 71  ? 71.125  -56.695  7.754   1.00 72.20  ? 1071 GLN A C   1 
ATOM   547  O O   . GLN A 1 71  ? 70.856  -56.660  8.959   1.00 73.06  ? 1071 GLN A O   1 
ATOM   548  C CB  . GLN A 1 71  ? 72.237  -58.838  7.033   1.00 70.91  ? 1071 GLN A CB  1 
ATOM   549  C CG  . GLN A 1 71  ? 71.985  -60.348  6.941   1.00 96.37  ? 1071 GLN A CG  1 
ATOM   550  C CD  . GLN A 1 71  ? 73.239  -61.171  6.738   1.00 117.35 ? 1071 GLN A CD  1 
ATOM   551  O OE1 . GLN A 1 71  ? 73.283  -62.067  5.892   1.00 114.33 ? 1071 GLN A OE1 1 
ATOM   552  N NE2 . GLN A 1 71  ? 74.277  -60.918  7.527   1.00 108.61 ? 1071 GLN A NE2 1 
ATOM   553  N N   . ILE A 1 72  ? 71.571  -55.616  7.057   1.00 66.19  ? 1072 ILE A N   1 
ATOM   554  C CA  . ILE A 1 72  ? 71.749  -54.275  7.634   1.00 65.38  ? 1072 ILE A CA  1 
ATOM   555  C C   . ILE A 1 72  ? 70.356  -53.714  7.986   1.00 72.41  ? 1072 ILE A C   1 
ATOM   556  O O   . ILE A 1 72  ? 70.183  -53.180  9.081   1.00 73.41  ? 1072 ILE A O   1 
ATOM   557  C CB  . ILE A 1 72  ? 72.583  -53.327  6.702   1.00 67.07  ? 1072 ILE A CB  1 
ATOM   558  C CG1 . ILE A 1 72  ? 74.080  -53.681  6.747   1.00 65.32  ? 1072 ILE A CG1 1 
ATOM   559  C CG2 . ILE A 1 72  ? 72.400  -51.850  7.067   1.00 69.99  ? 1072 ILE A CG2 1 
ATOM   560  C CD1 . ILE A 1 72  ? 74.938  -53.142  5.569   1.00 68.41  ? 1072 ILE A CD1 1 
ATOM   561  N N   . ASP A 1 73  ? 69.368  -53.888  7.084   1.00 71.24  ? 1073 ASP A N   1 
ATOM   562  C CA  . ASP A 1 73  ? 67.981  -53.448  7.257   1.00 74.51  ? 1073 ASP A CA  1 
ATOM   563  C C   . ASP A 1 73  ? 67.284  -54.155  8.437   1.00 80.79  ? 1073 ASP A C   1 
ATOM   564  O O   . ASP A 1 73  ? 66.465  -53.533  9.118   1.00 82.47  ? 1073 ASP A O   1 
ATOM   565  C CB  . ASP A 1 73  ? 67.183  -53.686  5.964   1.00 78.99  ? 1073 ASP A CB  1 
ATOM   566  C CG  . ASP A 1 73  ? 67.446  -52.699  4.839   1.00 96.41  ? 1073 ASP A CG  1 
ATOM   567  O OD1 . ASP A 1 73  ? 67.944  -51.580  5.128   1.00 97.41  ? 1073 ASP A OD1 1 
ATOM   568  O OD2 . ASP A 1 73  ? 67.102  -53.022  3.674   1.00 105.70 ? 1073 ASP A OD2 1 
ATOM   569  N N   . ASP A 1 74  ? 67.600  -55.453  8.663   1.00 77.94  ? 1074 ASP A N   1 
ATOM   570  C CA  . ASP A 1 74  ? 67.064  -56.251  9.773   1.00 80.43  ? 1074 ASP A CA  1 
ATOM   571  C C   . ASP A 1 74  ? 67.561  -55.675  11.100  1.00 85.35  ? 1074 ASP A C   1 
ATOM   572  O O   . ASP A 1 74  ? 66.773  -55.495  12.031  1.00 87.73  ? 1074 ASP A O   1 
ATOM   573  C CB  . ASP A 1 74  ? 67.478  -57.728  9.635   1.00 83.04  ? 1074 ASP A CB  1 
ATOM   574  C CG  . ASP A 1 74  ? 66.728  -58.545  8.592   1.00 99.56  ? 1074 ASP A CG  1 
ATOM   575  O OD1 . ASP A 1 74  ? 65.716  -58.037  8.043   1.00 102.61 ? 1074 ASP A OD1 1 
ATOM   576  O OD2 . ASP A 1 74  ? 67.132  -59.710  8.346   1.00 106.94 ? 1074 ASP A OD2 1 
ATOM   577  N N   . ALA A 1 75  ? 68.873  -55.357  11.153  1.00 80.28  ? 1075 ALA A N   1 
ATOM   578  C CA  . ALA A 1 75  ? 69.565  -54.745  12.287  1.00 80.66  ? 1075 ALA A CA  1 
ATOM   579  C C   . ALA A 1 75  ? 69.071  -53.316  12.514  1.00 85.85  ? 1075 ALA A C   1 
ATOM   580  O O   . ALA A 1 75  ? 68.964  -52.886  13.663  1.00 88.09  ? 1075 ALA A O   1 
ATOM   581  C CB  . ALA A 1 75  ? 71.062  -54.746  12.036  1.00 79.18  ? 1075 ALA A CB  1 
ATOM   582  N N   . LEU A 1 76  ? 68.755  -52.593  11.417  1.00 81.54  ? 1076 LEU A N   1 
ATOM   583  C CA  . LEU A 1 76  ? 68.226  -51.229  11.445  1.00 83.40  ? 1076 LEU A CA  1 
ATOM   584  C C   . LEU A 1 76  ? 66.830  -51.210  12.057  1.00 90.78  ? 1076 LEU A C   1 
ATOM   585  O O   . LEU A 1 76  ? 66.516  -50.291  12.813  1.00 93.31  ? 1076 LEU A O   1 
ATOM   586  C CB  . LEU A 1 76  ? 68.183  -50.625  10.033  1.00 82.62  ? 1076 LEU A CB  1 
ATOM   587  C CG  . LEU A 1 76  ? 69.428  -49.891  9.548   1.00 86.19  ? 1076 LEU A CG  1 
ATOM   588  C CD1 . LEU A 1 76  ? 69.461  -49.856  8.033   1.00 85.90  ? 1076 LEU A CD1 1 
ATOM   589  C CD2 . LEU A 1 76  ? 69.490  -48.468  10.105  1.00 90.97  ? 1076 LEU A CD2 1 
ATOM   590  N N   . LYS A 1 77  ? 66.003  -52.234  11.740  1.00 87.87  ? 1077 LYS A N   1 
ATOM   591  C CA  . LYS A 1 77  ? 64.642  -52.395  12.253  1.00 91.57  ? 1077 LYS A CA  1 
ATOM   592  C C   . LYS A 1 77  ? 64.654  -52.591  13.777  1.00 97.88  ? 1077 LYS A C   1 
ATOM   593  O O   . LYS A 1 77  ? 63.754  -52.107  14.460  1.00 101.75 ? 1077 LYS A O   1 
ATOM   594  C CB  . LYS A 1 77  ? 63.939  -53.576  11.565  1.00 95.12  ? 1077 LYS A CB  1 
ATOM   595  C CG  . LYS A 1 77  ? 62.458  -53.324  11.269  1.00 120.01 ? 1077 LYS A CG  1 
ATOM   596  C CD  . LYS A 1 77  ? 61.538  -53.811  12.388  1.00 139.60 ? 1077 LYS A CD  1 
ATOM   597  C CE  . LYS A 1 77  ? 60.096  -53.435  12.147  1.00 161.20 ? 1077 LYS A CE  1 
ATOM   598  N NZ  . LYS A 1 77  ? 59.199  -53.992  13.196  1.00 177.65 ? 1077 LYS A NZ  1 
ATOM   599  N N   . LEU A 1 78  ? 65.689  -53.272  14.304  1.00 92.27  ? 1078 LEU A N   1 
ATOM   600  C CA  . LEU A 1 78  ? 65.868  -53.509  15.739  1.00 94.20  ? 1078 LEU A CA  1 
ATOM   601  C C   . LEU A 1 78  ? 66.336  -52.230  16.445  1.00 98.17  ? 1078 LEU A C   1 
ATOM   602  O O   . LEU A 1 78  ? 65.794  -51.886  17.496  1.00 101.92 ? 1078 LEU A O   1 
ATOM   603  C CB  . LEU A 1 78  ? 66.871  -54.647  15.979  1.00 92.81  ? 1078 LEU A CB  1 
ATOM   604  C CG  . LEU A 1 78  ? 66.477  -56.020  15.453  1.00 96.99  ? 1078 LEU A CG  1 
ATOM   605  C CD1 . LEU A 1 78  ? 67.700  -56.881  15.234  1.00 95.17  ? 1078 LEU A CD1 1 
ATOM   606  C CD2 . LEU A 1 78  ? 65.486  -56.703  16.380  1.00 103.75 ? 1078 LEU A CD2 1 
ATOM   607  N N   . ALA A 1 79  ? 67.332  -51.523  15.852  1.00 90.51  ? 1079 ALA A N   1 
ATOM   608  C CA  . ALA A 1 79  ? 67.910  -50.272  16.361  1.00 91.33  ? 1079 ALA A CA  1 
ATOM   609  C C   . ALA A 1 79  ? 66.870  -49.157  16.435  1.00 97.83  ? 1079 ALA A C   1 
ATOM   610  O O   . ALA A 1 79  ? 66.894  -48.387  17.395  1.00 101.99 ? 1079 ALA A O   1 
ATOM   611  C CB  . ALA A 1 79  ? 69.074  -49.836  15.485  1.00 88.66  ? 1079 ALA A CB  1 
ATOM   612  N N   . ASN A 1 80  ? 65.947  -49.086  15.439  1.00 92.40  ? 1080 ASN A N   1 
ATOM   613  C CA  . ASN A 1 80  ? 64.864  -48.090  15.363  1.00 95.21  ? 1080 ASN A CA  1 
ATOM   614  C C   . ASN A 1 80  ? 63.789  -48.343  16.428  1.00 101.81 ? 1080 ASN A C   1 
ATOM   615  O O   . ASN A 1 80  ? 63.093  -47.406  16.826  1.00 105.40 ? 1080 ASN A O   1 
ATOM   616  C CB  . ASN A 1 80  ? 64.235  -48.065  13.971  1.00 93.60  ? 1080 ASN A CB  1 
ATOM   617  C CG  . ASN A 1 80  ? 64.903  -47.091  13.037  1.00 110.69 ? 1080 ASN A CG  1 
ATOM   618  O OD1 . ASN A 1 80  ? 65.895  -47.403  12.373  1.00 93.14  ? 1080 ASN A OD1 1 
ATOM   619  N ND2 . ASN A 1 80  ? 64.368  -45.884  12.967  1.00 110.26 ? 1080 ASN A ND2 1 
ATOM   620  N N   . GLU A 1 81  ? 63.669  -49.606  16.887  1.00 97.26  ? 1081 GLU A N   1 
ATOM   621  C CA  . GLU A 1 81  ? 62.746  -50.036  17.941  1.00 101.56 ? 1081 GLU A CA  1 
ATOM   622  C C   . GLU A 1 81  ? 63.378  -49.830  19.335  1.00 108.05 ? 1081 GLU A C   1 
ATOM   623  O O   . GLU A 1 81  ? 62.691  -49.965  20.353  1.00 112.61 ? 1081 GLU A O   1 
ATOM   624  C CB  . GLU A 1 81  ? 62.361  -51.513  17.747  1.00 101.99 ? 1081 GLU A CB  1 
ATOM   625  C CG  . GLU A 1 81  ? 61.320  -51.760  16.670  1.00 112.40 ? 1081 GLU A CG  1 
ATOM   626  C CD  . GLU A 1 81  ? 60.956  -53.219  16.466  1.00 138.48 ? 1081 GLU A CD  1 
ATOM   627  O OE1 . GLU A 1 81  ? 61.867  -54.035  16.193  1.00 123.05 ? 1081 GLU A OE1 1 
ATOM   628  O OE2 . GLU A 1 81  ? 59.750  -53.545  16.561  1.00 145.94 ? 1081 GLU A OE2 1 
ATOM   629  N N   . GLY A 1 82  ? 64.674  -49.503  19.349  1.00 101.84 ? 1082 GLY A N   1 
ATOM   630  C CA  . GLY A 1 82  ? 65.467  -49.279  20.552  1.00 104.89 ? 1082 GLY A CA  1 
ATOM   631  C C   . GLY A 1 82  ? 65.929  -50.582  21.164  1.00 108.61 ? 1082 GLY A C   1 
ATOM   632  O O   . GLY A 1 82  ? 65.725  -50.812  22.359  1.00 114.68 ? 1082 GLY A O   1 
ATOM   633  N N   . LYS A 1 83  ? 66.538  -51.455  20.335  1.00 98.12  ? 1083 LYS A N   1 
ATOM   634  C CA  . LYS A 1 83  ? 67.001  -52.781  20.740  1.00 97.29  ? 1083 LYS A CA  1 
ATOM   635  C C   . LYS A 1 83  ? 68.494  -52.928  20.433  1.00 97.66  ? 1083 LYS A C   1 
ATOM   636  O O   . LYS A 1 83  ? 68.861  -53.453  19.379  1.00 93.14  ? 1083 LYS A O   1 
ATOM   637  C CB  . LYS A 1 83  ? 66.158  -53.868  20.034  1.00 97.48  ? 1083 LYS A CB  1 
ATOM   638  C CG  . LYS A 1 83  ? 64.671  -53.830  20.401  1.00 108.40 ? 1083 LYS A CG  1 
ATOM   639  C CD  . LYS A 1 83  ? 63.808  -54.704  19.510  1.00 111.82 ? 1083 LYS A CD  1 
ATOM   640  C CE  . LYS A 1 83  ? 62.365  -54.626  19.942  1.00 123.04 ? 1083 LYS A CE  1 
ATOM   641  N NZ  . LYS A 1 83  ? 61.467  -55.342  19.003  1.00 130.41 ? 1083 LYS A NZ  1 
ATOM   642  N N   . VAL A 1 84  ? 69.354  -52.445  21.361  1.00 96.55  ? 1084 VAL A N   1 
ATOM   643  C CA  . VAL A 1 84  ? 70.823  -52.432  21.245  1.00 94.09  ? 1084 VAL A CA  1 
ATOM   644  C C   . VAL A 1 84  ? 71.377  -53.859  21.136  1.00 95.78  ? 1084 VAL A C   1 
ATOM   645  O O   . VAL A 1 84  ? 71.981  -54.188  20.113  1.00 90.81  ? 1084 VAL A O   1 
ATOM   646  C CB  . VAL A 1 84  ? 71.512  -51.652  22.397  1.00 103.68 ? 1084 VAL A CB  1 
ATOM   647  C CG1 . VAL A 1 84  ? 73.011  -51.506  22.146  1.00 102.54 ? 1084 VAL A CG1 1 
ATOM   648  C CG2 . VAL A 1 84  ? 70.880  -50.279  22.600  1.00 106.22 ? 1084 VAL A CG2 1 
ATOM   649  N N   . LYS A 1 85  ? 71.162  -54.695  22.179  1.00 96.38  ? 1085 LYS A N   1 
ATOM   650  C CA  . LYS A 1 85  ? 71.631  -56.086  22.272  1.00 96.38  ? 1085 LYS A CA  1 
ATOM   651  C C   . LYS A 1 85  ? 71.193  -56.947  21.074  1.00 94.51  ? 1085 LYS A C   1 
ATOM   652  O O   . LYS A 1 85  ? 71.935  -57.834  20.654  1.00 92.07  ? 1085 LYS A O   1 
ATOM   653  C CB  . LYS A 1 85  ? 71.136  -56.723  23.580  1.00 105.86 ? 1085 LYS A CB  1 
ATOM   654  C CG  . LYS A 1 85  ? 72.142  -56.680  24.730  1.00 121.88 ? 1085 LYS A CG  1 
ATOM   655  C CD  . LYS A 1 85  ? 72.072  -55.388  25.536  1.00 134.91 ? 1085 LYS A CD  1 
ATOM   656  C CE  . LYS A 1 85  ? 73.176  -55.305  26.558  1.00 152.76 ? 1085 LYS A CE  1 
ATOM   657  N NZ  . LYS A 1 85  ? 73.188  -53.984  27.238  1.00 167.12 ? 1085 LYS A NZ  1 
ATOM   658  N N   . GLU A 1 86  ? 70.003  -56.667  20.522  1.00 89.73  ? 1086 GLU A N   1 
ATOM   659  C CA  . GLU A 1 86  ? 69.424  -57.376  19.381  1.00 86.04  ? 1086 GLU A CA  1 
ATOM   660  C C   . GLU A 1 86  ? 70.059  -56.903  18.071  1.00 84.85  ? 1086 GLU A C   1 
ATOM   661  O O   . GLU A 1 86  ? 70.353  -57.743  17.218  1.00 83.15  ? 1086 GLU A O   1 
ATOM   662  C CB  . GLU A 1 86  ? 67.896  -57.211  19.340  1.00 88.62  ? 1086 GLU A CB  1 
ATOM   663  C CG  . GLU A 1 86  ? 67.179  -57.831  20.528  1.00 101.65 ? 1086 GLU A CG  1 
ATOM   664  C CD  . GLU A 1 86  ? 66.949  -56.902  21.706  1.00 115.98 ? 1086 GLU A CD  1 
ATOM   665  O OE1 . GLU A 1 86  ? 65.769  -56.584  21.977  1.00 122.92 ? 1086 GLU A OE1 1 
ATOM   666  O OE2 . GLU A 1 86  ? 67.935  -56.487  22.357  1.00 96.42  ? 1086 GLU A OE2 1 
ATOM   667  N N   . ALA A 1 87  ? 70.289  -55.572  17.917  1.00 79.17  ? 1087 ALA A N   1 
ATOM   668  C CA  . ALA A 1 87  ? 70.930  -54.987  16.733  1.00 74.07  ? 1087 ALA A CA  1 
ATOM   669  C C   . ALA A 1 87  ? 72.416  -55.355  16.676  1.00 77.21  ? 1087 ALA A C   1 
ATOM   670  O O   . ALA A 1 87  ? 72.944  -55.546  15.580  1.00 74.04  ? 1087 ALA A O   1 
ATOM   671  C CB  . ALA A 1 87  ? 70.763  -53.478  16.724  1.00 74.81  ? 1087 ALA A CB  1 
ATOM   672  N N   . GLN A 1 88  ? 73.078  -55.475  17.852  1.00 77.05  ? 1088 GLN A N   1 
ATOM   673  C CA  . GLN A 1 88  ? 74.485  -55.871  17.970  1.00 77.41  ? 1088 GLN A CA  1 
ATOM   674  C C   . GLN A 1 88  ? 74.651  -57.366  17.615  1.00 82.10  ? 1088 GLN A C   1 
ATOM   675  O O   . GLN A 1 88  ? 75.695  -57.757  17.083  1.00 80.85  ? 1088 GLN A O   1 
ATOM   676  C CB  . GLN A 1 88  ? 75.021  -55.584  19.382  1.00 84.27  ? 1088 GLN A CB  1 
ATOM   677  C CG  . GLN A 1 88  ? 75.326  -54.108  19.649  1.00 96.75  ? 1088 GLN A CG  1 
ATOM   678  C CD  . GLN A 1 88  ? 75.761  -53.825  21.073  1.00 118.72 ? 1088 GLN A CD  1 
ATOM   679  O OE1 . GLN A 1 88  ? 75.418  -54.538  22.022  1.00 118.44 ? 1088 GLN A OE1 1 
ATOM   680  N NE2 . GLN A 1 88  ? 76.495  -52.742  21.263  1.00 112.76 ? 1088 GLN A NE2 1 
ATOM   681  N N   . ALA A 1 89  ? 73.610  -58.185  17.902  1.00 80.71  ? 1089 ALA A N   1 
ATOM   682  C CA  . ALA A 1 89  ? 73.558  -59.617  17.597  1.00 81.81  ? 1089 ALA A CA  1 
ATOM   683  C C   . ALA A 1 89  ? 73.398  -59.844  16.088  1.00 83.84  ? 1089 ALA A C   1 
ATOM   684  O O   . ALA A 1 89  ? 73.982  -60.784  15.544  1.00 83.28  ? 1089 ALA A O   1 
ATOM   685  C CB  . ALA A 1 89  ? 72.412  -60.268  18.351  1.00 86.65  ? 1089 ALA A CB  1 
ATOM   686  N N   . ALA A 1 90  ? 72.609  -58.975  15.416  1.00 79.44  ? 1090 ALA A N   1 
ATOM   687  C CA  . ALA A 1 90  ? 72.366  -59.016  13.973  1.00 76.87  ? 1090 ALA A CA  1 
ATOM   688  C C   . ALA A 1 90  ? 73.617  -58.587  13.191  1.00 81.56  ? 1090 ALA A C   1 
ATOM   689  O O   . ALA A 1 90  ? 73.792  -58.991  12.037  1.00 80.11  ? 1090 ALA A O   1 
ATOM   690  C CB  . ALA A 1 90  ? 71.191  -58.123  13.619  1.00 76.54  ? 1090 ALA A CB  1 
ATOM   691  N N   . ALA A 1 91  ? 74.490  -57.778  13.832  1.00 80.05  ? 1091 ALA A N   1 
ATOM   692  C CA  . ALA A 1 91  ? 75.759  -57.305  13.283  1.00 78.66  ? 1091 ALA A CA  1 
ATOM   693  C C   . ALA A 1 91  ? 76.786  -58.442  13.227  1.00 85.10  ? 1091 ALA A C   1 
ATOM   694  O O   . ALA A 1 91  ? 77.650  -58.432  12.351  1.00 83.64  ? 1091 ALA A O   1 
ATOM   695  C CB  . ALA A 1 91  ? 76.295  -56.154  14.117  1.00 81.04  ? 1091 ALA A CB  1 
ATOM   696  N N   . GLU A 1 92  ? 76.684  -59.426  14.148  1.00 85.79  ? 1092 GLU A N   1 
ATOM   697  C CA  . GLU A 1 92  ? 77.549  -60.614  14.194  1.00 88.41  ? 1092 GLU A CA  1 
ATOM   698  C C   . GLU A 1 92  ? 77.289  -61.523  12.977  1.00 90.31  ? 1092 GLU A C   1 
ATOM   699  O O   . GLU A 1 92  ? 78.183  -62.258  12.566  1.00 90.76  ? 1092 GLU A O   1 
ATOM   700  C CB  . GLU A 1 92  ? 77.334  -61.408  15.498  1.00 95.45  ? 1092 GLU A CB  1 
ATOM   701  C CG  . GLU A 1 92  ? 77.885  -60.746  16.754  1.00 114.83 ? 1092 GLU A CG  1 
ATOM   702  C CD  . GLU A 1 92  ? 77.630  -61.446  18.082  1.00 156.25 ? 1092 GLU A CD  1 
ATOM   703  O OE1 . GLU A 1 92  ? 76.953  -62.500  18.099  1.00 161.03 ? 1092 GLU A OE1 1 
ATOM   704  O OE2 . GLU A 1 92  ? 78.106  -60.923  19.116  1.00 159.27 ? 1092 GLU A OE2 1 
ATOM   705  N N   . GLN A 1 93  ? 76.063  -61.472  12.410  1.00 85.19  ? 1093 GLN A N   1 
ATOM   706  C CA  . GLN A 1 93  ? 75.663  -62.237  11.228  1.00 84.42  ? 1093 GLN A CA  1 
ATOM   707  C C   . GLN A 1 93  ? 76.331  -61.677  9.960   1.00 84.75  ? 1093 GLN A C   1 
ATOM   708  O O   . GLN A 1 93  ? 76.591  -62.444  9.028   1.00 86.18  ? 1093 GLN A O   1 
ATOM   709  C CB  . GLN A 1 93  ? 74.140  -62.254  11.081  1.00 86.28  ? 1093 GLN A CB  1 
ATOM   710  C CG  . GLN A 1 93  ? 73.476  -63.363  11.905  1.00 113.69 ? 1093 GLN A CG  1 
ATOM   711  C CD  . GLN A 1 93  ? 71.985  -63.172  12.116  1.00 141.21 ? 1093 GLN A CD  1 
ATOM   712  O OE1 . GLN A 1 93  ? 71.467  -63.363  13.226  1.00 137.73 ? 1093 GLN A OE1 1 
ATOM   713  N NE2 . GLN A 1 93  ? 71.252  -62.828  11.053  1.00 136.42 ? 1093 GLN A NE2 1 
ATOM   714  N N   . LEU A 1 94  ? 76.624  -60.350  9.934   1.00 76.45  ? 1094 LEU A N   1 
ATOM   715  C CA  . LEU A 1 94  ? 77.314  -59.666  8.831   1.00 72.54  ? 1094 LEU A CA  1 
ATOM   716  C C   . LEU A 1 94  ? 78.746  -60.182  8.698   1.00 75.03  ? 1094 LEU A C   1 
ATOM   717  O O   . LEU A 1 94  ? 79.260  -60.259  7.587   1.00 73.39  ? 1094 LEU A O   1 
ATOM   718  C CB  . LEU A 1 94  ? 77.325  -58.144  9.045   1.00 70.89  ? 1094 LEU A CB  1 
ATOM   719  C CG  . LEU A 1 94  ? 76.038  -57.402  8.724   1.00 74.90  ? 1094 LEU A CG  1 
ATOM   720  C CD1 . LEU A 1 94  ? 75.851  -56.222  9.641   1.00 75.38  ? 1094 LEU A CD1 1 
ATOM   721  C CD2 . LEU A 1 94  ? 76.021  -56.932  7.285   1.00 76.69  ? 1094 LEU A CD2 1 
ATOM   722  N N   . LYS A 1 95  ? 79.371  -60.549  9.841   1.00 73.22  ? 1095 LYS A N   1 
ATOM   723  C CA  . LYS A 1 95  ? 80.717  -61.118  9.927   1.00 75.32  ? 1095 LYS A CA  1 
ATOM   724  C C   . LYS A 1 95  ? 80.796  -62.412  9.120   1.00 81.89  ? 1095 LYS A C   1 
ATOM   725  O O   . LYS A 1 95  ? 81.801  -62.641  8.455   1.00 82.69  ? 1095 LYS A O   1 
ATOM   726  C CB  . LYS A 1 95  ? 81.126  -61.383  11.389  1.00 80.81  ? 1095 LYS A CB  1 
ATOM   727  C CG  . LYS A 1 95  ? 81.504  -60.139  12.174  1.00 89.96  ? 1095 LYS A CG  1 
ATOM   728  C CD  . LYS A 1 95  ? 81.928  -60.483  13.591  1.00 100.31 ? 1095 LYS A CD  1 
ATOM   729  C CE  . LYS A 1 95  ? 82.281  -59.242  14.374  1.00 111.57 ? 1095 LYS A CE  1 
ATOM   730  N NZ  . LYS A 1 95  ? 82.777  -59.571  15.735  1.00 127.60 ? 1095 LYS A NZ  1 
ATOM   731  N N   . THR A 1 96  ? 79.723  -63.236  9.156   1.00 80.14  ? 1096 THR A N   1 
ATOM   732  C CA  . THR A 1 96  ? 79.615  -64.503  8.422   1.00 82.89  ? 1096 THR A CA  1 
ATOM   733  C C   . THR A 1 96  ? 79.508  -64.216  6.904   1.00 84.95  ? 1096 THR A C   1 
ATOM   734  O O   . THR A 1 96  ? 80.032  -64.988  6.099   1.00 86.62  ? 1096 THR A O   1 
ATOM   735  C CB  . THR A 1 96  ? 78.417  -65.327  8.959   1.00 92.54  ? 1096 THR A CB  1 
ATOM   736  O OG1 . THR A 1 96  ? 78.421  -65.323  10.391  1.00 92.80  ? 1096 THR A OG1 1 
ATOM   737  C CG2 . THR A 1 96  ? 78.418  -66.769  8.458   1.00 95.71  ? 1096 THR A CG2 1 
ATOM   738  N N   . THR A 1 97  ? 78.849  -63.098  6.529   1.00 78.38  ? 1097 THR A N   1 
ATOM   739  C CA  . THR A 1 97  ? 78.678  -62.681  5.134   1.00 76.95  ? 1097 THR A CA  1 
ATOM   740  C C   . THR A 1 97  ? 80.007  -62.130  4.596   1.00 80.15  ? 1097 THR A C   1 
ATOM   741  O O   . THR A 1 97  ? 80.389  -62.460  3.474   1.00 81.16  ? 1097 THR A O   1 
ATOM   742  C CB  . THR A 1 97  ? 77.528  -61.652  5.000   1.00 82.20  ? 1097 THR A CB  1 
ATOM   743  O OG1 . THR A 1 97  ? 76.421  -62.054  5.810   1.00 87.64  ? 1097 THR A OG1 1 
ATOM   744  C CG2 . THR A 1 97  ? 77.062  -61.475  3.561   1.00 78.21  ? 1097 THR A CG2 1 
ATOM   745  N N   . ARG A 1 98  ? 80.702  -61.297  5.401   1.00 74.89  ? 1098 ARG A N   1 
ATOM   746  C CA  . ARG A 1 98  ? 81.985  -60.669  5.069   1.00 74.41  ? 1098 ARG A CA  1 
ATOM   747  C C   . ARG A 1 98  ? 83.091  -61.739  4.907   1.00 83.01  ? 1098 ARG A C   1 
ATOM   748  O O   . ARG A 1 98  ? 83.979  -61.566  4.068   1.00 84.31  ? 1098 ARG A O   1 
ATOM   749  C CB  . ARG A 1 98  ? 82.344  -59.619  6.145   1.00 71.07  ? 1098 ARG A CB  1 
ATOM   750  C CG  . ARG A 1 98  ? 83.808  -59.185  6.225   1.00 66.78  ? 1098 ARG A CG  1 
ATOM   751  C CD  . ARG A 1 98  ? 84.394  -59.719  7.502   1.00 62.27  ? 1098 ARG A CD  1 
ATOM   752  N NE  . ARG A 1 98  ? 84.592  -58.677  8.501   1.00 60.11  ? 1098 ARG A NE  1 
ATOM   753  C CZ  . ARG A 1 98  ? 84.918  -58.909  9.768   1.00 77.61  ? 1098 ARG A CZ  1 
ATOM   754  N NH1 . ARG A 1 98  ? 85.116  -57.899  10.604  1.00 69.44  ? 1098 ARG A NH1 1 
ATOM   755  N NH2 . ARG A 1 98  ? 85.038  -60.156  10.212  1.00 61.68  ? 1098 ARG A NH2 1 
ATOM   756  N N   . ASN A 1 99  ? 83.029  -62.829  5.705   1.00 81.64  ? 1099 ASN A N   1 
ATOM   757  C CA  . ASN A 1 99  ? 83.975  -63.934  5.629   1.00 85.66  ? 1099 ASN A CA  1 
ATOM   758  C C   . ASN A 1 99  ? 83.708  -64.784  4.386   1.00 92.61  ? 1099 ASN A C   1 
ATOM   759  O O   . ASN A 1 99  ? 84.655  -65.312  3.804   1.00 96.18  ? 1099 ASN A O   1 
ATOM   760  C CB  . ASN A 1 99  ? 83.936  -64.798  6.885   1.00 90.08  ? 1099 ASN A CB  1 
ATOM   761  C CG  . ASN A 1 99  ? 84.277  -64.080  8.174   1.00 114.74 ? 1099 ASN A CG  1 
ATOM   762  O OD1 . ASN A 1 99  ? 84.915  -63.019  8.200   1.00 106.25 ? 1099 ASN A OD1 1 
ATOM   763  N ND2 . ASN A 1 99  ? 83.797  -64.620  9.283   1.00 111.27 ? 1099 ASN A ND2 1 
ATOM   764  N N   . ALA A 1 100 ? 82.432  -64.906  3.971   1.00 88.20  ? 1100 ALA A N   1 
ATOM   765  C CA  . ALA A 1 100 ? 82.035  -65.639  2.765   1.00 90.38  ? 1100 ALA A CA  1 
ATOM   766  C C   . ALA A 1 100 ? 82.503  -64.874  1.496   1.00 93.01  ? 1100 ALA A C   1 
ATOM   767  O O   . ALA A 1 100 ? 82.726  -65.481  0.449   1.00 95.38  ? 1100 ALA A O   1 
ATOM   768  C CB  . ALA A 1 100 ? 80.527  -65.841  2.751   1.00 90.92  ? 1100 ALA A CB  1 
ATOM   769  N N   . TYR A 1 101 ? 82.707  -63.546  1.634   1.00 86.23  ? 1101 TYR A N   1 
ATOM   770  C CA  . TYR A 1 101 ? 83.207  -62.660  0.588   1.00 85.77  ? 1101 TYR A CA  1 
ATOM   771  C C   . TYR A 1 101 ? 84.723  -62.796  0.453   1.00 91.11  ? 1101 TYR A C   1 
ATOM   772  O O   . TYR A 1 101 ? 85.205  -62.983  -0.662  1.00 93.62  ? 1101 TYR A O   1 
ATOM   773  C CB  . TYR A 1 101 ? 82.830  -61.178  0.872   1.00 84.30  ? 1101 TYR A CB  1 
ATOM   774  C CG  . TYR A 1 101 ? 83.525  -60.178  -0.037  1.00 87.72  ? 1101 TYR A CG  1 
ATOM   775  C CD1 . TYR A 1 101 ? 84.770  -59.644  0.298   1.00 90.67  ? 1101 TYR A CD1 1 
ATOM   776  C CD2 . TYR A 1 101 ? 82.947  -59.778  -1.240  1.00 89.27  ? 1101 TYR A CD2 1 
ATOM   777  C CE1 . TYR A 1 101 ? 85.445  -58.779  -0.565  1.00 92.51  ? 1101 TYR A CE1 1 
ATOM   778  C CE2 . TYR A 1 101 ? 83.601  -58.892  -2.099  1.00 91.29  ? 1101 TYR A CE2 1 
ATOM   779  C CZ  . TYR A 1 101 ? 84.851  -58.398  -1.757  1.00 97.91  ? 1101 TYR A CZ  1 
ATOM   780  O OH  . TYR A 1 101 ? 85.498  -57.521  -2.589  1.00 98.86  ? 1101 TYR A OH  1 
ATOM   781  N N   . ILE A 1 102 ? 85.474  -62.629  1.571   1.00 86.29  ? 1102 ILE A N   1 
ATOM   782  C CA  . ILE A 1 102 ? 86.945  -62.644  1.590   1.00 88.57  ? 1102 ILE A CA  1 
ATOM   783  C C   . ILE A 1 102 ? 87.511  -64.021  1.131   1.00 95.38  ? 1102 ILE A C   1 
ATOM   784  O O   . ILE A 1 102 ? 88.588  -64.054  0.529   1.00 97.49  ? 1102 ILE A O   1 
ATOM   785  C CB  . ILE A 1 102 ? 87.565  -62.168  2.947   1.00 91.81  ? 1102 ILE A CB  1 
ATOM   786  C CG1 . ILE A 1 102 ? 87.198  -63.080  4.139   1.00 93.62  ? 1102 ILE A CG1 1 
ATOM   787  C CG2 . ILE A 1 102 ? 87.207  -60.703  3.236   1.00 89.08  ? 1102 ILE A CG2 1 
ATOM   788  C CD1 . ILE A 1 102 ? 88.344  -63.341  5.137   1.00 105.17 ? 1102 ILE A CD1 1 
ATOM   789  N N   . GLN A 1 103 ? 86.774  -65.130  1.371   1.00 92.15  ? 1103 GLN A N   1 
ATOM   790  C CA  . GLN A 1 103 ? 87.174  -66.465  0.918   1.00 96.77  ? 1103 GLN A CA  1 
ATOM   791  C C   . GLN A 1 103 ? 87.128  -66.539  -0.612  1.00 102.85 ? 1103 GLN A C   1 
ATOM   792  O O   . GLN A 1 103 ? 87.961  -67.214  -1.217  1.00 107.31 ? 1103 GLN A O   1 
ATOM   793  C CB  . GLN A 1 103 ? 86.264  -67.553  1.515   1.00 99.65  ? 1103 GLN A CB  1 
ATOM   794  C CG  . GLN A 1 103 ? 86.593  -67.959  2.947   1.00 111.66 ? 1103 GLN A CG  1 
ATOM   795  C CD  . GLN A 1 103 ? 85.823  -69.185  3.407   1.00 136.33 ? 1103 GLN A CD  1 
ATOM   796  O OE1 . GLN A 1 103 ? 84.618  -69.347  3.161   1.00 130.97 ? 1103 GLN A OE1 1 
ATOM   797  N NE2 . GLN A 1 103 ? 86.497  -70.066  4.127   1.00 134.89 ? 1103 GLN A NE2 1 
ATOM   798  N N   . LYS A 1 104 ? 86.172  -65.814  -1.228  1.00 96.62  ? 1104 LYS A N   1 
ATOM   799  C CA  . LYS A 1 104 ? 85.940  -65.802  -2.669  1.00 98.85  ? 1104 LYS A CA  1 
ATOM   800  C C   . LYS A 1 104 ? 86.708  -64.708  -3.428  1.00 103.87 ? 1104 LYS A C   1 
ATOM   801  O O   . LYS A 1 104 ? 87.306  -65.022  -4.460  1.00 107.77 ? 1104 LYS A O   1 
ATOM   802  C CB  . LYS A 1 104 ? 84.437  -65.659  -2.972  1.00 99.28  ? 1104 LYS A CB  1 
ATOM   803  C CG  . LYS A 1 104 ? 83.602  -66.884  -2.593  1.00 113.61 ? 1104 LYS A CG  1 
ATOM   804  C CD  . LYS A 1 104 ? 82.111  -66.640  -2.802  1.00 120.24 ? 1104 LYS A CD  1 
ATOM   805  C CE  . LYS A 1 104 ? 81.254  -67.757  -2.251  1.00 128.45 ? 1104 LYS A CE  1 
ATOM   806  N NZ  . LYS A 1 104 ? 79.802  -67.436  -2.336  1.00 131.74 ? 1104 LYS A NZ  1 
ATOM   807  N N   . TYR A 1 105 ? 86.687  -63.442  -2.943  1.00 97.77  ? 1105 TYR A N   1 
ATOM   808  C CA  . TYR A 1 105 ? 87.271  -62.294  -3.658  1.00 98.39  ? 1105 TYR A CA  1 
ATOM   809  C C   . TYR A 1 105 ? 88.640  -61.786  -3.111  1.00 104.12 ? 1105 TYR A C   1 
ATOM   810  O O   . TYR A 1 105 ? 89.015  -60.648  -3.415  1.00 103.65 ? 1105 TYR A O   1 
ATOM   811  C CB  . TYR A 1 105 ? 86.252  -61.133  -3.718  1.00 95.94  ? 1105 TYR A CB  1 
ATOM   812  C CG  . TYR A 1 105 ? 85.008  -61.518  -4.489  1.00 99.26  ? 1105 TYR A CG  1 
ATOM   813  C CD1 . TYR A 1 105 ? 84.971  -61.434  -5.878  1.00 105.20 ? 1105 TYR A CD1 1 
ATOM   814  C CD2 . TYR A 1 105 ? 83.902  -62.063  -3.840  1.00 98.48  ? 1105 TYR A CD2 1 
ATOM   815  C CE1 . TYR A 1 105 ? 83.853  -61.857  -6.600  1.00 109.10 ? 1105 TYR A CE1 1 
ATOM   816  C CE2 . TYR A 1 105 ? 82.778  -62.486  -4.549  1.00 101.32 ? 1105 TYR A CE2 1 
ATOM   817  C CZ  . TYR A 1 105 ? 82.756  -62.378  -5.930  1.00 113.79 ? 1105 TYR A CZ  1 
ATOM   818  O OH  . TYR A 1 105 ? 81.648  -62.796  -6.629  1.00 117.68 ? 1105 TYR A OH  1 
ATOM   819  N N   . LEU A 1 106 ? 89.419  -62.647  -2.404  1.00 102.83 ? 1106 LEU A N   1 
ATOM   820  C CA  . LEU A 1 106 ? 90.761  -62.307  -1.908  1.00 126.11 ? 1106 LEU A CA  1 
ATOM   821  C C   . LEU A 1 106 ? 91.719  -63.484  -2.105  1.00 150.78 ? 1106 LEU A C   1 
ATOM   822  O O   . LEU A 1 106 ? 92.617  -63.424  -2.946  1.00 114.95 ? 1106 LEU A O   1 
ATOM   823  C CB  . LEU A 1 106 ? 90.743  -61.880  -0.421  1.00 123.54 ? 1106 LEU A CB  1 
ATOM   824  C CG  . LEU A 1 106 ? 90.712  -60.371  -0.044  1.00 125.45 ? 1106 LEU A CG  1 
ATOM   825  C CD1 . LEU A 1 106 ? 91.840  -59.571  -0.699  1.00 128.86 ? 1106 LEU A CD1 1 
ATOM   826  C CD2 . LEU A 1 106 ? 89.338  -59.742  -0.244  1.00 122.89 ? 1106 LEU A CD2 1 
ATOM   827  N N   . PRO A 1 115 ? 92.065  -73.783  -7.192  1.00 103.88 ? 39   PRO A N   1 
ATOM   828  C CA  . PRO A 1 115 ? 91.281  -74.748  -6.405  1.00 103.94 ? 39   PRO A CA  1 
ATOM   829  C C   . PRO A 1 115 ? 92.109  -75.937  -5.901  1.00 106.48 ? 39   PRO A C   1 
ATOM   830  O O   . PRO A 1 115 ? 93.243  -76.138  -6.332  1.00 106.10 ? 39   PRO A O   1 
ATOM   831  C CB  . PRO A 1 115 ? 90.197  -75.225  -7.389  1.00 108.03 ? 39   PRO A CB  1 
ATOM   832  C CG  . PRO A 1 115 ? 90.393  -74.419  -8.674  1.00 113.42 ? 39   PRO A CG  1 
ATOM   833  C CD  . PRO A 1 115 ? 91.316  -73.285  -8.359  1.00 107.30 ? 39   PRO A CD  1 
ATOM   834  N N   . SER A 1 116 ? 91.520  -76.744  -5.007  1.00 101.87 ? 40   SER A N   1 
ATOM   835  C CA  . SER A 1 116 ? 92.151  -77.946  -4.467  1.00 100.68 ? 40   SER A CA  1 
ATOM   836  C C   . SER A 1 116 ? 92.440  -78.967  -5.575  1.00 103.57 ? 40   SER A C   1 
ATOM   837  O O   . SER A 1 116 ? 93.384  -79.750  -5.463  1.00 101.68 ? 40   SER A O   1 
ATOM   838  C CB  . SER A 1 116 ? 91.249  -78.567  -3.412  1.00 105.88 ? 40   SER A CB  1 
ATOM   839  O OG  . SER A 1 116 ? 91.163  -77.713  -2.285  1.00 115.00 ? 40   SER A OG  1 
ATOM   840  N N   . ASP A 1 117 ? 91.644  -78.906  -6.666  1.00 101.03 ? 41   ASP A N   1 
ATOM   841  C CA  . ASP A 1 117 ? 91.742  -79.746  -7.853  1.00 101.53 ? 41   ASP A CA  1 
ATOM   842  C C   . ASP A 1 117 ? 93.037  -79.441  -8.657  1.00 102.24 ? 41   ASP A C   1 
ATOM   843  O O   . ASP A 1 117 ? 93.221  -80.006  -9.737  1.00 104.17 ? 41   ASP A O   1 
ATOM   844  C CB  . ASP A 1 117 ? 90.487  -79.601  -8.719  1.00 105.57 ? 41   ASP A CB  1 
ATOM   845  N N   . LYS A 1 118 ? 93.957  -78.604  -8.114  1.00 93.25  ? 42   LYS A N   1 
ATOM   846  C CA  . LYS A 1 118 ? 95.288  -78.378  -8.691  1.00 90.42  ? 42   LYS A CA  1 
ATOM   847  C C   . LYS A 1 118 ? 96.251  -79.508  -8.261  1.00 88.62  ? 42   LYS A C   1 
ATOM   848  O O   . LYS A 1 118 ? 97.449  -79.457  -8.556  1.00 87.00  ? 42   LYS A O   1 
ATOM   849  C CB  . LYS A 1 118 ? 95.856  -77.018  -8.260  1.00 91.07  ? 42   LYS A CB  1 
ATOM   850  C CG  . LYS A 1 118 ? 95.194  -75.836  -8.945  1.00 109.91 ? 42   LYS A CG  1 
ATOM   851  C CD  . LYS A 1 118 ? 95.949  -74.521  -8.724  1.00 121.30 ? 42   LYS A CD  1 
ATOM   852  C CE  . LYS A 1 118 ? 95.443  -73.646  -7.594  1.00 133.02 ? 42   LYS A CE  1 
ATOM   853  N NZ  . LYS A 1 118 ? 95.908  -74.132  -6.269  1.00 139.15 ? 42   LYS A NZ  1 
ATOM   854  N N   . HIS A 1 119 ? 95.701  -80.537  -7.579  1.00 82.28  ? 43   HIS A N   1 
ATOM   855  C CA  . HIS A 1 119 ? 96.361  -81.726  -7.036  1.00 79.82  ? 43   HIS A CA  1 
ATOM   856  C C   . HIS A 1 119 ? 97.152  -82.513  -8.077  1.00 82.94  ? 43   HIS A C   1 
ATOM   857  O O   . HIS A 1 119 ? 96.732  -82.641  -9.229  1.00 84.58  ? 43   HIS A O   1 
ATOM   858  C CB  . HIS A 1 119 ? 95.326  -82.666  -6.392  1.00 80.59  ? 43   HIS A CB  1 
ATOM   859  C CG  . HIS A 1 119 ? 95.896  -83.907  -5.770  1.00 83.00  ? 43   HIS A CG  1 
ATOM   860  N ND1 . HIS A 1 119 ? 96.172  -85.034  -6.524  1.00 85.69  ? 43   HIS A ND1 1 
ATOM   861  C CD2 . HIS A 1 119 ? 96.224  -84.155  -4.481  1.00 83.00  ? 43   HIS A CD2 1 
ATOM   862  C CE1 . HIS A 1 119 ? 96.666  -85.920  -5.676  1.00 84.33  ? 43   HIS A CE1 1 
ATOM   863  N NE2 . HIS A 1 119 ? 96.714  -85.440  -4.437  1.00 83.07  ? 43   HIS A NE2 1 
ATOM   864  N N   . LEU A 1 120 ? 98.289  -83.061  -7.609  1.00 76.16  ? 44   LEU A N   1 
ATOM   865  C CA  . LEU A 1 120 ? 99.250  -83.917  -8.284  1.00 75.50  ? 44   LEU A CA  1 
ATOM   866  C C   . LEU A 1 120 ? 99.663  -85.021  -7.324  1.00 76.31  ? 44   LEU A C   1 
ATOM   867  O O   . LEU A 1 120 ? 99.940  -84.743  -6.160  1.00 73.01  ? 44   LEU A O   1 
ATOM   868  C CB  . LEU A 1 120 ? 100.488 -83.098  -8.721  1.00 74.55  ? 44   LEU A CB  1 
ATOM   869  C CG  . LEU A 1 120 ? 100.359 -82.171  -9.939  1.00 79.94  ? 44   LEU A CG  1 
ATOM   870  C CD1 . LEU A 1 120 ? 101.437 -81.116  -9.910  1.00 78.03  ? 44   LEU A CD1 1 
ATOM   871  C CD2 . LEU A 1 120 ? 100.481 -82.945  -11.244 1.00 84.22  ? 44   LEU A CD2 1 
ATOM   872  N N   . ASP A 1 121 ? 99.715  -86.270  -7.804  1.00 74.40  ? 45   ASP A N   1 
ATOM   873  C CA  . ASP A 1 121 ? 100.146 -87.436  -7.018  1.00 73.88  ? 45   ASP A CA  1 
ATOM   874  C C   . ASP A 1 121 ? 101.659 -87.404  -6.771  1.00 73.54  ? 45   ASP A C   1 
ATOM   875  O O   . ASP A 1 121 ? 102.153 -87.959  -5.780  1.00 73.76  ? 45   ASP A O   1 
ATOM   876  C CB  . ASP A 1 121 ? 99.786  -88.734  -7.761  1.00 79.11  ? 45   ASP A CB  1 
ATOM   877  C CG  . ASP A 1 121 ? 98.327  -89.142  -7.807  1.00 98.22  ? 45   ASP A CG  1 
ATOM   878  O OD1 . ASP A 1 121 ? 97.479  -88.403  -7.259  1.00 98.53  ? 45   ASP A OD1 1 
ATOM   879  O OD2 . ASP A 1 121 ? 98.030  -90.187  -8.405  1.00 109.36 ? 45   ASP A OD2 1 
ATOM   880  N N   . ALA A 1 122 ? 102.404 -86.782  -7.703  1.00 65.27  ? 46   ALA A N   1 
ATOM   881  C CA  . ALA A 1 122 ? 103.856 -86.664  -7.645  1.00 61.44  ? 46   ALA A CA  1 
ATOM   882  C C   . ALA A 1 122 ? 104.339 -85.960  -6.377  1.00 58.62  ? 46   ALA A C   1 
ATOM   883  O O   . ALA A 1 122 ? 105.361 -86.364  -5.831  1.00 57.03  ? 46   ALA A O   1 
ATOM   884  C CB  . ALA A 1 122 ? 104.358 -85.929  -8.870  1.00 62.57  ? 46   ALA A CB  1 
ATOM   885  N N   . ILE A 1 123 ? 103.612 -84.922  -5.907  1.00 52.54  ? 47   ILE A N   1 
ATOM   886  C CA  . ILE A 1 123 ? 103.990 -84.136  -4.731  1.00 49.65  ? 47   ILE A CA  1 
ATOM   887  C C   . ILE A 1 123 ? 104.043 -85.023  -3.450  1.00 53.10  ? 47   ILE A C   1 
ATOM   888  O O   . ILE A 1 123 ? 105.131 -85.077  -2.877  1.00 52.11  ? 47   ILE A O   1 
ATOM   889  C CB  . ILE A 1 123 ? 103.123 -82.875  -4.569  1.00 52.00  ? 47   ILE A CB  1 
ATOM   890  C CG1 . ILE A 1 123 ? 103.636 -81.773  -5.496  1.00 52.13  ? 47   ILE A CG1 1 
ATOM   891  C CG2 . ILE A 1 123 ? 103.102 -82.372  -3.122  1.00 52.11  ? 47   ILE A CG2 1 
ATOM   892  C CD1 . ILE A 1 123 ? 102.582 -81.067  -6.226  1.00 62.85  ? 47   ILE A CD1 1 
ATOM   893  N N   . PRO A 1 124 ? 103.008 -85.802  -3.030  1.00 49.70  ? 48   PRO A N   1 
ATOM   894  C CA  . PRO A 1 124 ? 103.169 -86.620  -1.816  1.00 48.64  ? 48   PRO A CA  1 
ATOM   895  C C   . PRO A 1 124 ? 104.334 -87.637  -1.863  1.00 52.04  ? 48   PRO A C   1 
ATOM   896  O O   . PRO A 1 124 ? 105.050 -87.783  -0.863  1.00 50.86  ? 48   PRO A O   1 
ATOM   897  C CB  . PRO A 1 124 ? 101.826 -87.336  -1.719  1.00 51.58  ? 48   PRO A CB  1 
ATOM   898  C CG  . PRO A 1 124 ? 100.868 -86.429  -2.353  1.00 56.26  ? 48   PRO A CG  1 
ATOM   899  C CD  . PRO A 1 124 ? 101.615 -85.881  -3.520  1.00 52.14  ? 48   PRO A CD  1 
ATOM   900  N N   . ILE A 1 125 ? 104.548 -88.297  -3.035  1.00 48.13  ? 49   ILE A N   1 
ATOM   901  C CA  . ILE A 1 125 ? 105.628 -89.279  -3.247  1.00 47.52  ? 49   ILE A CA  1 
ATOM   902  C C   . ILE A 1 125 ? 106.991 -88.613  -3.023  1.00 51.74  ? 49   ILE A C   1 
ATOM   903  O O   . ILE A 1 125 ? 107.857 -89.195  -2.368  1.00 51.52  ? 49   ILE A O   1 
ATOM   904  C CB  . ILE A 1 125 ? 105.536 -89.906  -4.672  1.00 51.46  ? 49   ILE A CB  1 
ATOM   905  C CG1 . ILE A 1 125 ? 104.206 -90.704  -4.895  1.00 53.31  ? 49   ILE A CG1 1 
ATOM   906  C CG2 . ILE A 1 125 ? 106.768 -90.729  -5.061  1.00 51.57  ? 49   ILE A CG2 1 
ATOM   907  C CD1 . ILE A 1 125 ? 103.813 -91.832  -3.842  1.00 58.49  ? 49   ILE A CD1 1 
ATOM   908  N N   . LEU A 1 126 ? 107.154 -87.380  -3.541  1.00 47.79  ? 50   LEU A N   1 
ATOM   909  C CA  . LEU A 1 126 ? 108.376 -86.587  -3.453  1.00 46.31  ? 50   LEU A CA  1 
ATOM   910  C C   . LEU A 1 126 ? 108.653 -86.125  -2.027  1.00 48.41  ? 50   LEU A C   1 
ATOM   911  O O   . LEU A 1 126 ? 109.813 -85.971  -1.649  1.00 46.92  ? 50   LEU A O   1 
ATOM   912  C CB  . LEU A 1 126 ? 108.255 -85.386  -4.386  1.00 46.44  ? 50   LEU A CB  1 
ATOM   913  C CG  . LEU A 1 126 ? 109.013 -85.442  -5.703  1.00 52.52  ? 50   LEU A CG  1 
ATOM   914  C CD1 . LEU A 1 126 ? 108.714 -86.704  -6.494  1.00 54.62  ? 50   LEU A CD1 1 
ATOM   915  C CD2 . LEU A 1 126 ? 108.681 -84.219  -6.554  1.00 55.93  ? 50   LEU A CD2 1 
ATOM   916  N N   . TYR A 1 127 ? 107.595 -85.940  -1.235  1.00 45.74  ? 51   TYR A N   1 
ATOM   917  C CA  . TYR A 1 127 ? 107.697 -85.525  0.159   1.00 45.05  ? 51   TYR A CA  1 
ATOM   918  C C   . TYR A 1 127 ? 108.215 -86.684  1.015   1.00 52.27  ? 51   TYR A C   1 
ATOM   919  O O   . TYR A 1 127 ? 109.079 -86.496  1.871   1.00 50.69  ? 51   TYR A O   1 
ATOM   920  C CB  . TYR A 1 127 ? 106.338 -85.013  0.643   1.00 45.35  ? 51   TYR A CB  1 
ATOM   921  C CG  . TYR A 1 127 ? 106.124 -83.540  0.350   1.00 45.85  ? 51   TYR A CG  1 
ATOM   922  C CD1 . TYR A 1 127 ? 106.288 -83.029  -0.937  1.00 48.03  ? 51   TYR A CD1 1 
ATOM   923  C CD2 . TYR A 1 127 ? 105.716 -82.664  1.347   1.00 45.83  ? 51   TYR A CD2 1 
ATOM   924  C CE1 . TYR A 1 127 ? 106.116 -81.674  -1.207  1.00 48.21  ? 51   TYR A CE1 1 
ATOM   925  C CE2 . TYR A 1 127 ? 105.514 -81.310  1.084   1.00 46.16  ? 51   TYR A CE2 1 
ATOM   926  C CZ  . TYR A 1 127 ? 105.718 -80.820  -0.196  1.00 55.78  ? 51   TYR A CZ  1 
ATOM   927  O OH  . TYR A 1 127 ? 105.513 -79.492  -0.479  1.00 61.67  ? 51   TYR A OH  1 
ATOM   928  N N   . TYR A 1 128 ? 107.748 -87.899  0.713   1.00 52.14  ? 52   TYR A N   1 
ATOM   929  C CA  . TYR A 1 128 ? 108.201 -89.087  1.407   1.00 52.87  ? 52   TYR A CA  1 
ATOM   930  C C   . TYR A 1 128 ? 109.611 -89.526  0.956   1.00 56.41  ? 52   TYR A C   1 
ATOM   931  O O   . TYR A 1 128 ? 110.407 -89.876  1.827   1.00 56.91  ? 52   TYR A O   1 
ATOM   932  C CB  . TYR A 1 128 ? 107.204 -90.234  1.218   1.00 56.40  ? 52   TYR A CB  1 
ATOM   933  C CG  . TYR A 1 128 ? 106.076 -90.267  2.229   1.00 59.94  ? 52   TYR A CG  1 
ATOM   934  C CD1 . TYR A 1 128 ? 106.221 -90.933  3.444   1.00 62.59  ? 52   TYR A CD1 1 
ATOM   935  C CD2 . TYR A 1 128 ? 104.827 -89.728  1.928   1.00 61.19  ? 52   TYR A CD2 1 
ATOM   936  C CE1 . TYR A 1 128 ? 105.173 -90.998  4.364   1.00 63.32  ? 52   TYR A CE1 1 
ATOM   937  C CE2 . TYR A 1 128 ? 103.767 -89.803  2.833   1.00 62.29  ? 52   TYR A CE2 1 
ATOM   938  C CZ  . TYR A 1 128 ? 103.949 -90.427  4.055   1.00 68.66  ? 52   TYR A CZ  1 
ATOM   939  O OH  . TYR A 1 128 ? 102.913 -90.479  4.952   1.00 71.15  ? 52   TYR A OH  1 
ATOM   940  N N   . ILE A 1 129 ? 109.933 -89.502  -0.378  1.00 51.45  ? 53   ILE A N   1 
ATOM   941  C CA  . ILE A 1 129 ? 111.240 -90.000  -0.860  1.00 50.75  ? 53   ILE A CA  1 
ATOM   942  C C   . ILE A 1 129 ? 112.386 -89.166  -0.293  1.00 53.89  ? 53   ILE A C   1 
ATOM   943  O O   . ILE A 1 129 ? 113.504 -89.672  -0.210  1.00 53.01  ? 53   ILE A O   1 
ATOM   944  C CB  . ILE A 1 129 ? 111.430 -90.223  -2.397  1.00 53.80  ? 53   ILE A CB  1 
ATOM   945  C CG1 . ILE A 1 129 ? 111.918 -88.972  -3.133  1.00 53.23  ? 53   ILE A CG1 1 
ATOM   946  C CG2 . ILE A 1 129 ? 110.242 -90.830  -3.108  1.00 54.61  ? 53   ILE A CG2 1 
ATOM   947  C CD1 . ILE A 1 129 ? 113.359 -89.072  -3.555  1.00 58.85  ? 53   ILE A CD1 1 
ATOM   948  N N   . ILE A 1 130 ? 112.129 -87.905  0.069   1.00 50.85  ? 54   ILE A N   1 
ATOM   949  C CA  . ILE A 1 130 ? 113.187 -87.066  0.637   1.00 50.28  ? 54   ILE A CA  1 
ATOM   950  C C   . ILE A 1 130 ? 113.136 -87.105  2.176   1.00 56.10  ? 54   ILE A C   1 
ATOM   951  O O   . ILE A 1 130 ? 114.073 -86.646  2.839   1.00 56.43  ? 54   ILE A O   1 
ATOM   952  C CB  . ILE A 1 130 ? 113.216 -85.610  0.106   1.00 52.05  ? 54   ILE A CB  1 
ATOM   953  C CG1 . ILE A 1 130 ? 112.137 -84.745  0.738   1.00 51.32  ? 54   ILE A CG1 1 
ATOM   954  C CG2 . ILE A 1 130 ? 113.197 -85.514  -1.418  1.00 53.69  ? 54   ILE A CG2 1 
ATOM   955  C CD1 . ILE A 1 130 ? 112.710 -83.726  1.647   1.00 61.53  ? 54   ILE A CD1 1 
ATOM   956  N N   . PHE A 1 131 ? 112.045 -87.635  2.734   1.00 52.95  ? 55   PHE A N   1 
ATOM   957  C CA  . PHE A 1 131 ? 111.912 -87.750  4.172   1.00 52.84  ? 55   PHE A CA  1 
ATOM   958  C C   . PHE A 1 131 ? 112.858 -88.826  4.656   1.00 61.30  ? 55   PHE A C   1 
ATOM   959  O O   . PHE A 1 131 ? 113.722 -88.523  5.461   1.00 62.23  ? 55   PHE A O   1 
ATOM   960  C CB  . PHE A 1 131 ? 110.440 -88.041  4.562   1.00 54.48  ? 55   PHE A CB  1 
ATOM   961  C CG  . PHE A 1 131 ? 110.200 -88.810  5.848   1.00 55.48  ? 55   PHE A CG  1 
ATOM   962  C CD1 . PHE A 1 131 ? 110.371 -88.202  7.084   1.00 57.18  ? 55   PHE A CD1 1 
ATOM   963  C CD2 . PHE A 1 131 ? 109.781 -90.132  5.818   1.00 57.98  ? 55   PHE A CD2 1 
ATOM   964  C CE1 . PHE A 1 131 ? 110.146 -88.906  8.266   1.00 58.34  ? 55   PHE A CE1 1 
ATOM   965  C CE2 . PHE A 1 131 ? 109.548 -90.836  7.004   1.00 61.13  ? 55   PHE A CE2 1 
ATOM   966  C CZ  . PHE A 1 131 ? 109.734 -90.218  8.219   1.00 58.39  ? 55   PHE A CZ  1 
ATOM   967  N N   . VAL A 1 132 ? 112.723 -90.056  4.135   1.00 60.13  ? 56   VAL A N   1 
ATOM   968  C CA  . VAL A 1 132 ? 113.506 -91.219  4.545   1.00 61.86  ? 56   VAL A CA  1 
ATOM   969  C C   . VAL A 1 132 ? 114.997 -90.994  4.330   1.00 66.87  ? 56   VAL A C   1 
ATOM   970  O O   . VAL A 1 132 ? 115.798 -91.349  5.192   1.00 66.99  ? 56   VAL A O   1 
ATOM   971  C CB  . VAL A 1 132 ? 113.017 -92.521  3.856   1.00 67.64  ? 56   VAL A CB  1 
ATOM   972  C CG1 . VAL A 1 132 ? 111.744 -93.038  4.518   1.00 68.32  ? 56   VAL A CG1 1 
ATOM   973  C CG2 . VAL A 1 132 ? 112.798 -92.336  2.357   1.00 67.69  ? 56   VAL A CG2 1 
ATOM   974  N N   . ILE A 1 133 ? 115.352 -90.370  3.203   1.00 63.75  ? 57   ILE A N   1 
ATOM   975  C CA  . ILE A 1 133 ? 116.728 -90.073  2.825   1.00 63.57  ? 57   ILE A CA  1 
ATOM   976  C C   . ILE A 1 133 ? 117.344 -89.129  3.849   1.00 65.30  ? 57   ILE A C   1 
ATOM   977  O O   . ILE A 1 133 ? 118.402 -89.439  4.399   1.00 65.05  ? 57   ILE A O   1 
ATOM   978  C CB  . ILE A 1 133 ? 116.769 -89.499  1.366   1.00 67.01  ? 57   ILE A CB  1 
ATOM   979  C CG1 . ILE A 1 133 ? 116.523 -90.595  0.289   1.00 69.61  ? 57   ILE A CG1 1 
ATOM   980  C CG2 . ILE A 1 133 ? 118.037 -88.686  1.045   1.00 66.98  ? 57   ILE A CG2 1 
ATOM   981  C CD1 . ILE A 1 133 ? 117.500 -91.844  0.257   1.00 83.91  ? 57   ILE A CD1 1 
ATOM   982  N N   . GLY A 1 134 ? 116.657 -88.017  4.098   1.00 59.88  ? 58   GLY A N   1 
ATOM   983  C CA  . GLY A 1 134 ? 117.080 -86.992  5.033   1.00 58.86  ? 58   GLY A CA  1 
ATOM   984  C C   . GLY A 1 134 ? 117.241 -87.534  6.430   1.00 63.60  ? 58   GLY A C   1 
ATOM   985  O O   . GLY A 1 134 ? 118.192 -87.186  7.130   1.00 64.04  ? 58   GLY A O   1 
ATOM   986  N N   . PHE A 1 135 ? 116.313 -88.387  6.839   1.00 60.04  ? 59   PHE A N   1 
ATOM   987  C CA  . PHE A 1 135 ? 116.329 -88.977  8.161   1.00 61.04  ? 59   PHE A CA  1 
ATOM   988  C C   . PHE A 1 135 ? 117.506 -89.907  8.288   1.00 65.87  ? 59   PHE A C   1 
ATOM   989  O O   . PHE A 1 135 ? 118.167 -89.912  9.327   1.00 65.89  ? 59   PHE A O   1 
ATOM   990  C CB  . PHE A 1 135 ? 115.009 -89.718  8.426   1.00 64.07  ? 59   PHE A CB  1 
ATOM   991  C CG  . PHE A 1 135 ? 114.401 -89.416  9.768   1.00 66.68  ? 59   PHE A CG  1 
ATOM   992  C CD1 . PHE A 1 135 ? 113.612 -88.288  9.954   1.00 69.49  ? 59   PHE A CD1 1 
ATOM   993  C CD2 . PHE A 1 135 ? 114.601 -90.270  10.849  1.00 70.55  ? 59   PHE A CD2 1 
ATOM   994  C CE1 . PHE A 1 135 ? 113.049 -88.008  11.206  1.00 71.12  ? 59   PHE A CE1 1 
ATOM   995  C CE2 . PHE A 1 135 ? 114.039 -89.989  12.098  1.00 73.83  ? 59   PHE A CE2 1 
ATOM   996  C CZ  . PHE A 1 135 ? 113.266 -88.859  12.268  1.00 71.02  ? 59   PHE A CZ  1 
ATOM   997  N N   . LEU A 1 136 ? 117.780 -90.674  7.213   1.00 62.98  ? 60   LEU A N   1 
ATOM   998  C CA  . LEU A 1 136 ? 118.887 -91.614  7.161   1.00 63.40  ? 60   LEU A CA  1 
ATOM   999  C C   . LEU A 1 136 ? 120.197 -90.861  7.192   1.00 65.50  ? 60   LEU A C   1 
ATOM   1000 O O   . LEU A 1 136 ? 121.080 -91.176  7.995   1.00 66.36  ? 60   LEU A O   1 
ATOM   1001 C CB  . LEU A 1 136 ? 118.805 -92.496  5.906   1.00 64.28  ? 60   LEU A CB  1 
ATOM   1002 C CG  . LEU A 1 136 ? 117.951 -93.776  5.993   1.00 71.12  ? 60   LEU A CG  1 
ATOM   1003 C CD1 . LEU A 1 136 ? 117.913 -94.490  4.649   1.00 71.96  ? 60   LEU A CD1 1 
ATOM   1004 C CD2 . LEU A 1 136 ? 118.444 -94.735  7.077   1.00 76.45  ? 60   LEU A CD2 1 
ATOM   1005 N N   . VAL A 1 137 ? 120.294 -89.821  6.355   1.00 58.97  ? 61   VAL A N   1 
ATOM   1006 C CA  . VAL A 1 137 ? 121.533 -89.088  6.314   1.00 57.88  ? 61   VAL A CA  1 
ATOM   1007 C C   . VAL A 1 137 ? 121.793 -88.407  7.652   1.00 60.34  ? 61   VAL A C   1 
ATOM   1008 O O   . VAL A 1 137 ? 122.931 -88.465  8.118   1.00 60.32  ? 61   VAL A O   1 
ATOM   1009 C CB  . VAL A 1 137 ? 121.762 -88.132  5.129   1.00 61.14  ? 61   VAL A CB  1 
ATOM   1010 C CG1 . VAL A 1 137 ? 122.041 -88.911  3.853   1.00 61.14  ? 61   VAL A CG1 1 
ATOM   1011 C CG2 . VAL A 1 137 ? 120.654 -87.098  4.940   1.00 60.11  ? 61   VAL A CG2 1 
ATOM   1012 N N   . ASN A 1 138 ? 120.764 -87.843  8.302   1.00 55.03  ? 62   ASN A N   1 
ATOM   1013 C CA  . ASN A 1 138 ? 120.957 -87.185  9.589   1.00 53.64  ? 62   ASN A CA  1 
ATOM   1014 C C   . ASN A 1 138 ? 121.212 -88.177  10.732  1.00 54.99  ? 62   ASN A C   1 
ATOM   1015 O O   . ASN A 1 138 ? 121.976 -87.855  11.644  1.00 53.89  ? 62   ASN A O   1 
ATOM   1016 C CB  . ASN A 1 138 ? 119.802 -86.277  9.894   1.00 54.02  ? 62   ASN A CB  1 
ATOM   1017 C CG  . ASN A 1 138 ? 119.861 -85.013  9.061   1.00 73.11  ? 62   ASN A CG  1 
ATOM   1018 O OD1 . ASN A 1 138 ? 120.810 -84.227  9.148   1.00 62.18  ? 62   ASN A OD1 1 
ATOM   1019 N ND2 . ASN A 1 138 ? 118.857 -84.767  8.244   1.00 67.06  ? 62   ASN A ND2 1 
ATOM   1020 N N   . ILE A 1 139 ? 120.643 -89.386  10.663  1.00 52.13  ? 63   ILE A N   1 
ATOM   1021 C CA  . ILE A 1 139 ? 120.900 -90.355  11.727  1.00 54.10  ? 63   ILE A CA  1 
ATOM   1022 C C   . ILE A 1 139 ? 122.349 -90.819  11.664  1.00 58.65  ? 63   ILE A C   1 
ATOM   1023 O O   . ILE A 1 139 ? 122.946 -91.116  12.708  1.00 59.39  ? 63   ILE A O   1 
ATOM   1024 C CB  . ILE A 1 139 ? 119.922 -91.564  11.821  1.00 58.38  ? 63   ILE A CB  1 
ATOM   1025 C CG1 . ILE A 1 139 ? 119.927 -92.475  10.578  1.00 60.11  ? 63   ILE A CG1 1 
ATOM   1026 C CG2 . ILE A 1 139 ? 118.496 -91.158  12.190  1.00 57.70  ? 63   ILE A CG2 1 
ATOM   1027 C CD1 . ILE A 1 139 ? 120.912 -93.746  10.665  1.00 75.06  ? 63   ILE A CD1 1 
ATOM   1028 N N   . VAL A 1 140 ? 122.901 -90.876  10.440  1.00 53.88  ? 64   VAL A N   1 
ATOM   1029 C CA  . VAL A 1 140 ? 124.277 -91.288  10.198  1.00 54.34  ? 64   VAL A CA  1 
ATOM   1030 C C   . VAL A 1 140 ? 125.195 -90.337  10.959  1.00 57.48  ? 64   VAL A C   1 
ATOM   1031 O O   . VAL A 1 140 ? 126.138 -90.807  11.575  1.00 59.10  ? 64   VAL A O   1 
ATOM   1032 C CB  . VAL A 1 140 ? 124.594 -91.396  8.673   1.00 57.50  ? 64   VAL A CB  1 
ATOM   1033 C CG1 . VAL A 1 140 ? 126.080 -91.184  8.368   1.00 57.35  ? 64   VAL A CG1 1 
ATOM   1034 C CG2 . VAL A 1 140 ? 124.113 -92.735  8.111   1.00 57.99  ? 64   VAL A CG2 1 
ATOM   1035 N N   . VAL A 1 141 ? 124.891 -89.034  10.968  1.00 51.63  ? 65   VAL A N   1 
ATOM   1036 C CA  . VAL A 1 141 ? 125.678 -88.000  11.661  1.00 51.57  ? 65   VAL A CA  1 
ATOM   1037 C C   . VAL A 1 141 ? 125.667 -88.241  13.166  1.00 58.83  ? 65   VAL A C   1 
ATOM   1038 O O   . VAL A 1 141 ? 126.700 -88.178  13.846  1.00 59.45  ? 65   VAL A O   1 
ATOM   1039 C CB  . VAL A 1 141 ? 125.124 -86.579  11.317  1.00 53.41  ? 65   VAL A CB  1 
ATOM   1040 C CG1 . VAL A 1 141 ? 125.710 -85.489  12.201  1.00 53.95  ? 65   VAL A CG1 1 
ATOM   1041 C CG2 . VAL A 1 141 ? 125.288 -86.235  9.844   1.00 52.01  ? 65   VAL A CG2 1 
ATOM   1042 N N   . VAL A 1 142 ? 124.478 -88.477  13.674  1.00 57.73  ? 66   VAL A N   1 
ATOM   1043 C CA  . VAL A 1 142 ? 124.244 -88.690  15.085  1.00 59.69  ? 66   VAL A CA  1 
ATOM   1044 C C   . VAL A 1 142 ? 125.019 -89.934  15.541  1.00 68.39  ? 66   VAL A C   1 
ATOM   1045 O O   . VAL A 1 142 ? 125.734 -89.881  16.550  1.00 68.65  ? 66   VAL A O   1 
ATOM   1046 C CB  . VAL A 1 142 ? 122.708 -88.760  15.272  1.00 62.36  ? 66   VAL A CB  1 
ATOM   1047 C CG1 . VAL A 1 142 ? 122.265 -89.804  16.283  1.00 63.91  ? 66   VAL A CG1 1 
ATOM   1048 C CG2 . VAL A 1 142 ? 122.140 -87.378  15.580  1.00 60.77  ? 66   VAL A CG2 1 
ATOM   1049 N N   . THR A 1 143 ? 124.925 -91.011  14.752  1.00 68.32  ? 67   THR A N   1 
ATOM   1050 C CA  . THR A 1 143 ? 125.618 -92.258  15.042  1.00 71.20  ? 67   THR A CA  1 
ATOM   1051 C C   . THR A 1 143 ? 127.121 -92.111  14.866  1.00 77.28  ? 67   THR A C   1 
ATOM   1052 O O   . THR A 1 143 ? 127.877 -92.713  15.630  1.00 78.18  ? 67   THR A O   1 
ATOM   1053 C CB  . THR A 1 143 ? 125.092 -93.409  14.203  1.00 80.01  ? 67   THR A CB  1 
ATOM   1054 O OG1 . THR A 1 143 ? 124.986 -93.005  12.849  1.00 82.11  ? 67   THR A OG1 1 
ATOM   1055 C CG2 . THR A 1 143 ? 123.752 -93.937  14.708  1.00 77.11  ? 67   THR A CG2 1 
ATOM   1056 N N   . LEU A 1 144 ? 127.571 -91.322  13.881  1.00 74.69  ? 68   LEU A N   1 
ATOM   1057 C CA  . LEU A 1 144 ? 129.002 -91.206  13.709  1.00 76.49  ? 68   LEU A CA  1 
ATOM   1058 C C   . LEU A 1 144 ? 129.601 -90.393  14.865  1.00 86.58  ? 68   LEU A C   1 
ATOM   1059 O O   . LEU A 1 144 ? 130.670 -90.772  15.340  1.00 87.86  ? 68   LEU A O   1 
ATOM   1060 C CB  . LEU A 1 144 ? 129.459 -90.742  12.329  1.00 74.81  ? 68   LEU A CB  1 
ATOM   1061 C CG  . LEU A 1 144 ? 129.279 -89.333  11.886  1.00 77.99  ? 68   LEU A CG  1 
ATOM   1062 C CD1 . LEU A 1 144 ? 130.561 -88.529  12.101  1.00 78.65  ? 68   LEU A CD1 1 
ATOM   1063 C CD2 . LEU A 1 144 ? 128.950 -89.312  10.416  1.00 79.32  ? 68   LEU A CD2 1 
ATOM   1064 N N   . PHE A 1 145 ? 128.881 -89.403  15.415  1.00 86.83  ? 69   PHE A N   1 
ATOM   1065 C CA  . PHE A 1 145 ? 129.356 -88.694  16.604  1.00 90.07  ? 69   PHE A CA  1 
ATOM   1066 C C   . PHE A 1 145 ? 129.510 -89.686  17.759  1.00 100.28 ? 69   PHE A C   1 
ATOM   1067 O O   . PHE A 1 145 ? 130.494 -89.616  18.509  1.00 100.01 ? 69   PHE A O   1 
ATOM   1068 C CB  . PHE A 1 145 ? 128.386 -87.557  16.967  1.00 91.52  ? 69   PHE A CB  1 
ATOM   1069 C CG  . PHE A 1 145 ? 128.629 -86.261  16.225  1.00 92.82  ? 69   PHE A CG  1 
ATOM   1070 C CD1 . PHE A 1 145 ? 129.388 -86.236  15.057  1.00 95.88  ? 69   PHE A CD1 1 
ATOM   1071 C CD2 . PHE A 1 145 ? 128.101 -85.069  16.691  1.00 95.51  ? 69   PHE A CD2 1 
ATOM   1072 C CE1 . PHE A 1 145 ? 129.631 -85.042  14.384  1.00 96.07  ? 69   PHE A CE1 1 
ATOM   1073 C CE2 . PHE A 1 145 ? 128.333 -83.870  16.008  1.00 97.88  ? 69   PHE A CE2 1 
ATOM   1074 C CZ  . PHE A 1 145 ? 129.109 -83.865  14.864  1.00 95.46  ? 69   PHE A CZ  1 
ATOM   1075 N N   . CYS A 1 146 ? 128.548 -90.652  17.863  1.00 101.74 ? 70   CYS A N   1 
ATOM   1076 C CA  . CYS A 1 146 ? 128.560 -91.717  18.879  1.00 105.32 ? 70   CYS A CA  1 
ATOM   1077 C C   . CYS A 1 146 ? 129.812 -92.563  18.736  1.00 115.26 ? 70   CYS A C   1 
ATOM   1078 O O   . CYS A 1 146 ? 130.468 -92.861  19.724  1.00 117.13 ? 70   CYS A O   1 
ATOM   1079 C CB  . CYS A 1 146 ? 127.302 -92.582  18.787  1.00 105.30 ? 70   CYS A CB  1 
ATOM   1080 S SG  . CYS A 1 146 ? 126.187 -92.457  20.208  1.00 110.37 ? 70   CYS A SG  1 
ATOM   1081 N N   . CYS A 1 147 ? 130.140 -92.966  17.488  1.00 114.66 ? 71   CYS A N   1 
ATOM   1082 C CA  . CYS A 1 147 ? 131.317 -93.793  17.183  1.00 117.51 ? 71   CYS A CA  1 
ATOM   1083 C C   . CYS A 1 147 ? 132.589 -93.026  17.493  1.00 124.94 ? 71   CYS A C   1 
ATOM   1084 O O   . CYS A 1 147 ? 133.549 -93.612  17.998  1.00 126.89 ? 71   CYS A O   1 
ATOM   1085 C CB  . CYS A 1 147 ? 131.300 -94.259  15.729  1.00 116.92 ? 71   CYS A CB  1 
ATOM   1086 S SG  . CYS A 1 147 ? 129.971 -95.425  15.324  1.00 120.73 ? 71   CYS A SG  1 
ATOM   1087 N N   . GLN A 1 148 ? 132.600 -91.718  17.180  1.00 121.61 ? 72   GLN A N   1 
ATOM   1088 C CA  . GLN A 1 148 ? 133.747 -90.867  17.435  1.00 122.69 ? 72   GLN A CA  1 
ATOM   1089 C C   . GLN A 1 148 ? 134.012 -90.814  18.938  1.00 129.30 ? 72   GLN A C   1 
ATOM   1090 O O   . GLN A 1 148 ? 135.168 -90.969  19.346  1.00 130.35 ? 72   GLN A O   1 
ATOM   1091 C CB  . GLN A 1 148 ? 133.553 -89.461  16.838  1.00 122.52 ? 72   GLN A CB  1 
ATOM   1092 C CG  . GLN A 1 148 ? 134.795 -88.543  16.927  1.00 137.88 ? 72   GLN A CG  1 
ATOM   1093 C CD  . GLN A 1 148 ? 136.127 -89.251  16.753  1.00 153.99 ? 72   GLN A CD  1 
ATOM   1094 O OE1 . GLN A 1 148 ? 136.419 -89.849  15.710  1.00 148.86 ? 72   GLN A OE1 1 
ATOM   1095 N NE2 . GLN A 1 148 ? 136.958 -89.208  17.786  1.00 143.89 ? 72   GLN A NE2 1 
ATOM   1096 N N   . LYS A 1 149 ? 132.948 -90.644  19.760  1.00 126.57 ? 73   LYS A N   1 
ATOM   1097 C CA  . LYS A 1 149 ? 133.106 -90.648  21.219  1.00 156.70 ? 73   LYS A CA  1 
ATOM   1098 C C   . LYS A 1 149 ? 131.947 -91.386  21.912  1.00 189.32 ? 73   LYS A C   1 
ATOM   1099 O O   . LYS A 1 149 ? 130.911 -90.811  22.257  1.00 150.84 ? 73   LYS A O   1 
ATOM   1100 C CB  . LYS A 1 149 ? 133.309 -89.231  21.815  1.00 159.22 ? 73   LYS A CB  1 
ATOM   1101 C CG  . LYS A 1 149 ? 134.781 -88.802  21.951  1.00 168.91 ? 73   LYS A CG  1 
ATOM   1102 C CD  . LYS A 1 149 ? 135.520 -89.474  23.122  1.00 177.01 ? 73   LYS A CD  1 
ATOM   1103 C CE  . LYS A 1 149 ? 136.784 -90.186  22.692  1.00 181.45 ? 73   LYS A CE  1 
ATOM   1104 N NZ  . LYS A 1 149 ? 137.905 -89.242  22.441  1.00 186.29 ? 73   LYS A NZ  1 
ATOM   1105 N N   . LYS A 1 153 ? 134.475 -80.589  20.437  1.00 114.95 ? 77   LYS A N   1 
ATOM   1106 C CA  . LYS A 1 153 ? 134.700 -79.272  19.848  1.00 113.77 ? 77   LYS A CA  1 
ATOM   1107 C C   . LYS A 1 153 ? 133.410 -78.447  19.797  1.00 114.84 ? 77   LYS A C   1 
ATOM   1108 O O   . LYS A 1 153 ? 132.308 -78.998  19.733  1.00 113.44 ? 77   LYS A O   1 
ATOM   1109 C CB  . LYS A 1 153 ? 135.309 -79.396  18.442  1.00 114.58 ? 77   LYS A CB  1 
ATOM   1110 N N   . VAL A 1 154 ? 133.572 -77.115  19.818  1.00 110.31 ? 78   VAL A N   1 
ATOM   1111 C CA  . VAL A 1 154 ? 132.487 -76.132  19.760  1.00 108.26 ? 78   VAL A CA  1 
ATOM   1112 C C   . VAL A 1 154 ? 131.708 -76.265  18.446  1.00 105.69 ? 78   VAL A C   1 
ATOM   1113 O O   . VAL A 1 154 ? 130.477 -76.280  18.465  1.00 103.79 ? 78   VAL A O   1 
ATOM   1114 C CB  . VAL A 1 154 ? 132.988 -74.686  19.979  1.00 114.31 ? 78   VAL A CB  1 
ATOM   1115 C CG1 . VAL A 1 154 ? 133.097 -74.369  21.467  1.00 116.90 ? 78   VAL A CG1 1 
ATOM   1116 C CG2 . VAL A 1 154 ? 134.319 -74.420  19.268  1.00 114.89 ? 78   VAL A CG2 1 
ATOM   1117 N N   . SER A 1 155 ? 132.428 -76.404  17.317  1.00 98.64  ? 79   SER A N   1 
ATOM   1118 C CA  . SER A 1 155 ? 131.836 -76.578  15.991  1.00 94.47  ? 79   SER A CA  1 
ATOM   1119 C C   . SER A 1 155 ? 130.989 -77.836  15.954  1.00 92.88  ? 79   SER A C   1 
ATOM   1120 O O   . SER A 1 155 ? 129.900 -77.820  15.391  1.00 90.87  ? 79   SER A O   1 
ATOM   1121 C CB  . SER A 1 155 ? 132.923 -76.658  14.919  1.00 97.84  ? 79   SER A CB  1 
ATOM   1122 O OG  . SER A 1 155 ? 134.009 -75.773  15.145  1.00 108.90 ? 79   SER A OG  1 
ATOM   1123 N N   . SER A 1 156 ? 131.488 -78.921  16.562  1.00 87.02  ? 80   SER A N   1 
ATOM   1124 C CA  . SER A 1 156 ? 130.802 -80.208  16.623  1.00 84.48  ? 80   SER A CA  1 
ATOM   1125 C C   . SER A 1 156 ? 129.516 -80.122  17.441  1.00 83.77  ? 80   SER A C   1 
ATOM   1126 O O   . SER A 1 156 ? 128.590 -80.908  17.214  1.00 82.44  ? 80   SER A O   1 
ATOM   1127 C CB  . SER A 1 156 ? 131.716 -81.280  17.203  1.00 90.06  ? 80   SER A CB  1 
ATOM   1128 O OG  . SER A 1 156 ? 132.843 -81.500  16.371  1.00 102.38 ? 80   SER A OG  1 
ATOM   1129 N N   . ILE A 1 157 ? 129.451 -79.161  18.380  1.00 77.79  ? 81   ILE A N   1 
ATOM   1130 C CA  . ILE A 1 157 ? 128.263 -78.966  19.211  1.00 76.07  ? 81   ILE A CA  1 
ATOM   1131 C C   . ILE A 1 157 ? 127.176 -78.282  18.361  1.00 75.07  ? 81   ILE A C   1 
ATOM   1132 O O   . ILE A 1 157 ? 125.994 -78.583  18.559  1.00 73.55  ? 81   ILE A O   1 
ATOM   1133 C CB  . ILE A 1 157 ? 128.585 -78.221  20.544  1.00 81.06  ? 81   ILE A CB  1 
ATOM   1134 C CG1 . ILE A 1 157 ? 129.585 -79.011  21.446  1.00 82.95  ? 81   ILE A CG1 1 
ATOM   1135 C CG2 . ILE A 1 157 ? 127.325 -77.808  21.337  1.00 81.19  ? 81   ILE A CG2 1 
ATOM   1136 C CD1 . ILE A 1 157 ? 129.390 -80.578  21.546  1.00 86.45  ? 81   ILE A CD1 1 
ATOM   1137 N N   . TYR A 1 158 ? 127.570 -77.443  17.369  1.00 69.00  ? 82   TYR A N   1 
ATOM   1138 C CA  . TYR A 1 158 ? 126.582 -76.820  16.479  1.00 65.99  ? 82   TYR A CA  1 
ATOM   1139 C C   . TYR A 1 158 ? 126.071 -77.848  15.441  1.00 64.92  ? 82   TYR A C   1 
ATOM   1140 O O   . TYR A 1 158 ? 124.903 -77.766  15.050  1.00 61.90  ? 82   TYR A O   1 
ATOM   1141 C CB  . TYR A 1 158 ? 127.104 -75.560  15.778  1.00 67.80  ? 82   TYR A CB  1 
ATOM   1142 C CG  . TYR A 1 158 ? 127.533 -74.435  16.698  1.00 72.81  ? 82   TYR A CG  1 
ATOM   1143 C CD1 . TYR A 1 158 ? 126.614 -73.776  17.507  1.00 75.52  ? 82   TYR A CD1 1 
ATOM   1144 C CD2 . TYR A 1 158 ? 128.838 -73.962  16.685  1.00 75.81  ? 82   TYR A CD2 1 
ATOM   1145 C CE1 . TYR A 1 158 ? 127.002 -72.722  18.339  1.00 78.49  ? 82   TYR A CE1 1 
ATOM   1146 C CE2 . TYR A 1 158 ? 129.238 -72.909  17.511  1.00 79.09  ? 82   TYR A CE2 1 
ATOM   1147 C CZ  . TYR A 1 158 ? 128.316 -72.292  18.338  1.00 85.99  ? 82   TYR A CZ  1 
ATOM   1148 O OH  . TYR A 1 158 ? 128.711 -71.259  19.153  1.00 88.55  ? 82   TYR A OH  1 
ATOM   1149 N N   . ILE A 1 159 ? 126.931 -78.837  15.035  1.00 61.00  ? 83   ILE A N   1 
ATOM   1150 C CA  . ILE A 1 159 ? 126.560 -79.922  14.088  1.00 58.76  ? 83   ILE A CA  1 
ATOM   1151 C C   . ILE A 1 159 ? 125.432 -80.757  14.697  1.00 59.17  ? 83   ILE A C   1 
ATOM   1152 O O   . ILE A 1 159 ? 124.442 -80.999  14.017  1.00 57.45  ? 83   ILE A O   1 
ATOM   1153 C CB  . ILE A 1 159 ? 127.714 -80.869  13.630  1.00 62.08  ? 83   ILE A CB  1 
ATOM   1154 C CG1 . ILE A 1 159 ? 129.056 -80.137  13.377  1.00 63.55  ? 83   ILE A CG1 1 
ATOM   1155 C CG2 . ILE A 1 159 ? 127.301 -81.732  12.414  1.00 60.55  ? 83   ILE A CG2 1 
ATOM   1156 C CD1 . ILE A 1 159 ? 129.238 -79.373  12.106  1.00 71.33  ? 83   ILE A CD1 1 
ATOM   1157 N N   . PHE A 1 160 ? 125.573 -81.156  15.983  1.00 54.57  ? 84   PHE A N   1 
ATOM   1158 C CA  . PHE A 1 160 ? 124.563 -81.928  16.703  1.00 53.78  ? 84   PHE A CA  1 
ATOM   1159 C C   . PHE A 1 160 ? 123.218 -81.203  16.701  1.00 58.61  ? 84   PHE A C   1 
ATOM   1160 O O   . PHE A 1 160 ? 122.209 -81.788  16.293  1.00 58.28  ? 84   PHE A O   1 
ATOM   1161 C CB  . PHE A 1 160 ? 125.009 -82.202  18.144  1.00 56.73  ? 84   PHE A CB  1 
ATOM   1162 C CG  . PHE A 1 160 ? 123.993 -82.955  18.965  1.00 57.90  ? 84   PHE A CG  1 
ATOM   1163 C CD1 . PHE A 1 160 ? 123.793 -84.312  18.776  1.00 60.96  ? 84   PHE A CD1 1 
ATOM   1164 C CD2 . PHE A 1 160 ? 123.224 -82.302  19.917  1.00 60.11  ? 84   PHE A CD2 1 
ATOM   1165 C CE1 . PHE A 1 160 ? 122.838 -85.005  19.524  1.00 62.47  ? 84   PHE A CE1 1 
ATOM   1166 C CE2 . PHE A 1 160 ? 122.277 -82.998  20.670  1.00 63.72  ? 84   PHE A CE2 1 
ATOM   1167 C CZ  . PHE A 1 160 ? 122.098 -84.349  20.477  1.00 61.84  ? 84   PHE A CZ  1 
ATOM   1168 N N   . ASN A 1 161 ? 123.205 -79.935  17.151  1.00 54.39  ? 85   ASN A N   1 
ATOM   1169 C CA  . ASN A 1 161 ? 121.986 -79.143  17.219  1.00 52.71  ? 85   ASN A CA  1 
ATOM   1170 C C   . ASN A 1 161 ? 121.332 -78.984  15.854  1.00 53.69  ? 85   ASN A C   1 
ATOM   1171 O O   . ASN A 1 161 ? 120.115 -79.141  15.763  1.00 52.86  ? 85   ASN A O   1 
ATOM   1172 C CB  . ASN A 1 161 ? 122.263 -77.799  17.838  1.00 51.29  ? 85   ASN A CB  1 
ATOM   1173 C CG  . ASN A 1 161 ? 122.314 -77.875  19.329  1.00 63.23  ? 85   ASN A CG  1 
ATOM   1174 O OD1 . ASN A 1 161 ? 123.376 -78.054  19.931  1.00 57.01  ? 85   ASN A OD1 1 
ATOM   1175 N ND2 . ASN A 1 161 ? 121.151 -77.799  19.954  1.00 47.15  ? 85   ASN A ND2 1 
ATOM   1176 N N   . LEU A 1 162 ? 122.124 -78.718  14.798  1.00 47.95  ? 86   LEU A N   1 
ATOM   1177 C CA  . LEU A 1 162 ? 121.604 -78.566  13.439  1.00 45.47  ? 86   LEU A CA  1 
ATOM   1178 C C   . LEU A 1 162 ? 121.010 -79.890  12.948  1.00 49.28  ? 86   LEU A C   1 
ATOM   1179 O O   . LEU A 1 162 ? 119.949 -79.880  12.322  1.00 48.15  ? 86   LEU A O   1 
ATOM   1180 C CB  . LEU A 1 162 ? 122.708 -78.058  12.484  1.00 44.61  ? 86   LEU A CB  1 
ATOM   1181 C CG  . LEU A 1 162 ? 122.456 -78.057  10.952  1.00 46.73  ? 86   LEU A CG  1 
ATOM   1182 C CD1 . LEU A 1 162 ? 121.294 -77.184  10.567  1.00 46.37  ? 86   LEU A CD1 1 
ATOM   1183 C CD2 . LEU A 1 162 ? 123.671 -77.604  10.204  1.00 47.09  ? 86   LEU A CD2 1 
ATOM   1184 N N   . ALA A 1 163 ? 121.674 -81.013  13.248  1.00 46.07  ? 87   ALA A N   1 
ATOM   1185 C CA  . ALA A 1 163 ? 121.193 -82.330  12.847  1.00 46.16  ? 87   ALA A CA  1 
ATOM   1186 C C   . ALA A 1 163 ? 119.901 -82.646  13.559  1.00 52.44  ? 87   ALA A C   1 
ATOM   1187 O O   . ALA A 1 163 ? 118.988 -83.163  12.927  1.00 52.69  ? 87   ALA A O   1 
ATOM   1188 C CB  . ALA A 1 163 ? 122.231 -83.397  13.145  1.00 47.61  ? 87   ALA A CB  1 
ATOM   1189 N N   . VAL A 1 164 ? 119.803 -82.308  14.859  1.00 50.08  ? 88   VAL A N   1 
ATOM   1190 C CA  . VAL A 1 164 ? 118.600 -82.539  15.660  1.00 50.42  ? 88   VAL A CA  1 
ATOM   1191 C C   . VAL A 1 164 ? 117.454 -81.723  15.071  1.00 54.31  ? 88   VAL A C   1 
ATOM   1192 O O   . VAL A 1 164 ? 116.371 -82.268  14.882  1.00 52.85  ? 88   VAL A O   1 
ATOM   1193 C CB  . VAL A 1 164 ? 118.837 -82.226  17.163  1.00 55.91  ? 88   VAL A CB  1 
ATOM   1194 C CG1 . VAL A 1 164 ? 117.534 -82.017  17.933  1.00 55.68  ? 88   VAL A CG1 1 
ATOM   1195 C CG2 . VAL A 1 164 ? 119.669 -83.321  17.823  1.00 57.51  ? 88   VAL A CG2 1 
ATOM   1196 N N   . ALA A 1 165 ? 117.706 -80.440  14.744  1.00 52.04  ? 89   ALA A N   1 
ATOM   1197 C CA  . ALA A 1 165 ? 116.699 -79.551  14.167  1.00 51.42  ? 89   ALA A CA  1 
ATOM   1198 C C   . ALA A 1 165 ? 116.231 -80.079  12.835  1.00 55.59  ? 89   ALA A C   1 
ATOM   1199 O O   . ALA A 1 165 ? 115.031 -80.090  12.572  1.00 55.68  ? 89   ALA A O   1 
ATOM   1200 C CB  . ALA A 1 165 ? 117.266 -78.157  14.001  1.00 52.15  ? 89   ALA A CB  1 
ATOM   1201 N N   . ASP A 1 166 ? 117.173 -80.549  12.009  1.00 52.08  ? 90   ASP A N   1 
ATOM   1202 C CA  . ASP A 1 166 ? 116.876 -81.098  10.695  1.00 51.61  ? 90   ASP A CA  1 
ATOM   1203 C C   . ASP A 1 166 ? 116.018 -82.341  10.815  1.00 55.64  ? 90   ASP A C   1 
ATOM   1204 O O   . ASP A 1 166 ? 115.034 -82.456  10.092  1.00 55.96  ? 90   ASP A O   1 
ATOM   1205 C CB  . ASP A 1 166 ? 118.163 -81.406  9.924   1.00 54.23  ? 90   ASP A CB  1 
ATOM   1206 C CG  . ASP A 1 166 ? 118.847 -80.188  9.302   1.00 66.86  ? 90   ASP A CG  1 
ATOM   1207 O OD1 . ASP A 1 166 ? 118.131 -79.310  8.750   1.00 65.00  ? 90   ASP A OD1 1 
ATOM   1208 O OD2 . ASP A 1 166 ? 120.100 -80.145  9.307   1.00 75.39  ? 90   ASP A OD2 1 
ATOM   1209 N N   . LEU A 1 167 ? 116.336 -83.221  11.776  1.00 52.49  ? 91   LEU A N   1 
ATOM   1210 C CA  . LEU A 1 167 ? 115.615 -84.465  12.015  1.00 52.42  ? 91   LEU A CA  1 
ATOM   1211 C C   . LEU A 1 167 ? 114.146 -84.194  12.396  1.00 53.75  ? 91   LEU A C   1 
ATOM   1212 O O   . LEU A 1 167 ? 113.252 -84.860  11.871  1.00 52.62  ? 91   LEU A O   1 
ATOM   1213 C CB  . LEU A 1 167 ? 116.347 -85.265  13.116  1.00 53.78  ? 91   LEU A CB  1 
ATOM   1214 C CG  . LEU A 1 167 ? 116.591 -86.776  12.948  1.00 59.58  ? 91   LEU A CG  1 
ATOM   1215 C CD1 . LEU A 1 167 ? 116.813 -87.183  11.503  1.00 59.63  ? 91   LEU A CD1 1 
ATOM   1216 C CD2 . LEU A 1 167 ? 117.772 -87.224  13.779  1.00 60.67  ? 91   LEU A CD2 1 
ATOM   1217 N N   . LEU A 1 168 ? 113.904 -83.185  13.253  1.00 49.50  ? 92   LEU A N   1 
ATOM   1218 C CA  . LEU A 1 168 ? 112.554 -82.846  13.705  1.00 49.56  ? 92   LEU A CA  1 
ATOM   1219 C C   . LEU A 1 168 ? 111.708 -82.219  12.599  1.00 53.07  ? 92   LEU A C   1 
ATOM   1220 O O   . LEU A 1 168 ? 110.477 -82.373  12.589  1.00 51.88  ? 92   LEU A O   1 
ATOM   1221 C CB  . LEU A 1 168 ? 112.580 -81.912  14.924  1.00 50.17  ? 92   LEU A CB  1 
ATOM   1222 C CG  . LEU A 1 168 ? 113.238 -82.445  16.206  1.00 56.59  ? 92   LEU A CG  1 
ATOM   1223 C CD1 . LEU A 1 168 ? 113.161 -81.430  17.315  1.00 57.85  ? 92   LEU A CD1 1 
ATOM   1224 C CD2 . LEU A 1 168 ? 112.624 -83.760  16.675  1.00 59.56  ? 92   LEU A CD2 1 
ATOM   1225 N N   . LEU A 1 169 ? 112.374 -81.499  11.679  1.00 48.90  ? 93   LEU A N   1 
ATOM   1226 C CA  . LEU A 1 169 ? 111.731 -80.814  10.566  1.00 47.65  ? 93   LEU A CA  1 
ATOM   1227 C C   . LEU A 1 169 ? 111.293 -81.827  9.506   1.00 50.90  ? 93   LEU A C   1 
ATOM   1228 O O   . LEU A 1 169 ? 110.173 -81.732  8.980   1.00 51.22  ? 93   LEU A O   1 
ATOM   1229 C CB  . LEU A 1 169 ? 112.706 -79.781  9.995   1.00 47.15  ? 93   LEU A CB  1 
ATOM   1230 C CG  . LEU A 1 169 ? 112.234 -78.911  8.829   1.00 52.10  ? 93   LEU A CG  1 
ATOM   1231 C CD1 . LEU A 1 169 ? 111.142 -77.924  9.262   1.00 52.09  ? 93   LEU A CD1 1 
ATOM   1232 C CD2 . LEU A 1 169 ? 113.401 -78.161  8.213   1.00 54.97  ? 93   LEU A CD2 1 
ATOM   1233 N N   . LEU A 1 170 ? 112.156 -82.834  9.248   1.00 45.47  ? 94   LEU A N   1 
ATOM   1234 C CA  . LEU A 1 170 ? 111.883 -83.896  8.272   1.00 44.39  ? 94   LEU A CA  1 
ATOM   1235 C C   . LEU A 1 170 ? 110.769 -84.799  8.763   1.00 50.60  ? 94   LEU A C   1 
ATOM   1236 O O   . LEU A 1 170 ? 109.938 -85.211  7.963   1.00 51.03  ? 94   LEU A O   1 
ATOM   1237 C CB  . LEU A 1 170 ? 113.146 -84.695  7.983   1.00 43.46  ? 94   LEU A CB  1 
ATOM   1238 C CG  . LEU A 1 170 ? 114.244 -83.912  7.262   1.00 46.22  ? 94   LEU A CG  1 
ATOM   1239 C CD1 . LEU A 1 170 ? 115.575 -84.565  7.424   1.00 46.85  ? 94   LEU A CD1 1 
ATOM   1240 C CD2 . LEU A 1 170 ? 113.915 -83.671  5.809   1.00 46.91  ? 94   LEU A CD2 1 
ATOM   1241 N N   . ALA A 1 171 ? 110.711 -85.038  10.083  1.00 48.29  ? 95   ALA A N   1 
ATOM   1242 C CA  . ALA A 1 171 ? 109.692 -85.852  10.736  1.00 49.56  ? 95   ALA A CA  1 
ATOM   1243 C C   . ALA A 1 171 ? 108.264 -85.297  10.488  1.00 54.43  ? 95   ALA A C   1 
ATOM   1244 O O   . ALA A 1 171 ? 107.307 -86.044  10.609  1.00 56.20  ? 95   ALA A O   1 
ATOM   1245 C CB  . ALA A 1 171 ? 109.973 -85.929  12.227  1.00 51.07  ? 95   ALA A CB  1 
ATOM   1246 N N   . THR A 1 172 ? 108.127 -84.014  10.137  1.00 48.32  ? 96   THR A N   1 
ATOM   1247 C CA  . THR A 1 172 ? 106.816 -83.449  9.865   1.00 47.51  ? 96   THR A CA  1 
ATOM   1248 C C   . THR A 1 172 ? 106.348 -83.680  8.417   1.00 52.47  ? 96   THR A C   1 
ATOM   1249 O O   . THR A 1 172 ? 105.204 -83.355  8.123   1.00 52.83  ? 96   THR A O   1 
ATOM   1250 C CB  . THR A 1 172 ? 106.784 -81.945  10.152  1.00 46.05  ? 96   THR A CB  1 
ATOM   1251 O OG1 . THR A 1 172 ? 107.512 -81.251  9.151   1.00 42.89  ? 96   THR A OG1 1 
ATOM   1252 C CG2 . THR A 1 172 ? 107.225 -81.579  11.564  1.00 42.82  ? 96   THR A CG2 1 
ATOM   1253 N N   . LEU A 1 173 ? 107.206 -84.183  7.512   1.00 49.06  ? 97   LEU A N   1 
ATOM   1254 C CA  . LEU A 1 173 ? 106.875 -84.391  6.098   1.00 48.69  ? 97   LEU A CA  1 
ATOM   1255 C C   . LEU A 1 173 ? 105.684 -85.325  5.876   1.00 53.92  ? 97   LEU A C   1 
ATOM   1256 O O   . LEU A 1 173 ? 104.862 -84.981  5.019   1.00 54.88  ? 97   LEU A O   1 
ATOM   1257 C CB  . LEU A 1 173 ? 108.061 -84.868  5.282   1.00 48.67  ? 97   LEU A CB  1 
ATOM   1258 C CG  . LEU A 1 173 ? 108.983 -83.734  4.818   1.00 52.99  ? 97   LEU A CG  1 
ATOM   1259 C CD1 . LEU A 1 173 ? 110.412 -84.201  4.711   1.00 53.61  ? 97   LEU A CD1 1 
ATOM   1260 C CD2 . LEU A 1 173 ? 108.526 -83.145  3.495   1.00 54.20  ? 97   LEU A CD2 1 
ATOM   1261 N N   . PRO A 1 174 ? 105.508 -86.458  6.626   1.00 49.83  ? 98   PRO A N   1 
ATOM   1262 C CA  . PRO A 1 174 ? 104.292 -87.274  6.436   1.00 49.96  ? 98   PRO A CA  1 
ATOM   1263 C C   . PRO A 1 174 ? 102.979 -86.497  6.698   1.00 51.95  ? 98   PRO A C   1 
ATOM   1264 O O   . PRO A 1 174 ? 101.997 -86.784  6.014   1.00 51.61  ? 98   PRO A O   1 
ATOM   1265 C CB  . PRO A 1 174 ? 104.470 -88.413  7.446   1.00 52.25  ? 98   PRO A CB  1 
ATOM   1266 C CG  . PRO A 1 174 ? 105.948 -88.513  7.653   1.00 55.62  ? 98   PRO A CG  1 
ATOM   1267 C CD  . PRO A 1 174 ? 106.387 -87.083  7.643   1.00 50.50  ? 98   PRO A CD  1 
ATOM   1268 N N   . LEU A 1 175 ? 102.956 -85.513  7.641   1.00 46.90  ? 99   LEU A N   1 
ATOM   1269 C CA  . LEU A 1 175 ? 101.757 -84.705  7.904   1.00 47.14  ? 99   LEU A CA  1 
ATOM   1270 C C   . LEU A 1 175 ? 101.338 -83.877  6.694   1.00 52.70  ? 99   LEU A C   1 
ATOM   1271 O O   . LEU A 1 175 ? 100.151 -83.807  6.382   1.00 52.89  ? 99   LEU A O   1 
ATOM   1272 C CB  . LEU A 1 175 ? 101.981 -83.744  9.068   1.00 46.55  ? 99   LEU A CB  1 
ATOM   1273 C CG  . LEU A 1 175 ? 102.164 -84.321  10.430  1.00 52.34  ? 99   LEU A CG  1 
ATOM   1274 C CD1 . LEU A 1 175 ? 102.715 -83.265  11.372  1.00 51.40  ? 99   LEU A CD1 1 
ATOM   1275 C CD2 . LEU A 1 175 ? 100.858 -84.848  10.977  1.00 56.56  ? 99   LEU A CD2 1 
ATOM   1276 N N   . TRP A 1 176 ? 102.304 -83.238  6.020   1.00 50.09  ? 100  TRP A N   1 
ATOM   1277 C CA  . TRP A 1 176 ? 102.025 -82.380  4.860   1.00 50.23  ? 100  TRP A CA  1 
ATOM   1278 C C   . TRP A 1 176 ? 101.766 -83.181  3.572   1.00 55.42  ? 100  TRP A C   1 
ATOM   1279 O O   . TRP A 1 176 ? 101.026 -82.702  2.713   1.00 56.79  ? 100  TRP A O   1 
ATOM   1280 C CB  . TRP A 1 176 ? 103.147 -81.370  4.623   1.00 48.03  ? 100  TRP A CB  1 
ATOM   1281 C CG  . TRP A 1 176 ? 103.753 -80.802  5.872   1.00 48.71  ? 100  TRP A CG  1 
ATOM   1282 C CD1 . TRP A 1 176 ? 105.079 -80.773  6.190   1.00 51.10  ? 100  TRP A CD1 1 
ATOM   1283 C CD2 . TRP A 1 176 ? 103.057 -80.241  6.997   1.00 49.00  ? 100  TRP A CD2 1 
ATOM   1284 N NE1 . TRP A 1 176 ? 105.258 -80.214  7.432   1.00 50.87  ? 100  TRP A NE1 1 
ATOM   1285 C CE2 . TRP A 1 176 ? 104.035 -79.875  7.952   1.00 52.67  ? 100  TRP A CE2 1 
ATOM   1286 C CE3 . TRP A 1 176 ? 101.701 -80.009  7.294   1.00 50.88  ? 100  TRP A CE3 1 
ATOM   1287 C CZ2 . TRP A 1 176 ? 103.705 -79.276  9.173   1.00 51.97  ? 100  TRP A CZ2 1 
ATOM   1288 C CZ3 . TRP A 1 176 ? 101.374 -79.425  8.511   1.00 52.65  ? 100  TRP A CZ3 1 
ATOM   1289 C CH2 . TRP A 1 176 ? 102.369 -79.062  9.433   1.00 52.86  ? 100  TRP A CH2 1 
ATOM   1290 N N   . ALA A 1 177 ? 102.401 -84.356  3.405   1.00 49.65  ? 101  ALA A N   1 
ATOM   1291 C CA  . ALA A 1 177 ? 102.158 -85.218  2.251   1.00 49.28  ? 101  ALA A CA  1 
ATOM   1292 C C   . ALA A 1 177 ? 100.761 -85.880  2.377   1.00 54.82  ? 101  ALA A C   1 
ATOM   1293 O O   . ALA A 1 177 ? 100.180 -86.261  1.361   1.00 57.69  ? 101  ALA A O   1 
ATOM   1294 C CB  . ALA A 1 177 ? 103.245 -86.264  2.154   1.00 50.06  ? 101  ALA A CB  1 
ATOM   1295 N N   . THR A 1 178 ? 100.198 -85.946  3.622   1.00 48.71  ? 102  THR A N   1 
ATOM   1296 C CA  . THR A 1 178 ? 98.846  -86.470  3.906   1.00 48.98  ? 102  THR A CA  1 
ATOM   1297 C C   . THR A 1 178 ? 97.782  -85.353  3.766   1.00 54.04  ? 102  THR A C   1 
ATOM   1298 O O   . THR A 1 178 ? 96.756  -85.570  3.129   1.00 54.19  ? 102  THR A O   1 
ATOM   1299 C CB  . THR A 1 178 ? 98.772  -87.094  5.285   1.00 49.40  ? 102  THR A CB  1 
ATOM   1300 O OG1 . THR A 1 178 ? 99.716  -88.161  5.378   1.00 52.76  ? 102  THR A OG1 1 
ATOM   1301 C CG2 . THR A 1 178 ? 97.393  -87.590  5.616   1.00 42.02  ? 102  THR A CG2 1 
ATOM   1302 N N   . TYR A 1 179 ? 98.030  -84.163  4.354   1.00 51.25  ? 103  TYR A N   1 
ATOM   1303 C CA  . TYR A 1 179 ? 97.159  -82.983  4.251   1.00 50.92  ? 103  TYR A CA  1 
ATOM   1304 C C   . TYR A 1 179 ? 96.922  -82.616  2.772   1.00 56.55  ? 103  TYR A C   1 
ATOM   1305 O O   . TYR A 1 179 ? 95.768  -82.462  2.373   1.00 58.92  ? 103  TYR A O   1 
ATOM   1306 C CB  . TYR A 1 179 ? 97.794  -81.822  5.027   1.00 50.19  ? 103  TYR A CB  1 
ATOM   1307 C CG  . TYR A 1 179 ? 97.077  -80.492  4.980   1.00 51.81  ? 103  TYR A CG  1 
ATOM   1308 C CD1 . TYR A 1 179 ? 95.752  -80.372  5.399   1.00 54.56  ? 103  TYR A CD1 1 
ATOM   1309 C CD2 . TYR A 1 179 ? 97.763  -79.324  4.658   1.00 51.62  ? 103  TYR A CD2 1 
ATOM   1310 C CE1 . TYR A 1 179 ? 95.114  -79.132  5.436   1.00 54.02  ? 103  TYR A CE1 1 
ATOM   1311 C CE2 . TYR A 1 179 ? 97.132  -78.082  4.685   1.00 52.18  ? 103  TYR A CE2 1 
ATOM   1312 C CZ  . TYR A 1 179 ? 95.805  -77.993  5.056   1.00 56.96  ? 103  TYR A CZ  1 
ATOM   1313 O OH  . TYR A 1 179 ? 95.211  -76.759  5.068   1.00 57.06  ? 103  TYR A OH  1 
ATOM   1314 N N   . TYR A 1 180 ? 98.000  -82.559  1.953   1.00 52.07  ? 104  TYR A N   1 
ATOM   1315 C CA  . TYR A 1 180 ? 97.948  -82.273  0.514   1.00 52.66  ? 104  TYR A CA  1 
ATOM   1316 C C   . TYR A 1 180 ? 97.123  -83.312  -0.255  1.00 61.90  ? 104  TYR A C   1 
ATOM   1317 O O   . TYR A 1 180 ? 96.527  -82.968  -1.283  1.00 63.65  ? 104  TYR A O   1 
ATOM   1318 C CB  . TYR A 1 180 ? 99.367  -82.236  -0.071  1.00 52.39  ? 104  TYR A CB  1 
ATOM   1319 C CG  . TYR A 1 180 ? 99.411  -81.963  -1.560  1.00 53.35  ? 104  TYR A CG  1 
ATOM   1320 C CD1 . TYR A 1 180 ? 99.463  -80.660  -2.047  1.00 53.86  ? 104  TYR A CD1 1 
ATOM   1321 C CD2 . TYR A 1 180 ? 99.400  -83.005  -2.484  1.00 55.26  ? 104  TYR A CD2 1 
ATOM   1322 C CE1 . TYR A 1 180 ? 99.488  -80.399  -3.415  1.00 53.49  ? 104  TYR A CE1 1 
ATOM   1323 C CE2 . TYR A 1 180 ? 99.396  -82.754  -3.855  1.00 57.11  ? 104  TYR A CE2 1 
ATOM   1324 C CZ  . TYR A 1 180 ? 99.453  -81.448  -4.316  1.00 62.85  ? 104  TYR A CZ  1 
ATOM   1325 O OH  . TYR A 1 180 ? 99.458  -81.180  -5.662  1.00 65.74  ? 104  TYR A OH  1 
ATOM   1326 N N   . SER A 1 181 ? 97.121  -84.582  0.230   1.00 59.88  ? 105  SER A N   1 
ATOM   1327 C CA  . SER A 1 181 ? 96.444  -85.749  -0.361  1.00 61.68  ? 105  SER A CA  1 
ATOM   1328 C C   . SER A 1 181 ? 94.947  -85.818  -0.079  1.00 69.24  ? 105  SER A C   1 
ATOM   1329 O O   . SER A 1 181 ? 94.238  -86.596  -0.729  1.00 71.34  ? 105  SER A O   1 
ATOM   1330 C CB  . SER A 1 181 ? 97.079  -87.038  0.141   1.00 63.54  ? 105  SER A CB  1 
ATOM   1331 O OG  . SER A 1 181 ? 98.361  -87.226  -0.423  1.00 69.24  ? 105  SER A OG  1 
ATOM   1332 N N   . TYR A 1 182 ? 94.478  -85.050  0.907   1.00 65.91  ? 106  TYR A N   1 
ATOM   1333 C CA  . TYR A 1 182 ? 93.061  -84.970  1.238   1.00 67.61  ? 106  TYR A CA  1 
ATOM   1334 C C   . TYR A 1 182 ? 92.544  -83.607  0.763   1.00 71.16  ? 106  TYR A C   1 
ATOM   1335 O O   . TYR A 1 182 ? 91.568  -83.072  1.280   1.00 71.74  ? 106  TYR A O   1 
ATOM   1336 C CB  . TYR A 1 182 ? 92.848  -85.242  2.725   1.00 68.96  ? 106  TYR A CB  1 
ATOM   1337 C CG  . TYR A 1 182 ? 93.013  -86.717  3.045   1.00 72.81  ? 106  TYR A CG  1 
ATOM   1338 C CD1 . TYR A 1 182 ? 92.051  -87.651  2.658   1.00 77.24  ? 106  TYR A CD1 1 
ATOM   1339 C CD2 . TYR A 1 182 ? 94.107  -87.174  3.769   1.00 73.20  ? 106  TYR A CD2 1 
ATOM   1340 C CE1 . TYR A 1 182 ? 92.201  -89.008  2.944   1.00 80.11  ? 106  TYR A CE1 1 
ATOM   1341 C CE2 . TYR A 1 182 ? 94.269  -88.529  4.058   1.00 75.79  ? 106  TYR A CE2 1 
ATOM   1342 C CZ  . TYR A 1 182 ? 93.312  -89.443  3.647   1.00 88.14  ? 106  TYR A CZ  1 
ATOM   1343 O OH  . TYR A 1 182 ? 93.485  -90.782  3.919   1.00 92.92  ? 106  TYR A OH  1 
ATOM   1344 N N   . ARG A 1 183 ? 93.217  -83.088  -0.293  1.00 66.45  ? 107  ARG A N   1 
ATOM   1345 C CA  . ARG A 1 183 ? 92.959  -81.842  -1.013  1.00 65.70  ? 107  ARG A CA  1 
ATOM   1346 C C   . ARG A 1 183 ? 92.775  -80.684  -0.006  1.00 68.20  ? 107  ARG A C   1 
ATOM   1347 O O   . ARG A 1 183 ? 91.818  -79.913  -0.076  1.00 69.97  ? 107  ARG A O   1 
ATOM   1348 C CB  . ARG A 1 183 ? 91.757  -82.028  -1.975  1.00 66.14  ? 107  ARG A CB  1 
ATOM   1349 C CG  . ARG A 1 183 ? 92.111  -82.693  -3.325  1.00 67.92  ? 107  ARG A CG  1 
ATOM   1350 C CD  . ARG A 1 183 ? 92.451  -84.174  -3.230  1.00 67.45  ? 107  ARG A CD  1 
ATOM   1351 N NE  . ARG A 1 183 ? 92.497  -84.837  -4.536  1.00 71.48  ? 107  ARG A NE  1 
ATOM   1352 C CZ  . ARG A 1 183 ? 92.928  -86.082  -4.730  1.00 85.56  ? 107  ARG A CZ  1 
ATOM   1353 N NH1 . ARG A 1 183 ? 93.382  -86.802  -3.711  1.00 76.32  ? 107  ARG A NH1 1 
ATOM   1354 N NH2 . ARG A 1 183 ? 92.929  -86.610  -5.947  1.00 69.60  ? 107  ARG A NH2 1 
ATOM   1355 N N   . TYR A 1 184 ? 93.695  -80.652  0.980   1.00 60.85  ? 108  TYR A N   1 
ATOM   1356 C CA  . TYR A 1 184 ? 93.826  -79.713  2.093   1.00 58.05  ? 108  TYR A CA  1 
ATOM   1357 C C   . TYR A 1 184 ? 92.671  -79.833  3.116   1.00 61.12  ? 108  TYR A C   1 
ATOM   1358 O O   . TYR A 1 184 ? 92.154  -78.821  3.575   1.00 59.29  ? 108  TYR A O   1 
ATOM   1359 C CB  . TYR A 1 184 ? 94.012  -78.264  1.604   1.00 57.40  ? 108  TYR A CB  1 
ATOM   1360 C CG  . TYR A 1 184 ? 95.249  -78.075  0.751   1.00 56.13  ? 108  TYR A CG  1 
ATOM   1361 C CD1 . TYR A 1 184 ? 96.510  -77.973  1.329   1.00 56.67  ? 108  TYR A CD1 1 
ATOM   1362 C CD2 . TYR A 1 184 ? 95.158  -77.983  -0.633  1.00 56.48  ? 108  TYR A CD2 1 
ATOM   1363 C CE1 . TYR A 1 184 ? 97.653  -77.803  0.547   1.00 55.20  ? 108  TYR A CE1 1 
ATOM   1364 C CE2 . TYR A 1 184 ? 96.292  -77.806  -1.422  1.00 55.77  ? 108  TYR A CE2 1 
ATOM   1365 C CZ  . TYR A 1 184 ? 97.536  -77.715  -0.827  1.00 56.99  ? 108  TYR A CZ  1 
ATOM   1366 O OH  . TYR A 1 184 ? 98.649  -77.524  -1.599  1.00 54.32  ? 108  TYR A OH  1 
ATOM   1367 N N   . ASP A 1 185 ? 92.349  -81.066  3.544   1.00 59.46  ? 109  ASP A N   1 
ATOM   1368 C CA  . ASP A 1 185 ? 91.361  -81.307  4.600   1.00 61.09  ? 109  ASP A CA  1 
ATOM   1369 C C   . ASP A 1 185 ? 92.079  -81.883  5.828   1.00 67.56  ? 109  ASP A C   1 
ATOM   1370 O O   . ASP A 1 185 ? 92.497  -83.046  5.822   1.00 68.20  ? 109  ASP A O   1 
ATOM   1371 C CB  . ASP A 1 185 ? 90.205  -82.218  4.143   1.00 64.86  ? 109  ASP A CB  1 
ATOM   1372 C CG  . ASP A 1 185 ? 89.076  -82.381  5.151   1.00 77.89  ? 109  ASP A CG  1 
ATOM   1373 O OD1 . ASP A 1 185 ? 88.804  -81.418  5.906   1.00 79.37  ? 109  ASP A OD1 1 
ATOM   1374 O OD2 . ASP A 1 185 ? 88.424  -83.449  5.145   1.00 84.26  ? 109  ASP A OD2 1 
ATOM   1375 N N   . TRP A 1 186 ? 92.261  -81.039  6.858   1.00 64.57  ? 110  TRP A N   1 
ATOM   1376 C CA  . TRP A 1 186 ? 92.929  -81.370  8.111   1.00 64.14  ? 110  TRP A CA  1 
ATOM   1377 C C   . TRP A 1 186 ? 92.071  -82.346  8.923   1.00 73.14  ? 110  TRP A C   1 
ATOM   1378 O O   . TRP A 1 186 ? 90.941  -82.014  9.292   1.00 74.13  ? 110  TRP A O   1 
ATOM   1379 C CB  . TRP A 1 186 ? 93.226  -80.085  8.905   1.00 61.22  ? 110  TRP A CB  1 
ATOM   1380 C CG  . TRP A 1 186 ? 94.188  -80.315  10.024  1.00 61.13  ? 110  TRP A CG  1 
ATOM   1381 C CD1 . TRP A 1 186 ? 93.882  -80.515  11.334  1.00 64.81  ? 110  TRP A CD1 1 
ATOM   1382 C CD2 . TRP A 1 186 ? 95.606  -80.479  9.911   1.00 59.46  ? 110  TRP A CD2 1 
ATOM   1383 N NE1 . TRP A 1 186 ? 95.027  -80.742  12.057  1.00 63.75  ? 110  TRP A NE1 1 
ATOM   1384 C CE2 . TRP A 1 186 ? 96.102  -80.730  11.207  1.00 63.70  ? 110  TRP A CE2 1 
ATOM   1385 C CE3 . TRP A 1 186 ? 96.512  -80.417  8.839   1.00 59.45  ? 110  TRP A CE3 1 
ATOM   1386 C CZ2 . TRP A 1 186 ? 97.467  -80.913  11.466  1.00 61.97  ? 110  TRP A CZ2 1 
ATOM   1387 C CZ3 . TRP A 1 186 ? 97.860  -80.615  9.091   1.00 60.01  ? 110  TRP A CZ3 1 
ATOM   1388 C CH2 . TRP A 1 186 ? 98.328  -80.847  10.394  1.00 60.86  ? 110  TRP A CH2 1 
ATOM   1389 N N   . LEU A 1 187 ? 92.606  -83.555  9.179   1.00 73.12  ? 111  LEU A N   1 
ATOM   1390 C CA  . LEU A 1 187 ? 91.918  -84.621  9.928   1.00 75.79  ? 111  LEU A CA  1 
ATOM   1391 C C   . LEU A 1 187 ? 92.670  -85.018  11.220  1.00 82.22  ? 111  LEU A C   1 
ATOM   1392 O O   . LEU A 1 187 ? 92.399  -86.081  11.788  1.00 82.93  ? 111  LEU A O   1 
ATOM   1393 C CB  . LEU A 1 187 ? 91.724  -85.861  9.034   1.00 76.74  ? 111  LEU A CB  1 
ATOM   1394 C CG  . LEU A 1 187 ? 90.602  -85.805  8.001   1.00 82.54  ? 111  LEU A CG  1 
ATOM   1395 C CD1 . LEU A 1 187 ? 90.758  -86.915  7.008   1.00 83.70  ? 111  LEU A CD1 1 
ATOM   1396 C CD2 . LEU A 1 187 ? 89.220  -85.950  8.652   1.00 87.57  ? 111  LEU A CD2 1 
ATOM   1397 N N   . PHE A 1 188 ? 93.576  -84.146  11.696  1.00 79.58  ? 112  PHE A N   1 
ATOM   1398 C CA  . PHE A 1 188 ? 94.377  -84.383  12.898  1.00 80.24  ? 112  PHE A CA  1 
ATOM   1399 C C   . PHE A 1 188 ? 93.860  -83.608  14.129  1.00 85.25  ? 112  PHE A C   1 
ATOM   1400 O O   . PHE A 1 188 ? 94.175  -83.992  15.255  1.00 86.24  ? 112  PHE A O   1 
ATOM   1401 C CB  . PHE A 1 188 ? 95.846  -84.023  12.641  1.00 80.60  ? 112  PHE A CB  1 
ATOM   1402 C CG  . PHE A 1 188 ? 96.499  -84.744  11.488  1.00 81.72  ? 112  PHE A CG  1 
ATOM   1403 C CD1 . PHE A 1 188 ? 97.094  -85.988  11.671  1.00 85.76  ? 112  PHE A CD1 1 
ATOM   1404 C CD2 . PHE A 1 188 ? 96.547  -84.166  10.223  1.00 82.92  ? 112  PHE A CD2 1 
ATOM   1405 C CE1 . PHE A 1 188 ? 97.708  -86.651  10.602  1.00 86.38  ? 112  PHE A CE1 1 
ATOM   1406 C CE2 . PHE A 1 188 ? 97.168  -84.823  9.157   1.00 85.65  ? 112  PHE A CE2 1 
ATOM   1407 C CZ  . PHE A 1 188 ? 97.745  -86.061  9.353   1.00 84.63  ? 112  PHE A CZ  1 
ATOM   1408 N N   . GLY A 1 189 ? 93.087  -82.548  13.912  1.00 81.24  ? 113  GLY A N   1 
ATOM   1409 C CA  . GLY A 1 189 ? 92.538  -81.735  14.992  1.00 82.05  ? 113  GLY A CA  1 
ATOM   1410 C C   . GLY A 1 189 ? 93.042  -80.302  14.992  1.00 85.10  ? 113  GLY A C   1 
ATOM   1411 O O   . GLY A 1 189 ? 94.178  -80.059  14.584  1.00 82.53  ? 113  GLY A O   1 
ATOM   1412 N N   . PRO A 1 190 ? 92.231  -79.321  15.468  1.00 83.02  ? 114  PRO A N   1 
ATOM   1413 C CA  . PRO A 1 190 ? 92.684  -77.905  15.455  1.00 82.27  ? 114  PRO A CA  1 
ATOM   1414 C C   . PRO A 1 190 ? 93.836  -77.597  16.415  1.00 85.45  ? 114  PRO A C   1 
ATOM   1415 O O   . PRO A 1 190 ? 94.515  -76.579  16.237  1.00 84.51  ? 114  PRO A O   1 
ATOM   1416 C CB  . PRO A 1 190 ? 91.434  -77.114  15.844  1.00 85.46  ? 114  PRO A CB  1 
ATOM   1417 C CG  . PRO A 1 190 ? 90.580  -78.092  16.538  1.00 91.25  ? 114  PRO A CG  1 
ATOM   1418 C CD  . PRO A 1 190 ? 90.854  -79.444  15.985  1.00 86.08  ? 114  PRO A CD  1 
ATOM   1419 N N   . VAL A 1 191 ? 94.055  -78.468  17.423  1.00 81.86  ? 115  VAL A N   1 
ATOM   1420 C CA  . VAL A 1 191 ? 95.140  -78.319  18.395  1.00 81.04  ? 115  VAL A CA  1 
ATOM   1421 C C   . VAL A 1 191 ? 96.442  -78.705  17.687  1.00 82.73  ? 115  VAL A C   1 
ATOM   1422 O O   . VAL A 1 191 ? 97.420  -77.967  17.777  1.00 82.48  ? 115  VAL A O   1 
ATOM   1423 C CB  . VAL A 1 191 ? 94.887  -79.109  19.712  1.00 86.49  ? 115  VAL A CB  1 
ATOM   1424 C CG1 . VAL A 1 191 ? 96.024  -78.905  20.715  1.00 86.55  ? 115  VAL A CG1 1 
ATOM   1425 C CG2 . VAL A 1 191 ? 93.550  -78.702  20.343  1.00 87.89  ? 115  VAL A CG2 1 
ATOM   1426 N N   . MET A 1 192 ? 96.422  -79.802  16.911  1.00 78.35  ? 116  MET A N   1 
ATOM   1427 C CA  . MET A 1 192 ? 97.571  -80.272  16.122  1.00 76.65  ? 116  MET A CA  1 
ATOM   1428 C C   . MET A 1 192 ? 97.963  -79.244  15.063  1.00 74.45  ? 116  MET A C   1 
ATOM   1429 O O   . MET A 1 192 ? 99.126  -79.181  14.696  1.00 72.69  ? 116  MET A O   1 
ATOM   1430 C CB  . MET A 1 192 ? 97.273  -81.615  15.432  1.00 80.20  ? 116  MET A CB  1 
ATOM   1431 C CG  . MET A 1 192 ? 97.016  -82.780  16.378  1.00 86.69  ? 116  MET A CG  1 
ATOM   1432 S SD  . MET A 1 192 ? 98.355  -84.008  16.490  1.00 92.01  ? 116  MET A SD  1 
ATOM   1433 C CE  . MET A 1 192 ? 98.407  -84.666  14.823  1.00 87.57  ? 116  MET A CE  1 
ATOM   1434 N N   . CYS A 1 193 ? 96.995  -78.439  14.577  1.00 68.98  ? 117  CYS A N   1 
ATOM   1435 C CA  . CYS A 1 193 ? 97.195  -77.379  13.581  1.00 66.87  ? 117  CYS A CA  1 
ATOM   1436 C C   . CYS A 1 193 ? 98.091  -76.272  14.171  1.00 67.70  ? 117  CYS A C   1 
ATOM   1437 O O   . CYS A 1 193 ? 98.978  -75.782  13.470  1.00 66.07  ? 117  CYS A O   1 
ATOM   1438 C CB  . CYS A 1 193 ? 95.851  -76.836  13.101  1.00 67.75  ? 117  CYS A CB  1 
ATOM   1439 S SG  . CYS A 1 193 ? 95.963  -75.551  11.826  1.00 70.97  ? 117  CYS A SG  1 
ATOM   1440 N N   . LYS A 1 194 ? 97.897  -75.926  15.464  1.00 63.24  ? 118  LYS A N   1 
ATOM   1441 C CA  . LYS A 1 194 ? 98.725  -74.947  16.172  1.00 62.21  ? 118  LYS A CA  1 
ATOM   1442 C C   . LYS A 1 194 ? 100.049 -75.568  16.625  1.00 66.09  ? 118  LYS A C   1 
ATOM   1443 O O   . LYS A 1 194 ? 101.096 -74.932  16.461  1.00 64.61  ? 118  LYS A O   1 
ATOM   1444 C CB  . LYS A 1 194 ? 97.998  -74.368  17.389  1.00 65.33  ? 118  LYS A CB  1 
ATOM   1445 C CG  . LYS A 1 194 ? 97.157  -73.170  17.055  1.00 69.77  ? 118  LYS A CG  1 
ATOM   1446 C CD  . LYS A 1 194 ? 96.737  -72.354  18.265  1.00 72.24  ? 118  LYS A CD  1 
ATOM   1447 C CE  . LYS A 1 194 ? 95.987  -71.095  17.877  1.00 81.67  ? 118  LYS A CE  1 
ATOM   1448 N NZ  . LYS A 1 194 ? 94.678  -71.370  17.236  1.00 97.97  ? 118  LYS A NZ  1 
ATOM   1449 N N   . VAL A 1 195 ? 99.998  -76.809  17.202  1.00 62.79  ? 119  VAL A N   1 
ATOM   1450 C CA  . VAL A 1 195 ? 101.146 -77.550  17.746  1.00 62.17  ? 119  VAL A CA  1 
ATOM   1451 C C   . VAL A 1 195 ? 102.139 -77.910  16.636  1.00 66.21  ? 119  VAL A C   1 
ATOM   1452 O O   . VAL A 1 195 ? 103.283 -77.486  16.723  1.00 66.02  ? 119  VAL A O   1 
ATOM   1453 C CB  . VAL A 1 195 ? 100.713 -78.796  18.564  1.00 66.16  ? 119  VAL A CB  1 
ATOM   1454 C CG1 . VAL A 1 195 ? 101.907 -79.683  18.917  1.00 65.70  ? 119  VAL A CG1 1 
ATOM   1455 C CG2 . VAL A 1 195 ? 99.963  -78.385  19.827  1.00 67.44  ? 119  VAL A CG2 1 
ATOM   1456 N N   . PHE A 1 196 ? 101.714 -78.666  15.608  1.00 63.54  ? 120  PHE A N   1 
ATOM   1457 C CA  . PHE A 1 196 ? 102.586 -79.073  14.506  1.00 63.12  ? 120  PHE A CA  1 
ATOM   1458 C C   . PHE A 1 196 ? 102.898 -77.917  13.546  1.00 64.45  ? 120  PHE A C   1 
ATOM   1459 O O   . PHE A 1 196 ? 103.940 -77.949  12.895  1.00 63.28  ? 120  PHE A O   1 
ATOM   1460 C CB  . PHE A 1 196 ? 102.038 -80.289  13.759  1.00 66.06  ? 120  PHE A CB  1 
ATOM   1461 C CG  . PHE A 1 196 ? 102.337 -81.543  14.544  1.00 70.20  ? 120  PHE A CG  1 
ATOM   1462 C CD1 . PHE A 1 196 ? 103.644 -82.012  14.664  1.00 74.44  ? 120  PHE A CD1 1 
ATOM   1463 C CD2 . PHE A 1 196 ? 101.326 -82.223  15.212  1.00 74.70  ? 120  PHE A CD2 1 
ATOM   1464 C CE1 . PHE A 1 196 ? 103.931 -83.151  15.424  1.00 77.01  ? 120  PHE A CE1 1 
ATOM   1465 C CE2 . PHE A 1 196 ? 101.616 -83.369  15.968  1.00 79.60  ? 120  PHE A CE2 1 
ATOM   1466 C CZ  . PHE A 1 196 ? 102.914 -83.826  16.066  1.00 77.75  ? 120  PHE A CZ  1 
ATOM   1467 N N   . GLY A 1 197 ? 102.033 -76.904  13.507  1.00 59.65  ? 121  GLY A N   1 
ATOM   1468 C CA  . GLY A 1 197 ? 102.247 -75.705  12.704  1.00 58.31  ? 121  GLY A CA  1 
ATOM   1469 C C   . GLY A 1 197 ? 103.421 -74.893  13.226  1.00 60.08  ? 121  GLY A C   1 
ATOM   1470 O O   . GLY A 1 197 ? 104.283 -74.480  12.449  1.00 58.53  ? 121  GLY A O   1 
ATOM   1471 N N   . SER A 1 198 ? 103.472 -74.684  14.558  1.00 56.36  ? 122  SER A N   1 
ATOM   1472 C CA  . SER A 1 198 ? 104.542 -73.960  15.246  1.00 55.93  ? 122  SER A CA  1 
ATOM   1473 C C   . SER A 1 198 ? 105.825 -74.783  15.323  1.00 57.71  ? 122  SER A C   1 
ATOM   1474 O O   . SER A 1 198 ? 106.907 -74.227  15.149  1.00 57.38  ? 122  SER A O   1 
ATOM   1475 C CB  . SER A 1 198 ? 104.106 -73.581  16.655  1.00 61.31  ? 122  SER A CB  1 
ATOM   1476 O OG  . SER A 1 198 ? 102.858 -72.916  16.622  1.00 71.64  ? 122  SER A OG  1 
ATOM   1477 N N   . PHE A 1 199 ? 105.707 -76.098  15.590  1.00 53.12  ? 123  PHE A N   1 
ATOM   1478 C CA  . PHE A 1 199 ? 106.839 -77.023  15.678  1.00 53.13  ? 123  PHE A CA  1 
ATOM   1479 C C   . PHE A 1 199 ? 107.626 -77.015  14.372  1.00 55.36  ? 123  PHE A C   1 
ATOM   1480 O O   . PHE A 1 199 ? 108.852 -77.034  14.404  1.00 54.64  ? 123  PHE A O   1 
ATOM   1481 C CB  . PHE A 1 199 ? 106.362 -78.444  16.030  1.00 55.80  ? 123  PHE A CB  1 
ATOM   1482 C CG  . PHE A 1 199 ? 107.440 -79.450  16.360  1.00 58.10  ? 123  PHE A CG  1 
ATOM   1483 C CD1 . PHE A 1 199 ? 108.102 -79.408  17.582  1.00 62.45  ? 123  PHE A CD1 1 
ATOM   1484 C CD2 . PHE A 1 199 ? 107.749 -80.476  15.475  1.00 59.76  ? 123  PHE A CD2 1 
ATOM   1485 C CE1 . PHE A 1 199 ? 109.085 -80.347  17.894  1.00 63.69  ? 123  PHE A CE1 1 
ATOM   1486 C CE2 . PHE A 1 199 ? 108.723 -81.422  15.792  1.00 63.04  ? 123  PHE A CE2 1 
ATOM   1487 C CZ  . PHE A 1 199 ? 109.386 -81.351  16.999  1.00 62.25  ? 123  PHE A CZ  1 
ATOM   1488 N N   . LEU A 1 200 ? 106.919 -76.914  13.236  1.00 51.85  ? 124  LEU A N   1 
ATOM   1489 C CA  . LEU A 1 200 ? 107.500 -76.841  11.901  1.00 51.23  ? 124  LEU A CA  1 
ATOM   1490 C C   . LEU A 1 200 ? 108.359 -75.583  11.760  1.00 58.05  ? 124  LEU A C   1 
ATOM   1491 O O   . LEU A 1 200 ? 109.500 -75.679  11.307  1.00 59.17  ? 124  LEU A O   1 
ATOM   1492 C CB  . LEU A 1 200 ? 106.381 -76.851  10.839  1.00 50.70  ? 124  LEU A CB  1 
ATOM   1493 C CG  . LEU A 1 200 ? 106.797 -76.595  9.387   1.00 54.45  ? 124  LEU A CG  1 
ATOM   1494 C CD1 . LEU A 1 200 ? 107.372 -77.841  8.750   1.00 54.58  ? 124  LEU A CD1 1 
ATOM   1495 C CD2 . LEU A 1 200 ? 105.639 -76.081  8.583   1.00 56.00  ? 124  LEU A CD2 1 
ATOM   1496 N N   . THR A 1 201 ? 107.812 -74.415  12.156  1.00 55.01  ? 125  THR A N   1 
ATOM   1497 C CA  . THR A 1 201 ? 108.457 -73.103  12.071  1.00 54.97  ? 125  THR A CA  1 
ATOM   1498 C C   . THR A 1 201 ? 109.647 -73.005  13.062  1.00 59.41  ? 125  THR A C   1 
ATOM   1499 O O   . THR A 1 201 ? 110.692 -72.470  12.688  1.00 59.15  ? 125  THR A O   1 
ATOM   1500 C CB  . THR A 1 201 ? 107.401 -72.003  12.291  1.00 61.89  ? 125  THR A CB  1 
ATOM   1501 O OG1 . THR A 1 201 ? 106.313 -72.237  11.398  1.00 61.95  ? 125  THR A OG1 1 
ATOM   1502 C CG2 . THR A 1 201 ? 107.939 -70.615  12.028  1.00 59.70  ? 125  THR A CG2 1 
ATOM   1503 N N   . LEU A 1 202 ? 109.492 -73.543  14.293  1.00 55.63  ? 126  LEU A N   1 
ATOM   1504 C CA  . LEU A 1 202 ? 110.514 -73.547  15.349  1.00 55.72  ? 126  LEU A CA  1 
ATOM   1505 C C   . LEU A 1 202 ? 111.799 -74.242  14.899  1.00 58.99  ? 126  LEU A C   1 
ATOM   1506 O O   . LEU A 1 202 ? 112.878 -73.737  15.178  1.00 60.09  ? 126  LEU A O   1 
ATOM   1507 C CB  . LEU A 1 202 ? 109.970 -74.247  16.609  1.00 56.67  ? 126  LEU A CB  1 
ATOM   1508 C CG  . LEU A 1 202 ? 110.737 -74.031  17.909  1.00 62.47  ? 126  LEU A CG  1 
ATOM   1509 C CD1 . LEU A 1 202 ? 109.790 -73.847  19.059  1.00 64.48  ? 126  LEU A CD1 1 
ATOM   1510 C CD2 . LEU A 1 202 ? 111.651 -75.190  18.201  1.00 63.55  ? 126  LEU A CD2 1 
ATOM   1511 N N   . ASN A 1 203 ? 111.682 -75.410  14.244  1.00 53.95  ? 127  ASN A N   1 
ATOM   1512 C CA  . ASN A 1 203 ? 112.811 -76.211  13.773  1.00 52.26  ? 127  ASN A CA  1 
ATOM   1513 C C   . ASN A 1 203 ? 113.345 -75.737  12.429  1.00 55.44  ? 127  ASN A C   1 
ATOM   1514 O O   . ASN A 1 203 ? 114.519 -75.967  12.151  1.00 55.18  ? 127  ASN A O   1 
ATOM   1515 C CB  . ASN A 1 203 ? 112.436 -77.680  13.698  1.00 46.33  ? 127  ASN A CB  1 
ATOM   1516 C CG  . ASN A 1 203 ? 112.255 -78.291  15.056  1.00 50.83  ? 127  ASN A CG  1 
ATOM   1517 O OD1 . ASN A 1 203 ? 111.159 -78.691  15.418  1.00 49.18  ? 127  ASN A OD1 1 
ATOM   1518 N ND2 . ASN A 1 203 ? 113.315 -78.349  15.854  1.00 36.24  ? 127  ASN A ND2 1 
ATOM   1519 N N   . MET A 1 204 ? 112.507 -75.089  11.596  1.00 52.44  ? 128  MET A N   1 
ATOM   1520 C CA  . MET A 1 204 ? 112.951 -74.554  10.308  1.00 52.41  ? 128  MET A CA  1 
ATOM   1521 C C   . MET A 1 204 ? 113.913 -73.390  10.574  1.00 57.33  ? 128  MET A C   1 
ATOM   1522 O O   . MET A 1 204 ? 114.996 -73.364  9.990   1.00 57.09  ? 128  MET A O   1 
ATOM   1523 C CB  . MET A 1 204 ? 111.766 -74.127  9.427   1.00 54.78  ? 128  MET A CB  1 
ATOM   1524 C CG  . MET A 1 204 ? 112.187 -73.566  8.075   1.00 59.08  ? 128  MET A CG  1 
ATOM   1525 S SD  . MET A 1 204 ? 111.088 -72.258  7.465   1.00 65.05  ? 128  MET A SD  1 
ATOM   1526 C CE  . MET A 1 204 ? 111.468 -70.922  8.602   1.00 62.66  ? 128  MET A CE  1 
ATOM   1527 N N   . PHE A 1 205 ? 113.547 -72.480  11.506  1.00 54.45  ? 129  PHE A N   1 
ATOM   1528 C CA  . PHE A 1 205 ? 114.380 -71.349  11.904  1.00 55.37  ? 129  PHE A CA  1 
ATOM   1529 C C   . PHE A 1 205 ? 115.624 -71.816  12.664  1.00 60.78  ? 129  PHE A C   1 
ATOM   1530 O O   . PHE A 1 205 ? 116.703 -71.297  12.392  1.00 61.57  ? 129  PHE A O   1 
ATOM   1531 C CB  . PHE A 1 205 ? 113.596 -70.336  12.748  1.00 58.30  ? 129  PHE A CB  1 
ATOM   1532 C CG  . PHE A 1 205 ? 112.758 -69.368  11.952  1.00 59.71  ? 129  PHE A CG  1 
ATOM   1533 C CD1 . PHE A 1 205 ? 113.344 -68.517  11.019  1.00 62.90  ? 129  PHE A CD1 1 
ATOM   1534 C CD2 . PHE A 1 205 ? 111.389 -69.273  12.165  1.00 62.16  ? 129  PHE A CD2 1 
ATOM   1535 C CE1 . PHE A 1 205 ? 112.570 -67.614  10.285  1.00 63.74  ? 129  PHE A CE1 1 
ATOM   1536 C CE2 . PHE A 1 205 ? 110.618 -68.356  11.443  1.00 65.09  ? 129  PHE A CE2 1 
ATOM   1537 C CZ  . PHE A 1 205 ? 111.213 -67.537  10.506  1.00 62.89  ? 129  PHE A CZ  1 
ATOM   1538 N N   . ALA A 1 206 ? 115.491 -72.806  13.585  1.00 56.77  ? 130  ALA A N   1 
ATOM   1539 C CA  . ALA A 1 206 ? 116.615 -73.360  14.354  1.00 56.61  ? 130  ALA A CA  1 
ATOM   1540 C C   . ALA A 1 206 ? 117.655 -73.999  13.425  1.00 58.89  ? 130  ALA A C   1 
ATOM   1541 O O   . ALA A 1 206 ? 118.840 -73.929  13.720  1.00 59.81  ? 130  ALA A O   1 
ATOM   1542 C CB  . ALA A 1 206 ? 116.125 -74.372  15.369  1.00 57.63  ? 130  ALA A CB  1 
ATOM   1543 N N   . SER A 1 207 ? 117.218 -74.577  12.290  1.00 53.41  ? 131  SER A N   1 
ATOM   1544 C CA  . SER A 1 207 ? 118.100 -75.152  11.271  1.00 52.67  ? 131  SER A CA  1 
ATOM   1545 C C   . SER A 1 207 ? 118.852 -74.035  10.534  1.00 56.31  ? 131  SER A C   1 
ATOM   1546 O O   . SER A 1 207 ? 120.055 -74.165  10.329  1.00 57.55  ? 131  SER A O   1 
ATOM   1547 C CB  . SER A 1 207 ? 117.307 -75.999  10.280  1.00 55.84  ? 131  SER A CB  1 
ATOM   1548 O OG  . SER A 1 207 ? 118.094 -76.367  9.159   1.00 65.56  ? 131  SER A OG  1 
ATOM   1549 N N   . ILE A 1 208 ? 118.145 -72.933  10.165  1.00 50.98  ? 132  ILE A N   1 
ATOM   1550 C CA  . ILE A 1 208 ? 118.689 -71.753  9.459   1.00 49.57  ? 132  ILE A CA  1 
ATOM   1551 C C   . ILE A 1 208 ? 119.674 -70.995  10.358  1.00 51.85  ? 132  ILE A C   1 
ATOM   1552 O O   . ILE A 1 208 ? 120.763 -70.631  9.907   1.00 51.33  ? 132  ILE A O   1 
ATOM   1553 C CB  . ILE A 1 208 ? 117.557 -70.803  8.947   1.00 51.84  ? 132  ILE A CB  1 
ATOM   1554 C CG1 . ILE A 1 208 ? 116.613 -71.518  7.944   1.00 51.27  ? 132  ILE A CG1 1 
ATOM   1555 C CG2 . ILE A 1 208 ? 118.157 -69.569  8.301   1.00 51.69  ? 132  ILE A CG2 1 
ATOM   1556 C CD1 . ILE A 1 208 ? 115.242 -70.867  7.755   1.00 61.68  ? 132  ILE A CD1 1 
ATOM   1557 N N   . PHE A 1 209 ? 119.285 -70.765  11.621  1.00 48.53  ? 133  PHE A N   1 
ATOM   1558 C CA  . PHE A 1 209 ? 120.074 -70.019  12.596  1.00 50.04  ? 133  PHE A CA  1 
ATOM   1559 C C   . PHE A 1 209 ? 121.331 -70.786  13.023  1.00 54.62  ? 133  PHE A C   1 
ATOM   1560 O O   . PHE A 1 209 ? 122.302 -70.141  13.421  1.00 55.59  ? 133  PHE A O   1 
ATOM   1561 C CB  . PHE A 1 209 ? 119.227 -69.627  13.826  1.00 52.82  ? 133  PHE A CB  1 
ATOM   1562 C CG  . PHE A 1 209 ? 118.012 -68.730  13.633  1.00 54.62  ? 133  PHE A CG  1 
ATOM   1563 C CD1 . PHE A 1 209 ? 117.799 -68.057  12.431  1.00 57.27  ? 133  PHE A CD1 1 
ATOM   1564 C CD2 . PHE A 1 209 ? 117.097 -68.540  14.666  1.00 57.74  ? 133  PHE A CD2 1 
ATOM   1565 C CE1 . PHE A 1 209 ? 116.675 -67.243  12.256  1.00 58.68  ? 133  PHE A CE1 1 
ATOM   1566 C CE2 . PHE A 1 209 ? 115.982 -67.714  14.496  1.00 60.97  ? 133  PHE A CE2 1 
ATOM   1567 C CZ  . PHE A 1 209 ? 115.776 -67.074  13.291  1.00 58.74  ? 133  PHE A CZ  1 
ATOM   1568 N N   . PHE A 1 210 ? 121.336 -72.141  12.924  1.00 50.01  ? 134  PHE A N   1 
ATOM   1569 C CA  . PHE A 1 210 ? 122.528 -72.916  13.275  1.00 50.34  ? 134  PHE A CA  1 
ATOM   1570 C C   . PHE A 1 210 ? 123.477 -73.003  12.071  1.00 56.34  ? 134  PHE A C   1 
ATOM   1571 O O   . PHE A 1 210 ? 124.684 -73.160  12.280  1.00 57.94  ? 134  PHE A O   1 
ATOM   1572 C CB  . PHE A 1 210 ? 122.210 -74.306  13.856  1.00 51.12  ? 134  PHE A CB  1 
ATOM   1573 C CG  . PHE A 1 210 ? 121.943 -74.321  15.350  1.00 53.05  ? 134  PHE A CG  1 
ATOM   1574 C CD1 . PHE A 1 210 ? 122.917 -73.911  16.254  1.00 57.21  ? 134  PHE A CD1 1 
ATOM   1575 C CD2 . PHE A 1 210 ? 120.737 -74.794  15.853  1.00 53.72  ? 134  PHE A CD2 1 
ATOM   1576 C CE1 . PHE A 1 210 ? 122.663 -73.913  17.631  1.00 59.35  ? 134  PHE A CE1 1 
ATOM   1577 C CE2 . PHE A 1 210 ? 120.485 -74.794  17.226  1.00 57.77  ? 134  PHE A CE2 1 
ATOM   1578 C CZ  . PHE A 1 210 ? 121.450 -74.355  18.108  1.00 57.61  ? 134  PHE A CZ  1 
ATOM   1579 N N   . ILE A 1 211 ? 122.955 -72.839  10.824  1.00 51.66  ? 135  ILE A N   1 
ATOM   1580 C CA  . ILE A 1 211 ? 123.774 -72.788  9.593   1.00 51.01  ? 135  ILE A CA  1 
ATOM   1581 C C   . ILE A 1 211 ? 124.638 -71.518  9.661   1.00 57.15  ? 135  ILE A C   1 
ATOM   1582 O O   . ILE A 1 211 ? 125.818 -71.540  9.295   1.00 56.95  ? 135  ILE A O   1 
ATOM   1583 C CB  . ILE A 1 211 ? 122.897 -72.846  8.302   1.00 52.09  ? 135  ILE A CB  1 
ATOM   1584 C CG1 . ILE A 1 211 ? 122.440 -74.288  8.010   1.00 50.97  ? 135  ILE A CG1 1 
ATOM   1585 C CG2 . ILE A 1 211 ? 123.615 -72.248  7.075   1.00 51.99  ? 135  ILE A CG2 1 
ATOM   1586 C CD1 . ILE A 1 211 ? 121.166 -74.389  7.142   1.00 54.26  ? 135  ILE A CD1 1 
ATOM   1587 N N   . THR A 1 212 ? 124.032 -70.433  10.175  1.00 56.40  ? 136  THR A N   1 
ATOM   1588 C CA  . THR A 1 212 ? 124.632 -69.117  10.383  1.00 58.97  ? 136  THR A CA  1 
ATOM   1589 C C   . THR A 1 212 ? 125.761 -69.221  11.427  1.00 68.17  ? 136  THR A C   1 
ATOM   1590 O O   . THR A 1 212 ? 126.862 -68.732  11.167  1.00 69.27  ? 136  THR A O   1 
ATOM   1591 C CB  . THR A 1 212 ? 123.543 -68.122  10.778  1.00 63.10  ? 136  THR A CB  1 
ATOM   1592 O OG1 . THR A 1 212 ? 122.483 -68.210  9.826   1.00 59.44  ? 136  THR A OG1 1 
ATOM   1593 C CG2 . THR A 1 212 ? 124.046 -66.707  10.827  1.00 62.48  ? 136  THR A CG2 1 
ATOM   1594 N N   . CYS A 1 213 ? 125.500 -69.904  12.570  1.00 66.71  ? 137  CYS A N   1 
ATOM   1595 C CA  . CYS A 1 213 ? 126.476 -70.147  13.638  1.00 69.02  ? 137  CYS A CA  1 
ATOM   1596 C C   . CYS A 1 213 ? 127.705 -70.851  13.074  1.00 74.25  ? 137  CYS A C   1 
ATOM   1597 O O   . CYS A 1 213 ? 128.833 -70.458  13.369  1.00 75.13  ? 137  CYS A O   1 
ATOM   1598 C CB  . CYS A 1 213 ? 125.847 -70.963  14.761  1.00 69.75  ? 137  CYS A CB  1 
ATOM   1599 S SG  . CYS A 1 213 ? 124.660 -70.044  15.770  1.00 74.87  ? 137  CYS A SG  1 
ATOM   1600 N N   . MET A 1 214 ? 127.470 -71.881  12.240  1.00 70.27  ? 138  MET A N   1 
ATOM   1601 C CA  . MET A 1 214 ? 128.488 -72.690  11.586  1.00 69.84  ? 138  MET A CA  1 
ATOM   1602 C C   . MET A 1 214 ? 129.369 -71.861  10.658  1.00 72.60  ? 138  MET A C   1 
ATOM   1603 O O   . MET A 1 214 ? 130.576 -72.106  10.605  1.00 73.50  ? 138  MET A O   1 
ATOM   1604 C CB  . MET A 1 214 ? 127.840 -73.842  10.801  1.00 70.73  ? 138  MET A CB  1 
ATOM   1605 C CG  . MET A 1 214 ? 127.632 -75.106  11.615  1.00 74.85  ? 138  MET A CG  1 
ATOM   1606 S SD  . MET A 1 214 ? 129.049 -75.642  12.617  1.00 82.00  ? 138  MET A SD  1 
ATOM   1607 C CE  . MET A 1 214 ? 130.318 -75.924  11.360  1.00 78.81  ? 138  MET A CE  1 
ATOM   1608 N N   . SER A 1 215 ? 128.774 -70.889  9.933   1.00 66.81  ? 139  SER A N   1 
ATOM   1609 C CA  . SER A 1 215 ? 129.509 -70.016  9.018   1.00 66.61  ? 139  SER A CA  1 
ATOM   1610 C C   . SER A 1 215 ? 130.363 -68.999  9.794   1.00 70.36  ? 139  SER A C   1 
ATOM   1611 O O   . SER A 1 215 ? 131.486 -68.713  9.376   1.00 71.21  ? 139  SER A O   1 
ATOM   1612 C CB  . SER A 1 215 ? 128.557 -69.307  8.060   1.00 69.45  ? 139  SER A CB  1 
ATOM   1613 O OG  . SER A 1 215 ? 128.323 -70.099  6.907   1.00 76.29  ? 139  SER A OG  1 
ATOM   1614 N N   . VAL A 1 216 ? 129.844 -68.484  10.932  1.00 65.65  ? 140  VAL A N   1 
ATOM   1615 C CA  . VAL A 1 216 ? 130.538 -67.525  11.803  1.00 66.78  ? 140  VAL A CA  1 
ATOM   1616 C C   . VAL A 1 216 ? 131.731 -68.220  12.478  1.00 71.54  ? 140  VAL A C   1 
ATOM   1617 O O   . VAL A 1 216 ? 132.797 -67.615  12.591  1.00 72.34  ? 140  VAL A O   1 
ATOM   1618 C CB  . VAL A 1 216 ? 129.577 -66.878  12.842  1.00 70.42  ? 140  VAL A CB  1 
ATOM   1619 C CG1 . VAL A 1 216 ? 130.325 -65.971  13.817  1.00 72.45  ? 140  VAL A CG1 1 
ATOM   1620 C CG2 . VAL A 1 216 ? 128.457 -66.107  12.151  1.00 69.20  ? 140  VAL A CG2 1 
ATOM   1621 N N   . ASP A 1 217 ? 131.555 -69.490  12.897  1.00 67.95  ? 141  ASP A N   1 
ATOM   1622 C CA  . ASP A 1 217 ? 132.591 -70.293  13.553  1.00 68.85  ? 141  ASP A CA  1 
ATOM   1623 C C   . ASP A 1 217 ? 133.736 -70.610  12.589  1.00 72.57  ? 141  ASP A C   1 
ATOM   1624 O O   . ASP A 1 217 ? 134.893 -70.391  12.950  1.00 74.46  ? 141  ASP A O   1 
ATOM   1625 C CB  . ASP A 1 217 ? 132.001 -71.582  14.133  1.00 69.84  ? 141  ASP A CB  1 
ATOM   1626 C CG  . ASP A 1 217 ? 132.764 -72.091  15.331  1.00 86.13  ? 141  ASP A CG  1 
ATOM   1627 O OD1 . ASP A 1 217 ? 132.658 -71.465  16.414  1.00 88.89  ? 141  ASP A OD1 1 
ATOM   1628 O OD2 . ASP A 1 217 ? 133.478 -73.106  15.190  1.00 95.30  ? 141  ASP A OD2 1 
ATOM   1629 N N   . ARG A 1 218 ? 133.413 -71.080  11.357  1.00 67.43  ? 142  ARG A N   1 
ATOM   1630 C CA  . ARG A 1 218 ? 134.381 -71.384  10.293  1.00 67.55  ? 142  ARG A CA  1 
ATOM   1631 C C   . ARG A 1 218 ? 135.184 -70.137  9.913   1.00 76.69  ? 142  ARG A C   1 
ATOM   1632 O O   . ARG A 1 218 ? 136.369 -70.253  9.606   1.00 79.19  ? 142  ARG A O   1 
ATOM   1633 C CB  . ARG A 1 218 ? 133.691 -71.960  9.052   1.00 63.63  ? 142  ARG A CB  1 
ATOM   1634 C CG  . ARG A 1 218 ? 133.374 -73.441  9.172   1.00 71.97  ? 142  ARG A CG  1 
ATOM   1635 C CD  . ARG A 1 218 ? 132.714 -73.988  7.922   1.00 77.14  ? 142  ARG A CD  1 
ATOM   1636 N NE  . ARG A 1 218 ? 132.759 -75.451  7.889   1.00 75.32  ? 142  ARG A NE  1 
ATOM   1637 C CZ  . ARG A 1 218 ? 132.481 -76.189  6.818   1.00 79.98  ? 142  ARG A CZ  1 
ATOM   1638 N NH1 . ARG A 1 218 ? 132.127 -75.610  5.677   1.00 47.98  ? 142  ARG A NH1 1 
ATOM   1639 N NH2 . ARG A 1 218 ? 132.550 -77.512  6.883   1.00 76.74  ? 142  ARG A NH2 1 
ATOM   1640 N N   . TYR A 1 219 ? 134.551 -68.949  9.962   1.00 74.22  ? 143  TYR A N   1 
ATOM   1641 C CA  . TYR A 1 219 ? 135.215 -67.682  9.678   1.00 76.21  ? 143  TYR A CA  1 
ATOM   1642 C C   . TYR A 1 219 ? 136.142 -67.302  10.834  1.00 82.94  ? 143  TYR A C   1 
ATOM   1643 O O   . TYR A 1 219 ? 137.262 -66.867  10.584  1.00 84.08  ? 143  TYR A O   1 
ATOM   1644 C CB  . TYR A 1 219 ? 134.182 -66.568  9.405   1.00 77.45  ? 143  TYR A CB  1 
ATOM   1645 C CG  . TYR A 1 219 ? 134.784 -65.180  9.388   1.00 81.50  ? 143  TYR A CG  1 
ATOM   1646 C CD1 . TYR A 1 219 ? 135.539 -64.739  8.305   1.00 83.96  ? 143  TYR A CD1 1 
ATOM   1647 C CD2 . TYR A 1 219 ? 134.621 -64.316  10.466  1.00 84.04  ? 143  TYR A CD2 1 
ATOM   1648 C CE1 . TYR A 1 219 ? 136.122 -63.476  8.299   1.00 87.39  ? 143  TYR A CE1 1 
ATOM   1649 C CE2 . TYR A 1 219 ? 135.192 -63.046  10.468  1.00 87.59  ? 143  TYR A CE2 1 
ATOM   1650 C CZ  . TYR A 1 219 ? 135.940 -62.628  9.379   1.00 97.75  ? 143  TYR A CZ  1 
ATOM   1651 O OH  . TYR A 1 219 ? 136.508 -61.373  9.369   1.00 103.41 ? 143  TYR A OH  1 
ATOM   1652 N N   . GLN A 1 220 ? 135.665 -67.463  12.089  1.00 80.58  ? 144  GLN A N   1 
ATOM   1653 C CA  . GLN A 1 220 ? 136.390 -67.161  13.329  1.00 83.34  ? 144  GLN A CA  1 
ATOM   1654 C C   . GLN A 1 220 ? 137.667 -68.009  13.453  1.00 89.10  ? 144  GLN A C   1 
ATOM   1655 O O   . GLN A 1 220 ? 138.688 -67.516  13.943  1.00 90.32  ? 144  GLN A O   1 
ATOM   1656 C CB  . GLN A 1 220 ? 135.478 -67.398  14.543  1.00 84.70  ? 144  GLN A CB  1 
ATOM   1657 C CG  . GLN A 1 220 ? 135.607 -66.336  15.635  1.00 108.95 ? 144  GLN A CG  1 
ATOM   1658 C CD  . GLN A 1 220 ? 134.563 -66.443  16.729  1.00 128.60 ? 144  GLN A CD  1 
ATOM   1659 O OE1 . GLN A 1 220 ? 133.533 -67.107  16.595  1.00 120.95 ? 144  GLN A OE1 1 
ATOM   1660 N NE2 . GLN A 1 220 ? 134.805 -65.772  17.847  1.00 127.25 ? 144  GLN A NE2 1 
ATOM   1661 N N   . SER A 1 221 ? 137.603 -69.276  12.997  1.00 85.10  ? 145  SER A N   1 
ATOM   1662 C CA  . SER A 1 221 ? 138.720 -70.217  13.024  1.00 86.24  ? 145  SER A CA  1 
ATOM   1663 C C   . SER A 1 221 ? 139.733 -69.919  11.909  1.00 92.28  ? 145  SER A C   1 
ATOM   1664 O O   . SER A 1 221 ? 140.936 -70.094  12.131  1.00 94.58  ? 145  SER A O   1 
ATOM   1665 C CB  . SER A 1 221 ? 138.217 -71.654  12.911  1.00 87.03  ? 145  SER A CB  1 
ATOM   1666 O OG  . SER A 1 221 ? 137.665 -71.923  11.635  1.00 91.99  ? 145  SER A OG  1 
ATOM   1667 N N   . VAL A 1 222 ? 139.247 -69.471  10.723  1.00 87.27  ? 146  VAL A N   1 
ATOM   1668 C CA  . VAL A 1 222 ? 140.064 -69.134  9.549   1.00 87.94  ? 146  VAL A CA  1 
ATOM   1669 C C   . VAL A 1 222 ? 140.984 -67.927  9.856   1.00 96.94  ? 146  VAL A C   1 
ATOM   1670 O O   . VAL A 1 222 ? 142.119 -67.903  9.376   1.00 98.84  ? 146  VAL A O   1 
ATOM   1671 C CB  . VAL A 1 222 ? 139.171 -68.921  8.296   1.00 89.59  ? 146  VAL A CB  1 
ATOM   1672 C CG1 . VAL A 1 222 ? 139.643 -67.770  7.404   1.00 90.46  ? 146  VAL A CG1 1 
ATOM   1673 C CG2 . VAL A 1 222 ? 139.055 -70.215  7.502   1.00 87.57  ? 146  VAL A CG2 1 
ATOM   1674 N N   . ILE A 1 223 ? 140.526 -66.970  10.685  1.00 95.17  ? 147  ILE A N   1 
ATOM   1675 C CA  . ILE A 1 223 ? 141.322 -65.794  11.046  1.00 98.32  ? 147  ILE A CA  1 
ATOM   1676 C C   . ILE A 1 223 ? 142.275 -66.129  12.236  1.00 106.18 ? 147  ILE A C   1 
ATOM   1677 O O   . ILE A 1 223 ? 143.456 -65.773  12.168  1.00 108.99 ? 147  ILE A O   1 
ATOM   1678 C CB  . ILE A 1 223 ? 140.427 -64.542  11.319  1.00 101.68 ? 147  ILE A CB  1 
ATOM   1679 C CG1 . ILE A 1 223 ? 139.339 -64.321  10.223  1.00 99.45  ? 147  ILE A CG1 1 
ATOM   1680 C CG2 . ILE A 1 223 ? 141.255 -63.277  11.548  1.00 106.33 ? 147  ILE A CG2 1 
ATOM   1681 C CD1 . ILE A 1 223 ? 139.790 -64.126  8.728   1.00 105.99 ? 147  ILE A CD1 1 
ATOM   1682 N N   . TYR A 1 224 ? 141.789 -66.875  13.262  1.00 102.26 ? 148  TYR A N   1 
ATOM   1683 C CA  . TYR A 1 224 ? 142.537 -67.284  14.469  1.00 134.02 ? 148  TYR A CA  1 
ATOM   1684 C C   . TYR A 1 224 ? 143.948 -67.868  14.169  1.00 142.92 ? 148  TYR A C   1 
ATOM   1685 O O   . TYR A 1 224 ? 144.102 -68.969  13.637  1.00 94.45  ? 148  TYR A O   1 
ATOM   1686 C CB  . TYR A 1 224 ? 141.722 -68.295  15.293  1.00 133.84 ? 148  TYR A CB  1 
ATOM   1687 N N   . ALA A 1 236 ? 129.843 -70.153  24.179  1.00 106.85 ? 160  ALA A N   1 
ATOM   1688 C CA  . ALA A 1 236 ? 129.264 -71.168  23.298  1.00 103.71 ? 160  ALA A CA  1 
ATOM   1689 C C   . ALA A 1 236 ? 128.072 -71.877  23.944  1.00 106.63 ? 160  ALA A C   1 
ATOM   1690 O O   . ALA A 1 236 ? 127.146 -72.262  23.230  1.00 103.38 ? 160  ALA A O   1 
ATOM   1691 C CB  . ALA A 1 236 ? 130.317 -72.186  22.900  1.00 104.19 ? 160  ALA A CB  1 
ATOM   1692 N N   . SER A 1 237 ? 128.096 -72.043  25.291  1.00 105.62 ? 161  SER A N   1 
ATOM   1693 C CA  . SER A 1 237 ? 127.030 -72.657  26.107  1.00 105.20 ? 161  SER A CA  1 
ATOM   1694 C C   . SER A 1 237 ? 125.879 -71.658  26.321  1.00 107.72 ? 161  SER A C   1 
ATOM   1695 O O   . SER A 1 237 ? 124.873 -71.972  26.967  1.00 107.23 ? 161  SER A O   1 
ATOM   1696 C CB  . SER A 1 237 ? 127.591 -73.123  27.450  1.00 111.68 ? 161  SER A CB  1 
ATOM   1697 O OG  . SER A 1 237 ? 128.011 -72.032  28.252  1.00 123.45 ? 161  SER A OG  1 
ATOM   1698 N N   . TYR A 1 238 ? 126.057 -70.449  25.760  1.00 103.22 ? 162  TYR A N   1 
ATOM   1699 C CA  . TYR A 1 238 ? 125.135 -69.323  25.771  1.00 102.56 ? 162  TYR A CA  1 
ATOM   1700 C C   . TYR A 1 238 ? 124.448 -69.174  24.405  1.00 101.13 ? 162  TYR A C   1 
ATOM   1701 O O   . TYR A 1 238 ? 123.275 -68.820  24.365  1.00 100.21 ? 162  TYR A O   1 
ATOM   1702 C CB  . TYR A 1 238 ? 125.892 -68.032  26.134  1.00 106.48 ? 162  TYR A CB  1 
ATOM   1703 N N   . ILE A 1 239 ? 125.175 -69.445  23.297  1.00 94.38  ? 163  ILE A N   1 
ATOM   1704 C CA  . ILE A 1 239 ? 124.693 -69.320  21.919  1.00 90.63  ? 163  ILE A CA  1 
ATOM   1705 C C   . ILE A 1 239 ? 123.613 -70.368  21.626  1.00 90.05  ? 163  ILE A C   1 
ATOM   1706 O O   . ILE A 1 239 ? 122.525 -69.980  21.207  1.00 88.70  ? 163  ILE A O   1 
ATOM   1707 C CB  . ILE A 1 239 ? 125.869 -69.379  20.894  1.00 93.19  ? 163  ILE A CB  1 
ATOM   1708 C CG1 . ILE A 1 239 ? 126.745 -68.120  20.996  1.00 96.12  ? 163  ILE A CG1 1 
ATOM   1709 C CG2 . ILE A 1 239 ? 125.370 -69.547  19.455  1.00 91.03  ? 163  ILE A CG2 1 
ATOM   1710 C CD1 . ILE A 1 239 ? 128.218 -68.381  20.932  1.00 107.19 ? 163  ILE A CD1 1 
ATOM   1711 N N   . VAL A 1 240 ? 123.896 -71.673  21.847  1.00 84.39  ? 164  VAL A N   1 
ATOM   1712 C CA  . VAL A 1 240 ? 122.930 -72.751  21.579  1.00 81.63  ? 164  VAL A CA  1 
ATOM   1713 C C   . VAL A 1 240 ? 121.552 -72.437  22.264  1.00 83.74  ? 164  VAL A C   1 
ATOM   1714 O O   . VAL A 1 240 ? 120.578 -72.367  21.507  1.00 81.50  ? 164  VAL A O   1 
ATOM   1715 C CB  . VAL A 1 240 ? 123.454 -74.194  21.874  1.00 85.82  ? 164  VAL A CB  1 
ATOM   1716 C CG1 . VAL A 1 240 ? 124.366 -74.264  23.097  1.00 88.48  ? 164  VAL A CG1 1 
ATOM   1717 C CG2 . VAL A 1 240 ? 122.328 -75.212  21.961  1.00 84.66  ? 164  VAL A CG2 1 
ATOM   1718 N N   . PRO A 1 241 ? 121.416 -72.135  23.597  1.00 81.07  ? 165  PRO A N   1 
ATOM   1719 C CA  . PRO A 1 241 ? 120.069 -71.825  24.125  1.00 80.38  ? 165  PRO A CA  1 
ATOM   1720 C C   . PRO A 1 241 ? 119.440 -70.564  23.520  1.00 82.25  ? 165  PRO A C   1 
ATOM   1721 O O   . PRO A 1 241 ? 118.218 -70.516  23.376  1.00 80.79  ? 165  PRO A O   1 
ATOM   1722 C CB  . PRO A 1 241 ? 120.291 -71.671  25.632  1.00 85.13  ? 165  PRO A CB  1 
ATOM   1723 C CG  . PRO A 1 241 ? 121.732 -71.426  25.795  1.00 91.43  ? 165  PRO A CG  1 
ATOM   1724 C CD  . PRO A 1 241 ? 122.420 -72.130  24.686  1.00 85.04  ? 165  PRO A CD  1 
ATOM   1725 N N   . LEU A 1 242 ? 120.262 -69.565  23.131  1.00 78.75  ? 166  LEU A N   1 
ATOM   1726 C CA  . LEU A 1 242 ? 119.776 -68.338  22.488  1.00 78.03  ? 166  LEU A CA  1 
ATOM   1727 C C   . LEU A 1 242 ? 119.199 -68.605  21.092  1.00 79.45  ? 166  LEU A C   1 
ATOM   1728 O O   . LEU A 1 242 ? 118.205 -67.982  20.725  1.00 78.16  ? 166  LEU A O   1 
ATOM   1729 C CB  . LEU A 1 242 ? 120.874 -67.275  22.372  1.00 79.48  ? 166  LEU A CB  1 
ATOM   1730 C CG  . LEU A 1 242 ? 120.573 -65.946  23.125  1.00 86.93  ? 166  LEU A CG  1 
ATOM   1731 C CD1 . LEU A 1 242 ? 121.826 -65.246  23.535  1.00 93.24  ? 166  LEU A CD1 1 
ATOM   1732 C CD2 . LEU A 1 242 ? 119.581 -64.972  22.405  1.00 86.20  ? 166  LEU A CD2 1 
ATOM   1733 N N   . VAL A 1 243 ? 119.817 -69.530  20.321  1.00 75.22  ? 167  VAL A N   1 
ATOM   1734 C CA  . VAL A 1 243 ? 119.400 -69.899  18.960  1.00 72.60  ? 167  VAL A CA  1 
ATOM   1735 C C   . VAL A 1 243 ? 118.020 -70.571  19.012  1.00 76.20  ? 167  VAL A C   1 
ATOM   1736 O O   . VAL A 1 243 ? 117.203 -70.365  18.112  1.00 74.79  ? 167  VAL A O   1 
ATOM   1737 C CB  . VAL A 1 243 ? 120.459 -70.777  18.245  1.00 75.53  ? 167  VAL A CB  1 
ATOM   1738 C CG1 . VAL A 1 243 ? 119.970 -71.249  16.883  1.00 73.06  ? 167  VAL A CG1 1 
ATOM   1739 C CG2 . VAL A 1 243 ? 121.772 -70.021  18.092  1.00 76.53  ? 167  VAL A CG2 1 
ATOM   1740 N N   . TRP A 1 244 ? 117.750 -71.330  20.084  1.00 73.88  ? 168  TRP A N   1 
ATOM   1741 C CA  . TRP A 1 244 ? 116.460 -71.981  20.285  1.00 72.67  ? 168  TRP A CA  1 
ATOM   1742 C C   . TRP A 1 244 ? 115.428 -70.961  20.772  1.00 78.49  ? 168  TRP A C   1 
ATOM   1743 O O   . TRP A 1 244 ? 114.271 -71.044  20.376  1.00 76.84  ? 168  TRP A O   1 
ATOM   1744 C CB  . TRP A 1 244 ? 116.585 -73.168  21.244  1.00 71.74  ? 168  TRP A CB  1 
ATOM   1745 C CG  . TRP A 1 244 ? 117.278 -74.341  20.621  1.00 71.13  ? 168  TRP A CG  1 
ATOM   1746 C CD1 . TRP A 1 244 ? 118.577 -74.713  20.795  1.00 74.62  ? 168  TRP A CD1 1 
ATOM   1747 C CD2 . TRP A 1 244 ? 116.724 -75.250  19.669  1.00 68.91  ? 168  TRP A CD2 1 
ATOM   1748 N NE1 . TRP A 1 244 ? 118.861 -75.811  20.025  1.00 72.43  ? 168  TRP A NE1 1 
ATOM   1749 C CE2 . TRP A 1 244 ? 117.741 -76.167  19.325  1.00 72.11  ? 168  TRP A CE2 1 
ATOM   1750 C CE3 . TRP A 1 244 ? 115.457 -75.391  19.078  1.00 68.97  ? 168  TRP A CE3 1 
ATOM   1751 C CZ2 . TRP A 1 244 ? 117.533 -77.211  18.418  1.00 69.92  ? 168  TRP A CZ2 1 
ATOM   1752 C CZ3 . TRP A 1 244 ? 115.249 -76.434  18.191  1.00 69.12  ? 168  TRP A CZ3 1 
ATOM   1753 C CH2 . TRP A 1 244 ? 116.284 -77.320  17.855  1.00 69.44  ? 168  TRP A CH2 1 
ATOM   1754 N N   . CYS A 1 245 ? 115.856 -69.975  21.582  1.00 78.58  ? 169  CYS A N   1 
ATOM   1755 C CA  . CYS A 1 245 ? 114.982 -68.914  22.072  1.00 80.68  ? 169  CYS A CA  1 
ATOM   1756 C C   . CYS A 1 245 ? 114.523 -68.014  20.910  1.00 82.54  ? 169  CYS A C   1 
ATOM   1757 O O   . CYS A 1 245 ? 113.346 -67.664  20.854  1.00 81.66  ? 169  CYS A O   1 
ATOM   1758 C CB  . CYS A 1 245 ? 115.670 -68.107  23.167  1.00 84.70  ? 169  CYS A CB  1 
ATOM   1759 S SG  . CYS A 1 245 ? 114.750 -66.637  23.688  1.00 91.18  ? 169  CYS A SG  1 
ATOM   1760 N N   . MET A 1 246 ? 115.443 -67.668  19.980  1.00 78.32  ? 170  MET A N   1 
ATOM   1761 C CA  . MET A 1 246 ? 115.168 -66.853  18.785  1.00 76.91  ? 170  MET A CA  1 
ATOM   1762 C C   . MET A 1 246 ? 114.221 -67.585  17.829  1.00 75.80  ? 170  MET A C   1 
ATOM   1763 O O   . MET A 1 246 ? 113.412 -66.941  17.161  1.00 73.02  ? 170  MET A O   1 
ATOM   1764 C CB  . MET A 1 246 ? 116.465 -66.487  18.052  1.00 79.59  ? 170  MET A CB  1 
ATOM   1765 C CG  . MET A 1 246 ? 117.203 -65.317  18.671  1.00 86.15  ? 170  MET A CG  1 
ATOM   1766 S SD  . MET A 1 246 ? 118.704 -64.895  17.740  1.00 90.88  ? 170  MET A SD  1 
ATOM   1767 C CE  . MET A 1 246 ? 119.838 -66.142  18.329  1.00 87.78  ? 170  MET A CE  1 
ATOM   1768 N N   . ALA A 1 247 ? 114.321 -68.932  17.776  1.00 71.33  ? 171  ALA A N   1 
ATOM   1769 C CA  . ALA A 1 247 ? 113.460 -69.788  16.958  1.00 69.40  ? 171  ALA A CA  1 
ATOM   1770 C C   . ALA A 1 247 ? 112.042 -69.857  17.565  1.00 75.34  ? 171  ALA A C   1 
ATOM   1771 O O   . ALA A 1 247 ? 111.062 -69.923  16.820  1.00 73.76  ? 171  ALA A O   1 
ATOM   1772 C CB  . ALA A 1 247 ? 114.066 -71.175  16.841  1.00 69.03  ? 171  ALA A CB  1 
ATOM   1773 N N   . CYS A 1 248 ? 111.938 -69.804  18.914  1.00 74.64  ? 172  CYS A N   1 
ATOM   1774 C CA  . CYS A 1 248 ? 110.673 -69.809  19.665  1.00 75.66  ? 172  CYS A CA  1 
ATOM   1775 C C   . CYS A 1 248 ? 109.921 -68.527  19.408  1.00 77.94  ? 172  CYS A C   1 
ATOM   1776 O O   . CYS A 1 248 ? 108.711 -68.561  19.213  1.00 77.63  ? 172  CYS A O   1 
ATOM   1777 C CB  . CYS A 1 248 ? 110.921 -70.000  21.159  1.00 79.08  ? 172  CYS A CB  1 
ATOM   1778 S SG  . CYS A 1 248 ? 111.494 -71.659  21.613  1.00 83.51  ? 172  CYS A SG  1 
ATOM   1779 N N   . LEU A 1 249 ? 110.638 -67.388  19.442  1.00 73.92  ? 173  LEU A N   1 
ATOM   1780 C CA  . LEU A 1 249 ? 110.117 -66.034  19.227  1.00 73.75  ? 173  LEU A CA  1 
ATOM   1781 C C   . LEU A 1 249 ? 109.642 -65.827  17.784  1.00 73.69  ? 173  LEU A C   1 
ATOM   1782 O O   . LEU A 1 249 ? 108.588 -65.227  17.578  1.00 73.92  ? 173  LEU A O   1 
ATOM   1783 C CB  . LEU A 1 249 ? 111.201 -64.995  19.581  1.00 75.42  ? 173  LEU A CB  1 
ATOM   1784 C CG  . LEU A 1 249 ? 111.120 -64.320  20.949  1.00 82.86  ? 173  LEU A CG  1 
ATOM   1785 C CD1 . LEU A 1 249 ? 111.379 -65.302  22.090  1.00 84.31  ? 173  LEU A CD1 1 
ATOM   1786 C CD2 . LEU A 1 249 ? 112.130 -63.224  21.045  1.00 86.77  ? 173  LEU A CD2 1 
ATOM   1787 N N   . SER A 1 250 ? 110.403 -66.345  16.798  1.00 66.47  ? 174  SER A N   1 
ATOM   1788 C CA  . SER A 1 250 ? 110.102 -66.227  15.367  1.00 63.78  ? 174  SER A CA  1 
ATOM   1789 C C   . SER A 1 250 ? 108.910 -67.097  14.952  1.00 65.28  ? 174  SER A C   1 
ATOM   1790 O O   . SER A 1 250 ? 108.357 -66.875  13.879  1.00 63.41  ? 174  SER A O   1 
ATOM   1791 C CB  . SER A 1 250 ? 111.324 -66.592  14.527  1.00 65.86  ? 174  SER A CB  1 
ATOM   1792 O OG  . SER A 1 250 ? 112.464 -65.805  14.831  1.00 73.80  ? 174  SER A OG  1 
ATOM   1793 N N   . SER A 1 251 ? 108.518 -68.083  15.789  1.00 62.79  ? 175  SER A N   1 
ATOM   1794 C CA  . SER A 1 251 ? 107.388 -68.985  15.512  1.00 61.62  ? 175  SER A CA  1 
ATOM   1795 C C   . SER A 1 251 ? 106.133 -68.628  16.341  1.00 66.74  ? 175  SER A C   1 
ATOM   1796 O O   . SER A 1 251 ? 105.174 -69.398  16.353  1.00 66.41  ? 175  SER A O   1 
ATOM   1797 C CB  . SER A 1 251 ? 107.786 -70.442  15.745  1.00 63.66  ? 175  SER A CB  1 
ATOM   1798 O OG  . SER A 1 251 ? 108.172 -70.669  17.088  1.00 74.90  ? 175  SER A OG  1 
ATOM   1799 N N   . LEU A 1 252 ? 106.130 -67.452  17.002  1.00 65.48  ? 176  LEU A N   1 
ATOM   1800 C CA  . LEU A 1 252 ? 104.993 -66.950  17.781  1.00 67.04  ? 176  LEU A CA  1 
ATOM   1801 C C   . LEU A 1 252 ? 103.814 -66.503  16.872  1.00 71.23  ? 176  LEU A C   1 
ATOM   1802 O O   . LEU A 1 252 ? 102.675 -66.841  17.223  1.00 71.55  ? 176  LEU A O   1 
ATOM   1803 C CB  . LEU A 1 252 ? 105.400 -65.818  18.728  1.00 68.89  ? 176  LEU A CB  1 
ATOM   1804 C CG  . LEU A 1 252 ? 106.016 -66.285  20.034  1.00 75.14  ? 176  LEU A CG  1 
ATOM   1805 C CD1 . LEU A 1 252 ? 106.735 -65.170  20.720  1.00 77.33  ? 176  LEU A CD1 1 
ATOM   1806 C CD2 . LEU A 1 252 ? 104.974 -66.903  20.955  1.00 79.22  ? 176  LEU A CD2 1 
ATOM   1807 N N   . PRO A 1 253 ? 104.023 -65.833  15.692  1.00 66.10  ? 177  PRO A N   1 
ATOM   1808 C CA  . PRO A 1 253 ? 102.872 -65.511  14.825  1.00 64.69  ? 177  PRO A CA  1 
ATOM   1809 C C   . PRO A 1 253 ? 102.202 -66.756  14.233  1.00 64.73  ? 177  PRO A C   1 
ATOM   1810 O O   . PRO A 1 253 ? 101.019 -66.685  13.919  1.00 64.62  ? 177  PRO A O   1 
ATOM   1811 C CB  . PRO A 1 253 ? 103.491 -64.646  13.732  1.00 66.22  ? 177  PRO A CB  1 
ATOM   1812 C CG  . PRO A 1 253 ? 104.811 -64.176  14.300  1.00 71.48  ? 177  PRO A CG  1 
ATOM   1813 C CD  . PRO A 1 253 ? 105.277 -65.331  15.088  1.00 66.81  ? 177  PRO A CD  1 
ATOM   1814 N N   . THR A 1 254 ? 102.923 -67.892  14.108  1.00 59.14  ? 178  THR A N   1 
ATOM   1815 C CA  . THR A 1 254 ? 102.353 -69.165  13.636  1.00 57.63  ? 178  THR A CA  1 
ATOM   1816 C C   . THR A 1 254 ? 101.442 -69.713  14.739  1.00 61.67  ? 178  THR A C   1 
ATOM   1817 O O   . THR A 1 254 ? 100.305 -70.101  14.468  1.00 61.00  ? 178  THR A O   1 
ATOM   1818 C CB  . THR A 1 254 ? 103.456 -70.172  13.248  1.00 63.19  ? 178  THR A CB  1 
ATOM   1819 O OG1 . THR A 1 254 ? 104.257 -69.632  12.205  1.00 66.02  ? 178  THR A OG1 1 
ATOM   1820 C CG2 . THR A 1 254 ? 102.903 -71.482  12.788  1.00 59.13  ? 178  THR A CG2 1 
ATOM   1821 N N   . PHE A 1 255 ? 101.946 -69.715  15.985  1.00 59.11  ? 179  PHE A N   1 
ATOM   1822 C CA  . PHE A 1 255 ? 101.225 -70.202  17.155  1.00 60.39  ? 179  PHE A CA  1 
ATOM   1823 C C   . PHE A 1 255 ? 99.979  -69.394  17.433  1.00 65.42  ? 179  PHE A C   1 
ATOM   1824 O O   . PHE A 1 255 ? 98.977  -69.975  17.828  1.00 65.80  ? 179  PHE A O   1 
ATOM   1825 C CB  . PHE A 1 255 ? 102.125 -70.204  18.403  1.00 63.49  ? 179  PHE A CB  1 
ATOM   1826 C CG  . PHE A 1 255 ? 101.450 -70.791  19.622  1.00 66.28  ? 179  PHE A CG  1 
ATOM   1827 C CD1 . PHE A 1 255 ? 101.378 -72.169  19.803  1.00 68.74  ? 179  PHE A CD1 1 
ATOM   1828 C CD2 . PHE A 1 255 ? 100.865 -69.967  20.576  1.00 69.68  ? 179  PHE A CD2 1 
ATOM   1829 C CE1 . PHE A 1 255 ? 100.746 -72.709  20.924  1.00 71.06  ? 179  PHE A CE1 1 
ATOM   1830 C CE2 . PHE A 1 255 ? 100.216 -70.509  21.686  1.00 74.16  ? 179  PHE A CE2 1 
ATOM   1831 C CZ  . PHE A 1 255 ? 100.169 -71.876  21.857  1.00 71.95  ? 179  PHE A CZ  1 
ATOM   1832 N N   . TYR A 1 256 ? 100.043 -68.069  17.271  1.00 62.83  ? 180  TYR A N   1 
ATOM   1833 C CA  . TYR A 1 256 ? 98.909  -67.206  17.546  1.00 64.29  ? 180  TYR A CA  1 
ATOM   1834 C C   . TYR A 1 256 ? 97.816  -67.319  16.474  1.00 66.18  ? 180  TYR A C   1 
ATOM   1835 O O   . TYR A 1 256 ? 96.642  -67.304  16.838  1.00 66.83  ? 180  TYR A O   1 
ATOM   1836 C CB  . TYR A 1 256 ? 99.371  -65.744  17.699  1.00 67.76  ? 180  TYR A CB  1 
ATOM   1837 C CG  . TYR A 1 256 ? 98.270  -64.802  18.136  1.00 72.99  ? 180  TYR A CG  1 
ATOM   1838 C CD1 . TYR A 1 256 ? 97.851  -64.753  19.462  1.00 77.47  ? 180  TYR A CD1 1 
ATOM   1839 C CD2 . TYR A 1 256 ? 97.630  -63.974  17.219  1.00 74.11  ? 180  TYR A CD2 1 
ATOM   1840 C CE1 . TYR A 1 256 ? 96.810  -63.912  19.864  1.00 81.32  ? 180  TYR A CE1 1 
ATOM   1841 C CE2 . TYR A 1 256 ? 96.594  -63.123  17.609  1.00 77.04  ? 180  TYR A CE2 1 
ATOM   1842 C CZ  . TYR A 1 256 ? 96.186  -63.094  18.934  1.00 87.59  ? 180  TYR A CZ  1 
ATOM   1843 O OH  . TYR A 1 256 ? 95.162  -62.259  19.325  1.00 89.67  ? 180  TYR A OH  1 
ATOM   1844 N N   . PHE A 1 257 ? 98.181  -67.465  15.177  1.00 61.08  ? 181  PHE A N   1 
ATOM   1845 C CA  . PHE A 1 257 ? 97.195  -67.461  14.090  1.00 60.30  ? 181  PHE A CA  1 
ATOM   1846 C C   . PHE A 1 257 ? 96.815  -68.836  13.456  1.00 63.72  ? 181  PHE A C   1 
ATOM   1847 O O   . PHE A 1 257 ? 95.684  -68.913  12.966  1.00 63.58  ? 181  PHE A O   1 
ATOM   1848 C CB  . PHE A 1 257 ? 97.643  -66.510  12.965  1.00 61.05  ? 181  PHE A CB  1 
ATOM   1849 C CG  . PHE A 1 257 ? 97.674  -65.049  13.365  1.00 63.13  ? 181  PHE A CG  1 
ATOM   1850 C CD1 . PHE A 1 257 ? 96.497  -64.329  13.526  1.00 66.80  ? 181  PHE A CD1 1 
ATOM   1851 C CD2 . PHE A 1 257 ? 98.881  -64.392  13.569  1.00 64.79  ? 181  PHE A CD2 1 
ATOM   1852 C CE1 . PHE A 1 257 ? 96.529  -62.984  13.908  1.00 69.09  ? 181  PHE A CE1 1 
ATOM   1853 C CE2 . PHE A 1 257 ? 98.913  -63.048  13.954  1.00 68.71  ? 181  PHE A CE2 1 
ATOM   1854 C CZ  . PHE A 1 257 ? 97.737  -62.350  14.114  1.00 68.03  ? 181  PHE A CZ  1 
ATOM   1855 N N   . ARG A 1 258 ? 97.693  -69.881  13.431  1.00 59.86  ? 182  ARG A N   1 
ATOM   1856 C CA  . ARG A 1 258 ? 97.331  -71.182  12.797  1.00 59.88  ? 182  ARG A CA  1 
ATOM   1857 C C   . ARG A 1 258 ? 96.092  -71.825  13.433  1.00 66.74  ? 182  ARG A C   1 
ATOM   1858 O O   . ARG A 1 258 ? 96.078  -72.026  14.646  1.00 68.25  ? 182  ARG A O   1 
ATOM   1859 C CB  . ARG A 1 258 ? 98.478  -72.219  12.839  1.00 58.34  ? 182  ARG A CB  1 
ATOM   1860 C CG  . ARG A 1 258 ? 99.508  -72.104  11.731  1.00 62.05  ? 182  ARG A CG  1 
ATOM   1861 C CD  . ARG A 1 258 ? 99.089  -72.767  10.441  1.00 62.38  ? 182  ARG A CD  1 
ATOM   1862 N NE  . ARG A 1 258 ? 99.689  -72.083  9.296   1.00 62.11  ? 182  ARG A NE  1 
ATOM   1863 C CZ  . ARG A 1 258 ? 99.345  -72.289  8.030   1.00 78.85  ? 182  ARG A CZ  1 
ATOM   1864 N NH1 . ARG A 1 258 ? 98.417  -73.185  7.723   1.00 72.24  ? 182  ARG A NH1 1 
ATOM   1865 N NH2 . ARG A 1 258 ? 99.933  -71.604  7.058   1.00 65.55  ? 182  ARG A NH2 1 
ATOM   1866 N N   . ASP A 1 259 ? 95.051  -72.129  12.627  1.00 62.82  ? 183  ASP A N   1 
ATOM   1867 C CA  . ASP A 1 259 ? 93.834  -72.773  13.137  1.00 63.61  ? 183  ASP A CA  1 
ATOM   1868 C C   . ASP A 1 259 ? 93.039  -73.426  12.019  1.00 65.89  ? 183  ASP A C   1 
ATOM   1869 O O   . ASP A 1 259 ? 93.202  -73.064  10.856  1.00 63.76  ? 183  ASP A O   1 
ATOM   1870 C CB  . ASP A 1 259 ? 92.933  -71.797  13.921  1.00 67.34  ? 183  ASP A CB  1 
ATOM   1871 C CG  . ASP A 1 259 ? 92.120  -72.476  15.019  1.00 82.73  ? 183  ASP A CG  1 
ATOM   1872 O OD1 . ASP A 1 259 ? 92.549  -73.546  15.511  1.00 82.85  ? 183  ASP A OD1 1 
ATOM   1873 O OD2 . ASP A 1 259 ? 91.059  -71.945  15.379  1.00 92.19  ? 183  ASP A OD2 1 
ATOM   1874 N N   . VAL A 1 260 ? 92.186  -74.404  12.366  1.00 63.26  ? 184  VAL A N   1 
ATOM   1875 C CA  . VAL A 1 260 ? 91.359  -75.094  11.385  1.00 62.90  ? 184  VAL A CA  1 
ATOM   1876 C C   . VAL A 1 260 ? 90.129  -74.226  11.094  1.00 66.56  ? 184  VAL A C   1 
ATOM   1877 O O   . VAL A 1 260 ? 89.415  -73.837  12.015  1.00 66.54  ? 184  VAL A O   1 
ATOM   1878 C CB  . VAL A 1 260 ? 90.992  -76.530  11.822  1.00 67.32  ? 184  VAL A CB  1 
ATOM   1879 C CG1 . VAL A 1 260 ? 89.894  -77.114  10.944  1.00 67.96  ? 184  VAL A CG1 1 
ATOM   1880 C CG2 . VAL A 1 260 ? 92.222  -77.429  11.793  1.00 66.24  ? 184  VAL A CG2 1 
ATOM   1881 N N   . ARG A 1 261 ? 89.927  -73.885  9.809   1.00 62.52  ? 185  ARG A N   1 
ATOM   1882 C CA  . ARG A 1 261 ? 88.789  -73.093  9.351   1.00 63.25  ? 185  ARG A CA  1 
ATOM   1883 C C   . ARG A 1 261 ? 88.077  -73.829  8.231   1.00 69.63  ? 185  ARG A C   1 
ATOM   1884 O O   . ARG A 1 261 ? 88.725  -74.483  7.415   1.00 69.05  ? 185  ARG A O   1 
ATOM   1885 C CB  . ARG A 1 261 ? 89.208  -71.687  8.895   1.00 61.13  ? 185  ARG A CB  1 
ATOM   1886 C CG  . ARG A 1 261 ? 89.656  -70.777  10.031  1.00 70.50  ? 185  ARG A CG  1 
ATOM   1887 C CD  . ARG A 1 261 ? 88.528  -70.290  10.934  1.00 75.43  ? 185  ARG A CD  1 
ATOM   1888 N NE  . ARG A 1 261 ? 89.049  -69.579  12.106  1.00 77.48  ? 185  ARG A NE  1 
ATOM   1889 C CZ  . ARG A 1 261 ? 89.303  -70.153  13.278  1.00 85.01  ? 185  ARG A CZ  1 
ATOM   1890 N NH1 . ARG A 1 261 ? 89.069  -71.446  13.455  1.00 76.11  ? 185  ARG A NH1 1 
ATOM   1891 N NH2 . ARG A 1 261 ? 89.785  -69.436  14.285  1.00 59.14  ? 185  ARG A NH2 1 
ATOM   1892 N N   . THR A 1 262 ? 86.745  -73.744  8.214   1.00 68.96  ? 186  THR A N   1 
ATOM   1893 C CA  . THR A 1 262 ? 85.914  -74.412  7.222   1.00 70.76  ? 186  THR A CA  1 
ATOM   1894 C C   . THR A 1 262 ? 85.863  -73.599  5.926   1.00 76.10  ? 186  THR A C   1 
ATOM   1895 O O   . THR A 1 262 ? 85.584  -72.397  5.962   1.00 76.68  ? 186  THR A O   1 
ATOM   1896 C CB  . THR A 1 262 ? 84.495  -74.625  7.774   1.00 84.35  ? 186  THR A CB  1 
ATOM   1897 O OG1 . THR A 1 262 ? 83.962  -73.348  8.128   1.00 90.74  ? 186  THR A OG1 1 
ATOM   1898 C CG2 . THR A 1 262 ? 84.456  -75.538  8.994   1.00 82.40  ? 186  THR A CG2 1 
ATOM   1899 N N   . ILE A 1 263 ? 86.124  -74.251  4.791   1.00 72.90  ? 187  ILE A N   1 
ATOM   1900 C CA  . ILE A 1 263 ? 86.048  -73.623  3.480   1.00 73.16  ? 187  ILE A CA  1 
ATOM   1901 C C   . ILE A 1 263 ? 84.798  -74.230  2.828   1.00 80.14  ? 187  ILE A C   1 
ATOM   1902 O O   . ILE A 1 263 ? 84.850  -75.341  2.291   1.00 79.47  ? 187  ILE A O   1 
ATOM   1903 C CB  . ILE A 1 263 ? 87.389  -73.803  2.704   1.00 74.80  ? 187  ILE A CB  1 
ATOM   1904 C CG1 . ILE A 1 263 ? 88.456  -72.818  3.231   1.00 73.50  ? 187  ILE A CG1 1 
ATOM   1905 C CG2 . ILE A 1 263 ? 87.232  -73.616  1.195   1.00 76.81  ? 187  ILE A CG2 1 
ATOM   1906 C CD1 . ILE A 1 263 ? 89.304  -73.313  4.318   1.00 78.84  ? 187  ILE A CD1 1 
ATOM   1907 N N   . GLU A 1 264 ? 83.648  -73.523  2.978   1.00 79.88  ? 188  GLU A N   1 
ATOM   1908 C CA  . GLU A 1 264 ? 82.306  -73.926  2.514   1.00 82.51  ? 188  GLU A CA  1 
ATOM   1909 C C   . GLU A 1 264 ? 82.246  -74.196  1.012   1.00 88.11  ? 188  GLU A C   1 
ATOM   1910 O O   . GLU A 1 264 ? 81.470  -75.050  0.595   1.00 89.13  ? 188  GLU A O   1 
ATOM   1911 C CB  . GLU A 1 264 ? 81.263  -72.853  2.889   1.00 85.07  ? 188  GLU A CB  1 
ATOM   1912 N N   . TYR A 1 265 ? 83.086  -73.498  0.211   1.00 84.51  ? 189  TYR A N   1 
ATOM   1913 C CA  . TYR A 1 265 ? 83.203  -73.653  -1.243  1.00 85.23  ? 189  TYR A CA  1 
ATOM   1914 C C   . TYR A 1 265 ? 83.619  -75.070  -1.637  1.00 90.69  ? 189  TYR A C   1 
ATOM   1915 O O   . TYR A 1 265 ? 83.076  -75.621  -2.612  1.00 91.73  ? 189  TYR A O   1 
ATOM   1916 C CB  . TYR A 1 265 ? 84.229  -72.640  -1.807  1.00 84.79  ? 189  TYR A CB  1 
ATOM   1917 N N   . LEU A 1 266 ? 84.553  -75.680  -0.872  1.00 86.47  ? 190  LEU A N   1 
ATOM   1918 C CA  . LEU A 1 266 ? 85.094  -77.025  -1.105  1.00 86.15  ? 190  LEU A CA  1 
ATOM   1919 C C   . LEU A 1 266 ? 84.605  -78.096  -0.092  1.00 89.32  ? 190  LEU A C   1 
ATOM   1920 O O   . LEU A 1 266 ? 84.872  -79.277  -0.311  1.00 88.26  ? 190  LEU A O   1 
ATOM   1921 C CB  . LEU A 1 266 ? 86.628  -76.963  -1.107  1.00 84.21  ? 190  LEU A CB  1 
ATOM   1922 C CG  . LEU A 1 266 ? 87.305  -76.233  -2.267  1.00 88.73  ? 190  LEU A CG  1 
ATOM   1923 C CD1 . LEU A 1 266 ? 88.624  -75.662  -1.848  1.00 86.58  ? 190  LEU A CD1 1 
ATOM   1924 C CD2 . LEU A 1 266 ? 87.509  -77.143  -3.469  1.00 93.45  ? 190  LEU A CD2 1 
ATOM   1925 N N   . GLY A 1 267 ? 83.909  -77.663  0.973   1.00 85.86  ? 191  GLY A N   1 
ATOM   1926 C CA  . GLY A 1 267 ? 83.408  -78.528  2.048   1.00 85.56  ? 191  GLY A CA  1 
ATOM   1927 C C   . GLY A 1 267 ? 84.556  -79.215  2.753   1.00 85.45  ? 191  GLY A C   1 
ATOM   1928 O O   . GLY A 1 267 ? 84.511  -80.417  3.022   1.00 85.88  ? 191  GLY A O   1 
ATOM   1929 N N   . VAL A 1 268 ? 85.614  -78.426  2.998   1.00 78.74  ? 192  VAL A N   1 
ATOM   1930 C CA  . VAL A 1 268 ? 86.892  -78.875  3.524   1.00 76.27  ? 192  VAL A CA  1 
ATOM   1931 C C   . VAL A 1 268 ? 87.370  -77.941  4.632   1.00 78.50  ? 192  VAL A C   1 
ATOM   1932 O O   . VAL A 1 268 ? 87.416  -76.715  4.480   1.00 77.95  ? 192  VAL A O   1 
ATOM   1933 C CB  . VAL A 1 268 ? 87.897  -79.002  2.338   1.00 78.24  ? 192  VAL A CB  1 
ATOM   1934 C CG1 . VAL A 1 268 ? 89.284  -78.485  2.667   1.00 75.82  ? 192  VAL A CG1 1 
ATOM   1935 C CG2 . VAL A 1 268 ? 87.942  -80.426  1.814   1.00 78.69  ? 192  VAL A CG2 1 
ATOM   1936 N N   . ASN A 1 269 ? 87.699  -78.564  5.762   1.00 73.99  ? 193  ASN A N   1 
ATOM   1937 C CA  . ASN A 1 269 ? 88.249  -77.953  6.965   1.00 72.37  ? 193  ASN A CA  1 
ATOM   1938 C C   . ASN A 1 269 ? 89.729  -77.878  6.760   1.00 72.73  ? 193  ASN A C   1 
ATOM   1939 O O   . ASN A 1 269 ? 90.376  -78.919  6.696   1.00 71.59  ? 193  ASN A O   1 
ATOM   1940 C CB  . ASN A 1 269 ? 87.906  -78.813  8.194   1.00 75.79  ? 193  ASN A CB  1 
ATOM   1941 C CG  . ASN A 1 269 ? 86.501  -78.713  8.713   1.00 105.99 ? 193  ASN A CG  1 
ATOM   1942 O OD1 . ASN A 1 269 ? 85.604  -78.138  8.089   1.00 105.17 ? 193  ASN A OD1 1 
ATOM   1943 N ND2 . ASN A 1 269 ? 86.272  -79.330  9.859   1.00 96.80  ? 193  ASN A ND2 1 
ATOM   1944 N N   . ALA A 1 270 ? 90.280  -76.672  6.599   1.00 67.43  ? 194  ALA A N   1 
ATOM   1945 C CA  . ALA A 1 270 ? 91.709  -76.535  6.337   1.00 65.48  ? 194  ALA A CA  1 
ATOM   1946 C C   . ALA A 1 270 ? 92.457  -75.847  7.462   1.00 69.47  ? 194  ALA A C   1 
ATOM   1947 O O   . ALA A 1 270 ? 91.908  -74.961  8.120   1.00 69.65  ? 194  ALA A O   1 
ATOM   1948 C CB  . ALA A 1 270 ? 91.929  -75.781  5.040   1.00 65.64  ? 194  ALA A CB  1 
ATOM   1949 N N   . CYS A 1 271 ? 93.721  -76.278  7.674   1.00 65.05  ? 195  CYS A N   1 
ATOM   1950 C CA  . CYS A 1 271 ? 94.676  -75.745  8.638   1.00 64.06  ? 195  CYS A CA  1 
ATOM   1951 C C   . CYS A 1 271 ? 95.318  -74.536  7.969   1.00 63.89  ? 195  CYS A C   1 
ATOM   1952 O O   . CYS A 1 271 ? 96.143  -74.702  7.065   1.00 62.88  ? 195  CYS A O   1 
ATOM   1953 C CB  . CYS A 1 271 ? 95.697  -76.823  9.015   1.00 65.04  ? 195  CYS A CB  1 
ATOM   1954 S SG  . CYS A 1 271 ? 96.965  -76.298  10.210  1.00 69.30  ? 195  CYS A SG  1 
ATOM   1955 N N   . ILE A 1 272 ? 94.857  -73.322  8.330   1.00 58.73  ? 196  ILE A N   1 
ATOM   1956 C CA  . ILE A 1 272 ? 95.304  -72.063  7.713   1.00 57.47  ? 196  ILE A CA  1 
ATOM   1957 C C   . ILE A 1 272 ? 95.634  -70.982  8.752   1.00 60.37  ? 196  ILE A C   1 
ATOM   1958 O O   . ILE A 1 272 ? 95.228  -71.092  9.910   1.00 61.79  ? 196  ILE A O   1 
ATOM   1959 C CB  . ILE A 1 272 ? 94.242  -71.533  6.699   1.00 61.36  ? 196  ILE A CB  1 
ATOM   1960 C CG1 . ILE A 1 272 ? 92.828  -71.403  7.312   1.00 62.58  ? 196  ILE A CG1 1 
ATOM   1961 C CG2 . ILE A 1 272 ? 94.212  -72.360  5.419   1.00 62.94  ? 196  ILE A CG2 1 
ATOM   1962 C CD1 . ILE A 1 272 ? 92.431  -69.985  7.616   1.00 68.14  ? 196  ILE A CD1 1 
ATOM   1963 N N   . MET A 1 273 ? 96.356  -69.929  8.329   1.00 54.66  ? 197  MET A N   1 
ATOM   1964 C CA  . MET A 1 273 ? 96.661  -68.784  9.184   1.00 53.89  ? 197  MET A CA  1 
ATOM   1965 C C   . MET A 1 273 ? 95.386  -67.957  9.258   1.00 57.55  ? 197  MET A C   1 
ATOM   1966 O O   . MET A 1 273 ? 94.969  -67.358  8.264   1.00 55.86  ? 197  MET A O   1 
ATOM   1967 C CB  . MET A 1 273 ? 97.869  -67.974  8.653   1.00 55.53  ? 197  MET A CB  1 
ATOM   1968 C CG  . MET A 1 273 ? 99.227  -68.644  8.881   1.00 57.94  ? 197  MET A CG  1 
ATOM   1969 S SD  . MET A 1 273 ? 99.839  -68.540  10.590  1.00 62.62  ? 197  MET A SD  1 
ATOM   1970 C CE  . MET A 1 273 ? 100.794 -67.023  10.533  1.00 59.43  ? 197  MET A CE  1 
ATOM   1971 N N   . ALA A 1 274 ? 94.708  -68.034  10.408  1.00 56.61  ? 198  ALA A N   1 
ATOM   1972 C CA  . ALA A 1 274 ? 93.433  -67.365  10.663  1.00 58.67  ? 198  ALA A CA  1 
ATOM   1973 C C   . ALA A 1 274 ? 93.630  -65.892  11.105  1.00 66.26  ? 198  ALA A C   1 
ATOM   1974 O O   . ALA A 1 274 ? 93.373  -65.538  12.265  1.00 66.93  ? 198  ALA A O   1 
ATOM   1975 C CB  . ALA A 1 274 ? 92.644  -68.148  11.708  1.00 60.16  ? 198  ALA A CB  1 
ATOM   1976 N N   . PHE A 1 275 ? 94.078  -65.029  10.161  1.00 64.64  ? 199  PHE A N   1 
ATOM   1977 C CA  . PHE A 1 275 ? 94.295  -63.590  10.401  1.00 66.31  ? 199  PHE A CA  1 
ATOM   1978 C C   . PHE A 1 275 ? 92.965  -62.861  10.606  1.00 74.72  ? 199  PHE A C   1 
ATOM   1979 O O   . PHE A 1 275 ? 91.961  -63.304  10.030  1.00 74.87  ? 199  PHE A O   1 
ATOM   1980 C CB  . PHE A 1 275 ? 95.056  -62.937  9.234   1.00 67.43  ? 199  PHE A CB  1 
ATOM   1981 C CG  . PHE A 1 275 ? 96.433  -63.470  8.955   1.00 67.27  ? 199  PHE A CG  1 
ATOM   1982 C CD1 . PHE A 1 275 ? 97.428  -63.407  9.922   1.00 70.02  ? 199  PHE A CD1 1 
ATOM   1983 C CD2 . PHE A 1 275 ? 96.758  -63.968  7.703   1.00 68.26  ? 199  PHE A CD2 1 
ATOM   1984 C CE1 . PHE A 1 275 ? 98.705  -63.885  9.658   1.00 70.03  ? 199  PHE A CE1 1 
ATOM   1985 C CE2 . PHE A 1 275 ? 98.037  -64.446  7.436   1.00 69.99  ? 199  PHE A CE2 1 
ATOM   1986 C CZ  . PHE A 1 275 ? 99.002  -64.403  8.416   1.00 68.35  ? 199  PHE A CZ  1 
ATOM   1987 N N   . PRO A 1 276 ? 92.910  -61.738  11.379  1.00 74.81  ? 200  PRO A N   1 
ATOM   1988 C CA  . PRO A 1 276 ? 91.621  -61.029  11.539  1.00 76.59  ? 200  PRO A CA  1 
ATOM   1989 C C   . PRO A 1 276 ? 91.115  -60.525  10.182  1.00 81.83  ? 200  PRO A C   1 
ATOM   1990 O O   . PRO A 1 276 ? 91.902  -59.927  9.433   1.00 81.57  ? 200  PRO A O   1 
ATOM   1991 C CB  . PRO A 1 276 ? 91.937  -59.897  12.523  1.00 79.66  ? 200  PRO A CB  1 
ATOM   1992 C CG  . PRO A 1 276 ? 93.400  -59.711  12.457  1.00 83.09  ? 200  PRO A CG  1 
ATOM   1993 C CD  . PRO A 1 276 ? 93.991  -61.061  12.128  1.00 76.96  ? 200  PRO A CD  1 
ATOM   1994 N N   . PRO A 1 277 ? 89.912  -60.987  9.748   1.00 78.88  ? 201  PRO A N   1 
ATOM   1995 C CA  . PRO A 1 277 ? 89.415  -60.629  8.406   1.00 79.00  ? 201  PRO A CA  1 
ATOM   1996 C C   . PRO A 1 277 ? 89.228  -59.126  8.219   1.00 85.50  ? 201  PRO A C   1 
ATOM   1997 O O   . PRO A 1 277 ? 89.043  -58.677  7.083   1.00 86.27  ? 201  PRO A O   1 
ATOM   1998 C CB  . PRO A 1 277 ? 88.085  -61.379  8.316   1.00 81.24  ? 201  PRO A CB  1 
ATOM   1999 C CG  . PRO A 1 277 ? 88.202  -62.485  9.327   1.00 85.14  ? 201  PRO A CG  1 
ATOM   2000 C CD  . PRO A 1 277 ? 88.930  -61.826  10.458  1.00 80.91  ? 201  PRO A CD  1 
ATOM   2001 N N   . GLU A 1 278 ? 89.318  -58.354  9.330   1.00 82.79  ? 202  GLU A N   1 
ATOM   2002 C CA  . GLU A 1 278 ? 89.258  -56.894  9.367   1.00 84.01  ? 202  GLU A CA  1 
ATOM   2003 C C   . GLU A 1 278 ? 90.362  -56.293  8.459   1.00 87.70  ? 202  GLU A C   1 
ATOM   2004 O O   . GLU A 1 278 ? 90.060  -55.390  7.676   1.00 89.92  ? 202  GLU A O   1 
ATOM   2005 C CB  . GLU A 1 278 ? 89.394  -56.397  10.816  1.00 86.36  ? 202  GLU A CB  1 
ATOM   2006 N N   . LYS A 1 279 ? 91.616  -56.831  8.534   1.00 80.72  ? 203  LYS A N   1 
ATOM   2007 C CA  . LYS A 1 279 ? 92.783  -56.447  7.715   1.00 78.86  ? 203  LYS A CA  1 
ATOM   2008 C C   . LYS A 1 279 ? 93.594  -57.730  7.364   1.00 79.74  ? 203  LYS A C   1 
ATOM   2009 O O   . LYS A 1 279 ? 94.763  -57.866  7.742   1.00 78.54  ? 203  LYS A O   1 
ATOM   2010 C CB  . LYS A 1 279 ? 93.644  -55.383  8.430   1.00 81.29  ? 203  LYS A CB  1 
ATOM   2011 N N   . TYR A 1 280 ? 92.935  -58.675  6.647   1.00 74.58  ? 204  TYR A N   1 
ATOM   2012 C CA  . TYR A 1 280 ? 93.457  -59.989  6.256   1.00 72.27  ? 204  TYR A CA  1 
ATOM   2013 C C   . TYR A 1 280 ? 94.542  -59.879  5.180   1.00 76.00  ? 204  TYR A C   1 
ATOM   2014 O O   . TYR A 1 280 ? 95.544  -60.602  5.251   1.00 74.70  ? 204  TYR A O   1 
ATOM   2015 C CB  . TYR A 1 280 ? 92.311  -60.897  5.762   1.00 73.20  ? 204  TYR A CB  1 
ATOM   2016 C CG  . TYR A 1 280 ? 92.681  -62.361  5.652   1.00 73.22  ? 204  TYR A CG  1 
ATOM   2017 C CD1 . TYR A 1 280 ? 92.466  -63.237  6.712   1.00 74.87  ? 204  TYR A CD1 1 
ATOM   2018 C CD2 . TYR A 1 280 ? 93.225  -62.877  4.479   1.00 73.23  ? 204  TYR A CD2 1 
ATOM   2019 C CE1 . TYR A 1 280 ? 92.836  -64.580  6.630   1.00 74.44  ? 204  TYR A CE1 1 
ATOM   2020 C CE2 . TYR A 1 280 ? 93.592  -64.220  4.380   1.00 73.05  ? 204  TYR A CE2 1 
ATOM   2021 C CZ  . TYR A 1 280 ? 93.392  -65.069  5.460   1.00 79.05  ? 204  TYR A CZ  1 
ATOM   2022 O OH  . TYR A 1 280 ? 93.743  -66.392  5.370   1.00 75.87  ? 204  TYR A OH  1 
ATOM   2023 N N   . ALA A 1 281 ? 94.330  -59.004  4.174   1.00 72.91  ? 205  ALA A N   1 
ATOM   2024 C CA  . ALA A 1 281 ? 95.270  -58.784  3.070   1.00 71.95  ? 205  ALA A CA  1 
ATOM   2025 C C   . ALA A 1 281 ? 96.576  -58.171  3.572   1.00 73.76  ? 205  ALA A C   1 
ATOM   2026 O O   . ALA A 1 281 ? 97.652  -58.584  3.135   1.00 72.75  ? 205  ALA A O   1 
ATOM   2027 C CB  . ALA A 1 281 ? 94.642  -57.885  2.011   1.00 74.28  ? 205  ALA A CB  1 
ATOM   2028 N N   . GLN A 1 282 ? 96.470  -57.201  4.506   1.00 69.75  ? 206  GLN A N   1 
ATOM   2029 C CA  . GLN A 1 282 ? 97.577  -56.484  5.149   1.00 69.19  ? 206  GLN A CA  1 
ATOM   2030 C C   . GLN A 1 282 ? 98.468  -57.481  5.914   1.00 67.26  ? 206  GLN A C   1 
ATOM   2031 O O   . GLN A 1 282 ? 99.694  -57.420  5.797   1.00 65.83  ? 206  GLN A O   1 
ATOM   2032 C CB  . GLN A 1 282 ? 97.013  -55.375  6.083   1.00 73.01  ? 206  GLN A CB  1 
ATOM   2033 C CG  . GLN A 1 282 ? 98.044  -54.696  6.998   1.00 104.64 ? 206  GLN A CG  1 
ATOM   2034 C CD  . GLN A 1 282 ? 97.422  -53.787  8.037   1.00 135.23 ? 206  GLN A CD  1 
ATOM   2035 O OE1 . GLN A 1 282 ? 97.280  -54.148  9.215   1.00 130.92 ? 206  GLN A OE1 1 
ATOM   2036 N NE2 . GLN A 1 282 ? 97.082  -52.574  7.631   1.00 133.09 ? 206  GLN A NE2 1 
ATOM   2037 N N   . TRP A 1 283 ? 97.837  -58.394  6.681   1.00 60.27  ? 207  TRP A N   1 
ATOM   2038 C CA  . TRP A 1 283 ? 98.507  -59.400  7.495   1.00 57.46  ? 207  TRP A CA  1 
ATOM   2039 C C   . TRP A 1 283 ? 99.249  -60.429  6.650   1.00 57.96  ? 207  TRP A C   1 
ATOM   2040 O O   . TRP A 1 283 ? 100.361 -60.782  7.007   1.00 56.94  ? 207  TRP A O   1 
ATOM   2041 C CB  . TRP A 1 283 ? 97.504  -60.100  8.413   1.00 55.74  ? 207  TRP A CB  1 
ATOM   2042 C CG  . TRP A 1 283 ? 97.456  -59.512  9.789   1.00 57.52  ? 207  TRP A CG  1 
ATOM   2043 C CD1 . TRP A 1 283 ? 96.460  -58.748  10.324  1.00 61.79  ? 207  TRP A CD1 1 
ATOM   2044 C CD2 . TRP A 1 283 ? 98.470  -59.616  10.798  1.00 57.07  ? 207  TRP A CD2 1 
ATOM   2045 N NE1 . TRP A 1 283 ? 96.783  -58.382  11.612  1.00 61.88  ? 207  TRP A NE1 1 
ATOM   2046 C CE2 . TRP A 1 283 ? 98.010  -58.905  11.931  1.00 62.15  ? 207  TRP A CE2 1 
ATOM   2047 C CE3 . TRP A 1 283 ? 99.722  -60.260  10.862  1.00 56.89  ? 207  TRP A CE3 1 
ATOM   2048 C CZ2 . TRP A 1 283 ? 98.749  -58.829  13.119  1.00 61.94  ? 207  TRP A CZ2 1 
ATOM   2049 C CZ3 . TRP A 1 283 ? 100.452 -60.188  12.040  1.00 58.97  ? 207  TRP A CZ3 1 
ATOM   2050 C CH2 . TRP A 1 283 ? 99.967  -59.478  13.152  1.00 61.29  ? 207  TRP A CH2 1 
ATOM   2051 N N   . SER A 1 284 ? 98.653  -60.898  5.541   1.00 53.05  ? 208  SER A N   1 
ATOM   2052 C CA  . SER A 1 284 ? 99.266  -61.880  4.643   1.00 50.92  ? 208  SER A CA  1 
ATOM   2053 C C   . SER A 1 284 ? 100.511 -61.298  3.955   1.00 55.10  ? 208  SER A C   1 
ATOM   2054 O O   . SER A 1 284 ? 101.503 -62.008  3.799   1.00 53.75  ? 208  SER A O   1 
ATOM   2055 C CB  . SER A 1 284 ? 98.254  -62.363  3.609   1.00 53.64  ? 208  SER A CB  1 
ATOM   2056 O OG  . SER A 1 284 ? 97.145  -62.995  4.232   1.00 59.70  ? 208  SER A OG  1 
ATOM   2057 N N   . ALA A 1 285 ? 100.475 -59.997  3.590   1.00 53.62  ? 209  ALA A N   1 
ATOM   2058 C CA  . ALA A 1 285 ? 101.599 -59.283  2.966   1.00 53.90  ? 209  ALA A CA  1 
ATOM   2059 C C   . ALA A 1 285 ? 102.710 -59.009  3.995   1.00 58.84  ? 209  ALA A C   1 
ATOM   2060 O O   . ALA A 1 285 ? 103.884 -59.215  3.679   1.00 58.97  ? 209  ALA A O   1 
ATOM   2061 C CB  . ALA A 1 285 ? 101.124 -57.981  2.341   1.00 56.15  ? 209  ALA A CB  1 
ATOM   2062 N N   . GLY A 1 286 ? 102.326 -58.588  5.211   1.00 55.16  ? 210  GLY A N   1 
ATOM   2063 C CA  . GLY A 1 286 ? 103.237 -58.313  6.321   1.00 54.91  ? 210  GLY A CA  1 
ATOM   2064 C C   . GLY A 1 286 ? 103.988 -59.537  6.808   1.00 57.59  ? 210  GLY A C   1 
ATOM   2065 O O   . GLY A 1 286 ? 105.196 -59.463  7.055   1.00 56.50  ? 210  GLY A O   1 
ATOM   2066 N N   . ILE A 1 287 ? 103.280 -60.688  6.915   1.00 53.91  ? 211  ILE A N   1 
ATOM   2067 C CA  . ILE A 1 287 ? 103.837 -61.976  7.348   1.00 52.35  ? 211  ILE A CA  1 
ATOM   2068 C C   . ILE A 1 287 ? 104.712 -62.564  6.225   1.00 53.48  ? 211  ILE A C   1 
ATOM   2069 O O   . ILE A 1 287 ? 105.767 -63.116  6.539   1.00 52.50  ? 211  ILE A O   1 
ATOM   2070 C CB  . ILE A 1 287 ? 102.720 -62.947  7.843   1.00 55.24  ? 211  ILE A CB  1 
ATOM   2071 C CG1 . ILE A 1 287 ? 102.099 -62.491  9.197   1.00 57.16  ? 211  ILE A CG1 1 
ATOM   2072 C CG2 . ILE A 1 287 ? 103.132 -64.405  7.890   1.00 54.82  ? 211  ILE A CG2 1 
ATOM   2073 C CD1 . ILE A 1 287 ? 103.052 -62.270  10.435  1.00 68.27  ? 211  ILE A CD1 1 
ATOM   2074 N N   . ALA A 1 288 ? 104.321 -62.406  4.934   1.00 48.48  ? 212  ALA A N   1 
ATOM   2075 C CA  . ALA A 1 288 ? 105.142 -62.880  3.805   1.00 47.13  ? 212  ALA A CA  1 
ATOM   2076 C C   . ALA A 1 288 ? 106.525 -62.180  3.793   1.00 53.21  ? 212  ALA A C   1 
ATOM   2077 O O   . ALA A 1 288 ? 107.542 -62.835  3.555   1.00 51.72  ? 212  ALA A O   1 
ATOM   2078 C CB  . ALA A 1 288 ? 104.423 -62.652  2.486   1.00 47.65  ? 212  ALA A CB  1 
ATOM   2079 N N   . LEU A 1 289 ? 106.560 -60.873  4.112   1.00 52.13  ? 213  LEU A N   1 
ATOM   2080 C CA  . LEU A 1 289 ? 107.794 -60.094  4.180   1.00 54.00  ? 213  LEU A CA  1 
ATOM   2081 C C   . LEU A 1 289 ? 108.703 -60.552  5.360   1.00 59.65  ? 213  LEU A C   1 
ATOM   2082 O O   . LEU A 1 289 ? 109.924 -60.640  5.175   1.00 58.84  ? 213  LEU A O   1 
ATOM   2083 C CB  . LEU A 1 289 ? 107.459 -58.604  4.293   1.00 56.28  ? 213  LEU A CB  1 
ATOM   2084 C CG  . LEU A 1 289 ? 107.548 -57.749  3.003   1.00 62.49  ? 213  LEU A CG  1 
ATOM   2085 C CD1 . LEU A 1 289 ? 106.462 -58.103  1.992   1.00 61.41  ? 213  LEU A CD1 1 
ATOM   2086 C CD2 . LEU A 1 289 ? 107.420 -56.278  3.338   1.00 68.75  ? 213  LEU A CD2 1 
ATOM   2087 N N   . MET A 1 290 ? 108.110 -60.880  6.542   1.00 57.66  ? 214  MET A N   1 
ATOM   2088 C CA  . MET A 1 290 ? 108.819 -61.379  7.739   1.00 57.97  ? 214  MET A CA  1 
ATOM   2089 C C   . MET A 1 290 ? 109.486 -62.725  7.436   1.00 61.34  ? 214  MET A C   1 
ATOM   2090 O O   . MET A 1 290 ? 110.564 -63.022  7.961   1.00 62.36  ? 214  MET A O   1 
ATOM   2091 C CB  . MET A 1 290 ? 107.847 -61.516  8.935   1.00 61.03  ? 214  MET A CB  1 
ATOM   2092 C CG  . MET A 1 290 ? 108.380 -62.369  10.100  1.00 64.80  ? 214  MET A CG  1 
ATOM   2093 S SD  . MET A 1 290 ? 107.177 -62.603  11.419  1.00 70.07  ? 214  MET A SD  1 
ATOM   2094 C CE  . MET A 1 290 ? 107.963 -63.889  12.356  1.00 65.58  ? 214  MET A CE  1 
ATOM   2095 N N   . LYS A 1 291 ? 108.837 -63.536  6.586   1.00 55.33  ? 215  LYS A N   1 
ATOM   2096 C CA  . LYS A 1 291 ? 109.361 -64.832  6.169   1.00 52.70  ? 215  LYS A CA  1 
ATOM   2097 C C   . LYS A 1 291 ? 110.688 -64.667  5.404   1.00 56.16  ? 215  LYS A C   1 
ATOM   2098 O O   . LYS A 1 291 ? 111.587 -65.478  5.610   1.00 55.88  ? 215  LYS A O   1 
ATOM   2099 C CB  . LYS A 1 291 ? 108.346 -65.580  5.293   1.00 52.60  ? 215  LYS A CB  1 
ATOM   2100 C CG  . LYS A 1 291 ? 107.125 -66.073  6.018   1.00 58.29  ? 215  LYS A CG  1 
ATOM   2101 C CD  . LYS A 1 291 ? 106.231 -66.812  5.046   1.00 61.51  ? 215  LYS A CD  1 
ATOM   2102 C CE  . LYS A 1 291 ? 104.928 -67.182  5.677   1.00 59.55  ? 215  LYS A CE  1 
ATOM   2103 N NZ  . LYS A 1 291 ? 104.295 -68.292  4.936   1.00 69.04  ? 215  LYS A NZ  1 
ATOM   2104 N N   . ASN A 1 292 ? 110.800 -63.626  4.534   1.00 51.94  ? 216  ASN A N   1 
ATOM   2105 C CA  . ASN A 1 292 ? 111.973 -63.339  3.706   1.00 51.98  ? 216  ASN A CA  1 
ATOM   2106 C C   . ASN A 1 292 ? 113.134 -62.708  4.497   1.00 58.13  ? 216  ASN A C   1 
ATOM   2107 O O   . ASN A 1 292 ? 114.283 -63.098  4.300   1.00 56.34  ? 216  ASN A O   1 
ATOM   2108 C CB  . ASN A 1 292 ? 111.602 -62.410  2.540   1.00 52.02  ? 216  ASN A CB  1 
ATOM   2109 C CG  . ASN A 1 292 ? 110.597 -62.943  1.541   1.00 69.93  ? 216  ASN A CG  1 
ATOM   2110 O OD1 . ASN A 1 292 ? 109.725 -62.211  1.058   1.00 61.84  ? 216  ASN A OD1 1 
ATOM   2111 N ND2 . ASN A 1 292 ? 110.723 -64.206  1.161   1.00 63.62  ? 216  ASN A ND2 1 
ATOM   2112 N N   . ILE A 1 293 ? 112.841 -61.714  5.351   1.00 57.67  ? 217  ILE A N   1 
ATOM   2113 C CA  . ILE A 1 293 ? 113.849 -61.001  6.137   1.00 59.25  ? 217  ILE A CA  1 
ATOM   2114 C C   . ILE A 1 293 ? 114.517 -61.953  7.156   1.00 64.31  ? 217  ILE A C   1 
ATOM   2115 O O   . ILE A 1 293 ? 115.737 -62.103  7.131   1.00 64.29  ? 217  ILE A O   1 
ATOM   2116 C CB  . ILE A 1 293 ? 113.227 -59.743  6.821   1.00 64.16  ? 217  ILE A CB  1 
ATOM   2117 C CG1 . ILE A 1 293 ? 112.567 -58.761  5.808   1.00 65.82  ? 217  ILE A CG1 1 
ATOM   2118 C CG2 . ILE A 1 293 ? 114.223 -59.015  7.725   1.00 66.72  ? 217  ILE A CG2 1 
ATOM   2119 C CD1 . ILE A 1 293 ? 113.431 -58.297  4.536   1.00 77.87  ? 217  ILE A CD1 1 
ATOM   2120 N N   . LEU A 1 294 ? 113.720 -62.593  8.026   1.00 61.67  ? 218  LEU A N   1 
ATOM   2121 C CA  . LEU A 1 294 ? 114.203 -63.480  9.086   1.00 61.88  ? 218  LEU A CA  1 
ATOM   2122 C C   . LEU A 1 294 ? 114.713 -64.828  8.593   1.00 63.98  ? 218  LEU A C   1 
ATOM   2123 O O   . LEU A 1 294 ? 115.587 -65.418  9.232   1.00 63.78  ? 218  LEU A O   1 
ATOM   2124 C CB  . LEU A 1 294 ? 113.085 -63.733  10.115  1.00 62.51  ? 218  LEU A CB  1 
ATOM   2125 C CG  . LEU A 1 294 ? 113.002 -62.766  11.288  1.00 69.74  ? 218  LEU A CG  1 
ATOM   2126 C CD1 . LEU A 1 294 ? 111.670 -62.900  11.993  1.00 69.61  ? 218  LEU A CD1 1 
ATOM   2127 C CD2 . LEU A 1 294 ? 114.159 -62.988  12.278  1.00 74.47  ? 218  LEU A CD2 1 
ATOM   2128 N N   . GLY A 1 295 ? 114.128 -65.333  7.513   1.00 58.45  ? 219  GLY A N   1 
ATOM   2129 C CA  . GLY A 1 295 ? 114.463 -66.647  6.977   1.00 55.38  ? 219  GLY A CA  1 
ATOM   2130 C C   . GLY A 1 295 ? 115.407 -66.691  5.796   1.00 54.57  ? 219  GLY A C   1 
ATOM   2131 O O   . GLY A 1 295 ? 115.871 -67.783  5.458   1.00 54.60  ? 219  GLY A O   1 
ATOM   2132 N N   . PHE A 1 296 ? 115.692 -65.543  5.142   1.00 47.59  ? 220  PHE A N   1 
ATOM   2133 C CA  . PHE A 1 296 ? 116.584 -65.560  3.986   1.00 46.54  ? 220  PHE A CA  1 
ATOM   2134 C C   . PHE A 1 296 ? 117.554 -64.367  3.932   1.00 54.07  ? 220  PHE A C   1 
ATOM   2135 O O   . PHE A 1 296 ? 118.756 -64.602  3.815   1.00 54.86  ? 220  PHE A O   1 
ATOM   2136 C CB  . PHE A 1 296 ? 115.792 -65.648  2.669   1.00 46.93  ? 220  PHE A CB  1 
ATOM   2137 C CG  . PHE A 1 296 ? 116.622 -66.001  1.451   1.00 48.05  ? 220  PHE A CG  1 
ATOM   2138 C CD1 . PHE A 1 296 ? 117.006 -67.317  1.206   1.00 50.55  ? 220  PHE A CD1 1 
ATOM   2139 C CD2 . PHE A 1 296 ? 116.990 -65.026  0.533   1.00 50.70  ? 220  PHE A CD2 1 
ATOM   2140 C CE1 . PHE A 1 296 ? 117.761 -67.645  0.076   1.00 51.45  ? 220  PHE A CE1 1 
ATOM   2141 C CE2 . PHE A 1 296 ? 117.742 -65.356  -0.598  1.00 53.96  ? 220  PHE A CE2 1 
ATOM   2142 C CZ  . PHE A 1 296 ? 118.124 -66.664  -0.817  1.00 51.49  ? 220  PHE A CZ  1 
ATOM   2143 N N   . ILE A 1 297 ? 117.054 -63.115  3.997   1.00 51.07  ? 221  ILE A N   1 
ATOM   2144 C CA  . ILE A 1 297 ? 117.865 -61.904  3.878   1.00 52.19  ? 221  ILE A CA  1 
ATOM   2145 C C   . ILE A 1 297 ? 118.950 -61.874  4.960   1.00 57.77  ? 221  ILE A C   1 
ATOM   2146 O O   . ILE A 1 297 ? 120.131 -61.953  4.610   1.00 58.17  ? 221  ILE A O   1 
ATOM   2147 C CB  . ILE A 1 297 ? 116.988 -60.603  3.877   1.00 56.89  ? 221  ILE A CB  1 
ATOM   2148 C CG1 . ILE A 1 297 ? 115.928 -60.591  2.732   1.00 57.67  ? 221  ILE A CG1 1 
ATOM   2149 C CG2 . ILE A 1 297 ? 117.828 -59.311  3.879   1.00 58.61  ? 221  ILE A CG2 1 
ATOM   2150 C CD1 . ILE A 1 297 ? 116.445 -60.924  1.272   1.00 71.89  ? 221  ILE A CD1 1 
ATOM   2151 N N   . ILE A 1 298 ? 118.562 -61.760  6.252   1.00 55.29  ? 222  ILE A N   1 
ATOM   2152 C CA  . ILE A 1 298 ? 119.505 -61.676  7.376   1.00 56.37  ? 222  ILE A CA  1 
ATOM   2153 C C   . ILE A 1 298 ? 120.418 -62.912  7.383   1.00 60.56  ? 222  ILE A C   1 
ATOM   2154 O O   . ILE A 1 298 ? 121.637 -62.719  7.382   1.00 62.41  ? 222  ILE A O   1 
ATOM   2155 C CB  . ILE A 1 298 ? 118.815 -61.424  8.748   1.00 59.78  ? 222  ILE A CB  1 
ATOM   2156 C CG1 . ILE A 1 298 ? 118.258 -59.982  8.817   1.00 60.88  ? 222  ILE A CG1 1 
ATOM   2157 C CG2 . ILE A 1 298 ? 119.789 -61.695  9.911   1.00 61.50  ? 222  ILE A CG2 1 
ATOM   2158 C CD1 . ILE A 1 298 ? 117.230 -59.747  9.900   1.00 62.81  ? 222  ILE A CD1 1 
ATOM   2159 N N   . PRO A 1 299 ? 119.907 -64.164  7.306   1.00 54.96  ? 223  PRO A N   1 
ATOM   2160 C CA  . PRO A 1 299 ? 120.828 -65.307  7.272   1.00 54.05  ? 223  PRO A CA  1 
ATOM   2161 C C   . PRO A 1 299 ? 121.832 -65.224  6.107   1.00 57.67  ? 223  PRO A C   1 
ATOM   2162 O O   . PRO A 1 299 ? 123.033 -65.301  6.368   1.00 58.05  ? 223  PRO A O   1 
ATOM   2163 C CB  . PRO A 1 299 ? 119.887 -66.509  7.138   1.00 54.25  ? 223  PRO A CB  1 
ATOM   2164 C CG  . PRO A 1 299 ? 118.601 -66.043  7.715   1.00 58.60  ? 223  PRO A CG  1 
ATOM   2165 C CD  . PRO A 1 299 ? 118.500 -64.623  7.295   1.00 55.51  ? 223  PRO A CD  1 
ATOM   2166 N N   . LEU A 1 300 ? 121.363 -64.961  4.858   1.00 52.96  ? 224  LEU A N   1 
ATOM   2167 C CA  . LEU A 1 300 ? 122.215 -64.857  3.661   1.00 52.06  ? 224  LEU A CA  1 
ATOM   2168 C C   . LEU A 1 300 ? 123.286 -63.787  3.787   1.00 57.55  ? 224  LEU A C   1 
ATOM   2169 O O   . LEU A 1 300 ? 124.362 -63.982  3.230   1.00 57.76  ? 224  LEU A O   1 
ATOM   2170 C CB  . LEU A 1 300 ? 121.404 -64.615  2.374   1.00 51.10  ? 224  LEU A CB  1 
ATOM   2171 C CG  . LEU A 1 300 ? 121.983 -65.176  1.062   1.00 54.99  ? 224  LEU A CG  1 
ATOM   2172 C CD1 . LEU A 1 300 ? 122.659 -64.090  0.245   1.00 56.22  ? 224  LEU A CD1 1 
ATOM   2173 C CD2 . LEU A 1 300 ? 122.892 -66.420  1.280   1.00 55.66  ? 224  LEU A CD2 1 
ATOM   2174 N N   . ILE A 1 301 ? 123.006 -62.671  4.495   1.00 55.78  ? 225  ILE A N   1 
ATOM   2175 C CA  . ILE A 1 301 ? 123.983 -61.598  4.726   1.00 57.91  ? 225  ILE A CA  1 
ATOM   2176 C C   . ILE A 1 301 ? 125.206 -62.219  5.417   1.00 62.75  ? 225  ILE A C   1 
ATOM   2177 O O   . ILE A 1 301 ? 126.322 -62.095  4.903   1.00 63.33  ? 225  ILE A O   1 
ATOM   2178 C CB  . ILE A 1 301 ? 123.358 -60.415  5.539   1.00 62.59  ? 225  ILE A CB  1 
ATOM   2179 C CG1 . ILE A 1 301 ? 122.487 -59.519  4.628   1.00 63.75  ? 225  ILE A CG1 1 
ATOM   2180 C CG2 . ILE A 1 301 ? 124.421 -59.581  6.278   1.00 65.04  ? 225  ILE A CG2 1 
ATOM   2181 C CD1 . ILE A 1 301 ? 121.499 -58.552  5.360   1.00 67.89  ? 225  ILE A CD1 1 
ATOM   2182 N N   . PHE A 1 302 ? 124.963 -62.961  6.529   1.00 58.63  ? 226  PHE A N   1 
ATOM   2183 C CA  . PHE A 1 302 ? 125.975 -63.648  7.333   1.00 58.84  ? 226  PHE A CA  1 
ATOM   2184 C C   . PHE A 1 302 ? 126.734 -64.708  6.551   1.00 60.81  ? 226  PHE A C   1 
ATOM   2185 O O   . PHE A 1 302 ? 127.959 -64.698  6.591   1.00 61.99  ? 226  PHE A O   1 
ATOM   2186 C CB  . PHE A 1 302 ? 125.334 -64.312  8.551   1.00 60.45  ? 226  PHE A CB  1 
ATOM   2187 C CG  . PHE A 1 302 ? 124.954 -63.378  9.664   1.00 63.80  ? 226  PHE A CG  1 
ATOM   2188 C CD1 . PHE A 1 302 ? 125.866 -63.047  10.655  1.00 69.33  ? 226  PHE A CD1 1 
ATOM   2189 C CD2 . PHE A 1 302 ? 123.670 -62.865  9.751   1.00 65.56  ? 226  PHE A CD2 1 
ATOM   2190 C CE1 . PHE A 1 302 ? 125.514 -62.174  11.687  1.00 72.17  ? 226  PHE A CE1 1 
ATOM   2191 C CE2 . PHE A 1 302 ? 123.311 -62.014  10.795  1.00 70.25  ? 226  PHE A CE2 1 
ATOM   2192 C CZ  . PHE A 1 302 ? 124.237 -61.670  11.754  1.00 70.54  ? 226  PHE A CZ  1 
ATOM   2193 N N   . ILE A 1 303 ? 126.024 -65.629  5.860   1.00 54.20  ? 227  ILE A N   1 
ATOM   2194 C CA  . ILE A 1 303 ? 126.641 -66.706  5.069   1.00 52.85  ? 227  ILE A CA  1 
ATOM   2195 C C   . ILE A 1 303 ? 127.590 -66.109  4.012   1.00 55.69  ? 227  ILE A C   1 
ATOM   2196 O O   . ILE A 1 303 ? 128.705 -66.596  3.861   1.00 56.48  ? 227  ILE A O   1 
ATOM   2197 C CB  . ILE A 1 303 ? 125.615 -67.685  4.393   1.00 54.76  ? 227  ILE A CB  1 
ATOM   2198 C CG1 . ILE A 1 303 ? 124.302 -67.918  5.213   1.00 55.16  ? 227  ILE A CG1 1 
ATOM   2199 C CG2 . ILE A 1 303 ? 126.271 -69.010  4.033   1.00 54.84  ? 227  ILE A CG2 1 
ATOM   2200 C CD1 . ILE A 1 303 ? 124.396 -68.590  6.634   1.00 66.84  ? 227  ILE A CD1 1 
ATOM   2201 N N   . ALA A 1 304 ? 127.153 -65.047  3.310   1.00 50.76  ? 228  ALA A N   1 
ATOM   2202 C CA  . ALA A 1 304 ? 127.926 -64.387  2.269   1.00 51.25  ? 228  ALA A CA  1 
ATOM   2203 C C   . ALA A 1 304 ? 129.105 -63.583  2.838   1.00 57.60  ? 228  ALA A C   1 
ATOM   2204 O O   . ALA A 1 304 ? 130.188 -63.638  2.247   1.00 58.64  ? 228  ALA A O   1 
ATOM   2205 C CB  . ALA A 1 304 ? 127.025 -63.494  1.441   1.00 52.17  ? 228  ALA A CB  1 
ATOM   2206 N N   . THR A 1 305 ? 128.916 -62.851  3.973   1.00 55.07  ? 229  THR A N   1 
ATOM   2207 C CA  . THR A 1 305 ? 129.999 -62.070  4.601   1.00 57.55  ? 229  THR A CA  1 
ATOM   2208 C C   . THR A 1 305 ? 131.122 -62.995  5.077   1.00 62.78  ? 229  THR A C   1 
ATOM   2209 O O   . THR A 1 305 ? 132.293 -62.675  4.880   1.00 63.02  ? 229  THR A O   1 
ATOM   2210 C CB  . THR A 1 305 ? 129.466 -61.205  5.748   1.00 67.68  ? 229  THR A CB  1 
ATOM   2211 O OG1 . THR A 1 305 ? 128.458 -60.356  5.224   1.00 64.95  ? 229  THR A OG1 1 
ATOM   2212 C CG2 . THR A 1 305 ? 130.536 -60.378  6.416   1.00 70.00  ? 229  THR A CG2 1 
ATOM   2213 N N   . CYS A 1 306 ? 130.756 -64.158  5.659   1.00 60.22  ? 230  CYS A N   1 
ATOM   2214 C CA  . CYS A 1 306 ? 131.694 -65.174  6.147   1.00 60.54  ? 230  CYS A CA  1 
ATOM   2215 C C   . CYS A 1 306 ? 132.449 -65.833  5.004   1.00 63.40  ? 230  CYS A C   1 
ATOM   2216 O O   . CYS A 1 306 ? 133.649 -66.029  5.151   1.00 65.55  ? 230  CYS A O   1 
ATOM   2217 C CB  . CYS A 1 306 ? 130.984 -66.211  7.004   1.00 59.79  ? 230  CYS A CB  1 
ATOM   2218 S SG  . CYS A 1 306 ? 130.424 -65.576  8.602   1.00 65.15  ? 230  CYS A SG  1 
ATOM   2219 N N   . TYR A 1 307 ? 131.782 -66.158  3.871   1.00 56.85  ? 231  TYR A N   1 
ATOM   2220 C CA  . TYR A 1 307 ? 132.462 -66.767  2.729   1.00 56.59  ? 231  TYR A CA  1 
ATOM   2221 C C   . TYR A 1 307 ? 133.542 -65.832  2.163   1.00 63.37  ? 231  TYR A C   1 
ATOM   2222 O O   . TYR A 1 307 ? 134.674 -66.272  1.945   1.00 63.65  ? 231  TYR A O   1 
ATOM   2223 C CB  . TYR A 1 307 ? 131.490 -67.185  1.607   1.00 56.69  ? 231  TYR A CB  1 
ATOM   2224 C CG  . TYR A 1 307 ? 132.223 -67.514  0.317   1.00 60.48  ? 231  TYR A CG  1 
ATOM   2225 C CD1 . TYR A 1 307 ? 133.075 -68.618  0.236   1.00 61.78  ? 231  TYR A CD1 1 
ATOM   2226 C CD2 . TYR A 1 307 ? 132.148 -66.670  -0.787  1.00 62.90  ? 231  TYR A CD2 1 
ATOM   2227 C CE1 . TYR A 1 307 ? 133.816 -68.881  -0.914  1.00 61.81  ? 231  TYR A CE1 1 
ATOM   2228 C CE2 . TYR A 1 307 ? 132.884 -66.927  -1.946  1.00 64.95  ? 231  TYR A CE2 1 
ATOM   2229 C CZ  . TYR A 1 307 ? 133.708 -68.041  -2.007  1.00 70.51  ? 231  TYR A CZ  1 
ATOM   2230 O OH  . TYR A 1 307 ? 134.422 -68.319  -3.147  1.00 71.65  ? 231  TYR A OH  1 
ATOM   2231 N N   . PHE A 1 308 ? 133.181 -64.558  1.907   1.00 61.16  ? 232  PHE A N   1 
ATOM   2232 C CA  . PHE A 1 308 ? 134.092 -63.560  1.356   1.00 62.80  ? 232  PHE A CA  1 
ATOM   2233 C C   . PHE A 1 308 ? 135.108 -63.093  2.409   1.00 71.07  ? 232  PHE A C   1 
ATOM   2234 O O   . PHE A 1 308 ? 136.152 -62.552  2.041   1.00 72.76  ? 232  PHE A O   1 
ATOM   2235 C CB  . PHE A 1 308 ? 133.315 -62.383  0.752   1.00 64.27  ? 232  PHE A CB  1 
ATOM   2236 C CG  . PHE A 1 308 ? 132.639 -62.736  -0.553  1.00 63.72  ? 232  PHE A CG  1 
ATOM   2237 C CD1 . PHE A 1 308 ? 133.376 -62.831  -1.736  1.00 66.15  ? 232  PHE A CD1 1 
ATOM   2238 C CD2 . PHE A 1 308 ? 131.267 -62.978  -0.602  1.00 63.57  ? 232  PHE A CD2 1 
ATOM   2239 C CE1 . PHE A 1 308 ? 132.754 -63.169  -2.943  1.00 65.75  ? 232  PHE A CE1 1 
ATOM   2240 C CE2 . PHE A 1 308 ? 130.642 -63.313  -1.808  1.00 65.04  ? 232  PHE A CE2 1 
ATOM   2241 C CZ  . PHE A 1 308 ? 131.392 -63.406  -2.971  1.00 63.91  ? 232  PHE A CZ  1 
ATOM   2242 N N   . GLY A 1 309 ? 134.813 -63.351  3.688   1.00 68.69  ? 233  GLY A N   1 
ATOM   2243 C CA  . GLY A 1 309 ? 135.709 -63.066  4.806   1.00 71.16  ? 233  GLY A CA  1 
ATOM   2244 C C   . GLY A 1 309 ? 136.818 -64.107  4.874   1.00 76.50  ? 233  GLY A C   1 
ATOM   2245 O O   . GLY A 1 309 ? 137.982 -63.783  5.158   1.00 77.42  ? 233  GLY A O   1 
ATOM   2246 N N   . ILE A 1 310 ? 136.446 -65.376  4.584   1.00 71.98  ? 234  ILE A N   1 
ATOM   2247 C CA  . ILE A 1 310 ? 137.335 -66.530  4.492   1.00 71.79  ? 234  ILE A CA  1 
ATOM   2248 C C   . ILE A 1 310 ? 138.149 -66.383  3.186   1.00 76.40  ? 234  ILE A C   1 
ATOM   2249 O O   . ILE A 1 310 ? 139.375 -66.470  3.236   1.00 78.08  ? 234  ILE A O   1 
ATOM   2250 C CB  . ILE A 1 310 ? 136.521 -67.864  4.582   1.00 72.73  ? 234  ILE A CB  1 
ATOM   2251 C CG1 . ILE A 1 310 ? 136.064 -68.130  6.038   1.00 72.70  ? 234  ILE A CG1 1 
ATOM   2252 C CG2 . ILE A 1 310 ? 137.309 -69.071  4.025   1.00 73.90  ? 234  ILE A CG2 1 
ATOM   2253 C CD1 . ILE A 1 310 ? 134.964 -69.191  6.205   1.00 76.58  ? 234  ILE A CD1 1 
ATOM   2254 N N   . ARG A 1 311 ? 137.474 -66.085  2.045   1.00 71.97  ? 235  ARG A N   1 
ATOM   2255 C CA  . ARG A 1 311 ? 138.103 -65.907  0.733   1.00 72.79  ? 235  ARG A CA  1 
ATOM   2256 C C   . ARG A 1 311 ? 139.167 -64.802  0.763   1.00 79.61  ? 235  ARG A C   1 
ATOM   2257 O O   . ARG A 1 311 ? 140.218 -64.984  0.162   1.00 80.50  ? 235  ARG A O   1 
ATOM   2258 C CB  . ARG A 1 311 ? 137.053 -65.619  -0.354  1.00 72.77  ? 235  ARG A CB  1 
ATOM   2259 C CG  . ARG A 1 311 ? 137.570 -65.811  -1.776  1.00 85.12  ? 235  ARG A CG  1 
ATOM   2260 C CD  . ARG A 1 311 ? 136.509 -65.504  -2.810  1.00 98.80  ? 235  ARG A CD  1 
ATOM   2261 N NE  . ARG A 1 311 ? 136.973 -64.503  -3.771  1.00 116.93 ? 235  ARG A NE  1 
ATOM   2262 C CZ  . ARG A 1 311 ? 136.267 -64.072  -4.812  1.00 141.44 ? 235  ARG A CZ  1 
ATOM   2263 N NH1 . ARG A 1 311 ? 135.054 -64.557  -5.049  1.00 132.98 ? 235  ARG A NH1 1 
ATOM   2264 N NH2 . ARG A 1 311 ? 136.773 -63.159  -5.629  1.00 134.06 ? 235  ARG A NH2 1 
ATOM   2265 N N   . LYS A 1 312 ? 138.918 -63.697  1.502   1.00 77.88  ? 236  LYS A N   1 
ATOM   2266 C CA  . LYS A 1 312 ? 139.860 -62.577  1.638   1.00 81.37  ? 236  LYS A CA  1 
ATOM   2267 C C   . LYS A 1 312 ? 141.105 -62.947  2.462   1.00 88.47  ? 236  LYS A C   1 
ATOM   2268 O O   . LYS A 1 312 ? 142.160 -62.341  2.253   1.00 90.59  ? 236  LYS A O   1 
ATOM   2269 C CB  . LYS A 1 312 ? 139.185 -61.348  2.276   1.00 84.58  ? 236  LYS A CB  1 
ATOM   2270 C CG  . LYS A 1 312 ? 139.445 -60.062  1.509   1.00 95.83  ? 236  LYS A CG  1 
ATOM   2271 C CD  . LYS A 1 312 ? 139.692 -58.861  2.418   1.00 107.88 ? 236  LYS A CD  1 
ATOM   2272 C CE  . LYS A 1 312 ? 140.118 -57.645  1.612   1.00 118.09 ? 236  LYS A CE  1 
ATOM   2273 N NZ  . LYS A 1 312 ? 140.799 -56.611  2.441   1.00 121.93 ? 236  LYS A NZ  1 
ATOM   2274 N N   . HIS A 1 313 ? 140.977 -63.915  3.403   1.00 84.29  ? 237  HIS A N   1 
ATOM   2275 C CA  . HIS A 1 313 ? 142.061 -64.361  4.290   1.00 85.37  ? 237  HIS A CA  1 
ATOM   2276 C C   . HIS A 1 313 ? 142.993 -65.362  3.626   1.00 88.92  ? 237  HIS A C   1 
ATOM   2277 O O   . HIS A 1 313 ? 144.180 -65.385  3.951   1.00 90.11  ? 237  HIS A O   1 
ATOM   2278 C CB  . HIS A 1 313 ? 141.495 -64.989  5.570   1.00 84.93  ? 237  HIS A CB  1 
ATOM   2279 N N   . LEU A 1 314 ? 142.454 -66.222  2.747   1.00 83.50  ? 238  LEU A N   1 
ATOM   2280 C CA  . LEU A 1 314 ? 143.227 -67.253  2.064   1.00 83.24  ? 238  LEU A CA  1 
ATOM   2281 C C   . LEU A 1 314 ? 143.967 -66.703  0.840   1.00 89.05  ? 238  LEU A C   1 
ATOM   2282 O O   . LEU A 1 314 ? 145.054 -67.198  0.521   1.00 90.34  ? 238  LEU A O   1 
ATOM   2283 C CB  . LEU A 1 314 ? 142.322 -68.418  1.666   1.00 80.71  ? 238  LEU A CB  1 
ATOM   2284 C CG  . LEU A 1 314 ? 142.215 -69.539  2.701   1.00 85.10  ? 238  LEU A CG  1 
ATOM   2285 C CD1 . LEU A 1 314 ? 141.107 -69.272  3.717   1.00 84.43  ? 238  LEU A CD1 1 
ATOM   2286 C CD2 . LEU A 1 314 ? 141.979 -70.881  2.028   1.00 86.67  ? 238  LEU A CD2 1 
ATOM   2287 N N   . LEU A 1 315 ? 143.403 -65.665  0.185   1.00 85.11  ? 239  LEU A N   1 
ATOM   2288 C CA  . LEU A 1 315 ? 143.969 -65.002  -0.999  1.00 86.56  ? 239  LEU A CA  1 
ATOM   2289 C C   . LEU A 1 315 ? 145.158 -64.093  -0.612  1.00 94.11  ? 239  LEU A C   1 
ATOM   2290 O O   . LEU A 1 315 ? 145.909 -63.638  -1.482  1.00 95.88  ? 239  LEU A O   1 
ATOM   2291 C CB  . LEU A 1 315 ? 142.873 -64.199  -1.724  1.00 86.03  ? 239  LEU A CB  1 
ATOM   2292 C CG  . LEU A 1 315 ? 142.140 -64.848  -2.928  1.00 89.04  ? 239  LEU A CG  1 
ATOM   2293 C CD1 . LEU A 1 315 ? 141.718 -66.310  -2.664  1.00 86.61  ? 239  LEU A CD1 1 
ATOM   2294 C CD2 . LEU A 1 315 ? 140.913 -64.025  -3.322  1.00 90.49  ? 239  LEU A CD2 1 
ATOM   2295 N N   . LYS A 1 316 ? 145.313 -63.837  0.700   1.00 91.13  ? 240  LYS A N   1 
ATOM   2296 C CA  . LYS A 1 316 ? 146.405 -63.091  1.330   1.00 93.64  ? 240  LYS A CA  1 
ATOM   2297 C C   . LYS A 1 316 ? 147.114 -64.060  2.294   1.00 97.52  ? 240  LYS A C   1 
ATOM   2298 O O   . LYS A 1 316 ? 146.748 -65.240  2.318   1.00 95.53  ? 240  LYS A O   1 
ATOM   2299 C CB  . LYS A 1 316 ? 145.866 -61.835  2.047   1.00 96.91  ? 240  LYS A CB  1 
ATOM   2300 N N   . THR A 1 317 ? 148.107 -63.579  3.078   1.00 96.39  ? 241  THR A N   1 
ATOM   2301 C CA  . THR A 1 317 ? 148.908 -64.342  4.057   1.00 128.80 ? 241  THR A CA  1 
ATOM   2302 C C   . THR A 1 317 ? 149.734 -65.453  3.364   1.00 160.01 ? 241  THR A C   1 
ATOM   2303 O O   . THR A 1 317 ? 149.221 -66.505  2.976   1.00 116.91 ? 241  THR A O   1 
ATOM   2304 C CB  . THR A 1 317 ? 148.049 -64.888  5.213   1.00 134.04 ? 241  THR A CB  1 
ATOM   2305 N N   . TYR A 1 320 ? 150.916 -69.613  -4.625  1.00 148.67 ? 244  TYR A N   1 
ATOM   2306 C CA  . TYR A 1 320 ? 151.937 -70.651  -4.466  1.00 149.23 ? 244  TYR A CA  1 
ATOM   2307 C C   . TYR A 1 320 ? 151.778 -71.756  -5.532  1.00 150.83 ? 244  TYR A C   1 
ATOM   2308 O O   . TYR A 1 320 ? 150.885 -71.675  -6.377  1.00 149.43 ? 244  TYR A O   1 
ATOM   2309 C CB  . TYR A 1 320 ? 151.881 -71.246  -3.040  1.00 149.67 ? 244  TYR A CB  1 
ATOM   2310 C CG  . TYR A 1 320 ? 153.233 -71.643  -2.483  1.00 153.89 ? 244  TYR A CG  1 
ATOM   2311 C CD1 . TYR A 1 320 ? 154.124 -70.683  -2.010  1.00 158.73 ? 244  TYR A CD1 1 
ATOM   2312 C CD2 . TYR A 1 320 ? 153.617 -72.979  -2.414  1.00 154.22 ? 244  TYR A CD2 1 
ATOM   2313 C CE1 . TYR A 1 320 ? 155.373 -71.041  -1.501  1.00 161.79 ? 244  TYR A CE1 1 
ATOM   2314 C CE2 . TYR A 1 320 ? 154.855 -73.350  -1.892  1.00 157.28 ? 244  TYR A CE2 1 
ATOM   2315 C CZ  . TYR A 1 320 ? 155.733 -72.377  -1.441  1.00 167.08 ? 244  TYR A CZ  1 
ATOM   2316 O OH  . TYR A 1 320 ? 156.957 -72.734  -0.931  1.00 169.26 ? 244  TYR A OH  1 
ATOM   2317 N N   . GLY A 1 321 ? 152.675 -72.742  -5.501  1.00 146.65 ? 245  GLY A N   1 
ATOM   2318 C CA  . GLY A 1 321 ? 152.676 -73.878  -6.413  1.00 145.22 ? 245  GLY A CA  1 
ATOM   2319 C C   . GLY A 1 321 ? 152.076 -75.111  -5.773  1.00 144.74 ? 245  GLY A C   1 
ATOM   2320 O O   . GLY A 1 321 ? 151.073 -75.640  -6.263  1.00 142.54 ? 245  GLY A O   1 
ATOM   2321 N N   . LYS A 1 322 ? 152.683 -75.565  -4.658  1.00 139.62 ? 246  LYS A N   1 
ATOM   2322 C CA  . LYS A 1 322 ? 152.243 -76.737  -3.895  1.00 136.49 ? 246  LYS A CA  1 
ATOM   2323 C C   . LYS A 1 322 ? 151.135 -76.379  -2.884  1.00 134.99 ? 246  LYS A C   1 
ATOM   2324 O O   . LYS A 1 322 ? 150.214 -77.174  -2.689  1.00 132.08 ? 246  LYS A O   1 
ATOM   2325 C CB  . LYS A 1 322 ? 153.435 -77.382  -3.168  1.00 140.49 ? 246  LYS A CB  1 
ATOM   2326 N N   . ASN A 1 323 ? 151.226 -75.186  -2.256  1.00 129.94 ? 247  ASN A N   1 
ATOM   2327 C CA  . ASN A 1 323 ? 150.277 -74.702  -1.250  1.00 126.84 ? 247  ASN A CA  1 
ATOM   2328 C C   . ASN A 1 323 ? 149.008 -74.067  -1.859  1.00 125.28 ? 247  ASN A C   1 
ATOM   2329 O O   . ASN A 1 323 ? 148.118 -73.678  -1.103  1.00 123.31 ? 247  ASN A O   1 
ATOM   2330 C CB  . ASN A 1 323 ? 150.952 -73.710  -0.303  1.00 130.13 ? 247  ASN A CB  1 
ATOM   2331 N N   . ARG A 1 324 ? 148.906 -73.970  -3.200  1.00 119.46 ? 248  ARG A N   1 
ATOM   2332 C CA  . ARG A 1 324 ? 147.699 -73.417  -3.820  1.00 116.47 ? 248  ARG A CA  1 
ATOM   2333 C C   . ARG A 1 324 ? 146.618 -74.498  -3.946  1.00 114.64 ? 248  ARG A C   1 
ATOM   2334 O O   . ARG A 1 324 ? 145.438 -74.168  -3.909  1.00 112.86 ? 248  ARG A O   1 
ATOM   2335 C CB  . ARG A 1 324 ? 147.983 -72.750  -5.186  1.00 118.38 ? 248  ARG A CB  1 
ATOM   2336 C CG  . ARG A 1 324 ? 148.273 -73.699  -6.350  1.00 129.65 ? 248  ARG A CG  1 
ATOM   2337 C CD  . ARG A 1 324 ? 147.571 -73.262  -7.618  1.00 139.24 ? 248  ARG A CD  1 
ATOM   2338 N NE  . ARG A 1 324 ? 147.492 -74.355  -8.589  1.00 148.58 ? 248  ARG A NE  1 
ATOM   2339 C CZ  . ARG A 1 324 ? 146.419 -75.117  -8.781  1.00 160.20 ? 248  ARG A CZ  1 
ATOM   2340 N NH1 . ARG A 1 324 ? 145.309 -74.902  -8.084  1.00 148.21 ? 248  ARG A NH1 1 
ATOM   2341 N NH2 . ARG A 1 324 ? 146.442 -76.092  -9.680  1.00 143.69 ? 248  ARG A NH2 1 
ATOM   2342 N N   . ILE A 1 325 ? 147.022 -75.778  -4.086  1.00 108.81 ? 249  ILE A N   1 
ATOM   2343 C CA  . ILE A 1 325 ? 146.117 -76.923  -4.246  1.00 105.81 ? 249  ILE A CA  1 
ATOM   2344 C C   . ILE A 1 325 ? 145.258 -77.061  -2.987  1.00 105.84 ? 249  ILE A C   1 
ATOM   2345 O O   . ILE A 1 325 ? 144.042 -77.235  -3.092  1.00 103.08 ? 249  ILE A O   1 
ATOM   2346 C CB  . ILE A 1 325 ? 146.927 -78.225  -4.567  1.00 109.78 ? 249  ILE A CB  1 
ATOM   2347 C CG1 . ILE A 1 325 ? 147.762 -78.067  -5.851  1.00 112.69 ? 249  ILE A CG1 1 
ATOM   2348 C CG2 . ILE A 1 325 ? 146.031 -79.457  -4.677  1.00 108.53 ? 249  ILE A CG2 1 
ATOM   2349 C CD1 . ILE A 1 325 ? 149.234 -78.494  -5.727  1.00 123.34 ? 249  ILE A CD1 1 
ATOM   2350 N N   . THR A 1 326 ? 145.897 -76.937  -1.806  1.00 102.05 ? 250  THR A N   1 
ATOM   2351 C CA  . THR A 1 326 ? 145.260 -77.057  -0.493  1.00 99.91  ? 250  THR A CA  1 
ATOM   2352 C C   . THR A 1 326 ? 144.317 -75.868  -0.210  1.00 101.59 ? 250  THR A C   1 
ATOM   2353 O O   . THR A 1 326 ? 143.201 -76.107  0.252   1.00 99.88  ? 250  THR A O   1 
ATOM   2354 C CB  . THR A 1 326 ? 146.297 -77.280  0.635   1.00 105.56 ? 250  THR A CB  1 
ATOM   2355 O OG1 . THR A 1 326 ? 145.657 -77.207  1.909   1.00 99.35  ? 250  THR A OG1 1 
ATOM   2356 C CG2 . THR A 1 326 ? 147.474 -76.320  0.595   1.00 107.78 ? 250  THR A CG2 1 
ATOM   2357 N N   . ARG A 1 327 ? 144.739 -74.616  -0.501  1.00 97.61  ? 251  ARG A N   1 
ATOM   2358 C CA  . ARG A 1 327 ? 143.914 -73.421  -0.271  1.00 95.89  ? 251  ARG A CA  1 
ATOM   2359 C C   . ARG A 1 327 ? 142.654 -73.445  -1.136  1.00 96.38  ? 251  ARG A C   1 
ATOM   2360 O O   . ARG A 1 327 ? 141.585 -73.096  -0.637  1.00 95.19  ? 251  ARG A O   1 
ATOM   2361 C CB  . ARG A 1 327 ? 144.708 -72.124  -0.519  1.00 98.19  ? 251  ARG A CB  1 
ATOM   2362 N N   . ASP A 1 328 ? 142.770 -73.897  -2.410  1.00 91.83  ? 252  ASP A N   1 
ATOM   2363 C CA  . ASP A 1 328 ? 141.656 -74.005  -3.365  1.00 89.87  ? 252  ASP A CA  1 
ATOM   2364 C C   . ASP A 1 328 ? 140.578 -74.963  -2.838  1.00 89.47  ? 252  ASP A C   1 
ATOM   2365 O O   . ASP A 1 328 ? 139.392 -74.647  -2.915  1.00 87.89  ? 252  ASP A O   1 
ATOM   2366 C CB  . ASP A 1 328 ? 142.158 -74.468  -4.750  1.00 92.94  ? 252  ASP A CB  1 
ATOM   2367 C CG  . ASP A 1 328 ? 142.810 -73.395  -5.622  1.00 105.96 ? 252  ASP A CG  1 
ATOM   2368 O OD1 . ASP A 1 328 ? 143.095 -72.285  -5.101  1.00 107.76 ? 252  ASP A OD1 1 
ATOM   2369 O OD2 . ASP A 1 328 ? 143.050 -73.670  -6.821  1.00 111.62 ? 252  ASP A OD2 1 
ATOM   2370 N N   . GLN A 1 329 ? 141.006 -76.106  -2.269  1.00 84.09  ? 253  GLN A N   1 
ATOM   2371 C CA  . GLN A 1 329 ? 140.144 -77.137  -1.697  1.00 81.50  ? 253  GLN A CA  1 
ATOM   2372 C C   . GLN A 1 329 ? 139.344 -76.597  -0.491  1.00 81.66  ? 253  GLN A C   1 
ATOM   2373 O O   . GLN A 1 329 ? 138.161 -76.914  -0.370  1.00 80.41  ? 253  GLN A O   1 
ATOM   2374 C CB  . GLN A 1 329 ? 140.987 -78.360  -1.289  1.00 83.68  ? 253  GLN A CB  1 
ATOM   2375 C CG  . GLN A 1 329 ? 140.245 -79.685  -1.400  1.00 106.32 ? 253  GLN A CG  1 
ATOM   2376 C CD  . GLN A 1 329 ? 141.184 -80.863  -1.351  1.00 135.34 ? 253  GLN A CD  1 
ATOM   2377 O OE1 . GLN A 1 329 ? 141.712 -81.230  -0.293  1.00 133.35 ? 253  GLN A OE1 1 
ATOM   2378 N NE2 . GLN A 1 329 ? 141.398 -81.497  -2.496  1.00 131.09 ? 253  GLN A NE2 1 
ATOM   2379 N N   . VAL A 1 330 ? 139.981 -75.778  0.376   1.00 76.17  ? 254  VAL A N   1 
ATOM   2380 C CA  . VAL A 1 330 ? 139.363 -75.172  1.565   1.00 74.09  ? 254  VAL A CA  1 
ATOM   2381 C C   . VAL A 1 330 ? 138.289 -74.164  1.107   1.00 75.63  ? 254  VAL A C   1 
ATOM   2382 O O   . VAL A 1 330 ? 137.193 -74.123  1.674   1.00 73.95  ? 254  VAL A O   1 
ATOM   2383 C CB  . VAL A 1 330 ? 140.430 -74.517  2.504   1.00 79.35  ? 254  VAL A CB  1 
ATOM   2384 C CG1 . VAL A 1 330 ? 139.780 -73.828  3.699   1.00 78.75  ? 254  VAL A CG1 1 
ATOM   2385 C CG2 . VAL A 1 330 ? 141.454 -75.540  3.003   1.00 80.03  ? 254  VAL A CG2 1 
ATOM   2386 N N   . LEU A 1 331 ? 138.592 -73.389  0.056   1.00 71.80  ? 255  LEU A N   1 
ATOM   2387 C CA  . LEU A 1 331 ? 137.675 -72.395  -0.499  1.00 70.65  ? 255  LEU A CA  1 
ATOM   2388 C C   . LEU A 1 331 ? 136.478 -73.044  -1.169  1.00 72.35  ? 255  LEU A C   1 
ATOM   2389 O O   . LEU A 1 331 ? 135.389 -72.475  -1.114  1.00 70.68  ? 255  LEU A O   1 
ATOM   2390 C CB  . LEU A 1 331 ? 138.393 -71.476  -1.488  1.00 72.19  ? 255  LEU A CB  1 
ATOM   2391 C CG  . LEU A 1 331 ? 139.368 -70.490  -0.870  1.00 78.37  ? 255  LEU A CG  1 
ATOM   2392 C CD1 . LEU A 1 331 ? 140.337 -69.958  -1.913  1.00 80.18  ? 255  LEU A CD1 1 
ATOM   2393 C CD2 . LEU A 1 331 ? 138.641 -69.377  -0.154  1.00 81.10  ? 255  LEU A CD2 1 
ATOM   2394 N N   . LYS A 1 332 ? 136.670 -74.243  -1.775  1.00 69.29  ? 256  LYS A N   1 
ATOM   2395 C CA  . LYS A 1 332 ? 135.598 -75.010  -2.418  1.00 68.13  ? 256  LYS A CA  1 
ATOM   2396 C C   . LYS A 1 332 ? 134.549 -75.458  -1.379  1.00 71.08  ? 256  LYS A C   1 
ATOM   2397 O O   . LYS A 1 332 ? 133.342 -75.411  -1.653  1.00 68.49  ? 256  LYS A O   1 
ATOM   2398 C CB  . LYS A 1 332 ? 136.156 -76.213  -3.199  1.00 70.71  ? 256  LYS A CB  1 
ATOM   2399 C CG  . LYS A 1 332 ? 136.692 -75.873  -4.612  1.00 89.36  ? 256  LYS A CG  1 
ATOM   2400 C CD  . LYS A 1 332 ? 135.834 -74.881  -5.466  1.00 102.82 ? 256  LYS A CD  1 
ATOM   2401 C CE  . LYS A 1 332 ? 134.515 -75.412  -6.002  1.00 110.83 ? 256  LYS A CE  1 
ATOM   2402 N NZ  . LYS A 1 332 ? 133.765 -74.369  -6.761  1.00 112.57 ? 256  LYS A NZ  1 
ATOM   2403 N N   . MET A 1 333 ? 135.020 -75.830  -0.172  1.00 68.81  ? 257  MET A N   1 
ATOM   2404 C CA  . MET A 1 333 ? 134.184 -76.229  0.963   1.00 68.19  ? 257  MET A CA  1 
ATOM   2405 C C   . MET A 1 333 ? 133.420 -75.020  1.521   1.00 73.61  ? 257  MET A C   1 
ATOM   2406 O O   . MET A 1 333 ? 132.286 -75.165  1.987   1.00 73.11  ? 257  MET A O   1 
ATOM   2407 C CB  . MET A 1 333 ? 135.043 -76.877  2.052   1.00 71.24  ? 257  MET A CB  1 
ATOM   2408 C CG  . MET A 1 333 ? 135.591 -78.217  1.637   1.00 75.77  ? 257  MET A CG  1 
ATOM   2409 S SD  . MET A 1 333 ? 137.036 -78.715  2.590   1.00 82.34  ? 257  MET A SD  1 
ATOM   2410 C CE  . MET A 1 333 ? 136.271 -79.360  3.989   1.00 78.26  ? 257  MET A CE  1 
ATOM   2411 N N   . ALA A 1 334 ? 134.043 -73.833  1.458   1.00 70.68  ? 258  ALA A N   1 
ATOM   2412 C CA  . ALA A 1 334 ? 133.442 -72.582  1.898   1.00 69.80  ? 258  ALA A CA  1 
ATOM   2413 C C   . ALA A 1 334 ? 132.381 -72.121  0.890   1.00 70.52  ? 258  ALA A C   1 
ATOM   2414 O O   . ALA A 1 334 ? 131.353 -71.572  1.286   1.00 69.55  ? 258  ALA A O   1 
ATOM   2415 C CB  . ALA A 1 334 ? 134.524 -71.521  2.059   1.00 72.27  ? 258  ALA A CB  1 
ATOM   2416 N N   . ALA A 1 335 ? 132.631 -72.358  -0.412  1.00 64.99  ? 259  ALA A N   1 
ATOM   2417 C CA  . ALA A 1 335 ? 131.733 -71.962  -1.494  1.00 63.61  ? 259  ALA A CA  1 
ATOM   2418 C C   . ALA A 1 335 ? 130.468 -72.804  -1.525  1.00 65.44  ? 259  ALA A C   1 
ATOM   2419 O O   . ALA A 1 335 ? 129.412 -72.301  -1.890  1.00 64.13  ? 259  ALA A O   1 
ATOM   2420 C CB  . ALA A 1 335 ? 132.454 -72.072  -2.829  1.00 65.29  ? 259  ALA A CB  1 
ATOM   2421 N N   . ALA A 1 336 ? 130.583 -74.088  -1.154  1.00 62.69  ? 260  ALA A N   1 
ATOM   2422 C CA  . ALA A 1 336 ? 129.503 -75.073  -1.174  1.00 61.16  ? 260  ALA A CA  1 
ATOM   2423 C C   . ALA A 1 336 ? 128.355 -74.711  -0.237  1.00 66.31  ? 260  ALA A C   1 
ATOM   2424 O O   . ALA A 1 336 ? 127.201 -74.748  -0.666  1.00 65.68  ? 260  ALA A O   1 
ATOM   2425 C CB  . ALA A 1 336 ? 130.048 -76.445  -0.815  1.00 61.64  ? 260  ALA A CB  1 
ATOM   2426 N N   . VAL A 1 337 ? 128.665 -74.340  1.023   1.00 64.18  ? 261  VAL A N   1 
ATOM   2427 C CA  . VAL A 1 337 ? 127.661 -74.008  2.050   1.00 63.57  ? 261  VAL A CA  1 
ATOM   2428 C C   . VAL A 1 337 ? 126.811 -72.763  1.679   1.00 66.04  ? 261  VAL A C   1 
ATOM   2429 O O   . VAL A 1 337 ? 125.629 -72.736  2.015   1.00 64.70  ? 261  VAL A O   1 
ATOM   2430 C CB  . VAL A 1 337 ? 128.260 -73.875  3.478   1.00 68.39  ? 261  VAL A CB  1 
ATOM   2431 C CG1 . VAL A 1 337 ? 128.800 -75.208  3.969   1.00 67.93  ? 261  VAL A CG1 1 
ATOM   2432 C CG2 . VAL A 1 337 ? 129.345 -72.808  3.548   1.00 70.12  ? 261  VAL A CG2 1 
ATOM   2433 N N   . VAL A 1 338 ? 127.389 -71.775  0.973   1.00 63.05  ? 262  VAL A N   1 
ATOM   2434 C CA  . VAL A 1 338 ? 126.660 -70.563  0.586   1.00 63.02  ? 262  VAL A CA  1 
ATOM   2435 C C   . VAL A 1 338 ? 125.831 -70.828  -0.692  1.00 66.10  ? 262  VAL A C   1 
ATOM   2436 O O   . VAL A 1 338 ? 124.694 -70.358  -0.778  1.00 65.86  ? 262  VAL A O   1 
ATOM   2437 C CB  . VAL A 1 338 ? 127.569 -69.293  0.483   1.00 68.37  ? 262  VAL A CB  1 
ATOM   2438 C CG1 . VAL A 1 338 ? 128.540 -69.343  -0.693  1.00 69.12  ? 262  VAL A CG1 1 
ATOM   2439 C CG2 . VAL A 1 338 ? 126.747 -68.014  0.456   1.00 68.54  ? 262  VAL A CG2 1 
ATOM   2440 N N   . LEU A 1 339 ? 126.373 -71.606  -1.646  1.00 61.94  ? 263  LEU A N   1 
ATOM   2441 C CA  . LEU A 1 339 ? 125.678 -71.920  -2.891  1.00 61.46  ? 263  LEU A CA  1 
ATOM   2442 C C   . LEU A 1 339 ? 124.505 -72.883  -2.655  1.00 64.18  ? 263  LEU A C   1 
ATOM   2443 O O   . LEU A 1 339 ? 123.466 -72.709  -3.287  1.00 64.16  ? 263  LEU A O   1 
ATOM   2444 C CB  . LEU A 1 339 ? 126.653 -72.491  -3.928  1.00 62.53  ? 263  LEU A CB  1 
ATOM   2445 C CG  . LEU A 1 339 ? 127.101 -71.529  -5.041  1.00 68.83  ? 263  LEU A CG  1 
ATOM   2446 C CD1 . LEU A 1 339 ? 128.125 -70.516  -4.537  1.00 70.31  ? 263  LEU A CD1 1 
ATOM   2447 C CD2 . LEU A 1 339 ? 127.706 -72.294  -6.198  1.00 71.27  ? 263  LEU A CD2 1 
ATOM   2448 N N   . ALA A 1 340 ? 124.647 -73.858  -1.723  1.00 59.80  ? 264  ALA A N   1 
ATOM   2449 C CA  . ALA A 1 340 ? 123.591 -74.824  -1.382  1.00 58.18  ? 264  ALA A CA  1 
ATOM   2450 C C   . ALA A 1 340 ? 122.407 -74.143  -0.677  1.00 61.75  ? 264  ALA A C   1 
ATOM   2451 O O   . ALA A 1 340 ? 121.269 -74.587  -0.836  1.00 60.37  ? 264  ALA A O   1 
ATOM   2452 C CB  . ALA A 1 340 ? 124.148 -75.933  -0.504  1.00 58.61  ? 264  ALA A CB  1 
ATOM   2453 N N   . PHE A 1 341 ? 122.669 -73.067  0.093   1.00 59.17  ? 265  PHE A N   1 
ATOM   2454 C CA  . PHE A 1 341 ? 121.615 -72.332  0.783   1.00 58.77  ? 265  PHE A CA  1 
ATOM   2455 C C   . PHE A 1 341 ? 120.723 -71.590  -0.220  1.00 64.31  ? 265  PHE A C   1 
ATOM   2456 O O   . PHE A 1 341 ? 119.498 -71.647  -0.077  1.00 63.18  ? 265  PHE A O   1 
ATOM   2457 C CB  . PHE A 1 341 ? 122.201 -71.354  1.813   1.00 60.99  ? 265  PHE A CB  1 
ATOM   2458 C CG  . PHE A 1 341 ? 121.179 -70.628  2.668   1.00 62.23  ? 265  PHE A CG  1 
ATOM   2459 C CD1 . PHE A 1 341 ? 120.680 -71.207  3.831   1.00 64.15  ? 265  PHE A CD1 1 
ATOM   2460 C CD2 . PHE A 1 341 ? 120.749 -69.347  2.334   1.00 65.14  ? 265  PHE A CD2 1 
ATOM   2461 C CE1 . PHE A 1 341 ? 119.747 -70.532  4.625   1.00 64.93  ? 265  PHE A CE1 1 
ATOM   2462 C CE2 . PHE A 1 341 ? 119.809 -68.677  3.126   1.00 68.06  ? 265  PHE A CE2 1 
ATOM   2463 C CZ  . PHE A 1 341 ? 119.317 -69.274  4.267   1.00 65.28  ? 265  PHE A CZ  1 
ATOM   2464 N N   . ILE A 1 342 ? 121.321 -70.903  -1.224  1.00 63.30  ? 266  ILE A N   1 
ATOM   2465 C CA  . ILE A 1 342 ? 120.526 -70.136  -2.196  1.00 64.42  ? 266  ILE A CA  1 
ATOM   2466 C C   . ILE A 1 342 ? 119.824 -71.068  -3.209  1.00 69.50  ? 266  ILE A C   1 
ATOM   2467 O O   . ILE A 1 342 ? 118.749 -70.709  -3.693  1.00 70.30  ? 266  ILE A O   1 
ATOM   2468 C CB  . ILE A 1 342 ? 121.280 -68.974  -2.903  1.00 68.78  ? 266  ILE A CB  1 
ATOM   2469 C CG1 . ILE A 1 342 ? 122.480 -69.458  -3.736  1.00 70.69  ? 266  ILE A CG1 1 
ATOM   2470 C CG2 . ILE A 1 342 ? 121.688 -67.898  -1.899  1.00 69.38  ? 266  ILE A CG2 1 
ATOM   2471 C CD1 . ILE A 1 342 ? 122.846 -68.533  -4.936  1.00 82.80  ? 266  ILE A CD1 1 
ATOM   2472 N N   . ILE A 1 343 ? 120.383 -72.255  -3.501  1.00 64.80  ? 267  ILE A N   1 
ATOM   2473 C CA  . ILE A 1 343 ? 119.717 -73.176  -4.428  1.00 64.90  ? 267  ILE A CA  1 
ATOM   2474 C C   . ILE A 1 343 ? 118.438 -73.739  -3.758  1.00 68.79  ? 267  ILE A C   1 
ATOM   2475 O O   . ILE A 1 343 ? 117.395 -73.822  -4.409  1.00 69.30  ? 267  ILE A O   1 
ATOM   2476 C CB  . ILE A 1 343 ? 120.684 -74.298  -4.931  1.00 68.32  ? 267  ILE A CB  1 
ATOM   2477 C CG1 . ILE A 1 343 ? 121.803 -73.744  -5.848  1.00 70.30  ? 267  ILE A CG1 1 
ATOM   2478 C CG2 . ILE A 1 343 ? 119.954 -75.481  -5.594  1.00 68.60  ? 267  ILE A CG2 1 
ATOM   2479 C CD1 . ILE A 1 343 ? 121.367 -72.803  -7.037  1.00 83.15  ? 267  ILE A CD1 1 
ATOM   2480 N N   . CYS A 1 344 ? 118.516 -74.055  -2.450  1.00 63.57  ? 268  CYS A N   1 
ATOM   2481 C CA  . CYS A 1 344 ? 117.432 -74.640  -1.669  1.00 62.16  ? 268  CYS A CA  1 
ATOM   2482 C C   . CYS A 1 344 ? 116.351 -73.640  -1.233  1.00 63.17  ? 268  CYS A C   1 
ATOM   2483 O O   . CYS A 1 344 ? 115.173 -74.003  -1.237  1.00 62.51  ? 268  CYS A O   1 
ATOM   2484 C CB  . CYS A 1 344 ? 118.004 -75.368  -0.460  1.00 62.71  ? 268  CYS A CB  1 
ATOM   2485 S SG  . CYS A 1 344 ? 118.940 -76.865  -0.872  1.00 67.30  ? 268  CYS A SG  1 
ATOM   2486 N N   . TRP A 1 345 ? 116.727 -72.416  -0.832  1.00 58.75  ? 269  TRP A N   1 
ATOM   2487 C CA  . TRP A 1 345 ? 115.750 -71.467  -0.297  1.00 58.32  ? 269  TRP A CA  1 
ATOM   2488 C C   . TRP A 1 345 ? 115.355 -70.276  -1.212  1.00 59.38  ? 269  TRP A C   1 
ATOM   2489 O O   . TRP A 1 345 ? 114.285 -69.716  -0.976  1.00 58.08  ? 269  TRP A O   1 
ATOM   2490 C CB  . TRP A 1 345 ? 116.245 -70.924  1.045   1.00 57.84  ? 269  TRP A CB  1 
ATOM   2491 C CG  . TRP A 1 345 ? 116.095 -71.911  2.165   1.00 58.66  ? 269  TRP A CG  1 
ATOM   2492 C CD1 . TRP A 1 345 ? 117.084 -72.649  2.750   1.00 61.44  ? 269  TRP A CD1 1 
ATOM   2493 C CD2 . TRP A 1 345 ? 114.869 -72.298  2.806   1.00 58.52  ? 269  TRP A CD2 1 
ATOM   2494 N NE1 . TRP A 1 345 ? 116.557 -73.444  3.745   1.00 60.62  ? 269  TRP A NE1 1 
ATOM   2495 C CE2 . TRP A 1 345 ? 115.195 -73.262  3.789   1.00 62.21  ? 269  TRP A CE2 1 
ATOM   2496 C CE3 . TRP A 1 345 ? 113.520 -71.918  2.650   1.00 59.84  ? 269  TRP A CE3 1 
ATOM   2497 C CZ2 . TRP A 1 345 ? 114.220 -73.852  4.615   1.00 61.30  ? 269  TRP A CZ2 1 
ATOM   2498 C CZ3 . TRP A 1 345 ? 112.557 -72.500  3.469   1.00 61.00  ? 269  TRP A CZ3 1 
ATOM   2499 C CH2 . TRP A 1 345 ? 112.909 -73.450  4.440   1.00 61.46  ? 269  TRP A CH2 1 
ATOM   2500 N N   . LEU A 1 346 ? 116.170 -69.878  -2.219  1.00 54.80  ? 270  LEU A N   1 
ATOM   2501 C CA  . LEU A 1 346 ? 115.810 -68.741  -3.085  1.00 54.40  ? 270  LEU A CA  1 
ATOM   2502 C C   . LEU A 1 346 ? 114.515 -69.015  -3.894  1.00 56.55  ? 270  LEU A C   1 
ATOM   2503 O O   . LEU A 1 346 ? 113.649 -68.133  -3.873  1.00 57.63  ? 270  LEU A O   1 
ATOM   2504 C CB  . LEU A 1 346 ? 116.958 -68.302  -4.022  1.00 55.44  ? 270  LEU A CB  1 
ATOM   2505 C CG  . LEU A 1 346 ? 116.703 -67.099  -4.951  1.00 61.46  ? 270  LEU A CG  1 
ATOM   2506 C CD1 . LEU A 1 346 ? 116.876 -65.774  -4.222  1.00 62.04  ? 270  LEU A CD1 1 
ATOM   2507 C CD2 . LEU A 1 346 ? 117.612 -67.143  -6.164  1.00 64.82  ? 270  LEU A CD2 1 
ATOM   2508 N N   . PRO A 1 347 ? 114.301 -70.188  -4.557  1.00 51.00  ? 271  PRO A N   1 
ATOM   2509 C CA  . PRO A 1 347 ? 113.042 -70.385  -5.307  1.00 50.77  ? 271  PRO A CA  1 
ATOM   2510 C C   . PRO A 1 347 ? 111.767 -70.123  -4.482  1.00 55.10  ? 271  PRO A C   1 
ATOM   2511 O O   . PRO A 1 347 ? 110.874 -69.436  -4.984  1.00 56.69  ? 271  PRO A O   1 
ATOM   2512 C CB  . PRO A 1 347 ? 113.130 -71.842  -5.760  1.00 52.04  ? 271  PRO A CB  1 
ATOM   2513 C CG  . PRO A 1 347 ? 114.575 -72.093  -5.881  1.00 56.59  ? 271  PRO A CG  1 
ATOM   2514 C CD  . PRO A 1 347 ? 115.188 -71.359  -4.722  1.00 51.94  ? 271  PRO A CD  1 
ATOM   2515 N N   . PHE A 1 348 ? 111.698 -70.611  -3.219  1.00 50.20  ? 272  PHE A N   1 
ATOM   2516 C CA  . PHE A 1 348 ? 110.552 -70.412  -2.324  1.00 49.53  ? 272  PHE A CA  1 
ATOM   2517 C C   . PHE A 1 348 ? 110.398 -68.940  -1.900  1.00 54.48  ? 272  PHE A C   1 
ATOM   2518 O O   . PHE A 1 348 ? 109.274 -68.440  -1.881  1.00 55.53  ? 272  PHE A O   1 
ATOM   2519 C CB  . PHE A 1 348 ? 110.653 -71.315  -1.079  1.00 50.49  ? 272  PHE A CB  1 
ATOM   2520 C CG  . PHE A 1 348 ? 109.728 -70.941  0.063   1.00 52.10  ? 272  PHE A CG  1 
ATOM   2521 C CD1 . PHE A 1 348 ? 108.378 -71.261  0.019   1.00 55.19  ? 272  PHE A CD1 1 
ATOM   2522 C CD2 . PHE A 1 348 ? 110.207 -70.246  1.173   1.00 54.61  ? 272  PHE A CD2 1 
ATOM   2523 C CE1 . PHE A 1 348 ? 107.521 -70.892  1.062   1.00 56.14  ? 272  PHE A CE1 1 
ATOM   2524 C CE2 . PHE A 1 348 ? 109.348 -69.874  2.213   1.00 56.86  ? 272  PHE A CE2 1 
ATOM   2525 C CZ  . PHE A 1 348 ? 108.014 -70.208  2.154   1.00 54.84  ? 272  PHE A CZ  1 
ATOM   2526 N N   . HIS A 1 349 ? 111.501 -68.268  -1.525  1.00 49.98  ? 273  HIS A N   1 
ATOM   2527 C CA  . HIS A 1 349 ? 111.471 -66.881  -1.062  1.00 50.24  ? 273  HIS A CA  1 
ATOM   2528 C C   . HIS A 1 349 ? 111.119 -65.901  -2.198  1.00 54.59  ? 273  HIS A C   1 
ATOM   2529 O O   . HIS A 1 349 ? 110.519 -64.852  -1.926  1.00 54.47  ? 273  HIS A O   1 
ATOM   2530 C CB  . HIS A 1 349 ? 112.789 -66.505  -0.369  1.00 51.04  ? 273  HIS A CB  1 
ATOM   2531 C CG  . HIS A 1 349 ? 112.874 -67.061  1.019   1.00 53.80  ? 273  HIS A CG  1 
ATOM   2532 N ND1 . HIS A 1 349 ? 112.336 -66.386  2.096   1.00 55.79  ? 273  HIS A ND1 1 
ATOM   2533 C CD2 . HIS A 1 349 ? 113.383 -68.238  1.452   1.00 55.07  ? 273  HIS A CD2 1 
ATOM   2534 C CE1 . HIS A 1 349 ? 112.551 -67.159  3.148   1.00 54.91  ? 273  HIS A CE1 1 
ATOM   2535 N NE2 . HIS A 1 349 ? 113.179 -68.284  2.810   1.00 54.72  ? 273  HIS A NE2 1 
ATOM   2536 N N   . VAL A 1 350 ? 111.429 -66.267  -3.464  1.00 51.54  ? 274  VAL A N   1 
ATOM   2537 C CA  . VAL A 1 350 ? 111.081 -65.462  -4.649  1.00 52.66  ? 274  VAL A CA  1 
ATOM   2538 C C   . VAL A 1 350 ? 109.553 -65.510  -4.819  1.00 54.52  ? 274  VAL A C   1 
ATOM   2539 O O   . VAL A 1 350 ? 108.913 -64.468  -4.972  1.00 53.64  ? 274  VAL A O   1 
ATOM   2540 C CB  . VAL A 1 350 ? 111.850 -65.937  -5.926  1.00 57.28  ? 274  VAL A CB  1 
ATOM   2541 C CG1 . VAL A 1 350 ? 111.155 -65.485  -7.218  1.00 58.09  ? 274  VAL A CG1 1 
ATOM   2542 C CG2 . VAL A 1 350 ? 113.311 -65.472  -5.899  1.00 57.32  ? 274  VAL A CG2 1 
ATOM   2543 N N   . LEU A 1 351 ? 108.987 -66.730  -4.729  1.00 50.99  ? 275  LEU A N   1 
ATOM   2544 C CA  . LEU A 1 351 ? 107.555 -67.038  -4.822  1.00 51.20  ? 275  LEU A CA  1 
ATOM   2545 C C   . LEU A 1 351 ? 106.754 -66.357  -3.713  1.00 55.12  ? 275  LEU A C   1 
ATOM   2546 O O   . LEU A 1 351 ? 105.631 -65.921  -3.967  1.00 55.42  ? 275  LEU A O   1 
ATOM   2547 C CB  . LEU A 1 351 ? 107.359 -68.560  -4.749  1.00 50.38  ? 275  LEU A CB  1 
ATOM   2548 C CG  . LEU A 1 351 ? 107.112 -69.308  -6.060  1.00 55.66  ? 275  LEU A CG  1 
ATOM   2549 C CD1 . LEU A 1 351 ? 108.167 -69.006  -7.109  1.00 56.20  ? 275  LEU A CD1 1 
ATOM   2550 C CD2 . LEU A 1 351 ? 107.090 -70.792  -5.821  1.00 58.26  ? 275  LEU A CD2 1 
ATOM   2551 N N   . THR A 1 352 ? 107.339 -66.256  -2.501  1.00 51.80  ? 276  THR A N   1 
ATOM   2552 C CA  . THR A 1 352 ? 106.762 -65.619  -1.312  1.00 52.28  ? 276  THR A CA  1 
ATOM   2553 C C   . THR A 1 352 ? 106.720 -64.090  -1.500  1.00 59.14  ? 276  THR A C   1 
ATOM   2554 O O   . THR A 1 352 ? 105.736 -63.465  -1.091  1.00 60.39  ? 276  THR A O   1 
ATOM   2555 C CB  . THR A 1 352 ? 107.542 -66.059  -0.063  1.00 55.83  ? 276  THR A CB  1 
ATOM   2556 O OG1 . THR A 1 352 ? 107.272 -67.445  0.138   1.00 56.30  ? 276  THR A OG1 1 
ATOM   2557 C CG2 . THR A 1 352 ? 107.159 -65.294  1.200   1.00 49.45  ? 276  THR A CG2 1 
ATOM   2558 N N   . PHE A 1 353 ? 107.757 -63.490  -2.124  1.00 56.30  ? 277  PHE A N   1 
ATOM   2559 C CA  . PHE A 1 353 ? 107.759 -62.039  -2.370  1.00 57.30  ? 277  PHE A CA  1 
ATOM   2560 C C   . PHE A 1 353 ? 106.743 -61.671  -3.457  1.00 63.39  ? 277  PHE A C   1 
ATOM   2561 O O   . PHE A 1 353 ? 106.091 -60.631  -3.347  1.00 65.00  ? 277  PHE A O   1 
ATOM   2562 C CB  . PHE A 1 353 ? 109.157 -61.508  -2.737  1.00 58.90  ? 277  PHE A CB  1 
ATOM   2563 C CG  . PHE A 1 353 ? 109.197 -59.997  -2.823  1.00 61.14  ? 277  PHE A CG  1 
ATOM   2564 C CD1 . PHE A 1 353 ? 109.156 -59.215  -1.675  1.00 64.02  ? 277  PHE A CD1 1 
ATOM   2565 C CD2 . PHE A 1 353 ? 109.248 -59.355  -4.053  1.00 64.22  ? 277  PHE A CD2 1 
ATOM   2566 C CE1 . PHE A 1 353 ? 109.165 -57.816  -1.758  1.00 66.32  ? 277  PHE A CE1 1 
ATOM   2567 C CE2 . PHE A 1 353 ? 109.268 -57.953  -4.133  1.00 68.01  ? 277  PHE A CE2 1 
ATOM   2568 C CZ  . PHE A 1 353 ? 109.227 -57.197  -2.985  1.00 66.13  ? 277  PHE A CZ  1 
ATOM   2569 N N   . LEU A 1 354 ? 106.610 -62.529  -4.494  1.00 59.51  ? 278  LEU A N   1 
ATOM   2570 C CA  . LEU A 1 354 ? 105.651 -62.363  -5.588  1.00 60.26  ? 278  LEU A CA  1 
ATOM   2571 C C   . LEU A 1 354 ? 104.218 -62.466  -5.060  1.00 66.21  ? 278  LEU A C   1 
ATOM   2572 O O   . LEU A 1 354 ? 103.341 -61.732  -5.525  1.00 67.66  ? 278  LEU A O   1 
ATOM   2573 C CB  . LEU A 1 354 ? 105.888 -63.408  -6.693  1.00 59.72  ? 278  LEU A CB  1 
ATOM   2574 C CG  . LEU A 1 354 ? 107.112 -63.213  -7.580  1.00 64.00  ? 278  LEU A CG  1 
ATOM   2575 C CD1 . LEU A 1 354 ? 107.377 -64.446  -8.408  1.00 62.99  ? 278  LEU A CD1 1 
ATOM   2576 C CD2 . LEU A 1 354 ? 106.953 -62.008  -8.485  1.00 68.90  ? 278  LEU A CD2 1 
ATOM   2577 N N   . ASP A 1 355 ? 103.999 -63.364  -4.076  1.00 62.45  ? 279  ASP A N   1 
ATOM   2578 C CA  . ASP A 1 355 ? 102.719 -63.585  -3.398  1.00 62.73  ? 279  ASP A CA  1 
ATOM   2579 C C   . ASP A 1 355 ? 102.364 -62.379  -2.527  1.00 66.43  ? 279  ASP A C   1 
ATOM   2580 O O   . ASP A 1 355 ? 101.188 -62.029  -2.448  1.00 68.50  ? 279  ASP A O   1 
ATOM   2581 C CB  . ASP A 1 355 ? 102.757 -64.871  -2.546  1.00 63.89  ? 279  ASP A CB  1 
ATOM   2582 C CG  . ASP A 1 355 ? 101.561 -65.055  -1.620  1.00 79.06  ? 279  ASP A CG  1 
ATOM   2583 O OD1 . ASP A 1 355 ? 100.442 -65.309  -2.135  1.00 81.23  ? 279  ASP A OD1 1 
ATOM   2584 O OD2 . ASP A 1 355 ? 101.738 -64.925  -0.383  1.00 85.20  ? 279  ASP A OD2 1 
ATOM   2585 N N   . ALA A 1 356 ? 103.364 -61.752  -1.875  1.00 60.79  ? 280  ALA A N   1 
ATOM   2586 C CA  . ALA A 1 356 ? 103.170 -60.576  -1.019  1.00 61.23  ? 280  ALA A CA  1 
ATOM   2587 C C   . ALA A 1 356 ? 102.638 -59.396  -1.834  1.00 67.03  ? 280  ALA A C   1 
ATOM   2588 O O   . ALA A 1 356 ? 101.759 -58.670  -1.363  1.00 68.35  ? 280  ALA A O   1 
ATOM   2589 C CB  . ALA A 1 356 ? 104.480 -60.205  -0.353  1.00 61.99  ? 280  ALA A CB  1 
ATOM   2590 N N   . LEU A 1 357 ? 103.149 -59.235  -3.077  1.00 62.63  ? 281  LEU A N   1 
ATOM   2591 C CA  . LEU A 1 357 ? 102.748 -58.178  -4.014  1.00 62.85  ? 281  LEU A CA  1 
ATOM   2592 C C   . LEU A 1 357 ? 101.319 -58.400  -4.511  1.00 64.95  ? 281  LEU A C   1 
ATOM   2593 O O   . LEU A 1 357 ? 100.636 -57.433  -4.820  1.00 64.93  ? 281  LEU A O   1 
ATOM   2594 C CB  . LEU A 1 357 ? 103.726 -58.096  -5.207  1.00 62.86  ? 281  LEU A CB  1 
ATOM   2595 C CG  . LEU A 1 357 ? 105.195 -57.827  -4.876  1.00 65.63  ? 281  LEU A CG  1 
ATOM   2596 C CD1 . LEU A 1 357 ? 106.089 -58.273  -5.993  1.00 65.21  ? 281  LEU A CD1 1 
ATOM   2597 C CD2 . LEU A 1 357 ? 105.437 -56.381  -4.541  1.00 68.31  ? 281  LEU A CD2 1 
ATOM   2598 N N   . ALA A 1 358 ? 100.874 -59.670  -4.584  1.00 61.33  ? 282  ALA A N   1 
ATOM   2599 C CA  . ALA A 1 358 ? 99.516  -60.049  -4.989  1.00 62.41  ? 282  ALA A CA  1 
ATOM   2600 C C   . ALA A 1 358 ? 98.519  -59.565  -3.946  1.00 68.34  ? 282  ALA A C   1 
ATOM   2601 O O   . ALA A 1 358 ? 97.513  -58.951  -4.309  1.00 69.72  ? 282  ALA A O   1 
ATOM   2602 C CB  . ALA A 1 358 ? 99.413  -61.556  -5.171  1.00 61.87  ? 282  ALA A CB  1 
ATOM   2603 N N   . TRP A 1 359 ? 98.839  -59.786  -2.652  1.00 64.72  ? 283  TRP A N   1 
ATOM   2604 C CA  . TRP A 1 359 ? 98.053  -59.325  -1.513  1.00 65.66  ? 283  TRP A CA  1 
ATOM   2605 C C   . TRP A 1 359 ? 98.006  -57.788  -1.439  1.00 73.35  ? 283  TRP A C   1 
ATOM   2606 O O   . TRP A 1 359 ? 96.979  -57.247  -1.018  1.00 74.28  ? 283  TRP A O   1 
ATOM   2607 C CB  . TRP A 1 359 ? 98.605  -59.906  -0.208  1.00 63.16  ? 283  TRP A CB  1 
ATOM   2608 C CG  . TRP A 1 359 ? 98.176  -61.324  0.036   1.00 63.21  ? 283  TRP A CG  1 
ATOM   2609 C CD1 . TRP A 1 359 ? 98.963  -62.439  0.012   1.00 64.67  ? 283  TRP A CD1 1 
ATOM   2610 C CD2 . TRP A 1 359 ? 96.836  -61.781  0.287   1.00 63.48  ? 283  TRP A CD2 1 
ATOM   2611 N NE1 . TRP A 1 359 ? 98.198  -63.562  0.236   1.00 63.56  ? 283  TRP A NE1 1 
ATOM   2612 C CE2 . TRP A 1 359 ? 96.891  -63.186  0.416   1.00 65.91  ? 283  TRP A CE2 1 
ATOM   2613 C CE3 . TRP A 1 359 ? 95.589  -61.136  0.404   1.00 66.06  ? 283  TRP A CE3 1 
ATOM   2614 C CZ2 . TRP A 1 359 ? 95.755  -63.955  0.692   1.00 65.34  ? 283  TRP A CZ2 1 
ATOM   2615 C CZ3 . TRP A 1 359 ? 94.460  -61.900  0.657   1.00 67.72  ? 283  TRP A CZ3 1 
ATOM   2616 C CH2 . TRP A 1 359 ? 94.548  -63.293  0.795   1.00 67.14  ? 283  TRP A CH2 1 
ATOM   2617 N N   . MET A 1 360 ? 99.110  -57.093  -1.856  1.00 71.33  ? 284  MET A N   1 
ATOM   2618 C CA  . MET A 1 360 ? 99.234  -55.621  -1.897  1.00 72.86  ? 284  MET A CA  1 
ATOM   2619 C C   . MET A 1 360 ? 98.376  -55.006  -3.010  1.00 76.55  ? 284  MET A C   1 
ATOM   2620 O O   . MET A 1 360 ? 97.907  -53.876  -2.876  1.00 78.31  ? 284  MET A O   1 
ATOM   2621 C CB  . MET A 1 360 ? 100.692 -55.202  -2.121  1.00 75.72  ? 284  MET A CB  1 
ATOM   2622 C CG  . MET A 1 360 ? 101.520 -55.152  -0.876  1.00 79.43  ? 284  MET A CG  1 
ATOM   2623 S SD  . MET A 1 360 ? 103.238 -55.406  -1.324  1.00 83.92  ? 284  MET A SD  1 
ATOM   2624 C CE  . MET A 1 360 ? 103.836 -56.294  0.169   1.00 79.23  ? 284  MET A CE  1 
ATOM   2625 N N   . GLY A 1 361 ? 98.205  -55.755  -4.094  1.00 71.08  ? 285  GLY A N   1 
ATOM   2626 C CA  . GLY A 1 361 ? 97.452  -55.336  -5.266  1.00 71.83  ? 285  GLY A CA  1 
ATOM   2627 C C   . GLY A 1 361 ? 98.337  -54.957  -6.438  1.00 75.20  ? 285  GLY A C   1 
ATOM   2628 O O   . GLY A 1 361 ? 97.855  -54.364  -7.404  1.00 76.95  ? 285  GLY A O   1 
ATOM   2629 N N   . VAL A 1 362 ? 99.636  -55.305  -6.369  1.00 69.66  ? 286  VAL A N   1 
ATOM   2630 C CA  . VAL A 1 362 ? 100.623 -55.014  -7.414  1.00 70.66  ? 286  VAL A CA  1 
ATOM   2631 C C   . VAL A 1 362 ? 100.347 -55.927  -8.610  1.00 77.33  ? 286  VAL A C   1 
ATOM   2632 O O   . VAL A 1 362 ? 99.970  -55.440  -9.677  1.00 78.90  ? 286  VAL A O   1 
ATOM   2633 C CB  . VAL A 1 362 ? 102.091 -55.139  -6.911  1.00 73.15  ? 286  VAL A CB  1 
ATOM   2634 C CG1 . VAL A 1 362 ? 103.071 -54.537  -7.914  1.00 74.52  ? 286  VAL A CG1 1 
ATOM   2635 C CG2 . VAL A 1 362 ? 102.265 -54.507  -5.535  1.00 72.46  ? 286  VAL A CG2 1 
ATOM   2636 N N   . ILE A 1 363 ? 100.516 -57.245  -8.419  1.00 74.85  ? 287  ILE A N   1 
ATOM   2637 C CA  . ILE A 1 363 ? 100.268 -58.254  -9.443  1.00 76.11  ? 287  ILE A CA  1 
ATOM   2638 C C   . ILE A 1 363 ? 98.816  -58.718  -9.278  1.00 82.84  ? 287  ILE A C   1 
ATOM   2639 O O   . ILE A 1 363 ? 98.413  -59.102  -8.178  1.00 81.76  ? 287  ILE A O   1 
ATOM   2640 C CB  . ILE A 1 363 ? 101.334 -59.412  -9.438  1.00 77.90  ? 287  ILE A CB  1 
ATOM   2641 C CG1 . ILE A 1 363 ? 100.947 -60.567  -10.378 1.00 78.89  ? 287  ILE A CG1 1 
ATOM   2642 C CG2 . ILE A 1 363 ? 101.700 -59.931  -8.047  1.00 76.30  ? 287  ILE A CG2 1 
ATOM   2643 C CD1 . ILE A 1 363 ? 101.337 -60.320  -11.848 1.00 91.68  ? 287  ILE A CD1 1 
ATOM   2644 N N   . ASN A 1 364 ? 98.020  -58.605  -10.360 1.00 82.73  ? 288  ASN A N   1 
ATOM   2645 C CA  . ASN A 1 364 ? 96.601  -58.968  -10.369 1.00 83.86  ? 288  ASN A CA  1 
ATOM   2646 C C   . ASN A 1 364 ? 96.248  -60.022  -11.448 1.00 89.48  ? 288  ASN A C   1 
ATOM   2647 O O   . ASN A 1 364 ? 95.109  -60.491  -11.487 1.00 89.91  ? 288  ASN A O   1 
ATOM   2648 C CB  . ASN A 1 364 ? 95.738  -57.720  -10.541 1.00 88.08  ? 288  ASN A CB  1 
ATOM   2649 C CG  . ASN A 1 364 ? 95.520  -56.962  -9.259  1.00 116.37 ? 288  ASN A CG  1 
ATOM   2650 O OD1 . ASN A 1 364 ? 95.365  -57.538  -8.168  1.00 107.50 ? 288  ASN A OD1 1 
ATOM   2651 N ND2 . ASN A 1 364 ? 95.483  -55.644  -9.371  1.00 112.50 ? 288  ASN A ND2 1 
ATOM   2652 N N   . SER A 1 365 ? 97.228  -60.421  -12.285 1.00 86.41  ? 289  SER A N   1 
ATOM   2653 C CA  . SER A 1 365 ? 97.061  -61.426  -13.339 1.00 86.81  ? 289  SER A CA  1 
ATOM   2654 C C   . SER A 1 365 ? 96.919  -62.804  -12.717 1.00 88.98  ? 289  SER A C   1 
ATOM   2655 O O   . SER A 1 365 ? 97.893  -63.339  -12.188 1.00 87.06  ? 289  SER A O   1 
ATOM   2656 C CB  . SER A 1 365 ? 98.247  -61.392  -14.305 1.00 90.72  ? 289  SER A CB  1 
ATOM   2657 O OG  . SER A 1 365 ? 98.315  -62.538  -15.140 1.00 98.05  ? 289  SER A OG  1 
ATOM   2658 N N   . CYS A 1 366 ? 95.706  -63.383  -12.790 1.00 86.28  ? 290  CYS A N   1 
ATOM   2659 C CA  . CYS A 1 366 ? 95.397  -64.711  -12.249 1.00 84.65  ? 290  CYS A CA  1 
ATOM   2660 C C   . CYS A 1 366 ? 96.208  -65.809  -12.973 1.00 86.16  ? 290  CYS A C   1 
ATOM   2661 O O   . CYS A 1 366 ? 96.457  -66.855  -12.376 1.00 83.83  ? 290  CYS A O   1 
ATOM   2662 C CB  . CYS A 1 366 ? 93.897  -64.989  -12.296 1.00 86.64  ? 290  CYS A CB  1 
ATOM   2663 S SG  . CYS A 1 366 ? 93.023  -64.633  -10.742 1.00 89.55  ? 290  CYS A SG  1 
ATOM   2664 N N   . GLU A 1 367 ? 96.650  -65.546  -14.230 1.00 83.14  ? 291  GLU A N   1 
ATOM   2665 C CA  . GLU A 1 367 ? 97.520  -66.424  -15.017 1.00 82.61  ? 291  GLU A CA  1 
ATOM   2666 C C   . GLU A 1 367 ? 98.859  -66.577  -14.286 1.00 83.81  ? 291  GLU A C   1 
ATOM   2667 O O   . GLU A 1 367 ? 99.304  -67.699  -14.065 1.00 82.85  ? 291  GLU A O   1 
ATOM   2668 C CB  . GLU A 1 367 ? 97.744  -65.853  -16.430 1.00 86.49  ? 291  GLU A CB  1 
ATOM   2669 C CG  . GLU A 1 367 ? 96.506  -65.834  -17.310 1.00 102.38 ? 291  GLU A CG  1 
ATOM   2670 C CD  . GLU A 1 367 ? 96.626  -64.967  -18.551 1.00 129.65 ? 291  GLU A CD  1 
ATOM   2671 O OE1 . GLU A 1 367 ? 97.492  -65.261  -19.407 1.00 126.11 ? 291  GLU A OE1 1 
ATOM   2672 O OE2 . GLU A 1 367 ? 95.846  -63.995  -18.670 1.00 125.53 ? 291  GLU A OE2 1 
ATOM   2673 N N   . VAL A 1 368 ? 99.460  -65.441  -13.848 1.00 78.67  ? 292  VAL A N   1 
ATOM   2674 C CA  . VAL A 1 368 ? 100.736 -65.380  -13.118 1.00 75.73  ? 292  VAL A CA  1 
ATOM   2675 C C   . VAL A 1 368 ? 100.544 -65.922  -11.682 1.00 74.41  ? 292  VAL A C   1 
ATOM   2676 O O   . VAL A 1 368 ? 101.405 -66.661  -11.198 1.00 71.97  ? 292  VAL A O   1 
ATOM   2677 C CB  . VAL A 1 368 ? 101.335 -63.939  -13.126 1.00 80.41  ? 292  VAL A CB  1 
ATOM   2678 C CG1 . VAL A 1 368 ? 102.627 -63.854  -12.306 1.00 78.58  ? 292  VAL A CG1 1 
ATOM   2679 C CG2 . VAL A 1 368 ? 101.578 -63.443  -14.553 1.00 82.53  ? 292  VAL A CG2 1 
ATOM   2680 N N   . ILE A 1 369 ? 99.407  -65.580  -11.024 1.00 69.25  ? 293  ILE A N   1 
ATOM   2681 C CA  . ILE A 1 369 ? 99.053  -66.017  -9.661  1.00 66.44  ? 293  ILE A CA  1 
ATOM   2682 C C   . ILE A 1 369 ? 98.914  -67.556  -9.621  1.00 67.69  ? 293  ILE A C   1 
ATOM   2683 O O   . ILE A 1 369 ? 99.338  -68.172  -8.643  1.00 65.66  ? 293  ILE A O   1 
ATOM   2684 C CB  . ILE A 1 369 ? 97.770  -65.296  -9.131  1.00 69.92  ? 293  ILE A CB  1 
ATOM   2685 C CG1 . ILE A 1 369 ? 98.008  -63.788  -8.974  1.00 70.51  ? 293  ILE A CG1 1 
ATOM   2686 C CG2 . ILE A 1 369 ? 97.292  -65.880  -7.788  1.00 69.45  ? 293  ILE A CG2 1 
ATOM   2687 C CD1 . ILE A 1 369 ? 96.736  -62.924  -9.059  1.00 77.85  ? 293  ILE A CD1 1 
ATOM   2688 N N   . ALA A 1 370 ? 98.356  -68.165  -10.690 1.00 64.17  ? 294  ALA A N   1 
ATOM   2689 C CA  . ALA A 1 370 ? 98.182  -69.614  -10.806 1.00 62.88  ? 294  ALA A CA  1 
ATOM   2690 C C   . ALA A 1 370 ? 99.527  -70.336  -10.820 1.00 64.81  ? 294  ALA A C   1 
ATOM   2691 O O   . ALA A 1 370 ? 99.661  -71.364  -10.161 1.00 62.98  ? 294  ALA A O   1 
ATOM   2692 C CB  . ALA A 1 370 ? 97.397  -69.951  -12.060 1.00 65.67  ? 294  ALA A CB  1 
ATOM   2693 N N   . VAL A 1 371 ? 100.528 -69.773  -11.532 1.00 61.97  ? 295  VAL A N   1 
ATOM   2694 C CA  . VAL A 1 371 ? 101.893 -70.310  -11.657 1.00 61.37  ? 295  VAL A CA  1 
ATOM   2695 C C   . VAL A 1 371 ? 102.558 -70.389  -10.259 1.00 64.06  ? 295  VAL A C   1 
ATOM   2696 O O   . VAL A 1 371 ? 103.150 -71.422  -9.935  1.00 62.56  ? 295  VAL A O   1 
ATOM   2697 C CB  . VAL A 1 371 ? 102.746 -69.501  -12.676 1.00 66.22  ? 295  VAL A CB  1 
ATOM   2698 C CG1 . VAL A 1 371 ? 104.189 -70.005  -12.747 1.00 64.86  ? 295  VAL A CG1 1 
ATOM   2699 C CG2 . VAL A 1 371 ? 102.105 -69.522  -14.063 1.00 68.46  ? 295  VAL A CG2 1 
ATOM   2700 N N   . ILE A 1 372 ? 102.427 -69.324  -9.432  1.00 60.83  ? 296  ILE A N   1 
ATOM   2701 C CA  . ILE A 1 372 ? 102.981 -69.273  -8.070  1.00 59.85  ? 296  ILE A CA  1 
ATOM   2702 C C   . ILE A 1 372 ? 102.436 -70.464  -7.261  1.00 65.05  ? 296  ILE A C   1 
ATOM   2703 O O   . ILE A 1 372 ? 103.217 -71.219  -6.685  1.00 63.20  ? 296  ILE A O   1 
ATOM   2704 C CB  . ILE A 1 372 ? 102.701 -67.904  -7.366  1.00 62.89  ? 296  ILE A CB  1 
ATOM   2705 C CG1 . ILE A 1 372 ? 103.259 -66.711  -8.198  1.00 63.72  ? 296  ILE A CG1 1 
ATOM   2706 C CG2 . ILE A 1 372 ? 103.266 -67.895  -5.918  1.00 62.70  ? 296  ILE A CG2 1 
ATOM   2707 C CD1 . ILE A 1 372 ? 102.735 -65.319  -7.820  1.00 67.29  ? 296  ILE A CD1 1 
ATOM   2708 N N   . ASP A 1 373 ? 101.108 -70.653  -7.295  1.00 64.68  ? 297  ASP A N   1 
ATOM   2709 C CA  . ASP A 1 373 ? 100.367 -71.708  -6.606  1.00 65.38  ? 297  ASP A CA  1 
ATOM   2710 C C   . ASP A 1 373 ? 100.811 -73.112  -7.024  1.00 69.28  ? 297  ASP A C   1 
ATOM   2711 O O   . ASP A 1 373 ? 100.946 -73.975  -6.152  1.00 68.28  ? 297  ASP A O   1 
ATOM   2712 C CB  . ASP A 1 373 ? 98.857  -71.545  -6.859  1.00 69.83  ? 297  ASP A CB  1 
ATOM   2713 C CG  . ASP A 1 373 ? 98.256  -70.226  -6.384  1.00 93.95  ? 297  ASP A CG  1 
ATOM   2714 O OD1 . ASP A 1 373 ? 98.679  -69.723  -5.305  1.00 95.66  ? 297  ASP A OD1 1 
ATOM   2715 O OD2 . ASP A 1 373 ? 97.330  -69.720  -7.059  1.00 105.79 ? 297  ASP A OD2 1 
ATOM   2716 N N   . LEU A 1 374 ? 101.034 -73.341  -8.345  1.00 66.82  ? 298  LEU A N   1 
ATOM   2717 C CA  . LEU A 1 374 ? 101.458 -74.637  -8.894  1.00 66.98  ? 298  LEU A CA  1 
ATOM   2718 C C   . LEU A 1 374 ? 102.898 -74.974  -8.485  1.00 67.23  ? 298  LEU A C   1 
ATOM   2719 O O   . LEU A 1 374 ? 103.167 -76.113  -8.121  1.00 66.61  ? 298  LEU A O   1 
ATOM   2720 C CB  . LEU A 1 374 ? 101.353 -74.631  -10.439 1.00 69.53  ? 298  LEU A CB  1 
ATOM   2721 C CG  . LEU A 1 374 ? 100.105 -75.120  -11.175 1.00 77.62  ? 298  LEU A CG  1 
ATOM   2722 C CD1 . LEU A 1 374 ? 98.896  -74.198  -10.971 1.00 78.31  ? 298  LEU A CD1 1 
ATOM   2723 C CD2 . LEU A 1 374 ? 100.381 -75.155  -12.646 1.00 84.08  ? 298  LEU A CD2 1 
ATOM   2724 N N   . ALA A 1 375 ? 103.810 -73.979  -8.525  1.00 60.77  ? 299  ALA A N   1 
ATOM   2725 C CA  . ALA A 1 375 ? 105.233 -74.124  -8.219  1.00 58.36  ? 299  ALA A CA  1 
ATOM   2726 C C   . ALA A 1 375 ? 105.530 -74.210  -6.718  1.00 57.67  ? 299  ALA A C   1 
ATOM   2727 O O   . ALA A 1 375 ? 106.506 -74.860  -6.347  1.00 55.62  ? 299  ALA A O   1 
ATOM   2728 C CB  . ALA A 1 375 ? 106.007 -72.956  -8.817  1.00 59.42  ? 299  ALA A CB  1 
ATOM   2729 N N   . LEU A 1 376 ? 104.715 -73.543  -5.867  1.00 52.04  ? 300  LEU A N   1 
ATOM   2730 C CA  . LEU A 1 376 ? 104.910 -73.435  -4.416  1.00 49.61  ? 300  LEU A CA  1 
ATOM   2731 C C   . LEU A 1 376 ? 105.163 -74.777  -3.674  1.00 50.19  ? 300  LEU A C   1 
ATOM   2732 O O   . LEU A 1 376 ? 106.115 -74.786  -2.891  1.00 48.52  ? 300  LEU A O   1 
ATOM   2733 C CB  . LEU A 1 376 ? 103.758 -72.685  -3.743  1.00 49.67  ? 300  LEU A CB  1 
ATOM   2734 C CG  . LEU A 1 376 ? 104.061 -72.054  -2.379  1.00 53.18  ? 300  LEU A CG  1 
ATOM   2735 C CD1 . LEU A 1 376 ? 105.176 -71.001  -2.462  1.00 52.66  ? 300  LEU A CD1 1 
ATOM   2736 C CD2 . LEU A 1 376 ? 102.817 -71.453  -1.797  1.00 56.12  ? 300  LEU A CD2 1 
ATOM   2737 N N   . PRO A 1 377 ? 104.418 -75.901  -3.856  1.00 45.90  ? 301  PRO A N   1 
ATOM   2738 C CA  . PRO A 1 377 ? 104.776 -77.123  -3.101  1.00 45.11  ? 301  PRO A CA  1 
ATOM   2739 C C   . PRO A 1 377 ? 106.176 -77.651  -3.467  1.00 50.30  ? 301  PRO A C   1 
ATOM   2740 O O   . PRO A 1 377 ? 106.864 -78.204  -2.599  1.00 49.37  ? 301  PRO A O   1 
ATOM   2741 C CB  . PRO A 1 377 ? 103.669 -78.123  -3.471  1.00 47.37  ? 301  PRO A CB  1 
ATOM   2742 C CG  . PRO A 1 377 ? 102.564 -77.297  -4.048  1.00 52.11  ? 301  PRO A CG  1 
ATOM   2743 C CD  . PRO A 1 377 ? 103.236 -76.138  -4.714  1.00 47.86  ? 301  PRO A CD  1 
ATOM   2744 N N   . PHE A 1 378 ? 106.616 -77.435  -4.734  1.00 48.49  ? 302  PHE A N   1 
ATOM   2745 C CA  . PHE A 1 378 ? 107.941 -77.852  -5.221  1.00 48.86  ? 302  PHE A CA  1 
ATOM   2746 C C   . PHE A 1 378 ? 109.050 -76.947  -4.651  1.00 51.66  ? 302  PHE A C   1 
ATOM   2747 O O   . PHE A 1 378 ? 110.147 -77.430  -4.380  1.00 49.98  ? 302  PHE A O   1 
ATOM   2748 C CB  . PHE A 1 378 ? 108.011 -77.896  -6.753  1.00 52.05  ? 302  PHE A CB  1 
ATOM   2749 C CG  . PHE A 1 378 ? 107.079 -78.904  -7.381  1.00 54.90  ? 302  PHE A CG  1 
ATOM   2750 C CD1 . PHE A 1 378 ? 107.439 -80.244  -7.477  1.00 58.57  ? 302  PHE A CD1 1 
ATOM   2751 C CD2 . PHE A 1 378 ? 105.848 -78.512  -7.897  1.00 57.64  ? 302  PHE A CD2 1 
ATOM   2752 C CE1 . PHE A 1 378 ? 106.579 -81.176  -8.072  1.00 60.45  ? 302  PHE A CE1 1 
ATOM   2753 C CE2 . PHE A 1 378 ? 104.995 -79.441  -8.498  1.00 61.41  ? 302  PHE A CE2 1 
ATOM   2754 C CZ  . PHE A 1 378 ? 105.368 -80.767  -8.583  1.00 59.91  ? 302  PHE A CZ  1 
ATOM   2755 N N   . ALA A 1 379 ? 108.757 -75.641  -4.451  1.00 48.20  ? 303  ALA A N   1 
ATOM   2756 C CA  . ALA A 1 379 ? 109.688 -74.681  -3.856  1.00 46.62  ? 303  ALA A CA  1 
ATOM   2757 C C   . ALA A 1 379 ? 109.777 -74.897  -2.336  1.00 50.13  ? 303  ALA A C   1 
ATOM   2758 O O   . ALA A 1 379 ? 110.826 -74.624  -1.741  1.00 49.36  ? 303  ALA A O   1 
ATOM   2759 C CB  . ALA A 1 379 ? 109.250 -73.276  -4.173  1.00 47.52  ? 303  ALA A CB  1 
ATOM   2760 N N   . ILE A 1 380 ? 108.686 -75.441  -1.724  1.00 46.79  ? 304  ILE A N   1 
ATOM   2761 C CA  . ILE A 1 380 ? 108.585 -75.811  -0.297  1.00 45.44  ? 304  ILE A CA  1 
ATOM   2762 C C   . ILE A 1 380 ? 109.485 -77.042  -0.035  1.00 47.95  ? 304  ILE A C   1 
ATOM   2763 O O   . ILE A 1 380 ? 110.215 -77.069  0.958   1.00 46.17  ? 304  ILE A O   1 
ATOM   2764 C CB  . ILE A 1 380 ? 107.092 -76.041  0.149   1.00 47.87  ? 304  ILE A CB  1 
ATOM   2765 C CG1 . ILE A 1 380 ? 106.403 -74.689  0.454   1.00 48.29  ? 304  ILE A CG1 1 
ATOM   2766 C CG2 . ILE A 1 380 ? 106.978 -76.976  1.365   1.00 47.03  ? 304  ILE A CG2 1 
ATOM   2767 C CD1 . ILE A 1 380 ? 104.853 -74.721  0.551   1.00 56.17  ? 304  ILE A CD1 1 
ATOM   2768 N N   . LEU A 1 381 ? 109.436 -78.035  -0.942  1.00 45.28  ? 305  LEU A N   1 
ATOM   2769 C CA  . LEU A 1 381 ? 110.201 -79.286  -0.863  1.00 45.21  ? 305  LEU A CA  1 
ATOM   2770 C C   . LEU A 1 381 ? 111.730 -79.036  -0.899  1.00 50.42  ? 305  LEU A C   1 
ATOM   2771 O O   . LEU A 1 381 ? 112.460 -79.743  -0.203  1.00 49.71  ? 305  LEU A O   1 
ATOM   2772 C CB  . LEU A 1 381 ? 109.782 -80.224  -1.996  1.00 45.67  ? 305  LEU A CB  1 
ATOM   2773 C CG  . LEU A 1 381 ? 110.385 -81.607  -1.988  1.00 50.50  ? 305  LEU A CG  1 
ATOM   2774 C CD1 . LEU A 1 381 ? 109.849 -82.430  -0.851  1.00 50.47  ? 305  LEU A CD1 1 
ATOM   2775 C CD2 . LEU A 1 381 ? 110.152 -82.295  -3.305  1.00 55.27  ? 305  LEU A CD2 1 
ATOM   2776 N N   . LEU A 1 382 ? 112.199 -78.021  -1.679  1.00 47.25  ? 306  LEU A N   1 
ATOM   2777 C CA  . LEU A 1 382 ? 113.607 -77.619  -1.768  1.00 46.41  ? 306  LEU A CA  1 
ATOM   2778 C C   . LEU A 1 382 ? 114.144 -77.156  -0.412  1.00 48.85  ? 306  LEU A C   1 
ATOM   2779 O O   . LEU A 1 382 ? 115.311 -77.399  -0.112  1.00 48.48  ? 306  LEU A O   1 
ATOM   2780 C CB  . LEU A 1 382 ? 113.804 -76.514  -2.804  1.00 47.11  ? 306  LEU A CB  1 
ATOM   2781 C CG  . LEU A 1 382 ? 113.934 -76.955  -4.262  1.00 52.99  ? 306  LEU A CG  1 
ATOM   2782 C CD1 . LEU A 1 382 ? 113.776 -75.768  -5.196  1.00 54.07  ? 306  LEU A CD1 1 
ATOM   2783 C CD2 . LEU A 1 382 ? 115.271 -77.634  -4.525  1.00 55.13  ? 306  LEU A CD2 1 
ATOM   2784 N N   . GLY A 1 383 ? 113.285 -76.531  0.394   1.00 45.60  ? 307  GLY A N   1 
ATOM   2785 C CA  . GLY A 1 383 ? 113.596 -76.095  1.750   1.00 45.77  ? 307  GLY A CA  1 
ATOM   2786 C C   . GLY A 1 383 ? 113.927 -77.271  2.644   1.00 52.37  ? 307  GLY A C   1 
ATOM   2787 O O   . GLY A 1 383 ? 114.893 -77.211  3.409   1.00 54.06  ? 307  GLY A O   1 
ATOM   2788 N N   . PHE A 1 384 ? 113.153 -78.368  2.518   1.00 49.10  ? 308  PHE A N   1 
ATOM   2789 C CA  . PHE A 1 384 ? 113.346 -79.626  3.257   1.00 49.07  ? 308  PHE A CA  1 
ATOM   2790 C C   . PHE A 1 384 ? 114.575 -80.379  2.751   1.00 53.62  ? 308  PHE A C   1 
ATOM   2791 O O   . PHE A 1 384 ? 115.215 -81.076  3.534   1.00 53.44  ? 308  PHE A O   1 
ATOM   2792 C CB  . PHE A 1 384 ? 112.106 -80.536  3.145   1.00 50.97  ? 308  PHE A CB  1 
ATOM   2793 C CG  . PHE A 1 384 ? 110.949 -80.171  4.038   1.00 52.79  ? 308  PHE A CG  1 
ATOM   2794 C CD1 . PHE A 1 384 ? 110.962 -80.498  5.389   1.00 56.62  ? 308  PHE A CD1 1 
ATOM   2795 C CD2 . PHE A 1 384 ? 109.839 -79.510  3.529   1.00 54.75  ? 308  PHE A CD2 1 
ATOM   2796 C CE1 . PHE A 1 384 ? 109.890 -80.149  6.218   1.00 57.69  ? 308  PHE A CE1 1 
ATOM   2797 C CE2 . PHE A 1 384 ? 108.766 -79.172  4.357   1.00 57.79  ? 308  PHE A CE2 1 
ATOM   2798 C CZ  . PHE A 1 384 ? 108.803 -79.483  5.699   1.00 56.16  ? 308  PHE A CZ  1 
ATOM   2799 N N   . THR A 1 385 ? 114.897 -80.239  1.445   1.00 51.09  ? 309  THR A N   1 
ATOM   2800 C CA  . THR A 1 385 ? 116.043 -80.867  0.768   1.00 51.75  ? 309  THR A CA  1 
ATOM   2801 C C   . THR A 1 385 ? 117.365 -80.338  1.358   1.00 56.14  ? 309  THR A C   1 
ATOM   2802 O O   . THR A 1 385 ? 118.343 -81.086  1.403   1.00 55.77  ? 309  THR A O   1 
ATOM   2803 C CB  . THR A 1 385 ? 115.960 -80.640  -0.752  1.00 60.31  ? 309  THR A CB  1 
ATOM   2804 O OG1 . THR A 1 385 ? 114.652 -80.998  -1.196  1.00 62.16  ? 309  THR A OG1 1 
ATOM   2805 C CG2 . THR A 1 385 ? 116.996 -81.442  -1.540  1.00 57.88  ? 309  THR A CG2 1 
ATOM   2806 N N   . ASN A 1 386 ? 117.379 -79.074  1.845   1.00 52.69  ? 310  ASN A N   1 
ATOM   2807 C CA  . ASN A 1 386 ? 118.536 -78.447  2.489   1.00 52.67  ? 310  ASN A CA  1 
ATOM   2808 C C   . ASN A 1 386 ? 118.999 -79.274  3.703   1.00 57.33  ? 310  ASN A C   1 
ATOM   2809 O O   . ASN A 1 386 ? 120.197 -79.333  3.966   1.00 58.09  ? 310  ASN A O   1 
ATOM   2810 C CB  . ASN A 1 386 ? 118.194 -77.017  2.903   1.00 52.64  ? 310  ASN A CB  1 
ATOM   2811 C CG  . ASN A 1 386 ? 119.329 -76.222  3.512   1.00 71.21  ? 310  ASN A CG  1 
ATOM   2812 O OD1 . ASN A 1 386 ? 119.238 -75.751  4.655   1.00 63.76  ? 310  ASN A OD1 1 
ATOM   2813 N ND2 . ASN A 1 386 ? 120.399 -76.011  2.752   1.00 61.94  ? 310  ASN A ND2 1 
ATOM   2814 N N   . SER A 1 387 ? 118.054 -79.941  4.404   1.00 53.63  ? 311  SER A N   1 
ATOM   2815 C CA  . SER A 1 387 ? 118.301 -80.814  5.556   1.00 53.64  ? 311  SER A CA  1 
ATOM   2816 C C   . SER A 1 387 ? 119.030 -82.096  5.142   1.00 56.37  ? 311  SER A C   1 
ATOM   2817 O O   . SER A 1 387 ? 119.703 -82.705  5.972   1.00 55.54  ? 311  SER A O   1 
ATOM   2818 C CB  . SER A 1 387 ? 116.986 -81.174  6.241   1.00 58.39  ? 311  SER A CB  1 
ATOM   2819 O OG  . SER A 1 387 ? 116.323 -80.018  6.723   1.00 70.18  ? 311  SER A OG  1 
ATOM   2820 N N   . CYS A 1 388 ? 118.870 -82.515  3.869   1.00 53.48  ? 312  CYS A N   1 
ATOM   2821 C CA  . CYS A 1 388 ? 119.526 -83.698  3.307   1.00 54.74  ? 312  CYS A CA  1 
ATOM   2822 C C   . CYS A 1 388 ? 120.945 -83.326  2.857   1.00 58.36  ? 312  CYS A C   1 
ATOM   2823 O O   . CYS A 1 388 ? 121.827 -84.181  2.863   1.00 60.19  ? 312  CYS A O   1 
ATOM   2824 C CB  . CYS A 1 388 ? 118.722 -84.300  2.153   1.00 56.03  ? 312  CYS A CB  1 
ATOM   2825 S SG  . CYS A 1 388 ? 116.932 -84.428  2.443   1.00 60.03  ? 312  CYS A SG  1 
ATOM   2826 N N   . VAL A 1 389 ? 121.155 -82.062  2.453   1.00 52.83  ? 313  VAL A N   1 
ATOM   2827 C CA  . VAL A 1 389 ? 122.439 -81.544  1.984   1.00 52.52  ? 313  VAL A CA  1 
ATOM   2828 C C   . VAL A 1 389 ? 123.376 -81.318  3.180   1.00 59.99  ? 313  VAL A C   1 
ATOM   2829 O O   . VAL A 1 389 ? 124.533 -81.733  3.110   1.00 61.35  ? 313  VAL A O   1 
ATOM   2830 C CB  . VAL A 1 389 ? 122.279 -80.256  1.130   1.00 54.97  ? 313  VAL A CB  1 
ATOM   2831 C CG1 . VAL A 1 389 ? 123.618 -79.789  0.566   1.00 55.12  ? 313  VAL A CG1 1 
ATOM   2832 C CG2 . VAL A 1 389 ? 121.280 -80.460  -0.002  1.00 54.43  ? 313  VAL A CG2 1 
ATOM   2833 N N   . ASN A 1 390 ? 122.873 -80.683  4.271   1.00 57.57  ? 314  ASN A N   1 
ATOM   2834 C CA  . ASN A 1 390 ? 123.598 -80.336  5.510   1.00 58.45  ? 314  ASN A CA  1 
ATOM   2835 C C   . ASN A 1 390 ? 124.588 -81.427  6.013   1.00 63.35  ? 314  ASN A C   1 
ATOM   2836 O O   . ASN A 1 390 ? 125.736 -81.050  6.252   1.00 63.29  ? 314  ASN A O   1 
ATOM   2837 C CB  . ASN A 1 390 ? 122.635 -79.953  6.635   1.00 59.79  ? 314  ASN A CB  1 
ATOM   2838 C CG  . ASN A 1 390 ? 121.979 -78.596  6.469   1.00 82.07  ? 314  ASN A CG  1 
ATOM   2839 O OD1 . ASN A 1 390 ? 122.403 -77.743  5.671   1.00 76.69  ? 314  ASN A OD1 1 
ATOM   2840 N ND2 . ASN A 1 390 ? 120.912 -78.370  7.221   1.00 72.55  ? 314  ASN A ND2 1 
ATOM   2841 N N   . PRO A 1 391 ? 124.245 -82.744  6.138   1.00 60.87  ? 315  PRO A N   1 
ATOM   2842 C CA  . PRO A 1 391 ? 125.255 -83.733  6.587   1.00 61.76  ? 315  PRO A CA  1 
ATOM   2843 C C   . PRO A 1 391 ? 126.529 -83.783  5.728   1.00 64.79  ? 315  PRO A C   1 
ATOM   2844 O O   . PRO A 1 391 ? 127.613 -84.006  6.270   1.00 65.37  ? 315  PRO A O   1 
ATOM   2845 C CB  . PRO A 1 391 ? 124.509 -85.068  6.488   1.00 63.87  ? 315  PRO A CB  1 
ATOM   2846 C CG  . PRO A 1 391 ? 123.085 -84.713  6.643   1.00 67.52  ? 315  PRO A CG  1 
ATOM   2847 C CD  . PRO A 1 391 ? 122.938 -83.404  5.926   1.00 62.26  ? 315  PRO A CD  1 
ATOM   2848 N N   . PHE A 1 392 ? 126.397 -83.553  4.404   1.00 59.32  ? 316  PHE A N   1 
ATOM   2849 C CA  . PHE A 1 392 ? 127.498 -83.556  3.438   1.00 58.39  ? 316  PHE A CA  1 
ATOM   2850 C C   . PHE A 1 392 ? 128.328 -82.267  3.498   1.00 60.77  ? 316  PHE A C   1 
ATOM   2851 O O   . PHE A 1 392 ? 129.496 -82.282  3.114   1.00 60.43  ? 316  PHE A O   1 
ATOM   2852 C CB  . PHE A 1 392 ? 126.959 -83.765  2.013   1.00 59.32  ? 316  PHE A CB  1 
ATOM   2853 C CG  . PHE A 1 392 ? 126.342 -85.118  1.758   1.00 60.34  ? 316  PHE A CG  1 
ATOM   2854 C CD1 . PHE A 1 392 ? 124.992 -85.342  2.001   1.00 62.71  ? 316  PHE A CD1 1 
ATOM   2855 C CD2 . PHE A 1 392 ? 127.105 -86.164  1.256   1.00 63.08  ? 316  PHE A CD2 1 
ATOM   2856 C CE1 . PHE A 1 392 ? 124.421 -86.599  1.765   1.00 64.00  ? 316  PHE A CE1 1 
ATOM   2857 C CE2 . PHE A 1 392 ? 126.535 -87.420  1.022   1.00 66.03  ? 316  PHE A CE2 1 
ATOM   2858 C CZ  . PHE A 1 392 ? 125.197 -87.629  1.274   1.00 63.54  ? 316  PHE A CZ  1 
ATOM   2859 N N   . LEU A 1 393 ? 127.733 -81.164  3.968   1.00 56.99  ? 317  LEU A N   1 
ATOM   2860 C CA  . LEU A 1 393 ? 128.391 -79.854  4.032   1.00 57.47  ? 317  LEU A CA  1 
ATOM   2861 C C   . LEU A 1 393 ? 129.191 -79.617  5.300   1.00 61.08  ? 317  LEU A C   1 
ATOM   2862 O O   . LEU A 1 393 ? 130.145 -78.845  5.260   1.00 60.72  ? 317  LEU A O   1 
ATOM   2863 C CB  . LEU A 1 393 ? 127.352 -78.719  3.927   1.00 56.98  ? 317  LEU A CB  1 
ATOM   2864 C CG  . LEU A 1 393 ? 126.640 -78.494  2.603   1.00 61.60  ? 317  LEU A CG  1 
ATOM   2865 C CD1 . LEU A 1 393 ? 125.574 -77.442  2.753   1.00 61.26  ? 317  LEU A CD1 1 
ATOM   2866 C CD2 . LEU A 1 393 ? 127.614 -78.082  1.513   1.00 65.38  ? 317  LEU A CD2 1 
ATOM   2867 N N   . TYR A 1 394 ? 128.777 -80.193  6.431   1.00 58.40  ? 318  TYR A N   1 
ATOM   2868 C CA  . TYR A 1 394 ? 129.446 -79.882  7.682   1.00 60.53  ? 318  TYR A CA  1 
ATOM   2869 C C   . TYR A 1 394 ? 130.037 -81.104  8.397   1.00 68.59  ? 318  TYR A C   1 
ATOM   2870 O O   . TYR A 1 394 ? 131.200 -81.045  8.808   1.00 69.44  ? 318  TYR A O   1 
ATOM   2871 C CB  . TYR A 1 394 ? 128.477 -79.136  8.617   1.00 62.03  ? 318  TYR A CB  1 
ATOM   2872 C CG  . TYR A 1 394 ? 128.021 -77.788  8.089   1.00 64.39  ? 318  TYR A CG  1 
ATOM   2873 C CD1 . TYR A 1 394 ? 128.880 -76.691  8.083   1.00 67.65  ? 318  TYR A CD1 1 
ATOM   2874 C CD2 . TYR A 1 394 ? 126.730 -77.605  7.605   1.00 63.96  ? 318  TYR A CD2 1 
ATOM   2875 C CE1 . TYR A 1 394 ? 128.473 -75.453  7.586   1.00 68.14  ? 318  TYR A CE1 1 
ATOM   2876 C CE2 . TYR A 1 394 ? 126.309 -76.367  7.113   1.00 64.73  ? 318  TYR A CE2 1 
ATOM   2877 C CZ  . TYR A 1 394 ? 127.183 -75.291  7.113   1.00 75.27  ? 318  TYR A CZ  1 
ATOM   2878 O OH  . TYR A 1 394 ? 126.789 -74.062  6.630   1.00 80.98  ? 318  TYR A OH  1 
ATOM   2879 N N   . CYS A 1 395 ? 129.260 -82.193  8.562   1.00 66.34  ? 319  CYS A N   1 
ATOM   2880 C CA  . CYS A 1 395 ? 129.732 -83.373  9.288   1.00 67.08  ? 319  CYS A CA  1 
ATOM   2881 C C   . CYS A 1 395 ? 130.673 -84.232  8.455   1.00 69.22  ? 319  CYS A C   1 
ATOM   2882 O O   . CYS A 1 395 ? 131.712 -84.636  8.972   1.00 70.38  ? 319  CYS A O   1 
ATOM   2883 C CB  . CYS A 1 395 ? 128.564 -84.204  9.813   1.00 67.60  ? 319  CYS A CB  1 
ATOM   2884 S SG  . CYS A 1 395 ? 129.061 -85.605  10.858  1.00 73.15  ? 319  CYS A SG  1 
ATOM   2885 N N   . PHE A 1 396 ? 130.305 -84.549  7.200   1.00 63.38  ? 320  PHE A N   1 
ATOM   2886 C CA  . PHE A 1 396 ? 131.102 -85.445  6.356   1.00 63.32  ? 320  PHE A CA  1 
ATOM   2887 C C   . PHE A 1 396 ? 132.405 -84.793  5.855   1.00 72.22  ? 320  PHE A C   1 
ATOM   2888 O O   . PHE A 1 396 ? 133.309 -85.515  5.433   1.00 73.99  ? 320  PHE A O   1 
ATOM   2889 C CB  . PHE A 1 396 ? 130.272 -86.025  5.187   1.00 62.94  ? 320  PHE A CB  1 
ATOM   2890 C CG  . PHE A 1 396 ? 129.016 -86.792  5.567   1.00 62.08  ? 320  PHE A CG  1 
ATOM   2891 C CD1 . PHE A 1 396 ? 128.906 -87.416  6.802   1.00 63.65  ? 320  PHE A CD1 1 
ATOM   2892 C CD2 . PHE A 1 396 ? 127.952 -86.899  4.680   1.00 61.93  ? 320  PHE A CD2 1 
ATOM   2893 C CE1 . PHE A 1 396 ? 127.748 -88.097  7.151   1.00 63.74  ? 320  PHE A CE1 1 
ATOM   2894 C CE2 . PHE A 1 396 ? 126.792 -87.589  5.033   1.00 63.42  ? 320  PHE A CE2 1 
ATOM   2895 C CZ  . PHE A 1 396 ? 126.703 -88.190  6.262   1.00 61.74  ? 320  PHE A CZ  1 
ATOM   2896 N N   . VAL A 1 397 ? 132.534 -83.456  5.957   1.00 70.47  ? 321  VAL A N   1 
ATOM   2897 C CA  . VAL A 1 397 ? 133.766 -82.746  5.580   1.00 72.32  ? 321  VAL A CA  1 
ATOM   2898 C C   . VAL A 1 397 ? 134.284 -81.909  6.791   1.00 78.51  ? 321  VAL A C   1 
ATOM   2899 O O   . VAL A 1 397 ? 134.974 -80.903  6.618   1.00 78.47  ? 321  VAL A O   1 
ATOM   2900 C CB  . VAL A 1 397 ? 133.637 -81.901  4.280   1.00 76.02  ? 321  VAL A CB  1 
ATOM   2901 C CG1 . VAL A 1 397 ? 133.566 -82.789  3.036   1.00 76.07  ? 321  VAL A CG1 1 
ATOM   2902 C CG2 . VAL A 1 397 ? 132.466 -80.928  4.340   1.00 74.41  ? 321  VAL A CG2 1 
ATOM   2903 N N   . GLY A 1 398 ? 133.961 -82.375  7.998   1.00 76.55  ? 322  GLY A N   1 
ATOM   2904 C CA  . GLY A 1 398 ? 134.345 -81.754  9.261   1.00 77.54  ? 322  GLY A CA  1 
ATOM   2905 C C   . GLY A 1 398 ? 135.814 -81.902  9.587   1.00 82.76  ? 322  GLY A C   1 
ATOM   2906 O O   . GLY A 1 398 ? 136.484 -80.899  9.849   1.00 83.53  ? 322  GLY A O   1 
ATOM   2907 N N   . ASN A 1 399 ? 136.324 -83.152  9.567   1.00 78.87  ? 323  ASN A N   1 
ATOM   2908 C CA  . ASN A 1 399 ? 137.724 -83.471  9.854   1.00 80.29  ? 323  ASN A CA  1 
ATOM   2909 C C   . ASN A 1 399 ? 138.666 -82.840  8.818   1.00 84.79  ? 323  ASN A C   1 
ATOM   2910 O O   . ASN A 1 399 ? 139.698 -82.282  9.192   1.00 85.88  ? 323  ASN A O   1 
ATOM   2911 C CB  . ASN A 1 399 ? 137.927 -84.992  9.909   1.00 79.87  ? 323  ASN A CB  1 
ATOM   2912 C CG  . ASN A 1 399 ? 137.065 -85.719  10.914  1.00 97.48  ? 323  ASN A CG  1 
ATOM   2913 O OD1 . ASN A 1 399 ? 136.541 -85.146  11.877  1.00 94.26  ? 323  ASN A OD1 1 
ATOM   2914 N ND2 . ASN A 1 399 ? 136.926 -87.019  10.725  1.00 88.22  ? 323  ASN A ND2 1 
ATOM   2915 N N   . ARG A 1 400 ? 138.277 -82.902  7.528   1.00 80.36  ? 324  ARG A N   1 
ATOM   2916 C CA  . ARG A 1 400 ? 139.001 -82.386  6.360   1.00 80.19  ? 324  ARG A CA  1 
ATOM   2917 C C   . ARG A 1 400 ? 139.250 -80.870  6.460   1.00 83.74  ? 324  ARG A C   1 
ATOM   2918 O O   . ARG A 1 400 ? 140.351 -80.426  6.134   1.00 84.62  ? 324  ARG A O   1 
ATOM   2919 C CB  . ARG A 1 400 ? 138.213 -82.724  5.077   1.00 78.92  ? 324  ARG A CB  1 
ATOM   2920 C CG  . ARG A 1 400 ? 138.898 -82.387  3.758   1.00 88.09  ? 324  ARG A CG  1 
ATOM   2921 C CD  . ARG A 1 400 ? 137.945 -82.588  2.599   1.00 96.61  ? 324  ARG A CD  1 
ATOM   2922 N NE  . ARG A 1 400 ? 138.420 -83.628  1.688   1.00 110.43 ? 324  ARG A NE  1 
ATOM   2923 C CZ  . ARG A 1 400 ? 137.641 -84.296  0.845   1.00 129.79 ? 324  ARG A CZ  1 
ATOM   2924 N NH1 . ARG A 1 400 ? 136.335 -84.055  0.802   1.00 116.98 ? 324  ARG A NH1 1 
ATOM   2925 N NH2 . ARG A 1 400 ? 138.158 -85.222  0.047   1.00 119.58 ? 324  ARG A NH2 1 
ATOM   2926 N N   . PHE A 1 401 ? 138.239 -80.090  6.904   1.00 78.96  ? 325  PHE A N   1 
ATOM   2927 C CA  . PHE A 1 401 ? 138.322 -78.635  7.041   1.00 79.08  ? 325  PHE A CA  1 
ATOM   2928 C C   . PHE A 1 401 ? 139.385 -78.225  8.062   1.00 87.00  ? 325  PHE A C   1 
ATOM   2929 O O   . PHE A 1 401 ? 140.189 -77.342  7.763   1.00 87.48  ? 325  PHE A O   1 
ATOM   2930 C CB  . PHE A 1 401 ? 136.959 -78.045  7.432   1.00 79.00  ? 325  PHE A CB  1 
ATOM   2931 C CG  . PHE A 1 401 ? 136.884 -76.546  7.320   1.00 80.49  ? 325  PHE A CG  1 
ATOM   2932 C CD1 . PHE A 1 401 ? 136.573 -75.937  6.109   1.00 82.84  ? 325  PHE A CD1 1 
ATOM   2933 C CD2 . PHE A 1 401 ? 137.116 -75.737  8.427   1.00 83.85  ? 325  PHE A CD2 1 
ATOM   2934 C CE1 . PHE A 1 401 ? 136.514 -74.542  6.003   1.00 84.22  ? 325  PHE A CE1 1 
ATOM   2935 C CE2 . PHE A 1 401 ? 137.060 -74.344  8.321   1.00 87.42  ? 325  PHE A CE2 1 
ATOM   2936 C CZ  . PHE A 1 401 ? 136.756 -73.755  7.111   1.00 84.68  ? 325  PHE A CZ  1 
ATOM   2937 N N   . GLN A 1 402 ? 139.392 -78.874  9.252   1.00 85.38  ? 326  GLN A N   1 
ATOM   2938 C CA  . GLN A 1 402 ? 140.321 -78.606  10.354  1.00 87.36  ? 326  GLN A CA  1 
ATOM   2939 C C   . GLN A 1 402 ? 141.760 -79.008  10.011  1.00 91.70  ? 326  GLN A C   1 
ATOM   2940 O O   . GLN A 1 402 ? 142.674 -78.246  10.312  1.00 93.24  ? 326  GLN A O   1 
ATOM   2941 C CB  . GLN A 1 402 ? 139.869 -79.330  11.630  1.00 89.16  ? 326  GLN A CB  1 
ATOM   2942 N N   . GLN A 1 403 ? 141.959 -80.194  9.397   1.00 86.98  ? 327  GLN A N   1 
ATOM   2943 C CA  . GLN A 1 403 ? 143.271 -80.721  9.009   1.00 88.00  ? 327  GLN A CA  1 
ATOM   2944 C C   . GLN A 1 403 ? 143.933 -79.883  7.913   1.00 93.54  ? 327  GLN A C   1 
ATOM   2945 O O   . GLN A 1 403 ? 145.150 -79.709  7.945   1.00 96.02  ? 327  GLN A O   1 
ATOM   2946 C CB  . GLN A 1 403 ? 143.162 -82.181  8.556   1.00 88.50  ? 327  GLN A CB  1 
ATOM   2947 C CG  . GLN A 1 403 ? 143.506 -83.178  9.652   1.00 110.26 ? 327  GLN A CG  1 
ATOM   2948 C CD  . GLN A 1 403 ? 142.373 -83.381  10.631  1.00 134.69 ? 327  GLN A CD  1 
ATOM   2949 O OE1 . GLN A 1 403 ? 141.494 -84.235  10.440  1.00 128.11 ? 327  GLN A OE1 1 
ATOM   2950 N NE2 . GLN A 1 403 ? 142.381 -82.615  11.715  1.00 129.88 ? 327  GLN A NE2 1 
ATOM   2951 N N   . LYS A 1 404 ? 143.147 -79.360  6.958   1.00 88.99  ? 328  LYS A N   1 
ATOM   2952 C CA  . LYS A 1 404 ? 143.662 -78.533  5.863   1.00 89.70  ? 328  LYS A CA  1 
ATOM   2953 C C   . LYS A 1 404 ? 143.876 -77.067  6.307   1.00 96.86  ? 328  LYS A C   1 
ATOM   2954 O O   . LYS A 1 404 ? 144.658 -76.351  5.674   1.00 98.53  ? 328  LYS A O   1 
ATOM   2955 C CB  . LYS A 1 404 ? 142.729 -78.611  4.646   1.00 89.98  ? 328  LYS A CB  1 
ATOM   2956 N N   . LEU A 1 405 ? 143.203 -76.628  7.397   1.00 93.51  ? 329  LEU A N   1 
ATOM   2957 C CA  . LEU A 1 405 ? 143.339 -75.274  7.950   1.00 94.46  ? 329  LEU A CA  1 
ATOM   2958 C C   . LEU A 1 405 ? 144.571 -75.188  8.872   1.00 100.34 ? 329  LEU A C   1 
ATOM   2959 O O   . LEU A 1 405 ? 145.295 -74.193  8.833   1.00 101.32 ? 329  LEU A O   1 
ATOM   2960 C CB  . LEU A 1 405 ? 142.071 -74.838  8.695   1.00 93.39  ? 329  LEU A CB  1 
ATOM   2961 N N   . ARG A 1 406 ? 144.825 -76.243  9.672   1.00 97.49  ? 330  ARG A N   1 
ATOM   2962 C CA  . ARG A 1 406 ? 145.985 -76.341  10.565  1.00 100.08 ? 330  ARG A CA  1 
ATOM   2963 C C   . ARG A 1 406 ? 147.281 -76.555  9.750   1.00 106.98 ? 330  ARG A C   1 
ATOM   2964 O O   . ARG A 1 406 ? 148.381 -76.453  10.302  1.00 109.14 ? 330  ARG A O   1 
ATOM   2965 C CB  . ARG A 1 406 ? 145.790 -77.469  11.588  1.00 99.19  ? 330  ARG A CB  1 
ATOM   2966 N N   . SER A 1 407 ? 147.139 -76.824  8.431   1.00 102.96 ? 331  SER A N   1 
ATOM   2967 C CA  . SER A 1 407 ? 148.229 -77.013  7.473   1.00 104.31 ? 331  SER A CA  1 
ATOM   2968 C C   . SER A 1 407 ? 148.698 -75.667  6.892   1.00 109.25 ? 331  SER A C   1 
ATOM   2969 O O   . SER A 1 407 ? 149.894 -75.385  6.921   1.00 110.90 ? 331  SER A O   1 
ATOM   2970 C CB  . SER A 1 407 ? 147.788 -77.948  6.349   1.00 107.18 ? 331  SER A CB  1 
ATOM   2971 O OG  . SER A 1 407 ? 148.760 -78.028  5.318   1.00 120.19 ? 331  SER A OG  1 
ATOM   2972 N N   . VAL A 1 408 ? 147.756 -74.852  6.367   1.00 104.77 ? 332  VAL A N   1 
ATOM   2973 C CA  . VAL A 1 408 ? 148.004 -73.535  5.757   1.00 105.58 ? 332  VAL A CA  1 
ATOM   2974 C C   . VAL A 1 408 ? 148.549 -72.513  6.791   1.00 112.21 ? 332  VAL A C   1 
ATOM   2975 O O   . VAL A 1 408 ? 149.446 -71.738  6.447   1.00 113.93 ? 332  VAL A O   1 
ATOM   2976 C CB  . VAL A 1 408 ? 146.763 -72.972  5.004   1.00 106.96 ? 332  VAL A CB  1 
ATOM   2977 C CG1 . VAL A 1 408 ? 146.568 -73.670  3.665   1.00 105.55 ? 332  VAL A CG1 1 
ATOM   2978 C CG2 . VAL A 1 408 ? 145.493 -73.054  5.837   1.00 104.79 ? 332  VAL A CG2 1 
ATOM   2979 N N   . PHE A 1 409 ? 148.032 -72.529  8.041   1.00 108.49 ? 333  PHE A N   1 
ATOM   2980 C CA  . PHE A 1 409 ? 148.447 -71.622  9.118   1.00 133.75 ? 333  PHE A CA  1 
ATOM   2981 C C   . PHE A 1 409 ? 149.898 -71.882  9.583   1.00 150.98 ? 333  PHE A C   1 
ATOM   2982 O O   . PHE A 1 409 ? 150.344 -73.025  9.694   1.00 104.64 ? 333  PHE A O   1 
ATOM   2983 C CB  . PHE A 1 409 ? 147.485 -71.730  10.308  1.00 134.71 ? 333  PHE A CB  1 
ATOM   2984 N N   . ASP B 1 2   ? 138.391 -60.647  55.346  1.00 170.10 ? 1002 ASP B N   1 
ATOM   2985 C CA  . ASP B 1 2   ? 139.713 -60.714  54.727  1.00 167.08 ? 1002 ASP B CA  1 
ATOM   2986 C C   . ASP B 1 2   ? 139.751 -61.740  53.583  1.00 167.43 ? 1002 ASP B C   1 
ATOM   2987 O O   . ASP B 1 2   ? 140.361 -61.459  52.550  1.00 164.07 ? 1002 ASP B O   1 
ATOM   2988 C CB  . ASP B 1 2   ? 140.797 -61.028  55.771  1.00 171.37 ? 1002 ASP B CB  1 
ATOM   2989 C CG  . ASP B 1 2   ? 141.181 -59.840  56.632  1.00 183.31 ? 1002 ASP B CG  1 
ATOM   2990 O OD1 . ASP B 1 2   ? 141.888 -58.943  56.123  1.00 182.46 ? 1002 ASP B OD1 1 
ATOM   2991 O OD2 . ASP B 1 2   ? 140.805 -59.824  57.823  1.00 192.93 ? 1002 ASP B OD2 1 
ATOM   2992 N N   . LEU B 1 3   ? 139.108 -62.918  53.764  1.00 164.76 ? 1003 LEU B N   1 
ATOM   2993 C CA  . LEU B 1 3   ? 139.047 -63.976  52.745  1.00 161.79 ? 1003 LEU B CA  1 
ATOM   2994 C C   . LEU B 1 3   ? 138.012 -63.624  51.666  1.00 164.90 ? 1003 LEU B C   1 
ATOM   2995 O O   . LEU B 1 3   ? 138.261 -63.868  50.482  1.00 161.64 ? 1003 LEU B O   1 
ATOM   2996 C CB  . LEU B 1 3   ? 138.724 -65.341  53.376  1.00 163.73 ? 1003 LEU B CB  1 
ATOM   2997 C CG  . LEU B 1 3   ? 138.975 -66.556  52.484  1.00 165.99 ? 1003 LEU B CG  1 
ATOM   2998 C CD1 . LEU B 1 3   ? 140.285 -67.235  52.840  1.00 166.16 ? 1003 LEU B CD1 1 
ATOM   2999 C CD2 . LEU B 1 3   ? 137.819 -67.531  52.557  1.00 170.39 ? 1003 LEU B CD2 1 
ATOM   3000 N N   . GLU B 1 4   ? 136.856 -63.050  52.083  1.00 164.30 ? 1004 GLU B N   1 
ATOM   3001 C CA  . GLU B 1 4   ? 135.775 -62.606  51.196  1.00 164.08 ? 1004 GLU B CA  1 
ATOM   3002 C C   . GLU B 1 4   ? 136.241 -61.395  50.375  1.00 166.71 ? 1004 GLU B C   1 
ATOM   3003 O O   . GLU B 1 4   ? 135.770 -61.207  49.255  1.00 165.23 ? 1004 GLU B O   1 
ATOM   3004 C CB  . GLU B 1 4   ? 134.510 -62.259  52.010  1.00 169.66 ? 1004 GLU B CB  1 
ATOM   3005 C CG  . GLU B 1 4   ? 133.220 -62.239  51.202  1.00 180.08 ? 1004 GLU B CG  1 
ATOM   3006 C CD  . GLU B 1 4   ? 131.989 -61.777  51.960  1.00 200.26 ? 1004 GLU B CD  1 
ATOM   3007 O OE1 . GLU B 1 4   ? 131.744 -60.550  52.007  1.00 193.94 ? 1004 GLU B OE1 1 
ATOM   3008 O OE2 . GLU B 1 4   ? 131.254 -62.644  52.488  1.00 193.35 ? 1004 GLU B OE2 1 
ATOM   3009 N N   . ASP B 1 5   ? 137.181 -60.595  50.934  1.00 163.79 ? 1005 ASP B N   1 
ATOM   3010 C CA  . ASP B 1 5   ? 137.758 -59.393  50.324  1.00 162.59 ? 1005 ASP B CA  1 
ATOM   3011 C C   . ASP B 1 5   ? 138.784 -59.728  49.219  1.00 162.86 ? 1005 ASP B C   1 
ATOM   3012 O O   . ASP B 1 5   ? 138.984 -58.906  48.321  1.00 161.24 ? 1005 ASP B O   1 
ATOM   3013 C CB  . ASP B 1 5   ? 138.404 -58.500  51.401  1.00 166.96 ? 1005 ASP B CB  1 
ATOM   3014 C CG  . ASP B 1 5   ? 137.430 -57.993  52.454  1.00 181.35 ? 1005 ASP B CG  1 
ATOM   3015 O OD1 . ASP B 1 5   ? 136.549 -57.175  52.106  1.00 183.28 ? 1005 ASP B OD1 1 
ATOM   3016 O OD2 . ASP B 1 5   ? 137.559 -58.402  53.628  1.00 189.39 ? 1005 ASP B OD2 1 
ATOM   3017 N N   . ASN B 1 6   ? 139.421 -60.919  49.277  1.00 158.29 ? 1006 ASN B N   1 
ATOM   3018 C CA  . ASN B 1 6   ? 140.391 -61.357  48.267  1.00 155.30 ? 1006 ASN B CA  1 
ATOM   3019 C C   . ASN B 1 6   ? 139.698 -62.130  47.148  1.00 158.11 ? 1006 ASN B C   1 
ATOM   3020 O O   . ASN B 1 6   ? 140.110 -62.019  45.990  1.00 155.70 ? 1006 ASN B O   1 
ATOM   3021 C CB  . ASN B 1 6   ? 141.509 -62.191  48.883  1.00 156.26 ? 1006 ASN B CB  1 
ATOM   3022 C CG  . ASN B 1 6   ? 142.613 -61.362  49.497  1.00 180.80 ? 1006 ASN B CG  1 
ATOM   3023 O OD1 . ASN B 1 6   ? 142.840 -61.385  50.706  1.00 178.46 ? 1006 ASN B OD1 1 
ATOM   3024 N ND2 . ASN B 1 6   ? 143.349 -60.625  48.678  1.00 171.09 ? 1006 ASN B ND2 1 
ATOM   3025 N N   . TRP B 1 7   ? 138.644 -62.903  47.487  1.00 156.56 ? 1007 TRP B N   1 
ATOM   3026 C CA  . TRP B 1 7   ? 137.863 -63.649  46.502  1.00 156.20 ? 1007 TRP B CA  1 
ATOM   3027 C C   . TRP B 1 7   ? 136.993 -62.695  45.690  1.00 158.30 ? 1007 TRP B C   1 
ATOM   3028 O O   . TRP B 1 7   ? 136.808 -62.927  44.494  1.00 157.01 ? 1007 TRP B O   1 
ATOM   3029 C CB  . TRP B 1 7   ? 137.019 -64.752  47.146  1.00 158.02 ? 1007 TRP B CB  1 
ATOM   3030 C CG  . TRP B 1 7   ? 137.718 -66.081  47.184  1.00 158.87 ? 1007 TRP B CG  1 
ATOM   3031 C CD1 . TRP B 1 7   ? 138.165 -66.737  48.293  1.00 163.25 ? 1007 TRP B CD1 1 
ATOM   3032 C CD2 . TRP B 1 7   ? 138.091 -66.896  46.058  1.00 157.27 ? 1007 TRP B CD2 1 
ATOM   3033 N NE1 . TRP B 1 7   ? 138.774 -67.919  47.932  1.00 162.15 ? 1007 TRP B NE1 1 
ATOM   3034 C CE2 . TRP B 1 7   ? 138.748 -68.040  46.566  1.00 161.67 ? 1007 TRP B CE2 1 
ATOM   3035 C CE3 . TRP B 1 7   ? 137.934 -66.772  44.664  1.00 157.35 ? 1007 TRP B CE3 1 
ATOM   3036 C CZ2 . TRP B 1 7   ? 139.242 -69.058  45.733  1.00 160.08 ? 1007 TRP B CZ2 1 
ATOM   3037 C CZ3 . TRP B 1 7   ? 138.446 -67.767  43.840  1.00 157.91 ? 1007 TRP B CZ3 1 
ATOM   3038 C CH2 . TRP B 1 7   ? 139.065 -68.908  44.373  1.00 158.91 ? 1007 TRP B CH2 1 
ATOM   3039 N N   . GLU B 1 8   ? 136.504 -61.599  46.322  1.00 154.89 ? 1008 GLU B N   1 
ATOM   3040 C CA  . GLU B 1 8   ? 135.728 -60.554  45.646  1.00 155.01 ? 1008 GLU B CA  1 
ATOM   3041 C C   . GLU B 1 8   ? 136.580 -59.915  44.557  1.00 153.73 ? 1008 GLU B C   1 
ATOM   3042 O O   . GLU B 1 8   ? 136.072 -59.675  43.470  1.00 153.80 ? 1008 GLU B O   1 
ATOM   3043 C CB  . GLU B 1 8   ? 135.226 -59.483  46.630  1.00 159.40 ? 1008 GLU B CB  1 
ATOM   3044 C CG  . GLU B 1 8   ? 133.726 -59.519  46.878  1.00 173.16 ? 1008 GLU B CG  1 
ATOM   3045 C CD  . GLU B 1 8   ? 132.859 -58.996  45.748  1.00 192.53 ? 1008 GLU B CD  1 
ATOM   3046 O OE1 . GLU B 1 8   ? 132.535 -57.787  45.756  1.00 187.66 ? 1008 GLU B OE1 1 
ATOM   3047 O OE2 . GLU B 1 8   ? 132.484 -59.803  44.866  1.00 184.77 ? 1008 GLU B OE2 1 
ATOM   3048 N N   . THR B 1 9   ? 137.888 -59.702  44.837  1.00 145.98 ? 1009 THR B N   1 
ATOM   3049 C CA  . THR B 1 9   ? 138.876 -59.142  43.910  1.00 142.80 ? 1009 THR B CA  1 
ATOM   3050 C C   . THR B 1 9   ? 139.107 -60.115  42.735  1.00 142.06 ? 1009 THR B C   1 
ATOM   3051 O O   . THR B 1 9   ? 139.100 -59.678  41.582  1.00 141.34 ? 1009 THR B O   1 
ATOM   3052 C CB  . THR B 1 9   ? 140.189 -58.818  44.651  1.00 149.45 ? 1009 THR B CB  1 
ATOM   3053 O OG1 . THR B 1 9   ? 139.893 -58.119  45.862  1.00 150.40 ? 1009 THR B OG1 1 
ATOM   3054 C CG2 . THR B 1 9   ? 141.159 -57.994  43.806  1.00 147.39 ? 1009 THR B CG2 1 
ATOM   3055 N N   . LEU B 1 10  ? 139.285 -61.423  43.031  1.00 135.65 ? 1010 LEU B N   1 
ATOM   3056 C CA  . LEU B 1 10  ? 139.508 -62.468  42.027  1.00 133.08 ? 1010 LEU B CA  1 
ATOM   3057 C C   . LEU B 1 10  ? 138.282 -62.657  41.131  1.00 136.89 ? 1010 LEU B C   1 
ATOM   3058 O O   . LEU B 1 10  ? 138.440 -62.854  39.926  1.00 135.69 ? 1010 LEU B O   1 
ATOM   3059 C CB  . LEU B 1 10  ? 139.890 -63.800  42.692  1.00 132.64 ? 1010 LEU B CB  1 
ATOM   3060 C CG  . LEU B 1 10  ? 141.328 -63.901  43.192  1.00 136.12 ? 1010 LEU B CG  1 
ATOM   3061 C CD1 . LEU B 1 10  ? 141.414 -64.742  44.439  1.00 137.40 ? 1010 LEU B CD1 1 
ATOM   3062 C CD2 . LEU B 1 10  ? 142.249 -64.462  42.123  1.00 137.23 ? 1010 LEU B CD2 1 
ATOM   3063 N N   . ASN B 1 11  ? 137.070 -62.566  41.710  1.00 135.01 ? 1011 ASN B N   1 
ATOM   3064 C CA  . ASN B 1 11  ? 135.813 -62.717  40.975  1.00 136.68 ? 1011 ASN B CA  1 
ATOM   3065 C C   . ASN B 1 11  ? 135.438 -61.430  40.224  1.00 139.89 ? 1011 ASN B C   1 
ATOM   3066 O O   . ASN B 1 11  ? 134.811 -61.520  39.165  1.00 141.01 ? 1011 ASN B O   1 
ATOM   3067 C CB  . ASN B 1 11  ? 134.683 -63.156  41.907  1.00 140.32 ? 1011 ASN B CB  1 
ATOM   3068 C CG  . ASN B 1 11  ? 134.830 -64.579  42.405  1.00 162.11 ? 1011 ASN B CG  1 
ATOM   3069 O OD1 . ASN B 1 11  ? 135.044 -65.524  41.632  1.00 154.06 ? 1011 ASN B OD1 1 
ATOM   3070 N ND2 . ASN B 1 11  ? 134.696 -64.768  43.711  1.00 155.33 ? 1011 ASN B ND2 1 
ATOM   3071 N N   . ASP B 1 12  ? 135.825 -60.247  40.758  1.00 134.71 ? 1012 ASP B N   1 
ATOM   3072 C CA  . ASP B 1 12  ? 135.570 -58.944  40.130  1.00 135.37 ? 1012 ASP B CA  1 
ATOM   3073 C C   . ASP B 1 12  ? 136.349 -58.835  38.823  1.00 135.10 ? 1012 ASP B C   1 
ATOM   3074 O O   . ASP B 1 12  ? 135.762 -58.508  37.789  1.00 136.94 ? 1012 ASP B O   1 
ATOM   3075 C CB  . ASP B 1 12  ? 135.949 -57.776  41.069  1.00 137.88 ? 1012 ASP B CB  1 
ATOM   3076 C CG  . ASP B 1 12  ? 134.798 -57.124  41.823  1.00 154.57 ? 1012 ASP B CG  1 
ATOM   3077 O OD1 . ASP B 1 12  ? 133.961 -57.865  42.399  1.00 157.05 ? 1012 ASP B OD1 1 
ATOM   3078 O OD2 . ASP B 1 12  ? 134.772 -55.873  41.898  1.00 162.91 ? 1012 ASP B OD2 1 
ATOM   3079 N N   . ASN B 1 13  ? 137.662 -59.155  38.870  1.00 125.98 ? 1013 ASN B N   1 
ATOM   3080 C CA  . ASN B 1 13  ? 138.564 -59.101  37.725  1.00 122.96 ? 1013 ASN B CA  1 
ATOM   3081 C C   . ASN B 1 13  ? 138.245 -60.185  36.693  1.00 125.07 ? 1013 ASN B C   1 
ATOM   3082 O O   . ASN B 1 13  ? 138.546 -59.989  35.516  1.00 124.92 ? 1013 ASN B O   1 
ATOM   3083 C CB  . ASN B 1 13  ? 140.010 -59.184  38.176  1.00 118.45 ? 1013 ASN B CB  1 
ATOM   3084 C CG  . ASN B 1 13  ? 140.490 -57.883  38.758  1.00 131.44 ? 1013 ASN B CG  1 
ATOM   3085 O OD1 . ASN B 1 13  ? 140.826 -56.941  38.038  1.00 124.88 ? 1013 ASN B OD1 1 
ATOM   3086 N ND2 . ASN B 1 13  ? 140.483 -57.779  40.073  1.00 121.93 ? 1013 ASN B ND2 1 
ATOM   3087 N N   . LEU B 1 14  ? 137.607 -61.300  37.116  1.00 120.67 ? 1014 LEU B N   1 
ATOM   3088 C CA  . LEU B 1 14  ? 137.187 -62.365  36.200  1.00 121.11 ? 1014 LEU B CA  1 
ATOM   3089 C C   . LEU B 1 14  ? 136.147 -61.824  35.212  1.00 126.94 ? 1014 LEU B C   1 
ATOM   3090 O O   . LEU B 1 14  ? 136.222 -62.123  34.020  1.00 127.77 ? 1014 LEU B O   1 
ATOM   3091 C CB  . LEU B 1 14  ? 136.625 -63.572  36.967  1.00 121.99 ? 1014 LEU B CB  1 
ATOM   3092 C CG  . LEU B 1 14  ? 137.602 -64.713  37.233  1.00 124.89 ? 1014 LEU B CG  1 
ATOM   3093 C CD1 . LEU B 1 14  ? 137.112 -65.593  38.361  1.00 126.01 ? 1014 LEU B CD1 1 
ATOM   3094 C CD2 . LEU B 1 14  ? 137.829 -65.553  35.987  1.00 128.43 ? 1014 LEU B CD2 1 
ATOM   3095 N N   . LYS B 1 15  ? 135.213 -60.985  35.711  1.00 124.24 ? 1015 LYS B N   1 
ATOM   3096 C CA  . LYS B 1 15  ? 134.161 -60.321  34.933  1.00 127.25 ? 1015 LYS B CA  1 
ATOM   3097 C C   . LYS B 1 15  ? 134.788 -59.308  33.974  1.00 128.49 ? 1015 LYS B C   1 
ATOM   3098 O O   . LYS B 1 15  ? 134.347 -59.190  32.827  1.00 131.06 ? 1015 LYS B O   1 
ATOM   3099 C CB  . LYS B 1 15  ? 133.145 -59.623  35.863  1.00 132.51 ? 1015 LYS B CB  1 
ATOM   3100 C CG  . LYS B 1 15  ? 132.482 -60.546  36.885  1.00 146.20 ? 1015 LYS B CG  1 
ATOM   3101 C CD  . LYS B 1 15  ? 131.392 -59.839  37.685  1.00 158.16 ? 1015 LYS B CD  1 
ATOM   3102 C CE  . LYS B 1 15  ? 131.008 -60.623  38.917  1.00 165.52 ? 1015 LYS B CE  1 
ATOM   3103 N NZ  . LYS B 1 15  ? 129.553 -60.565  39.192  1.00 178.77 ? 1015 LYS B NZ  1 
ATOM   3104 N N   . VAL B 1 16  ? 135.840 -58.599  34.453  1.00 119.88 ? 1016 VAL B N   1 
ATOM   3105 C CA  . VAL B 1 16  ? 136.608 -57.592  33.715  1.00 118.49 ? 1016 VAL B CA  1 
ATOM   3106 C C   . VAL B 1 16  ? 137.266 -58.246  32.485  1.00 120.32 ? 1016 VAL B C   1 
ATOM   3107 O O   . VAL B 1 16  ? 137.186 -57.675  31.397  1.00 122.67 ? 1016 VAL B O   1 
ATOM   3108 C CB  . VAL B 1 16  ? 137.649 -56.877  34.627  1.00 119.41 ? 1016 VAL B CB  1 
ATOM   3109 C CG1 . VAL B 1 16  ? 138.546 -55.927  33.833  1.00 119.33 ? 1016 VAL B CG1 1 
ATOM   3110 C CG2 . VAL B 1 16  ? 136.965 -56.131  35.766  1.00 120.85 ? 1016 VAL B CG2 1 
ATOM   3111 N N   . ILE B 1 17  ? 137.871 -59.450  32.652  1.00 112.48 ? 1017 ILE B N   1 
ATOM   3112 C CA  . ILE B 1 17  ? 138.543 -60.198  31.577  1.00 110.80 ? 1017 ILE B CA  1 
ATOM   3113 C C   . ILE B 1 17  ? 137.533 -60.533  30.455  1.00 116.63 ? 1017 ILE B C   1 
ATOM   3114 O O   . ILE B 1 17  ? 137.873 -60.386  29.279  1.00 117.32 ? 1017 ILE B O   1 
ATOM   3115 C CB  . ILE B 1 17  ? 139.288 -61.461  32.118  1.00 110.80 ? 1017 ILE B CB  1 
ATOM   3116 C CG1 . ILE B 1 17  ? 140.479 -61.048  33.012  1.00 108.29 ? 1017 ILE B CG1 1 
ATOM   3117 C CG2 . ILE B 1 17  ? 139.787 -62.363  30.976  1.00 111.83 ? 1017 ILE B CG2 1 
ATOM   3118 C CD1 . ILE B 1 17  ? 140.897 -62.060  34.072  1.00 113.81 ? 1017 ILE B CD1 1 
ATOM   3119 N N   . GLU B 1 18  ? 136.297 -60.923  30.818  1.00 114.56 ? 1018 GLU B N   1 
ATOM   3120 C CA  . GLU B 1 18  ? 135.242 -61.257  29.858  1.00 118.66 ? 1018 GLU B CA  1 
ATOM   3121 C C   . GLU B 1 18  ? 134.754 -60.035  29.063  1.00 124.43 ? 1018 GLU B C   1 
ATOM   3122 O O   . GLU B 1 18  ? 134.447 -60.173  27.877  1.00 127.21 ? 1018 GLU B O   1 
ATOM   3123 C CB  . GLU B 1 18  ? 134.055 -61.920  30.567  1.00 122.44 ? 1018 GLU B CB  1 
ATOM   3124 C CG  . GLU B 1 18  ? 134.148 -63.433  30.610  1.00 133.68 ? 1018 GLU B CG  1 
ATOM   3125 C CD  . GLU B 1 18  ? 134.987 -63.986  31.743  1.00 148.62 ? 1018 GLU B CD  1 
ATOM   3126 O OE1 . GLU B 1 18  ? 134.419 -64.239  32.829  1.00 146.27 ? 1018 GLU B OE1 1 
ATOM   3127 O OE2 . GLU B 1 18  ? 136.211 -64.164  31.547  1.00 134.48 ? 1018 GLU B OE2 1 
ATOM   3128 N N   . LYS B 1 19  ? 134.686 -58.854  29.708  1.00 119.85 ? 1019 LYS B N   1 
ATOM   3129 C CA  . LYS B 1 19  ? 134.225 -57.613  29.078  1.00 123.43 ? 1019 LYS B CA  1 
ATOM   3130 C C   . LYS B 1 19  ? 135.384 -56.797  28.450  1.00 125.25 ? 1019 LYS B C   1 
ATOM   3131 O O   . LYS B 1 19  ? 135.131 -55.766  27.819  1.00 128.20 ? 1019 LYS B O   1 
ATOM   3132 C CB  . LYS B 1 19  ? 133.440 -56.754  30.092  1.00 127.55 ? 1019 LYS B CB  1 
ATOM   3133 C CG  . LYS B 1 19  ? 132.015 -57.251  30.371  1.00 144.70 ? 1019 LYS B CG  1 
ATOM   3134 C CD  . LYS B 1 19  ? 131.005 -56.744  29.336  1.00 163.31 ? 1019 LYS B CD  1 
ATOM   3135 C CE  . LYS B 1 19  ? 129.637 -57.363  29.497  1.00 182.50 ? 1019 LYS B CE  1 
ATOM   3136 N NZ  . LYS B 1 19  ? 128.719 -56.958  28.397  1.00 199.53 ? 1019 LYS B NZ  1 
ATOM   3137 N N   . ALA B 1 20  ? 136.638 -57.272  28.595  1.00 117.17 ? 1020 ALA B N   1 
ATOM   3138 C CA  . ALA B 1 20  ? 137.827 -56.615  28.038  1.00 115.64 ? 1020 ALA B CA  1 
ATOM   3139 C C   . ALA B 1 20  ? 137.930 -56.833  26.529  1.00 122.02 ? 1020 ALA B C   1 
ATOM   3140 O O   . ALA B 1 20  ? 137.553 -57.897  26.031  1.00 122.57 ? 1020 ALA B O   1 
ATOM   3141 C CB  . ALA B 1 20  ? 139.083 -57.131  28.719  1.00 111.29 ? 1020 ALA B CB  1 
ATOM   3142 N N   . ASP B 1 21  ? 138.457 -55.825  25.810  1.00 119.99 ? 1021 ASP B N   1 
ATOM   3143 C CA  . ASP B 1 21  ? 138.627 -55.863  24.355  1.00 122.81 ? 1021 ASP B CA  1 
ATOM   3144 C C   . ASP B 1 21  ? 140.108 -55.910  23.950  1.00 123.10 ? 1021 ASP B C   1 
ATOM   3145 O O   . ASP B 1 21  ? 140.423 -56.433  22.878  1.00 124.50 ? 1021 ASP B O   1 
ATOM   3146 C CB  . ASP B 1 21  ? 137.930 -54.659  23.698  1.00 130.33 ? 1021 ASP B CB  1 
ATOM   3147 C CG  . ASP B 1 21  ? 136.410 -54.733  23.734  1.00 144.74 ? 1021 ASP B CG  1 
ATOM   3148 O OD1 . ASP B 1 21  ? 135.830 -54.550  24.830  1.00 144.00 ? 1021 ASP B OD1 1 
ATOM   3149 O OD2 . ASP B 1 21  ? 135.800 -54.949  22.662  1.00 155.42 ? 1021 ASP B OD2 1 
ATOM   3150 N N   . ASN B 1 22  ? 141.007 -55.370  24.800  1.00 115.48 ? 1022 ASN B N   1 
ATOM   3151 C CA  . ASN B 1 22  ? 142.456 -55.350  24.557  1.00 113.16 ? 1022 ASN B CA  1 
ATOM   3152 C C   . ASN B 1 22  ? 143.212 -56.244  25.559  1.00 110.94 ? 1022 ASN B C   1 
ATOM   3153 O O   . ASN B 1 22  ? 142.716 -56.495  26.658  1.00 108.09 ? 1022 ASN B O   1 
ATOM   3154 C CB  . ASN B 1 22  ? 143.015 -53.917  24.578  1.00 116.77 ? 1022 ASN B CB  1 
ATOM   3155 C CG  . ASN B 1 22  ? 142.558 -53.060  25.733  1.00 149.22 ? 1022 ASN B CG  1 
ATOM   3156 O OD1 . ASN B 1 22  ? 141.386 -52.679  25.836  1.00 148.32 ? 1022 ASN B OD1 1 
ATOM   3157 N ND2 . ASN B 1 22  ? 143.491 -52.676  26.591  1.00 141.45 ? 1022 ASN B ND2 1 
ATOM   3158 N N   . ALA B 1 23  ? 144.410 -56.730  25.161  1.00 105.86 ? 1023 ALA B N   1 
ATOM   3159 C CA  . ALA B 1 23  ? 145.270 -57.600  25.974  1.00 101.60 ? 1023 ALA B CA  1 
ATOM   3160 C C   . ALA B 1 23  ? 145.877 -56.852  27.166  1.00 102.77 ? 1023 ALA B C   1 
ATOM   3161 O O   . ALA B 1 23  ? 146.215 -57.484  28.168  1.00 99.12  ? 1023 ALA B O   1 
ATOM   3162 C CB  . ALA B 1 23  ? 146.374 -58.198  25.118  1.00 102.76 ? 1023 ALA B CB  1 
ATOM   3163 N N   . ALA B 1 24  ? 146.010 -55.511  27.057  1.00 101.36 ? 1024 ALA B N   1 
ATOM   3164 C CA  . ALA B 1 24  ? 146.515 -54.643  28.123  1.00 100.44 ? 1024 ALA B CA  1 
ATOM   3165 C C   . ALA B 1 24  ? 145.507 -54.587  29.283  1.00 101.72 ? 1024 ALA B C   1 
ATOM   3166 O O   . ALA B 1 24  ? 145.911 -54.497  30.443  1.00 99.35  ? 1024 ALA B O   1 
ATOM   3167 C CB  . ALA B 1 24  ? 146.784 -53.249  27.578  1.00 104.89 ? 1024 ALA B CB  1 
ATOM   3168 N N   . GLN B 1 25  ? 144.198 -54.663  28.954  1.00 98.78  ? 1025 GLN B N   1 
ATOM   3169 C CA  . GLN B 1 25  ? 143.081 -54.698  29.900  1.00 97.65  ? 1025 GLN B CA  1 
ATOM   3170 C C   . GLN B 1 25  ? 143.066 -56.032  30.647  1.00 97.88  ? 1025 GLN B C   1 
ATOM   3171 O O   . GLN B 1 25  ? 142.812 -56.061  31.852  1.00 96.22  ? 1025 GLN B O   1 
ATOM   3172 C CB  . GLN B 1 25  ? 141.749 -54.507  29.157  1.00 101.94 ? 1025 GLN B CB  1 
ATOM   3173 C CG  . GLN B 1 25  ? 141.078 -53.163  29.380  1.00 118.14 ? 1025 GLN B CG  1 
ATOM   3174 C CD  . GLN B 1 25  ? 139.620 -53.228  29.004  1.00 140.63 ? 1025 GLN B CD  1 
ATOM   3175 O OE1 . GLN B 1 25  ? 139.254 -53.214  27.825  1.00 136.67 ? 1025 GLN B OE1 1 
ATOM   3176 N NE2 . GLN B 1 25  ? 138.753 -53.314  30.003  1.00 137.23 ? 1025 GLN B NE2 1 
ATOM   3177 N N   . VAL B 1 26  ? 143.335 -57.134  29.917  1.00 93.38  ? 1026 VAL B N   1 
ATOM   3178 C CA  . VAL B 1 26  ? 143.357 -58.513  30.415  1.00 90.82  ? 1026 VAL B CA  1 
ATOM   3179 C C   . VAL B 1 26  ? 144.567 -58.725  31.344  1.00 92.23  ? 1026 VAL B C   1 
ATOM   3180 O O   . VAL B 1 26  ? 144.393 -59.276  32.431  1.00 90.29  ? 1026 VAL B O   1 
ATOM   3181 C CB  . VAL B 1 26  ? 143.340 -59.536  29.247  1.00 95.69  ? 1026 VAL B CB  1 
ATOM   3182 C CG1 . VAL B 1 26  ? 143.448 -60.970  29.753  1.00 93.57  ? 1026 VAL B CG1 1 
ATOM   3183 C CG2 . VAL B 1 26  ? 142.090 -59.371  28.388  1.00 98.89  ? 1026 VAL B CG2 1 
ATOM   3184 N N   . LYS B 1 27  ? 145.776 -58.283  30.926  1.00 88.93  ? 1027 LYS B N   1 
ATOM   3185 C CA  . LYS B 1 27  ? 147.009 -58.412  31.716  1.00 87.27  ? 1027 LYS B CA  1 
ATOM   3186 C C   . LYS B 1 27  ? 146.897 -57.648  33.045  1.00 91.21  ? 1027 LYS B C   1 
ATOM   3187 O O   . LYS B 1 27  ? 147.408 -58.122  34.057  1.00 89.67  ? 1027 LYS B O   1 
ATOM   3188 C CB  . LYS B 1 27  ? 148.228 -57.922  30.920  1.00 90.85  ? 1027 LYS B CB  1 
ATOM   3189 C CG  . LYS B 1 27  ? 149.548 -58.454  31.461  1.00 101.67 ? 1027 LYS B CG  1 
ATOM   3190 C CD  . LYS B 1 27  ? 150.747 -57.650  30.995  1.00 112.20 ? 1027 LYS B CD  1 
ATOM   3191 C CE  . LYS B 1 27  ? 151.913 -57.865  31.928  1.00 121.70 ? 1027 LYS B CE  1 
ATOM   3192 N NZ  . LYS B 1 27  ? 153.171 -57.288  31.389  1.00 133.80 ? 1027 LYS B NZ  1 
ATOM   3193 N N   . ASP B 1 28  ? 146.208 -56.487  33.033  1.00 89.57  ? 1028 ASP B N   1 
ATOM   3194 C CA  . ASP B 1 28  ? 145.984 -55.622  34.194  1.00 90.17  ? 1028 ASP B CA  1 
ATOM   3195 C C   . ASP B 1 28  ? 145.114 -56.311  35.259  1.00 91.63  ? 1028 ASP B C   1 
ATOM   3196 O O   . ASP B 1 28  ? 145.417 -56.208  36.450  1.00 90.96  ? 1028 ASP B O   1 
ATOM   3197 C CB  . ASP B 1 28  ? 145.335 -54.303  33.752  1.00 95.15  ? 1028 ASP B CB  1 
ATOM   3198 C CG  . ASP B 1 28  ? 145.836 -53.103  34.522  1.00 109.99 ? 1028 ASP B CG  1 
ATOM   3199 O OD1 . ASP B 1 28  ? 146.824 -52.483  34.073  1.00 112.42 ? 1028 ASP B OD1 1 
ATOM   3200 O OD2 . ASP B 1 28  ? 145.248 -52.790  35.581  1.00 117.23 ? 1028 ASP B OD2 1 
ATOM   3201 N N   . ALA B 1 29  ? 144.045 -57.010  34.827  1.00 86.87  ? 1029 ALA B N   1 
ATOM   3202 C CA  . ALA B 1 29  ? 143.137 -57.742  35.709  1.00 85.26  ? 1029 ALA B CA  1 
ATOM   3203 C C   . ALA B 1 29  ? 143.807 -58.997  36.278  1.00 86.34  ? 1029 ALA B C   1 
ATOM   3204 O O   . ALA B 1 29  ? 143.599 -59.307  37.451  1.00 85.77  ? 1029 ALA B O   1 
ATOM   3205 C CB  . ALA B 1 29  ? 141.871 -58.121  34.960  1.00 86.99  ? 1029 ALA B CB  1 
ATOM   3206 N N   . LEU B 1 30  ? 144.607 -59.712  35.450  1.00 81.18  ? 1030 LEU B N   1 
ATOM   3207 C CA  . LEU B 1 30  ? 145.331 -60.924  35.837  1.00 79.56  ? 1030 LEU B CA  1 
ATOM   3208 C C   . LEU B 1 30  ? 146.440 -60.618  36.852  1.00 84.73  ? 1030 LEU B C   1 
ATOM   3209 O O   . LEU B 1 30  ? 146.743 -61.479  37.678  1.00 84.55  ? 1030 LEU B O   1 
ATOM   3210 C CB  . LEU B 1 30  ? 145.934 -61.637  34.611  1.00 79.33  ? 1030 LEU B CB  1 
ATOM   3211 C CG  . LEU B 1 30  ? 144.975 -62.348  33.641  1.00 84.42  ? 1030 LEU B CG  1 
ATOM   3212 C CD1 . LEU B 1 30  ? 145.680 -62.684  32.353  1.00 84.91  ? 1030 LEU B CD1 1 
ATOM   3213 C CD2 . LEU B 1 30  ? 144.410 -63.623  34.240  1.00 86.40  ? 1030 LEU B CD2 1 
ATOM   3214 N N   . THR B 1 31  ? 147.055 -59.408  36.782  1.00 82.48  ? 1031 THR B N   1 
ATOM   3215 C CA  . THR B 1 31  ? 148.107 -58.953  37.705  1.00 83.38  ? 1031 THR B CA  1 
ATOM   3216 C C   . THR B 1 31  ? 147.481 -58.704  39.089  1.00 87.90  ? 1031 THR B C   1 
ATOM   3217 O O   . THR B 1 31  ? 148.075 -59.083  40.105  1.00 88.47  ? 1031 THR B O   1 
ATOM   3218 C CB  . THR B 1 31  ? 148.830 -57.711  37.141  1.00 94.05  ? 1031 THR B CB  1 
ATOM   3219 O OG1 . THR B 1 31  ? 149.418 -58.058  35.886  1.00 96.75  ? 1031 THR B OG1 1 
ATOM   3220 C CG2 . THR B 1 31  ? 149.926 -57.182  38.067  1.00 93.21  ? 1031 THR B CG2 1 
ATOM   3221 N N   . LYS B 1 32  ? 146.269 -58.098  39.119  1.00 84.10  ? 1032 LYS B N   1 
ATOM   3222 C CA  . LYS B 1 32  ? 145.507 -57.821  40.346  1.00 84.42  ? 1032 LYS B CA  1 
ATOM   3223 C C   . LYS B 1 32  ? 145.041 -59.136  40.986  1.00 86.60  ? 1032 LYS B C   1 
ATOM   3224 O O   . LYS B 1 32  ? 144.917 -59.214  42.209  1.00 87.22  ? 1032 LYS B O   1 
ATOM   3225 C CB  . LYS B 1 32  ? 144.299 -56.900  40.070  1.00 87.55  ? 1032 LYS B CB  1 
ATOM   3226 C CG  . LYS B 1 32  ? 144.670 -55.481  39.646  1.00 94.98  ? 1032 LYS B CG  1 
ATOM   3227 C CD  . LYS B 1 32  ? 143.471 -54.548  39.698  1.00 101.57 ? 1032 LYS B CD  1 
ATOM   3228 C CE  . LYS B 1 32  ? 143.655 -53.324  38.835  1.00 109.18 ? 1032 LYS B CE  1 
ATOM   3229 N NZ  . LYS B 1 32  ? 143.282 -53.584  37.419  1.00 114.22 ? 1032 LYS B NZ  1 
ATOM   3230 N N   . MET B 1 33  ? 144.810 -60.167  40.153  1.00 81.03  ? 1033 MET B N   1 
ATOM   3231 C CA  . MET B 1 33  ? 144.390 -61.492  40.594  1.00 80.10  ? 1033 MET B CA  1 
ATOM   3232 C C   . MET B 1 33  ? 145.542 -62.240  41.236  1.00 83.75  ? 1033 MET B C   1 
ATOM   3233 O O   . MET B 1 33  ? 145.354 -62.802  42.315  1.00 82.98  ? 1033 MET B O   1 
ATOM   3234 C CB  . MET B 1 33  ? 143.833 -62.306  39.423  1.00 81.68  ? 1033 MET B CB  1 
ATOM   3235 C CG  . MET B 1 33  ? 142.418 -61.957  39.077  1.00 86.74  ? 1033 MET B CG  1 
ATOM   3236 S SD  . MET B 1 33  ? 141.868 -62.853  37.616  1.00 91.82  ? 1033 MET B SD  1 
ATOM   3237 C CE  . MET B 1 33  ? 141.377 -64.413  38.362  1.00 88.80  ? 1033 MET B CE  1 
ATOM   3238 N N   . ARG B 1 34  ? 146.730 -62.254  40.569  1.00 81.06  ? 1034 ARG B N   1 
ATOM   3239 C CA  . ARG B 1 34  ? 147.937 -62.950  41.036  1.00 81.79  ? 1034 ARG B CA  1 
ATOM   3240 C C   . ARG B 1 34  ? 148.340 -62.469  42.420  1.00 89.09  ? 1034 ARG B C   1 
ATOM   3241 O O   . ARG B 1 34  ? 148.660 -63.297  43.270  1.00 89.97  ? 1034 ARG B O   1 
ATOM   3242 C CB  . ARG B 1 34  ? 149.116 -62.797  40.062  1.00 81.46  ? 1034 ARG B CB  1 
ATOM   3243 C CG  . ARG B 1 34  ? 150.140 -63.915  40.232  1.00 89.76  ? 1034 ARG B CG  1 
ATOM   3244 C CD  . ARG B 1 34  ? 151.515 -63.564  39.705  1.00 96.63  ? 1034 ARG B CD  1 
ATOM   3245 N NE  . ARG B 1 34  ? 152.298 -64.774  39.436  1.00 105.71 ? 1034 ARG B NE  1 
ATOM   3246 C CZ  . ARG B 1 34  ? 153.174 -65.321  40.277  1.00 119.76 ? 1034 ARG B CZ  1 
ATOM   3247 N NH1 . ARG B 1 34  ? 153.407 -64.769  41.460  1.00 105.36 ? 1034 ARG B NH1 1 
ATOM   3248 N NH2 . ARG B 1 34  ? 153.827 -66.425  39.935  1.00 106.48 ? 1034 ARG B NH2 1 
ATOM   3249 N N   . ALA B 1 35  ? 148.289 -61.144  42.655  1.00 87.81  ? 1035 ALA B N   1 
ATOM   3250 C CA  . ALA B 1 35  ? 148.604 -60.540  43.946  1.00 90.95  ? 1035 ALA B CA  1 
ATOM   3251 C C   . ALA B 1 35  ? 147.605 -60.993  45.011  1.00 97.56  ? 1035 ALA B C   1 
ATOM   3252 O O   . ALA B 1 35  ? 148.030 -61.421  46.081  1.00 98.74  ? 1035 ALA B O   1 
ATOM   3253 C CB  . ALA B 1 35  ? 148.603 -59.025  43.830  1.00 92.99  ? 1035 ALA B CB  1 
ATOM   3254 N N   . ALA B 1 36  ? 146.289 -60.947  44.692  1.00 95.19  ? 1036 ALA B N   1 
ATOM   3255 C CA  . ALA B 1 36  ? 145.186 -61.343  45.575  1.00 96.76  ? 1036 ALA B CA  1 
ATOM   3256 C C   . ALA B 1 36  ? 145.232 -62.839  45.922  1.00 101.63 ? 1036 ALA B C   1 
ATOM   3257 O O   . ALA B 1 36  ? 144.927 -63.202  47.054  1.00 103.37 ? 1036 ALA B O   1 
ATOM   3258 C CB  . ALA B 1 36  ? 143.851 -61.000  44.933  1.00 96.91  ? 1036 ALA B CB  1 
ATOM   3259 N N   . ALA B 1 37  ? 145.616 -63.698  44.950  1.00 96.84  ? 1037 ALA B N   1 
ATOM   3260 C CA  . ALA B 1 37  ? 145.738 -65.149  45.125  1.00 97.03  ? 1037 ALA B CA  1 
ATOM   3261 C C   . ALA B 1 37  ? 146.899 -65.493  46.068  1.00 103.84 ? 1037 ALA B C   1 
ATOM   3262 O O   . ALA B 1 37  ? 146.764 -66.398  46.893  1.00 105.17 ? 1037 ALA B O   1 
ATOM   3263 C CB  . ALA B 1 37  ? 145.930 -65.829  43.775  1.00 95.96  ? 1037 ALA B CB  1 
ATOM   3264 N N   . LEU B 1 38  ? 148.022 -64.752  45.965  1.00 101.60 ? 1038 LEU B N   1 
ATOM   3265 C CA  . LEU B 1 38  ? 149.196 -64.930  46.825  1.00 104.61 ? 1038 LEU B CA  1 
ATOM   3266 C C   . LEU B 1 38  ? 148.905 -64.428  48.239  1.00 113.96 ? 1038 LEU B C   1 
ATOM   3267 O O   . LEU B 1 38  ? 149.393 -65.003  49.209  1.00 116.39 ? 1038 LEU B O   1 
ATOM   3268 C CB  . LEU B 1 38  ? 150.415 -64.191  46.249  1.00 104.78 ? 1038 LEU B CB  1 
ATOM   3269 C CG  . LEU B 1 38  ? 151.107 -64.826  45.048  1.00 107.31 ? 1038 LEU B CG  1 
ATOM   3270 C CD1 . LEU B 1 38  ? 151.823 -63.781  44.235  1.00 106.86 ? 1038 LEU B CD1 1 
ATOM   3271 C CD2 . LEU B 1 38  ? 152.081 -65.907  45.479  1.00 112.21 ? 1038 LEU B CD2 1 
ATOM   3272 N N   . ASP B 1 39  ? 148.103 -63.352  48.341  1.00 112.55 ? 1039 ASP B N   1 
ATOM   3273 C CA  . ASP B 1 39  ? 147.699 -62.708  49.591  1.00 116.43 ? 1039 ASP B CA  1 
ATOM   3274 C C   . ASP B 1 39  ? 146.646 -63.545  50.321  1.00 122.82 ? 1039 ASP B C   1 
ATOM   3275 O O   . ASP B 1 39  ? 146.580 -63.485  51.550  1.00 125.73 ? 1039 ASP B O   1 
ATOM   3276 C CB  . ASP B 1 39  ? 147.174 -61.290  49.298  1.00 118.36 ? 1039 ASP B CB  1 
ATOM   3277 C CG  . ASP B 1 39  ? 146.864 -60.401  50.483  1.00 136.00 ? 1039 ASP B CG  1 
ATOM   3278 O OD1 . ASP B 1 39  ? 147.440 -60.631  51.571  1.00 140.77 ? 1039 ASP B OD1 1 
ATOM   3279 O OD2 . ASP B 1 39  ? 146.101 -59.426  50.307  1.00 142.58 ? 1039 ASP B OD2 1 
ATOM   3280 N N   . ALA B 1 40  ? 145.835 -64.321  49.574  1.00 118.51 ? 1040 ALA B N   1 
ATOM   3281 C CA  . ALA B 1 40  ? 144.790 -65.184  50.135  1.00 120.10 ? 1040 ALA B CA  1 
ATOM   3282 C C   . ALA B 1 40  ? 145.370 -66.514  50.619  1.00 127.94 ? 1040 ALA B C   1 
ATOM   3283 O O   . ALA B 1 40  ? 144.833 -67.122  51.553  1.00 129.72 ? 1040 ALA B O   1 
ATOM   3284 C CB  . ALA B 1 40  ? 143.711 -65.438  49.098  1.00 118.30 ? 1040 ALA B CB  1 
ATOM   3285 N N   . GLN B 1 41  ? 146.471 -66.951  49.972  1.00 125.59 ? 1041 GLN B N   1 
ATOM   3286 C CA  . GLN B 1 41  ? 147.223 -68.184  50.221  1.00 128.21 ? 1041 GLN B CA  1 
ATOM   3287 C C   . GLN B 1 41  ? 147.746 -68.280  51.672  1.00 139.87 ? 1041 GLN B C   1 
ATOM   3288 O O   . GLN B 1 41  ? 147.866 -69.386  52.203  1.00 142.37 ? 1041 GLN B O   1 
ATOM   3289 C CB  . GLN B 1 41  ? 148.406 -68.250  49.236  1.00 128.14 ? 1041 GLN B CB  1 
ATOM   3290 C CG  . GLN B 1 41  ? 148.998 -69.639  49.014  1.00 142.02 ? 1041 GLN B CG  1 
ATOM   3291 C CD  . GLN B 1 41  ? 150.134 -69.635  48.014  1.00 158.04 ? 1041 GLN B CD  1 
ATOM   3292 O OE1 . GLN B 1 41  ? 151.067 -68.821  48.076  1.00 152.90 ? 1041 GLN B OE1 1 
ATOM   3293 N NE2 . GLN B 1 41  ? 150.106 -70.583  47.092  1.00 149.36 ? 1041 GLN B NE2 1 
ATOM   3294 N N   . LYS B 1 42  ? 148.038 -67.127  52.304  1.00 139.99 ? 1042 LYS B N   1 
ATOM   3295 C CA  . LYS B 1 42  ? 148.608 -67.023  53.652  1.00 145.76 ? 1042 LYS B CA  1 
ATOM   3296 C C   . LYS B 1 42  ? 147.534 -66.886  54.746  1.00 154.59 ? 1042 LYS B C   1 
ATOM   3297 O O   . LYS B 1 42  ? 147.807 -67.209  55.904  1.00 158.55 ? 1042 LYS B O   1 
ATOM   3298 C CB  . LYS B 1 42  ? 149.593 -65.839  53.713  1.00 149.80 ? 1042 LYS B CB  1 
ATOM   3299 C CG  . LYS B 1 42  ? 150.884 -66.091  52.927  1.00 164.46 ? 1042 LYS B CG  1 
ATOM   3300 C CD  . LYS B 1 42  ? 151.553 -64.798  52.439  1.00 174.38 ? 1042 LYS B CD  1 
ATOM   3301 C CE  . LYS B 1 42  ? 152.619 -65.027  51.389  1.00 182.82 ? 1042 LYS B CE  1 
ATOM   3302 N NZ  . LYS B 1 42  ? 152.675 -63.926  50.390  1.00 188.15 ? 1042 LYS B NZ  1 
ATOM   3303 N N   . ALA B 1 43  ? 146.320 -66.437  54.375  1.00 150.87 ? 1043 ALA B N   1 
ATOM   3304 C CA  . ALA B 1 43  ? 145.187 -66.237  55.285  1.00 153.83 ? 1043 ALA B CA  1 
ATOM   3305 C C   . ALA B 1 43  ? 144.477 -67.549  55.650  1.00 161.28 ? 1043 ALA B C   1 
ATOM   3306 O O   . ALA B 1 43  ? 144.518 -68.511  54.880  1.00 158.99 ? 1043 ALA B O   1 
ATOM   3307 C CB  . ALA B 1 43  ? 144.186 -65.283  54.656  1.00 151.82 ? 1043 ALA B CB  1 
ATOM   3308 N N   . THR B 1 44  ? 143.827 -67.574  56.836  1.00 163.19 ? 1044 THR B N   1 
ATOM   3309 C CA  . THR B 1 44  ? 143.050 -68.709  57.347  1.00 165.91 ? 1044 THR B CA  1 
ATOM   3310 C C   . THR B 1 44  ? 141.557 -68.353  57.258  1.00 171.40 ? 1044 THR B C   1 
ATOM   3311 O O   . THR B 1 44  ? 141.165 -67.304  57.774  1.00 172.24 ? 1044 THR B O   1 
ATOM   3312 C CB  . THR B 1 44  ? 143.474 -69.095  58.772  1.00 177.91 ? 1044 THR B CB  1 
ATOM   3313 O OG1 . THR B 1 44  ? 143.290 -67.979  59.646  1.00 179.10 ? 1044 THR B OG1 1 
ATOM   3314 C CG2 . THR B 1 44  ? 144.912 -69.601  58.840  1.00 177.68 ? 1044 THR B CG2 1 
ATOM   3315 N N   . PRO B 1 45  ? 140.725 -69.178  56.578  1.00 168.45 ? 1045 PRO B N   1 
ATOM   3316 C CA  . PRO B 1 45  ? 139.294 -68.830  56.423  1.00 169.01 ? 1045 PRO B CA  1 
ATOM   3317 C C   . PRO B 1 45  ? 138.478 -68.868  57.735  1.00 179.49 ? 1045 PRO B C   1 
ATOM   3318 O O   . PRO B 1 45  ? 138.924 -69.501  58.696  1.00 182.78 ? 1045 PRO B O   1 
ATOM   3319 C CB  . PRO B 1 45  ? 138.782 -69.877  55.424  1.00 168.95 ? 1045 PRO B CB  1 
ATOM   3320 C CG  . PRO B 1 45  ? 139.727 -71.012  55.535  1.00 174.00 ? 1045 PRO B CG  1 
ATOM   3321 C CD  . PRO B 1 45  ? 141.057 -70.438  55.880  1.00 169.06 ? 1045 PRO B CD  1 
ATOM   3322 N N   . PRO B 1 46  ? 137.278 -68.214  57.803  1.00 177.92 ? 1046 PRO B N   1 
ATOM   3323 C CA  . PRO B 1 46  ? 136.487 -68.244  59.052  1.00 183.46 ? 1046 PRO B CA  1 
ATOM   3324 C C   . PRO B 1 46  ? 135.838 -69.608  59.341  1.00 191.78 ? 1046 PRO B C   1 
ATOM   3325 O O   . PRO B 1 46  ? 135.208 -69.777  60.388  1.00 196.23 ? 1046 PRO B O   1 
ATOM   3326 C CB  . PRO B 1 46  ? 135.424 -67.167  58.821  1.00 185.13 ? 1046 PRO B CB  1 
ATOM   3327 C CG  . PRO B 1 46  ? 135.256 -67.117  57.352  1.00 184.78 ? 1046 PRO B CG  1 
ATOM   3328 C CD  . PRO B 1 46  ? 136.605 -67.402  56.765  1.00 176.49 ? 1046 PRO B CD  1 
ATOM   3329 N N   . LYS B 1 47  ? 135.985 -70.569  58.408  1.00 187.08 ? 1047 LYS B N   1 
ATOM   3330 C CA  . LYS B 1 47  ? 135.478 -71.939  58.521  1.00 190.31 ? 1047 LYS B CA  1 
ATOM   3331 C C   . LYS B 1 47  ? 136.557 -72.844  59.123  1.00 196.74 ? 1047 LYS B C   1 
ATOM   3332 O O   . LYS B 1 47  ? 136.230 -73.800  59.827  1.00 200.92 ? 1047 LYS B O   1 
ATOM   3333 C CB  . LYS B 1 47  ? 135.030 -72.483  57.145  1.00 190.09 ? 1047 LYS B CB  1 
ATOM   3334 C CG  . LYS B 1 47  ? 133.939 -71.669  56.441  1.00 204.06 ? 1047 LYS B CG  1 
ATOM   3335 C CD  . LYS B 1 47  ? 132.530 -72.074  56.857  1.00 218.75 ? 1047 LYS B CD  1 
ATOM   3336 C CE  . LYS B 1 47  ? 131.498 -71.220  56.169  1.00 228.19 ? 1047 LYS B CE  1 
ATOM   3337 N NZ  . LYS B 1 47  ? 130.126 -71.553  56.624  1.00 241.85 ? 1047 LYS B NZ  1 
ATOM   3338 N N   . LEU B 1 48  ? 137.843 -72.536  58.840  1.00 190.85 ? 1048 LEU B N   1 
ATOM   3339 C CA  . LEU B 1 48  ? 139.004 -73.295  59.319  1.00 192.93 ? 1048 LEU B CA  1 
ATOM   3340 C C   . LEU B 1 48  ? 139.957 -72.400  60.152  1.00 198.43 ? 1048 LEU B C   1 
ATOM   3341 O O   . LEU B 1 48  ? 141.163 -72.656  60.198  1.00 198.04 ? 1048 LEU B O   1 
ATOM   3342 C CB  . LEU B 1 48  ? 139.769 -73.951  58.136  1.00 189.35 ? 1048 LEU B CB  1 
ATOM   3343 C CG  . LEU B 1 48  ? 138.973 -74.490  56.926  1.00 191.64 ? 1048 LEU B CG  1 
ATOM   3344 C CD1 . LEU B 1 48  ? 139.905 -74.854  55.785  1.00 188.14 ? 1048 LEU B CD1 1 
ATOM   3345 C CD2 . LEU B 1 48  ? 138.103 -75.687  57.294  1.00 198.64 ? 1048 LEU B CD2 1 
ATOM   3346 N N   . GLU B 1 49  ? 139.404 -71.372  60.835  1.00 197.13 ? 1049 GLU B N   1 
ATOM   3347 C CA  . GLU B 1 49  ? 140.161 -70.435  61.683  1.00 199.38 ? 1049 GLU B CA  1 
ATOM   3348 C C   . GLU B 1 49  ? 140.718 -71.121  62.946  1.00 210.58 ? 1049 GLU B C   1 
ATOM   3349 O O   . GLU B 1 49  ? 141.732 -70.672  63.486  1.00 212.25 ? 1049 GLU B O   1 
ATOM   3350 C CB  . GLU B 1 49  ? 139.323 -69.192  62.061  1.00 201.40 ? 1049 GLU B CB  1 
ATOM   3351 C CG  . GLU B 1 49  ? 137.865 -69.451  62.424  1.00 212.43 ? 1049 GLU B CG  1 
ATOM   3352 C CD  . GLU B 1 49  ? 137.522 -69.673  63.886  1.00 231.79 ? 1049 GLU B CD  1 
ATOM   3353 O OE1 . GLU B 1 49  ? 138.277 -69.200  64.766  1.00 225.19 ? 1049 GLU B OE1 1 
ATOM   3354 O OE2 . GLU B 1 49  ? 136.460 -70.281  64.150  1.00 223.94 ? 1049 GLU B OE2 1 
ATOM   3355 N N   . ASP B 1 50  ? 140.068 -72.213  63.393  1.00 211.40 ? 1050 ASP B N   1 
ATOM   3356 C CA  . ASP B 1 50  ? 140.472 -73.007  64.555  1.00 218.04 ? 1050 ASP B CA  1 
ATOM   3357 C C   . ASP B 1 50  ? 141.552 -74.038  64.176  1.00 222.15 ? 1050 ASP B C   1 
ATOM   3358 O O   . ASP B 1 50  ? 142.395 -74.373  65.010  1.00 226.52 ? 1050 ASP B O   1 
ATOM   3359 C CB  . ASP B 1 50  ? 139.251 -73.729  65.166  1.00 224.29 ? 1050 ASP B CB  1 
ATOM   3360 C CG  . ASP B 1 50  ? 138.015 -72.865  65.359  1.00 230.16 ? 1050 ASP B CG  1 
ATOM   3361 O OD1 . ASP B 1 50  ? 138.088 -71.886  66.133  1.00 231.25 ? 1050 ASP B OD1 1 
ATOM   3362 O OD2 . ASP B 1 50  ? 136.964 -73.195  64.768  1.00 232.77 ? 1050 ASP B OD2 1 
ATOM   3363 N N   . LYS B 1 51  ? 141.516 -74.527  62.915  1.00 214.00 ? 1051 LYS B N   1 
ATOM   3364 C CA  . LYS B 1 51  ? 142.407 -75.549  62.347  1.00 213.39 ? 1051 LYS B CA  1 
ATOM   3365 C C   . LYS B 1 51  ? 143.890 -75.145  62.368  1.00 217.49 ? 1051 LYS B C   1 
ATOM   3366 O O   . LYS B 1 51  ? 144.216 -73.956  62.332  1.00 214.82 ? 1051 LYS B O   1 
ATOM   3367 C CB  . LYS B 1 51  ? 141.987 -75.898  60.907  1.00 210.21 ? 1051 LYS B CB  1 
ATOM   3368 C CG  . LYS B 1 51  ? 140.592 -76.506  60.809  1.00 224.15 ? 1051 LYS B CG  1 
ATOM   3369 C CD  . LYS B 1 51  ? 140.471 -77.522  59.687  1.00 230.61 ? 1051 LYS B CD  1 
ATOM   3370 C CE  . LYS B 1 51  ? 139.177 -78.290  59.799  1.00 241.56 ? 1051 LYS B CE  1 
ATOM   3371 N NZ  . LYS B 1 51  ? 138.995 -79.242  58.674  1.00 246.16 ? 1051 LYS B NZ  1 
ATOM   3372 N N   . SER B 1 52  ? 144.779 -76.157  62.424  1.00 217.46 ? 1052 SER B N   1 
ATOM   3373 C CA  . SER B 1 52  ? 146.235 -75.982  62.459  1.00 218.78 ? 1052 SER B CA  1 
ATOM   3374 C C   . SER B 1 52  ? 146.824 -75.833  61.038  1.00 216.98 ? 1052 SER B C   1 
ATOM   3375 O O   . SER B 1 52  ? 146.263 -76.400  60.096  1.00 213.07 ? 1052 SER B O   1 
ATOM   3376 C CB  . SER B 1 52  ? 146.894 -77.148  63.189  1.00 229.16 ? 1052 SER B CB  1 
ATOM   3377 O OG  . SER B 1 52  ? 146.621 -78.388  62.558  1.00 237.37 ? 1052 SER B OG  1 
ATOM   3378 N N   . PRO B 1 53  ? 147.959 -75.102  60.857  1.00 212.96 ? 1053 PRO B N   1 
ATOM   3379 C CA  . PRO B 1 53  ? 148.517 -74.929  59.500  1.00 207.18 ? 1053 PRO B CA  1 
ATOM   3380 C C   . PRO B 1 53  ? 149.186 -76.178  58.908  1.00 210.95 ? 1053 PRO B C   1 
ATOM   3381 O O   . PRO B 1 53  ? 149.356 -76.239  57.687  1.00 205.74 ? 1053 PRO B O   1 
ATOM   3382 C CB  . PRO B 1 53  ? 149.555 -73.809  59.676  1.00 209.73 ? 1053 PRO B CB  1 
ATOM   3383 C CG  . PRO B 1 53  ? 149.304 -73.225  61.036  1.00 219.07 ? 1053 PRO B CG  1 
ATOM   3384 C CD  . PRO B 1 53  ? 148.746 -74.341  61.848  1.00 219.15 ? 1053 PRO B CD  1 
ATOM   3385 N N   . ASP B 1 54  ? 149.573 -77.155  59.749  1.00 213.20 ? 1054 ASP B N   1 
ATOM   3386 C CA  . ASP B 1 54  ? 150.246 -78.377  59.299  1.00 214.81 ? 1054 ASP B CA  1 
ATOM   3387 C C   . ASP B 1 54  ? 149.264 -79.539  59.028  1.00 217.90 ? 1054 ASP B C   1 
ATOM   3388 O O   . ASP B 1 54  ? 149.704 -80.621  58.628  1.00 219.49 ? 1054 ASP B O   1 
ATOM   3389 C CB  . ASP B 1 54  ? 151.316 -78.806  60.321  1.00 224.49 ? 1054 ASP B CB  1 
ATOM   3390 C CG  . ASP B 1 54  ? 152.496 -77.856  60.448  1.00 235.09 ? 1054 ASP B CG  1 
ATOM   3391 O OD1 . ASP B 1 54  ? 152.734 -77.068  59.504  1.00 230.10 ? 1054 ASP B OD1 1 
ATOM   3392 O OD2 . ASP B 1 54  ? 153.199 -77.920  61.479  1.00 246.72 ? 1054 ASP B OD2 1 
ATOM   3393 N N   . SER B 1 55  ? 147.947 -79.306  59.211  1.00 211.99 ? 1055 SER B N   1 
ATOM   3394 C CA  . SER B 1 55  ? 146.886 -80.296  58.986  1.00 211.96 ? 1055 SER B CA  1 
ATOM   3395 C C   . SER B 1 55  ? 146.754 -80.666  57.482  1.00 209.56 ? 1055 SER B C   1 
ATOM   3396 O O   . SER B 1 55  ? 147.075 -79.824  56.637  1.00 204.15 ? 1055 SER B O   1 
ATOM   3397 C CB  . SER B 1 55  ? 145.556 -79.769  59.520  1.00 215.36 ? 1055 SER B CB  1 
ATOM   3398 O OG  . SER B 1 55  ? 145.158 -78.579  58.860  1.00 218.92 ? 1055 SER B OG  1 
ATOM   3399 N N   . PRO B 1 56  ? 146.269 -81.889  57.114  1.00 206.66 ? 1056 PRO B N   1 
ATOM   3400 C CA  . PRO B 1 56  ? 146.141 -82.232  55.678  1.00 201.89 ? 1056 PRO B CA  1 
ATOM   3401 C C   . PRO B 1 56  ? 145.141 -81.353  54.908  1.00 198.66 ? 1056 PRO B C   1 
ATOM   3402 O O   . PRO B 1 56  ? 145.232 -81.277  53.682  1.00 194.23 ? 1056 PRO B O   1 
ATOM   3403 C CB  . PRO B 1 56  ? 145.682 -83.693  55.701  1.00 208.34 ? 1056 PRO B CB  1 
ATOM   3404 C CG  . PRO B 1 56  ? 145.063 -83.883  57.038  1.00 217.88 ? 1056 PRO B CG  1 
ATOM   3405 C CD  . PRO B 1 56  ? 145.851 -83.021  57.969  1.00 214.50 ? 1056 PRO B CD  1 
ATOM   3406 N N   . GLU B 1 57  ? 144.198 -80.694  55.624  1.00 194.09 ? 1057 GLU B N   1 
ATOM   3407 C CA  . GLU B 1 57  ? 143.207 -79.774  55.045  1.00 188.54 ? 1057 GLU B CA  1 
ATOM   3408 C C   . GLU B 1 57  ? 143.904 -78.488  54.594  1.00 185.14 ? 1057 GLU B C   1 
ATOM   3409 O O   . GLU B 1 57  ? 143.503 -77.890  53.600  1.00 179.90 ? 1057 GLU B O   1 
ATOM   3410 C CB  . GLU B 1 57  ? 142.082 -79.452  56.047  1.00 192.50 ? 1057 GLU B CB  1 
ATOM   3411 C CG  . GLU B 1 57  ? 141.231 -80.644  56.457  1.00 208.22 ? 1057 GLU B CG  1 
ATOM   3412 C CD  . GLU B 1 57  ? 141.657 -81.317  57.748  1.00 232.40 ? 1057 GLU B CD  1 
ATOM   3413 O OE1 . GLU B 1 57  ? 141.621 -80.653  58.809  1.00 226.86 ? 1057 GLU B OE1 1 
ATOM   3414 O OE2 . GLU B 1 57  ? 141.994 -82.521  57.704  1.00 229.12 ? 1057 GLU B OE2 1 
ATOM   3415 N N   . MET B 1 58  ? 144.973 -78.094  55.330  1.00 181.88 ? 1058 MET B N   1 
ATOM   3416 C CA  . MET B 1 58  ? 145.826 -76.927  55.073  1.00 177.85 ? 1058 MET B CA  1 
ATOM   3417 C C   . MET B 1 58  ? 147.113 -77.360  54.333  1.00 178.97 ? 1058 MET B C   1 
ATOM   3418 O O   . MET B 1 58  ? 148.188 -76.784  54.530  1.00 178.74 ? 1058 MET B O   1 
ATOM   3419 C CB  . MET B 1 58  ? 146.153 -76.180  56.382  1.00 183.42 ? 1058 MET B CB  1 
ATOM   3420 C CG  . MET B 1 58  ? 144.959 -75.480  56.994  1.00 187.23 ? 1058 MET B CG  1 
ATOM   3421 S SD  . MET B 1 58  ? 145.388 -73.881  57.715  1.00 191.70 ? 1058 MET B SD  1 
ATOM   3422 C CE  . MET B 1 58  ? 143.895 -73.514  58.574  1.00 190.21 ? 1058 MET B CE  1 
ATOM   3423 N N   . LYS B 1 59  ? 146.980 -78.398  53.492  1.00 173.78 ? 1059 LYS B N   1 
ATOM   3424 C CA  . LYS B 1 59  ? 148.011 -78.967  52.621  1.00 172.53 ? 1059 LYS B CA  1 
ATOM   3425 C C   . LYS B 1 59  ? 147.485 -78.983  51.196  1.00 169.94 ? 1059 LYS B C   1 
ATOM   3426 O O   . LYS B 1 59  ? 148.245 -78.765  50.253  1.00 166.90 ? 1059 LYS B O   1 
ATOM   3427 C CB  . LYS B 1 59  ? 148.397 -80.393  53.054  1.00 180.46 ? 1059 LYS B CB  1 
ATOM   3428 C CG  . LYS B 1 59  ? 149.343 -80.478  54.237  1.00 198.00 ? 1059 LYS B CG  1 
ATOM   3429 C CD  . LYS B 1 59  ? 149.932 -81.880  54.339  1.00 211.81 ? 1059 LYS B CD  1 
ATOM   3430 C CE  . LYS B 1 59  ? 150.529 -82.175  55.691  1.00 226.98 ? 1059 LYS B CE  1 
ATOM   3431 N NZ  . LYS B 1 59  ? 149.501 -82.636  56.660  1.00 237.45 ? 1059 LYS B NZ  1 
ATOM   3432 N N   . ASP B 1 60  ? 146.169 -79.246  51.051  1.00 164.71 ? 1060 ASP B N   1 
ATOM   3433 C CA  . ASP B 1 60  ? 145.481 -79.314  49.760  1.00 160.71 ? 1060 ASP B CA  1 
ATOM   3434 C C   . ASP B 1 60  ? 144.820 -77.985  49.371  1.00 159.27 ? 1060 ASP B C   1 
ATOM   3435 O O   . ASP B 1 60  ? 144.773 -77.661  48.186  1.00 155.62 ? 1060 ASP B O   1 
ATOM   3436 C CB  . ASP B 1 60  ? 144.417 -80.415  49.767  1.00 165.34 ? 1060 ASP B CB  1 
ATOM   3437 C CG  . ASP B 1 60  ? 144.209 -81.036  48.396  1.00 171.89 ? 1060 ASP B CG  1 
ATOM   3438 O OD1 . ASP B 1 60  ? 144.694 -82.161  48.178  1.00 174.98 ? 1060 ASP B OD1 1 
ATOM   3439 O OD2 . ASP B 1 60  ? 143.573 -80.387  47.534  1.00 173.43 ? 1060 ASP B OD2 1 
ATOM   3440 N N   . PHE B 1 61  ? 144.268 -77.244  50.358  1.00 155.59 ? 1061 PHE B N   1 
ATOM   3441 C CA  . PHE B 1 61  ? 143.619 -75.947  50.125  1.00 151.68 ? 1061 PHE B CA  1 
ATOM   3442 C C   . PHE B 1 61  ? 144.660 -74.879  49.766  1.00 150.70 ? 1061 PHE B C   1 
ATOM   3443 O O   . PHE B 1 61  ? 144.325 -73.912  49.080  1.00 146.85 ? 1061 PHE B O   1 
ATOM   3444 C CB  . PHE B 1 61  ? 142.790 -75.510  51.345  1.00 155.80 ? 1061 PHE B CB  1 
ATOM   3445 C CG  . PHE B 1 61  ? 141.327 -75.893  51.293  1.00 158.80 ? 1061 PHE B CG  1 
ATOM   3446 C CD1 . PHE B 1 61  ? 140.905 -77.152  51.704  1.00 166.01 ? 1061 PHE B CD1 1 
ATOM   3447 C CD2 . PHE B 1 61  ? 140.368 -74.984  50.860  1.00 158.81 ? 1061 PHE B CD2 1 
ATOM   3448 C CE1 . PHE B 1 61  ? 139.551 -77.501  51.665  1.00 168.90 ? 1061 PHE B CE1 1 
ATOM   3449 C CE2 . PHE B 1 61  ? 139.014 -75.333  50.824  1.00 163.65 ? 1061 PHE B CE2 1 
ATOM   3450 C CZ  . PHE B 1 61  ? 138.616 -76.589  51.226  1.00 165.88 ? 1061 PHE B CZ  1 
ATOM   3451 N N   . ARG B 1 62  ? 145.921 -75.068  50.220  1.00 147.51 ? 1062 ARG B N   1 
ATOM   3452 C CA  . ARG B 1 62  ? 147.053 -74.181  49.925  1.00 144.74 ? 1062 ARG B CA  1 
ATOM   3453 C C   . ARG B 1 62  ? 147.595 -74.527  48.538  1.00 144.35 ? 1062 ARG B C   1 
ATOM   3454 O O   . ARG B 1 62  ? 147.949 -73.629  47.772  1.00 140.99 ? 1062 ARG B O   1 
ATOM   3455 C CB  . ARG B 1 62  ? 148.156 -74.279  51.005  1.00 148.30 ? 1062 ARG B CB  1 
ATOM   3456 C CG  . ARG B 1 62  ? 147.686 -74.224  52.477  1.00 160.49 ? 1062 ARG B CG  1 
ATOM   3457 C CD  . ARG B 1 62  ? 147.012 -72.925  52.908  1.00 166.15 ? 1062 ARG B CD  1 
ATOM   3458 N NE  . ARG B 1 62  ? 145.576 -72.940  52.620  1.00 170.49 ? 1062 ARG B NE  1 
ATOM   3459 C CZ  . ARG B 1 62  ? 144.738 -71.939  52.870  1.00 180.67 ? 1062 ARG B CZ  1 
ATOM   3460 N NH1 . ARG B 1 62  ? 145.181 -70.820  53.434  1.00 168.05 ? 1062 ARG B NH1 1 
ATOM   3461 N NH2 . ARG B 1 62  ? 143.453 -72.046  52.565  1.00 163.24 ? 1062 ARG B NH2 1 
ATOM   3462 N N   . HIS B 1 63  ? 147.612 -75.841  48.211  1.00 141.07 ? 1063 HIS B N   1 
ATOM   3463 C CA  . HIS B 1 63  ? 147.998 -76.422  46.922  1.00 138.83 ? 1063 HIS B CA  1 
ATOM   3464 C C   . HIS B 1 63  ? 147.016 -75.946  45.845  1.00 136.51 ? 1063 HIS B C   1 
ATOM   3465 O O   . HIS B 1 63  ? 147.429 -75.716  44.709  1.00 133.97 ? 1063 HIS B O   1 
ATOM   3466 C CB  . HIS B 1 63  ? 148.039 -77.966  47.011  1.00 143.33 ? 1063 HIS B CB  1 
ATOM   3467 C CG  . HIS B 1 63  ? 148.241 -78.652  45.693  1.00 146.14 ? 1063 HIS B CG  1 
ATOM   3468 N ND1 . HIS B 1 63  ? 149.480 -78.713  45.096  1.00 148.08 ? 1063 HIS B ND1 1 
ATOM   3469 C CD2 . HIS B 1 63  ? 147.340 -79.278  44.898  1.00 147.64 ? 1063 HIS B CD2 1 
ATOM   3470 C CE1 . HIS B 1 63  ? 149.297 -79.369  43.960  1.00 147.24 ? 1063 HIS B CE1 1 
ATOM   3471 N NE2 . HIS B 1 63  ? 148.023 -79.727  43.801  1.00 147.41 ? 1063 HIS B NE2 1 
ATOM   3472 N N   . GLY B 1 64  ? 145.751 -75.756  46.229  1.00 130.93 ? 1064 GLY B N   1 
ATOM   3473 C CA  . GLY B 1 64  ? 144.689 -75.254  45.363  1.00 127.44 ? 1064 GLY B CA  1 
ATOM   3474 C C   . GLY B 1 64  ? 144.986 -73.870  44.820  1.00 125.67 ? 1064 GLY B C   1 
ATOM   3475 O O   . GLY B 1 64  ? 144.652 -73.574  43.670  1.00 123.48 ? 1064 GLY B O   1 
ATOM   3476 N N   . PHE B 1 65  ? 145.646 -73.023  45.638  1.00 120.40 ? 1065 PHE B N   1 
ATOM   3477 C CA  . PHE B 1 65  ? 146.045 -71.671  45.249  1.00 117.09 ? 1065 PHE B CA  1 
ATOM   3478 C C   . PHE B 1 65  ? 147.248 -71.696  44.320  1.00 118.93 ? 1065 PHE B C   1 
ATOM   3479 O O   . PHE B 1 65  ? 147.339 -70.843  43.441  1.00 116.61 ? 1065 PHE B O   1 
ATOM   3480 C CB  . PHE B 1 65  ? 146.343 -70.797  46.470  1.00 119.74 ? 1065 PHE B CB  1 
ATOM   3481 C CG  . PHE B 1 65  ? 145.091 -70.263  47.110  1.00 121.43 ? 1065 PHE B CG  1 
ATOM   3482 C CD1 . PHE B 1 65  ? 144.370 -69.235  46.515  1.00 122.39 ? 1065 PHE B CD1 1 
ATOM   3483 C CD2 . PHE B 1 65  ? 144.621 -70.797  48.301  1.00 126.57 ? 1065 PHE B CD2 1 
ATOM   3484 C CE1 . PHE B 1 65  ? 143.196 -68.755  47.097  1.00 124.34 ? 1065 PHE B CE1 1 
ATOM   3485 C CE2 . PHE B 1 65  ? 143.448 -70.317  48.886  1.00 130.29 ? 1065 PHE B CE2 1 
ATOM   3486 C CZ  . PHE B 1 65  ? 142.746 -69.296  48.282  1.00 126.44 ? 1065 PHE B CZ  1 
ATOM   3487 N N   . ASP B 1 66  ? 148.162 -72.671  44.501  1.00 116.26 ? 1066 ASP B N   1 
ATOM   3488 C CA  . ASP B 1 66  ? 149.348 -72.839  43.654  1.00 115.40 ? 1066 ASP B CA  1 
ATOM   3489 C C   . ASP B 1 66  ? 148.919 -73.159  42.226  1.00 114.54 ? 1066 ASP B C   1 
ATOM   3490 O O   . ASP B 1 66  ? 149.582 -72.741  41.277  1.00 113.03 ? 1066 ASP B O   1 
ATOM   3491 C CB  . ASP B 1 66  ? 150.271 -73.943  44.203  1.00 121.27 ? 1066 ASP B CB  1 
ATOM   3492 C CG  . ASP B 1 66  ? 150.991 -73.595  45.497  1.00 137.77 ? 1066 ASP B CG  1 
ATOM   3493 O OD1 . ASP B 1 66  ? 151.666 -72.539  45.538  1.00 138.37 ? 1066 ASP B OD1 1 
ATOM   3494 O OD2 . ASP B 1 66  ? 150.944 -74.416  46.441  1.00 147.71 ? 1066 ASP B OD2 1 
ATOM   3495 N N   . ILE B 1 67  ? 147.794 -73.897  42.089  1.00 109.18 ? 1067 ILE B N   1 
ATOM   3496 C CA  . ILE B 1 67  ? 147.150 -74.265  40.827  1.00 107.31 ? 1067 ILE B CA  1 
ATOM   3497 C C   . ILE B 1 67  ? 146.576 -72.982  40.209  1.00 106.73 ? 1067 ILE B C   1 
ATOM   3498 O O   . ILE B 1 67  ? 146.811 -72.709  39.032  1.00 105.20 ? 1067 ILE B O   1 
ATOM   3499 C CB  . ILE B 1 67  ? 146.060 -75.355  41.066  1.00 112.46 ? 1067 ILE B CB  1 
ATOM   3500 C CG1 . ILE B 1 67  ? 146.686 -76.677  41.562  1.00 116.22 ? 1067 ILE B CG1 1 
ATOM   3501 C CG2 . ILE B 1 67  ? 145.204 -75.599  39.819  1.00 113.10 ? 1067 ILE B CG2 1 
ATOM   3502 C CD1 . ILE B 1 67  ? 145.713 -77.619  42.263  1.00 127.59 ? 1067 ILE B CD1 1 
ATOM   3503 N N   . LEU B 1 68  ? 145.849 -72.195  41.028  1.00 101.33 ? 1068 LEU B N   1 
ATOM   3504 C CA  . LEU B 1 68  ? 145.209 -70.930  40.673  1.00 98.57  ? 1068 LEU B CA  1 
ATOM   3505 C C   . LEU B 1 68  ? 146.227 -69.891  40.179  1.00 97.02  ? 1068 LEU B C   1 
ATOM   3506 O O   . LEU B 1 68  ? 145.961 -69.229  39.177  1.00 95.29  ? 1068 LEU B O   1 
ATOM   3507 C CB  . LEU B 1 68  ? 144.449 -70.392  41.893  1.00 99.47  ? 1068 LEU B CB  1 
ATOM   3508 C CG  . LEU B 1 68  ? 143.105 -69.726  41.613  1.00 104.54 ? 1068 LEU B CG  1 
ATOM   3509 C CD1 . LEU B 1 68  ? 142.043 -70.234  42.567  1.00 106.81 ? 1068 LEU B CD1 1 
ATOM   3510 C CD2 . LEU B 1 68  ? 143.212 -68.203  41.698  1.00 106.16 ? 1068 LEU B CD2 1 
ATOM   3511 N N   . VAL B 1 69  ? 147.394 -69.770  40.861  1.00 91.35  ? 1069 VAL B N   1 
ATOM   3512 C CA  . VAL B 1 69  ? 148.477 -68.846  40.494  1.00 89.33  ? 1069 VAL B CA  1 
ATOM   3513 C C   . VAL B 1 69  ? 149.121 -69.350  39.190  1.00 92.88  ? 1069 VAL B C   1 
ATOM   3514 O O   . VAL B 1 69  ? 149.410 -68.543  38.305  1.00 92.54  ? 1069 VAL B O   1 
ATOM   3515 C CB  . VAL B 1 69  ? 149.517 -68.642  41.640  1.00 93.94  ? 1069 VAL B CB  1 
ATOM   3516 C CG1 . VAL B 1 69  ? 150.731 -67.846  41.162  1.00 93.89  ? 1069 VAL B CG1 1 
ATOM   3517 C CG2 . VAL B 1 69  ? 148.886 -67.950  42.848  1.00 93.95  ? 1069 VAL B CG2 1 
ATOM   3518 N N   . GLY B 1 70  ? 149.297 -70.669  39.081  1.00 89.68  ? 1070 GLY B N   1 
ATOM   3519 C CA  . GLY B 1 70  ? 149.848 -71.330  37.901  1.00 89.92  ? 1070 GLY B CA  1 
ATOM   3520 C C   . GLY B 1 70  ? 149.022 -71.096  36.648  1.00 92.58  ? 1070 GLY B C   1 
ATOM   3521 O O   . GLY B 1 70  ? 149.584 -70.844  35.579  1.00 92.70  ? 1070 GLY B O   1 
ATOM   3522 N N   . GLN B 1 71  ? 147.676 -71.138  36.786  1.00 87.45  ? 1071 GLN B N   1 
ATOM   3523 C CA  . GLN B 1 71  ? 146.710 -70.876  35.720  1.00 86.49  ? 1071 GLN B CA  1 
ATOM   3524 C C   . GLN B 1 71  ? 146.696 -69.389  35.336  1.00 87.21  ? 1071 GLN B C   1 
ATOM   3525 O O   . GLN B 1 71  ? 146.468 -69.077  34.167  1.00 86.97  ? 1071 GLN B O   1 
ATOM   3526 C CB  . GLN B 1 71  ? 145.309 -71.329  36.140  1.00 89.01  ? 1071 GLN B CB  1 
ATOM   3527 C CG  . GLN B 1 71  ? 145.051 -72.804  35.851  1.00 112.44 ? 1071 GLN B CG  1 
ATOM   3528 C CD  . GLN B 1 71  ? 143.785 -73.342  36.475  1.00 133.36 ? 1071 GLN B CD  1 
ATOM   3529 O OE1 . GLN B 1 71  ? 143.784 -74.410  37.088  1.00 130.74 ? 1071 GLN B OE1 1 
ATOM   3530 N NE2 . GLN B 1 71  ? 142.669 -72.644  36.309  1.00 126.46 ? 1071 GLN B NE2 1 
ATOM   3531 N N   . ILE B 1 72  ? 146.934 -68.479  36.316  1.00 82.14  ? 1072 ILE B N   1 
ATOM   3532 C CA  . ILE B 1 72  ? 147.000 -67.027  36.095  1.00 81.28  ? 1072 ILE B CA  1 
ATOM   3533 C C   . ILE B 1 72  ? 148.251 -66.726  35.235  1.00 87.10  ? 1072 ILE B C   1 
ATOM   3534 O O   . ILE B 1 72  ? 148.151 -65.961  34.274  1.00 86.92  ? 1072 ILE B O   1 
ATOM   3535 C CB  . ILE B 1 72  ? 146.964 -66.223  37.437  1.00 83.74  ? 1072 ILE B CB  1 
ATOM   3536 C CG1 . ILE B 1 72  ? 145.534 -66.203  38.033  1.00 84.14  ? 1072 ILE B CG1 1 
ATOM   3537 C CG2 . ILE B 1 72  ? 147.464 -64.782  37.252  1.00 84.00  ? 1072 ILE B CG2 1 
ATOM   3538 C CD1 . ILE B 1 72  ? 145.422 -65.835  39.551  1.00 87.12  ? 1072 ILE B CD1 1 
ATOM   3539 N N   . ASP B 1 73  ? 149.395 -67.375  35.550  1.00 85.05  ? 1073 ASP B N   1 
ATOM   3540 C CA  . ASP B 1 73  ? 150.670 -67.244  34.833  1.00 86.28  ? 1073 ASP B CA  1 
ATOM   3541 C C   . ASP B 1 73  ? 150.577 -67.738  33.374  1.00 90.76  ? 1073 ASP B C   1 
ATOM   3542 O O   . ASP B 1 73  ? 151.232 -67.165  32.494  1.00 91.02  ? 1073 ASP B O   1 
ATOM   3543 C CB  . ASP B 1 73  ? 151.783 -68.007  35.570  1.00 90.02  ? 1073 ASP B CB  1 
ATOM   3544 C CG  . ASP B 1 73  ? 152.312 -67.338  36.831  1.00 103.09 ? 1073 ASP B CG  1 
ATOM   3545 O OD1 . ASP B 1 73  ? 152.135 -66.107  36.973  1.00 103.56 ? 1073 ASP B OD1 1 
ATOM   3546 O OD2 . ASP B 1 73  ? 152.947 -68.038  37.654  1.00 111.51 ? 1073 ASP B OD2 1 
ATOM   3547 N N   . ASP B 1 74  ? 149.777 -68.801  33.125  1.00 87.15  ? 1074 ASP B N   1 
ATOM   3548 C CA  . ASP B 1 74  ? 149.544 -69.356  31.786  1.00 87.92  ? 1074 ASP B CA  1 
ATOM   3549 C C   . ASP B 1 74  ? 148.792 -68.333  30.939  1.00 89.25  ? 1074 ASP B C   1 
ATOM   3550 O O   . ASP B 1 74  ? 149.165 -68.091  29.791  1.00 90.08  ? 1074 ASP B O   1 
ATOM   3551 C CB  . ASP B 1 74  ? 148.747 -70.676  31.866  1.00 91.21  ? 1074 ASP B CB  1 
ATOM   3552 C CG  . ASP B 1 74  ? 149.519 -71.909  32.312  1.00 104.83 ? 1074 ASP B CG  1 
ATOM   3553 O OD1 . ASP B 1 74  ? 150.773 -71.834  32.409  1.00 106.33 ? 1074 ASP B OD1 1 
ATOM   3554 O OD2 . ASP B 1 74  ? 148.875 -72.962  32.527  1.00 111.25 ? 1074 ASP B OD2 1 
ATOM   3555 N N   . ALA B 1 75  ? 147.754 -67.711  31.539  1.00 82.88  ? 1075 ALA B N   1 
ATOM   3556 C CA  . ALA B 1 75  ? 146.922 -66.667  30.951  1.00 82.21  ? 1075 ALA B CA  1 
ATOM   3557 C C   . ALA B 1 75  ? 147.737 -65.390  30.739  1.00 84.03  ? 1075 ALA B C   1 
ATOM   3558 O O   . ALA B 1 75  ? 147.522 -64.692  29.745  1.00 85.64  ? 1075 ALA B O   1 
ATOM   3559 C CB  . ALA B 1 75  ? 145.730 -66.388  31.850  1.00 82.35  ? 1075 ALA B CB  1 
ATOM   3560 N N   . LEU B 1 76  ? 148.683 -65.099  31.665  1.00 77.06  ? 1076 LEU B N   1 
ATOM   3561 C CA  . LEU B 1 76  ? 149.589 -63.947  31.600  1.00 75.74  ? 1076 LEU B CA  1 
ATOM   3562 C C   . LEU B 1 76  ? 150.555 -64.090  30.429  1.00 79.03  ? 1076 LEU B C   1 
ATOM   3563 O O   . LEU B 1 76  ? 150.837 -63.102  29.756  1.00 78.91  ? 1076 LEU B O   1 
ATOM   3564 C CB  . LEU B 1 76  ? 150.378 -63.796  32.909  1.00 75.08  ? 1076 LEU B CB  1 
ATOM   3565 C CG  . LEU B 1 76  ? 149.746 -62.959  34.016  1.00 78.89  ? 1076 LEU B CG  1 
ATOM   3566 C CD1 . LEU B 1 76  ? 150.313 -63.339  35.364  1.00 78.53  ? 1076 LEU B CD1 1 
ATOM   3567 C CD2 . LEU B 1 76  ? 149.945 -61.467  33.771  1.00 82.97  ? 1076 LEU B CD2 1 
ATOM   3568 N N   . LYS B 1 77  ? 151.043 -65.327  30.178  1.00 75.87  ? 1077 LYS B N   1 
ATOM   3569 C CA  . LYS B 1 77  ? 151.952 -65.660  29.076  1.00 77.52  ? 1077 LYS B CA  1 
ATOM   3570 C C   . LYS B 1 77  ? 151.278 -65.415  27.720  1.00 83.17  ? 1077 LYS B C   1 
ATOM   3571 O O   . LYS B 1 77  ? 151.946 -64.990  26.781  1.00 84.10  ? 1077 LYS B O   1 
ATOM   3572 C CB  . LYS B 1 77  ? 152.419 -67.120  29.184  1.00 80.22  ? 1077 LYS B CB  1 
ATOM   3573 C CG  . LYS B 1 77  ? 153.880 -67.334  28.795  1.00 92.24  ? 1077 LYS B CG  1 
ATOM   3574 C CD  . LYS B 1 77  ? 154.061 -67.711  27.329  1.00 100.46 ? 1077 LYS B CD  1 
ATOM   3575 C CE  . LYS B 1 77  ? 155.517 -67.780  26.943  1.00 107.52 ? 1077 LYS B CE  1 
ATOM   3576 N NZ  . LYS B 1 77  ? 155.692 -68.209  25.531  1.00 118.19 ? 1077 LYS B NZ  1 
ATOM   3577 N N   . LEU B 1 78  ? 149.955 -65.658  27.631  1.00 80.37  ? 1078 LEU B N   1 
ATOM   3578 C CA  . LEU B 1 78  ? 149.161 -65.439  26.420  1.00 82.63  ? 1078 LEU B CA  1 
ATOM   3579 C C   . LEU B 1 78  ? 148.913 -63.944  26.200  1.00 88.34  ? 1078 LEU B C   1 
ATOM   3580 O O   . LEU B 1 78  ? 149.087 -63.460  25.082  1.00 90.02  ? 1078 LEU B O   1 
ATOM   3581 C CB  . LEU B 1 78  ? 147.825 -66.193  26.502  1.00 82.85  ? 1078 LEU B CB  1 
ATOM   3582 C CG  . LEU B 1 78  ? 147.908 -67.712  26.584  1.00 88.25  ? 1078 LEU B CG  1 
ATOM   3583 C CD1 . LEU B 1 78  ? 146.654 -68.286  27.207  1.00 87.98  ? 1078 LEU B CD1 1 
ATOM   3584 C CD2 . LEU B 1 78  ? 148.174 -68.330  25.214  1.00 94.37  ? 1078 LEU B CD2 1 
ATOM   3585 N N   . ALA B 1 79  ? 148.525 -63.217  27.273  1.00 84.43  ? 1079 ALA B N   1 
ATOM   3586 C CA  . ALA B 1 79  ? 148.249 -61.776  27.274  1.00 85.09  ? 1079 ALA B CA  1 
ATOM   3587 C C   . ALA B 1 79  ? 149.492 -60.955  26.896  1.00 91.30  ? 1079 ALA B C   1 
ATOM   3588 O O   . ALA B 1 79  ? 149.359 -59.966  26.175  1.00 92.32  ? 1079 ALA B O   1 
ATOM   3589 C CB  . ALA B 1 79  ? 147.733 -61.344  28.640  1.00 83.86  ? 1079 ALA B CB  1 
ATOM   3590 N N   . ASN B 1 80  ? 150.693 -61.380  27.366  1.00 89.13  ? 1080 ASN B N   1 
ATOM   3591 C CA  . ASN B 1 80  ? 151.984 -60.732  27.084  1.00 91.66  ? 1080 ASN B CA  1 
ATOM   3592 C C   . ASN B 1 80  ? 152.412 -60.933  25.624  1.00 98.74  ? 1080 ASN B C   1 
ATOM   3593 O O   . ASN B 1 80  ? 153.184 -60.130  25.101  1.00 99.53  ? 1080 ASN B O   1 
ATOM   3594 C CB  . ASN B 1 80  ? 153.074 -61.242  28.023  1.00 94.24  ? 1080 ASN B CB  1 
ATOM   3595 C CG  . ASN B 1 80  ? 153.189 -60.436  29.292  1.00 122.34 ? 1080 ASN B CG  1 
ATOM   3596 O OD1 . ASN B 1 80  ? 152.496 -60.685  30.282  1.00 118.41 ? 1080 ASN B OD1 1 
ATOM   3597 N ND2 . ASN B 1 80  ? 154.075 -59.450  29.290  1.00 115.73 ? 1080 ASN B ND2 1 
ATOM   3598 N N   . GLU B 1 81  ? 151.909 -62.006  24.980  1.00 97.30  ? 1081 GLU B N   1 
ATOM   3599 C CA  . GLU B 1 81  ? 152.145 -62.337  23.571  1.00 100.73 ? 1081 GLU B CA  1 
ATOM   3600 C C   . GLU B 1 81  ? 151.130 -61.605  22.669  1.00 108.65 ? 1081 GLU B C   1 
ATOM   3601 O O   . GLU B 1 81  ? 151.280 -61.605  21.444  1.00 111.78 ? 1081 GLU B O   1 
ATOM   3602 C CB  . GLU B 1 81  ? 152.053 -63.858  23.349  1.00 101.97 ? 1081 GLU B CB  1 
ATOM   3603 C CG  . GLU B 1 81  ? 153.283 -64.635  23.782  1.00 112.57 ? 1081 GLU B CG  1 
ATOM   3604 C CD  . GLU B 1 81  ? 153.186 -66.134  23.575  1.00 136.37 ? 1081 GLU B CD  1 
ATOM   3605 O OE1 . GLU B 1 81  ? 152.237 -66.751  24.111  1.00 129.75 ? 1081 GLU B OE1 1 
ATOM   3606 O OE2 . GLU B 1 81  ? 154.074 -66.697  22.894  1.00 136.03 ? 1081 GLU B OE2 1 
ATOM   3607 N N   . GLY B 1 82  ? 150.119 -60.992  23.296  1.00 104.80 ? 1082 GLY B N   1 
ATOM   3608 C CA  . GLY B 1 82  ? 149.043 -60.266  22.631  1.00 107.13 ? 1082 GLY B CA  1 
ATOM   3609 C C   . GLY B 1 82  ? 147.974 -61.200  22.106  1.00 112.81 ? 1082 GLY B C   1 
ATOM   3610 O O   . GLY B 1 82  ? 147.611 -61.129  20.929  1.00 115.99 ? 1082 GLY B O   1 
ATOM   3611 N N   . LYS B 1 83  ? 147.482 -62.100  22.979  1.00 107.37 ? 1083 LYS B N   1 
ATOM   3612 C CA  . LYS B 1 83  ? 146.485 -63.118  22.643  1.00 108.60 ? 1083 LYS B CA  1 
ATOM   3613 C C   . LYS B 1 83  ? 145.271 -62.988  23.575  1.00 112.33 ? 1083 LYS B C   1 
ATOM   3614 O O   . LYS B 1 83  ? 145.190 -63.681  24.591  1.00 109.47 ? 1083 LYS B O   1 
ATOM   3615 C CB  . LYS B 1 83  ? 147.121 -64.525  22.721  1.00 110.02 ? 1083 LYS B CB  1 
ATOM   3616 C CG  . LYS B 1 83  ? 148.265 -64.735  21.730  1.00 124.29 ? 1083 LYS B CG  1 
ATOM   3617 C CD  . LYS B 1 83  ? 149.061 -65.998  21.996  1.00 133.30 ? 1083 LYS B CD  1 
ATOM   3618 C CE  . LYS B 1 83  ? 150.158 -66.150  20.971  1.00 148.91 ? 1083 LYS B CE  1 
ATOM   3619 N NZ  . LYS B 1 83  ? 151.052 -67.295  21.280  1.00 158.47 ? 1083 LYS B NZ  1 
ATOM   3620 N N   . VAL B 1 84  ? 144.336 -62.077  23.222  1.00 111.75 ? 1084 VAL B N   1 
ATOM   3621 C CA  . VAL B 1 84  ? 143.127 -61.752  23.994  1.00 111.41 ? 1084 VAL B CA  1 
ATOM   3622 C C   . VAL B 1 84  ? 142.217 -62.981  24.128  1.00 116.45 ? 1084 VAL B C   1 
ATOM   3623 O O   . VAL B 1 84  ? 141.985 -63.430  25.252  1.00 113.90 ? 1084 VAL B O   1 
ATOM   3624 C CB  . VAL B 1 84  ? 142.346 -60.541  23.414  1.00 118.73 ? 1084 VAL B CB  1 
ATOM   3625 C CG1 . VAL B 1 84  ? 141.207 -60.120  24.341  1.00 118.45 ? 1084 VAL B CG1 1 
ATOM   3626 C CG2 . VAL B 1 84  ? 143.265 -59.360  23.158  1.00 118.59 ? 1084 VAL B CG2 1 
ATOM   3627 N N   . LYS B 1 85  ? 141.719 -63.517  22.992  1.00 116.79 ? 1085 LYS B N   1 
ATOM   3628 C CA  . LYS B 1 85  ? 140.818 -64.674  22.918  1.00 118.85 ? 1085 LYS B CA  1 
ATOM   3629 C C   . LYS B 1 85  ? 141.371 -65.913  23.649  1.00 120.56 ? 1085 LYS B C   1 
ATOM   3630 O O   . LYS B 1 85  ? 140.597 -66.679  24.223  1.00 120.58 ? 1085 LYS B O   1 
ATOM   3631 C CB  . LYS B 1 85  ? 140.525 -65.022  21.448  1.00 126.37 ? 1085 LYS B CB  1 
ATOM   3632 C CG  . LYS B 1 85  ? 139.229 -64.421  20.902  1.00 141.05 ? 1085 LYS B CG  1 
ATOM   3633 C CD  . LYS B 1 85  ? 139.392 -63.000  20.364  1.00 148.58 ? 1085 LYS B CD  1 
ATOM   3634 C CE  . LYS B 1 85  ? 138.058 -62.405  19.988  1.00 159.21 ? 1085 LYS B CE  1 
ATOM   3635 N NZ  . LYS B 1 85  ? 138.163 -60.958  19.674  1.00 166.75 ? 1085 LYS B NZ  1 
ATOM   3636 N N   . GLU B 1 86  ? 142.703 -66.087  23.636  1.00 115.37 ? 1086 GLU B N   1 
ATOM   3637 C CA  . GLU B 1 86  ? 143.403 -67.202  24.271  1.00 113.45 ? 1086 GLU B CA  1 
ATOM   3638 C C   . GLU B 1 86  ? 143.520 -66.976  25.782  1.00 114.46 ? 1086 GLU B C   1 
ATOM   3639 O O   . GLU B 1 86  ? 143.319 -67.926  26.544  1.00 113.52 ? 1086 GLU B O   1 
ATOM   3640 C CB  . GLU B 1 86  ? 144.787 -67.419  23.639  1.00 114.77 ? 1086 GLU B CB  1 
ATOM   3641 C CG  . GLU B 1 86  ? 144.734 -67.844  22.181  1.00 131.78 ? 1086 GLU B CG  1 
ATOM   3642 C CD  . GLU B 1 86  ? 144.783 -66.711  21.172  1.00 162.90 ? 1086 GLU B CD  1 
ATOM   3643 O OE1 . GLU B 1 86  ? 145.792 -66.625  20.436  1.00 165.71 ? 1086 GLU B OE1 1 
ATOM   3644 O OE2 . GLU B 1 86  ? 143.820 -65.912  21.109  1.00 160.16 ? 1086 GLU B OE2 1 
ATOM   3645 N N   . ALA B 1 87  ? 143.828 -65.725  26.215  1.00 109.29 ? 1087 ALA B N   1 
ATOM   3646 C CA  . ALA B 1 87  ? 143.934 -65.355  27.634  1.00 105.80 ? 1087 ALA B CA  1 
ATOM   3647 C C   . ALA B 1 87  ? 142.555 -65.361  28.306  1.00 110.26 ? 1087 ALA B C   1 
ATOM   3648 O O   . ALA B 1 87  ? 142.461 -65.717  29.480  1.00 108.07 ? 1087 ALA B O   1 
ATOM   3649 C CB  . ALA B 1 87  ? 144.583 -63.991  27.786  1.00 105.37 ? 1087 ALA B CB  1 
ATOM   3650 N N   . GLN B 1 88  ? 141.488 -64.990  27.554  1.00 109.75 ? 1088 GLN B N   1 
ATOM   3651 C CA  . GLN B 1 88  ? 140.098 -64.995  28.029  1.00 111.01 ? 1088 GLN B CA  1 
ATOM   3652 C C   . GLN B 1 88  ? 139.593 -66.441  28.197  1.00 116.58 ? 1088 GLN B C   1 
ATOM   3653 O O   . GLN B 1 88  ? 138.772 -66.705  29.079  1.00 115.98 ? 1088 GLN B O   1 
ATOM   3654 C CB  . GLN B 1 88  ? 139.188 -64.212  27.072  1.00 116.01 ? 1088 GLN B CB  1 
ATOM   3655 C CG  . GLN B 1 88  ? 139.316 -62.691  27.192  1.00 124.07 ? 1088 GLN B CG  1 
ATOM   3656 C CD  . GLN B 1 88  ? 138.487 -61.927  26.178  1.00 143.68 ? 1088 GLN B CD  1 
ATOM   3657 O OE1 . GLN B 1 88  ? 138.173 -62.408  25.082  1.00 144.27 ? 1088 GLN B OE1 1 
ATOM   3658 N NE2 . GLN B 1 88  ? 138.152 -60.690  26.507  1.00 131.16 ? 1088 GLN B NE2 1 
ATOM   3659 N N   . ALA B 1 89  ? 140.103 -67.368  27.356  1.00 115.39 ? 1089 ALA B N   1 
ATOM   3660 C CA  . ALA B 1 89  ? 139.790 -68.800  27.389  1.00 117.46 ? 1089 ALA B CA  1 
ATOM   3661 C C   . ALA B 1 89  ? 140.434 -69.464  28.610  1.00 118.66 ? 1089 ALA B C   1 
ATOM   3662 O O   . ALA B 1 89  ? 139.828 -70.352  29.213  1.00 118.71 ? 1089 ALA B O   1 
ATOM   3663 C CB  . ALA B 1 89  ? 140.270 -69.472  26.109  1.00 120.82 ? 1089 ALA B CB  1 
ATOM   3664 N N   . ALA B 1 90  ? 141.663 -69.027  28.972  1.00 113.21 ? 1090 ALA B N   1 
ATOM   3665 C CA  . ALA B 1 90  ? 142.420 -69.522  30.125  1.00 111.16 ? 1090 ALA B CA  1 
ATOM   3666 C C   . ALA B 1 90  ? 141.787 -69.047  31.439  1.00 115.39 ? 1090 ALA B C   1 
ATOM   3667 O O   . ALA B 1 90  ? 141.947 -69.706  32.468  1.00 113.82 ? 1090 ALA B O   1 
ATOM   3668 C CB  . ALA B 1 90  ? 143.868 -69.065  30.036  1.00 109.74 ? 1090 ALA B CB  1 
ATOM   3669 N N   . ALA B 1 91  ? 141.058 -67.910  31.390  1.00 113.88 ? 1091 ALA B N   1 
ATOM   3670 C CA  . ALA B 1 91  ? 140.335 -67.326  32.519  1.00 113.84 ? 1091 ALA B CA  1 
ATOM   3671 C C   . ALA B 1 91  ? 139.094 -68.160  32.869  1.00 121.81 ? 1091 ALA B C   1 
ATOM   3672 O O   . ALA B 1 91  ? 138.698 -68.196  34.035  1.00 121.13 ? 1091 ALA B O   1 
ATOM   3673 C CB  . ALA B 1 91  ? 139.931 -65.900  32.197  1.00 115.00 ? 1091 ALA B CB  1 
ATOM   3674 N N   . GLU B 1 92  ? 138.495 -68.840  31.865  1.00 122.47 ? 1092 GLU B N   1 
ATOM   3675 C CA  . GLU B 1 92  ? 137.338 -69.727  32.041  1.00 126.37 ? 1092 GLU B CA  1 
ATOM   3676 C C   . GLU B 1 92  ? 137.726 -70.969  32.865  1.00 130.02 ? 1092 GLU B C   1 
ATOM   3677 O O   . GLU B 1 92  ? 136.866 -71.552  33.529  1.00 132.13 ? 1092 GLU B O   1 
ATOM   3678 C CB  . GLU B 1 92  ? 136.757 -70.159  30.677  1.00 132.24 ? 1092 GLU B CB  1 
ATOM   3679 C CG  . GLU B 1 92  ? 136.018 -69.066  29.916  1.00 146.66 ? 1092 GLU B CG  1 
ATOM   3680 C CD  . GLU B 1 92  ? 135.489 -69.419  28.535  1.00 173.71 ? 1092 GLU B CD  1 
ATOM   3681 O OE1 . GLU B 1 92  ? 135.713 -70.558  28.064  1.00 169.59 ? 1092 GLU B OE1 1 
ATOM   3682 O OE2 . GLU B 1 92  ? 134.848 -68.539  27.916  1.00 172.12 ? 1092 GLU B OE2 1 
ATOM   3683 N N   . GLN B 1 93  ? 139.016 -71.373  32.807  1.00 123.95 ? 1093 GLN B N   1 
ATOM   3684 C CA  . GLN B 1 93  ? 139.565 -72.512  33.539  1.00 123.32 ? 1093 GLN B CA  1 
ATOM   3685 C C   . GLN B 1 93  ? 139.678 -72.195  35.033  1.00 125.29 ? 1093 GLN B C   1 
ATOM   3686 O O   . GLN B 1 93  ? 139.577 -73.114  35.846  1.00 125.87 ? 1093 GLN B O   1 
ATOM   3687 C CB  . GLN B 1 93  ? 140.926 -72.926  32.962  1.00 123.31 ? 1093 GLN B CB  1 
ATOM   3688 C CG  . GLN B 1 93  ? 140.808 -73.882  31.774  1.00 138.75 ? 1093 GLN B CG  1 
ATOM   3689 C CD  . GLN B 1 93  ? 142.067 -73.998  30.934  1.00 152.36 ? 1093 GLN B CD  1 
ATOM   3690 O OE1 . GLN B 1 93  ? 142.014 -73.984  29.698  1.00 146.89 ? 1093 GLN B OE1 1 
ATOM   3691 N NE2 . GLN B 1 93  ? 143.223 -74.148  31.566  1.00 141.61 ? 1093 GLN B NE2 1 
ATOM   3692 N N   . LEU B 1 94  ? 139.871 -70.900  35.393  1.00 119.83 ? 1094 LEU B N   1 
ATOM   3693 C CA  . LEU B 1 94  ? 139.948 -70.421  36.779  1.00 118.35 ? 1094 LEU B CA  1 
ATOM   3694 C C   . LEU B 1 94  ? 138.604 -70.613  37.499  1.00 126.19 ? 1094 LEU B C   1 
ATOM   3695 O O   . LEU B 1 94  ? 138.587 -70.900  38.701  1.00 125.62 ? 1094 LEU B O   1 
ATOM   3696 C CB  . LEU B 1 94  ? 140.365 -68.941  36.830  1.00 115.90 ? 1094 LEU B CB  1 
ATOM   3697 C CG  . LEU B 1 94  ? 141.849 -68.640  36.630  1.00 117.75 ? 1094 LEU B CG  1 
ATOM   3698 C CD1 . LEU B 1 94  ? 142.041 -67.328  35.918  1.00 116.70 ? 1094 LEU B CD1 1 
ATOM   3699 C CD2 . LEU B 1 94  ? 142.589 -68.623  37.953  1.00 118.59 ? 1094 LEU B CD2 1 
ATOM   3700 N N   . LYS B 1 95  ? 137.480 -70.473  36.752  1.00 126.73 ? 1095 LYS B N   1 
ATOM   3701 C CA  . LYS B 1 95  ? 136.100 -70.666  37.226  1.00 130.34 ? 1095 LYS B CA  1 
ATOM   3702 C C   . LYS B 1 95  ? 135.946 -72.086  37.800  1.00 137.12 ? 1095 LYS B C   1 
ATOM   3703 O O   . LYS B 1 95  ? 135.370 -72.248  38.873  1.00 137.97 ? 1095 LYS B O   1 
ATOM   3704 C CB  . LYS B 1 95  ? 135.103 -70.417  36.067  1.00 136.14 ? 1095 LYS B CB  1 
ATOM   3705 C CG  . LYS B 1 95  ? 133.620 -70.423  36.452  1.00 153.06 ? 1095 LYS B CG  1 
ATOM   3706 C CD  . LYS B 1 95  ? 132.684 -70.267  35.246  1.00 165.00 ? 1095 LYS B CD  1 
ATOM   3707 C CE  . LYS B 1 95  ? 132.228 -68.841  35.024  1.00 171.80 ? 1095 LYS B CE  1 
ATOM   3708 N NZ  . LYS B 1 95  ? 131.089 -68.766  34.070  1.00 181.53 ? 1095 LYS B NZ  1 
ATOM   3709 N N   . THR B 1 96  ? 136.531 -73.090  37.108  1.00 135.13 ? 1096 THR B N   1 
ATOM   3710 C CA  . THR B 1 96  ? 136.533 -74.514  37.471  1.00 138.08 ? 1096 THR B CA  1 
ATOM   3711 C C   . THR B 1 96  ? 137.368 -74.736  38.748  1.00 140.92 ? 1096 THR B C   1 
ATOM   3712 O O   . THR B 1 96  ? 137.046 -75.632  39.532  1.00 142.65 ? 1096 THR B O   1 
ATOM   3713 C CB  . THR B 1 96  ? 137.048 -75.378  36.287  1.00 149.04 ? 1096 THR B CB  1 
ATOM   3714 O OG1 . THR B 1 96  ? 136.452 -74.935  35.061  1.00 151.79 ? 1096 THR B OG1 1 
ATOM   3715 C CG2 . THR B 1 96  ? 136.768 -76.871  36.469  1.00 150.69 ? 1096 THR B CG2 1 
ATOM   3716 N N   . THR B 1 97  ? 138.428 -73.924  38.955  1.00 134.79 ? 1097 THR B N   1 
ATOM   3717 C CA  . THR B 1 97  ? 139.295 -74.006  40.141  1.00 133.56 ? 1097 THR B CA  1 
ATOM   3718 C C   . THR B 1 97  ? 138.555 -73.406  41.347  1.00 138.53 ? 1097 THR B C   1 
ATOM   3719 O O   . THR B 1 97  ? 138.617 -73.975  42.441  1.00 139.44 ? 1097 THR B O   1 
ATOM   3720 C CB  . THR B 1 97  ? 140.654 -73.332  39.890  1.00 138.74 ? 1097 THR B CB  1 
ATOM   3721 O OG1 . THR B 1 97  ? 141.141 -73.722  38.606  1.00 138.43 ? 1097 THR B OG1 1 
ATOM   3722 C CG2 . THR B 1 97  ? 141.692 -73.689  40.954  1.00 136.90 ? 1097 THR B CG2 1 
ATOM   3723 N N   . ARG B 1 98  ? 137.835 -72.279  41.125  1.00 135.18 ? 1098 ARG B N   1 
ATOM   3724 C CA  . ARG B 1 98  ? 137.031 -71.566  42.123  1.00 136.44 ? 1098 ARG B CA  1 
ATOM   3725 C C   . ARG B 1 98  ? 135.921 -72.474  42.690  1.00 145.62 ? 1098 ARG B C   1 
ATOM   3726 O O   . ARG B 1 98  ? 135.634 -72.417  43.890  1.00 146.63 ? 1098 ARG B O   1 
ATOM   3727 C CB  . ARG B 1 98  ? 136.422 -70.297  41.499  1.00 136.11 ? 1098 ARG B CB  1 
ATOM   3728 C CG  . ARG B 1 98  ? 135.777 -69.349  42.510  1.00 148.26 ? 1098 ARG B CG  1 
ATOM   3729 C CD  . ARG B 1 98  ? 134.281 -69.210  42.339  1.00 164.20 ? 1098 ARG B CD  1 
ATOM   3730 N NE  . ARG B 1 98  ? 133.942 -68.300  41.245  1.00 176.17 ? 1098 ARG B NE  1 
ATOM   3731 C CZ  . ARG B 1 98  ? 133.567 -68.694  40.033  1.00 194.57 ? 1098 ARG B CZ  1 
ATOM   3732 N NH1 . ARG B 1 98  ? 133.279 -67.799  39.098  1.00 183.38 ? 1098 ARG B NH1 1 
ATOM   3733 N NH2 . ARG B 1 98  ? 133.468 -69.986  39.750  1.00 184.16 ? 1098 ARG B NH2 1 
ATOM   3734 N N   . ASN B 1 99  ? 135.319 -73.316  41.821  1.00 145.31 ? 1099 ASN B N   1 
ATOM   3735 C CA  . ASN B 1 99  ? 134.245 -74.256  42.167  1.00 149.96 ? 1099 ASN B CA  1 
ATOM   3736 C C   . ASN B 1 99  ? 134.801 -75.494  42.888  1.00 155.13 ? 1099 ASN B C   1 
ATOM   3737 O O   . ASN B 1 99  ? 134.121 -76.048  43.753  1.00 158.45 ? 1099 ASN B O   1 
ATOM   3738 C CB  . ASN B 1 99  ? 133.462 -74.669  40.909  1.00 153.32 ? 1099 ASN B CB  1 
ATOM   3739 C CG  . ASN B 1 99  ? 132.815 -73.524  40.155  1.00 175.45 ? 1099 ASN B CG  1 
ATOM   3740 O OD1 . ASN B 1 99  ? 132.530 -72.453  40.702  1.00 167.84 ? 1099 ASN B OD1 1 
ATOM   3741 N ND2 . ASN B 1 99  ? 132.586 -73.719  38.866  1.00 169.68 ? 1099 ASN B ND2 1 
ATOM   3742 N N   . ALA B 1 100 ? 136.035 -75.915  42.538  1.00 148.87 ? 1100 ALA B N   1 
ATOM   3743 C CA  . ALA B 1 100 ? 136.708 -77.064  43.145  1.00 149.88 ? 1100 ALA B CA  1 
ATOM   3744 C C   . ALA B 1 100 ? 137.186 -76.761  44.561  1.00 153.02 ? 1100 ALA B C   1 
ATOM   3745 O O   . ALA B 1 100 ? 137.289 -77.692  45.362  1.00 155.61 ? 1100 ALA B O   1 
ATOM   3746 C CB  . ALA B 1 100 ? 137.885 -77.498  42.289  1.00 148.63 ? 1100 ALA B CB  1 
ATOM   3747 N N   . TYR B 1 101 ? 137.504 -75.479  44.864  1.00 146.11 ? 1101 TYR B N   1 
ATOM   3748 C CA  . TYR B 1 101 ? 137.980 -75.005  46.172  1.00 175.13 ? 1101 TYR B CA  1 
ATOM   3749 C C   . TYR B 1 101 ? 137.099 -75.553  47.313  1.00 218.36 ? 1101 TYR B C   1 
ATOM   3750 O O   . TYR B 1 101 ? 137.530 -76.428  48.062  1.00 183.96 ? 1101 TYR B O   1 
ATOM   3751 C CB  . TYR B 1 101 ? 138.041 -73.455  46.193  1.00 173.14 ? 1101 TYR B CB  1 
ATOM   3752 C CG  . TYR B 1 101 ? 137.368 -72.791  47.378  1.00 176.33 ? 1101 TYR B CG  1 
ATOM   3753 C CD1 . TYR B 1 101 ? 138.042 -72.620  48.584  1.00 178.78 ? 1101 TYR B CD1 1 
ATOM   3754 C CD2 . TYR B 1 101 ? 136.064 -72.310  47.285  1.00 178.66 ? 1101 TYR B CD2 1 
ATOM   3755 C CE1 . TYR B 1 101 ? 137.423 -72.025  49.682  1.00 181.61 ? 1101 TYR B CE1 1 
ATOM   3756 C CE2 . TYR B 1 101 ? 135.436 -71.709  48.376  1.00 181.54 ? 1101 TYR B CE2 1 
ATOM   3757 C CZ  . TYR B 1 101 ? 136.122 -71.563  49.572  1.00 188.90 ? 1101 TYR B CZ  1 
ATOM   3758 O OH  . TYR B 1 101 ? 135.518 -70.962  50.651  1.00 191.43 ? 1101 TYR B OH  1 
ATOM   3759 N N   . LEU B 1 120 ? 123.626 -94.338  53.492  1.00 170.75 ? 44   LEU B N   1 
ATOM   3760 C CA  . LEU B 1 120 ? 122.386 -94.679  54.185  1.00 170.79 ? 44   LEU B CA  1 
ATOM   3761 C C   . LEU B 1 120 ? 121.817 -95.983  53.637  1.00 172.48 ? 44   LEU B C   1 
ATOM   3762 O O   . LEU B 1 120 ? 121.720 -96.140  52.418  1.00 171.42 ? 44   LEU B O   1 
ATOM   3763 C CB  . LEU B 1 120 ? 121.339 -93.546  54.054  1.00 170.37 ? 44   LEU B CB  1 
ATOM   3764 C CG  . LEU B 1 120 ? 121.570 -92.256  54.853  1.00 174.21 ? 44   LEU B CG  1 
ATOM   3765 C CD1 . LEU B 1 120 ? 120.892 -91.068  54.181  1.00 173.58 ? 44   LEU B CD1 1 
ATOM   3766 C CD2 . LEU B 1 120 ? 121.094 -92.395  56.299  1.00 176.81 ? 44   LEU B CD2 1 
ATOM   3767 N N   . ASP B 1 121 ? 121.434 -96.915  54.533  1.00 170.06 ? 45   ASP B N   1 
ATOM   3768 C CA  . ASP B 1 121 ? 120.836 -98.197  54.153  1.00 169.05 ? 45   ASP B CA  1 
ATOM   3769 C C   . ASP B 1 121 ? 119.387 -97.996  53.678  1.00 169.62 ? 45   ASP B C   1 
ATOM   3770 O O   . ASP B 1 121 ? 118.882 -98.802  52.894  1.00 168.86 ? 45   ASP B O   1 
ATOM   3771 C CB  . ASP B 1 121 ? 120.893 -99.196  55.326  1.00 171.42 ? 45   ASP B CB  1 
ATOM   3772 C CG  . ASP B 1 121 ? 121.728 -100.445 55.055  1.00 178.46 ? 45   ASP B CG  1 
ATOM   3773 O OD1 . ASP B 1 121 ? 121.519 -101.085 53.994  1.00 177.73 ? 45   ASP B OD1 1 
ATOM   3774 O OD2 . ASP B 1 121 ? 122.506 -100.857 55.963  1.00 183.97 ? 45   ASP B OD2 1 
ATOM   3775 N N   . ALA B 1 122 ? 118.730 -96.927  54.162  1.00 166.24 ? 46   ALA B N   1 
ATOM   3776 C CA  . ALA B 1 122 ? 117.354 -96.591  53.818  1.00 164.85 ? 46   ALA B CA  1 
ATOM   3777 C C   . ALA B 1 122 ? 117.161 -96.376  52.313  1.00 161.68 ? 46   ALA B C   1 
ATOM   3778 O O   . ALA B 1 122 ? 116.126 -96.787  51.793  1.00 159.05 ? 46   ALA B O   1 
ATOM   3779 C CB  . ALA B 1 122 ? 116.923 -95.348  54.573  1.00 165.81 ? 46   ALA B CB  1 
ATOM   3780 N N   . ILE B 1 123 ? 118.144 -95.755  51.619  1.00 153.92 ? 47   ILE B N   1 
ATOM   3781 C CA  . ILE B 1 123 ? 118.061 -95.458  50.187  1.00 147.41 ? 47   ILE B CA  1 
ATOM   3782 C C   . ILE B 1 123 ? 117.914 -96.761  49.351  1.00 148.99 ? 47   ILE B C   1 
ATOM   3783 O O   . ILE B 1 123 ? 116.898 -96.847  48.664  1.00 146.13 ? 47   ILE B O   1 
ATOM   3784 C CB  . ILE B 1 123 ? 119.216 -94.544  49.707  1.00 148.72 ? 47   ILE B CB  1 
ATOM   3785 C CG1 . ILE B 1 123 ? 118.902 -93.084  50.065  1.00 148.92 ? 47   ILE B CG1 1 
ATOM   3786 C CG2 . ILE B 1 123 ? 119.463 -94.668  48.190  1.00 144.26 ? 47   ILE B CG2 1 
ATOM   3787 C CD1 . ILE B 1 123 ? 120.049 -92.339  50.647  1.00 158.57 ? 47   ILE B CD1 1 
ATOM   3788 N N   . PRO B 1 124 ? 118.789 -97.803  49.423  1.00 146.71 ? 48   PRO B N   1 
ATOM   3789 C CA  . PRO B 1 124 ? 118.558 -99.005  48.594  1.00 144.62 ? 48   PRO B CA  1 
ATOM   3790 C C   . PRO B 1 124 ? 117.202 -99.697  48.824  1.00 148.00 ? 48   PRO B C   1 
ATOM   3791 O O   . PRO B 1 124 ? 116.570 -100.117 47.847  1.00 144.00 ? 48   PRO B O   1 
ATOM   3792 C CB  . PRO B 1 124 ? 119.714 -99.925  48.990  1.00 149.78 ? 48   PRO B CB  1 
ATOM   3793 C CG  . PRO B 1 124 ? 120.793 -99.002  49.403  1.00 155.41 ? 48   PRO B CG  1 
ATOM   3794 C CD  . PRO B 1 124 ? 120.078 -97.912  50.139  1.00 151.81 ? 48   PRO B CD  1 
ATOM   3795 N N   . ILE B 1 125 ? 116.746 -99.789  50.097  1.00 148.52 ? 49   ILE B N   1 
ATOM   3796 C CA  . ILE B 1 125 ? 115.463 -100.404 50.488  1.00 149.81 ? 49   ILE B CA  1 
ATOM   3797 C C   . ILE B 1 125 ? 114.305 -99.667  49.808  1.00 150.02 ? 49   ILE B C   1 
ATOM   3798 O O   . ILE B 1 125 ? 113.398 -100.309 49.281  1.00 148.98 ? 49   ILE B O   1 
ATOM   3799 C CB  . ILE B 1 125 ? 115.295 -100.424 52.042  1.00 158.42 ? 49   ILE B CB  1 
ATOM   3800 C CG1 . ILE B 1 125 ? 116.392 -101.281 52.755  1.00 162.04 ? 49   ILE B CG1 1 
ATOM   3801 C CG2 . ILE B 1 125 ? 113.880 -100.831 52.487  1.00 160.61 ? 49   ILE B CG2 1 
ATOM   3802 C CD1 . ILE B 1 125 ? 116.601 -102.787 52.290  1.00 167.22 ? 49   ILE B CD1 1 
ATOM   3803 N N   . LEU B 1 126 ? 114.369 -98.324  49.800  1.00 144.21 ? 50   LEU B N   1 
ATOM   3804 C CA  . LEU B 1 126 ? 113.373 -97.433  49.215  1.00 140.21 ? 50   LEU B CA  1 
ATOM   3805 C C   . LEU B 1 126 ? 113.325 -97.542  47.697  1.00 137.91 ? 50   LEU B C   1 
ATOM   3806 O O   . LEU B 1 126 ? 112.264 -97.355  47.110  1.00 135.27 ? 50   LEU B O   1 
ATOM   3807 C CB  . LEU B 1 126 ? 113.674 -95.995  49.634  1.00 140.34 ? 50   LEU B CB  1 
ATOM   3808 C CG  . LEU B 1 126 ? 112.798 -95.393  50.740  1.00 148.02 ? 50   LEU B CG  1 
ATOM   3809 C CD1 . LEU B 1 126 ? 112.740 -96.279  51.985  1.00 153.56 ? 50   LEU B CD1 1 
ATOM   3810 C CD2 . LEU B 1 126 ? 113.299 -94.020  51.125  1.00 151.21 ? 50   LEU B CD2 1 
ATOM   3811 N N   . TYR B 1 127 ? 114.459 -97.867  47.071  1.00 132.25 ? 51   TYR B N   1 
ATOM   3812 C CA  . TYR B 1 127 ? 114.565 -98.037  45.626  1.00 127.39 ? 51   TYR B CA  1 
ATOM   3813 C C   . TYR B 1 127 ? 113.876 -99.334  45.202  1.00 131.56 ? 51   TYR B C   1 
ATOM   3814 O O   . TYR B 1 127 ? 113.155 -99.354  44.202  1.00 127.87 ? 51   TYR B O   1 
ATOM   3815 C CB  . TYR B 1 127 ? 116.043 -98.008  45.201  1.00 127.51 ? 51   TYR B CB  1 
ATOM   3816 C CG  . TYR B 1 127 ? 116.566 -96.607  44.954  1.00 126.58 ? 51   TYR B CG  1 
ATOM   3817 C CD1 . TYR B 1 127 ? 116.420 -95.605  45.910  1.00 130.27 ? 51   TYR B CD1 1 
ATOM   3818 C CD2 . TYR B 1 127 ? 117.230 -96.288  43.771  1.00 123.74 ? 51   TYR B CD2 1 
ATOM   3819 C CE1 . TYR B 1 127 ? 116.874 -94.309  45.676  1.00 129.40 ? 51   TYR B CE1 1 
ATOM   3820 C CE2 . TYR B 1 127 ? 117.704 -94.999  43.533  1.00 122.92 ? 51   TYR B CE2 1 
ATOM   3821 C CZ  . TYR B 1 127 ? 117.530 -94.016  44.492  1.00 131.01 ? 51   TYR B CZ  1 
ATOM   3822 O OH  . TYR B 1 127 ? 117.998 -92.748  44.262  1.00 128.77 ? 51   TYR B OH  1 
ATOM   3823 N N   . TYR B 1 128 ? 114.027 -100.387 46.017  1.00 132.44 ? 52   TYR B N   1 
ATOM   3824 C CA  . TYR B 1 128 ? 113.404 -101.675 45.754  1.00 133.18 ? 52   TYR B CA  1 
ATOM   3825 C C   . TYR B 1 128 ? 111.914 -101.670 46.094  1.00 137.79 ? 52   TYR B C   1 
ATOM   3826 O O   . TYR B 1 128 ? 111.134 -102.192 45.301  1.00 135.68 ? 52   TYR B O   1 
ATOM   3827 C CB  . TYR B 1 128 ? 114.121 -102.793 46.520  1.00 138.58 ? 52   TYR B CB  1 
ATOM   3828 N N   . ILE B 1 129 ? 111.506 -101.126 47.256  1.00 137.48 ? 53   ILE B N   1 
ATOM   3829 C CA  . ILE B 1 129 ? 110.087 -101.146 47.646  1.00 138.93 ? 53   ILE B CA  1 
ATOM   3830 C C   . ILE B 1 129 ? 109.204 -100.454 46.591  1.00 139.33 ? 53   ILE B C   1 
ATOM   3831 O O   . ILE B 1 129 ? 108.099 -100.934 46.341  1.00 139.14 ? 53   ILE B O   1 
ATOM   3832 C CB  . ILE B 1 129 ? 109.790 -100.606 49.076  1.00 145.89 ? 53   ILE B CB  1 
ATOM   3833 C CG1 . ILE B 1 129 ? 110.319 -99.177  49.297  1.00 145.05 ? 53   ILE B CG1 1 
ATOM   3834 C CG2 . ILE B 1 129 ? 110.295 -101.569 50.154  1.00 151.63 ? 53   ILE B CG2 1 
ATOM   3835 C CD1 . ILE B 1 129 ? 109.278 -98.162  49.528  1.00 153.09 ? 53   ILE B CD1 1 
ATOM   3836 N N   . ILE B 1 130 ? 109.711 -99.390  45.927  1.00 132.65 ? 54   ILE B N   1 
ATOM   3837 C CA  . ILE B 1 130 ? 108.918 -98.685  44.916  1.00 128.52 ? 54   ILE B CA  1 
ATOM   3838 C C   . ILE B 1 130 ? 109.081 -99.352  43.543  1.00 128.67 ? 54   ILE B C   1 
ATOM   3839 O O   . ILE B 1 130 ? 108.318 -99.043  42.623  1.00 125.59 ? 54   ILE B O   1 
ATOM   3840 C CB  . ILE B 1 130 ? 109.178 -97.148  44.845  1.00 129.60 ? 54   ILE B CB  1 
ATOM   3841 C CG1 . ILE B 1 130 ? 110.475 -96.808  44.110  1.00 127.79 ? 54   ILE B CG1 1 
ATOM   3842 C CG2 . ILE B 1 130 ? 109.108 -96.454  46.206  1.00 133.74 ? 54   ILE B CG2 1 
ATOM   3843 C CD1 . ILE B 1 130 ? 110.216 -96.152  42.815  1.00 132.05 ? 54   ILE B CD1 1 
ATOM   3844 N N   . PHE B 1 131 ? 110.080 -100.231 43.397  1.00 125.19 ? 55   PHE B N   1 
ATOM   3845 C CA  . PHE B 1 131 ? 110.302 -100.934 42.145  1.00 122.53 ? 55   PHE B CA  1 
ATOM   3846 C C   . PHE B 1 131 ? 109.182 -101.944 41.949  1.00 129.02 ? 55   PHE B C   1 
ATOM   3847 O O   . PHE B 1 131 ? 108.459 -101.849 40.962  1.00 126.31 ? 55   PHE B O   1 
ATOM   3848 C CB  . PHE B 1 131 ? 111.698 -101.597 42.118  1.00 124.98 ? 55   PHE B CB  1 
ATOM   3849 C CG  . PHE B 1 131 ? 111.860 -102.837 41.266  1.00 125.95 ? 55   PHE B CG  1 
ATOM   3850 C CD1 . PHE B 1 131 ? 111.921 -102.747 39.880  1.00 125.39 ? 55   PHE B CD1 1 
ATOM   3851 C CD2 . PHE B 1 131 ? 111.982 -104.092 41.852  1.00 131.08 ? 55   PHE B CD2 1 
ATOM   3852 C CE1 . PHE B 1 131 ? 112.083 -103.892 39.094  1.00 126.29 ? 55   PHE B CE1 1 
ATOM   3853 C CE2 . PHE B 1 131 ? 112.143 -105.236 41.065  1.00 133.92 ? 55   PHE B CE2 1 
ATOM   3854 C CZ  . PHE B 1 131 ? 112.196 -105.128 39.694  1.00 128.62 ? 55   PHE B CZ  1 
ATOM   3855 N N   . VAL B 1 132 ? 109.011 -102.869 42.912  1.00 130.56 ? 56   VAL B N   1 
ATOM   3856 C CA  . VAL B 1 132 ? 108.023 -103.951 42.868  1.00 132.53 ? 56   VAL B CA  1 
ATOM   3857 C C   . VAL B 1 132 ? 106.595 -103.408 42.757  1.00 136.03 ? 56   VAL B C   1 
ATOM   3858 O O   . VAL B 1 132 ? 105.802 -103.942 41.978  1.00 135.16 ? 56   VAL B O   1 
ATOM   3859 C CB  . VAL B 1 132 ? 108.167 -104.928 44.058  1.00 141.25 ? 56   VAL B CB  1 
ATOM   3860 C CG1 . VAL B 1 132 ? 109.341 -105.875 43.835  1.00 142.10 ? 56   VAL B CG1 1 
ATOM   3861 C CG2 . VAL B 1 132 ? 108.303 -104.192 45.393  1.00 143.33 ? 56   VAL B CG2 1 
ATOM   3862 N N   . ILE B 1 133 ? 106.294 -102.331 43.498  1.00 132.52 ? 57   ILE B N   1 
ATOM   3863 C CA  . ILE B 1 133 ? 104.990 -101.673 43.514  1.00 131.62 ? 57   ILE B CA  1 
ATOM   3864 C C   . ILE B 1 133 ? 104.682 -101.126 42.117  1.00 131.44 ? 57   ILE B C   1 
ATOM   3865 O O   . ILE B 1 133 ? 103.633 -101.452 41.554  1.00 130.27 ? 57   ILE B O   1 
ATOM   3866 C CB  . ILE B 1 133 ? 104.963 -100.574 44.624  1.00 135.79 ? 57   ILE B CB  1 
ATOM   3867 C CG1 . ILE B 1 133 ? 104.882 -101.184 46.051  1.00 141.21 ? 57   ILE B CG1 1 
ATOM   3868 C CG2 . ILE B 1 133 ? 103.874 -99.507  44.407  1.00 134.91 ? 57   ILE B CG2 1 
ATOM   3869 C CD1 . ILE B 1 133 ? 103.639 -102.109 46.394  1.00 151.33 ? 57   ILE B CD1 1 
ATOM   3870 N N   . GLY B 1 134 ? 105.616 -100.328 41.587  1.00 125.91 ? 58   GLY B N   1 
ATOM   3871 C CA  . GLY B 1 134 ? 105.540 -99.704  40.271  1.00 121.84 ? 58   GLY B CA  1 
ATOM   3872 C C   . GLY B 1 134 ? 105.427 -100.693 39.131  1.00 124.80 ? 58   GLY B C   1 
ATOM   3873 O O   . GLY B 1 134 ? 104.762 -100.412 38.133  1.00 121.94 ? 58   GLY B O   1 
ATOM   3874 N N   . PHE B 1 135 ? 106.085 -101.851 39.271  1.00 123.72 ? 59   PHE B N   1 
ATOM   3875 C CA  . PHE B 1 135 ? 106.049 -102.920 38.283  1.00 123.81 ? 59   PHE B CA  1 
ATOM   3876 C C   . PHE B 1 135 ? 104.710 -103.616 38.338  1.00 129.82 ? 59   PHE B C   1 
ATOM   3877 O O   . PHE B 1 135 ? 104.156 -103.945 37.293  1.00 128.14 ? 59   PHE B O   1 
ATOM   3878 C CB  . PHE B 1 135 ? 107.188 -103.913 38.524  1.00 128.01 ? 59   PHE B CB  1 
ATOM   3879 C CG  . PHE B 1 135 ? 107.950 -104.273 37.271  1.00 128.13 ? 59   PHE B CG  1 
ATOM   3880 C CD1 . PHE B 1 135 ? 108.965 -103.449 36.791  1.00 129.17 ? 59   PHE B CD1 1 
ATOM   3881 C CD2 . PHE B 1 135 ? 107.658 -105.438 36.571  1.00 131.96 ? 59   PHE B CD2 1 
ATOM   3882 C CE1 . PHE B 1 135 ? 109.668 -103.781 35.626  1.00 128.56 ? 59   PHE B CE1 1 
ATOM   3883 C CE2 . PHE B 1 135 ? 108.365 -105.771 35.408  1.00 133.40 ? 59   PHE B CE2 1 
ATOM   3884 C CZ  . PHE B 1 135 ? 109.362 -104.938 34.941  1.00 128.73 ? 59   PHE B CZ  1 
ATOM   3885 N N   . LEU B 1 136 ? 104.177 -103.803 39.561  1.00 129.76 ? 60   LEU B N   1 
ATOM   3886 C CA  . LEU B 1 136 ? 102.884 -104.428 39.790  1.00 132.16 ? 60   LEU B CA  1 
ATOM   3887 C C   . LEU B 1 136 ? 101.750 -103.557 39.244  1.00 133.67 ? 60   LEU B C   1 
ATOM   3888 O O   . LEU B 1 136 ? 100.938 -104.074 38.475  1.00 133.51 ? 60   LEU B O   1 
ATOM   3889 C CB  . LEU B 1 136 ? 102.660 -104.738 41.283  1.00 136.52 ? 60   LEU B CB  1 
ATOM   3890 C CG  . LEU B 1 136 ? 103.225 -106.067 41.820  1.00 145.07 ? 60   LEU B CG  1 
ATOM   3891 C CD1 . LEU B 1 136 ? 103.020 -106.176 43.316  1.00 149.55 ? 60   LEU B CD1 1 
ATOM   3892 C CD2 . LEU B 1 136 ? 102.582 -107.275 41.147  1.00 148.85 ? 60   LEU B CD2 1 
ATOM   3893 N N   . VAL B 1 137 ? 101.683 -102.251 39.604  1.00 127.99 ? 61   VAL B N   1 
ATOM   3894 C CA  . VAL B 1 137 ? 100.606 -101.359 39.123  1.00 125.60 ? 61   VAL B CA  1 
ATOM   3895 C C   . VAL B 1 137 ? 100.656 -101.176 37.574  1.00 125.44 ? 61   VAL B C   1 
ATOM   3896 O O   . VAL B 1 137 ? 99.595  -101.123 36.949  1.00 124.28 ? 61   VAL B O   1 
ATOM   3897 C CB  . VAL B 1 137 ? 100.505 -99.982  39.855  1.00 128.46 ? 61   VAL B CB  1 
ATOM   3898 C CG1 . VAL B 1 137 ? 99.985  -100.147 41.278  1.00 132.09 ? 61   VAL B CG1 1 
ATOM   3899 C CG2 . VAL B 1 137 ? 101.822 -99.206  39.840  1.00 126.06 ? 61   VAL B CG2 1 
ATOM   3900 N N   . ASN B 1 138 ? 101.867 -101.126 36.966  1.00 119.69 ? 62   ASN B N   1 
ATOM   3901 C CA  . ASN B 1 138 ? 102.024 -100.962 35.517  1.00 116.33 ? 62   ASN B CA  1 
ATOM   3902 C C   . ASN B 1 138 ? 101.832 -102.280 34.751  1.00 121.89 ? 62   ASN B C   1 
ATOM   3903 O O   . ASN B 1 138 ? 101.452 -102.222 33.580  1.00 119.99 ? 62   ASN B O   1 
ATOM   3904 C CB  . ASN B 1 138 ? 103.359 -100.326 35.155  1.00 113.26 ? 62   ASN B CB  1 
ATOM   3905 C CG  . ASN B 1 138 ? 103.361 -98.826  35.299  1.00 130.21 ? 62   ASN B CG  1 
ATOM   3906 O OD1 . ASN B 1 138 ? 102.858 -98.089  34.442  1.00 121.53 ? 62   ASN B OD1 1 
ATOM   3907 N ND2 . ASN B 1 138 ? 103.929 -98.338  36.387  1.00 122.25 ? 62   ASN B ND2 1 
ATOM   3908 N N   . ILE B 1 139 ? 102.065 -103.457 35.389  1.00 121.56 ? 63   ILE B N   1 
ATOM   3909 C CA  . ILE B 1 139 ? 101.816 -104.730 34.708  1.00 123.09 ? 63   ILE B CA  1 
ATOM   3910 C C   . ILE B 1 139 ? 100.297 -104.965 34.717  1.00 129.51 ? 63   ILE B C   1 
ATOM   3911 O O   . ILE B 1 139 ? 99.795  -105.651 33.833  1.00 129.07 ? 63   ILE B O   1 
ATOM   3912 C CB  . ILE B 1 139 ? 102.644 -105.948 35.234  1.00 129.16 ? 63   ILE B CB  1 
ATOM   3913 C CG1 . ILE B 1 139 ? 102.743 -107.084 34.181  1.00 130.23 ? 63   ILE B CG1 1 
ATOM   3914 C CG2 . ILE B 1 139 ? 102.160 -106.478 36.585  1.00 133.86 ? 63   ILE B CG2 1 
ATOM   3915 C CD1 . ILE B 1 139 ? 103.894 -106.961 33.167  1.00 132.07 ? 63   ILE B CD1 1 
ATOM   3916 N N   . VAL B 1 140 ? 99.572  -104.333 35.675  1.00 128.66 ? 64   VAL B N   1 
ATOM   3917 C CA  . VAL B 1 140 ? 98.112  -104.381 35.788  1.00 131.10 ? 64   VAL B CA  1 
ATOM   3918 C C   . VAL B 1 140 ? 97.495  -103.579 34.616  1.00 134.33 ? 64   VAL B C   1 
ATOM   3919 O O   . VAL B 1 140 ? 96.542  -104.060 34.005  1.00 135.63 ? 64   VAL B O   1 
ATOM   3920 C CB  . VAL B 1 140 ? 97.633  -103.897 37.189  1.00 136.82 ? 64   VAL B CB  1 
ATOM   3921 C CG1 . VAL B 1 140 ? 96.226  -103.306 37.160  1.00 136.89 ? 64   VAL B CG1 1 
ATOM   3922 C CG2 . VAL B 1 140 ? 97.711  -105.030 38.204  1.00 141.00 ? 64   VAL B CG2 1 
ATOM   3923 N N   . VAL B 1 141 ? 98.090  -102.410 34.269  1.00 128.53 ? 65   VAL B N   1 
ATOM   3924 C CA  . VAL B 1 141 ? 97.661  -101.529 33.169  1.00 126.01 ? 65   VAL B CA  1 
ATOM   3925 C C   . VAL B 1 141 ? 97.800  -102.267 31.820  1.00 131.28 ? 65   VAL B C   1 
ATOM   3926 O O   . VAL B 1 141 ? 96.814  -102.359 31.087  1.00 131.55 ? 65   VAL B O   1 
ATOM   3927 C CB  . VAL B 1 141 ? 98.416  -100.166 33.170  1.00 126.34 ? 65   VAL B CB  1 
ATOM   3928 C CG1 . VAL B 1 141 ? 98.094  -99.344  31.924  1.00 123.26 ? 65   VAL B CG1 1 
ATOM   3929 C CG2 . VAL B 1 141 ? 98.089  -99.363  34.419  1.00 126.88 ? 65   VAL B CG2 1 
ATOM   3930 N N   . VAL B 1 142 ? 99.003  -102.811 31.516  1.00 128.48 ? 66   VAL B N   1 
ATOM   3931 C CA  . VAL B 1 142 ? 99.301  -103.563 30.284  1.00 128.59 ? 66   VAL B CA  1 
ATOM   3932 C C   . VAL B 1 142 ? 98.342  -104.765 30.164  1.00 137.91 ? 66   VAL B C   1 
ATOM   3933 O O   . VAL B 1 142 ? 97.848  -105.042 29.066  1.00 137.66 ? 66   VAL B O   1 
ATOM   3934 C CB  . VAL B 1 142 ? 100.794 -104.014 30.210  1.00 131.57 ? 66   VAL B CB  1 
ATOM   3935 C CG1 . VAL B 1 142 ? 101.080 -104.829 28.949  1.00 131.34 ? 66   VAL B CG1 1 
ATOM   3936 C CG2 . VAL B 1 142 ? 101.740 -102.820 30.287  1.00 128.19 ? 66   VAL B CG2 1 
ATOM   3937 N N   . THR B 1 143 ? 98.046  -105.441 31.292  1.00 138.92 ? 67   THR B N   1 
ATOM   3938 C CA  . THR B 1 143 ? 97.167  -106.601 31.251  1.00 143.22 ? 67   THR B CA  1 
ATOM   3939 C C   . THR B 1 143 ? 95.708  -106.207 31.107  1.00 150.05 ? 67   THR B C   1 
ATOM   3940 O O   . THR B 1 143 ? 95.013  -106.855 30.331  1.00 151.66 ? 67   THR B O   1 
ATOM   3941 C CB  . THR B 1 143 ? 97.360  -107.513 32.459  1.00 154.20 ? 67   THR B CB  1 
ATOM   3942 O OG1 . THR B 1 143 ? 97.350  -106.736 33.660  1.00 153.12 ? 67   THR B OG1 1 
ATOM   3943 C CG2 . THR B 1 143 ? 98.632  -108.349 32.364  1.00 153.57 ? 67   THR B CG2 1 
ATOM   3944 N N   . LEU B 1 144 ? 95.234  -105.167 31.822  1.00 146.87 ? 68   LEU B N   1 
ATOM   3945 C CA  . LEU B 1 144 ? 93.826  -104.811 31.710  1.00 148.20 ? 68   LEU B CA  1 
ATOM   3946 C C   . LEU B 1 144 ? 93.538  -104.244 30.314  1.00 150.28 ? 68   LEU B C   1 
ATOM   3947 O O   . LEU B 1 144 ? 92.508  -104.593 29.740  1.00 151.48 ? 68   LEU B O   1 
ATOM   3948 C CB  . LEU B 1 144 ? 93.330  -103.906 32.851  1.00 148.57 ? 68   LEU B CB  1 
ATOM   3949 C CG  . LEU B 1 144 ? 93.689  -102.427 32.884  1.00 150.01 ? 68   LEU B CG  1 
ATOM   3950 C CD1 . LEU B 1 144 ? 92.544  -101.598 32.310  1.00 149.63 ? 68   LEU B CD1 1 
ATOM   3951 C CD2 . LEU B 1 144 ? 93.896  -101.972 34.316  1.00 153.72 ? 68   LEU B CD2 1 
ATOM   3952 N N   . PHE B 1 145 ? 94.488  -103.476 29.732  1.00 144.09 ? 69   PHE B N   1 
ATOM   3953 C CA  . PHE B 1 145 ? 94.385  -102.938 28.370  1.00 141.92 ? 69   PHE B CA  1 
ATOM   3954 C C   . PHE B 1 145 ? 94.346  -104.080 27.351  1.00 147.71 ? 69   PHE B C   1 
ATOM   3955 O O   . PHE B 1 145 ? 93.711  -103.953 26.303  1.00 147.73 ? 69   PHE B O   1 
ATOM   3956 C CB  . PHE B 1 145 ? 95.554  -101.990 28.057  1.00 139.90 ? 69   PHE B CB  1 
ATOM   3957 N N   . CYS B 1 146 ? 95.004  -105.201 27.684  1.00 145.35 ? 70   CYS B N   1 
ATOM   3958 C CA  . CYS B 1 146 ? 95.047  -106.397 26.857  1.00 166.43 ? 70   CYS B CA  1 
ATOM   3959 C C   . CYS B 1 146 ? 93.718  -107.127 26.931  1.00 185.37 ? 70   CYS B C   1 
ATOM   3960 O O   . CYS B 1 146 ? 93.172  -107.502 25.895  1.00 143.84 ? 70   CYS B O   1 
ATOM   3961 C CB  . CYS B 1 146 ? 96.199  -107.296 27.283  1.00 167.64 ? 70   CYS B CB  1 
ATOM   3962 S SG  . CYS B 1 146 ? 97.562  -107.346 26.089  1.00 168.90 ? 70   CYS B SG  1 
ATOM   3963 N N   . LYS B 1 153 ? 90.843  -97.291  21.430  1.00 113.27 ? 77   LYS B N   1 
ATOM   3964 C CA  . LYS B 1 153 ? 90.808  -95.831  21.454  1.00 110.62 ? 77   LYS B CA  1 
ATOM   3965 C C   . LYS B 1 153 ? 92.213  -95.232  21.387  1.00 111.70 ? 77   LYS B C   1 
ATOM   3966 O O   . LYS B 1 153 ? 93.179  -95.865  21.812  1.00 110.99 ? 77   LYS B O   1 
ATOM   3967 C CB  . LYS B 1 153 ? 90.080  -95.328  22.708  1.00 113.63 ? 77   LYS B CB  1 
ATOM   3968 N N   . VAL B 1 154 ? 92.313  -94.002  20.855  1.00 106.75 ? 78   VAL B N   1 
ATOM   3969 C CA  . VAL B 1 154 ? 93.552  -93.226  20.697  1.00 103.73 ? 78   VAL B CA  1 
ATOM   3970 C C   . VAL B 1 154 ? 94.205  -92.952  22.061  1.00 106.28 ? 78   VAL B C   1 
ATOM   3971 O O   . VAL B 1 154 ? 95.408  -93.169  22.211  1.00 104.49 ? 78   VAL B O   1 
ATOM   3972 C CB  . VAL B 1 154 ? 93.322  -91.909  19.909  1.00 106.41 ? 78   VAL B CB  1 
ATOM   3973 C CG1 . VAL B 1 154 ? 93.316  -92.170  18.409  1.00 106.84 ? 78   VAL B CG1 1 
ATOM   3974 C CG2 . VAL B 1 154 ? 92.033  -91.200  20.336  1.00 107.16 ? 78   VAL B CG2 1 
ATOM   3975 N N   . SER B 1 155 ? 93.386  -92.521  23.053  1.00 103.45 ? 79   SER B N   1 
ATOM   3976 C CA  . SER B 1 155 ? 93.783  -92.233  24.436  1.00 102.47 ? 79   SER B CA  1 
ATOM   3977 C C   . SER B 1 155 ? 94.381  -93.473  25.081  1.00 104.90 ? 79   SER B C   1 
ATOM   3978 O O   . SER B 1 155 ? 95.379  -93.354  25.783  1.00 103.72 ? 79   SER B O   1 
ATOM   3979 C CB  . SER B 1 155 ? 92.586  -91.753  25.258  1.00 108.30 ? 79   SER B CB  1 
ATOM   3980 O OG  . SER B 1 155 ? 91.865  -90.699  24.637  1.00 118.24 ? 79   SER B OG  1 
ATOM   3981 N N   . SER B 1 156 ? 93.792  -94.665  24.799  1.00 101.35 ? 80   SER B N   1 
ATOM   3982 C CA  . SER B 1 156 ? 94.220  -95.970  25.313  1.00 101.24 ? 80   SER B CA  1 
ATOM   3983 C C   . SER B 1 156 ? 95.549  -96.416  24.702  1.00 100.33 ? 80   SER B C   1 
ATOM   3984 O O   . SER B 1 156 ? 96.282  -97.181  25.335  1.00 100.50 ? 80   SER B O   1 
ATOM   3985 C CB  . SER B 1 156 ? 93.148  -97.025  25.058  1.00 107.38 ? 80   SER B CB  1 
ATOM   3986 O OG  . SER B 1 156 ? 91.952  -96.714  25.755  1.00 116.83 ? 80   SER B OG  1 
ATOM   3987 N N   . ILE B 1 157 ? 95.865  -95.932  23.484  1.00 92.47  ? 81   ILE B N   1 
ATOM   3988 C CA  . ILE B 1 157 ? 97.119  -96.263  22.806  1.00 89.58  ? 81   ILE B CA  1 
ATOM   3989 C C   . ILE B 1 157 ? 98.267  -95.497  23.488  1.00 87.73  ? 81   ILE B C   1 
ATOM   3990 O O   . ILE B 1 157 ? 99.365  -96.043  23.588  1.00 87.32  ? 81   ILE B O   1 
ATOM   3991 C CB  . ILE B 1 157 ? 97.036  -96.030  21.264  1.00 91.95  ? 81   ILE B CB  1 
ATOM   3992 C CG1 . ILE B 1 157 ? 95.961  -96.934  20.591  1.00 94.99  ? 81   ILE B CG1 1 
ATOM   3993 C CG2 . ILE B 1 157 ? 98.392  -96.182  20.556  1.00 90.58  ? 81   ILE B CG2 1 
ATOM   3994 C CD1 . ILE B 1 157 ? 95.852  -98.440  21.081  1.00 107.63 ? 81   ILE B CD1 1 
ATOM   3995 N N   . TYR B 1 158 ? 98.004  -94.284  24.015  1.00 80.76  ? 82   TYR B N   1 
ATOM   3996 C CA  . TYR B 1 158 ? 99.028  -93.528  24.735  1.00 78.29  ? 82   TYR B CA  1 
ATOM   3997 C C   . TYR B 1 158 ? 99.249  -94.129  26.134  1.00 84.25  ? 82   TYR B C   1 
ATOM   3998 O O   . TYR B 1 158 ? 100.383 -94.096  26.619  1.00 84.19  ? 82   TYR B O   1 
ATOM   3999 C CB  . TYR B 1 158 ? 98.713  -92.018  24.831  1.00 77.31  ? 82   TYR B CB  1 
ATOM   4000 C CG  . TYR B 1 158 ? 98.569  -91.296  23.508  1.00 76.90  ? 82   TYR B CG  1 
ATOM   4001 C CD1 . TYR B 1 158 ? 99.644  -91.187  22.629  1.00 77.55  ? 82   TYR B CD1 1 
ATOM   4002 C CD2 . TYR B 1 158 ? 97.383  -90.645  23.172  1.00 78.01  ? 82   TYR B CD2 1 
ATOM   4003 C CE1 . TYR B 1 158 ? 99.519  -90.515  21.415  1.00 77.77  ? 82   TYR B CE1 1 
ATOM   4004 C CE2 . TYR B 1 158 ? 97.249  -89.953  21.972  1.00 78.08  ? 82   TYR B CE2 1 
ATOM   4005 C CZ  . TYR B 1 158 ? 98.320  -89.886  21.096  1.00 83.82  ? 82   TYR B CZ  1 
ATOM   4006 O OH  . TYR B 1 158 ? 98.176  -89.202  19.912  1.00 81.50  ? 82   TYR B OH  1 
ATOM   4007 N N   . ILE B 1 159 ? 98.186  -94.709  26.763  1.00 82.61  ? 83   ILE B N   1 
ATOM   4008 C CA  . ILE B 1 159 ? 98.274  -95.363  28.088  1.00 84.18  ? 83   ILE B CA  1 
ATOM   4009 C C   . ILE B 1 159 ? 99.242  -96.547  28.013  1.00 88.16  ? 83   ILE B C   1 
ATOM   4010 O O   . ILE B 1 159 ? 100.110 -96.668  28.876  1.00 87.47  ? 83   ILE B O   1 
ATOM   4011 C CB  . ILE B 1 159 ? 96.920  -95.832  28.710  1.00 89.63  ? 83   ILE B CB  1 
ATOM   4012 C CG1 . ILE B 1 159 ? 95.741  -94.849  28.466  1.00 89.84  ? 83   ILE B CG1 1 
ATOM   4013 C CG2 . ILE B 1 159 ? 97.083  -96.149  30.208  1.00 91.52  ? 83   ILE B CG2 1 
ATOM   4014 C CD1 . ILE B 1 159 ? 95.650  -93.590  29.301  1.00 96.28  ? 83   ILE B CD1 1 
ATOM   4015 N N   . PHE B 1 160 ? 99.097  -97.403  26.977  1.00 85.47  ? 84   PHE B N   1 
ATOM   4016 C CA  . PHE B 1 160 ? 99.960  -98.562  26.758  1.00 86.33  ? 84   PHE B CA  1 
ATOM   4017 C C   . PHE B 1 160 ? 101.427 -98.144  26.665  1.00 88.25  ? 84   PHE B C   1 
ATOM   4018 O O   . PHE B 1 160 ? 102.267 -98.681  27.396  1.00 89.30  ? 84   PHE B O   1 
ATOM   4019 C CB  . PHE B 1 160 ? 99.545  -99.321  25.487  1.00 88.99  ? 84   PHE B CB  1 
ATOM   4020 C CG  . PHE B 1 160 ? 100.434 -100.499 25.165  1.00 91.75  ? 84   PHE B CG  1 
ATOM   4021 C CD1 . PHE B 1 160 ? 100.342 -101.681 25.892  1.00 97.82  ? 84   PHE B CD1 1 
ATOM   4022 C CD2 . PHE B 1 160 ? 101.370 -100.425 24.141  1.00 92.95  ? 84   PHE B CD2 1 
ATOM   4023 C CE1 . PHE B 1 160 ? 101.177 -102.766 25.604  1.00 100.11 ? 84   PHE B CE1 1 
ATOM   4024 C CE2 . PHE B 1 160 ? 102.201 -101.513 23.850  1.00 97.05  ? 84   PHE B CE2 1 
ATOM   4025 C CZ  . PHE B 1 160 ? 102.093 -102.678 24.579  1.00 97.76  ? 84   PHE B CZ  1 
ATOM   4026 N N   . ASN B 1 161 ? 101.730 -97.184  25.776  1.00 81.55  ? 85   ASN B N   1 
ATOM   4027 C CA  . ASN B 1 161 ? 103.088 -96.701  25.571  1.00 79.28  ? 85   ASN B CA  1 
ATOM   4028 C C   . ASN B 1 161 ? 103.681 -96.116  26.843  1.00 82.16  ? 85   ASN B C   1 
ATOM   4029 O O   . ASN B 1 161 ? 104.833 -96.422  27.150  1.00 81.71  ? 85   ASN B O   1 
ATOM   4030 C CB  . ASN B 1 161 ? 103.130 -95.695  24.455  1.00 76.86  ? 85   ASN B CB  1 
ATOM   4031 C CG  . ASN B 1 161 ? 103.155 -96.356  23.113  1.00 98.39  ? 85   ASN B CG  1 
ATOM   4032 O OD1 . ASN B 1 161 ? 102.116 -96.598  22.492  1.00 97.20  ? 85   ASN B OD1 1 
ATOM   4033 N ND2 . ASN B 1 161 ? 104.344 -96.739  22.676  1.00 86.28  ? 85   ASN B ND2 1 
ATOM   4034 N N   . LEU B 1 162 ? 102.897 -95.320  27.599  1.00 77.87  ? 86   LEU B N   1 
ATOM   4035 C CA  . LEU B 1 162 ? 103.345 -94.726  28.857  1.00 77.82  ? 86   LEU B CA  1 
ATOM   4036 C C   . LEU B 1 162 ? 103.630 -95.832  29.895  1.00 84.03  ? 86   LEU B C   1 
ATOM   4037 O O   . LEU B 1 162 ? 104.637 -95.745  30.594  1.00 83.57  ? 86   LEU B O   1 
ATOM   4038 C CB  . LEU B 1 162 ? 102.310 -93.699  29.377  1.00 77.88  ? 86   LEU B CB  1 
ATOM   4039 C CG  . LEU B 1 162 ? 102.458 -93.128  30.807  1.00 84.06  ? 86   LEU B CG  1 
ATOM   4040 C CD1 . LEU B 1 162 ? 103.755 -92.376  30.984  1.00 83.58  ? 86   LEU B CD1 1 
ATOM   4041 C CD2 . LEU B 1 162 ? 101.302 -92.212  31.151  1.00 86.82  ? 86   LEU B CD2 1 
ATOM   4042 N N   . ALA B 1 163 ? 102.773 -96.872  29.966  1.00 82.88  ? 87   ALA B N   1 
ATOM   4043 C CA  . ALA B 1 163 ? 102.928 -98.008  30.879  1.00 85.44  ? 87   ALA B CA  1 
ATOM   4044 C C   . ALA B 1 163 ? 104.168 -98.834  30.527  1.00 89.77  ? 87   ALA B C   1 
ATOM   4045 O O   . ALA B 1 163 ? 104.853 -99.325  31.431  1.00 90.48  ? 87   ALA B O   1 
ATOM   4046 C CB  . ALA B 1 163 ? 101.689 -98.884  30.840  1.00 88.27  ? 87   ALA B CB  1 
ATOM   4047 N N   . VAL B 1 164 ? 104.462 -98.970  29.212  1.00 85.61  ? 88   VAL B N   1 
ATOM   4048 C CA  . VAL B 1 164 ? 105.642 -99.688  28.709  1.00 85.73  ? 88   VAL B CA  1 
ATOM   4049 C C   . VAL B 1 164 ? 106.918 -98.893  29.085  1.00 88.71  ? 88   VAL B C   1 
ATOM   4050 O O   . VAL B 1 164 ? 107.859 -99.483  29.614  1.00 89.80  ? 88   VAL B O   1 
ATOM   4051 C CB  . VAL B 1 164 ? 105.545 -99.976  27.186  1.00 88.49  ? 88   VAL B CB  1 
ATOM   4052 C CG1 . VAL B 1 164 ? 106.907 -100.324 26.583  1.00 87.46  ? 88   VAL B CG1 1 
ATOM   4053 C CG2 . VAL B 1 164 ? 104.534 -101.084 26.904  1.00 90.32  ? 88   VAL B CG2 1 
ATOM   4054 N N   . ALA B 1 165 ? 106.934 -97.566  28.826  1.00 82.99  ? 89   ALA B N   1 
ATOM   4055 C CA  . ALA B 1 165 ? 108.040 -96.660  29.146  1.00 81.70  ? 89   ALA B CA  1 
ATOM   4056 C C   . ALA B 1 165 ? 108.298 -96.597  30.663  1.00 87.90  ? 89   ALA B C   1 
ATOM   4057 O O   . ALA B 1 165 ? 109.454 -96.486  31.078  1.00 87.25  ? 89   ALA B O   1 
ATOM   4058 C CB  . ALA B 1 165 ? 107.742 -95.270  28.608  1.00 80.26  ? 89   ALA B CB  1 
ATOM   4059 N N   . ASP B 1 166 ? 107.225 -96.680  31.483  1.00 87.16  ? 90   ASP B N   1 
ATOM   4060 C CA  . ASP B 1 166 ? 107.313 -96.691  32.943  1.00 89.51  ? 90   ASP B CA  1 
ATOM   4061 C C   . ASP B 1 166 ? 107.911 -98.008  33.418  1.00 96.07  ? 90   ASP B C   1 
ATOM   4062 O O   . ASP B 1 166 ? 108.791 -97.991  34.271  1.00 96.55  ? 90   ASP B O   1 
ATOM   4063 C CB  . ASP B 1 166 ? 105.933 -96.457  33.594  1.00 92.67  ? 90   ASP B CB  1 
ATOM   4064 C CG  . ASP B 1 166 ? 105.460 -95.005  33.613  1.00 106.28 ? 90   ASP B CG  1 
ATOM   4065 O OD1 . ASP B 1 166 ? 106.296 -94.107  33.875  1.00 106.84 ? 90   ASP B OD1 1 
ATOM   4066 O OD2 . ASP B 1 166 ? 104.241 -94.771  33.423  1.00 113.54 ? 90   ASP B OD2 1 
ATOM   4067 N N   . LEU B 1 167 ? 107.475 -99.135  32.829  1.00 94.29  ? 91   LEU B N   1 
ATOM   4068 C CA  . LEU B 1 167 ? 107.942 -100.476 33.171  1.00 97.26  ? 91   LEU B CA  1 
ATOM   4069 C C   . LEU B 1 167 ? 109.454 -100.625 32.934  1.00 101.02 ? 91   LEU B C   1 
ATOM   4070 O O   . LEU B 1 167 ? 110.154 -101.167 33.799  1.00 103.69 ? 91   LEU B O   1 
ATOM   4071 C CB  . LEU B 1 167 ? 107.150 -101.516 32.349  1.00 98.37  ? 91   LEU B CB  1 
ATOM   4072 C CG  . LEU B 1 167 ? 106.620 -102.796 33.033  1.00 107.21 ? 91   LEU B CG  1 
ATOM   4073 C CD1 . LEU B 1 167 ? 106.187 -102.558 34.478  1.00 109.40 ? 91   LEU B CD1 1 
ATOM   4074 C CD2 . LEU B 1 167 ? 105.460 -103.379 32.243  1.00 111.03 ? 91   LEU B CD2 1 
ATOM   4075 N N   . LEU B 1 168 ? 109.962 -100.102 31.798  1.00 93.84  ? 92   LEU B N   1 
ATOM   4076 C CA  . LEU B 1 168 ? 111.386 -100.198 31.454  1.00 92.63  ? 92   LEU B CA  1 
ATOM   4077 C C   . LEU B 1 168 ? 112.261 -99.324  32.353  1.00 97.35  ? 92   LEU B C   1 
ATOM   4078 O O   . LEU B 1 168 ? 113.417 -99.669  32.608  1.00 97.79  ? 92   LEU B O   1 
ATOM   4079 C CB  . LEU B 1 168 ? 111.633 -99.838  29.981  1.00 89.73  ? 92   LEU B CB  1 
ATOM   4080 C CG  . LEU B 1 168 ? 110.954 -100.710 28.911  1.00 93.78  ? 92   LEU B CG  1 
ATOM   4081 C CD1 . LEU B 1 168 ? 111.313 -100.241 27.527  1.00 91.46  ? 92   LEU B CD1 1 
ATOM   4082 C CD2 . LEU B 1 168 ? 111.325 -102.174 29.047  1.00 98.32  ? 92   LEU B CD2 1 
ATOM   4083 N N   . LEU B 1 169 ? 111.706 -98.200  32.821  1.00 94.19  ? 93   LEU B N   1 
ATOM   4084 C CA  . LEU B 1 169 ? 112.391 -97.246  33.683  1.00 94.92  ? 93   LEU B CA  1 
ATOM   4085 C C   . LEU B 1 169 ? 112.530 -97.813  35.103  1.00 103.14 ? 93   LEU B C   1 
ATOM   4086 O O   . LEU B 1 169 ? 113.596 -97.692  35.715  1.00 104.72 ? 93   LEU B O   1 
ATOM   4087 C CB  . LEU B 1 169 ? 111.606 -95.921  33.675  1.00 93.50  ? 93   LEU B CB  1 
ATOM   4088 C CG  . LEU B 1 169 ? 112.165 -94.744  34.473  1.00 98.98  ? 93   LEU B CG  1 
ATOM   4089 C CD1 . LEU B 1 169 ? 113.440 -94.197  33.855  1.00 98.13  ? 93   LEU B CD1 1 
ATOM   4090 C CD2 . LEU B 1 169 ? 111.138 -93.637  34.578  1.00 101.69 ? 93   LEU B CD2 1 
ATOM   4091 N N   . LEU B 1 170 ? 111.466 -98.470  35.600  1.00 101.14 ? 94   LEU B N   1 
ATOM   4092 C CA  . LEU B 1 170 ? 111.442 -99.080  36.928  1.00 104.09 ? 94   LEU B CA  1 
ATOM   4093 C C   . LEU B 1 170 ? 112.371 -100.280 36.989  1.00 110.69 ? 94   LEU B C   1 
ATOM   4094 O O   . LEU B 1 170 ? 113.035 -100.480 38.007  1.00 112.98 ? 94   LEU B O   1 
ATOM   4095 C CB  . LEU B 1 170 ? 110.017 -99.480  37.319  1.00 105.19 ? 94   LEU B CB  1 
ATOM   4096 C CG  . LEU B 1 170 ? 109.058 -98.309  37.520  1.00 108.42 ? 94   LEU B CG  1 
ATOM   4097 C CD1 . LEU B 1 170 ? 107.631 -98.747  37.413  1.00 109.08 ? 94   LEU B CD1 1 
ATOM   4098 C CD2 . LEU B 1 170 ? 109.315 -97.576  38.819  1.00 112.33 ? 94   LEU B CD2 1 
ATOM   4099 N N   . ALA B 1 171 ? 112.475 -101.028 35.873  1.00 106.40 ? 95   ALA B N   1 
ATOM   4100 C CA  . ALA B 1 171 ? 113.344 -102.193 35.734  1.00 108.19 ? 95   ALA B CA  1 
ATOM   4101 C C   . ALA B 1 171 ? 114.838 -101.860 35.975  1.00 112.49 ? 95   ALA B C   1 
ATOM   4102 O O   . ALA B 1 171 ? 115.603 -102.765 36.304  1.00 113.94 ? 95   ALA B O   1 
ATOM   4103 C CB  . ALA B 1 171 ? 113.164 -102.803 34.353  1.00 107.40 ? 95   ALA B CB  1 
ATOM   4104 N N   . THR B 1 172 ? 115.255 -100.587 35.829  1.00 107.40 ? 96   THR B N   1 
ATOM   4105 C CA  . THR B 1 172 ? 116.656 -100.193 36.043  1.00 107.49 ? 96   THR B CA  1 
ATOM   4106 C C   . THR B 1 172 ? 116.944 -99.843  37.535  1.00 113.60 ? 96   THR B C   1 
ATOM   4107 O O   . THR B 1 172 ? 118.113 -99.627  37.876  1.00 113.78 ? 96   THR B O   1 
ATOM   4108 C CB  . THR B 1 172 ? 117.055 -99.033  35.103  1.00 110.32 ? 96   THR B CB  1 
ATOM   4109 O OG1 . THR B 1 172 ? 116.309 -97.859  35.430  1.00 107.17 ? 96   THR B OG1 1 
ATOM   4110 C CG2 . THR B 1 172 ? 116.881 -99.381  33.626  1.00 106.60 ? 96   THR B CG2 1 
ATOM   4111 N N   . LEU B 1 173 ? 115.901 -99.818  38.421  1.00 111.17 ? 97   LEU B N   1 
ATOM   4112 C CA  . LEU B 1 173 ? 116.062 -99.486  39.849  1.00 113.52 ? 97   LEU B CA  1 
ATOM   4113 C C   . LEU B 1 173 ? 117.014 -100.435 40.588  1.00 121.73 ? 97   LEU B C   1 
ATOM   4114 O O   . LEU B 1 173 ? 117.829 -99.910  41.349  1.00 122.94 ? 97   LEU B O   1 
ATOM   4115 C CB  . LEU B 1 173 ? 114.733 -99.393  40.606  1.00 114.32 ? 97   LEU B CB  1 
ATOM   4116 C CG  . LEU B 1 173 ? 114.047 -98.050  40.487  1.00 116.36 ? 97   LEU B CG  1 
ATOM   4117 C CD1 . LEU B 1 173 ? 112.554 -98.202  40.539  1.00 116.46 ? 97   LEU B CD1 1 
ATOM   4118 C CD2 . LEU B 1 173 ? 114.532 -97.082  41.551  1.00 119.69 ? 97   LEU B CD2 1 
ATOM   4119 N N   . PRO B 1 174 ? 116.993 -101.789 40.385  1.00 120.50 ? 98   PRO B N   1 
ATOM   4120 C CA  . PRO B 1 174 ? 117.956 -102.648 41.104  1.00 124.30 ? 98   PRO B CA  1 
ATOM   4121 C C   . PRO B 1 174 ? 119.423 -102.289 40.820  1.00 128.15 ? 98   PRO B C   1 
ATOM   4122 O O   . PRO B 1 174 ? 120.259 -102.414 41.711  1.00 130.57 ? 98   PRO B O   1 
ATOM   4123 C CB  . PRO B 1 174 ? 117.627 -104.054 40.586  1.00 126.89 ? 98   PRO B CB  1 
ATOM   4124 C CG  . PRO B 1 174 ? 116.209 -103.980 40.156  1.00 129.31 ? 98   PRO B CG  1 
ATOM   4125 C CD  . PRO B 1 174 ? 116.087 -102.614 39.552  1.00 121.02 ? 98   PRO B CD  1 
ATOM   4126 N N   . LEU B 1 175 ? 119.717 -101.819 39.595  1.00 121.80 ? 99   LEU B N   1 
ATOM   4127 C CA  . LEU B 1 175 ? 121.055 -101.420 39.163  1.00 121.32 ? 99   LEU B CA  1 
ATOM   4128 C C   . LEU B 1 175 ? 121.563 -100.221 39.970  1.00 127.59 ? 99   LEU B C   1 
ATOM   4129 O O   . LEU B 1 175 ? 122.692 -100.274 40.461  1.00 129.49 ? 99   LEU B O   1 
ATOM   4130 C CB  . LEU B 1 175 ? 121.073 -101.104 37.653  1.00 117.25 ? 99   LEU B CB  1 
ATOM   4131 C CG  . LEU B 1 175 ? 121.238 -102.292 36.704  1.00 121.21 ? 99   LEU B CG  1 
ATOM   4132 C CD1 . LEU B 1 175 ? 119.920 -103.043 36.492  1.00 120.91 ? 99   LEU B CD1 1 
ATOM   4133 C CD2 . LEU B 1 175 ? 121.756 -101.832 35.365  1.00 120.83 ? 99   LEU B CD2 1 
ATOM   4134 N N   . TRP B 1 176 ? 120.733 -99.166  40.138  1.00 123.77 ? 100  TRP B N   1 
ATOM   4135 C CA  . TRP B 1 176 ? 121.121 -97.967  40.899  1.00 125.07 ? 100  TRP B CA  1 
ATOM   4136 C C   . TRP B 1 176 ? 121.142 -98.221  42.409  1.00 133.66 ? 100  TRP B C   1 
ATOM   4137 O O   . TRP B 1 176 ? 121.886 -97.539  43.121  1.00 135.21 ? 100  TRP B O   1 
ATOM   4138 C CB  . TRP B 1 176 ? 120.216 -96.766  40.573  1.00 121.34 ? 100  TRP B CB  1 
ATOM   4139 C CG  . TRP B 1 176 ? 119.822 -96.651  39.127  1.00 118.49 ? 100  TRP B CG  1 
ATOM   4140 C CD1 . TRP B 1 176 ? 118.557 -96.532  38.637  1.00 119.37 ? 100  TRP B CD1 1 
ATOM   4141 C CD2 . TRP B 1 176 ? 120.695 -96.691  37.983  1.00 116.48 ? 100  TRP B CD2 1 
ATOM   4142 N NE1 . TRP B 1 176 ? 118.583 -96.484  37.259  1.00 115.79 ? 100  TRP B NE1 1 
ATOM   4143 C CE2 . TRP B 1 176 ? 119.884 -96.575  36.832  1.00 117.43 ? 100  TRP B CE2 1 
ATOM   4144 C CE3 . TRP B 1 176 ? 122.086 -96.813  37.818  1.00 118.63 ? 100  TRP B CE3 1 
ATOM   4145 C CZ2 . TRP B 1 176 ? 120.420 -96.570  35.534  1.00 114.65 ? 100  TRP B CZ2 1 
ATOM   4146 C CZ3 . TRP B 1 176 ? 122.614 -96.815  36.538  1.00 117.84 ? 100  TRP B CZ3 1 
ATOM   4147 C CH2 . TRP B 1 176 ? 121.787 -96.696  35.413  1.00 115.55 ? 100  TRP B CH2 1 
ATOM   4148 N N   . ALA B 1 177 ? 120.374 -99.228  42.887  1.00 132.46 ? 101  ALA B N   1 
ATOM   4149 C CA  . ALA B 1 177 ? 120.341 -99.629  44.299  1.00 136.98 ? 101  ALA B CA  1 
ATOM   4150 C C   . ALA B 1 177 ? 121.659 -100.325 44.684  1.00 144.58 ? 101  ALA B C   1 
ATOM   4151 O O   . ALA B 1 177 ? 122.207 -100.056 45.756  1.00 147.81 ? 101  ALA B O   1 
ATOM   4152 C CB  . ALA B 1 177 ? 119.159 -100.552 44.561  1.00 138.73 ? 101  ALA B CB  1 
ATOM   4153 N N   . THR B 1 178 ? 122.172 -101.198 43.783  1.00 139.94 ? 102  THR B N   1 
ATOM   4154 C CA  . THR B 1 178 ? 123.430 -101.934 43.934  1.00 142.20 ? 102  THR B CA  1 
ATOM   4155 C C   . THR B 1 178 ? 124.608 -100.948 43.785  1.00 146.24 ? 102  THR B C   1 
ATOM   4156 O O   . THR B 1 178 ? 125.566 -101.028 44.554  1.00 149.18 ? 102  THR B O   1 
ATOM   4157 C CB  . THR B 1 178 ? 123.491 -103.101 42.926  1.00 145.69 ? 102  THR B CB  1 
ATOM   4158 O OG1 . THR B 1 178 ? 122.254 -103.820 42.950  1.00 143.78 ? 102  THR B OG1 1 
ATOM   4159 C CG2 . THR B 1 178 ? 124.638 -104.062 43.208  1.00 146.40 ? 102  THR B CG2 1 
ATOM   4160 N N   . TYR B 1 179 ? 124.508 -99.998  42.824  1.00 139.57 ? 103  TYR B N   1 
ATOM   4161 C CA  . TYR B 1 179 ? 125.501 -98.947  42.556  1.00 139.05 ? 103  TYR B CA  1 
ATOM   4162 C C   . TYR B 1 179 ? 125.710 -98.068  43.798  1.00 144.92 ? 103  TYR B C   1 
ATOM   4163 O O   . TYR B 1 179 ? 126.840 -97.662  44.072  1.00 146.01 ? 103  TYR B O   1 
ATOM   4164 C CB  . TYR B 1 179 ? 125.059 -98.091  41.350  1.00 136.46 ? 103  TYR B CB  1 
ATOM   4165 C CG  . TYR B 1 179 ? 126.028 -97.001  40.932  1.00 138.97 ? 103  TYR B CG  1 
ATOM   4166 C CD1 . TYR B 1 179 ? 127.102 -97.279  40.089  1.00 140.75 ? 103  TYR B CD1 1 
ATOM   4167 C CD2 . TYR B 1 179 ? 125.823 -95.677  41.309  1.00 139.97 ? 103  TYR B CD2 1 
ATOM   4168 C CE1 . TYR B 1 179 ? 127.980 -96.274  39.678  1.00 141.36 ? 103  TYR B CE1 1 
ATOM   4169 C CE2 . TYR B 1 179 ? 126.692 -94.665  40.903  1.00 140.53 ? 103  TYR B CE2 1 
ATOM   4170 C CZ  . TYR B 1 179 ? 127.768 -94.966  40.085  1.00 147.62 ? 103  TYR B CZ  1 
ATOM   4171 O OH  . TYR B 1 179 ? 128.615 -93.961  39.683  1.00 148.25 ? 103  TYR B OH  1 
ATOM   4172 N N   . TYR B 1 180 ? 124.624 -97.790  44.547  1.00 141.99 ? 104  TYR B N   1 
ATOM   4173 C CA  . TYR B 1 180 ? 124.672 -96.990  45.768  1.00 144.85 ? 104  TYR B CA  1 
ATOM   4174 C C   . TYR B 1 180 ? 125.130 -97.842  46.967  1.00 155.00 ? 104  TYR B C   1 
ATOM   4175 O O   . TYR B 1 180 ? 125.742 -97.293  47.887  1.00 158.11 ? 104  TYR B O   1 
ATOM   4176 C CB  . TYR B 1 180 ? 123.311 -96.331  46.051  1.00 144.24 ? 104  TYR B CB  1 
ATOM   4177 C CG  . TYR B 1 180 ? 123.352 -95.305  47.164  1.00 148.15 ? 104  TYR B CG  1 
ATOM   4178 C CD1 . TYR B 1 180 ? 123.781 -94.002  46.924  1.00 148.72 ? 104  TYR B CD1 1 
ATOM   4179 C CD2 . TYR B 1 180 ? 122.959 -95.635  48.459  1.00 152.91 ? 104  TYR B CD2 1 
ATOM   4180 C CE1 . TYR B 1 180 ? 123.823 -93.053  47.946  1.00 152.14 ? 104  TYR B CE1 1 
ATOM   4181 C CE2 . TYR B 1 180 ? 122.994 -94.695  49.488  1.00 156.58 ? 104  TYR B CE2 1 
ATOM   4182 C CZ  . TYR B 1 180 ? 123.427 -93.405  49.227  1.00 162.05 ? 104  TYR B CZ  1 
ATOM   4183 O OH  . TYR B 1 180 ? 123.460 -92.476  50.239  1.00 165.10 ? 104  TYR B OH  1 
ATOM   4184 N N   . SER B 1 181 ? 124.849 -99.171  46.953  1.00 152.99 ? 105  SER B N   1 
ATOM   4185 C CA  . SER B 1 181 ? 125.238 -100.114 48.017  1.00 157.97 ? 105  SER B CA  1 
ATOM   4186 C C   . SER B 1 181 ? 126.765 -100.277 48.103  1.00 164.21 ? 105  SER B C   1 
ATOM   4187 O O   . SER B 1 181 ? 127.290 -100.584 49.177  1.00 168.03 ? 105  SER B O   1 
ATOM   4188 C CB  . SER B 1 181 ? 124.582 -101.475 47.801  1.00 161.83 ? 105  SER B CB  1 
ATOM   4189 O OG  . SER B 1 181 ? 123.188 -101.430 48.060  1.00 170.67 ? 105  SER B OG  1 
ATOM   4190 N N   . TYR B 1 182 ? 127.464 -100.055 46.970  1.00 157.80 ? 106  TYR B N   1 
ATOM   4191 C CA  . TYR B 1 182 ? 128.913 -100.120 46.852  1.00 159.43 ? 106  TYR B CA  1 
ATOM   4192 C C   . TYR B 1 182 ? 129.490 -98.693  46.908  1.00 163.29 ? 106  TYR B C   1 
ATOM   4193 O O   . TYR B 1 182 ? 130.643 -98.481  46.542  1.00 163.43 ? 106  TYR B O   1 
ATOM   4194 C CB  . TYR B 1 182 ? 129.311 -100.868 45.562  1.00 157.94 ? 106  TYR B CB  1 
ATOM   4195 C CG  . TYR B 1 182 ? 129.081 -102.359 45.652  1.00 161.94 ? 106  TYR B CG  1 
ATOM   4196 C CD1 . TYR B 1 182 ? 129.921 -103.169 46.410  1.00 168.99 ? 106  TYR B CD1 1 
ATOM   4197 C CD2 . TYR B 1 182 ? 128.027 -102.963 44.976  1.00 159.93 ? 106  TYR B CD2 1 
ATOM   4198 C CE1 . TYR B 1 182 ? 129.707 -104.543 46.507  1.00 171.37 ? 106  TYR B CE1 1 
ATOM   4199 C CE2 . TYR B 1 182 ? 127.799 -104.336 45.068  1.00 162.81 ? 106  TYR B CE2 1 
ATOM   4200 C CZ  . TYR B 1 182 ? 128.643 -105.124 45.834  1.00 174.91 ? 106  TYR B CZ  1 
ATOM   4201 O OH  . TYR B 1 182 ? 128.434 -106.481 45.914  1.00 176.15 ? 106  TYR B OH  1 
ATOM   4202 N N   . ARG B 1 183 ? 128.680 -97.725  47.410  1.00 159.82 ? 107  ARG B N   1 
ATOM   4203 C CA  . ARG B 1 183 ? 128.984 -96.297  47.597  1.00 159.91 ? 107  ARG B CA  1 
ATOM   4204 C C   . ARG B 1 183 ? 129.583 -95.652  46.318  1.00 161.19 ? 107  ARG B C   1 
ATOM   4205 O O   . ARG B 1 183 ? 130.709 -95.130  46.341  1.00 162.10 ? 107  ARG B O   1 
ATOM   4206 C CB  . ARG B 1 183 ? 129.901 -96.087  48.818  1.00 165.50 ? 107  ARG B CB  1 
ATOM   4207 N N   . TYR B 1 184 ? 128.775 -95.623  45.222  1.00 154.18 ? 108  TYR B N   1 
ATOM   4208 C CA  . TYR B 1 184 ? 129.097 -95.078  43.887  1.00 150.36 ? 108  TYR B CA  1 
ATOM   4209 C C   . TYR B 1 184 ? 130.282 -95.846  43.266  1.00 154.87 ? 108  TYR B C   1 
ATOM   4210 O O   . TYR B 1 184 ? 131.393 -95.316  43.177  1.00 155.51 ? 108  TYR B O   1 
ATOM   4211 C CB  . TYR B 1 184 ? 129.376 -93.554  43.927  1.00 151.57 ? 108  TYR B CB  1 
ATOM   4212 C CG  . TYR B 1 184 ? 128.152 -92.668  44.038  1.00 151.73 ? 108  TYR B CG  1 
ATOM   4213 C CD1 . TYR B 1 184 ? 127.600 -92.360  45.279  1.00 156.50 ? 108  TYR B CD1 1 
ATOM   4214 C CD2 . TYR B 1 184 ? 127.616 -92.045  42.915  1.00 148.49 ? 108  TYR B CD2 1 
ATOM   4215 C CE1 . TYR B 1 184 ? 126.500 -91.508  45.391  1.00 155.82 ? 108  TYR B CE1 1 
ATOM   4216 C CE2 . TYR B 1 184 ? 126.509 -91.201  43.013  1.00 147.84 ? 108  TYR B CE2 1 
ATOM   4217 C CZ  . TYR B 1 184 ? 125.958 -90.930  44.254  1.00 158.56 ? 108  TYR B CZ  1 
ATOM   4218 O OH  . TYR B 1 184 ? 124.877 -90.087  44.352  1.00 159.36 ? 108  TYR B OH  1 
ATOM   4219 N N   . ASP B 1 185 ? 130.033 -97.107  42.855  1.00 151.08 ? 109  ASP B N   1 
ATOM   4220 C CA  . ASP B 1 185 ? 131.027 -98.001  42.256  1.00 151.58 ? 109  ASP B CA  1 
ATOM   4221 C C   . ASP B 1 185 ? 130.467 -98.733  41.051  1.00 152.02 ? 109  ASP B C   1 
ATOM   4222 O O   . ASP B 1 185 ? 129.426 -99.384  41.167  1.00 150.85 ? 109  ASP B O   1 
ATOM   4223 C CB  . ASP B 1 185 ? 131.504 -99.031  43.283  1.00 158.11 ? 109  ASP B CB  1 
ATOM   4224 C CG  . ASP B 1 185 ? 132.852 -98.726  43.875  1.00 173.85 ? 109  ASP B CG  1 
ATOM   4225 O OD1 . ASP B 1 185 ? 132.911 -97.919  44.818  1.00 177.53 ? 109  ASP B OD1 1 
ATOM   4226 O OD2 . ASP B 1 185 ? 133.852 -99.302  43.397  1.00 180.26 ? 109  ASP B OD2 1 
ATOM   4227 N N   . TRP B 1 186 ? 131.163 -98.656  39.902  1.00 146.78 ? 110  TRP B N   1 
ATOM   4228 C CA  . TRP B 1 186 ? 130.715 -99.361  38.698  1.00 143.45 ? 110  TRP B CA  1 
ATOM   4229 C C   . TRP B 1 186 ? 131.544 -100.631 38.471  1.00 148.76 ? 110  TRP B C   1 
ATOM   4230 O O   . TRP B 1 186 ? 132.748 -100.553 38.221  1.00 149.62 ? 110  TRP B O   1 
ATOM   4231 C CB  . TRP B 1 186 ? 130.760 -98.451  37.465  1.00 138.54 ? 110  TRP B CB  1 
ATOM   4232 N N   . LEU B 1 187 ? 130.891 -101.801 38.598  1.00 145.24 ? 111  LEU B N   1 
ATOM   4233 C CA  . LEU B 1 187 ? 131.495 -103.132 38.436  1.00 146.74 ? 111  LEU B CA  1 
ATOM   4234 C C   . LEU B 1 187 ? 130.833 -103.932 37.299  1.00 146.27 ? 111  LEU B C   1 
ATOM   4235 O O   . LEU B 1 187 ? 131.045 -105.145 37.206  1.00 147.52 ? 111  LEU B O   1 
ATOM   4236 C CB  . LEU B 1 187 ? 131.374 -103.925 39.759  1.00 151.07 ? 111  LEU B CB  1 
ATOM   4237 C CG  . LEU B 1 187 ? 132.301 -103.531 40.904  1.00 160.04 ? 111  LEU B CG  1 
ATOM   4238 C CD1 . LEU B 1 187 ? 131.738 -103.988 42.245  1.00 163.77 ? 111  LEU B CD1 1 
ATOM   4239 C CD2 . LEU B 1 187 ? 133.708 -104.056 40.679  1.00 165.15 ? 111  LEU B CD2 1 
ATOM   4240 N N   . PHE B 1 188 ? 130.035 -103.250 36.442  1.00 137.65 ? 112  PHE B N   1 
ATOM   4241 C CA  . PHE B 1 188 ? 129.279 -103.854 35.337  1.00 134.25 ? 112  PHE B CA  1 
ATOM   4242 C C   . PHE B 1 188 ? 129.965 -103.702 33.968  1.00 134.42 ? 112  PHE B C   1 
ATOM   4243 O O   . PHE B 1 188 ? 129.654 -104.460 33.047  1.00 133.01 ? 112  PHE B O   1 
ATOM   4244 C CB  . PHE B 1 188 ? 127.870 -103.250 35.270  1.00 133.29 ? 112  PHE B CB  1 
ATOM   4245 N N   . GLY B 1 189 ? 130.876 -102.738 33.846  1.00 129.18 ? 113  GLY B N   1 
ATOM   4246 C CA  . GLY B 1 189 ? 131.593 -102.491 32.602  1.00 126.77 ? 113  GLY B CA  1 
ATOM   4247 C C   . GLY B 1 189 ? 131.314 -101.125 32.005  1.00 126.55 ? 113  GLY B C   1 
ATOM   4248 O O   . GLY B 1 189 ? 130.204 -100.605 32.152  1.00 124.45 ? 113  GLY B O   1 
ATOM   4249 N N   . PRO B 1 190 ? 132.301 -100.526 31.294  1.00 122.08 ? 114  PRO B N   1 
ATOM   4250 C CA  . PRO B 1 190 ? 132.086 -99.188  30.712  1.00 119.27 ? 114  PRO B CA  1 
ATOM   4251 C C   . PRO B 1 190 ? 131.060 -99.141  29.579  1.00 119.75 ? 114  PRO B C   1 
ATOM   4252 O O   . PRO B 1 190 ? 130.552 -98.056  29.280  1.00 117.19 ? 114  PRO B O   1 
ATOM   4253 C CB  . PRO B 1 190 ? 133.474 -98.799  30.200  1.00 122.07 ? 114  PRO B CB  1 
ATOM   4254 C CG  . PRO B 1 190 ? 134.191 -100.077 29.997  1.00 128.54 ? 114  PRO B CG  1 
ATOM   4255 C CD  . PRO B 1 190 ? 133.673 -101.011 31.039  1.00 125.81 ? 114  PRO B CD  1 
ATOM   4256 N N   . VAL B 1 191 ? 130.766 -100.301 28.954  1.00 115.65 ? 115  VAL B N   1 
ATOM   4257 C CA  . VAL B 1 191 ? 129.782 -100.423 27.877  1.00 112.41 ? 115  VAL B CA  1 
ATOM   4258 C C   . VAL B 1 191 ? 128.390 -100.325 28.515  1.00 112.58 ? 115  VAL B C   1 
ATOM   4259 O O   . VAL B 1 191 ? 127.559 -99.567  28.026  1.00 109.61 ? 115  VAL B O   1 
ATOM   4260 C CB  . VAL B 1 191 ? 129.969 -101.707 27.015  1.00 117.37 ? 115  VAL B CB  1 
ATOM   4261 C CG1 . VAL B 1 191 ? 128.971 -101.744 25.857  1.00 114.94 ? 115  VAL B CG1 1 
ATOM   4262 C CG2 . VAL B 1 191 ? 131.395 -101.815 26.481  1.00 118.59 ? 115  VAL B CG2 1 
ATOM   4263 N N   . MET B 1 192 ? 128.173 -101.024 29.650  1.00 109.49 ? 116  MET B N   1 
ATOM   4264 C CA  . MET B 1 192 ? 126.917 -100.992 30.408  1.00 107.99 ? 116  MET B CA  1 
ATOM   4265 C C   . MET B 1 192 ? 126.621 -99.579  30.926  1.00 108.82 ? 116  MET B C   1 
ATOM   4266 O O   . MET B 1 192 ? 125.454 -99.231  31.080  1.00 106.80 ? 116  MET B O   1 
ATOM   4267 C CB  . MET B 1 192 ? 126.969 -101.977 31.588  1.00 113.33 ? 116  MET B CB  1 
ATOM   4268 N N   . CYS B 1 193 ? 127.678 -98.775  31.193  1.00 105.06 ? 117  CYS B N   1 
ATOM   4269 C CA  . CYS B 1 193 ? 127.591 -97.388  31.672  1.00 103.56 ? 117  CYS B CA  1 
ATOM   4270 C C   . CYS B 1 193 ? 126.932 -96.509  30.591  1.00 103.46 ? 117  CYS B C   1 
ATOM   4271 O O   . CYS B 1 193 ? 126.091 -95.672  30.919  1.00 102.02 ? 117  CYS B O   1 
ATOM   4272 C CB  . CYS B 1 193 ? 128.974 -96.866  32.072  1.00 105.65 ? 117  CYS B CB  1 
ATOM   4273 S SG  . CYS B 1 193 ? 128.999 -95.164  32.717  1.00 109.25 ? 117  CYS B SG  1 
ATOM   4274 N N   . LYS B 1 194 ? 127.273 -96.744  29.304  1.00 97.82  ? 118  LYS B N   1 
ATOM   4275 C CA  . LYS B 1 194 ? 126.683 -96.027  28.173  1.00 94.38  ? 118  LYS B CA  1 
ATOM   4276 C C   . LYS B 1 194 ? 125.314 -96.603  27.815  1.00 97.40  ? 118  LYS B C   1 
ATOM   4277 O O   . LYS B 1 194 ? 124.388 -95.830  27.584  1.00 95.88  ? 118  LYS B O   1 
ATOM   4278 C CB  . LYS B 1 194 ? 127.600 -96.056  26.938  1.00 95.29  ? 118  LYS B CB  1 
ATOM   4279 C CG  . LYS B 1 194 ? 128.658 -94.968  26.941  1.00 96.96  ? 118  LYS B CG  1 
ATOM   4280 C CD  . LYS B 1 194 ? 129.268 -94.758  25.569  1.00 99.48  ? 118  LYS B CD  1 
ATOM   4281 C CE  . LYS B 1 194 ? 130.497 -93.879  25.567  1.00 105.68 ? 118  LYS B CE  1 
ATOM   4282 N NZ  . LYS B 1 194 ? 130.247 -92.500  26.071  1.00 113.76 ? 118  LYS B NZ  1 
ATOM   4283 N N   . VAL B 1 195 ? 125.192 -97.956  27.766  1.00 94.53  ? 119  VAL B N   1 
ATOM   4284 C CA  . VAL B 1 195 ? 123.975 -98.696  27.390  1.00 92.98  ? 119  VAL B CA  1 
ATOM   4285 C C   . VAL B 1 195 ? 122.842 -98.457  28.405  1.00 95.65  ? 119  VAL B C   1 
ATOM   4286 O O   . VAL B 1 195 ? 121.787 -97.961  28.006  1.00 93.81  ? 119  VAL B O   1 
ATOM   4287 C CB  . VAL B 1 195 ? 124.242 -100.213 27.175  1.00 98.44  ? 119  VAL B CB  1 
ATOM   4288 C CG1 . VAL B 1 195 ? 122.940 -100.999 27.020  1.00 97.86  ? 119  VAL B CG1 1 
ATOM   4289 C CG2 . VAL B 1 195 ? 125.136 -100.439 25.963  1.00 98.13  ? 119  VAL B CG2 1 
ATOM   4290 N N   . PHE B 1 196 ? 123.051 -98.800  29.690  1.00 93.29  ? 120  PHE B N   1 
ATOM   4291 C CA  . PHE B 1 196 ? 122.025 -98.632  30.724  1.00 92.99  ? 120  PHE B CA  1 
ATOM   4292 C C   . PHE B 1 196 ? 121.846 -97.158  31.118  1.00 95.00  ? 120  PHE B C   1 
ATOM   4293 O O   . PHE B 1 196 ? 120.764 -96.786  31.580  1.00 93.90  ? 120  PHE B O   1 
ATOM   4294 C CB  . PHE B 1 196 ? 122.333 -99.496  31.955  1.00 97.78  ? 120  PHE B CB  1 
ATOM   4295 N N   . GLY B 1 197 ? 122.878 -96.341  30.899  1.00 90.91  ? 121  GLY B N   1 
ATOM   4296 C CA  . GLY B 1 197 ? 122.827 -94.906  31.156  1.00 89.60  ? 121  GLY B CA  1 
ATOM   4297 C C   . GLY B 1 197 ? 121.873 -94.210  30.204  1.00 89.33  ? 121  GLY B C   1 
ATOM   4298 O O   . GLY B 1 197 ? 121.050 -93.408  30.640  1.00 88.29  ? 121  GLY B O   1 
ATOM   4299 N N   . SER B 1 198 ? 121.956 -94.541  28.900  1.00 83.90  ? 122  SER B N   1 
ATOM   4300 C CA  . SER B 1 198 ? 121.097 -94.000  27.841  1.00 81.25  ? 122  SER B CA  1 
ATOM   4301 C C   . SER B 1 198 ? 119.691 -94.586  27.897  1.00 84.17  ? 122  SER B C   1 
ATOM   4302 O O   . SER B 1 198 ? 118.726 -93.852  27.682  1.00 80.97  ? 122  SER B O   1 
ATOM   4303 C CB  . SER B 1 198 ? 121.696 -94.272  26.470  1.00 83.57  ? 122  SER B CB  1 
ATOM   4304 O OG  . SER B 1 198 ? 123.028 -93.800  26.444  1.00 94.47  ? 122  SER B OG  1 
ATOM   4305 N N   . PHE B 1 199 ? 119.575 -95.908  28.174  1.00 83.05  ? 123  PHE B N   1 
ATOM   4306 C CA  . PHE B 1 199 ? 118.295 -96.618  28.274  1.00 83.00  ? 123  PHE B CA  1 
ATOM   4307 C C   . PHE B 1 199 ? 117.423 -95.962  29.344  1.00 86.81  ? 123  PHE B C   1 
ATOM   4308 O O   . PHE B 1 199 ? 116.217 -95.800  29.141  1.00 84.52  ? 123  PHE B O   1 
ATOM   4309 C CB  . PHE B 1 199 ? 118.518 -98.118  28.571  1.00 86.87  ? 123  PHE B CB  1 
ATOM   4310 C CG  . PHE B 1 199 ? 117.281 -98.993  28.489  1.00 89.04  ? 123  PHE B CG  1 
ATOM   4311 C CD1 . PHE B 1 199 ? 116.722 -99.329  27.257  1.00 91.04  ? 123  PHE B CD1 1 
ATOM   4312 C CD2 . PHE B 1 199 ? 116.695 -99.511  29.640  1.00 93.32  ? 123  PHE B CD2 1 
ATOM   4313 C CE1 . PHE B 1 199 ? 115.582 -100.143 27.182  1.00 92.56  ? 123  PHE B CE1 1 
ATOM   4314 C CE2 . PHE B 1 199 ? 115.559 -100.331 29.562  1.00 96.81  ? 123  PHE B CE2 1 
ATOM   4315 C CZ  . PHE B 1 199 ? 115.013 -100.644 28.333  1.00 93.71  ? 123  PHE B CZ  1 
ATOM   4316 N N   . LEU B 1 200 ? 118.056 -95.535  30.451  1.00 85.85  ? 124  LEU B N   1 
ATOM   4317 C CA  . LEU B 1 200 ? 117.405 -94.842  31.559  1.00 86.93  ? 124  LEU B CA  1 
ATOM   4318 C C   . LEU B 1 200 ? 116.803 -93.508  31.089  1.00 89.56  ? 124  LEU B C   1 
ATOM   4319 O O   . LEU B 1 200 ? 115.636 -93.241  31.367  1.00 88.49  ? 124  LEU B O   1 
ATOM   4320 C CB  . LEU B 1 200 ? 118.420 -94.609  32.695  1.00 89.35  ? 124  LEU B CB  1 
ATOM   4321 C CG  . LEU B 1 200 ? 117.965 -93.742  33.863  1.00 95.43  ? 124  LEU B CG  1 
ATOM   4322 C CD1 . LEU B 1 200 ? 117.111 -94.532  34.836  1.00 97.83  ? 124  LEU B CD1 1 
ATOM   4323 C CD2 . LEU B 1 200 ? 119.149 -93.142  34.576  1.00 100.14 ? 124  LEU B CD2 1 
ATOM   4324 N N   . THR B 1 201 ? 117.599 -92.695  30.362  1.00 85.53  ? 125  THR B N   1 
ATOM   4325 C CA  . THR B 1 201 ? 117.226 -91.374  29.846  1.00 83.54  ? 125  THR B CA  1 
ATOM   4326 C C   . THR B 1 201 ? 116.151 -91.495  28.734  1.00 85.40  ? 125  THR B C   1 
ATOM   4327 O O   . THR B 1 201 ? 115.214 -90.694  28.722  1.00 84.86  ? 125  THR B O   1 
ATOM   4328 C CB  . THR B 1 201 ? 118.492 -90.631  29.380  1.00 88.79  ? 125  THR B CB  1 
ATOM   4329 O OG1 . THR B 1 201 ? 119.452 -90.658  30.437  1.00 85.00  ? 125  THR B OG1 1 
ATOM   4330 C CG2 . THR B 1 201 ? 118.230 -89.188  29.009  1.00 87.64  ? 125  THR B CG2 1 
ATOM   4331 N N   . LEU B 1 202 ? 116.276 -92.499  27.833  1.00 80.37  ? 126  LEU B N   1 
ATOM   4332 C CA  . LEU B 1 202 ? 115.348 -92.761  26.724  1.00 78.08  ? 126  LEU B CA  1 
ATOM   4333 C C   . LEU B 1 202 ? 113.916 -93.004  27.216  1.00 79.91  ? 126  LEU B C   1 
ATOM   4334 O O   . LEU B 1 202 ? 112.980 -92.484  26.619  1.00 77.76  ? 126  LEU B O   1 
ATOM   4335 C CB  . LEU B 1 202 ? 115.827 -93.981  25.917  1.00 78.56  ? 126  LEU B CB  1 
ATOM   4336 C CG  . LEU B 1 202 ? 115.205 -94.180  24.533  1.00 82.10  ? 126  LEU B CG  1 
ATOM   4337 C CD1 . LEU B 1 202 ? 116.244 -94.643  23.560  1.00 82.35  ? 126  LEU B CD1 1 
ATOM   4338 C CD2 . LEU B 1 202 ? 114.070 -95.192  24.569  1.00 85.42  ? 126  LEU B CD2 1 
ATOM   4339 N N   . ASN B 1 203 ? 113.756 -93.817  28.277  1.00 77.17  ? 127  ASN B N   1 
ATOM   4340 C CA  . ASN B 1 203 ? 112.456 -94.172  28.848  1.00 76.49  ? 127  ASN B CA  1 
ATOM   4341 C C   . ASN B 1 203 ? 111.940 -93.123  29.822  1.00 78.32  ? 127  ASN B C   1 
ATOM   4342 O O   . ASN B 1 203 ? 110.726 -93.033  30.000  1.00 77.16  ? 127  ASN B O   1 
ATOM   4343 C CB  . ASN B 1 203 ? 112.521 -95.535  29.525  1.00 77.80  ? 127  ASN B CB  1 
ATOM   4344 C CG  . ASN B 1 203 ? 112.680 -96.661  28.541  1.00 93.57  ? 127  ASN B CG  1 
ATOM   4345 O OD1 . ASN B 1 203 ? 113.706 -97.339  28.505  1.00 84.57  ? 127  ASN B OD1 1 
ATOM   4346 N ND2 . ASN B 1 203 ? 111.685 -96.856  27.688  1.00 86.82  ? 127  ASN B ND2 1 
ATOM   4347 N N   . MET B 1 204 ? 112.839 -92.339  30.454  1.00 74.73  ? 128  MET B N   1 
ATOM   4348 C CA  . MET B 1 204 ? 112.429 -91.270  31.367  1.00 75.01  ? 128  MET B CA  1 
ATOM   4349 C C   . MET B 1 204 ? 111.743 -90.171  30.547  1.00 76.20  ? 128  MET B C   1 
ATOM   4350 O O   . MET B 1 204 ? 110.653 -89.739  30.920  1.00 75.21  ? 128  MET B O   1 
ATOM   4351 C CB  . MET B 1 204 ? 113.618 -90.724  32.176  1.00 78.71  ? 128  MET B CB  1 
ATOM   4352 C CG  . MET B 1 204 ? 113.250 -89.609  33.135  1.00 83.24  ? 128  MET B CG  1 
ATOM   4353 S SD  . MET B 1 204 ? 114.570 -88.381  33.348  1.00 88.52  ? 128  MET B SD  1 
ATOM   4354 C CE  . MET B 1 204 ? 114.522 -87.544  31.755  1.00 82.82  ? 128  MET B CE  1 
ATOM   4355 N N   . PHE B 1 205 ? 112.345 -89.782  29.401  1.00 71.21  ? 129  PHE B N   1 
ATOM   4356 C CA  . PHE B 1 205 ? 111.784 -88.783  28.493  1.00 69.87  ? 129  PHE B CA  1 
ATOM   4357 C C   . PHE B 1 205 ? 110.521 -89.306  27.806  1.00 73.14  ? 129  PHE B C   1 
ATOM   4358 O O   . PHE B 1 205 ? 109.555 -88.555  27.712  1.00 73.05  ? 129  PHE B O   1 
ATOM   4359 C CB  . PHE B 1 205 ? 112.808 -88.328  27.444  1.00 71.17  ? 129  PHE B CB  1 
ATOM   4360 C CG  . PHE B 1 205 ? 113.775 -87.268  27.918  1.00 73.95  ? 129  PHE B CG  1 
ATOM   4361 C CD1 . PHE B 1 205 ? 113.318 -86.031  28.361  1.00 77.99  ? 129  PHE B CD1 1 
ATOM   4362 C CD2 . PHE B 1 205 ? 115.146 -87.487  27.878  1.00 77.04  ? 129  PHE B CD2 1 
ATOM   4363 C CE1 . PHE B 1 205 ? 114.219 -85.043  28.785  1.00 80.19  ? 129  PHE B CE1 1 
ATOM   4364 C CE2 . PHE B 1 205 ? 116.045 -86.494  28.293  1.00 81.20  ? 129  PHE B CE2 1 
ATOM   4365 C CZ  . PHE B 1 205 ? 115.577 -85.282  28.749  1.00 79.89  ? 129  PHE B CZ  1 
ATOM   4366 N N   . ALA B 1 206 ? 110.508 -90.586  27.358  1.00 69.07  ? 130  ALA B N   1 
ATOM   4367 C CA  . ALA B 1 206 ? 109.341 -91.207  26.713  1.00 68.35  ? 130  ALA B CA  1 
ATOM   4368 C C   . ALA B 1 206 ? 108.133 -91.246  27.661  1.00 74.28  ? 130  ALA B C   1 
ATOM   4369 O O   . ALA B 1 206 ? 107.003 -91.112  27.206  1.00 73.21  ? 130  ALA B O   1 
ATOM   4370 C CB  . ALA B 1 206 ? 109.679 -92.604  26.240  1.00 69.57  ? 130  ALA B CB  1 
ATOM   4371 N N   . SER B 1 207 ? 108.376 -91.384  28.980  1.00 73.46  ? 131  SER B N   1 
ATOM   4372 C CA  . SER B 1 207 ? 107.331 -91.351  30.008  1.00 74.52  ? 131  SER B CA  1 
ATOM   4373 C C   . SER B 1 207 ? 106.780 -89.921  30.156  1.00 76.27  ? 131  SER B C   1 
ATOM   4374 O O   . SER B 1 207 ? 105.565 -89.757  30.229  1.00 75.71  ? 131  SER B O   1 
ATOM   4375 C CB  . SER B 1 207 ? 107.874 -91.853  31.344  1.00 80.76  ? 131  SER B CB  1 
ATOM   4376 O OG  . SER B 1 207 ? 106.959 -91.619  32.403  1.00 90.56  ? 131  SER B OG  1 
ATOM   4377 N N   . ILE B 1 208 ? 107.678 -88.896  30.180  1.00 71.29  ? 132  ILE B N   1 
ATOM   4378 C CA  . ILE B 1 208 ? 107.346 -87.468  30.308  1.00 70.16  ? 132  ILE B CA  1 
ATOM   4379 C C   . ILE B 1 208 ? 106.593 -86.978  29.059  1.00 71.42  ? 132  ILE B C   1 
ATOM   4380 O O   . ILE B 1 208 ? 105.578 -86.286  29.187  1.00 70.73  ? 132  ILE B O   1 
ATOM   4381 C CB  . ILE B 1 208 ? 108.617 -86.598  30.567  1.00 73.50  ? 132  ILE B CB  1 
ATOM   4382 C CG1 . ILE B 1 208 ? 109.330 -86.992  31.878  1.00 76.00  ? 132  ILE B CG1 1 
ATOM   4383 C CG2 . ILE B 1 208 ? 108.264 -85.118  30.595  1.00 74.45  ? 132  ILE B CG2 1 
ATOM   4384 C CD1 . ILE B 1 208 ? 110.810 -86.541  31.987  1.00 82.43  ? 132  ILE B CD1 1 
ATOM   4385 N N   . PHE B 1 209 ? 107.096 -87.335  27.863  1.00 65.87  ? 133  PHE B N   1 
ATOM   4386 C CA  . PHE B 1 209 ? 106.535 -86.921  26.582  1.00 63.99  ? 133  PHE B CA  1 
ATOM   4387 C C   . PHE B 1 209 ? 105.178 -87.581  26.309  1.00 68.66  ? 133  PHE B C   1 
ATOM   4388 O O   . PHE B 1 209 ? 104.390 -87.000  25.566  1.00 68.31  ? 133  PHE B O   1 
ATOM   4389 C CB  . PHE B 1 209 ? 107.511 -87.195  25.424  1.00 64.55  ? 133  PHE B CB  1 
ATOM   4390 C CG  . PHE B 1 209 ? 108.871 -86.515  25.426  1.00 65.10  ? 133  PHE B CG  1 
ATOM   4391 C CD1 . PHE B 1 209 ? 109.148 -85.465  26.299  1.00 67.78  ? 133  PHE B CD1 1 
ATOM   4392 C CD2 . PHE B 1 209 ? 109.858 -86.899  24.526  1.00 66.20  ? 133  PHE B CD2 1 
ATOM   4393 C CE1 . PHE B 1 209 ? 110.399 -84.840  26.295  1.00 68.59  ? 133  PHE B CE1 1 
ATOM   4394 C CE2 . PHE B 1 209 ? 111.106 -86.266  24.517  1.00 68.70  ? 133  PHE B CE2 1 
ATOM   4395 C CZ  . PHE B 1 209 ? 111.370 -85.244  25.405  1.00 67.11  ? 133  PHE B CZ  1 
ATOM   4396 N N   . PHE B 1 210 ? 104.886 -88.762  26.908  1.00 66.10  ? 134  PHE B N   1 
ATOM   4397 C CA  . PHE B 1 210 ? 103.579 -89.404  26.721  1.00 66.43  ? 134  PHE B CA  1 
ATOM   4398 C C   . PHE B 1 210 ? 102.562 -88.841  27.726  1.00 73.85  ? 134  PHE B C   1 
ATOM   4399 O O   . PHE B 1 210 ? 101.364 -88.863  27.432  1.00 74.37  ? 134  PHE B O   1 
ATOM   4400 C CB  . PHE B 1 210 ? 103.641 -90.945  26.767  1.00 68.62  ? 134  PHE B CB  1 
ATOM   4401 C CG  . PHE B 1 210 ? 103.986 -91.607  25.443  1.00 68.88  ? 134  PHE B CG  1 
ATOM   4402 C CD1 . PHE B 1 210 ? 103.167 -91.445  24.327  1.00 70.80  ? 134  PHE B CD1 1 
ATOM   4403 C CD2 . PHE B 1 210 ? 105.103 -92.428  25.326  1.00 70.17  ? 134  PHE B CD2 1 
ATOM   4404 C CE1 . PHE B 1 210 ? 103.491 -92.049  23.107  1.00 70.87  ? 134  PHE B CE1 1 
ATOM   4405 C CE2 . PHE B 1 210 ? 105.427 -93.027  24.106  1.00 72.21  ? 134  PHE B CE2 1 
ATOM   4406 C CZ  . PHE B 1 210 ? 104.620 -92.833  23.006  1.00 69.91  ? 134  PHE B CZ  1 
ATOM   4407 N N   . ILE B 1 211 ? 103.032 -88.280  28.874  1.00 72.12  ? 135  ILE B N   1 
ATOM   4408 C CA  . ILE B 1 211 ? 102.169 -87.612  29.869  1.00 73.50  ? 135  ILE B CA  1 
ATOM   4409 C C   . ILE B 1 211 ? 101.598 -86.346  29.206  1.00 76.37  ? 135  ILE B C   1 
ATOM   4410 O O   . ILE B 1 211 ? 100.422 -86.017  29.390  1.00 76.90  ? 135  ILE B O   1 
ATOM   4411 C CB  . ILE B 1 211 ? 102.940 -87.300  31.195  1.00 78.02  ? 135  ILE B CB  1 
ATOM   4412 C CG1 . ILE B 1 211 ? 103.070 -88.559  32.066  1.00 80.71  ? 135  ILE B CG1 1 
ATOM   4413 C CG2 . ILE B 1 211 ? 102.295 -86.153  32.003  1.00 79.10  ? 135  ILE B CG2 1 
ATOM   4414 C CD1 . ILE B 1 211 ? 104.241 -88.515  33.084  1.00 92.09  ? 135  ILE B CD1 1 
ATOM   4415 N N   . THR B 1 212 ? 102.449 -85.672  28.403  1.00 71.18  ? 136  THR B N   1 
ATOM   4416 C CA  . THR B 1 212 ? 102.153 -84.464  27.637  1.00 69.95  ? 136  THR B CA  1 
ATOM   4417 C C   . THR B 1 212 ? 101.094 -84.777  26.567  1.00 75.83  ? 136  THR B C   1 
ATOM   4418 O O   . THR B 1 212 ? 100.109 -84.045  26.473  1.00 76.30  ? 136  THR B O   1 
ATOM   4419 C CB  . THR B 1 212 ? 103.445 -83.906  27.054  1.00 68.85  ? 136  THR B CB  1 
ATOM   4420 O OG1 . THR B 1 212 ? 104.402 -83.782  28.108  1.00 68.16  ? 136  THR B OG1 1 
ATOM   4421 C CG2 . THR B 1 212 ? 103.256 -82.565  26.413  1.00 65.19  ? 136  THR B CG2 1 
ATOM   4422 N N   . CYS B 1 213 ? 101.268 -85.889  25.811  1.00 73.01  ? 137  CYS B N   1 
ATOM   4423 C CA  . CYS B 1 213 ? 100.325 -86.372  24.795  1.00 73.31  ? 137  CYS B CA  1 
ATOM   4424 C C   . CYS B 1 213 ? 98.942  -86.563  25.413  1.00 78.65  ? 137  CYS B C   1 
ATOM   4425 O O   . CYS B 1 213 ? 97.942  -86.126  24.845  1.00 77.51  ? 137  CYS B O   1 
ATOM   4426 C CB  . CYS B 1 213 ? 100.830 -87.674  24.175  1.00 73.94  ? 137  CYS B CB  1 
ATOM   4427 S SG  . CYS B 1 213 ? 102.238 -87.472  23.059  1.00 76.82  ? 137  CYS B SG  1 
ATOM   4428 N N   . MET B 1 214 ? 98.908  -87.202  26.598  1.00 78.29  ? 138  MET B N   1 
ATOM   4429 C CA  . MET B 1 214 ? 97.705  -87.492  27.371  1.00 80.70  ? 138  MET B CA  1 
ATOM   4430 C C   . MET B 1 214 ? 96.967  -86.221  27.789  1.00 85.48  ? 138  MET B C   1 
ATOM   4431 O O   . MET B 1 214 ? 95.734  -86.207  27.762  1.00 86.08  ? 138  MET B O   1 
ATOM   4432 C CB  . MET B 1 214 ? 98.048  -88.330  28.613  1.00 84.67  ? 138  MET B CB  1 
ATOM   4433 C CG  . MET B 1 214 ? 98.036  -89.835  28.370  1.00 89.80  ? 138  MET B CG  1 
ATOM   4434 S SD  . MET B 1 214 ? 96.598  -90.474  27.447  1.00 95.94  ? 138  MET B SD  1 
ATOM   4435 C CE  . MET B 1 214 ? 95.205  -89.988  28.548  1.00 94.52  ? 138  MET B CE  1 
ATOM   4436 N N   . SER B 1 215 ? 97.713  -85.164  28.166  1.00 81.67  ? 139  SER B N   1 
ATOM   4437 C CA  . SER B 1 215 ? 97.136  -83.882  28.574  1.00 81.91  ? 139  SER B CA  1 
ATOM   4438 C C   . SER B 1 215 ? 96.566  -83.120  27.367  1.00 83.90  ? 139  SER B C   1 
ATOM   4439 O O   . SER B 1 215 ? 95.511  -82.495  27.494  1.00 84.47  ? 139  SER B O   1 
ATOM   4440 C CB  . SER B 1 215 ? 98.163  -83.031  29.314  1.00 85.94  ? 139  SER B CB  1 
ATOM   4441 O OG  . SER B 1 215 ? 98.160  -83.329  30.702  1.00 95.99  ? 139  SER B OG  1 
ATOM   4442 N N   . VAL B 1 216 ? 97.242  -83.203  26.201  1.00 78.32  ? 140  VAL B N   1 
ATOM   4443 C CA  . VAL B 1 216 ? 96.814  -82.563  24.949  1.00 77.57  ? 140  VAL B CA  1 
ATOM   4444 C C   . VAL B 1 216 ? 95.537  -83.251  24.426  1.00 83.55  ? 140  VAL B C   1 
ATOM   4445 O O   . VAL B 1 216 ? 94.632  -82.566  23.944  1.00 83.55  ? 140  VAL B O   1 
ATOM   4446 C CB  . VAL B 1 216 ? 97.941  -82.549  23.883  1.00 79.65  ? 140  VAL B CB  1 
ATOM   4447 C CG1 . VAL B 1 216 ? 97.447  -81.979  22.551  1.00 79.18  ? 140  VAL B CG1 1 
ATOM   4448 C CG2 . VAL B 1 216 ? 99.158  -81.768  24.379  1.00 78.76  ? 140  VAL B CG2 1 
ATOM   4449 N N   . ASP B 1 217 ? 95.460  -84.591  24.550  1.00 81.63  ? 141  ASP B N   1 
ATOM   4450 C CA  . ASP B 1 217 ? 94.311  -85.386  24.111  1.00 83.49  ? 141  ASP B CA  1 
ATOM   4451 C C   . ASP B 1 217 ? 93.066  -85.081  24.965  1.00 89.02  ? 141  ASP B C   1 
ATOM   4452 O O   . ASP B 1 217 ? 91.997  -84.824  24.402  1.00 88.41  ? 141  ASP B O   1 
ATOM   4453 C CB  . ASP B 1 217 ? 94.645  -86.887  24.147  1.00 86.27  ? 141  ASP B CB  1 
ATOM   4454 C CG  . ASP B 1 217 ? 93.843  -87.702  23.152  1.00 99.23  ? 141  ASP B CG  1 
ATOM   4455 O OD1 . ASP B 1 217 ? 94.121  -87.597  21.935  1.00 98.67  ? 141  ASP B OD1 1 
ATOM   4456 O OD2 . ASP B 1 217 ? 92.936  -88.440  23.588  1.00 108.37 ? 141  ASP B OD2 1 
ATOM   4457 N N   . ARG B 1 218 ? 93.222  -85.069  26.314  1.00 86.69  ? 142  ARG B N   1 
ATOM   4458 C CA  . ARG B 1 218 ? 92.160  -84.751  27.274  1.00 88.17  ? 142  ARG B CA  1 
ATOM   4459 C C   . ARG B 1 218 ? 91.629  -83.336  27.045  1.00 93.14  ? 142  ARG B C   1 
ATOM   4460 O O   . ARG B 1 218 ? 90.433  -83.105  27.220  1.00 94.25  ? 142  ARG B O   1 
ATOM   4461 C CB  . ARG B 1 218 ? 92.650  -84.904  28.722  1.00 88.58  ? 142  ARG B CB  1 
ATOM   4462 C CG  . ARG B 1 218 ? 92.645  -86.342  29.219  1.00 101.78 ? 142  ARG B CG  1 
ATOM   4463 C CD  . ARG B 1 218 ? 93.104  -86.448  30.663  1.00 112.08 ? 142  ARG B CD  1 
ATOM   4464 N NE  . ARG B 1 218 ? 92.756  -87.745  31.247  1.00 121.84 ? 142  ARG B NE  1 
ATOM   4465 C CZ  . ARG B 1 218 ? 92.813  -88.032  32.547  1.00 139.16 ? 142  ARG B CZ  1 
ATOM   4466 N NH1 . ARG B 1 218 ? 93.205  -87.114  33.422  1.00 127.55 ? 142  ARG B NH1 1 
ATOM   4467 N NH2 . ARG B 1 218 ? 92.470  -89.238  32.981  1.00 127.22 ? 142  ARG B NH2 1 
ATOM   4468 N N   . TYR B 1 219 ? 92.506  -82.401  26.632  1.00 89.17  ? 143  TYR B N   1 
ATOM   4469 C CA  . TYR B 1 219 ? 92.121  -81.025  26.330  1.00 89.66  ? 143  TYR B CA  1 
ATOM   4470 C C   . TYR B 1 219 ? 91.359  -80.970  25.009  1.00 94.91  ? 143  TYR B C   1 
ATOM   4471 O O   . TYR B 1 219 ? 90.348  -80.274  24.930  1.00 95.99  ? 143  TYR B O   1 
ATOM   4472 C CB  . TYR B 1 219 ? 93.344  -80.099  26.303  1.00 90.15  ? 143  TYR B CB  1 
ATOM   4473 C CG  . TYR B 1 219 ? 93.062  -78.737  25.706  1.00 92.98  ? 143  TYR B CG  1 
ATOM   4474 C CD1 . TYR B 1 219 ? 92.372  -77.767  26.426  1.00 96.44  ? 143  TYR B CD1 1 
ATOM   4475 C CD2 . TYR B 1 219 ? 93.467  -78.424  24.410  1.00 93.11  ? 143  TYR B CD2 1 
ATOM   4476 C CE1 . TYR B 1 219 ? 92.095  -76.517  25.874  1.00 98.29  ? 143  TYR B CE1 1 
ATOM   4477 C CE2 . TYR B 1 219 ? 93.194  -77.180  23.847  1.00 94.47  ? 143  TYR B CE2 1 
ATOM   4478 C CZ  . TYR B 1 219 ? 92.514  -76.227  24.585  1.00 105.68 ? 143  TYR B CZ  1 
ATOM   4479 O OH  . TYR B 1 219 ? 92.246  -75.001  24.029  1.00 111.08 ? 143  TYR B OH  1 
ATOM   4480 N N   . GLN B 1 220 ? 91.845  -81.704  23.983  1.00 91.12  ? 144  GLN B N   1 
ATOM   4481 C CA  . GLN B 1 220 ? 91.258  -81.790  22.638  1.00 91.37  ? 144  GLN B CA  1 
ATOM   4482 C C   . GLN B 1 220 ? 89.834  -82.355  22.686  1.00 96.98  ? 144  GLN B C   1 
ATOM   4483 O O   . GLN B 1 220 ? 88.974  -81.900  21.930  1.00 96.97  ? 144  GLN B O   1 
ATOM   4484 C CB  . GLN B 1 220 ? 92.143  -82.669  21.734  1.00 91.83  ? 144  GLN B CB  1 
ATOM   4485 C CG  . GLN B 1 220 ? 92.279  -82.148  20.307  1.00 105.82 ? 144  GLN B CG  1 
ATOM   4486 C CD  . GLN B 1 220 ? 93.351  -82.839  19.489  1.00 124.81 ? 144  GLN B CD  1 
ATOM   4487 O OE1 . GLN B 1 220 ? 94.212  -83.573  20.000  1.00 122.21 ? 144  GLN B OE1 1 
ATOM   4488 N NE2 . GLN B 1 220 ? 93.347  -82.574  18.189  1.00 112.04 ? 144  GLN B NE2 1 
ATOM   4489 N N   . SER B 1 221 ? 89.595  -83.337  23.587  1.00 94.64  ? 145  SER B N   1 
ATOM   4490 C CA  . SER B 1 221 ? 88.301  -83.989  23.781  1.00 96.26  ? 145  SER B CA  1 
ATOM   4491 C C   . SER B 1 221 ? 87.327  -83.090  24.570  1.00 102.36 ? 145  SER B C   1 
ATOM   4492 O O   . SER B 1 221 ? 86.125  -83.111  24.288  1.00 103.42 ? 145  SER B O   1 
ATOM   4493 C CB  . SER B 1 221 ? 88.482  -85.328  24.489  1.00 98.91  ? 145  SER B CB  1 
ATOM   4494 O OG  . SER B 1 221 ? 88.900  -85.157  25.833  1.00 104.09 ? 145  SER B OG  1 
ATOM   4495 N N   . VAL B 1 222 ? 87.849  -82.306  25.548  1.00 98.85  ? 146  VAL B N   1 
ATOM   4496 C CA  . VAL B 1 222 ? 87.081  -81.390  26.405  1.00 100.07 ? 146  VAL B CA  1 
ATOM   4497 C C   . VAL B 1 222 ? 86.455  -80.263  25.554  1.00 105.29 ? 146  VAL B C   1 
ATOM   4498 O O   . VAL B 1 222 ? 85.331  -79.851  25.846  1.00 107.41 ? 146  VAL B O   1 
ATOM   4499 C CB  . VAL B 1 222 ? 87.959  -80.858  27.583  1.00 103.22 ? 146  VAL B CB  1 
ATOM   4500 C CG1 . VAL B 1 222 ? 87.709  -79.388  27.903  1.00 103.20 ? 146  VAL B CG1 1 
ATOM   4501 C CG2 . VAL B 1 222 ? 87.783  -81.714  28.831  1.00 104.49 ? 146  VAL B CG2 1 
ATOM   4502 N N   . ILE B 1 223 ? 87.146  -79.807  24.490  1.00 100.51 ? 147  ILE B N   1 
ATOM   4503 C CA  . ILE B 1 223 ? 86.632  -78.744  23.619  1.00 100.67 ? 147  ILE B CA  1 
ATOM   4504 C C   . ILE B 1 223 ? 85.743  -79.318  22.486  1.00 105.98 ? 147  ILE B C   1 
ATOM   4505 O O   . ILE B 1 223 ? 84.627  -78.827  22.288  1.00 107.01 ? 147  ILE B O   1 
ATOM   4506 C CB  . ILE B 1 223 ? 87.775  -77.858  23.031  1.00 101.95 ? 147  ILE B CB  1 
ATOM   4507 C CG1 . ILE B 1 223 ? 88.852  -77.446  24.081  1.00 101.02 ? 147  ILE B CG1 1 
ATOM   4508 C CG2 . ILE B 1 223 ? 87.216  -76.630  22.300  1.00 103.86 ? 147  ILE B CG2 1 
ATOM   4509 C CD1 . ILE B 1 223 ? 88.405  -76.604  25.324  1.00 105.31 ? 147  ILE B CD1 1 
ATOM   4510 N N   . TYR B 1 224 ? 86.270  -80.296  21.707  1.00 102.46 ? 148  TYR B N   1 
ATOM   4511 C CA  . TYR B 1 224 ? 85.594  -80.872  20.536  1.00 103.73 ? 148  TYR B CA  1 
ATOM   4512 C C   . TYR B 1 224 ? 85.497  -82.415  20.549  1.00 111.09 ? 148  TYR B C   1 
ATOM   4513 O O   . TYR B 1 224 ? 86.535  -83.088  20.531  1.00 109.24 ? 148  TYR B O   1 
ATOM   4514 C CB  . TYR B 1 224 ? 86.295  -80.465  19.204  1.00 103.03 ? 148  TYR B CB  1 
ATOM   4515 C CG  . TYR B 1 224 ? 87.240  -79.280  19.251  1.00 101.71 ? 148  TYR B CG  1 
ATOM   4516 C CD1 . TYR B 1 224 ? 88.520  -79.405  19.782  1.00 101.31 ? 148  TYR B CD1 1 
ATOM   4517 C CD2 . TYR B 1 224 ? 86.901  -78.070  18.652  1.00 102.88 ? 148  TYR B CD2 1 
ATOM   4518 C CE1 . TYR B 1 224 ? 89.395  -78.322  19.824  1.00 100.36 ? 148  TYR B CE1 1 
ATOM   4519 C CE2 . TYR B 1 224 ? 87.778  -76.987  18.662  1.00 102.41 ? 148  TYR B CE2 1 
ATOM   4520 C CZ  . TYR B 1 224 ? 89.018  -77.113  19.263  1.00 106.88 ? 148  TYR B CZ  1 
ATOM   4521 O OH  . TYR B 1 224 ? 89.890  -76.053  19.266  1.00 106.94 ? 148  TYR B OH  1 
ATOM   4522 N N   . PRO B 1 225 ? 84.278  -83.000  20.427  1.00 112.29 ? 149  PRO B N   1 
ATOM   4523 C CA  . PRO B 1 225 ? 84.174  -84.465  20.321  1.00 113.70 ? 149  PRO B CA  1 
ATOM   4524 C C   . PRO B 1 225 ? 84.129  -84.898  18.835  1.00 119.59 ? 149  PRO B C   1 
ATOM   4525 O O   . PRO B 1 225 ? 83.199  -85.594  18.412  1.00 121.39 ? 149  PRO B O   1 
ATOM   4526 C CB  . PRO B 1 225 ? 82.869  -84.768  21.072  1.00 117.76 ? 149  PRO B CB  1 
ATOM   4527 C CG  . PRO B 1 225 ? 82.086  -83.449  21.058  1.00 122.68 ? 149  PRO B CG  1 
ATOM   4528 C CD  . PRO B 1 225 ? 82.936  -82.386  20.407  1.00 116.10 ? 149  PRO B CD  1 
ATOM   4529 N N   . PHE B 1 226 ? 85.138  -84.449  18.038  1.00 114.96 ? 150  PHE B N   1 
ATOM   4530 C CA  . PHE B 1 226 ? 85.278  -84.715  16.598  1.00 143.01 ? 150  PHE B CA  1 
ATOM   4531 C C   . PHE B 1 226 ? 86.603  -85.403  16.293  1.00 172.79 ? 150  PHE B C   1 
ATOM   4532 O O   . PHE B 1 226 ? 86.615  -86.476  15.695  1.00 136.61 ? 150  PHE B O   1 
ATOM   4533 C CB  . PHE B 1 226 ? 85.174  -83.409  15.791  1.00 144.63 ? 150  PHE B CB  1 
ATOM   4534 N N   . ALA B 1 236 ? 97.433  -90.939  15.248  1.00 79.58  ? 160  ALA B N   1 
ATOM   4535 C CA  . ALA B 1 236 ? 98.001  -91.528  16.461  1.00 78.35  ? 160  ALA B CA  1 
ATOM   4536 C C   . ALA B 1 236 ? 99.033  -92.604  16.132  1.00 81.30  ? 160  ALA B C   1 
ATOM   4537 O O   . ALA B 1 236 ? 99.719  -93.093  17.035  1.00 79.81  ? 160  ALA B O   1 
ATOM   4538 C CB  . ALA B 1 236 ? 96.900  -92.110  17.327  1.00 80.48  ? 160  ALA B CB  1 
ATOM   4539 N N   . SER B 1 237 ? 99.142  -92.971  14.837  1.00 78.85  ? 161  SER B N   1 
ATOM   4540 C CA  . SER B 1 237 ? 100.130 -93.945  14.361  1.00 78.79  ? 161  SER B CA  1 
ATOM   4541 C C   . SER B 1 237 ? 101.398 -93.213  13.900  1.00 80.17  ? 161  SER B C   1 
ATOM   4542 O O   . SER B 1 237 ? 102.376 -93.855  13.516  1.00 80.42  ? 161  SER B O   1 
ATOM   4543 C CB  . SER B 1 237 ? 99.556  -94.804  13.238  1.00 84.45  ? 161  SER B CB  1 
ATOM   4544 O OG  . SER B 1 237 ? 99.311  -94.042  12.068  1.00 93.42  ? 161  SER B OG  1 
ATOM   4545 N N   . TYR B 1 238 ? 101.363 -91.865  13.947  1.00 74.10  ? 162  TYR B N   1 
ATOM   4546 C CA  . TYR B 1 238 ? 102.444 -90.948  13.591  1.00 71.78  ? 162  TYR B CA  1 
ATOM   4547 C C   . TYR B 1 238 ? 103.074 -90.340  14.861  1.00 71.83  ? 162  TYR B C   1 
ATOM   4548 O O   . TYR B 1 238 ? 104.293 -90.145  14.907  1.00 70.73  ? 162  TYR B O   1 
ATOM   4549 C CB  . TYR B 1 238 ? 101.887 -89.842  12.659  1.00 73.31  ? 162  TYR B CB  1 
ATOM   4550 C CG  . TYR B 1 238 ? 102.746 -88.600  12.549  1.00 73.91  ? 162  TYR B CG  1 
ATOM   4551 C CD1 . TYR B 1 238 ? 102.471 -87.467  13.312  1.00 74.84  ? 162  TYR B CD1 1 
ATOM   4552 C CD2 . TYR B 1 238 ? 103.835 -88.556  11.684  1.00 74.90  ? 162  TYR B CD2 1 
ATOM   4553 C CE1 . TYR B 1 238 ? 103.286 -86.339  13.247  1.00 75.36  ? 162  TYR B CE1 1 
ATOM   4554 C CE2 . TYR B 1 238 ? 104.639 -87.425  11.591  1.00 75.01  ? 162  TYR B CE2 1 
ATOM   4555 C CZ  . TYR B 1 238 ? 104.367 -86.321  12.379  1.00 82.67  ? 162  TYR B CZ  1 
ATOM   4556 O OH  . TYR B 1 238 ? 105.174 -85.216  12.286  1.00 85.07  ? 162  TYR B OH  1 
ATOM   4557 N N   . ILE B 1 239 ? 102.233 -90.031  15.877  1.00 66.55  ? 163  ILE B N   1 
ATOM   4558 C CA  . ILE B 1 239 ? 102.649 -89.406  17.137  1.00 64.76  ? 163  ILE B CA  1 
ATOM   4559 C C   . ILE B 1 239 ? 103.507 -90.379  17.971  1.00 68.33  ? 163  ILE B C   1 
ATOM   4560 O O   . ILE B 1 239 ? 104.620 -90.009  18.349  1.00 67.95  ? 163  ILE B O   1 
ATOM   4561 C CB  . ILE B 1 239 ? 101.439 -88.835  17.934  1.00 67.75  ? 163  ILE B CB  1 
ATOM   4562 C CG1 . ILE B 1 239 ? 100.850 -87.613  17.203  1.00 68.30  ? 163  ILE B CG1 1 
ATOM   4563 C CG2 . ILE B 1 239 ? 101.829 -88.444  19.372  1.00 67.37  ? 163  ILE B CG2 1 
ATOM   4564 C CD1 . ILE B 1 239 ? 99.363  -87.586  17.146  1.00 81.26  ? 163  ILE B CD1 1 
ATOM   4565 N N   . VAL B 1 240 ? 103.013 -91.601  18.239  1.00 64.82  ? 164  VAL B N   1 
ATOM   4566 C CA  . VAL B 1 240 ? 103.741 -92.596  19.024  1.00 65.04  ? 164  VAL B CA  1 
ATOM   4567 C C   . VAL B 1 240 ? 105.196 -92.780  18.460  1.00 68.48  ? 164  VAL B C   1 
ATOM   4568 O O   . VAL B 1 240 ? 106.106 -92.550  19.261  1.00 68.08  ? 164  VAL B O   1 
ATOM   4569 C CB  . VAL B 1 240 ? 102.975 -93.944  19.214  1.00 70.87  ? 164  VAL B CB  1 
ATOM   4570 C CG1 . VAL B 1 240 ? 103.918 -95.081  19.614  1.00 70.94  ? 164  VAL B CG1 1 
ATOM   4571 C CG2 . VAL B 1 240 ? 101.862 -93.804  20.251  1.00 71.57  ? 164  VAL B CG2 1 
ATOM   4572 N N   . PRO B 1 241 ? 105.485 -93.071  17.146  1.00 64.22  ? 165  PRO B N   1 
ATOM   4573 C CA  . PRO B 1 241 ? 106.900 -93.179  16.716  1.00 63.27  ? 165  PRO B CA  1 
ATOM   4574 C C   . PRO B 1 241 ? 107.694 -91.872  16.867  1.00 65.39  ? 165  PRO B C   1 
ATOM   4575 O O   . PRO B 1 241 ? 108.889 -91.953  17.148  1.00 65.01  ? 165  PRO B O   1 
ATOM   4576 C CB  . PRO B 1 241 ? 106.815 -93.612  15.252  1.00 65.53  ? 165  PRO B CB  1 
ATOM   4577 C CG  . PRO B 1 241 ? 105.467 -93.270  14.826  1.00 70.30  ? 165  PRO B CG  1 
ATOM   4578 C CD  . PRO B 1 241 ? 104.581 -93.379  16.024  1.00 66.12  ? 165  PRO B CD  1 
ATOM   4579 N N   . LEU B 1 242 ? 107.045 -90.694  16.739  1.00 60.73  ? 166  LEU B N   1 
ATOM   4580 C CA  . LEU B 1 242 ? 107.710 -89.402  16.927  1.00 59.52  ? 166  LEU B CA  1 
ATOM   4581 C C   . LEU B 1 242 ? 108.147 -89.192  18.399  1.00 63.39  ? 166  LEU B C   1 
ATOM   4582 O O   . LEU B 1 242 ? 109.228 -88.640  18.640  1.00 62.57  ? 166  LEU B O   1 
ATOM   4583 C CB  . LEU B 1 242 ? 106.772 -88.270  16.509  1.00 59.21  ? 166  LEU B CB  1 
ATOM   4584 C CG  . LEU B 1 242 ? 107.231 -87.193  15.562  1.00 64.39  ? 166  LEU B CG  1 
ATOM   4585 C CD1 . LEU B 1 242 ? 106.209 -86.117  15.579  1.00 64.34  ? 166  LEU B CD1 1 
ATOM   4586 C CD2 . LEU B 1 242 ? 108.499 -86.496  16.066  1.00 66.73  ? 166  LEU B CD2 1 
ATOM   4587 N N   . VAL B 1 243 ? 107.303 -89.622  19.368  1.00 59.42  ? 167  VAL B N   1 
ATOM   4588 C CA  . VAL B 1 243 ? 107.568 -89.480  20.803  1.00 59.31  ? 167  VAL B CA  1 
ATOM   4589 C C   . VAL B 1 243 ? 108.796 -90.331  21.199  1.00 63.49  ? 167  VAL B C   1 
ATOM   4590 O O   . VAL B 1 243 ? 109.583 -89.924  22.060  1.00 63.27  ? 167  VAL B O   1 
ATOM   4591 C CB  . VAL B 1 243 ? 106.315 -89.821  21.648  1.00 64.10  ? 167  VAL B CB  1 
ATOM   4592 C CG1 . VAL B 1 243 ? 106.620 -89.771  23.144  1.00 64.28  ? 167  VAL B CG1 1 
ATOM   4593 C CG2 . VAL B 1 243 ? 105.161 -88.879  21.317  1.00 63.67  ? 167  VAL B CG2 1 
ATOM   4594 N N   . TRP B 1 244 ? 108.968 -91.485  20.547  1.00 60.77  ? 168  TRP B N   1 
ATOM   4595 C CA  . TRP B 1 244 ? 110.111 -92.357  20.784  1.00 61.71  ? 168  TRP B CA  1 
ATOM   4596 C C   . TRP B 1 244 ? 111.356 -91.797  20.092  1.00 67.34  ? 168  TRP B C   1 
ATOM   4597 O O   . TRP B 1 244 ? 112.455 -91.910  20.642  1.00 68.01  ? 168  TRP B O   1 
ATOM   4598 C CB  . TRP B 1 244 ? 109.816 -93.792  20.332  1.00 61.34  ? 168  TRP B CB  1 
ATOM   4599 C CG  . TRP B 1 244 ? 108.869 -94.498  21.260  1.00 62.89  ? 168  TRP B CG  1 
ATOM   4600 C CD1 . TRP B 1 244 ? 107.535 -94.699  21.069  1.00 66.07  ? 168  TRP B CD1 1 
ATOM   4601 C CD2 . TRP B 1 244 ? 109.173 -95.016  22.570  1.00 63.44  ? 168  TRP B CD2 1 
ATOM   4602 N NE1 . TRP B 1 244 ? 106.992 -95.340  22.161  1.00 66.56  ? 168  TRP B NE1 1 
ATOM   4603 C CE2 . TRP B 1 244 ? 107.974 -95.543  23.099  1.00 68.16  ? 168  TRP B CE2 1 
ATOM   4604 C CE3 . TRP B 1 244 ? 110.347 -95.101  23.340  1.00 64.76  ? 168  TRP B CE3 1 
ATOM   4605 C CZ2 . TRP B 1 244 ? 107.913 -96.145  24.362  1.00 68.55  ? 168  TRP B CZ2 1 
ATOM   4606 C CZ3 . TRP B 1 244 ? 110.290 -95.719  24.580  1.00 67.40  ? 168  TRP B CZ3 1 
ATOM   4607 C CH2 . TRP B 1 244 ? 109.082 -96.220  25.085  1.00 68.97  ? 168  TRP B CH2 1 
ATOM   4608 N N   . CYS B 1 245 ? 111.182 -91.154  18.917  1.00 63.71  ? 169  CYS B N   1 
ATOM   4609 C CA  . CYS B 1 245 ? 112.277 -90.533  18.177  1.00 63.24  ? 169  CYS B CA  1 
ATOM   4610 C C   . CYS B 1 245 ? 112.837 -89.342  18.965  1.00 66.21  ? 169  CYS B C   1 
ATOM   4611 O O   . CYS B 1 245 ? 114.059 -89.210  19.050  1.00 66.19  ? 169  CYS B O   1 
ATOM   4612 C CB  . CYS B 1 245 ? 111.831 -90.119  16.779  1.00 63.70  ? 169  CYS B CB  1 
ATOM   4613 S SG  . CYS B 1 245 ? 113.071 -89.161  15.869  1.00 67.92  ? 169  CYS B SG  1 
ATOM   4614 N N   . MET B 1 246 ? 111.948 -88.502  19.560  1.00 62.36  ? 170  MET B N   1 
ATOM   4615 C CA  . MET B 1 246 ? 112.314 -87.343  20.385  1.00 62.27  ? 170  MET B CA  1 
ATOM   4616 C C   . MET B 1 246 ? 113.033 -87.780  21.664  1.00 69.10  ? 170  MET B C   1 
ATOM   4617 O O   . MET B 1 246 ? 113.919 -87.063  22.134  1.00 70.15  ? 170  MET B O   1 
ATOM   4618 C CB  . MET B 1 246 ? 111.079 -86.510  20.741  1.00 64.03  ? 170  MET B CB  1 
ATOM   4619 C CG  . MET B 1 246 ? 110.629 -85.581  19.627  1.00 67.44  ? 170  MET B CG  1 
ATOM   4620 S SD  . MET B 1 246 ? 109.184 -84.563  20.076  1.00 71.51  ? 170  MET B SD  1 
ATOM   4621 C CE  . MET B 1 246 ? 107.846 -85.763  19.879  1.00 68.11  ? 170  MET B CE  1 
ATOM   4622 N N   . ALA B 1 247 ? 112.665 -88.960  22.213  1.00 66.18  ? 171  ALA B N   1 
ATOM   4623 C CA  . ALA B 1 247 ? 113.288 -89.541  23.402  1.00 67.54  ? 171  ALA B CA  1 
ATOM   4624 C C   . ALA B 1 247 ? 114.703 -90.076  23.074  1.00 75.12  ? 171  ALA B C   1 
ATOM   4625 O O   . ALA B 1 247 ? 115.600 -89.987  23.917  1.00 75.87  ? 171  ALA B O   1 
ATOM   4626 C CB  . ALA B 1 247 ? 112.414 -90.651  23.955  1.00 68.66  ? 171  ALA B CB  1 
ATOM   4627 N N   . CYS B 1 248 ? 114.897 -90.606  21.844  1.00 73.09  ? 172  CYS B N   1 
ATOM   4628 C CA  . CYS B 1 248 ? 116.180 -91.114  21.351  1.00 74.43  ? 172  CYS B CA  1 
ATOM   4629 C C   . CYS B 1 248 ? 117.167 -89.962  21.143  1.00 77.48  ? 172  CYS B C   1 
ATOM   4630 O O   . CYS B 1 248 ? 118.351 -90.114  21.457  1.00 78.31  ? 172  CYS B O   1 
ATOM   4631 C CB  . CYS B 1 248 ? 115.995 -91.920  20.070  1.00 75.66  ? 172  CYS B CB  1 
ATOM   4632 S SG  . CYS B 1 248 ? 115.326 -93.579  20.335  1.00 81.01  ? 172  CYS B SG  1 
ATOM   4633 N N   . LEU B 1 249 ? 116.681 -88.825  20.615  1.00 71.84  ? 173  LEU B N   1 
ATOM   4634 C CA  . LEU B 1 249 ? 117.454 -87.611  20.360  1.00 71.02  ? 173  LEU B CA  1 
ATOM   4635 C C   . LEU B 1 249 ? 117.869 -86.910  21.662  1.00 74.13  ? 173  LEU B C   1 
ATOM   4636 O O   . LEU B 1 249 ? 119.008 -86.452  21.767  1.00 73.56  ? 173  LEU B O   1 
ATOM   4637 C CB  . LEU B 1 249 ? 116.628 -86.648  19.485  1.00 70.09  ? 173  LEU B CB  1 
ATOM   4638 C CG  . LEU B 1 249 ? 116.933 -86.624  17.988  1.00 74.66  ? 173  LEU B CG  1 
ATOM   4639 C CD1 . LEU B 1 249 ? 116.556 -87.921  17.310  1.00 74.64  ? 173  LEU B CD1 1 
ATOM   4640 C CD2 . LEU B 1 249 ? 116.162 -85.523  17.321  1.00 77.35  ? 173  LEU B CD2 1 
ATOM   4641 N N   . SER B 1 250 ? 116.959 -86.856  22.656  1.00 70.73  ? 174  SER B N   1 
ATOM   4642 C CA  . SER B 1 250 ? 117.187 -86.216  23.955  1.00 71.47  ? 174  SER B CA  1 
ATOM   4643 C C   . SER B 1 250 ? 118.160 -87.011  24.838  1.00 76.14  ? 174  SER B C   1 
ATOM   4644 O O   . SER B 1 250 ? 118.688 -86.454  25.808  1.00 77.93  ? 174  SER B O   1 
ATOM   4645 C CB  . SER B 1 250 ? 115.866 -86.022  24.695  1.00 75.18  ? 174  SER B CB  1 
ATOM   4646 O OG  . SER B 1 250 ? 114.929 -85.249  23.965  1.00 83.42  ? 174  SER B OG  1 
ATOM   4647 N N   . SER B 1 251 ? 118.388 -88.307  24.516  1.00 71.06  ? 175  SER B N   1 
ATOM   4648 C CA  . SER B 1 251 ? 119.295 -89.179  25.274  1.00 71.72  ? 175  SER B CA  1 
ATOM   4649 C C   . SER B 1 251 ? 120.646 -89.383  24.561  1.00 73.14  ? 175  SER B C   1 
ATOM   4650 O O   . SER B 1 251 ? 121.428 -90.224  25.001  1.00 74.86  ? 175  SER B O   1 
ATOM   4651 C CB  . SER B 1 251 ? 118.640 -90.530  25.560  1.00 76.59  ? 175  SER B CB  1 
ATOM   4652 O OG  . SER B 1 251 ? 118.300 -91.217  24.368  1.00 88.18  ? 175  SER B OG  1 
ATOM   4653 N N   . LEU B 1 252 ? 120.935 -88.591  23.497  1.00 65.62  ? 176  LEU B N   1 
ATOM   4654 C CA  . LEU B 1 252 ? 122.194 -88.656  22.756  1.00 64.82  ? 176  LEU B CA  1 
ATOM   4655 C C   . LEU B 1 252 ? 123.371 -88.069  23.574  1.00 71.17  ? 176  LEU B C   1 
ATOM   4656 O O   . LEU B 1 252 ? 124.422 -88.710  23.577  1.00 70.59  ? 176  LEU B O   1 
ATOM   4657 C CB  . LEU B 1 252 ? 122.083 -87.975  21.394  1.00 63.58  ? 176  LEU B CB  1 
ATOM   4658 C CG  . LEU B 1 252 ? 121.455 -88.833  20.311  1.00 66.38  ? 176  LEU B CG  1 
ATOM   4659 C CD1 . LEU B 1 252 ? 121.036 -87.987  19.140  1.00 66.04  ? 176  LEU B CD1 1 
ATOM   4660 C CD2 . LEU B 1 252 ? 122.393 -89.962  19.867  1.00 67.85  ? 176  LEU B CD2 1 
ATOM   4661 N N   . PRO B 1 253 ? 123.235 -86.940  24.342  1.00 70.41  ? 177  PRO B N   1 
ATOM   4662 C CA  . PRO B 1 253 ? 124.369 -86.475  25.176  1.00 72.75  ? 177  PRO B CA  1 
ATOM   4663 C C   . PRO B 1 253 ? 124.699 -87.461  26.308  1.00 79.83  ? 177  PRO B C   1 
ATOM   4664 O O   . PRO B 1 253 ? 125.817 -87.461  26.816  1.00 82.41  ? 177  PRO B O   1 
ATOM   4665 C CB  . PRO B 1 253 ? 123.878 -85.134  25.733  1.00 74.46  ? 177  PRO B CB  1 
ATOM   4666 C CG  . PRO B 1 253 ? 122.730 -84.750  24.861  1.00 76.79  ? 177  PRO B CG  1 
ATOM   4667 C CD  . PRO B 1 253 ? 122.077 -86.041  24.519  1.00 71.04  ? 177  PRO B CD  1 
ATOM   4668 N N   . THR B 1 254 ? 123.728 -88.321  26.682  1.00 75.78  ? 178  THR B N   1 
ATOM   4669 C CA  . THR B 1 254 ? 123.929 -89.374  27.675  1.00 77.33  ? 178  THR B CA  1 
ATOM   4670 C C   . THR B 1 254 ? 124.853 -90.447  27.067  1.00 82.08  ? 178  THR B C   1 
ATOM   4671 O O   . THR B 1 254 ? 125.791 -90.880  27.736  1.00 83.63  ? 178  THR B O   1 
ATOM   4672 C CB  . THR B 1 254 ? 122.591 -89.973  28.135  1.00 89.08  ? 178  THR B CB  1 
ATOM   4673 O OG1 . THR B 1 254 ? 121.584 -88.957  28.216  1.00 92.39  ? 178  THR B OG1 1 
ATOM   4674 C CG2 . THR B 1 254 ? 122.712 -90.724  29.456  1.00 87.47  ? 178  THR B CG2 1 
ATOM   4675 N N   . PHE B 1 255 ? 124.608 -90.850  25.794  1.00 77.12  ? 179  PHE B N   1 
ATOM   4676 C CA  . PHE B 1 255 ? 125.444 -91.842  25.118  1.00 78.06  ? 179  PHE B CA  1 
ATOM   4677 C C   . PHE B 1 255 ? 126.810 -91.250  24.754  1.00 85.03  ? 179  PHE B C   1 
ATOM   4678 O O   . PHE B 1 255 ? 127.802 -91.977  24.725  1.00 86.91  ? 179  PHE B O   1 
ATOM   4679 C CB  . PHE B 1 255 ? 124.765 -92.421  23.860  1.00 78.40  ? 179  PHE B CB  1 
ATOM   4680 C CG  . PHE B 1 255 ? 125.142 -93.865  23.602  1.00 81.39  ? 179  PHE B CG  1 
ATOM   4681 C CD1 . PHE B 1 255 ? 124.266 -94.897  23.912  1.00 84.87  ? 179  PHE B CD1 1 
ATOM   4682 C CD2 . PHE B 1 255 ? 126.394 -94.196  23.088  1.00 85.59  ? 179  PHE B CD2 1 
ATOM   4683 C CE1 . PHE B 1 255 ? 124.628 -96.233  23.715  1.00 87.37  ? 179  PHE B CE1 1 
ATOM   4684 C CE2 . PHE B 1 255 ? 126.756 -95.532  22.887  1.00 89.92  ? 179  PHE B CE2 1 
ATOM   4685 C CZ  . PHE B 1 255 ? 125.869 -96.542  23.200  1.00 88.06  ? 179  PHE B CZ  1 
ATOM   4686 N N   . TYR B 1 256 ? 126.871 -89.942  24.481  1.00 81.41  ? 180  TYR B N   1 
ATOM   4687 C CA  . TYR B 1 256 ? 128.124 -89.307  24.100  1.00 82.78  ? 180  TYR B CA  1 
ATOM   4688 C C   . TYR B 1 256 ? 129.090 -89.129  25.289  1.00 88.53  ? 180  TYR B C   1 
ATOM   4689 O O   . TYR B 1 256 ? 130.295 -89.314  25.105  1.00 88.91  ? 180  TYR B O   1 
ATOM   4690 C CB  . TYR B 1 256 ? 127.873 -87.937  23.427  1.00 83.65  ? 180  TYR B CB  1 
ATOM   4691 C CG  . TYR B 1 256 ? 127.101 -87.942  22.115  1.00 84.27  ? 180  TYR B CG  1 
ATOM   4692 C CD1 . TYR B 1 256 ? 127.075 -89.068  21.295  1.00 85.84  ? 180  TYR B CD1 1 
ATOM   4693 C CD2 . TYR B 1 256 ? 126.441 -86.798  21.667  1.00 84.01  ? 180  TYR B CD2 1 
ATOM   4694 C CE1 . TYR B 1 256 ? 126.372 -89.070  20.090  1.00 85.32  ? 180  TYR B CE1 1 
ATOM   4695 C CE2 . TYR B 1 256 ? 125.754 -86.785  20.451  1.00 83.10  ? 180  TYR B CE2 1 
ATOM   4696 C CZ  . TYR B 1 256 ? 125.715 -87.927  19.671  1.00 90.00  ? 180  TYR B CZ  1 
ATOM   4697 O OH  . TYR B 1 256 ? 125.042 -87.933  18.475  1.00 91.03  ? 180  TYR B OH  1 
ATOM   4698 N N   . PHE B 1 257 ? 128.575 -88.789  26.493  1.00 85.83  ? 181  PHE B N   1 
ATOM   4699 C CA  . PHE B 1 257 ? 129.418 -88.458  27.640  1.00 88.43  ? 181  PHE B CA  1 
ATOM   4700 C C   . PHE B 1 257 ? 129.573 -89.532  28.729  1.00 94.12  ? 181  PHE B C   1 
ATOM   4701 O O   . PHE B 1 257 ? 130.662 -89.599  29.310  1.00 96.31  ? 181  PHE B O   1 
ATOM   4702 C CB  . PHE B 1 257 ? 128.914 -87.166  28.292  1.00 90.65  ? 181  PHE B CB  1 
ATOM   4703 C CG  . PHE B 1 257 ? 129.203 -85.963  27.434  1.00 92.46  ? 181  PHE B CG  1 
ATOM   4704 C CD1 . PHE B 1 257 ? 130.439 -85.328  27.494  1.00 98.70  ? 181  PHE B CD1 1 
ATOM   4705 C CD2 . PHE B 1 257 ? 128.262 -85.494  26.524  1.00 92.40  ? 181  PHE B CD2 1 
ATOM   4706 C CE1 . PHE B 1 257 ? 130.726 -84.246  26.660  1.00 100.16 ? 181  PHE B CE1 1 
ATOM   4707 C CE2 . PHE B 1 257 ? 128.547 -84.410  25.694  1.00 95.69  ? 181  PHE B CE2 1 
ATOM   4708 C CZ  . PHE B 1 257 ? 129.781 -83.800  25.760  1.00 96.77  ? 181  PHE B CZ  1 
ATOM   4709 N N   . ARG B 1 258 ? 128.524 -90.325  29.049  1.00 89.82  ? 182  ARG B N   1 
ATOM   4710 C CA  . ARG B 1 258 ? 128.614 -91.335  30.120  1.00 91.49  ? 182  ARG B CA  1 
ATOM   4711 C C   . ARG B 1 258 ? 129.741 -92.343  29.879  1.00 98.32  ? 182  ARG B C   1 
ATOM   4712 O O   . ARG B 1 258 ? 129.822 -92.926  28.803  1.00 97.65  ? 182  ARG B O   1 
ATOM   4713 C CB  . ARG B 1 258 ? 127.285 -92.095  30.305  1.00 89.40  ? 182  ARG B CB  1 
ATOM   4714 C CG  . ARG B 1 258 ? 126.226 -91.346  31.105  1.00 95.71  ? 182  ARG B CG  1 
ATOM   4715 C CD  . ARG B 1 258 ? 126.337 -91.569  32.599  1.00 102.64 ? 182  ARG B CD  1 
ATOM   4716 N NE  . ARG B 1 258 ? 125.621 -90.539  33.349  1.00 110.38 ? 182  ARG B NE  1 
ATOM   4717 C CZ  . ARG B 1 258 ? 125.721 -90.365  34.663  1.00 135.21 ? 182  ARG B CZ  1 
ATOM   4718 N NH1 . ARG B 1 258 ? 126.509 -91.146  35.385  1.00 127.64 ? 182  ARG B NH1 1 
ATOM   4719 N NH2 . ARG B 1 258 ? 125.034 -89.403  35.264  1.00 127.79 ? 182  ARG B NH2 1 
ATOM   4720 N N   . ASP B 1 259 ? 130.628 -92.512  30.875  1.00 97.32  ? 183  ASP B N   1 
ATOM   4721 C CA  . ASP B 1 259 ? 131.743 -93.468  30.858  1.00 98.70  ? 183  ASP B CA  1 
ATOM   4722 C C   . ASP B 1 259 ? 132.286 -93.733  32.272  1.00 105.10 ? 183  ASP B C   1 
ATOM   4723 O O   . ASP B 1 259 ? 132.105 -92.912  33.179  1.00 105.94 ? 183  ASP B O   1 
ATOM   4724 C CB  . ASP B 1 259 ? 132.893 -93.017  29.931  1.00 101.00 ? 183  ASP B CB  1 
ATOM   4725 C CG  . ASP B 1 259 ? 133.676 -94.195  29.368  1.00 111.06 ? 183  ASP B CG  1 
ATOM   4726 O OD1 . ASP B 1 259 ? 133.064 -95.271  29.161  1.00 110.67 ? 183  ASP B OD1 1 
ATOM   4727 O OD2 . ASP B 1 259 ? 134.902 -94.047  29.145  1.00 117.08 ? 183  ASP B OD2 1 
ATOM   4728 N N   . VAL B 1 260 ? 132.940 -94.901  32.444  1.00 102.51 ? 184  VAL B N   1 
ATOM   4729 C CA  . VAL B 1 260 ? 133.562 -95.333  33.693  1.00 105.26 ? 184  VAL B CA  1 
ATOM   4730 C C   . VAL B 1 260 ? 134.866 -94.537  33.855  1.00 111.58 ? 184  VAL B C   1 
ATOM   4731 O O   . VAL B 1 260 ? 135.743 -94.605  32.994  1.00 111.51 ? 184  VAL B O   1 
ATOM   4732 C CB  . VAL B 1 260 ? 133.767 -96.878  33.720  1.00 109.92 ? 184  VAL B CB  1 
ATOM   4733 C CG1 . VAL B 1 260 ? 134.815 -97.300  34.746  1.00 113.93 ? 184  VAL B CG1 1 
ATOM   4734 C CG2 . VAL B 1 260 ? 132.450 -97.595  33.988  1.00 108.41 ? 184  VAL B CG2 1 
ATOM   4735 N N   . ARG B 1 261 ? 134.963 -93.748  34.942  1.00 110.11 ? 185  ARG B N   1 
ATOM   4736 C CA  . ARG B 1 261 ? 136.123 -92.908  35.231  1.00 112.65 ? 185  ARG B CA  1 
ATOM   4737 C C   . ARG B 1 261 ? 136.585 -93.067  36.677  1.00 121.97 ? 185  ARG B C   1 
ATOM   4738 O O   . ARG B 1 261 ? 135.825 -93.516  37.538  1.00 121.75 ? 185  ARG B O   1 
ATOM   4739 C CB  . ARG B 1 261 ? 135.810 -91.428  34.932  1.00 110.23 ? 185  ARG B CB  1 
ATOM   4740 C CG  . ARG B 1 261 ? 136.629 -90.803  33.801  1.00 116.87 ? 185  ARG B CG  1 
ATOM   4741 C CD  . ARG B 1 261 ? 136.258 -91.356  32.434  1.00 117.82 ? 185  ARG B CD  1 
ATOM   4742 N NE  . ARG B 1 261 ? 136.758 -90.539  31.331  1.00 119.30 ? 185  ARG B NE  1 
ATOM   4743 C CZ  . ARG B 1 261 ? 137.021 -91.000  30.113  1.00 130.00 ? 185  ARG B CZ  1 
ATOM   4744 N NH1 . ARG B 1 261 ? 137.463 -90.178  29.168  1.00 116.61 ? 185  ARG B NH1 1 
ATOM   4745 N NH2 . ARG B 1 261 ? 136.872 -92.288  29.838  1.00 114.06 ? 185  ARG B NH2 1 
ATOM   4746 N N   . THR B 1 262 ? 137.854 -92.689  36.931  1.00 123.11 ? 186  THR B N   1 
ATOM   4747 C CA  . THR B 1 262 ? 138.501 -92.777  38.236  1.00 127.81 ? 186  THR B CA  1 
ATOM   4748 C C   . THR B 1 262 ? 138.548 -91.379  38.878  1.00 133.76 ? 186  THR B C   1 
ATOM   4749 O O   . THR B 1 262 ? 139.271 -90.502  38.407  1.00 134.26 ? 186  THR B O   1 
ATOM   4750 C CB  . THR B 1 262 ? 139.902 -93.419  38.102  1.00 140.16 ? 186  THR B CB  1 
ATOM   4751 O OG1 . THR B 1 262 ? 140.784 -92.509  37.439  1.00 142.67 ? 186  THR B OG1 1 
ATOM   4752 C CG2 . THR B 1 262 ? 139.886 -94.735  37.329  1.00 136.80 ? 186  THR B CG2 1 
ATOM   4753 N N   . ILE B 1 263 ? 137.741 -91.179  39.939  1.00 131.01 ? 187  ILE B N   1 
ATOM   4754 C CA  . ILE B 1 263 ? 137.683 -89.926  40.689  1.00 132.73 ? 187  ILE B CA  1 
ATOM   4755 C C   . ILE B 1 263 ? 138.821 -89.922  41.704  1.00 142.26 ? 187  ILE B C   1 
ATOM   4756 O O   . ILE B 1 263 ? 138.698 -90.569  42.742  1.00 144.80 ? 187  ILE B O   1 
ATOM   4757 C CB  . ILE B 1 263 ? 136.300 -89.751  41.361  1.00 134.42 ? 187  ILE B CB  1 
ATOM   4758 N N   . GLU B 1 264 ? 139.939 -89.224  41.395  1.00 140.32 ? 188  GLU B N   1 
ATOM   4759 C CA  . GLU B 1 264 ? 141.138 -89.155  42.243  1.00 145.35 ? 188  GLU B CA  1 
ATOM   4760 C C   . GLU B 1 264 ? 140.844 -88.625  43.655  1.00 152.90 ? 188  GLU B C   1 
ATOM   4761 O O   . GLU B 1 264 ? 141.517 -89.036  44.608  1.00 156.79 ? 188  GLU B O   1 
ATOM   4762 C CB  . GLU B 1 264 ? 142.221 -88.302  41.574  1.00 147.92 ? 188  GLU B CB  1 
ATOM   4763 N N   . TYR B 1 265 ? 139.834 -87.727  43.786  1.00 147.88 ? 189  TYR B N   1 
ATOM   4764 C CA  . TYR B 1 265 ? 139.389 -87.120  45.046  1.00 150.53 ? 189  TYR B CA  1 
ATOM   4765 C C   . TYR B 1 265 ? 138.918 -88.176  46.056  1.00 155.41 ? 189  TYR B C   1 
ATOM   4766 O O   . TYR B 1 265 ? 139.240 -88.063  47.239  1.00 160.08 ? 189  TYR B O   1 
ATOM   4767 C CB  . TYR B 1 265 ? 138.253 -86.115  44.770  1.00 148.39 ? 189  TYR B CB  1 
ATOM   4768 N N   . LEU B 1 266 ? 138.184 -89.216  45.583  1.00 147.54 ? 190  LEU B N   1 
ATOM   4769 C CA  . LEU B 1 266 ? 137.651 -90.295  46.421  1.00 148.40 ? 190  LEU B CA  1 
ATOM   4770 C C   . LEU B 1 266 ? 138.338 -91.666  46.191  1.00 153.27 ? 190  LEU B C   1 
ATOM   4771 O O   . LEU B 1 266 ? 138.119 -92.596  46.968  1.00 155.60 ? 190  LEU B O   1 
ATOM   4772 C CB  . LEU B 1 266 ? 136.141 -90.431  46.199  1.00 144.05 ? 190  LEU B CB  1 
ATOM   4773 N N   . GLY B 1 267 ? 139.155 -91.765  45.145  1.00 147.58 ? 191  GLY B N   1 
ATOM   4774 C CA  . GLY B 1 267 ? 139.860 -92.990  44.756  1.00 147.57 ? 191  GLY B CA  1 
ATOM   4775 C C   . GLY B 1 267 ? 138.920 -94.130  44.401  1.00 147.43 ? 191  GLY B C   1 
ATOM   4776 O O   . GLY B 1 267 ? 139.106 -95.250  44.882  1.00 148.95 ? 191  GLY B O   1 
ATOM   4777 N N   . VAL B 1 268 ? 137.912 -93.863  43.544  1.00 138.95 ? 192  VAL B N   1 
ATOM   4778 C CA  . VAL B 1 268 ? 136.888 -94.853  43.169  1.00 135.28 ? 192  VAL B CA  1 
ATOM   4779 C C   . VAL B 1 268 ? 136.609 -94.880  41.626  1.00 133.42 ? 192  VAL B C   1 
ATOM   4780 O O   . VAL B 1 268 ? 136.941 -93.913  40.949  1.00 131.21 ? 192  VAL B O   1 
ATOM   4781 C CB  . VAL B 1 268 ? 135.608 -94.545  43.999  1.00 138.48 ? 192  VAL B CB  1 
ATOM   4782 C CG1 . VAL B 1 268 ? 134.898 -93.270  43.541  1.00 134.71 ? 192  VAL B CG1 1 
ATOM   4783 C CG2 . VAL B 1 268 ? 134.670 -95.725  44.038  1.00 137.07 ? 192  VAL B CG2 1 
ATOM   4784 N N   . ASN B 1 269 ? 136.036 -95.998  41.092  1.00 128.15 ? 193  ASN B N   1 
ATOM   4785 C CA  . ASN B 1 269 ? 135.639 -96.153  39.678  1.00 124.06 ? 193  ASN B CA  1 
ATOM   4786 C C   . ASN B 1 269 ? 134.139 -95.909  39.534  1.00 125.95 ? 193  ASN B C   1 
ATOM   4787 O O   . ASN B 1 269 ? 133.334 -96.781  39.870  1.00 125.86 ? 193  ASN B O   1 
ATOM   4788 C CB  . ASN B 1 269 ? 136.012 -97.517  39.102  1.00 125.15 ? 193  ASN B CB  1 
ATOM   4789 C CG  . ASN B 1 269 ? 137.438 -97.631  38.633  1.00 158.84 ? 193  ASN B CG  1 
ATOM   4790 O OD1 . ASN B 1 269 ? 138.337 -96.938  39.110  1.00 161.96 ? 193  ASN B OD1 1 
ATOM   4791 N ND2 . ASN B 1 269 ? 137.688 -98.578  37.749  1.00 150.09 ? 193  ASN B ND2 1 
ATOM   4792 N N   . ALA B 1 270 ? 133.770 -94.718  39.043  1.00 120.57 ? 194  ALA B N   1 
ATOM   4793 C CA  . ALA B 1 270 ? 132.372 -94.362  38.921  1.00 117.66 ? 194  ALA B CA  1 
ATOM   4794 C C   . ALA B 1 270 ? 131.943 -94.114  37.481  1.00 118.40 ? 194  ALA B C   1 
ATOM   4795 O O   . ALA B 1 270 ? 132.725 -93.644  36.655  1.00 116.65 ? 194  ALA B O   1 
ATOM   4796 C CB  . ALA B 1 270 ? 132.086 -93.138  39.770  1.00 119.51 ? 194  ALA B CB  1 
ATOM   4797 N N   . CYS B 1 271 ? 130.665 -94.447  37.209  1.00 114.15 ? 195  CYS B N   1 
ATOM   4798 C CA  . CYS B 1 271 ? 129.948 -94.247  35.947  1.00 110.79 ? 195  CYS B CA  1 
ATOM   4799 C C   . CYS B 1 271 ? 129.442 -92.800  35.976  1.00 112.03 ? 195  CYS B C   1 
ATOM   4800 O O   . CYS B 1 271 ? 128.510 -92.492  36.716  1.00 111.66 ? 195  CYS B O   1 
ATOM   4801 C CB  . CYS B 1 271 ? 128.816 -95.270  35.815  1.00 110.35 ? 195  CYS B CB  1 
ATOM   4802 S SG  . CYS B 1 271 ? 127.771 -95.076  34.341  1.00 110.14 ? 195  CYS B SG  1 
ATOM   4803 N N   . ILE B 1 272 ? 130.153 -91.891  35.279  1.00 107.00 ? 196  ILE B N   1 
ATOM   4804 C CA  . ILE B 1 272 ? 129.865 -90.448  35.283  1.00 105.77 ? 196  ILE B CA  1 
ATOM   4805 C C   . ILE B 1 272 ? 129.891 -89.831  33.875  1.00 107.29 ? 196  ILE B C   1 
ATOM   4806 O O   . ILE B 1 272 ? 130.387 -90.454  32.936  1.00 106.17 ? 196  ILE B O   1 
ATOM   4807 C CB  . ILE B 1 272 ? 130.864 -89.684  36.211  1.00 112.13 ? 196  ILE B CB  1 
ATOM   4808 C CG1 . ILE B 1 272 ? 132.346 -89.992  35.882  1.00 114.02 ? 196  ILE B CG1 1 
ATOM   4809 C CG2 . ILE B 1 272 ? 130.561 -89.916  37.687  1.00 115.94 ? 196  ILE B CG2 1 
ATOM   4810 C CD1 . ILE B 1 272 ? 133.051 -88.903  35.178  1.00 117.71 ? 196  ILE B CD1 1 
ATOM   4811 N N   . MET B 1 273 ? 129.412 -88.568  33.760  1.00 102.61 ? 197  MET B N   1 
ATOM   4812 C CA  . MET B 1 273 ? 129.420 -87.782  32.520  1.00 100.25 ? 197  MET B CA  1 
ATOM   4813 C C   . MET B 1 273 ? 130.843 -87.229  32.304  1.00 106.01 ? 197  MET B C   1 
ATOM   4814 O O   . MET B 1 273 ? 131.206 -86.193  32.872  1.00 107.60 ? 197  MET B O   1 
ATOM   4815 C CB  . MET B 1 273 ? 128.365 -86.655  32.567  1.00 101.16 ? 197  MET B CB  1 
ATOM   4816 C CG  . MET B 1 273 ? 126.929 -87.153  32.571  1.00 102.41 ? 197  MET B CG  1 
ATOM   4817 S SD  . MET B 1 273 ? 126.387 -87.811  30.978  1.00 103.17 ? 197  MET B SD  1 
ATOM   4818 C CE  . MET B 1 273 ? 125.763 -86.338  30.210  1.00 98.08  ? 197  MET B CE  1 
ATOM   4819 N N   . ALA B 1 274 ? 131.651 -87.955  31.509  1.00 102.11 ? 198  ALA B N   1 
ATOM   4820 C CA  . ALA B 1 274 ? 133.057 -87.660  31.249  1.00 104.09 ? 198  ALA B CA  1 
ATOM   4821 C C   . ALA B 1 274 ? 133.248 -86.473  30.290  1.00 107.85 ? 198  ALA B C   1 
ATOM   4822 O O   . ALA B 1 274 ? 133.699 -86.653  29.155  1.00 106.72 ? 198  ALA B O   1 
ATOM   4823 C CB  . ALA B 1 274 ? 133.744 -88.903  30.707  1.00 104.98 ? 198  ALA B CB  1 
ATOM   4824 N N   . PHE B 1 275 ? 132.935 -85.251  30.769  1.00 105.65 ? 199  PHE B N   1 
ATOM   4825 C CA  . PHE B 1 275 ? 133.052 -84.020  29.986  1.00 105.46 ? 199  PHE B CA  1 
ATOM   4826 C C   . PHE B 1 275 ? 134.522 -83.641  29.766  1.00 112.52 ? 199  PHE B C   1 
ATOM   4827 O O   . PHE B 1 275 ? 135.344 -83.948  30.629  1.00 115.08 ? 199  PHE B O   1 
ATOM   4828 C CB  . PHE B 1 275 ? 132.313 -82.863  30.684  1.00 107.59 ? 199  PHE B CB  1 
ATOM   4829 N N   . PRO B 1 276 ? 134.876 -82.948  28.651  1.00 108.76 ? 200  PRO B N   1 
ATOM   4830 C CA  . PRO B 1 276 ? 136.284 -82.550  28.455  1.00 111.39 ? 200  PRO B CA  1 
ATOM   4831 C C   . PRO B 1 276 ? 136.749 -81.484  29.461  1.00 117.55 ? 200  PRO B C   1 
ATOM   4832 O O   . PRO B 1 276 ? 135.932 -80.676  29.891  1.00 116.32 ? 200  PRO B O   1 
ATOM   4833 C CB  . PRO B 1 276 ? 136.294 -81.984  27.027  1.00 112.02 ? 200  PRO B CB  1 
ATOM   4834 C CG  . PRO B 1 276 ? 134.902 -81.543  26.771  1.00 113.80 ? 200  PRO B CG  1 
ATOM   4835 C CD  . PRO B 1 276 ? 134.030 -82.507  27.516  1.00 107.63 ? 200  PRO B CD  1 
ATOM   4836 N N   . PRO B 1 277 ? 138.078 -81.357  29.732  1.00 117.27 ? 201  PRO B N   1 
ATOM   4837 C CA  . PRO B 1 277 ? 138.554 -80.306  30.658  1.00 123.12 ? 201  PRO B CA  1 
ATOM   4838 C C   . PRO B 1 277 ? 138.218 -78.881  30.212  1.00 151.15 ? 201  PRO B C   1 
ATOM   4839 O O   . PRO B 1 277 ? 137.666 -78.103  30.987  1.00 111.12 ? 201  PRO B O   1 
ATOM   4840 C CB  . PRO B 1 277 ? 140.073 -80.505  30.658  1.00 128.13 ? 201  PRO B CB  1 
ATOM   4841 C CG  . PRO B 1 277 ? 140.366 -81.244  29.386  1.00 129.61 ? 201  PRO B CG  1 
ATOM   4842 C CD  . PRO B 1 277 ? 139.209 -82.179  29.258  1.00 120.56 ? 201  PRO B CD  1 
ATOM   4843 N N   . TYR B 1 280 ? 134.978 -78.231  31.752  1.00 138.79 ? 204  TYR B N   1 
ATOM   4844 C CA  . TYR B 1 280 ? 134.187 -79.193  32.517  1.00 136.88 ? 204  TYR B CA  1 
ATOM   4845 C C   . TYR B 1 280 ? 133.042 -78.496  33.262  1.00 139.81 ? 204  TYR B C   1 
ATOM   4846 O O   . TYR B 1 280 ? 131.935 -79.038  33.300  1.00 136.53 ? 204  TYR B O   1 
ATOM   4847 C CB  . TYR B 1 280 ? 135.072 -79.978  33.513  1.00 141.05 ? 204  TYR B CB  1 
ATOM   4848 C CG  . TYR B 1 280 ? 134.402 -81.204  34.101  1.00 141.17 ? 204  TYR B CG  1 
ATOM   4849 C CD1 . TYR B 1 280 ? 133.629 -81.116  35.255  1.00 143.67 ? 204  TYR B CD1 1 
ATOM   4850 C CD2 . TYR B 1 280 ? 134.559 -82.457  33.515  1.00 140.32 ? 204  TYR B CD2 1 
ATOM   4851 C CE1 . TYR B 1 280 ? 132.995 -82.238  35.790  1.00 143.34 ? 204  TYR B CE1 1 
ATOM   4852 C CE2 . TYR B 1 280 ? 133.930 -83.586  34.039  1.00 140.14 ? 204  TYR B CE2 1 
ATOM   4853 C CZ  . TYR B 1 280 ? 133.151 -83.473  35.181  1.00 148.77 ? 204  TYR B CZ  1 
ATOM   4854 O OH  . TYR B 1 280 ? 132.529 -84.585  35.701  1.00 149.55 ? 204  TYR B OH  1 
ATOM   4855 N N   . ALA B 1 281 ? 133.317 -77.326  33.882  1.00 138.96 ? 205  ALA B N   1 
ATOM   4856 C CA  . ALA B 1 281 ? 132.330 -76.548  34.638  1.00 138.62 ? 205  ALA B CA  1 
ATOM   4857 C C   . ALA B 1 281 ? 131.229 -76.013  33.717  1.00 138.29 ? 205  ALA B C   1 
ATOM   4858 O O   . ALA B 1 281 ? 130.054 -76.056  34.084  1.00 135.89 ? 205  ALA B O   1 
ATOM   4859 C CB  . ALA B 1 281 ? 133.012 -75.402  35.368  1.00 143.88 ? 205  ALA B CB  1 
ATOM   4860 N N   . GLN B 1 282 ? 131.617 -75.541  32.515  1.00 134.00 ? 206  GLN B N   1 
ATOM   4861 C CA  . GLN B 1 282 ? 130.732 -75.011  31.474  1.00 130.89 ? 206  GLN B CA  1 
ATOM   4862 C C   . GLN B 1 282 ? 129.752 -76.100  30.988  1.00 128.08 ? 206  GLN B C   1 
ATOM   4863 O O   . GLN B 1 282 ? 128.551 -75.838  30.862  1.00 125.55 ? 206  GLN B O   1 
ATOM   4864 C CB  . GLN B 1 282 ? 131.582 -74.450  30.303  1.00 133.55 ? 206  GLN B CB  1 
ATOM   4865 C CG  . GLN B 1 282 ? 130.814 -74.088  29.023  1.00 152.28 ? 206  GLN B CG  1 
ATOM   4866 C CD  . GLN B 1 282 ? 131.401 -72.913  28.276  1.00 179.98 ? 206  GLN B CD  1 
ATOM   4867 O OE1 . GLN B 1 282 ? 130.801 -71.836  28.216  1.00 176.67 ? 206  GLN B OE1 1 
ATOM   4868 N NE2 . GLN B 1 282 ? 132.571 -73.083  27.659  1.00 176.42 ? 206  GLN B NE2 1 
ATOM   4869 N N   . TRP B 1 283 ? 130.271 -77.321  30.760  1.00 121.50 ? 207  TRP B N   1 
ATOM   4870 C CA  . TRP B 1 283 ? 129.506 -78.477  30.302  1.00 116.63 ? 207  TRP B CA  1 
ATOM   4871 C C   . TRP B 1 283 ? 128.497 -78.963  31.338  1.00 117.10 ? 207  TRP B C   1 
ATOM   4872 O O   . TRP B 1 283 ? 127.376 -79.292  30.964  1.00 113.63 ? 207  TRP B O   1 
ATOM   4873 C CB  . TRP B 1 283 ? 130.442 -79.623  29.913  1.00 115.28 ? 207  TRP B CB  1 
ATOM   4874 C CG  . TRP B 1 283 ? 130.730 -79.671  28.445  1.00 114.66 ? 207  TRP B CG  1 
ATOM   4875 C CD1 . TRP B 1 283 ? 131.896 -79.333  27.828  1.00 119.45 ? 207  TRP B CD1 1 
ATOM   4876 C CD2 . TRP B 1 283 ? 129.820 -80.051  27.407  1.00 111.16 ? 207  TRP B CD2 1 
ATOM   4877 N NE1 . TRP B 1 283 ? 131.779 -79.504  26.469  1.00 116.86 ? 207  TRP B NE1 1 
ATOM   4878 C CE2 . TRP B 1 283 ? 130.513 -79.941  26.183  1.00 115.02 ? 207  TRP B CE2 1 
ATOM   4879 C CE3 . TRP B 1 283 ? 128.486 -80.500  27.394  1.00 109.58 ? 207  TRP B CE3 1 
ATOM   4880 C CZ2 . TRP B 1 283 ? 129.917 -80.245  24.959  1.00 111.82 ? 207  TRP B CZ2 1 
ATOM   4881 C CZ3 . TRP B 1 283 ? 127.894 -80.798  26.177  1.00 108.53 ? 207  TRP B CZ3 1 
ATOM   4882 C CH2 . TRP B 1 283 ? 128.603 -80.661  24.978  1.00 109.31 ? 207  TRP B CH2 1 
ATOM   4883 N N   . SER B 1 284 ? 128.884 -79.008  32.626  1.00 115.00 ? 208  SER B N   1 
ATOM   4884 C CA  . SER B 1 284 ? 128.009 -79.440  33.719  1.00 114.06 ? 208  SER B CA  1 
ATOM   4885 C C   . SER B 1 284 ? 126.835 -78.473  33.898  1.00 116.21 ? 208  SER B C   1 
ATOM   4886 O O   . SER B 1 284 ? 125.722 -78.931  34.147  1.00 113.39 ? 208  SER B O   1 
ATOM   4887 C CB  . SER B 1 284 ? 128.791 -79.574  35.019  1.00 120.59 ? 208  SER B CB  1 
ATOM   4888 O OG  . SER B 1 284 ? 129.803 -80.557  34.890  1.00 129.22 ? 208  SER B OG  1 
ATOM   4889 N N   . ALA B 1 285 ? 127.076 -77.151  33.721  1.00 113.95 ? 209  ALA B N   1 
ATOM   4890 C CA  . ALA B 1 285 ? 126.054 -76.102  33.815  1.00 113.04 ? 209  ALA B CA  1 
ATOM   4891 C C   . ALA B 1 285 ? 125.120 -76.140  32.595  1.00 112.78 ? 209  ALA B C   1 
ATOM   4892 O O   . ALA B 1 285 ? 123.904 -76.036  32.768  1.00 111.35 ? 209  ALA B O   1 
ATOM   4893 C CB  . ALA B 1 285 ? 126.706 -74.733  33.945  1.00 116.92 ? 209  ALA B CB  1 
ATOM   4894 N N   . GLY B 1 286 ? 125.695 -76.321  31.397  1.00 107.17 ? 210  GLY B N   1 
ATOM   4895 C CA  . GLY B 1 286 ? 124.968 -76.419  30.133  1.00 103.38 ? 210  GLY B CA  1 
ATOM   4896 C C   . GLY B 1 286 ? 124.055 -77.628  30.050  1.00 103.89 ? 210  GLY B C   1 
ATOM   4897 O O   . GLY B 1 286 ? 122.917 -77.506  29.590  1.00 101.82 ? 210  GLY B O   1 
ATOM   4898 N N   . ILE B 1 287 ? 124.541 -78.799  30.522  1.00 100.10 ? 211  ILE B N   1 
ATOM   4899 C CA  . ILE B 1 287 ? 123.789 -80.060  30.543  1.00 97.67  ? 211  ILE B CA  1 
ATOM   4900 C C   . ILE B 1 287 ? 122.705 -80.002  31.641  1.00 103.31 ? 211  ILE B C   1 
ATOM   4901 O O   . ILE B 1 287 ? 121.590 -80.484  31.399  1.00 100.72 ? 211  ILE B O   1 
ATOM   4902 C CB  . ILE B 1 287 ? 124.728 -81.306  30.670  1.00 100.81 ? 211  ILE B CB  1 
ATOM   4903 C CG1 . ILE B 1 287 ? 125.563 -81.530  29.363  1.00 100.21 ? 211  ILE B CG1 1 
ATOM   4904 C CG2 . ILE B 1 287 ? 123.971 -82.603  31.090  1.00 99.63  ? 211  ILE B CG2 1 
ATOM   4905 C CD1 . ILE B 1 287 ? 124.774 -81.755  27.986  1.00 100.96 ? 211  ILE B CD1 1 
ATOM   4906 N N   . ALA B 1 288 ? 123.006 -79.389  32.819  1.00 103.65 ? 212  ALA B N   1 
ATOM   4907 C CA  . ALA B 1 288 ? 122.029 -79.244  33.917  1.00 104.20 ? 212  ALA B CA  1 
ATOM   4908 C C   . ALA B 1 288 ? 120.823 -78.417  33.461  1.00 105.72 ? 212  ALA B C   1 
ATOM   4909 O O   . ALA B 1 288 ? 119.687 -78.762  33.793  1.00 104.31 ? 212  ALA B O   1 
ATOM   4910 C CB  . ALA B 1 288 ? 122.673 -78.603  35.136  1.00 108.69 ? 212  ALA B CB  1 
ATOM   4911 N N   . LEU B 1 289 ? 121.085 -77.358  32.661  1.00 101.36 ? 213  LEU B N   1 
ATOM   4912 C CA  . LEU B 1 289 ? 120.099 -76.462  32.062  1.00 99.31  ? 213  LEU B CA  1 
ATOM   4913 C C   . LEU B 1 289 ? 119.236 -77.201  31.032  1.00 97.48  ? 213  LEU B C   1 
ATOM   4914 O O   . LEU B 1 289 ? 118.040 -76.946  30.983  1.00 95.79  ? 213  LEU B O   1 
ATOM   4915 C CB  . LEU B 1 289 ? 120.814 -75.266  31.413  1.00 100.90 ? 213  LEU B CB  1 
ATOM   4916 C CG  . LEU B 1 289 ? 120.725 -73.918  32.150  1.00 108.83 ? 213  LEU B CG  1 
ATOM   4917 C CD1 . LEU B 1 289 ? 121.441 -73.948  33.499  1.00 112.14 ? 213  LEU B CD1 1 
ATOM   4918 C CD2 . LEU B 1 289 ? 121.312 -72.801  31.307  1.00 113.16 ? 213  LEU B CD2 1 
ATOM   4919 N N   . MET B 1 290 ? 119.820 -78.138  30.248  1.00 91.53  ? 214  MET B N   1 
ATOM   4920 C CA  . MET B 1 290 ? 119.085 -78.935  29.253  1.00 88.11  ? 214  MET B CA  1 
ATOM   4921 C C   . MET B 1 290 ? 118.159 -79.963  29.922  1.00 89.89  ? 214  MET B C   1 
ATOM   4922 O O   . MET B 1 290 ? 117.134 -80.314  29.340  1.00 87.73  ? 214  MET B O   1 
ATOM   4923 C CB  . MET B 1 290 ? 120.042 -79.644  28.285  1.00 89.84  ? 214  MET B CB  1 
ATOM   4924 N N   . LYS B 1 291 ? 118.517 -80.440  31.133  1.00 87.21  ? 215  LYS B N   1 
ATOM   4925 C CA  . LYS B 1 291 ? 117.724 -81.388  31.924  1.00 86.69  ? 215  LYS B CA  1 
ATOM   4926 C C   . LYS B 1 291 ? 116.398 -80.752  32.390  1.00 90.66  ? 215  LYS B C   1 
ATOM   4927 O O   . LYS B 1 291 ? 115.369 -81.428  32.386  1.00 89.19  ? 215  LYS B O   1 
ATOM   4928 C CB  . LYS B 1 291 ? 118.533 -81.879  33.141  1.00 91.35  ? 215  LYS B CB  1 
ATOM   4929 N N   . ASN B 1 292 ? 116.433 -79.451  32.779  1.00 88.41  ? 216  ASN B N   1 
ATOM   4930 C CA  . ASN B 1 292 ? 115.287 -78.676  33.273  1.00 88.18  ? 216  ASN B CA  1 
ATOM   4931 C C   . ASN B 1 292 ? 114.340 -78.232  32.154  1.00 90.56  ? 216  ASN B C   1 
ATOM   4932 O O   . ASN B 1 292 ? 113.127 -78.321  32.332  1.00 90.63  ? 216  ASN B O   1 
ATOM   4933 C CB  . ASN B 1 292 ? 115.745 -77.430  34.044  1.00 89.16  ? 216  ASN B CB  1 
ATOM   4934 C CG  . ASN B 1 292 ? 116.555 -77.678  35.288  1.00 108.06 ? 216  ASN B CG  1 
ATOM   4935 O OD1 . ASN B 1 292 ? 117.508 -76.950  35.568  1.00 101.30 ? 216  ASN B OD1 1 
ATOM   4936 N ND2 . ASN B 1 292 ? 116.171 -78.655  36.100  1.00 99.16  ? 216  ASN B ND2 1 
ATOM   4937 N N   . ILE B 1 293 ? 114.880 -77.718  31.033  1.00 85.03  ? 217  ILE B N   1 
ATOM   4938 C CA  . ILE B 1 293 ? 114.086 -77.223  29.911  1.00 82.66  ? 217  ILE B CA  1 
ATOM   4939 C C   . ILE B 1 293 ? 113.307 -78.374  29.247  1.00 82.43  ? 217  ILE B C   1 
ATOM   4940 O O   . ILE B 1 293 ? 112.082 -78.303  29.170  1.00 80.63  ? 217  ILE B O   1 
ATOM   4941 C CB  . ILE B 1 293 ? 114.982 -76.448  28.896  1.00 86.31  ? 217  ILE B CB  1 
ATOM   4942 C CG1 . ILE B 1 293 ? 115.757 -75.258  29.554  1.00 89.42  ? 217  ILE B CG1 1 
ATOM   4943 C CG2 . ILE B 1 293 ? 114.205 -75.991  27.655  1.00 85.80  ? 217  ILE B CG2 1 
ATOM   4944 C CD1 . ILE B 1 293 ? 114.939 -74.204  30.408  1.00 97.50  ? 217  ILE B CD1 1 
ATOM   4945 N N   . LEU B 1 294 ? 114.007 -79.426  28.796  1.00 77.94  ? 218  LEU B N   1 
ATOM   4946 C CA  . LEU B 1 294 ? 113.404 -80.566  28.100  1.00 75.87  ? 218  LEU B CA  1 
ATOM   4947 C C   . LEU B 1 294 ? 112.611 -81.507  28.997  1.00 79.11  ? 218  LEU B C   1 
ATOM   4948 O O   . LEU B 1 294 ? 111.670 -82.141  28.518  1.00 77.64  ? 218  LEU B O   1 
ATOM   4949 C CB  . LEU B 1 294 ? 114.484 -81.386  27.386  1.00 75.55  ? 218  LEU B CB  1 
ATOM   4950 C CG  . LEU B 1 294 ? 114.800 -80.991  25.947  1.00 79.37  ? 218  LEU B CG  1 
ATOM   4951 C CD1 . LEU B 1 294 ? 116.117 -81.606  25.503  1.00 79.96  ? 218  LEU B CD1 1 
ATOM   4952 C CD2 . LEU B 1 294 ? 113.673 -81.401  24.991  1.00 79.47  ? 218  LEU B CD2 1 
ATOM   4953 N N   . GLY B 1 295 ? 113.021 -81.632  30.257  1.00 76.41  ? 219  GLY B N   1 
ATOM   4954 C CA  . GLY B 1 295 ? 112.399 -82.551  31.202  1.00 76.44  ? 219  GLY B CA  1 
ATOM   4955 C C   . GLY B 1 295 ? 111.394 -81.973  32.175  1.00 81.03  ? 219  GLY B C   1 
ATOM   4956 O O   . GLY B 1 295 ? 110.695 -82.747  32.832  1.00 80.94  ? 219  GLY B O   1 
ATOM   4957 N N   . PHE B 1 296 ? 111.307 -80.628  32.301  1.00 78.61  ? 220  PHE B N   1 
ATOM   4958 C CA  . PHE B 1 296 ? 110.361 -80.035  33.250  1.00 80.11  ? 220  PHE B CA  1 
ATOM   4959 C C   . PHE B 1 296 ? 109.660 -78.775  32.725  1.00 82.17  ? 220  PHE B C   1 
ATOM   4960 O O   . PHE B 1 296 ? 108.432 -78.739  32.761  1.00 80.82  ? 220  PHE B O   1 
ATOM   4961 C CB  . PHE B 1 296 ? 111.041 -79.729  34.595  1.00 85.29  ? 220  PHE B CB  1 
ATOM   4962 C CG  . PHE B 1 296 ? 110.091 -79.430  35.735  1.00 89.36  ? 220  PHE B CG  1 
ATOM   4963 C CD1 . PHE B 1 296 ? 109.436 -80.458  36.405  1.00 93.38  ? 220  PHE B CD1 1 
ATOM   4964 C CD2 . PHE B 1 296 ? 109.877 -78.122  36.160  1.00 93.31  ? 220  PHE B CD2 1 
ATOM   4965 C CE1 . PHE B 1 296 ? 108.567 -80.181  37.465  1.00 96.31  ? 220  PHE B CE1 1 
ATOM   4966 C CE2 . PHE B 1 296 ? 109.006 -77.847  37.219  1.00 97.83  ? 220  PHE B CE2 1 
ATOM   4967 C CZ  . PHE B 1 296 ? 108.358 -78.879  37.863  1.00 96.48  ? 220  PHE B CZ  1 
ATOM   4968 N N   . ILE B 1 297 ? 110.414 -77.754  32.263  1.00 78.57  ? 221  ILE B N   1 
ATOM   4969 C CA  . ILE B 1 297 ? 109.863 -76.478  31.795  1.00 78.37  ? 221  ILE B CA  1 
ATOM   4970 C C   . ILE B 1 297 ? 108.872 -76.697  30.642  1.00 79.64  ? 221  ILE B C   1 
ATOM   4971 O O   . ILE B 1 297 ? 107.683 -76.444  30.838  1.00 79.57  ? 221  ILE B O   1 
ATOM   4972 C CB  . ILE B 1 297 ? 110.977 -75.451  31.425  1.00 82.64  ? 221  ILE B CB  1 
ATOM   4973 C CG1 . ILE B 1 297 ? 111.939 -75.164  32.614  1.00 86.04  ? 221  ILE B CG1 1 
ATOM   4974 C CG2 . ILE B 1 297 ? 110.414 -74.146  30.824  1.00 83.39  ? 221  ILE B CG2 1 
ATOM   4975 C CD1 . ILE B 1 297 ? 111.282 -74.794  34.011  1.00 98.10  ? 221  ILE B CD1 1 
ATOM   4976 N N   . ILE B 1 298 ? 109.348 -77.164  29.465  1.00 73.92  ? 222  ILE B N   1 
ATOM   4977 C CA  . ILE B 1 298 ? 108.510 -77.389  28.278  1.00 71.61  ? 222  ILE B CA  1 
ATOM   4978 C C   . ILE B 1 298 ? 107.374 -78.360  28.625  1.00 75.46  ? 222  ILE B C   1 
ATOM   4979 O O   . ILE B 1 298 ? 106.230 -77.980  28.393  1.00 74.63  ? 222  ILE B O   1 
ATOM   4980 C CB  . ILE B 1 298 ? 109.312 -77.825  27.020  1.00 72.90  ? 222  ILE B CB  1 
ATOM   4981 C CG1 . ILE B 1 298 ? 110.140 -76.635  26.479  1.00 73.95  ? 222  ILE B CG1 1 
ATOM   4982 C CG2 . ILE B 1 298 ? 108.392 -78.402  25.933  1.00 71.36  ? 222  ILE B CG2 1 
ATOM   4983 C CD1 . ILE B 1 298 ? 111.261 -76.989  25.530  1.00 81.04  ? 222  ILE B CD1 1 
ATOM   4984 N N   . PRO B 1 299 ? 107.609 -79.545  29.242  1.00 72.82  ? 223  PRO B N   1 
ATOM   4985 C CA  . PRO B 1 299 ? 106.475 -80.417  29.578  1.00 72.53  ? 223  PRO B CA  1 
ATOM   4986 C C   . PRO B 1 299 ? 105.454 -79.721  30.482  1.00 77.52  ? 223  PRO B C   1 
ATOM   4987 O O   . PRO B 1 299 ? 104.283 -79.702  30.114  1.00 77.00  ? 223  PRO B O   1 
ATOM   4988 C CB  . PRO B 1 299 ? 107.136 -81.609  30.271  1.00 74.90  ? 223  PRO B CB  1 
ATOM   4989 C CG  . PRO B 1 299 ? 108.518 -81.625  29.741  1.00 78.93  ? 223  PRO B CG  1 
ATOM   4990 C CD  . PRO B 1 299 ? 108.888 -80.189  29.610  1.00 74.98  ? 223  PRO B CD  1 
ATOM   4991 N N   . LEU B 1 300 ? 105.894 -79.076  31.591  1.00 75.34  ? 224  LEU B N   1 
ATOM   4992 C CA  . LEU B 1 300 ? 104.993 -78.392  32.525  1.00 76.83  ? 224  LEU B CA  1 
ATOM   4993 C C   . LEU B 1 300 ? 104.181 -77.277  31.851  1.00 80.50  ? 224  LEU B C   1 
ATOM   4994 O O   . LEU B 1 300 ? 103.032 -77.092  32.241  1.00 81.60  ? 224  LEU B O   1 
ATOM   4995 C CB  . LEU B 1 300 ? 105.742 -77.838  33.751  1.00 79.35  ? 224  LEU B CB  1 
ATOM   4996 C CG  . LEU B 1 300 ? 104.981 -77.701  35.092  1.00 86.29  ? 224  LEU B CG  1 
ATOM   4997 C CD1 . LEU B 1 300 ? 104.437 -76.301  35.286  1.00 87.86  ? 224  LEU B CD1 1 
ATOM   4998 C CD2 . LEU B 1 300 ? 103.901 -78.763  35.269  1.00 87.77  ? 224  LEU B CD2 1 
ATOM   4999 N N   . ILE B 1 301 ? 104.745 -76.565  30.834  1.00 75.25  ? 225  ILE B N   1 
ATOM   5000 C CA  . ILE B 1 301 ? 104.027 -75.528  30.074  1.00 74.09  ? 225  ILE B CA  1 
ATOM   5001 C C   . ILE B 1 301 ? 102.755 -76.165  29.521  1.00 76.61  ? 225  ILE B C   1 
ATOM   5002 O O   . ILE B 1 301 ? 101.675 -75.664  29.821  1.00 77.32  ? 225  ILE B O   1 
ATOM   5003 C CB  . ILE B 1 301 ? 104.907 -74.883  28.963  1.00 76.27  ? 225  ILE B CB  1 
ATOM   5004 C CG1 . ILE B 1 301 ? 105.879 -73.847  29.570  1.00 78.70  ? 225  ILE B CG1 1 
ATOM   5005 C CG2 . ILE B 1 301 ? 104.065 -74.255  27.837  1.00 75.67  ? 225  ILE B CG2 1 
ATOM   5006 C CD1 . ILE B 1 301 ? 107.088 -73.434  28.667  1.00 86.58  ? 225  ILE B CD1 1 
ATOM   5007 N N   . PHE B 1 302 ? 102.892 -77.316  28.810  1.00 70.85  ? 226  PHE B N   1 
ATOM   5008 C CA  . PHE B 1 302 ? 101.818 -78.096  28.205  1.00 69.47  ? 226  PHE B CA  1 
ATOM   5009 C C   . PHE B 1 302 ? 100.817 -78.597  29.221  1.00 73.94  ? 226  PHE B C   1 
ATOM   5010 O O   . PHE B 1 302 ? 99.625  -78.383  29.014  1.00 73.70  ? 226  PHE B O   1 
ATOM   5011 C CB  . PHE B 1 302 ? 102.378 -79.286  27.429  1.00 70.16  ? 226  PHE B CB  1 
ATOM   5012 C CG  . PHE B 1 302 ? 103.003 -78.943  26.102  1.00 70.87  ? 226  PHE B CG  1 
ATOM   5013 C CD1 . PHE B 1 302 ? 104.332 -78.555  26.023  1.00 73.76  ? 226  PHE B CD1 1 
ATOM   5014 C CD2 . PHE B 1 302 ? 102.275 -79.050  24.924  1.00 72.90  ? 226  PHE B CD2 1 
ATOM   5015 C CE1 . PHE B 1 302 ? 104.916 -78.250  24.792  1.00 74.18  ? 226  PHE B CE1 1 
ATOM   5016 C CE2 . PHE B 1 302 ? 102.855 -78.734  23.695  1.00 74.99  ? 226  PHE B CE2 1 
ATOM   5017 C CZ  . PHE B 1 302 ? 104.173 -78.340  23.636  1.00 73.04  ? 226  PHE B CZ  1 
ATOM   5018 N N   . ILE B 1 303 ? 101.280 -79.271  30.303  1.00 71.83  ? 227  ILE B N   1 
ATOM   5019 C CA  . ILE B 1 303 ? 100.409 -79.826  31.354  1.00 73.58  ? 227  ILE B CA  1 
ATOM   5020 C C   . ILE B 1 303 ? 99.546  -78.710  31.966  1.00 80.22  ? 227  ILE B C   1 
ATOM   5021 O O   . ILE B 1 303 ? 98.339  -78.899  32.133  1.00 80.66  ? 227  ILE B O   1 
ATOM   5022 C CB  . ILE B 1 303 ? 101.161 -80.619  32.474  1.00 77.83  ? 227  ILE B CB  1 
ATOM   5023 C CG1 . ILE B 1 303 ? 102.436 -81.377  31.980  1.00 77.25  ? 227  ILE B CG1 1 
ATOM   5024 C CG2 . ILE B 1 303 ? 100.210 -81.570  33.206  1.00 80.23  ? 227  ILE B CG2 1 
ATOM   5025 C CD1 . ILE B 1 303 ? 102.282 -82.541  30.919  1.00 84.94  ? 227  ILE B CD1 1 
ATOM   5026 N N   . ALA B 1 304 ? 100.165 -77.555  32.270  1.00 78.15  ? 228  ALA B N   1 
ATOM   5027 C CA  . ALA B 1 304 ? 99.502  -76.399  32.864  1.00 80.01  ? 228  ALA B CA  1 
ATOM   5028 C C   . ALA B 1 304 ? 98.552  -75.706  31.881  1.00 84.62  ? 228  ALA B C   1 
ATOM   5029 O O   . ALA B 1 304 ? 97.456  -75.340  32.304  1.00 86.19  ? 228  ALA B O   1 
ATOM   5030 C CB  . ALA B 1 304 ? 100.531 -75.406  33.381  1.00 81.79  ? 228  ALA B CB  1 
ATOM   5031 N N   . THR B 1 305 ? 98.949  -75.520  30.590  1.00 79.29  ? 229  THR B N   1 
ATOM   5032 C CA  . THR B 1 305 ? 98.092  -74.877  29.576  1.00 78.51  ? 229  THR B CA  1 
ATOM   5033 C C   . THR B 1 305 ? 96.821  -75.700  29.341  1.00 81.31  ? 229  THR B C   1 
ATOM   5034 O O   . THR B 1 305 ? 95.728  -75.127  29.258  1.00 82.15  ? 229  THR B O   1 
ATOM   5035 C CB  . THR B 1 305 ? 98.823  -74.601  28.255  1.00 89.55  ? 229  THR B CB  1 
ATOM   5036 O OG1 . THR B 1 305 ? 99.809  -75.582  27.962  1.00 93.99  ? 229  THR B OG1 1 
ATOM   5037 C CG2 . THR B 1 305 ? 99.456  -73.222  28.210  1.00 90.51  ? 229  THR B CG2 1 
ATOM   5038 N N   . CYS B 1 306 ? 96.963  -77.042  29.301  1.00 75.85  ? 230  CYS B N   1 
ATOM   5039 C CA  . CYS B 1 306 ? 95.861  -77.984  29.110  1.00 74.96  ? 230  CYS B CA  1 
ATOM   5040 C C   . CYS B 1 306 ? 94.913  -77.984  30.307  1.00 79.18  ? 230  CYS B C   1 
ATOM   5041 O O   . CYS B 1 306 ? 93.710  -77.986  30.083  1.00 78.65  ? 230  CYS B O   1 
ATOM   5042 C CB  . CYS B 1 306 ? 96.384  -79.386  28.811  1.00 74.04  ? 230  CYS B CB  1 
ATOM   5043 S SG  . CYS B 1 306 ? 97.153  -79.550  27.181  1.00 75.72  ? 230  CYS B SG  1 
ATOM   5044 N N   . TYR B 1 307 ? 95.434  -77.947  31.558  1.00 77.05  ? 231  TYR B N   1 
ATOM   5045 C CA  . TYR B 1 307 ? 94.584  -77.918  32.749  1.00 79.58  ? 231  TYR B CA  1 
ATOM   5046 C C   . TYR B 1 307 ? 93.719  -76.650  32.784  1.00 86.36  ? 231  TYR B C   1 
ATOM   5047 O O   . TYR B 1 307 ? 92.513  -76.744  33.018  1.00 86.76  ? 231  TYR B O   1 
ATOM   5048 C CB  . TYR B 1 307 ? 95.390  -78.039  34.061  1.00 82.29  ? 231  TYR B CB  1 
ATOM   5049 C CG  . TYR B 1 307 ? 94.557  -77.686  35.282  1.00 86.88  ? 231  TYR B CG  1 
ATOM   5050 C CD1 . TYR B 1 307 ? 93.486  -78.487  35.677  1.00 90.15  ? 231  TYR B CD1 1 
ATOM   5051 C CD2 . TYR B 1 307 ? 94.780  -76.502  35.983  1.00 88.99  ? 231  TYR B CD2 1 
ATOM   5052 C CE1 . TYR B 1 307 ? 92.667  -78.127  36.743  1.00 93.43  ? 231  TYR B CE1 1 
ATOM   5053 C CE2 . TYR B 1 307 ? 93.974  -76.138  37.059  1.00 92.57  ? 231  TYR B CE2 1 
ATOM   5054 C CZ  . TYR B 1 307 ? 92.920  -76.955  37.438  1.00 102.02 ? 231  TYR B CZ  1 
ATOM   5055 O OH  . TYR B 1 307 ? 92.126  -76.614  38.506  1.00 106.51 ? 231  TYR B OH  1 
ATOM   5056 N N   . PHE B 1 308 ? 94.339  -75.476  32.589  1.00 84.65  ? 232  PHE B N   1 
ATOM   5057 C CA  . PHE B 1 308 ? 93.643  -74.191  32.607  1.00 86.82  ? 232  PHE B CA  1 
ATOM   5058 C C   . PHE B 1 308 ? 92.793  -73.994  31.339  1.00 91.10  ? 232  PHE B C   1 
ATOM   5059 O O   . PHE B 1 308 ? 91.860  -73.187  31.349  1.00 91.96  ? 232  PHE B O   1 
ATOM   5060 C CB  . PHE B 1 308 ? 94.635  -73.034  32.804  1.00 89.37  ? 232  PHE B CB  1 
ATOM   5061 C CG  . PHE B 1 308 ? 95.176  -72.956  34.214  1.00 92.91  ? 232  PHE B CG  1 
ATOM   5062 C CD1 . PHE B 1 308 ? 94.407  -72.431  35.244  1.00 98.60  ? 232  PHE B CD1 1 
ATOM   5063 C CD2 . PHE B 1 308 ? 96.455  -73.406  34.512  1.00 94.41  ? 232  PHE B CD2 1 
ATOM   5064 C CE1 . PHE B 1 308 ? 94.905  -72.373  36.549  1.00 101.46 ? 232  PHE B CE1 1 
ATOM   5065 C CE2 . PHE B 1 308 ? 96.950  -73.346  35.818  1.00 99.19  ? 232  PHE B CE2 1 
ATOM   5066 C CZ  . PHE B 1 308 ? 96.173  -72.830  36.826  1.00 99.92  ? 232  PHE B CZ  1 
ATOM   5067 N N   . GLY B 1 309 ? 93.110  -74.747  30.285  1.00 86.37  ? 233  GLY B N   1 
ATOM   5068 C CA  . GLY B 1 309 ? 92.357  -74.760  29.039  1.00 85.65  ? 233  GLY B CA  1 
ATOM   5069 C C   . GLY B 1 309 ? 91.108  -75.611  29.181  1.00 90.39  ? 233  GLY B C   1 
ATOM   5070 O O   . GLY B 1 309 ? 90.145  -75.434  28.431  1.00 90.41  ? 233  GLY B O   1 
ATOM   5071 N N   . ILE B 1 310 ? 91.126  -76.548  30.154  1.00 87.66  ? 234  ILE B N   1 
ATOM   5072 C CA  . ILE B 1 310 ? 90.014  -77.443  30.508  1.00 88.72  ? 234  ILE B CA  1 
ATOM   5073 C C   . ILE B 1 310 ? 89.168  -76.748  31.602  1.00 94.11  ? 234  ILE B C   1 
ATOM   5074 O O   . ILE B 1 310 ? 87.937  -76.823  31.580  1.00 94.65  ? 234  ILE B O   1 
ATOM   5075 C CB  . ILE B 1 310 ? 90.547  -78.850  30.942  1.00 91.57  ? 234  ILE B CB  1 
ATOM   5076 C CG1 . ILE B 1 310 ? 91.094  -79.635  29.722  1.00 90.25  ? 234  ILE B CG1 1 
ATOM   5077 C CG2 . ILE B 1 310 ? 89.483  -79.681  31.681  1.00 94.04  ? 234  ILE B CG2 1 
ATOM   5078 C CD1 . ILE B 1 310 ? 92.154  -80.750  30.050  1.00 95.62  ? 234  ILE B CD1 1 
ATOM   5079 N N   . ARG B 1 311 ? 89.841  -76.064  32.542  1.00 91.05  ? 235  ARG B N   1 
ATOM   5080 C CA  . ARG B 1 311 ? 89.211  -75.324  33.631  1.00 93.01  ? 235  ARG B CA  1 
ATOM   5081 C C   . ARG B 1 311 ? 88.388  -74.166  33.095  1.00 97.94  ? 235  ARG B C   1 
ATOM   5082 O O   . ARG B 1 311 ? 87.274  -73.984  33.578  1.00 100.35 ? 235  ARG B O   1 
ATOM   5083 C CB  . ARG B 1 311 ? 90.259  -74.805  34.627  1.00 93.45  ? 235  ARG B CB  1 
ATOM   5084 C CG  . ARG B 1 311 ? 89.671  -74.306  35.943  1.00 104.85 ? 235  ARG B CG  1 
ATOM   5085 C CD  . ARG B 1 311 ? 90.739  -73.818  36.896  1.00 113.48 ? 235  ARG B CD  1 
ATOM   5086 N NE  . ARG B 1 311 ? 90.497  -72.437  37.316  1.00 124.14 ? 235  ARG B NE  1 
ATOM   5087 C CZ  . ARG B 1 311 ? 91.246  -71.776  38.194  1.00 139.11 ? 235  ARG B CZ  1 
ATOM   5088 N NH1 . ARG B 1 311 ? 92.295  -72.363  38.758  1.00 123.01 ? 235  ARG B NH1 1 
ATOM   5089 N NH2 . ARG B 1 311 ? 90.953  -70.521  38.512  1.00 129.14 ? 235  ARG B NH2 1 
ATOM   5090 N N   . LYS B 1 312 ? 88.918  -73.385  32.122  1.00 92.76  ? 236  LYS B N   1 
ATOM   5091 C CA  . LYS B 1 312 ? 88.208  -72.234  31.548  1.00 93.51  ? 236  LYS B CA  1 
ATOM   5092 C C   . LYS B 1 312 ? 86.925  -72.661  30.812  1.00 99.66  ? 236  LYS B C   1 
ATOM   5093 O O   . LYS B 1 312 ? 85.883  -72.038  31.017  1.00 101.02 ? 236  LYS B O   1 
ATOM   5094 C CB  . LYS B 1 312 ? 89.115  -71.419  30.614  1.00 93.90  ? 236  LYS B CB  1 
ATOM   5095 N N   . HIS B 1 313 ? 86.996  -73.740  30.000  1.00 96.42  ? 237  HIS B N   1 
ATOM   5096 C CA  . HIS B 1 313 ? 85.879  -74.269  29.206  1.00 97.42  ? 237  HIS B CA  1 
ATOM   5097 C C   . HIS B 1 313 ? 84.754  -74.820  30.084  1.00 105.15 ? 237  HIS B C   1 
ATOM   5098 O O   . HIS B 1 313 ? 83.588  -74.496  29.849  1.00 106.47 ? 237  HIS B O   1 
ATOM   5099 C CB  . HIS B 1 313 ? 86.372  -75.360  28.236  1.00 96.43  ? 237  HIS B CB  1 
ATOM   5100 C CG  . HIS B 1 313 ? 85.368  -75.773  27.200  1.00 100.43 ? 237  HIS B CG  1 
ATOM   5101 N ND1 . HIS B 1 313 ? 85.354  -75.197  25.939  1.00 101.76 ? 237  HIS B ND1 1 
ATOM   5102 C CD2 . HIS B 1 313 ? 84.391  -76.708  27.262  1.00 103.53 ? 237  HIS B CD2 1 
ATOM   5103 C CE1 . HIS B 1 313 ? 84.370  -75.791  25.282  1.00 102.15 ? 237  HIS B CE1 1 
ATOM   5104 N NE2 . HIS B 1 313 ? 83.762  -76.707  26.037  1.00 103.61 ? 237  HIS B NE2 1 
ATOM   5105 N N   . LEU B 1 314 ? 85.096  -75.639  31.089  1.00 103.46 ? 238  LEU B N   1 
ATOM   5106 C CA  . LEU B 1 314 ? 84.099  -76.248  31.963  1.00 106.38 ? 238  LEU B CA  1 
ATOM   5107 C C   . LEU B 1 314 ? 83.515  -75.254  32.986  1.00 114.46 ? 238  LEU B C   1 
ATOM   5108 O O   . LEU B 1 314 ? 82.489  -75.557  33.603  1.00 116.69 ? 238  LEU B O   1 
ATOM   5109 C CB  . LEU B 1 314 ? 84.671  -77.492  32.665  1.00 106.35 ? 238  LEU B CB  1 
ATOM   5110 C CG  . LEU B 1 314 ? 84.544  -78.852  31.935  1.00 110.29 ? 238  LEU B CG  1 
ATOM   5111 C CD1 . LEU B 1 314 ? 83.147  -79.078  31.348  1.00 112.05 ? 238  LEU B CD1 1 
ATOM   5112 C CD2 . LEU B 1 314 ? 85.597  -79.025  30.872  1.00 109.55 ? 238  LEU B CD2 1 
ATOM   5113 N N   . LEU B 1 315 ? 84.134  -74.066  33.133  1.00 111.77 ? 239  LEU B N   1 
ATOM   5114 C CA  . LEU B 1 315 ? 83.647  -73.014  34.030  1.00 114.52 ? 239  LEU B CA  1 
ATOM   5115 C C   . LEU B 1 315 ? 82.619  -72.124  33.313  1.00 120.88 ? 239  LEU B C   1 
ATOM   5116 O O   . LEU B 1 315 ? 81.702  -71.608  33.957  1.00 123.31 ? 239  LEU B O   1 
ATOM   5117 C CB  . LEU B 1 315 ? 84.814  -72.166  34.552  1.00 114.16 ? 239  LEU B CB  1 
ATOM   5118 C CG  . LEU B 1 315 ? 84.947  -72.067  36.067  1.00 121.05 ? 239  LEU B CG  1 
ATOM   5119 C CD1 . LEU B 1 315 ? 86.100  -72.912  36.571  1.00 119.88 ? 239  LEU B CD1 1 
ATOM   5120 C CD2 . LEU B 1 315 ? 85.154  -70.630  36.491  1.00 125.78 ? 239  LEU B CD2 1 
ATOM   5121 N N   . LYS B 1 316 ? 82.767  -71.969  31.976  1.00 116.49 ? 240  LYS B N   1 
ATOM   5122 C CA  . LYS B 1 316 ? 81.902  -71.160  31.108  1.00 117.45 ? 240  LYS B CA  1 
ATOM   5123 C C   . LYS B 1 316 ? 80.515  -71.808  30.890  1.00 124.15 ? 240  LYS B C   1 
ATOM   5124 O O   . LYS B 1 316 ? 79.609  -71.144  30.382  1.00 124.61 ? 240  LYS B O   1 
ATOM   5125 C CB  . LYS B 1 316 ? 82.595  -70.920  29.753  1.00 117.56 ? 240  LYS B CB  1 
ATOM   5126 N N   . THR B 1 317 ? 80.353  -73.086  31.289  1.00 122.60 ? 241  THR B N   1 
ATOM   5127 C CA  . THR B 1 317 ? 79.117  -73.869  31.147  1.00 125.03 ? 241  THR B CA  1 
ATOM   5128 C C   . THR B 1 317 ? 78.026  -73.447  32.161  1.00 133.11 ? 241  THR B C   1 
ATOM   5129 O O   . THR B 1 317 ? 76.844  -73.428  31.801  1.00 134.65 ? 241  THR B O   1 
ATOM   5130 C CB  . THR B 1 317 ? 79.413  -75.374  31.279  1.00 134.29 ? 241  THR B CB  1 
ATOM   5131 O OG1 . THR B 1 317 ? 79.953  -75.645  32.576  1.00 135.88 ? 241  THR B OG1 1 
ATOM   5132 C CG2 . THR B 1 317 ? 80.355  -75.892  30.189  1.00 129.80 ? 241  THR B CG2 1 
ATOM   5133 N N   . ASN B 1 318 ? 78.428  -73.130  33.419  1.00 130.82 ? 242  ASN B N   1 
ATOM   5134 C CA  . ASN B 1 318 ? 77.575  -72.711  34.545  1.00 134.10 ? 242  ASN B CA  1 
ATOM   5135 C C   . ASN B 1 318 ? 76.503  -73.773  34.889  1.00 138.92 ? 242  ASN B C   1 
ATOM   5136 O O   . ASN B 1 318 ? 75.315  -73.625  34.570  1.00 140.30 ? 242  ASN B O   1 
ATOM   5137 C CB  . ASN B 1 318 ? 76.940  -71.329  34.315  1.00 139.85 ? 242  ASN B CB  1 
ATOM   5138 C CG  . ASN B 1 318 ? 77.506  -70.254  35.212  1.00 173.29 ? 242  ASN B CG  1 
ATOM   5139 O OD1 . ASN B 1 318 ? 78.586  -69.699  34.962  1.00 168.46 ? 242  ASN B OD1 1 
ATOM   5140 N ND2 . ASN B 1 318 ? 76.785  -69.940  36.281  1.00 168.55 ? 242  ASN B ND2 1 
ATOM   5141 N N   . SER B 1 319 ? 76.963  -74.840  35.562  1.00 134.20 ? 243  SER B N   1 
ATOM   5142 C CA  . SER B 1 319 ? 76.176  -75.980  36.040  1.00 135.39 ? 243  SER B CA  1 
ATOM   5143 C C   . SER B 1 319 ? 75.598  -75.673  37.421  1.00 140.04 ? 243  SER B C   1 
ATOM   5144 O O   . SER B 1 319 ? 76.286  -75.074  38.249  1.00 139.28 ? 243  SER B O   1 
ATOM   5145 C CB  . SER B 1 319 ? 77.048  -77.229  36.085  1.00 137.45 ? 243  SER B CB  1 
ATOM   5146 O OG  . SER B 1 319 ? 78.321  -76.945  36.641  1.00 144.26 ? 243  SER B OG  1 
ATOM   5147 N N   . TYR B 1 320 ? 74.344  -76.081  37.672  1.00 138.40 ? 244  TYR B N   1 
ATOM   5148 C CA  . TYR B 1 320 ? 73.652  -75.759  38.923  1.00 141.45 ? 244  TYR B CA  1 
ATOM   5149 C C   . TYR B 1 320 ? 73.228  -76.976  39.759  1.00 145.94 ? 244  TYR B C   1 
ATOM   5150 O O   . TYR B 1 320 ? 73.402  -76.948  40.980  1.00 147.16 ? 244  TYR B O   1 
ATOM   5151 C CB  . TYR B 1 320 ? 72.423  -74.851  38.672  1.00 145.16 ? 244  TYR B CB  1 
ATOM   5152 C CG  . TYR B 1 320 ? 71.708  -75.020  37.342  1.00 146.58 ? 244  TYR B CG  1 
ATOM   5153 C CD1 . TYR B 1 320 ? 72.225  -74.464  36.173  1.00 145.74 ? 244  TYR B CD1 1 
ATOM   5154 C CD2 . TYR B 1 320 ? 70.460  -75.633  37.272  1.00 150.19 ? 244  TYR B CD2 1 
ATOM   5155 C CE1 . TYR B 1 320 ? 71.562  -74.593  34.955  1.00 146.64 ? 244  TYR B CE1 1 
ATOM   5156 C CE2 . TYR B 1 320 ? 69.776  -75.749  36.061  1.00 150.96 ? 244  TYR B CE2 1 
ATOM   5157 C CZ  . TYR B 1 320 ? 70.329  -75.222  34.905  1.00 156.16 ? 244  TYR B CZ  1 
ATOM   5158 O OH  . TYR B 1 320 ? 69.660  -75.332  33.708  1.00 158.20 ? 244  TYR B OH  1 
ATOM   5159 N N   . GLY B 1 321 ? 72.655  -77.996  39.120  1.00 141.80 ? 245  GLY B N   1 
ATOM   5160 C CA  . GLY B 1 321 ? 72.177  -79.199  39.796  1.00 143.98 ? 245  GLY B CA  1 
ATOM   5161 C C   . GLY B 1 321 ? 73.280  -80.168  40.167  1.00 144.90 ? 245  GLY B C   1 
ATOM   5162 O O   . GLY B 1 321 ? 74.317  -79.756  40.697  1.00 142.84 ? 245  GLY B O   1 
ATOM   5163 N N   . LYS B 1 322 ? 73.069  -81.474  39.876  1.00 141.18 ? 246  LYS B N   1 
ATOM   5164 C CA  . LYS B 1 322 ? 74.062  -82.528  40.135  1.00 139.36 ? 246  LYS B CA  1 
ATOM   5165 C C   . LYS B 1 322 ? 75.220  -82.419  39.122  1.00 136.47 ? 246  LYS B C   1 
ATOM   5166 O O   . LYS B 1 322 ? 76.242  -83.088  39.274  1.00 134.35 ? 246  LYS B O   1 
ATOM   5167 C CB  . LYS B 1 322 ? 73.423  -83.939  40.138  1.00 144.69 ? 246  LYS B CB  1 
ATOM   5168 C CG  . LYS B 1 322 ? 72.893  -84.469  38.792  1.00 158.61 ? 246  LYS B CG  1 
ATOM   5169 C CD  . LYS B 1 322 ? 73.927  -85.285  37.966  1.00 166.08 ? 246  LYS B CD  1 
ATOM   5170 C CE  . LYS B 1 322 ? 74.424  -86.569  38.604  1.00 180.57 ? 246  LYS B CE  1 
ATOM   5171 N NZ  . LYS B 1 322 ? 73.341  -87.578  38.762  1.00 196.72 ? 246  LYS B NZ  1 
ATOM   5172 N N   . ASN B 1 323 ? 75.033  -81.579  38.086  1.00 129.90 ? 247  ASN B N   1 
ATOM   5173 C CA  . ASN B 1 323 ? 76.012  -81.276  37.050  1.00 125.15 ? 247  ASN B CA  1 
ATOM   5174 C C   . ASN B 1 323 ? 77.132  -80.423  37.650  1.00 126.84 ? 247  ASN B C   1 
ATOM   5175 O O   . ASN B 1 323 ? 78.257  -80.495  37.163  1.00 123.55 ? 247  ASN B O   1 
ATOM   5176 C CB  . ASN B 1 323 ? 75.367  -80.590  35.828  1.00 125.02 ? 247  ASN B CB  1 
ATOM   5177 C CG  . ASN B 1 323 ? 74.011  -79.945  36.057  1.00 157.75 ? 247  ASN B CG  1 
ATOM   5178 O OD1 . ASN B 1 323 ? 73.023  -80.605  36.400  1.00 156.15 ? 247  ASN B OD1 1 
ATOM   5179 N ND2 . ASN B 1 323 ? 73.913  -78.648  35.802  1.00 150.00 ? 247  ASN B ND2 1 
ATOM   5180 N N   . ARG B 1 324 ? 76.834  -79.640  38.721  1.00 125.32 ? 248  ARG B N   1 
ATOM   5181 C CA  . ARG B 1 324 ? 77.816  -78.834  39.461  1.00 124.40 ? 248  ARG B CA  1 
ATOM   5182 C C   . ARG B 1 324 ? 78.729  -79.767  40.265  1.00 129.79 ? 248  ARG B C   1 
ATOM   5183 O O   . ARG B 1 324 ? 79.922  -79.493  40.417  1.00 127.60 ? 248  ARG B O   1 
ATOM   5184 C CB  . ARG B 1 324 ? 77.126  -77.819  40.379  1.00 126.72 ? 248  ARG B CB  1 
ATOM   5185 N N   . ILE B 1 325 ? 78.157  -80.886  40.759  1.00 129.29 ? 249  ILE B N   1 
ATOM   5186 C CA  . ILE B 1 325 ? 78.856  -81.953  41.477  1.00 129.53 ? 249  ILE B CA  1 
ATOM   5187 C C   . ILE B 1 325 ? 79.705  -82.755  40.477  1.00 128.58 ? 249  ILE B C   1 
ATOM   5188 O O   . ILE B 1 325 ? 80.851  -83.099  40.785  1.00 127.05 ? 249  ILE B O   1 
ATOM   5189 C CB  . ILE B 1 325 ? 77.847  -82.853  42.228  1.00 136.90 ? 249  ILE B CB  1 
ATOM   5190 N N   . THR B 1 326 ? 79.150  -83.008  39.265  1.00 122.85 ? 250  THR B N   1 
ATOM   5191 C CA  . THR B 1 326 ? 79.801  -83.747  38.181  1.00 119.51 ? 250  THR B CA  1 
ATOM   5192 C C   . THR B 1 326 ? 80.980  -82.950  37.582  1.00 118.79 ? 250  THR B C   1 
ATOM   5193 O O   . THR B 1 326 ? 82.039  -83.544  37.379  1.00 116.08 ? 250  THR B O   1 
ATOM   5194 C CB  . THR B 1 326 ? 78.783  -84.159  37.102  1.00 126.88 ? 250  THR B CB  1 
ATOM   5195 N N   . ARG B 1 327 ? 80.817  -81.626  37.331  1.00 114.42 ? 251  ARG B N   1 
ATOM   5196 C CA  . ARG B 1 327 ? 81.885  -80.789  36.766  1.00 111.01 ? 251  ARG B CA  1 
ATOM   5197 C C   . ARG B 1 327 ? 83.078  -80.682  37.732  1.00 114.47 ? 251  ARG B C   1 
ATOM   5198 O O   . ARG B 1 327 ? 84.218  -80.732  37.275  1.00 111.28 ? 251  ARG B O   1 
ATOM   5199 C CB  . ARG B 1 327 ? 81.381  -79.394  36.333  1.00 110.75 ? 251  ARG B CB  1 
ATOM   5200 C CG  . ARG B 1 327 ? 81.077  -78.389  37.445  1.00 122.62 ? 251  ARG B CG  1 
ATOM   5201 C CD  . ARG B 1 327 ? 82.031  -77.206  37.431  1.00 125.65 ? 251  ARG B CD  1 
ATOM   5202 N NE  . ARG B 1 327 ? 81.679  -76.212  38.447  1.00 130.08 ? 251  ARG B NE  1 
ATOM   5203 C CZ  . ARG B 1 327 ? 82.139  -76.206  39.697  1.00 139.61 ? 251  ARG B CZ  1 
ATOM   5204 N NH1 . ARG B 1 327 ? 82.989  -77.143  40.104  1.00 114.29 ? 251  ARG B NH1 1 
ATOM   5205 N NH2 . ARG B 1 327 ? 81.754  -75.266  40.548  1.00 132.19 ? 251  ARG B NH2 1 
ATOM   5206 N N   . ASP B 1 328 ? 82.815  -80.580  39.052  1.00 114.03 ? 252  ASP B N   1 
ATOM   5207 C CA  . ASP B 1 328 ? 83.843  -80.497  40.093  1.00 114.43 ? 252  ASP B CA  1 
ATOM   5208 C C   . ASP B 1 328 ? 84.715  -81.760  40.099  1.00 117.66 ? 252  ASP B C   1 
ATOM   5209 O O   . ASP B 1 328 ? 85.939  -81.653  40.189  1.00 115.87 ? 252  ASP B O   1 
ATOM   5210 C CB  . ASP B 1 328 ? 83.196  -80.284  41.473  1.00 120.18 ? 252  ASP B CB  1 
ATOM   5211 N N   . GLN B 1 329 ? 84.081  -82.946  39.955  1.00 115.00 ? 253  GLN B N   1 
ATOM   5212 C CA  . GLN B 1 329 ? 84.731  -84.260  39.909  1.00 114.07 ? 253  GLN B CA  1 
ATOM   5213 C C   . GLN B 1 329 ? 85.674  -84.389  38.689  1.00 113.43 ? 253  GLN B C   1 
ATOM   5214 O O   . GLN B 1 329 ? 86.772  -84.933  38.827  1.00 111.95 ? 253  GLN B O   1 
ATOM   5215 C CB  . GLN B 1 329 ? 83.671  -85.369  39.887  1.00 117.78 ? 253  GLN B CB  1 
ATOM   5216 N N   . VAL B 1 330 ? 85.252  -83.866  37.511  1.00 107.64 ? 254  VAL B N   1 
ATOM   5217 C CA  . VAL B 1 330 ? 86.030  -83.870  36.255  1.00 103.76 ? 254  VAL B CA  1 
ATOM   5218 C C   . VAL B 1 330 ? 87.258  -82.964  36.429  1.00 105.65 ? 254  VAL B C   1 
ATOM   5219 O O   . VAL B 1 330 ? 88.361  -83.326  36.008  1.00 102.83 ? 254  VAL B O   1 
ATOM   5220 C CB  . VAL B 1 330 ? 85.165  -83.440  35.037  1.00 106.29 ? 254  VAL B CB  1 
ATOM   5221 C CG1 . VAL B 1 330 ? 85.993  -83.336  33.757  1.00 102.75 ? 254  VAL B CG1 1 
ATOM   5222 C CG2 . VAL B 1 330 ? 83.998  -84.390  34.841  1.00 108.22 ? 254  VAL B CG2 1 
ATOM   5223 N N   . LEU B 1 331 ? 87.047  -81.801  37.080  1.00 103.39 ? 255  LEU B N   1 
ATOM   5224 C CA  . LEU B 1 331 ? 88.063  -80.795  37.378  1.00 102.12 ? 255  LEU B CA  1 
ATOM   5225 C C   . LEU B 1 331 ? 89.122  -81.323  38.354  1.00 105.49 ? 255  LEU B C   1 
ATOM   5226 O O   . LEU B 1 331 ? 90.288  -80.933  38.249  1.00 103.16 ? 255  LEU B O   1 
ATOM   5227 C CB  . LEU B 1 331 ? 87.392  -79.531  37.956  1.00 104.06 ? 255  LEU B CB  1 
ATOM   5228 C CG  . LEU B 1 331 ? 87.278  -78.290  37.040  1.00 107.62 ? 255  LEU B CG  1 
ATOM   5229 C CD1 . LEU B 1 331 ? 88.651  -77.768  36.612  1.00 105.87 ? 255  LEU B CD1 1 
ATOM   5230 C CD2 . LEU B 1 331 ? 86.395  -78.549  35.832  1.00 108.94 ? 255  LEU B CD2 1 
ATOM   5231 N N   . LYS B 1 332 ? 88.711  -82.207  39.294  1.00 103.73 ? 256  LYS B N   1 
ATOM   5232 C CA  . LYS B 1 332 ? 89.586  -82.837  40.281  1.00 104.24 ? 256  LYS B CA  1 
ATOM   5233 C C   . LYS B 1 332 ? 90.549  -83.808  39.586  1.00 106.00 ? 256  LYS B C   1 
ATOM   5234 O O   . LYS B 1 332 ? 91.723  -83.858  39.953  1.00 104.74 ? 256  LYS B O   1 
ATOM   5235 C CB  . LYS B 1 332 ? 88.770  -83.551  41.371  1.00 109.80 ? 256  LYS B CB  1 
ATOM   5236 N N   . MET B 1 333 ? 90.062  -84.538  38.559  1.00 101.64 ? 257  MET B N   1 
ATOM   5237 C CA  . MET B 1 333 ? 90.848  -85.483  37.757  1.00 99.51  ? 257  MET B CA  1 
ATOM   5238 C C   . MET B 1 333 ? 91.855  -84.732  36.876  1.00 98.64  ? 257  MET B C   1 
ATOM   5239 O O   . MET B 1 333 ? 92.955  -85.231  36.636  1.00 96.51  ? 257  MET B O   1 
ATOM   5240 C CB  . MET B 1 333 ? 89.925  -86.358  36.903  1.00 102.23 ? 257  MET B CB  1 
ATOM   5241 C CG  . MET B 1 333 ? 89.102  -87.329  37.728  1.00 109.72 ? 257  MET B CG  1 
ATOM   5242 S SD  . MET B 1 333 ? 87.607  -87.912  36.894  1.00 115.61 ? 257  MET B SD  1 
ATOM   5243 C CE  . MET B 1 333 ? 88.292  -89.165  35.879  1.00 110.70 ? 257  MET B CE  1 
ATOM   5244 N N   . ALA B 1 334 ? 91.481  -83.528  36.412  1.00 93.76  ? 258  ALA B N   1 
ATOM   5245 C CA  . ALA B 1 334 ? 92.342  -82.661  35.612  1.00 90.89  ? 258  ALA B CA  1 
ATOM   5246 C C   . ALA B 1 334 ? 93.429  -82.031  36.488  1.00 96.08  ? 258  ALA B C   1 
ATOM   5247 O O   . ALA B 1 334 ? 94.568  -81.874  36.043  1.00 94.28  ? 258  ALA B O   1 
ATOM   5248 C CB  . ALA B 1 334 ? 91.515  -81.577  34.943  1.00 90.96  ? 258  ALA B CB  1 
ATOM   5249 N N   . ALA B 1 335 ? 93.077  -81.685  37.740  1.00 95.44  ? 259  ALA B N   1 
ATOM   5250 C CA  . ALA B 1 335 ? 93.985  -81.060  38.698  1.00 96.34  ? 259  ALA B CA  1 
ATOM   5251 C C   . ALA B 1 335 ? 95.041  -82.033  39.208  1.00 100.79 ? 259  ALA B C   1 
ATOM   5252 O O   . ALA B 1 335 ? 96.160  -81.612  39.484  1.00 100.03 ? 259  ALA B O   1 
ATOM   5253 C CB  . ALA B 1 335 ? 93.195  -80.504  39.869  1.00 100.19 ? 259  ALA B CB  1 
ATOM   5254 N N   . ALA B 1 336 ? 94.681  -83.324  39.343  1.00 98.63  ? 260  ALA B N   1 
ATOM   5255 C CA  . ALA B 1 336 ? 95.532  -84.396  39.863  1.00 99.24  ? 260  ALA B CA  1 
ATOM   5256 C C   . ALA B 1 336 ? 96.766  -84.639  39.011  1.00 101.18 ? 260  ALA B C   1 
ATOM   5257 O O   . ALA B 1 336 ? 97.860  -84.704  39.568  1.00 101.30 ? 260  ALA B O   1 
ATOM   5258 C CB  . ALA B 1 336 ? 94.736  -85.684  39.987  1.00 101.36 ? 260  ALA B CB  1 
ATOM   5259 N N   . VAL B 1 337 ? 96.604  -84.747  37.674  1.00 95.78  ? 261  VAL B N   1 
ATOM   5260 C CA  . VAL B 1 337 ? 97.702  -85.032  36.737  1.00 93.38  ? 261  VAL B CA  1 
ATOM   5261 C C   . VAL B 1 337 ? 98.773  -83.917  36.721  1.00 95.41  ? 261  VAL B C   1 
ATOM   5262 O O   . VAL B 1 337 ? 99.949  -84.236  36.556  1.00 94.43  ? 261  VAL B O   1 
ATOM   5263 C CB  . VAL B 1 337 ? 97.218  -85.370  35.301  1.00 95.59  ? 261  VAL B CB  1 
ATOM   5264 C CG1 . VAL B 1 337 ? 96.443  -86.682  35.284  1.00 96.59  ? 261  VAL B CG1 1 
ATOM   5265 C CG2 . VAL B 1 337 ? 96.385  -84.243  34.691  1.00 94.67  ? 261  VAL B CG2 1 
ATOM   5266 N N   . VAL B 1 338 ? 98.382  -82.640  36.916  1.00 91.67  ? 262  VAL B N   1 
ATOM   5267 C CA  . VAL B 1 338 ? 99.331  -81.524  36.907  1.00 90.69  ? 262  VAL B CA  1 
ATOM   5268 C C   . VAL B 1 338 ? 100.011 -81.399  38.288  1.00 96.98  ? 262  VAL B C   1 
ATOM   5269 O O   . VAL B 1 338 ? 101.211 -81.131  38.338  1.00 96.40  ? 262  VAL B O   1 
ATOM   5270 C CB  . VAL B 1 338 ? 98.710  -80.184  36.400  1.00 93.87  ? 262  VAL B CB  1 
ATOM   5271 C CG1 . VAL B 1 338 ? 97.694  -79.597  37.371  1.00 96.00  ? 262  VAL B CG1 1 
ATOM   5272 C CG2 . VAL B 1 338 ? 99.783  -79.158  36.051  1.00 92.88  ? 262  VAL B CG2 1 
ATOM   5273 N N   . LEU B 1 339 ? 99.269  -81.632  39.387  1.00 96.28  ? 263  LEU B N   1 
ATOM   5274 C CA  . LEU B 1 339 ? 99.810  -81.543  40.744  1.00 98.96  ? 263  LEU B CA  1 
ATOM   5275 C C   . LEU B 1 339 ? 100.763 -82.705  41.044  1.00 103.60 ? 263  LEU B C   1 
ATOM   5276 O O   . LEU B 1 339 ? 101.779 -82.476  41.693  1.00 104.96 ? 263  LEU B O   1 
ATOM   5277 C CB  . LEU B 1 339 ? 98.688  -81.477  41.789  1.00 101.82 ? 263  LEU B CB  1 
ATOM   5278 C CG  . LEU B 1 339 ? 98.389  -80.088  42.389  1.00 108.06 ? 263  LEU B CG  1 
ATOM   5279 C CD1 . LEU B 1 339 ? 97.636  -79.185  41.405  1.00 105.93 ? 263  LEU B CD1 1 
ATOM   5280 C CD2 . LEU B 1 339 ? 97.579  -80.214  43.661  1.00 114.11 ? 263  LEU B CD2 1 
ATOM   5281 N N   . ALA B 1 340 ? 100.470 -83.928  40.538  1.00 98.47  ? 264  ALA B N   1 
ATOM   5282 C CA  . ALA B 1 340 ? 101.319 -85.115  40.729  1.00 98.16  ? 264  ALA B CA  1 
ATOM   5283 C C   . ALA B 1 340 ? 102.659 -84.979  39.988  1.00 99.47  ? 264  ALA B C   1 
ATOM   5284 O O   . ALA B 1 340 ? 103.665 -85.509  40.459  1.00 100.66 ? 264  ALA B O   1 
ATOM   5285 C CB  . ALA B 1 340 ? 100.595 -86.371  40.264  1.00 98.37  ? 264  ALA B CB  1 
ATOM   5286 N N   . PHE B 1 341 ? 102.673 -84.269  38.840  1.00 91.59  ? 265  PHE B N   1 
ATOM   5287 C CA  . PHE B 1 341 ? 103.891 -84.053  38.070  1.00 88.67  ? 265  PHE B CA  1 
ATOM   5288 C C   . PHE B 1 341 ? 104.857 -83.134  38.828  1.00 93.94  ? 265  PHE B C   1 
ATOM   5289 O O   . PHE B 1 341 ? 106.047 -83.445  38.883  1.00 93.87  ? 265  PHE B O   1 
ATOM   5290 C CB  . PHE B 1 341 ? 103.575 -83.480  36.677  1.00 87.28  ? 265  PHE B CB  1 
ATOM   5291 C CG  . PHE B 1 341 ? 104.765 -83.333  35.752  1.00 86.57  ? 265  PHE B CG  1 
ATOM   5292 C CD1 . PHE B 1 341 ? 105.202 -84.402  34.975  1.00 87.75  ? 265  PHE B CD1 1 
ATOM   5293 C CD2 . PHE B 1 341 ? 105.431 -82.117  35.635  1.00 88.04  ? 265  PHE B CD2 1 
ATOM   5294 C CE1 . PHE B 1 341 ? 106.295 -84.262  34.116  1.00 86.91  ? 265  PHE B CE1 1 
ATOM   5295 C CE2 . PHE B 1 341 ? 106.530 -81.983  34.783  1.00 89.32  ? 265  PHE B CE2 1 
ATOM   5296 C CZ  . PHE B 1 341 ? 106.954 -83.055  34.028  1.00 85.92  ? 265  PHE B CZ  1 
ATOM   5297 N N   . ILE B 1 342 ? 104.361 -82.015  39.408  1.00 91.34  ? 266  ILE B N   1 
ATOM   5298 C CA  . ILE B 1 342 ? 105.234 -81.069  40.118  1.00 92.58  ? 266  ILE B CA  1 
ATOM   5299 C C   . ILE B 1 342 ? 105.665 -81.626  41.493  1.00 99.94  ? 266  ILE B C   1 
ATOM   5300 O O   . ILE B 1 342 ? 106.755 -81.286  41.945  1.00 101.14 ? 266  ILE B O   1 
ATOM   5301 C CB  . ILE B 1 342 ? 104.695 -79.614  40.228  1.00 95.90  ? 266  ILE B CB  1 
ATOM   5302 C CG1 . ILE B 1 342 ? 103.376 -79.520  41.009  1.00 98.15  ? 266  ILE B CG1 1 
ATOM   5303 C CG2 . ILE B 1 342 ? 104.582 -78.970  38.853  1.00 93.71  ? 266  ILE B CG2 1 
ATOM   5304 C CD1 . ILE B 1 342 ? 103.133 -78.149  41.706  1.00 109.84 ? 266  ILE B CD1 1 
ATOM   5305 N N   . ILE B 1 343 ? 104.863 -82.492  42.136  1.00 97.95  ? 267  ILE B N   1 
ATOM   5306 C CA  . ILE B 1 343 ? 105.267 -83.069  43.424  1.00 101.14 ? 267  ILE B CA  1 
ATOM   5307 C C   . ILE B 1 343 ? 106.437 -84.058  43.194  1.00 105.75 ? 267  ILE B C   1 
ATOM   5308 O O   . ILE B 1 343 ? 107.401 -84.051  43.961  1.00 107.86 ? 267  ILE B O   1 
ATOM   5309 C CB  . ILE B 1 343 ? 104.060 -83.716  44.175  1.00 105.97 ? 267  ILE B CB  1 
ATOM   5310 C CG1 . ILE B 1 343 ? 103.037 -82.655  44.656  1.00 107.84 ? 267  ILE B CG1 1 
ATOM   5311 C CG2 . ILE B 1 343 ? 104.486 -84.634  45.333  1.00 109.72 ? 267  ILE B CG2 1 
ATOM   5312 C CD1 . ILE B 1 343 ? 103.591 -81.394  45.450  1.00 119.28 ? 267  ILE B CD1 1 
ATOM   5313 N N   . CYS B 1 344 ? 106.372 -84.843  42.107  1.00 99.96  ? 268  CYS B N   1 
ATOM   5314 C CA  . CYS B 1 344 ? 107.355 -85.864  41.758  1.00 99.70  ? 268  CYS B CA  1 
ATOM   5315 C C   . CYS B 1 344 ? 108.644 -85.311  41.122  1.00 103.00 ? 268  CYS B C   1 
ATOM   5316 O O   . CYS B 1 344 ? 109.721 -85.835  41.415  1.00 104.34 ? 268  CYS B O   1 
ATOM   5317 C CB  . CYS B 1 344 ? 106.717 -86.907  40.848  1.00 98.17  ? 268  CYS B CB  1 
ATOM   5318 S SG  . CYS B 1 344 ? 105.467 -87.934  41.663  1.00 104.46 ? 268  CYS B SG  1 
ATOM   5319 N N   . TRP B 1 345 ? 108.552 -84.301  40.241  1.00 97.35  ? 269  TRP B N   1 
ATOM   5320 C CA  . TRP B 1 345 ? 109.726 -83.817  39.519  1.00 96.08  ? 269  TRP B CA  1 
ATOM   5321 C C   . TRP B 1 345 ? 110.300 -82.448  39.960  1.00 99.69  ? 269  TRP B C   1 
ATOM   5322 O O   . TRP B 1 345 ? 111.476 -82.215  39.678  1.00 99.70  ? 269  TRP B O   1 
ATOM   5323 C CB  . TRP B 1 345 ? 109.428 -83.775  38.016  1.00 92.17  ? 269  TRP B CB  1 
ATOM   5324 C CG  . TRP B 1 345 ? 109.438 -85.135  37.382  1.00 92.45  ? 269  TRP B CG  1 
ATOM   5325 C CD1 . TRP B 1 345 ? 108.355 -85.871  36.998  1.00 94.62  ? 269  TRP B CD1 1 
ATOM   5326 C CD2 . TRP B 1 345 ? 110.592 -85.942  37.106  1.00 92.39  ? 269  TRP B CD2 1 
ATOM   5327 N NE1 . TRP B 1 345 ? 108.764 -87.072  36.460  1.00 93.49  ? 269  TRP B NE1 1 
ATOM   5328 C CE2 . TRP B 1 345 ? 110.132 -87.148  36.529  1.00 95.38  ? 269  TRP B CE2 1 
ATOM   5329 C CE3 . TRP B 1 345 ? 111.978 -85.762  37.293  1.00 94.56  ? 269  TRP B CE3 1 
ATOM   5330 C CZ2 . TRP B 1 345 ? 111.006 -88.168  36.136  1.00 94.45  ? 269  TRP B CZ2 1 
ATOM   5331 C CZ3 . TRP B 1 345 ? 112.841 -86.772  36.906  1.00 95.63  ? 269  TRP B CZ3 1 
ATOM   5332 C CH2 . TRP B 1 345 ? 112.356 -87.954  36.328  1.00 95.15  ? 269  TRP B CH2 1 
ATOM   5333 N N   . LEU B 1 346 ? 109.528 -81.556  40.619  1.00 96.14  ? 270  LEU B N   1 
ATOM   5334 C CA  . LEU B 1 346 ? 110.059 -80.245  41.035  1.00 97.14  ? 270  LEU B CA  1 
ATOM   5335 C C   . LEU B 1 346 ? 111.220 -80.386  42.054  1.00 103.85 ? 270  LEU B C   1 
ATOM   5336 O O   . LEU B 1 346 ? 112.238 -79.739  41.813  1.00 103.12 ? 270  LEU B O   1 
ATOM   5337 C CB  . LEU B 1 346 ? 108.972 -79.285  41.575  1.00 98.18  ? 270  LEU B CB  1 
ATOM   5338 C CG  . LEU B 1 346 ? 109.408 -77.872  42.007  1.00 104.36 ? 270  LEU B CG  1 
ATOM   5339 C CD1 . LEU B 1 346 ? 109.537 -76.936  40.821  1.00 101.99 ? 270  LEU B CD1 1 
ATOM   5340 C CD2 . LEU B 1 346 ? 108.443 -77.286  43.014  1.00 109.36 ? 270  LEU B CD2 1 
ATOM   5341 N N   . PRO B 1 347 ? 111.156 -81.219  43.132  1.00 103.83 ? 271  PRO B N   1 
ATOM   5342 C CA  . PRO B 1 347 ? 112.304 -81.306  44.060  1.00 107.30 ? 271  PRO B CA  1 
ATOM   5343 C C   . PRO B 1 347 ? 113.657 -81.600  43.381  1.00 111.14 ? 271  PRO B C   1 
ATOM   5344 O O   . PRO B 1 347 ? 114.641 -80.927  43.702  1.00 112.51 ? 271  PRO B O   1 
ATOM   5345 C CB  . PRO B 1 347 ? 111.896 -82.435  45.008  1.00 111.11 ? 271  PRO B CB  1 
ATOM   5346 C CG  . PRO B 1 347 ? 110.418 -82.366  45.030  1.00 114.66 ? 271  PRO B CG  1 
ATOM   5347 C CD  . PRO B 1 347 ? 110.042 -82.066  43.609  1.00 106.07 ? 271  PRO B CD  1 
ATOM   5348 N N   . PHE B 1 348 ? 113.696 -82.545  42.413  1.00 105.66 ? 272  PHE B N   1 
ATOM   5349 C CA  . PHE B 1 348 ? 114.913 -82.897  41.671  1.00 104.67 ? 272  PHE B CA  1 
ATOM   5350 C C   . PHE B 1 348 ? 115.384 -81.756  40.748  1.00 107.47 ? 272  PHE B C   1 
ATOM   5351 O O   . PHE B 1 348 ? 116.586 -81.481  40.696  1.00 108.52 ? 272  PHE B O   1 
ATOM   5352 C CB  . PHE B 1 348 ? 114.704 -84.193  40.854  1.00 103.97 ? 272  PHE B CB  1 
ATOM   5353 C CG  . PHE B 1 348 ? 115.751 -84.452  39.794  1.00 103.73 ? 272  PHE B CG  1 
ATOM   5354 C CD1 . PHE B 1 348 ? 117.014 -84.923  40.140  1.00 108.56 ? 272  PHE B CD1 1 
ATOM   5355 C CD2 . PHE B 1 348 ? 115.484 -84.195  38.455  1.00 102.84 ? 272  PHE B CD2 1 
ATOM   5356 C CE1 . PHE B 1 348 ? 117.993 -85.134  39.161  1.00 108.04 ? 272  PHE B CE1 1 
ATOM   5357 C CE2 . PHE B 1 348 ? 116.466 -84.396  37.479  1.00 104.41 ? 272  PHE B CE2 1 
ATOM   5358 C CZ  . PHE B 1 348 ? 117.711 -84.873  37.838  1.00 104.10 ? 272  PHE B CZ  1 
ATOM   5359 N N   . HIS B 1 349 ? 114.454 -81.130  40.001  1.00 101.59 ? 273  HIS B N   1 
ATOM   5360 C CA  . HIS B 1 349 ? 114.783 -80.064  39.054  1.00 99.97  ? 273  HIS B CA  1 
ATOM   5361 C C   . HIS B 1 349 ? 115.234 -78.785  39.771  1.00 106.29 ? 273  HIS B C   1 
ATOM   5362 O O   . HIS B 1 349 ? 116.025 -78.039  39.198  1.00 105.30 ? 273  HIS B O   1 
ATOM   5363 C CB  . HIS B 1 349 ? 113.618 -79.797  38.098  1.00 97.86  ? 273  HIS B CB  1 
ATOM   5364 C CG  . HIS B 1 349 ? 113.511 -80.839  37.025  1.00 98.46  ? 273  HIS B CG  1 
ATOM   5365 N ND1 . HIS B 1 349 ? 114.242 -80.747  35.855  1.00 98.45  ? 273  HIS B ND1 1 
ATOM   5366 C CD2 . HIS B 1 349 ? 112.800 -81.989  37.003  1.00 99.31  ? 273  HIS B CD2 1 
ATOM   5367 C CE1 . HIS B 1 349 ? 113.935 -81.826  35.152  1.00 95.83  ? 273  HIS B CE1 1 
ATOM   5368 N NE2 . HIS B 1 349 ? 113.069 -82.602  35.801  1.00 96.58  ? 273  HIS B NE2 1 
ATOM   5369 N N   . VAL B 1 350 ? 114.787 -78.564  41.032  1.00 106.10 ? 274  VAL B N   1 
ATOM   5370 C CA  . VAL B 1 350 ? 115.197 -77.422  41.867  1.00 109.53 ? 274  VAL B CA  1 
ATOM   5371 C C   . VAL B 1 350 ? 116.668 -77.628  42.240  1.00 116.02 ? 274  VAL B C   1 
ATOM   5372 O O   . VAL B 1 350 ? 117.473 -76.713  42.074  1.00 116.74 ? 274  VAL B O   1 
ATOM   5373 C CB  . VAL B 1 350 ? 114.280 -77.230  43.114  1.00 116.11 ? 274  VAL B CB  1 
ATOM   5374 C CG1 . VAL B 1 350 ? 114.957 -76.425  44.222  1.00 120.16 ? 274  VAL B CG1 1 
ATOM   5375 C CG2 . VAL B 1 350 ? 112.963 -76.577  42.722  1.00 114.44 ? 274  VAL B CG2 1 
ATOM   5376 N N   . LEU B 1 351 ? 117.010 -78.851  42.689  1.00 113.70 ? 275  LEU B N   1 
ATOM   5377 C CA  . LEU B 1 351 ? 118.352 -79.288  43.075  1.00 115.96 ? 275  LEU B CA  1 
ATOM   5378 C C   . LEU B 1 351 ? 119.341 -79.208  41.903  1.00 118.56 ? 275  LEU B C   1 
ATOM   5379 O O   . LEU B 1 351 ? 120.503 -78.848  42.107  1.00 120.54 ? 275  LEU B O   1 
ATOM   5380 C CB  . LEU B 1 351 ? 118.272 -80.733  43.597  1.00 116.43 ? 275  LEU B CB  1 
ATOM   5381 C CG  . LEU B 1 351 ? 118.305 -80.950  45.111  1.00 125.42 ? 275  LEU B CG  1 
ATOM   5382 C CD1 . LEU B 1 351 ? 117.248 -80.119  45.833  1.00 127.24 ? 275  LEU B CD1 1 
ATOM   5383 C CD2 . LEU B 1 351 ? 118.095 -82.409  45.437  1.00 127.48 ? 275  LEU B CD2 1 
ATOM   5384 N N   . THR B 1 352 ? 118.865 -79.528  40.681  1.00 111.63 ? 276  THR B N   1 
ATOM   5385 C CA  . THR B 1 352 ? 119.628 -79.502  39.434  1.00 109.85 ? 276  THR B CA  1 
ATOM   5386 C C   . THR B 1 352 ? 119.923 -78.038  39.026  1.00 116.12 ? 276  THR B C   1 
ATOM   5387 O O   . THR B 1 352 ? 121.023 -77.762  38.542  1.00 116.44 ? 276  THR B O   1 
ATOM   5388 C CB  . THR B 1 352 ? 118.863 -80.301  38.360  1.00 115.10 ? 276  THR B CB  1 
ATOM   5389 O OG1 . THR B 1 352 ? 118.861 -81.678  38.745  1.00 115.08 ? 276  THR B OG1 1 
ATOM   5390 C CG2 . THR B 1 352 ? 119.468 -80.170  36.960  1.00 111.85 ? 276  THR B CG2 1 
ATOM   5391 N N   . PHE B 1 353 ? 118.964 -77.108  39.231  1.00 114.16 ? 277  PHE B N   1 
ATOM   5392 C CA  . PHE B 1 353 ? 119.176 -75.690  38.903  1.00 115.36 ? 277  PHE B CA  1 
ATOM   5393 C C   . PHE B 1 353 ? 120.146 -75.046  39.890  1.00 124.81 ? 277  PHE B C   1 
ATOM   5394 O O   . PHE B 1 353 ? 120.949 -74.213  39.476  1.00 125.25 ? 277  PHE B O   1 
ATOM   5395 C CB  . PHE B 1 353 ? 117.862 -74.897  38.853  1.00 116.21 ? 277  PHE B CB  1 
ATOM   5396 C CG  . PHE B 1 353 ? 118.031 -73.484  38.360  1.00 118.42 ? 277  PHE B CG  1 
ATOM   5397 C CD1 . PHE B 1 353 ? 118.261 -73.224  37.016  1.00 119.44 ? 277  PHE B CD1 1 
ATOM   5398 C CD2 . PHE B 1 353 ? 117.979 -72.413  39.243  1.00 123.69 ? 277  PHE B CD2 1 
ATOM   5399 C CE1 . PHE B 1 353 ? 118.436 -71.918  36.561  1.00 121.55 ? 277  PHE B CE1 1 
ATOM   5400 C CE2 . PHE B 1 353 ? 118.149 -71.105  38.788  1.00 127.71 ? 277  PHE B CE2 1 
ATOM   5401 C CZ  . PHE B 1 353 ? 118.376 -70.866  37.450  1.00 123.81 ? 277  PHE B CZ  1 
ATOM   5402 N N   . LEU B 1 354 ? 120.077 -75.438  41.183  1.00 125.35 ? 278  LEU B N   1 
ATOM   5403 C CA  . LEU B 1 354 ? 120.969 -74.961  42.244  1.00 130.31 ? 278  LEU B CA  1 
ATOM   5404 C C   . LEU B 1 354 ? 122.396 -75.431  41.982  1.00 137.06 ? 278  LEU B C   1 
ATOM   5405 O O   . LEU B 1 354 ? 123.344 -74.686  42.236  1.00 139.37 ? 278  LEU B O   1 
ATOM   5406 C CB  . LEU B 1 354 ? 120.499 -75.444  43.624  1.00 132.81 ? 278  LEU B CB  1 
ATOM   5407 C CG  . LEU B 1 354 ? 119.268 -74.764  44.213  1.00 138.16 ? 278  LEU B CG  1 
ATOM   5408 C CD1 . LEU B 1 354 ? 118.750 -75.539  45.402  1.00 140.34 ? 278  LEU B CD1 1 
ATOM   5409 C CD2 . LEU B 1 354 ? 119.563 -73.326  44.613  1.00 143.84 ? 278  LEU B CD2 1 
ATOM   5410 N N   . ASP B 1 355 ? 122.536 -76.666  41.452  1.00 133.14 ? 279  ASP B N   1 
ATOM   5411 C CA  . ASP B 1 355 ? 123.810 -77.282  41.079  1.00 134.28 ? 279  ASP B CA  1 
ATOM   5412 C C   . ASP B 1 355 ? 124.416 -76.568  39.866  1.00 138.21 ? 279  ASP B C   1 
ATOM   5413 O O   . ASP B 1 355 ? 125.633 -76.402  39.810  1.00 140.02 ? 279  ASP B O   1 
ATOM   5414 C CB  . ASP B 1 355 ? 123.621 -78.786  40.791  1.00 133.92 ? 279  ASP B CB  1 
ATOM   5415 C CG  . ASP B 1 355 ? 124.828 -79.470  40.179  1.00 145.91 ? 279  ASP B CG  1 
ATOM   5416 O OD1 . ASP B 1 355 ? 125.848 -79.621  40.886  1.00 149.76 ? 279  ASP B OD1 1 
ATOM   5417 O OD2 . ASP B 1 355 ? 124.755 -79.843  38.993  1.00 149.73 ? 279  ASP B OD2 1 
ATOM   5418 N N   . ALA B 1 356 ? 123.570 -76.149  38.902  1.00 132.68 ? 280  ALA B N   1 
ATOM   5419 C CA  . ALA B 1 356 ? 123.994 -75.434  37.696  1.00 131.82 ? 280  ALA B CA  1 
ATOM   5420 C C   . ALA B 1 356 ? 124.636 -74.087  38.051  1.00 139.58 ? 280  ALA B C   1 
ATOM   5421 O O   . ALA B 1 356 ? 125.648 -73.716  37.451  1.00 139.94 ? 280  ALA B O   1 
ATOM   5422 C CB  . ALA B 1 356 ? 122.809 -75.218  36.769  1.00 129.10 ? 280  ALA B CB  1 
ATOM   5423 N N   . LEU B 1 357 ? 124.064 -73.382  39.054  1.00 139.08 ? 281  LEU B N   1 
ATOM   5424 C CA  . LEU B 1 357 ? 124.546 -72.091  39.557  1.00 143.11 ? 281  LEU B CA  1 
ATOM   5425 C C   . LEU B 1 357 ? 125.888 -72.248  40.277  1.00 151.12 ? 281  LEU B C   1 
ATOM   5426 O O   . LEU B 1 357 ? 126.684 -71.310  40.276  1.00 153.50 ? 281  LEU B O   1 
ATOM   5427 C CB  . LEU B 1 357 ? 123.516 -71.441  40.493  1.00 144.71 ? 281  LEU B CB  1 
ATOM   5428 C CG  . LEU B 1 357 ? 122.138 -71.155  39.901  1.00 146.20 ? 281  LEU B CG  1 
ATOM   5429 C CD1 . LEU B 1 357 ? 121.106 -71.022  40.988  1.00 147.70 ? 281  LEU B CD1 1 
ATOM   5430 C CD2 . LEU B 1 357 ? 122.148 -69.929  38.993  1.00 148.62 ? 281  LEU B CD2 1 
ATOM   5431 N N   . ALA B 1 358 ? 126.139 -73.434  40.880  1.00 148.29 ? 282  ALA B N   1 
ATOM   5432 C CA  . ALA B 1 358 ? 127.395 -73.760  41.559  1.00 152.07 ? 282  ALA B CA  1 
ATOM   5433 C C   . ALA B 1 358 ? 128.535 -73.819  40.543  1.00 156.99 ? 282  ALA B C   1 
ATOM   5434 O O   . ALA B 1 358 ? 129.585 -73.226  40.789  1.00 160.25 ? 282  ALA B O   1 
ATOM   5435 C CB  . ALA B 1 358 ? 127.272 -75.080  42.312  1.00 152.64 ? 282  ALA B CB  1 
ATOM   5436 N N   . TRP B 1 359 ? 128.299 -74.450  39.366  1.00 150.77 ? 283  TRP B N   1 
ATOM   5437 C CA  . TRP B 1 359 ? 129.290 -74.543  38.287  1.00 150.75 ? 283  TRP B CA  1 
ATOM   5438 C C   . TRP B 1 359 ? 129.489 -73.182  37.608  1.00 157.85 ? 283  TRP B C   1 
ATOM   5439 O O   . TRP B 1 359 ? 130.566 -72.929  37.065  1.00 158.80 ? 283  TRP B O   1 
ATOM   5440 C CB  . TRP B 1 359 ? 128.917 -75.614  37.247  1.00 144.83 ? 283  TRP B CB  1 
ATOM   5441 C CG  . TRP B 1 359 ? 128.808 -77.009  37.795  1.00 145.02 ? 283  TRP B CG  1 
ATOM   5442 C CD1 . TRP B 1 359 ? 127.672 -77.749  37.919  1.00 145.20 ? 283  TRP B CD1 1 
ATOM   5443 C CD2 . TRP B 1 359 ? 129.877 -77.832  38.286  1.00 147.15 ? 283  TRP B CD2 1 
ATOM   5444 N NE1 . TRP B 1 359 ? 127.960 -78.977  38.467  1.00 145.14 ? 283  TRP B NE1 1 
ATOM   5445 C CE2 . TRP B 1 359 ? 129.307 -79.057  38.700  1.00 149.45 ? 283  TRP B CE2 1 
ATOM   5446 C CE3 . TRP B 1 359 ? 131.266 -77.655  38.414  1.00 151.75 ? 283  TRP B CE3 1 
ATOM   5447 C CZ2 . TRP B 1 359 ? 130.074 -80.099  39.232  1.00 150.49 ? 283  TRP B CZ2 1 
ATOM   5448 C CZ3 . TRP B 1 359 ? 132.024 -78.687  38.946  1.00 154.96 ? 283  TRP B CZ3 1 
ATOM   5449 C CH2 . TRP B 1 359 ? 131.429 -79.892  39.346  1.00 153.96 ? 283  TRP B CH2 1 
ATOM   5450 N N   . MET B 1 360 ? 128.458 -72.310  37.644  1.00 155.39 ? 284  MET B N   1 
ATOM   5451 C CA  . MET B 1 360 ? 128.528 -70.952  37.092  1.00 156.94 ? 284  MET B CA  1 
ATOM   5452 C C   . MET B 1 360 ? 129.378 -70.033  37.983  1.00 166.37 ? 284  MET B C   1 
ATOM   5453 O O   . MET B 1 360 ? 130.012 -69.104  37.481  1.00 167.74 ? 284  MET B O   1 
ATOM   5454 C CB  . MET B 1 360 ? 127.124 -70.346  36.936  1.00 157.33 ? 284  MET B CB  1 
ATOM   5455 C CG  . MET B 1 360 ? 126.412 -70.747  35.669  1.00 156.56 ? 284  MET B CG  1 
ATOM   5456 S SD  . MET B 1 360 ? 127.088 -69.993  34.160  1.00 160.97 ? 284  MET B SD  1 
ATOM   5457 C CE  . MET B 1 360 ? 125.809 -70.426  32.993  1.00 152.58 ? 284  MET B CE  1 
ATOM   5458 N N   . GLY B 1 361 ? 129.371 -70.310  39.289  1.00 165.77 ? 285  GLY B N   1 
ATOM   5459 C CA  . GLY B 1 361 ? 130.086 -69.543  40.302  1.00 171.33 ? 285  GLY B CA  1 
ATOM   5460 C C   . GLY B 1 361 ? 129.178 -68.644  41.119  1.00 177.48 ? 285  GLY B C   1 
ATOM   5461 O O   . GLY B 1 361 ? 129.665 -67.768  41.839  1.00 181.88 ? 285  GLY B O   1 
ATOM   5462 N N   . VAL B 1 362 ? 127.849 -68.857  41.017  1.00 170.64 ? 286  VAL B N   1 
ATOM   5463 C CA  . VAL B 1 362 ? 126.840 -68.076  41.737  1.00 171.83 ? 286  VAL B CA  1 
ATOM   5464 C C   . VAL B 1 362 ? 126.873 -68.476  43.218  1.00 180.15 ? 286  VAL B C   1 
ATOM   5465 O O   . VAL B 1 362 ? 127.229 -67.654  44.066  1.00 185.08 ? 286  VAL B O   1 
ATOM   5466 C CB  . VAL B 1 362 ? 125.420 -68.225  41.128  1.00 170.66 ? 286  VAL B CB  1 
ATOM   5467 C CG1 . VAL B 1 362 ? 124.469 -67.172  41.688  1.00 172.09 ? 286  VAL B CG1 1 
ATOM   5468 C CG2 . VAL B 1 362 ? 125.452 -68.162  39.603  1.00 166.75 ? 286  VAL B CG2 1 
ATOM   5469 N N   . ILE B 1 363 ? 126.525 -69.739  43.517  1.00 174.99 ? 287  ILE B N   1 
ATOM   5470 C CA  . ILE B 1 363 ? 126.546 -70.286  44.872  1.00 178.15 ? 287  ILE B CA  1 
ATOM   5471 C C   . ILE B 1 363 ? 127.926 -70.933  45.079  1.00 184.61 ? 287  ILE B C   1 
ATOM   5472 O O   . ILE B 1 363 ? 128.352 -71.761  44.268  1.00 180.88 ? 287  ILE B O   1 
ATOM   5473 C CB  . ILE B 1 363 ? 125.330 -71.232  45.177  1.00 178.19 ? 287  ILE B CB  1 
ATOM   5474 C CG1 . ILE B 1 363 ? 125.466 -71.956  46.547  1.00 181.98 ? 287  ILE B CG1 1 
ATOM   5475 C CG2 . ILE B 1 363 ? 125.026 -72.224  44.049  1.00 173.43 ? 287  ILE B CG2 1 
ATOM   5476 C CD1 . ILE B 1 363 ? 125.018 -71.145  47.740  1.00 192.80 ? 287  ILE B CD1 1 
ATOM   5477 N N   . ASN B 1 364 ? 128.648 -70.492  46.126  1.00 186.83 ? 288  ASN B N   1 
ATOM   5478 C CA  . ASN B 1 364 ? 130.000 -70.968  46.427  1.00 187.69 ? 288  ASN B CA  1 
ATOM   5479 C C   . ASN B 1 364 ? 130.137 -71.512  47.854  1.00 190.97 ? 288  ASN B C   1 
ATOM   5480 O O   . ASN B 1 364 ? 131.180 -72.094  48.175  1.00 191.08 ? 288  ASN B O   1 
ATOM   5481 C CB  . ASN B 1 364 ? 131.016 -69.846  46.208  1.00 189.57 ? 288  ASN B CB  1 
ATOM   5482 N N   . SER B 1 365 ? 129.117 -71.311  48.712  1.00 188.91 ? 289  SER B N   1 
ATOM   5483 C CA  . SER B 1 365 ? 129.164 -71.811  50.085  1.00 189.50 ? 289  SER B CA  1 
ATOM   5484 C C   . SER B 1 365 ? 129.005 -73.331  50.073  1.00 190.56 ? 289  SER B C   1 
ATOM   5485 O O   . SER B 1 365 ? 127.955 -73.843  49.674  1.00 189.06 ? 289  SER B O   1 
ATOM   5486 C CB  . SER B 1 365 ? 128.109 -71.138  50.958  1.00 192.42 ? 289  SER B CB  1 
ATOM   5487 O OG  . SER B 1 365 ? 126.813 -71.284  50.404  1.00 197.28 ? 289  SER B OG  1 
ATOM   5488 N N   . CYS B 1 366 ? 130.087 -74.041  50.458  1.00 188.47 ? 290  CYS B N   1 
ATOM   5489 C CA  . CYS B 1 366 ? 130.202 -75.504  50.496  1.00 187.44 ? 290  CYS B CA  1 
ATOM   5490 C C   . CYS B 1 366 ? 129.131 -76.155  51.388  1.00 189.91 ? 290  CYS B C   1 
ATOM   5491 O O   . CYS B 1 366 ? 128.734 -77.291  51.113  1.00 188.47 ? 290  CYS B O   1 
ATOM   5492 C CB  . CYS B 1 366 ? 131.605 -75.922  50.927  1.00 188.61 ? 290  CYS B CB  1 
ATOM   5493 S SG  . CYS B 1 366 ? 132.111 -75.281  52.545  1.00 193.37 ? 290  CYS B SG  1 
ATOM   5494 N N   . GLU B 1 367 ? 128.668 -75.440  52.442  1.00 188.59 ? 291  GLU B N   1 
ATOM   5495 C CA  . GLU B 1 367 ? 127.635 -75.894  53.388  1.00 188.17 ? 291  GLU B CA  1 
ATOM   5496 C C   . GLU B 1 367 ? 126.319 -76.194  52.645  1.00 188.77 ? 291  GLU B C   1 
ATOM   5497 O O   . GLU B 1 367 ? 125.706 -77.234  52.880  1.00 187.83 ? 291  GLU B O   1 
ATOM   5498 C CB  . GLU B 1 367 ? 127.395 -74.848  54.501  1.00 190.63 ? 291  GLU B CB  1 
ATOM   5499 C CG  . GLU B 1 367 ? 128.641 -74.369  55.240  1.00 199.17 ? 291  GLU B CG  1 
ATOM   5500 C CD  . GLU B 1 367 ? 129.229 -75.269  56.312  1.00 212.74 ? 291  GLU B CD  1 
ATOM   5501 O OE1 . GLU B 1 367 ? 130.464 -75.209  56.512  1.00 207.01 ? 291  GLU B OE1 1 
ATOM   5502 O OE2 . GLU B 1 367 ? 128.462 -76.000  56.980  1.00 208.64 ? 291  GLU B OE2 1 
ATOM   5503 N N   . VAL B 1 368 ? 125.920 -75.294  51.725  1.00 185.60 ? 292  VAL B N   1 
ATOM   5504 C CA  . VAL B 1 368 ? 124.715 -75.391  50.889  1.00 183.92 ? 292  VAL B CA  1 
ATOM   5505 C C   . VAL B 1 368 ? 124.931 -76.476  49.808  1.00 183.55 ? 292  VAL B C   1 
ATOM   5506 O O   . VAL B 1 368 ? 124.009 -77.249  49.543  1.00 179.47 ? 292  VAL B O   1 
ATOM   5507 C CB  . VAL B 1 368 ? 124.339 -74.000  50.278  1.00 187.00 ? 292  VAL B CB  1 
ATOM   5508 C CG1 . VAL B 1 368 ? 123.154 -74.093  49.322  1.00 183.58 ? 292  VAL B CG1 1 
ATOM   5509 C CG2 . VAL B 1 368 ? 124.047 -72.977  51.371  1.00 188.43 ? 292  VAL B CG2 1 
ATOM   5510 N N   . ILE B 1 369 ? 126.149 -76.538  49.211  1.00 179.30 ? 293  ILE B N   1 
ATOM   5511 C CA  . ILE B 1 369 ? 126.536 -77.504  48.164  1.00 174.72 ? 293  ILE B CA  1 
ATOM   5512 C C   . ILE B 1 369 ? 126.438 -78.951  48.710  1.00 178.08 ? 293  ILE B C   1 
ATOM   5513 O O   . ILE B 1 369 ? 125.987 -79.843  47.987  1.00 173.82 ? 293  ILE B O   1 
ATOM   5514 C CB  . ILE B 1 369 ? 127.950 -77.182  47.570  1.00 178.76 ? 293  ILE B CB  1 
ATOM   5515 C CG1 . ILE B 1 369 ? 127.961 -75.789  46.868  1.00 178.50 ? 293  ILE B CG1 1 
ATOM   5516 C CG2 . ILE B 1 369 ? 128.416 -78.280  46.594  1.00 175.89 ? 293  ILE B CG2 1 
ATOM   5517 C CD1 . ILE B 1 369 ? 129.313 -75.087  46.794  1.00 188.28 ? 293  ILE B CD1 1 
ATOM   5518 N N   . ALA B 1 370 ? 126.823 -79.164  49.983  1.00 178.68 ? 294  ALA B N   1 
ATOM   5519 C CA  . ALA B 1 370 ? 126.769 -80.469  50.646  1.00 178.51 ? 294  ALA B CA  1 
ATOM   5520 C C   . ALA B 1 370 ? 125.326 -80.983  50.766  1.00 179.43 ? 294  ALA B C   1 
ATOM   5521 O O   . ALA B 1 370 ? 125.079 -82.170  50.533  1.00 176.73 ? 294  ALA B O   1 
ATOM   5522 C CB  . ALA B 1 370 ? 127.409 -80.378  52.022  1.00 180.54 ? 294  ALA B CB  1 
ATOM   5523 N N   . VAL B 1 371 ? 124.376 -80.077  51.094  1.00 175.59 ? 295  VAL B N   1 
ATOM   5524 C CA  . VAL B 1 371 ? 122.943 -80.371  51.251  1.00 173.25 ? 295  VAL B CA  1 
ATOM   5525 C C   . VAL B 1 371 ? 122.366 -80.900  49.917  1.00 170.40 ? 295  VAL B C   1 
ATOM   5526 O O   . VAL B 1 371 ? 121.646 -81.905  49.932  1.00 168.73 ? 295  VAL B O   1 
ATOM   5527 C CB  . VAL B 1 371 ? 122.159 -79.133  51.784  1.00 178.99 ? 295  VAL B CB  1 
ATOM   5528 C CG1 . VAL B 1 371 ? 120.659 -79.411  51.884  1.00 176.77 ? 295  VAL B CG1 1 
ATOM   5529 C CG2 . VAL B 1 371 ? 122.699 -78.681  53.138  1.00 181.29 ? 295  VAL B CG2 1 
ATOM   5530 N N   . ILE B 1 372 ? 122.708 -80.250  48.777  1.00 162.84 ? 296  ILE B N   1 
ATOM   5531 C CA  . ILE B 1 372 ? 122.253 -80.657  47.438  1.00 156.65 ? 296  ILE B CA  1 
ATOM   5532 C C   . ILE B 1 372 ? 122.657 -82.122  47.193  1.00 159.80 ? 296  ILE B C   1 
ATOM   5533 O O   . ILE B 1 372 ? 121.807 -82.944  46.840  1.00 156.21 ? 296  ILE B O   1 
ATOM   5534 C CB  . ILE B 1 372 ? 122.792 -79.707  46.322  1.00 157.23 ? 296  ILE B CB  1 
ATOM   5535 C CG1 . ILE B 1 372 ? 122.384 -78.234  46.576  1.00 158.79 ? 296  ILE B CG1 1 
ATOM   5536 C CG2 . ILE B 1 372 ? 122.341 -80.175  44.927  1.00 152.50 ? 296  ILE B CG2 1 
ATOM   5537 C CD1 . ILE B 1 372 ? 123.171 -77.162  45.768  1.00 164.21 ? 296  ILE B CD1 1 
ATOM   5538 N N   . ASP B 1 373 ? 123.943 -82.438  47.449  1.00 159.85 ? 297  ASP B N   1 
ATOM   5539 C CA  . ASP B 1 373 ? 124.562 -83.753  47.288  1.00 159.59 ? 297  ASP B CA  1 
ATOM   5540 C C   . ASP B 1 373 ? 123.871 -84.835  48.136  1.00 164.17 ? 297  ASP B C   1 
ATOM   5541 O O   . ASP B 1 373 ? 123.650 -85.940  47.639  1.00 161.72 ? 297  ASP B O   1 
ATOM   5542 C CB  . ASP B 1 373 ? 126.063 -83.680  47.641  1.00 165.19 ? 297  ASP B CB  1 
ATOM   5543 C CG  . ASP B 1 373 ? 126.883 -82.717  46.793  1.00 175.81 ? 297  ASP B CG  1 
ATOM   5544 O OD1 . ASP B 1 373 ? 126.620 -82.622  45.572  1.00 172.69 ? 297  ASP B OD1 1 
ATOM   5545 O OD2 . ASP B 1 373 ? 127.825 -82.100  47.339  1.00 184.70 ? 297  ASP B OD2 1 
ATOM   5546 N N   . LEU B 1 374 ? 123.521 -84.516  49.390  1.00 163.76 ? 298  LEU B N   1 
ATOM   5547 C CA  . LEU B 1 374 ? 122.876 -85.455  50.309  1.00 165.33 ? 298  LEU B CA  1 
ATOM   5548 C C   . LEU B 1 374 ? 121.413 -85.757  49.892  1.00 164.50 ? 298  LEU B C   1 
ATOM   5549 O O   . LEU B 1 374 ? 120.974 -86.914  49.965  1.00 163.72 ? 298  LEU B O   1 
ATOM   5550 C CB  . LEU B 1 374 ? 122.988 -84.954  51.778  1.00 171.19 ? 298  LEU B CB  1 
ATOM   5551 C CG  . LEU B 1 374 ? 122.031 -83.939  52.416  1.00 177.24 ? 298  LEU B CG  1 
ATOM   5552 C CD1 . LEU B 1 374 ? 120.818 -84.635  53.005  1.00 177.32 ? 298  LEU B CD1 1 
ATOM   5553 C CD2 . LEU B 1 374 ? 122.712 -83.219  53.587  1.00 180.38 ? 298  LEU B CD2 1 
ATOM   5554 N N   . ALA B 1 375 ? 120.680 -84.715  49.462  1.00 157.73 ? 299  ALA B N   1 
ATOM   5555 C CA  . ALA B 1 375 ? 119.270 -84.790  49.083  1.00 154.00 ? 299  ALA B CA  1 
ATOM   5556 C C   . ALA B 1 375 ? 119.032 -85.429  47.702  1.00 151.37 ? 299  ALA B C   1 
ATOM   5557 O O   . ALA B 1 375 ? 117.961 -86.009  47.482  1.00 148.98 ? 299  ALA B O   1 
ATOM   5558 C CB  . ALA B 1 375 ? 118.660 -83.399  49.113  1.00 154.52 ? 299  ALA B CB  1 
ATOM   5559 N N   . LEU B 1 376 ? 120.028 -85.333  46.795  1.00 145.06 ? 300  LEU B N   1 
ATOM   5560 C CA  . LEU B 1 376 ? 119.999 -85.826  45.411  1.00 139.98 ? 300  LEU B CA  1 
ATOM   5561 C C   . LEU B 1 376 ? 119.397 -87.262  45.234  1.00 139.89 ? 300  LEU B C   1 
ATOM   5562 O O   . LEU B 1 376 ? 118.499 -87.372  44.400  1.00 135.97 ? 300  LEU B O   1 
ATOM   5563 C CB  . LEU B 1 376 ? 121.404 -85.762  44.786  1.00 140.17 ? 300  LEU B CB  1 
ATOM   5564 C CG  . LEU B 1 376 ? 121.487 -85.882  43.260  1.00 140.81 ? 300  LEU B CG  1 
ATOM   5565 C CD1 . LEU B 1 376 ? 121.382 -84.516  42.592  1.00 139.26 ? 300  LEU B CD1 1 
ATOM   5566 C CD2 . LEU B 1 376 ? 122.776 -86.576  42.841  1.00 143.77 ? 300  LEU B CD2 1 
ATOM   5567 N N   . PRO B 1 377 ? 119.801 -88.351  45.957  1.00 137.20 ? 301  PRO B N   1 
ATOM   5568 C CA  . PRO B 1 377 ? 119.187 -89.670  45.691  1.00 134.83 ? 301  PRO B CA  1 
ATOM   5569 C C   . PRO B 1 377 ? 117.719 -89.786  46.124  1.00 135.17 ? 301  PRO B C   1 
ATOM   5570 O O   . PRO B 1 377 ? 117.021 -90.661  45.618  1.00 132.54 ? 301  PRO B O   1 
ATOM   5571 C CB  . PRO B 1 377 ? 120.069 -90.646  46.479  1.00 140.51 ? 301  PRO B CB  1 
ATOM   5572 C CG  . PRO B 1 377 ? 121.324 -89.884  46.798  1.00 147.43 ? 301  PRO B CG  1 
ATOM   5573 C CD  . PRO B 1 377 ? 120.863 -88.475  46.977  1.00 142.96 ? 301  PRO B CD  1 
ATOM   5574 N N   . PHE B 1 378 ? 117.252 -88.919  47.046  1.00 131.81 ? 302  PHE B N   1 
ATOM   5575 C CA  . PHE B 1 378 ? 115.855 -88.891  47.502  1.00 130.81 ? 302  PHE B CA  1 
ATOM   5576 C C   . PHE B 1 378 ? 114.975 -88.165  46.465  1.00 128.07 ? 302  PHE B C   1 
ATOM   5577 O O   . PHE B 1 378 ? 113.807 -88.519  46.277  1.00 126.27 ? 302  PHE B O   1 
ATOM   5578 C CB  . PHE B 1 378 ? 115.765 -88.207  48.875  1.00 136.83 ? 302  PHE B CB  1 
ATOM   5579 N N   . ALA B 1 379 ? 115.557 -87.165  45.782  1.00 121.01 ? 303  ALA B N   1 
ATOM   5580 C CA  . ALA B 1 379 ? 114.906 -86.410  44.718  1.00 116.28 ? 303  ALA B CA  1 
ATOM   5581 C C   . ALA B 1 379 ? 114.774 -87.280  43.456  1.00 115.38 ? 303  ALA B C   1 
ATOM   5582 O O   . ALA B 1 379 ? 113.758 -87.188  42.761  1.00 112.76 ? 303  ALA B O   1 
ATOM   5583 C CB  . ALA B 1 379 ? 115.701 -85.153  44.421  1.00 116.67 ? 303  ALA B CB  1 
ATOM   5584 N N   . ILE B 1 380 ? 115.791 -88.150  43.194  1.00 110.63 ? 304  ILE B N   1 
ATOM   5585 C CA  . ILE B 1 380 ? 115.886 -89.104  42.068  1.00 107.06 ? 304  ILE B CA  1 
ATOM   5586 C C   . ILE B 1 380 ? 114.808 -90.212  42.219  1.00 110.01 ? 304  ILE B C   1 
ATOM   5587 O O   . ILE B 1 380 ? 114.297 -90.719  41.213  1.00 106.56 ? 304  ILE B O   1 
ATOM   5588 C CB  . ILE B 1 380 ? 117.345 -89.681  41.973  1.00 110.87 ? 304  ILE B CB  1 
ATOM   5589 C CG1 . ILE B 1 380 ? 118.305 -88.650  41.336  1.00 109.90 ? 304  ILE B CG1 1 
ATOM   5590 C CG2 . ILE B 1 380 ? 117.421 -91.025  41.221  1.00 109.97 ? 304  ILE B CG2 1 
ATOM   5591 C CD1 . ILE B 1 380 ? 119.789 -88.843  41.641  1.00 116.60 ? 304  ILE B CD1 1 
ATOM   5592 N N   . LEU B 1 381 ? 114.475 -90.573  43.472  1.00 109.79 ? 305  LEU B N   1 
ATOM   5593 C CA  . LEU B 1 381 ? 113.470 -91.587  43.788  1.00 110.51 ? 305  LEU B CA  1 
ATOM   5594 C C   . LEU B 1 381 ? 112.046 -91.083  43.485  1.00 113.94 ? 305  LEU B C   1 
ATOM   5595 O O   . LEU B 1 381 ? 111.218 -91.869  43.015  1.00 112.93 ? 305  LEU B O   1 
ATOM   5596 C CB  . LEU B 1 381 ? 113.595 -92.020  45.264  1.00 114.86 ? 305  LEU B CB  1 
ATOM   5597 C CG  . LEU B 1 381 ? 112.693 -93.171  45.705  1.00 120.93 ? 305  LEU B CG  1 
ATOM   5598 C CD1 . LEU B 1 381 ? 113.100 -94.478  45.055  1.00 120.35 ? 305  LEU B CD1 1 
ATOM   5599 C CD2 . LEU B 1 381 ? 112.686 -93.297  47.193  1.00 128.05 ? 305  LEU B CD2 1 
ATOM   5600 N N   . LEU B 1 382 ? 111.770 -89.781  43.740  1.00 110.82 ? 306  LEU B N   1 
ATOM   5601 C CA  . LEU B 1 382 ? 110.471 -89.145  43.482  1.00 109.47 ? 306  LEU B CA  1 
ATOM   5602 C C   . LEU B 1 382 ? 110.106 -89.184  41.993  1.00 109.62 ? 306  LEU B C   1 
ATOM   5603 O O   . LEU B 1 382 ? 108.931 -89.324  41.655  1.00 108.01 ? 306  LEU B O   1 
ATOM   5604 C CB  . LEU B 1 382 ? 110.460 -87.695  43.990  1.00 110.39 ? 306  LEU B CB  1 
ATOM   5605 C CG  . LEU B 1 382 ? 110.176 -87.495  45.473  1.00 118.98 ? 306  LEU B CG  1 
ATOM   5606 C CD1 . LEU B 1 382 ? 110.534 -86.090  45.894  1.00 120.21 ? 306  LEU B CD1 1 
ATOM   5607 C CD2 . LEU B 1 382 ? 108.712 -87.773  45.801  1.00 121.61 ? 306  LEU B CD2 1 
ATOM   5608 N N   . GLY B 1 383 ? 111.122 -89.084  41.134  1.00 104.83 ? 307  GLY B N   1 
ATOM   5609 C CA  . GLY B 1 383 ? 110.981 -89.178  39.686  1.00 101.46 ? 307  GLY B CA  1 
ATOM   5610 C C   . GLY B 1 383 ? 110.463 -90.541  39.265  1.00 105.56 ? 307  GLY B C   1 
ATOM   5611 O O   . GLY B 1 383 ? 109.583 -90.631  38.404  1.00 103.42 ? 307  GLY B O   1 
ATOM   5612 N N   . PHE B 1 384 ? 110.982 -91.611  39.909  1.00 104.56 ? 308  PHE B N   1 
ATOM   5613 C CA  . PHE B 1 384 ? 110.581 -93.003  39.682  1.00 104.78 ? 308  PHE B CA  1 
ATOM   5614 C C   . PHE B 1 384 ? 109.188 -93.276  40.263  1.00 110.44 ? 308  PHE B C   1 
ATOM   5615 O O   . PHE B 1 384 ? 108.463 -94.115  39.730  1.00 108.93 ? 308  PHE B O   1 
ATOM   5616 C CB  . PHE B 1 384 ? 111.607 -93.973  40.291  1.00 108.93 ? 308  PHE B CB  1 
ATOM   5617 N N   . THR B 1 385 ? 108.824 -92.563  41.356  1.00 110.10 ? 309  THR B N   1 
ATOM   5618 C CA  . THR B 1 385 ? 107.534 -92.671  42.055  1.00 112.48 ? 309  THR B CA  1 
ATOM   5619 C C   . THR B 1 385 ? 106.383 -92.217  41.134  1.00 114.81 ? 309  THR B C   1 
ATOM   5620 O O   . THR B 1 385 ? 105.273 -92.745  41.242  1.00 115.05 ? 309  THR B O   1 
ATOM   5621 C CB  . THR B 1 385 ? 107.571 -91.864  43.371  1.00 123.92 ? 309  THR B CB  1 
ATOM   5622 O OG1 . THR B 1 385 ? 108.748 -92.211  44.095  1.00 125.41 ? 309  THR B OG1 1 
ATOM   5623 C CG2 . THR B 1 385 ? 106.351 -92.110  44.257  1.00 125.16 ? 309  THR B CG2 1 
ATOM   5624 N N   . ASN B 1 386 ? 106.664 -91.271  40.210  1.00 109.20 ? 310  ASN B N   1 
ATOM   5625 C CA  . ASN B 1 386 ? 105.704 -90.765  39.224  1.00 106.76 ? 310  ASN B CA  1 
ATOM   5626 C C   . ASN B 1 386 ? 105.148 -91.913  38.359  1.00 110.24 ? 310  ASN B C   1 
ATOM   5627 O O   . ASN B 1 386 ? 103.981 -91.871  37.976  1.00 109.19 ? 310  ASN B O   1 
ATOM   5628 C CB  . ASN B 1 386 ? 106.366 -89.695  38.350  1.00 105.36 ? 310  ASN B CB  1 
ATOM   5629 C CG  . ASN B 1 386 ? 105.460 -89.026  37.344  1.00 130.84 ? 310  ASN B CG  1 
ATOM   5630 O OD1 . ASN B 1 386 ? 105.709 -89.066  36.133  1.00 123.38 ? 310  ASN B OD1 1 
ATOM   5631 N ND2 . ASN B 1 386 ? 104.415 -88.356  37.819  1.00 124.53 ? 310  ASN B ND2 1 
ATOM   5632 N N   . SER B 1 387 ? 105.977 -92.949  38.099  1.00 107.76 ? 311  SER B N   1 
ATOM   5633 C CA  . SER B 1 387 ? 105.625 -94.152  37.337  1.00 107.64 ? 311  SER B CA  1 
ATOM   5634 C C   . SER B 1 387 ? 104.615 -95.020  38.094  1.00 115.11 ? 311  SER B C   1 
ATOM   5635 O O   . SER B 1 387 ? 103.877 -95.780  37.468  1.00 113.88 ? 311  SER B O   1 
ATOM   5636 C CB  . SER B 1 387 ? 106.875 -94.971  37.029  1.00 111.46 ? 311  SER B CB  1 
ATOM   5637 O OG  . SER B 1 387 ? 107.798 -94.230  36.247  1.00 119.02 ? 311  SER B OG  1 
ATOM   5638 N N   . CYS B 1 388 ? 104.604 -94.922  39.435  1.00 116.09 ? 312  CYS B N   1 
ATOM   5639 C CA  . CYS B 1 388 ? 103.681 -95.662  40.301  1.00 119.72 ? 312  CYS B CA  1 
ATOM   5640 C C   . CYS B 1 388 ? 102.340 -94.920  40.370  1.00 123.99 ? 312  CYS B C   1 
ATOM   5641 O O   . CYS B 1 388 ? 101.298 -95.552  40.550  1.00 125.80 ? 312  CYS B O   1 
ATOM   5642 C CB  . CYS B 1 388 ? 104.269 -95.874  41.697  1.00 123.53 ? 312  CYS B CB  1 
ATOM   5643 S SG  . CYS B 1 388 ? 106.003 -96.409  41.720  1.00 127.67 ? 312  CYS B SG  1 
ATOM   5644 N N   . VAL B 1 389 ? 102.377 -93.580  40.248  1.00 118.30 ? 313  VAL B N   1 
ATOM   5645 C CA  . VAL B 1 389 ? 101.199 -92.714  40.308  1.00 117.71 ? 313  VAL B CA  1 
ATOM   5646 C C   . VAL B 1 389 ? 100.399 -92.824  38.997  1.00 118.47 ? 313  VAL B C   1 
ATOM   5647 O O   . VAL B 1 389 ? 99.181  -92.983  39.056  1.00 118.89 ? 313  VAL B O   1 
ATOM   5648 C CB  . VAL B 1 389 ? 101.579 -91.237  40.629  1.00 121.07 ? 313  VAL B CB  1 
ATOM   5649 C CG1 . VAL B 1 389 ? 100.335 -90.368  40.793  1.00 121.21 ? 313  VAL B CG1 1 
ATOM   5650 C CG2 . VAL B 1 389 ? 102.447 -91.143  41.880  1.00 123.59 ? 313  VAL B CG2 1 
ATOM   5651 N N   . ASN B 1 390 ? 101.093 -92.756  37.830  1.00 112.14 ? 314  ASN B N   1 
ATOM   5652 C CA  . ASN B 1 390 ? 100.537 -92.802  36.466  1.00 109.67 ? 314  ASN B CA  1 
ATOM   5653 C C   . ASN B 1 390 ? 99.370  -93.812  36.269  1.00 115.64 ? 314  ASN B C   1 
ATOM   5654 O O   . ASN B 1 390 ? 98.342  -93.368  35.752  1.00 114.93 ? 314  ASN B O   1 
ATOM   5655 C CB  . ASN B 1 390 ? 101.630 -93.062  35.424  1.00 107.51 ? 314  ASN B CB  1 
ATOM   5656 C CG  . ASN B 1 390 ? 102.543 -91.891  35.163  1.00 125.53 ? 314  ASN B CG  1 
ATOM   5657 O OD1 . ASN B 1 390 ? 102.257 -90.734  35.513  1.00 115.72 ? 314  ASN B OD1 1 
ATOM   5658 N ND2 . ASN B 1 390 ? 103.677 -92.175  34.540  1.00 117.12 ? 314  ASN B ND2 1 
ATOM   5659 N N   . PRO B 1 391 ? 99.441  -95.114  36.681  1.00 114.59 ? 315  PRO B N   1 
ATOM   5660 C CA  . PRO B 1 391 ? 98.279  -96.014  36.478  1.00 116.25 ? 315  PRO B CA  1 
ATOM   5661 C C   . PRO B 1 391 ? 96.964  -95.522  37.111  1.00 121.57 ? 315  PRO B C   1 
ATOM   5662 O O   . PRO B 1 391 ? 95.891  -95.752  36.547  1.00 121.24 ? 315  PRO B O   1 
ATOM   5663 C CB  . PRO B 1 391 ? 98.729  -97.313  37.148  1.00 120.72 ? 315  PRO B CB  1 
ATOM   5664 C CG  . PRO B 1 391 ? 100.204 -97.280  37.074  1.00 123.81 ? 315  PRO B CG  1 
ATOM   5665 C CD  . PRO B 1 391 ? 100.563 -95.850  37.302  1.00 117.48 ? 315  PRO B CD  1 
ATOM   5666 N N   . PHE B 1 392 ? 97.057  -94.833  38.265  1.00 119.32 ? 316  PHE B N   1 
ATOM   5667 C CA  . PHE B 1 392 ? 95.919  -94.287  39.010  1.00 120.82 ? 316  PHE B CA  1 
ATOM   5668 C C   . PHE B 1 392 ? 95.376  -92.995  38.382  1.00 122.41 ? 316  PHE B C   1 
ATOM   5669 O O   . PHE B 1 392 ? 94.204  -92.671  38.584  1.00 123.36 ? 316  PHE B O   1 
ATOM   5670 C CB  . PHE B 1 392 ? 96.319  -94.024  40.474  1.00 124.99 ? 316  PHE B CB  1 
ATOM   5671 C CG  . PHE B 1 392 ? 96.629  -95.269  41.274  1.00 129.84 ? 316  PHE B CG  1 
ATOM   5672 C CD1 . PHE B 1 392 ? 97.918  -95.785  41.316  1.00 132.60 ? 316  PHE B CD1 1 
ATOM   5673 C CD2 . PHE B 1 392 ? 95.635  -95.915  42.001  1.00 136.00 ? 316  PHE B CD2 1 
ATOM   5674 C CE1 . PHE B 1 392 ? 98.203  -96.941  42.052  1.00 136.91 ? 316  PHE B CE1 1 
ATOM   5675 C CE2 . PHE B 1 392 ? 95.920  -97.072  42.735  1.00 142.19 ? 316  PHE B CE2 1 
ATOM   5676 C CZ  . PHE B 1 392 ? 97.202  -97.578  42.755  1.00 139.79 ? 316  PHE B CZ  1 
ATOM   5677 N N   . LEU B 1 393 ? 96.220  -92.260  37.635  1.00 115.56 ? 317  LEU B N   1 
ATOM   5678 C CA  . LEU B 1 393 ? 95.855  -90.986  37.013  1.00 113.03 ? 317  LEU B CA  1 
ATOM   5679 C C   . LEU B 1 393 ? 95.191  -91.121  35.655  1.00 115.93 ? 317  LEU B C   1 
ATOM   5680 O O   . LEU B 1 393 ? 94.410  -90.242  35.284  1.00 115.20 ? 317  LEU B O   1 
ATOM   5681 C CB  . LEU B 1 393 ? 97.096  -90.094  36.827  1.00 110.79 ? 317  LEU B CB  1 
ATOM   5682 C CG  . LEU B 1 393 ? 97.759  -89.494  38.059  1.00 116.89 ? 317  LEU B CG  1 
ATOM   5683 C CD1 . LEU B 1 393 ? 99.037  -88.778  37.669  1.00 115.14 ? 317  LEU B CD1 1 
ATOM   5684 C CD2 . LEU B 1 393 ? 96.838  -88.521  38.770  1.00 120.44 ? 317  LEU B CD2 1 
ATOM   5685 N N   . TYR B 1 394 ? 95.545  -92.150  34.878  1.00 112.36 ? 318  TYR B N   1 
ATOM   5686 C CA  . TYR B 1 394 ? 95.032  -92.240  33.520  1.00 111.16 ? 318  TYR B CA  1 
ATOM   5687 C C   . TYR B 1 394 ? 94.243  -93.514  33.227  1.00 118.55 ? 318  TYR B C   1 
ATOM   5688 O O   . TYR B 1 394 ? 93.153  -93.415  32.662  1.00 118.84 ? 318  TYR B O   1 
ATOM   5689 C CB  . TYR B 1 394 ? 96.187  -92.097  32.515  1.00 109.39 ? 318  TYR B CB  1 
ATOM   5690 C CG  . TYR B 1 394 ? 96.885  -90.754  32.563  1.00 109.35 ? 318  TYR B CG  1 
ATOM   5691 C CD1 . TYR B 1 394 ? 96.280  -89.614  32.043  1.00 110.39 ? 318  TYR B CD1 1 
ATOM   5692 C CD2 . TYR B 1 394 ? 98.158  -90.626  33.112  1.00 109.74 ? 318  TYR B CD2 1 
ATOM   5693 C CE1 . TYR B 1 394 ? 96.913  -88.375  32.087  1.00 110.04 ? 318  TYR B CE1 1 
ATOM   5694 C CE2 . TYR B 1 394 ? 98.803  -89.391  33.160  1.00 109.25 ? 318  TYR B CE2 1 
ATOM   5695 C CZ  . TYR B 1 394 ? 98.179  -88.270  32.638  1.00 116.16 ? 318  TYR B CZ  1 
ATOM   5696 O OH  . TYR B 1 394 ? 98.804  -87.047  32.672  1.00 116.58 ? 318  TYR B OH  1 
ATOM   5697 N N   . CYS B 1 395 ? 94.781  -94.696  33.575  1.00 117.05 ? 319  CYS B N   1 
ATOM   5698 C CA  . CYS B 1 395 ? 94.125  -95.967  33.266  1.00 119.18 ? 319  CYS B CA  1 
ATOM   5699 C C   . CYS B 1 395 ? 92.968  -96.273  34.200  1.00 127.66 ? 319  CYS B C   1 
ATOM   5700 O O   . CYS B 1 395 ? 91.892  -96.649  33.720  1.00 128.65 ? 319  CYS B O   1 
ATOM   5701 C CB  . CYS B 1 395 ? 95.129  -97.115  33.256  1.00 119.86 ? 319  CYS B CB  1 
ATOM   5702 S SG  . CYS B 1 395 ? 94.434  -98.689  32.697  1.00 126.25 ? 319  CYS B SG  1 
ATOM   5703 N N   . PHE B 1 396 ? 93.189  -96.150  35.525  1.00 126.63 ? 320  PHE B N   1 
ATOM   5704 C CA  . PHE B 1 396 ? 92.180  -96.512  36.518  1.00 130.19 ? 320  PHE B CA  1 
ATOM   5705 C C   . PHE B 1 396 ? 91.002  -95.507  36.564  1.00 135.64 ? 320  PHE B C   1 
ATOM   5706 O O   . PHE B 1 396 ? 89.947  -95.857  37.086  1.00 138.18 ? 320  PHE B O   1 
ATOM   5707 C CB  . PHE B 1 396 ? 92.809  -96.737  37.913  1.00 133.80 ? 320  PHE B CB  1 
ATOM   5708 C CG  . PHE B 1 396 ? 93.908  -97.793  37.994  1.00 135.45 ? 320  PHE B CG  1 
ATOM   5709 C CD1 . PHE B 1 396 ? 93.960  -98.852  37.084  1.00 138.14 ? 320  PHE B CD1 1 
ATOM   5710 C CD2 . PHE B 1 396 ? 94.878  -97.734  38.986  1.00 137.88 ? 320  PHE B CD2 1 
ATOM   5711 C CE1 . PHE B 1 396 ? 94.987  -99.807  37.147  1.00 139.38 ? 320  PHE B CE1 1 
ATOM   5712 C CE2 . PHE B 1 396 ? 95.895  -98.694  39.055  1.00 140.97 ? 320  PHE B CE2 1 
ATOM   5713 C CZ  . PHE B 1 396 ? 95.942  -99.722  38.136  1.00 138.84 ? 320  PHE B CZ  1 
ATOM   5714 N N   . VAL B 1 397 ? 91.149  -94.310  35.962  1.00 130.64 ? 321  VAL B N   1 
ATOM   5715 C CA  . VAL B 1 397 ? 90.071  -93.306  35.892  1.00 131.02 ? 321  VAL B CA  1 
ATOM   5716 C C   . VAL B 1 397 ? 89.825  -92.896  34.410  1.00 133.54 ? 321  VAL B C   1 
ATOM   5717 O O   . VAL B 1 397 ? 89.363  -91.781  34.131  1.00 131.63 ? 321  VAL B O   1 
ATOM   5718 C CB  . VAL B 1 397 ? 90.305  -92.071  36.818  1.00 134.79 ? 321  VAL B CB  1 
ATOM   5719 C CG1 . VAL B 1 397 ? 90.112  -92.426  38.290  1.00 138.03 ? 321  VAL B CG1 1 
ATOM   5720 C CG2 . VAL B 1 397 ? 91.661  -91.401  36.574  1.00 131.76 ? 321  VAL B CG2 1 
ATOM   5721 N N   . GLY B 1 398 ? 90.115  -93.824  33.494  1.00 130.67 ? 322  GLY B N   1 
ATOM   5722 C CA  . GLY B 1 398 ? 89.976  -93.625  32.054  1.00 128.70 ? 322  GLY B CA  1 
ATOM   5723 C C   . GLY B 1 398 ? 88.545  -93.558  31.567  1.00 134.13 ? 322  GLY B C   1 
ATOM   5724 O O   . GLY B 1 398 ? 88.149  -92.591  30.900  1.00 132.41 ? 322  GLY B O   1 
ATOM   5725 N N   . ASN B 1 399 ? 87.766  -94.602  31.892  1.00 133.64 ? 323  ASN B N   1 
ATOM   5726 C CA  . ASN B 1 399 ? 86.360  -94.719  31.499  1.00 135.76 ? 323  ASN B CA  1 
ATOM   5727 C C   . ASN B 1 399 ? 85.505  -93.621  32.151  1.00 139.93 ? 323  ASN B C   1 
ATOM   5728 O O   . ASN B 1 399 ? 84.639  -93.050  31.483  1.00 139.08 ? 323  ASN B O   1 
ATOM   5729 C CB  . ASN B 1 399 ? 85.815  -96.105  31.864  1.00 142.57 ? 323  ASN B CB  1 
ATOM   5730 C CG  . ASN B 1 399 ? 86.575  -97.274  31.265  1.00 172.59 ? 323  ASN B CG  1 
ATOM   5731 O OD1 . ASN B 1 399 ? 87.282  -97.154  30.255  1.00 164.08 ? 323  ASN B OD1 1 
ATOM   5732 N ND2 . ASN B 1 399 ? 86.433  -98.445  31.873  1.00 169.78 ? 323  ASN B ND2 1 
ATOM   5733 N N   . ARG B 1 400 ? 85.782  -93.320  33.445  1.00 137.28 ? 324  ARG B N   1 
ATOM   5734 C CA  . ARG B 1 400 ? 85.113  -92.310  34.276  1.00 137.78 ? 324  ARG B CA  1 
ATOM   5735 C C   . ARG B 1 400 ? 85.210  -90.896  33.671  1.00 137.59 ? 324  ARG B C   1 
ATOM   5736 O O   . ARG B 1 400 ? 84.217  -90.171  33.688  1.00 138.10 ? 324  ARG B O   1 
ATOM   5737 C CB  . ARG B 1 400 ? 85.707  -92.311  35.697  1.00 139.45 ? 324  ARG B CB  1 
ATOM   5738 N N   . PHE B 1 401 ? 86.390  -90.518  33.134  1.00 130.11 ? 325  PHE B N   1 
ATOM   5739 C CA  . PHE B 1 401 ? 86.634  -89.211  32.520  1.00 126.91 ? 325  PHE B CA  1 
ATOM   5740 C C   . PHE B 1 401 ? 85.751  -88.986  31.289  1.00 130.12 ? 325  PHE B C   1 
ATOM   5741 O O   . PHE B 1 401 ? 85.137  -87.928  31.176  1.00 129.29 ? 325  PHE B O   1 
ATOM   5742 C CB  . PHE B 1 401 ? 88.113  -89.060  32.140  1.00 125.71 ? 325  PHE B CB  1 
ATOM   5743 N N   . GLN B 1 402 ? 85.676  -89.984  30.387  1.00 126.94 ? 326  GLN B N   1 
ATOM   5744 C CA  . GLN B 1 402 ? 84.896  -89.932  29.145  1.00 126.75 ? 326  GLN B CA  1 
ATOM   5745 C C   . GLN B 1 402 ? 83.374  -89.914  29.404  1.00 132.86 ? 326  GLN B C   1 
ATOM   5746 O O   . GLN B 1 402 ? 82.659  -89.135  28.764  1.00 132.07 ? 326  GLN B O   1 
ATOM   5747 C CB  . GLN B 1 402 ? 85.265  -91.121  28.241  1.00 128.18 ? 326  GLN B CB  1 
ATOM   5748 N N   . GLN B 1 403 ? 82.891  -90.771  30.335  1.00 131.57 ? 327  GLN B N   1 
ATOM   5749 C CA  . GLN B 1 403 ? 81.477  -90.890  30.699  1.00 134.10 ? 327  GLN B CA  1 
ATOM   5750 C C   . GLN B 1 403 ? 80.946  -89.621  31.380  1.00 136.63 ? 327  GLN B C   1 
ATOM   5751 O O   . GLN B 1 403 ? 79.796  -89.248  31.141  1.00 137.75 ? 327  GLN B O   1 
ATOM   5752 C CB  . GLN B 1 403 ? 81.253  -92.105  31.610  1.00 138.56 ? 327  GLN B CB  1 
ATOM   5753 N N   . LYS B 1 404 ? 81.773  -88.965  32.218  1.00 130.74 ? 328  LYS B N   1 
ATOM   5754 C CA  . LYS B 1 404 ? 81.386  -87.742  32.923  1.00 130.51 ? 328  LYS B CA  1 
ATOM   5755 C C   . LYS B 1 404 ? 81.514  -86.494  32.020  1.00 131.58 ? 328  LYS B C   1 
ATOM   5756 O O   . LYS B 1 404 ? 80.874  -85.479  32.303  1.00 131.41 ? 328  LYS B O   1 
ATOM   5757 C CB  . LYS B 1 404 ? 82.203  -87.565  34.209  1.00 132.72 ? 328  LYS B CB  1 
ATOM   5758 N N   . LEU B 1 405 ? 82.321  -86.576  30.934  1.00 125.80 ? 329  LEU B N   1 
ATOM   5759 C CA  . LEU B 1 405 ? 82.510  -85.480  29.973  1.00 123.37 ? 329  LEU B CA  1 
ATOM   5760 C C   . LEU B 1 405 ? 81.371  -85.464  28.956  1.00 128.54 ? 329  LEU B C   1 
ATOM   5761 O O   . LEU B 1 405 ? 80.881  -84.387  28.612  1.00 127.95 ? 329  LEU B O   1 
ATOM   5762 C CB  . LEU B 1 405 ? 83.876  -85.595  29.257  1.00 120.30 ? 329  LEU B CB  1 
ATOM   5763 C CG  . LEU B 1 405 ? 84.499  -84.342  28.602  1.00 122.10 ? 329  LEU B CG  1 
ATOM   5764 C CD1 . LEU B 1 405 ? 84.086  -84.186  27.149  1.00 121.76 ? 329  LEU B CD1 1 
ATOM   5765 C CD2 . LEU B 1 405 ? 84.285  -83.072  29.425  1.00 124.47 ? 329  LEU B CD2 1 
ATOM   5766 N N   . ARG B 1 406 ? 80.946  -86.660  28.484  1.00 126.57 ? 330  ARG B N   1 
ATOM   5767 C CA  . ARG B 1 406 ? 79.839  -86.825  27.534  1.00 127.92 ? 330  ARG B CA  1 
ATOM   5768 C C   . ARG B 1 406 ? 78.488  -86.498  28.211  1.00 134.35 ? 330  ARG B C   1 
ATOM   5769 O O   . ARG B 1 406 ? 77.474  -86.357  27.523  1.00 135.83 ? 330  ARG B O   1 
ATOM   5770 C CB  . ARG B 1 406 ? 79.833  -88.250  26.952  1.00 129.23 ? 330  ARG B CB  1 
ATOM   5771 N N   . SER B 1 407 ? 78.494  -86.355  29.558  1.00 131.11 ? 331  SER B N   1 
ATOM   5772 C CA  . SER B 1 407 ? 77.337  -86.024  30.392  1.00 133.46 ? 331  SER B CA  1 
ATOM   5773 C C   . SER B 1 407 ? 77.132  -84.502  30.479  1.00 135.30 ? 331  SER B C   1 
ATOM   5774 O O   . SER B 1 407 ? 76.026  -84.028  30.212  1.00 136.64 ? 331  SER B O   1 
ATOM   5775 C CB  . SER B 1 407 ? 77.505  -86.620  31.790  1.00 138.57 ? 331  SER B CB  1 
ATOM   5776 O OG  . SER B 1 407 ? 76.493  -86.188  32.684  1.00 150.36 ? 331  SER B OG  1 
ATOM   5777 N N   . VAL B 1 408 ? 78.196  -83.745  30.854  1.00 128.76 ? 332  VAL B N   1 
ATOM   5778 C CA  . VAL B 1 408 ? 78.193  -82.279  31.021  1.00 147.18 ? 332  VAL B CA  1 
ATOM   5779 C C   . VAL B 1 408 ? 77.975  -81.579  29.664  1.00 152.08 ? 332  VAL B C   1 
ATOM   5780 O O   . VAL B 1 408 ? 77.252  -80.587  29.588  1.00 104.72 ? 332  VAL B O   1 
ATOM   5781 C CB  . VAL B 1 408 ? 79.493  -81.773  31.718  1.00 148.89 ? 332  VAL B CB  1 
ATOM   5782 C CG1 . VAL B 1 408 ? 79.530  -80.252  31.825  1.00 148.10 ? 332  VAL B CG1 1 
ATOM   5783 C CG2 . VAL B 1 408 ? 79.658  -82.394  33.101  1.00 150.26 ? 332  VAL B CG2 1 
HETATM 5784 N N1  . 8EM C 2 .   ? 107.434 -74.005  4.783   1.00 54.22  ? 1501 8EM A N1  1 
HETATM 5785 N N3  . 8EM C 2 .   ? 102.828 -70.418  7.519   1.00 76.88  ? 1501 8EM A N3  1 
HETATM 5786 C C4  . 8EM C 2 .   ? 110.211 -75.937  4.687   1.00 47.00  ? 1501 8EM A C4  1 
HETATM 5787 C C5  . 8EM C 2 .   ? 111.452 -76.546  5.297   1.00 46.52  ? 1501 8EM A C5  1 
HETATM 5788 C C6  . 8EM C 2 .   ? 106.120 -73.850  4.318   1.00 54.66  ? 1501 8EM A C6  1 
HETATM 5789 C C7  . 8EM C 2 .   ? 108.292 -72.803  4.811   1.00 55.20  ? 1501 8EM A C7  1 
HETATM 5790 C C8  . 8EM C 2 .   ? 107.917 -71.789  5.872   1.00 54.92  ? 1501 8EM A C8  1 
HETATM 5791 C C10 . 8EM C 2 .   ? 107.904 -69.509  6.653   1.00 54.07  ? 1501 8EM A C10 1 
HETATM 5792 C C13 . 8EM C 2 .   ? 105.436 -68.523  9.127   1.00 69.80  ? 1501 8EM A C13 1 
HETATM 5793 C C15 . 8EM C 2 .   ? 105.149 -67.426  9.948   1.00 69.79  ? 1501 8EM A C15 1 
HETATM 5794 C C17 . 8EM C 2 .   ? 107.488 -66.949  10.156  1.00 69.20  ? 1501 8EM A C17 1 
HETATM 5795 C C20 . 8EM C 2 .   ? 107.195 -72.145  7.012   1.00 55.76  ? 1501 8EM A C20 1 
HETATM 5796 C C21 . 8EM C 2 .   ? 104.979 -77.331  5.116   1.00 54.79  ? 1501 8EM A C21 1 
HETATM 5797 C C22 . 8EM C 2 .   ? 103.632 -77.250  4.803   1.00 58.33  ? 1501 8EM A C22 1 
HETATM 5798 C C24 . 8EM C 2 .   ? 103.909 -74.950  4.131   1.00 58.02  ? 1501 8EM A C24 1 
HETATM 5799 C C26 . 8EM C 2 .   ? 100.955 -75.608  6.395   1.00 63.07  ? 1501 8EM A C26 1 
HETATM 5800 C C28 . 8EM C 2 .   ? 100.248 -75.845  8.697   1.00 64.33  ? 1501 8EM A C28 1 
HETATM 5801 O O1  . 8EM C 2 .   ? 99.546  -76.292  4.669   1.00 68.58  ? 1501 8EM A O1  1 
HETATM 5802 C C25 . 8EM C 2 .   ? 100.690 -76.005  4.970   1.00 64.90  ? 1501 8EM A C25 1 
HETATM 5803 C C31 . 8EM C 2 .   ? 102.093 -74.927  6.840   1.00 63.72  ? 1501 8EM A C31 1 
HETATM 5804 C C30 . 8EM C 2 .   ? 102.295 -74.703  8.195   1.00 65.33  ? 1501 8EM A C30 1 
HETATM 5805 C C29 . 8EM C 2 .   ? 101.376 -75.166  9.125   1.00 65.59  ? 1501 8EM A C29 1 
HETATM 5806 C C27 . 8EM C 2 .   ? 100.032 -76.062  7.344   1.00 62.65  ? 1501 8EM A C27 1 
HETATM 5807 N N6  . 8EM C 2 .   ? 101.680 -75.974  4.024   1.00 63.12  ? 1501 8EM A N6  1 
HETATM 5808 C C32 . 8EM C 2 .   ? 101.284 -76.040  2.622   1.00 64.67  ? 1501 8EM A C32 1 
HETATM 5809 C C33 . 8EM C 2 .   ? 101.462 -77.419  2.088   1.00 67.78  ? 1501 8EM A C33 1 
HETATM 5810 O O2  . 8EM C 2 .   ? 100.704 -78.405  2.659   1.00 69.27  ? 1501 8EM A O2  1 
HETATM 5811 C C36 . 8EM C 2 .   ? 101.054 -79.573  2.028   1.00 68.99  ? 1501 8EM A C36 1 
HETATM 5812 C C35 . 8EM C 2 .   ? 101.980 -79.345  1.114   1.00 68.16  ? 1501 8EM A C35 1 
HETATM 5813 C C34 . 8EM C 2 .   ? 102.250 -77.946  1.142   1.00 68.40  ? 1501 8EM A C34 1 
HETATM 5814 C C23 . 8EM C 2 .   ? 103.080 -76.056  4.323   1.00 60.69  ? 1501 8EM A C23 1 
HETATM 5815 C C1  . 8EM C 2 .   ? 105.807 -76.221  4.952   1.00 53.81  ? 1501 8EM A C1  1 
HETATM 5816 C C   . 8EM C 2 .   ? 105.266 -75.035  4.443   1.00 55.22  ? 1501 8EM A C   1 
HETATM 5817 O O   . 8EM C 2 .   ? 105.760 -72.798  3.815   1.00 55.49  ? 1501 8EM A O   1 
HETATM 5818 C C2  . 8EM C 2 .   ? 107.865 -75.246  5.262   1.00 53.26  ? 1501 8EM A C2  1 
HETATM 5819 C C3  . 8EM C 2 .   ? 109.272 -75.379  5.736   1.00 49.32  ? 1501 8EM A C3  1 
HETATM 5820 N N   . 8EM C 2 .   ? 107.137 -76.311  5.353   1.00 54.27  ? 1501 8EM A N   1 
HETATM 5821 C C19 . 8EM C 2 .   ? 106.830 -71.196  7.952   1.00 56.26  ? 1501 8EM A C19 1 
HETATM 5822 C C11 . 8EM C 2 .   ? 107.168 -69.854  7.786   1.00 56.95  ? 1501 8EM A C11 1 
HETATM 5823 C C9  . 8EM C 2 .   ? 108.273 -70.458  5.719   1.00 52.47  ? 1501 8EM A C9  1 
HETATM 5824 C C12 . 8EM C 2 .   ? 106.774 -68.819  8.785   1.00 64.13  ? 1501 8EM A C12 1 
HETATM 5825 C C18 . 8EM C 2 .   ? 107.786 -68.021  9.331   1.00 67.09  ? 1501 8EM A C18 1 
HETATM 5826 C C16 . 8EM C 2 .   ? 106.176 -66.650  10.458  1.00 69.89  ? 1501 8EM A C16 1 
HETATM 5827 C C14 . 8EM C 2 .   ? 104.256 -69.371  8.708   1.00 74.47  ? 1501 8EM A C14 1 
HETATM 5828 N N5  . 8EM C 2 .   ? 103.369 -69.905  9.560   1.00 76.21  ? 1501 8EM A N5  1 
HETATM 5829 N N4  . 8EM C 2 .   ? 102.483 -70.557  8.776   1.00 77.51  ? 1501 8EM A N4  1 
HETATM 5830 N N2  . 8EM C 2 .   ? 103.953 -69.668  7.440   1.00 75.97  ? 1501 8EM A N2  1 
HETATM 5831 N N1  . 8EM D 2 .   ? 117.592 -89.460  36.963  1.00 108.33 ? 1501 8EM B N1  1 
HETATM 5832 N N3  . 8EM D 2 .   ? 122.998 -88.050  33.755  1.00 117.64 ? 1501 8EM B N3  1 
HETATM 5833 C C4  . 8EM D 2 .   ? 114.482 -90.748  37.408  1.00 103.22 ? 1501 8EM B C4  1 
HETATM 5834 C C5  . 8EM D 2 .   ? 113.191 -91.334  36.906  1.00 101.28 ? 1501 8EM B C5  1 
HETATM 5835 C C6  . 8EM D 2 .   ? 118.870 -89.350  37.531  1.00 110.09 ? 1501 8EM B C6  1 
HETATM 5836 C C7  . 8EM D 2 .   ? 117.004 -88.248  36.363  1.00 109.57 ? 1501 8EM B C7  1 
HETATM 5837 C C8  . 8EM D 2 .   ? 117.658 -87.812  35.070  1.00 110.71 ? 1501 8EM B C8  1 
HETATM 5838 C C10 . 8EM D 2 .   ? 118.185 -86.057  33.495  1.00 109.26 ? 1501 8EM B C10 1 
HETATM 5839 C C13 . 8EM D 2 .   ? 120.953 -86.538  31.200  1.00 109.94 ? 1501 8EM B C13 1 
HETATM 5840 C C15 . 8EM D 2 .   ? 121.506 -85.914  30.077  1.00 109.01 ? 1501 8EM B C15 1 
HETATM 5841 C C17 . 8EM D 2 .   ? 119.329 -85.207  29.374  1.00 105.86 ? 1501 8EM B C17 1 
HETATM 5842 C C20 . 8EM D 2 .   ? 118.365 -88.701  34.267  1.00 110.80 ? 1501 8EM B C20 1 
HETATM 5843 C C21 . 8EM D 2 .   ? 119.291 -93.002  38.326  1.00 111.64 ? 1501 8EM B C21 1 
HETATM 5844 C C22 . 8EM D 2 .   ? 120.598 -93.027  38.788  1.00 113.83 ? 1501 8EM B C22 1 
HETATM 5845 C C24 . 8EM D 2 .   ? 120.762 -90.632  38.501  1.00 112.93 ? 1501 8EM B C24 1 
HETATM 5846 C C26 . 8EM D 2 .   ? 123.658 -92.599  37.096  1.00 114.70 ? 1501 8EM B C26 1 
HETATM 5847 C C28 . 8EM D 2 .   ? 124.453 -93.827  35.172  1.00 113.16 ? 1501 8EM B C28 1 
HETATM 5848 O O1  . 8EM D 2 .   ? 124.774 -92.781  39.138  1.00 121.13 ? 1501 8EM B O1  1 
HETATM 5849 C C25 . 8EM D 2 .   ? 123.735 -92.452  38.592  1.00 117.46 ? 1501 8EM B C25 1 
HETATM 5850 C C31 . 8EM D 2 .   ? 122.726 -91.967  36.270  1.00 112.30 ? 1501 8EM B C31 1 
HETATM 5851 C C30 . 8EM D 2 .   ? 122.665 -92.265  34.917  1.00 109.98 ? 1501 8EM B C30 1 
HETATM 5852 C C29 . 8EM D 2 .   ? 123.523 -93.196  34.369  1.00 110.93 ? 1501 8EM B C29 1 
HETATM 5853 C C27 . 8EM D 2 .   ? 124.528 -93.531  36.524  1.00 115.24 ? 1501 8EM B C27 1 
HETATM 5854 N N6  . 8EM D 2 .   ? 122.713 -91.887  39.305  1.00 117.17 ? 1501 8EM B N6  1 
HETATM 5855 C C32 . 8EM D 2 .   ? 122.990 -91.451  40.671  1.00 121.02 ? 1501 8EM B C32 1 
HETATM 5856 C C33 . 8EM D 2 .   ? 122.497 -92.460  41.649  1.00 123.70 ? 1501 8EM B C33 1 
HETATM 5857 O O2  . 8EM D 2 .   ? 123.077 -93.698  41.599  1.00 125.05 ? 1501 8EM B O2  1 
HETATM 5858 C C36 . 8EM D 2 .   ? 122.461 -94.454  42.565  1.00 127.77 ? 1501 8EM B C36 1 
HETATM 5859 C C35 . 8EM D 2 .   ? 121.539 -93.738  43.196  1.00 127.96 ? 1501 8EM B C35 1 
HETATM 5860 C C34 . 8EM D 2 .   ? 121.558 -92.437  42.606  1.00 125.26 ? 1501 8EM B C34 1 
HETATM 5861 C C23 . 8EM D 2 .   ? 121.349 -91.847  38.866  1.00 114.61 ? 1501 8EM B C23 1 
HETATM 5862 C C1  . 8EM D 2 .   ? 118.711 -91.795  37.922  1.00 110.25 ? 1501 8EM B C1  1 
HETATM 5863 C C   . 8EM D 2 .   ? 119.452 -90.611  38.017  1.00 111.09 ? 1501 8EM B C   1 
HETATM 5864 O O   . 8EM D 2 .   ? 119.415 -88.261  37.629  1.00 110.54 ? 1501 8EM B O   1 
HETATM 5865 C C2  . 8EM D 2 .   ? 116.950 -90.697  36.942  1.00 105.88 ? 1501 8EM B C2  1 
HETATM 5866 C C3  . 8EM D 2 .   ? 115.580 -90.783  36.361  1.00 102.26 ? 1501 8EM B C3  1 
HETATM 5867 N N   . 8EM D 2 .   ? 117.428 -91.814  37.382  1.00 107.90 ? 1501 8EM B N   1 
HETATM 5868 C C19 . 8EM D 2 .   ? 118.974 -88.275  33.096  1.00 109.55 ? 1501 8EM B C19 1 
HETATM 5869 C C11 . 8EM D 2 .   ? 118.905 -86.940  32.690  1.00 109.08 ? 1501 8EM B C11 1 
HETATM 5870 C C9  . 8EM D 2 .   ? 117.571 -86.488  34.658  1.00 110.48 ? 1501 8EM B C9  1 
HETATM 5871 C C12 . 8EM D 2 .   ? 119.561 -86.466  31.436  1.00 108.35 ? 1501 8EM B C12 1 
HETATM 5872 C C18 . 8EM D 2 .   ? 118.766 -85.807  30.490  1.00 106.62 ? 1501 8EM B C18 1 
HETATM 5873 C C16 . 8EM D 2 .   ? 120.692 -85.251  29.173  1.00 106.89 ? 1501 8EM B C16 1 
HETATM 5874 C C14 . 8EM D 2 .   ? 121.915 -87.320  32.067  1.00 113.07 ? 1501 8EM B C14 1 
HETATM 5875 N N5  . 8EM D 2 .   ? 122.712 -88.300  31.615  1.00 112.81 ? 1501 8EM B N5  1 
HETATM 5876 N N4  . 8EM D 2 .   ? 123.378 -88.739  32.706  1.00 115.77 ? 1501 8EM B N4  1 
HETATM 5877 N N2  . 8EM D 2 .   ? 122.069 -87.134  33.381  1.00 116.24 ? 1501 8EM B N2  1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ALA A 1   ? 1.2478 1.1002 2.1400 -0.0710 0.2891  0.2534  1001 ALA A N   
2    C CA  . ALA A 1   ? 1.2377 1.1060 2.0162 -0.0266 0.2688  0.2810  1001 ALA A CA  
3    C C   . ALA A 1   ? 1.2736 1.1981 2.0096 -0.0184 0.2865  0.2941  1001 ALA A C   
4    O O   . ALA A 1   ? 1.3266 1.2531 1.9808 0.0111  0.3030  0.3386  1001 ALA A O   
5    C CB  . ALA A 1   ? 1.3281 1.1374 2.0620 0.0040  0.2892  0.3436  1001 ALA A CB  
6    N N   . ASP A 2   ? 1.1608 1.1380 1.9496 -0.0398 0.2816  0.2526  1002 ASP A N   
7    C CA  . ASP A 2   ? 1.1614 1.1914 1.9284 -0.0310 0.3051  0.2586  1002 ASP A CA  
8    C C   . ASP A 2   ? 1.1174 1.1911 1.8472 -0.0136 0.2643  0.2133  1002 ASP A C   
9    O O   . ASP A 2   ? 1.1177 1.2396 1.8663 -0.0104 0.2804  0.2010  1002 ASP A O   
10   C CB  . ASP A 2   ? 1.2063 1.2670 2.0847 -0.0671 0.3466  0.2580  1002 ASP A CB  
11   C CG  . ASP A 2   ? 1.4395 1.5551 2.3119 -0.0579 0.3891  0.2756  1002 ASP A CG  
12   O OD1 . ASP A 2   ? 1.5406 1.6396 2.3469 -0.0386 0.4303  0.3268  1002 ASP A OD1 
13   O OD2 . ASP A 2   ? 1.4884 1.6702 2.4224 -0.0660 0.3832  0.2402  1002 ASP A OD2 
14   N N   . LEU A 3   ? 0.9891 1.0440 1.6691 0.0004  0.2179  0.1930  1003 LEU A N   
15   C CA  . LEU A 3   ? 0.9185 0.9966 1.5667 0.0149  0.1833  0.1561  1003 LEU A CA  
16   C C   . LEU A 3   ? 0.8848 1.0009 1.6130 0.0015  0.1658  0.1223  1003 LEU A C   
17   O O   . LEU A 3   ? 0.8526 0.9662 1.5799 0.0031  0.1287  0.0998  1003 LEU A O   
18   C CB  . LEU A 3   ? 0.9482 1.0436 1.5328 0.0368  0.2019  0.1558  1003 LEU A CB  
19   C CG  . LEU A 3   ? 0.9766 1.0787 1.5389 0.0508  0.1763  0.1182  1003 LEU A CG  
20   C CD1 . LEU A 3   ? 1.0142 1.0982 1.4837 0.0659  0.1683  0.1096  1003 LEU A CD1 
21   C CD2 . LEU A 3   ? 1.0209 1.1603 1.6282 0.0596  0.2003  0.1054  1003 LEU A CD2 
22   N N   . GLU A 4   ? 0.8103 0.9727 1.6058 -0.0086 0.1926  0.1206  1004 GLU A N   
23   C CA  . GLU A 4   ? 0.7515 0.9753 1.6307 -0.0184 0.1751  0.0910  1004 GLU A CA  
24   C C   . GLU A 4   ? 0.7543 0.9723 1.6855 -0.0474 0.1511  0.0704  1004 GLU A C   
25   O O   . GLU A 4   ? 0.6947 0.9472 1.6439 -0.0449 0.1133  0.0402  1004 GLU A O   
26   C CB  . GLU A 4   ? 0.7853 1.0704 1.7375 -0.0266 0.2146  0.0978  1004 GLU A CB  
27   C CG  . GLU A 4   ? 0.8932 1.2677 1.9400 -0.0326 0.1940  0.0681  1004 GLU A CG  
28   C CD  . GLU A 4   ? 1.2252 1.6760 2.3801 -0.0564 0.2293  0.0695  1004 GLU A CD  
29   O OE1 . GLU A 4   ? 1.2480 1.7894 2.4632 -0.0413 0.2196  0.0542  1004 GLU A OE1 
30   O OE2 . GLU A 4   ? 1.1767 1.6012 2.3639 -0.0893 0.2679  0.0886  1004 GLU A OE2 
31   N N   . ASP A 5   ? 0.7520 0.9225 1.7023 -0.0712 0.1770  0.0884  1005 ASP A N   
32   C CA  . ASP A 5   ? 0.7595 0.9009 1.7601 -0.1003 0.1672  0.0674  1005 ASP A CA  
33   C C   . ASP A 5   ? 0.7830 0.8795 1.7165 -0.0807 0.1329  0.0598  1005 ASP A C   
34   O O   . ASP A 5   ? 0.7551 0.8488 1.7191 -0.0944 0.1102  0.0243  1005 ASP A O   
35   C CB  . ASP A 5   ? 0.8551 0.9410 1.8933 -0.1245 0.2178  0.1015  1005 ASP A CB  
36   C CG  . ASP A 5   ? 1.0198 1.1536 2.1414 -0.1514 0.2611  0.1116  1005 ASP A CG  
37   O OD1 . ASP A 5   ? 0.9879 1.2075 2.1783 -0.1654 0.2441  0.0736  1005 ASP A OD1 
38   O OD2 . ASP A 5   ? 1.1661 1.2587 2.2888 -0.1573 0.3132  0.1604  1005 ASP A OD2 
39   N N   . ASN A 6   ? 0.7593 0.8283 1.6041 -0.0498 0.1300  0.0886  1006 ASN A N   
40   C CA  . ASN A 6   ? 0.7476 0.7889 1.5319 -0.0299 0.0993  0.0852  1006 ASN A CA  
41   C C   . ASN A 6   ? 0.7688 0.8539 1.5416 -0.0193 0.0633  0.0548  1006 ASN A C   
42   O O   . ASN A 6   ? 0.7402 0.8198 1.4992 -0.0142 0.0382  0.0385  1006 ASN A O   
43   C CB  . ASN A 6   ? 0.7590 0.7733 1.4636 -0.0059 0.1071  0.1216  1006 ASN A CB  
44   C CG  . ASN A 6   ? 1.0163 0.9816 1.7130 -0.0021 0.1323  0.1611  1006 ASN A CG  
45   O OD1 . ASN A 6   ? 1.0130 0.9720 1.6847 0.0047  0.1642  0.1989  1006 ASN A OD1 
46   N ND2 . ASN A 6   ? 0.8959 0.8262 1.6079 -0.0001 0.1214  0.1570  1006 ASN A ND2 
47   N N   . TRP A 7   ? 0.7430 0.8716 1.5230 -0.0118 0.0657  0.0516  1007 TRP A N   
48   C CA  . TRP A 7   ? 0.7285 0.8958 1.5020 0.0046  0.0387  0.0346  1007 TRP A CA  
49   C C   . TRP A 7   ? 0.7804 1.0019 1.6124 -0.0076 0.0173  0.0040  1007 TRP A C   
50   O O   . TRP A 7   ? 0.7692 1.0125 1.5816 0.0061  -0.0101 -0.0080 1007 TRP A O   
51   C CB  . TRP A 7   ? 0.7252 0.9150 1.4923 0.0240  0.0527  0.0436  1007 TRP A CB  
52   C CG  . TRP A 7   ? 0.7600 0.9050 1.4558 0.0417  0.0550  0.0536  1007 TRP A CG  
53   C CD1 . TRP A 7   ? 0.8327 0.9521 1.4879 0.0468  0.0794  0.0634  1007 TRP A CD1 
54   C CD2 . TRP A 7   ? 0.7528 0.8774 1.4115 0.0525  0.0332  0.0501  1007 TRP A CD2 
55   N NE1 . TRP A 7   ? 0.8432 0.9292 1.4421 0.0565  0.0696  0.0575  1007 TRP A NE1 
56   C CE2 . TRP A 7   ? 0.8357 0.9213 1.4422 0.0581  0.0438  0.0519  1007 TRP A CE2 
57   C CE3 . TRP A 7   ? 0.7491 0.8891 1.4134 0.0569  0.0083  0.0449  1007 TRP A CE3 
58   C CZ2 . TRP A 7   ? 0.8337 0.8914 1.4082 0.0611  0.0311  0.0468  1007 TRP A CZ2 
59   C CZ3 . TRP A 7   ? 0.7725 0.8839 1.3994 0.0646  0.0005  0.0497  1007 TRP A CZ3 
60   C CH2 . TRP A 7   ? 0.8083 0.8773 1.3980 0.0636  0.0123  0.0498  1007 TRP A CH2 
61   N N   . GLU A 8   ? 0.7510 0.9978 1.6552 -0.0355 0.0311  -0.0103 1008 GLU A N   
62   C CA  . GLU A 8   ? 0.7463 1.0530 1.7141 -0.0560 0.0085  -0.0529 1008 GLU A CA  
63   C C   . GLU A 8   ? 0.7810 1.0497 1.7216 -0.0606 -0.0101 -0.0765 1008 GLU A C   
64   O O   . GLU A 8   ? 0.7626 1.0846 1.7031 -0.0555 -0.0415 -0.1092 1008 GLU A O   
65   C CB  . GLU A 8   ? 0.7950 1.1240 1.8566 -0.0957 0.0335  -0.0670 1008 GLU A CB  
66   C CG  . GLU A 8   ? 1.0121 1.4523 2.1454 -0.0983 0.0244  -0.0835 1008 GLU A CG  
67   C CD  . GLU A 8   ? 1.5041 2.0378 2.6703 -0.1011 -0.0223 -0.1327 1008 GLU A CD  
68   O OE1 . GLU A 8   ? 1.5567 2.1283 2.8026 -0.1441 -0.0279 -0.1797 1008 GLU A OE1 
69   O OE2 . GLU A 8   ? 1.5215 2.0934 2.6344 -0.0607 -0.0519 -0.1248 1008 GLU A OE2 
70   N N   . THR A 9   ? 0.7484 0.9317 1.6601 -0.0632 0.0103  -0.0565 1009 THR A N   
71   C CA  . THR A 9   ? 0.7531 0.8914 1.6405 -0.0603 0.0010  -0.0726 1009 THR A CA  
72   C C   . THR A 9   ? 0.7412 0.8993 1.5609 -0.0290 -0.0254 -0.0675 1009 THR A C   
73   O O   . THR A 9   ? 0.7402 0.9201 1.5520 -0.0250 -0.0449 -0.0994 1009 THR A O   
74   C CB  . THR A 9   ? 0.8706 0.9222 1.7465 -0.0600 0.0320  -0.0381 1009 THR A CB  
75   O OG1 . THR A 9   ? 0.9364 0.9686 1.8720 -0.0869 0.0659  -0.0272 1009 THR A OG1 
76   C CG2 . THR A 9   ? 0.8596 0.8629 1.7328 -0.0557 0.0300  -0.0574 1009 THR A CG2 
77   N N   . LEU A 10  ? 0.6515 0.8028 1.4250 -0.0088 -0.0224 -0.0304 1010 LEU A N   
78   C CA  . LEU A 10  ? 0.6174 0.7784 1.3378 0.0149  -0.0389 -0.0196 1010 LEU A CA  
79   C C   . LEU A 10  ? 0.6467 0.8757 1.3711 0.0270  -0.0598 -0.0339 1010 LEU A C   
80   O O   . LEU A 10  ? 0.6437 0.8887 1.3360 0.0418  -0.0732 -0.0362 1010 LEU A O   
81   C CB  . LEU A 10  ? 0.6078 0.7413 1.2906 0.0255  -0.0276 0.0131  1010 LEU A CB  
82   C CG  . LEU A 10  ? 0.6764 0.7619 1.3314 0.0249  -0.0175 0.0317  1010 LEU A CG  
83   C CD1 . LEU A 10  ? 0.6900 0.7603 1.3216 0.0266  -0.0014 0.0514  1010 LEU A CD1 
84   C CD2 . LEU A 10  ? 0.6983 0.7810 1.3218 0.0352  -0.0312 0.0348  1010 LEU A CD2 
85   N N   . ASN A 11  ? 0.5921 0.8698 1.3572 0.0241  -0.0611 -0.0399 1011 ASN A N   
86   C CA  . ASN A 11  ? 0.5854 0.9446 1.3580 0.0433  -0.0835 -0.0473 1011 ASN A CA  
87   C C   . ASN A 11  ? 0.6546 1.0738 1.4523 0.0297  -0.1079 -0.0959 1011 ASN A C   
88   O O   . ASN A 11  ? 0.6582 1.1434 1.4311 0.0525  -0.1317 -0.1020 1011 ASN A O   
89   C CB  . ASN A 11  ? 0.5694 0.9708 1.3830 0.0515  -0.0760 -0.0341 1011 ASN A CB  
90   C CG  . ASN A 11  ? 0.7068 1.0578 1.4871 0.0734  -0.0542 0.0048  1011 ASN A CG  
91   O OD1 . ASN A 11  ? 0.6588 0.9839 1.3925 0.0956  -0.0559 0.0264  1011 ASN A OD1 
92   N ND2 . ASN A 11  ? 0.5293 0.8650 1.3349 0.0662  -0.0294 0.0120  1011 ASN A ND2 
93   N N   . ASP A 12  ? 0.6326 1.0274 1.4771 -0.0061 -0.0995 -0.1307 1012 ASP A N   
94   C CA  . ASP A 12  ? 0.6681 1.1060 1.5437 -0.0274 -0.1189 -0.1921 1012 ASP A CA  
95   C C   . ASP A 12  ? 0.7294 1.1487 1.5424 -0.0097 -0.1281 -0.2053 1012 ASP A C   
96   O O   . ASP A 12  ? 0.7495 1.2449 1.5422 0.0017  -0.1551 -0.2388 1012 ASP A O   
97   C CB  . ASP A 12  ? 0.7273 1.1142 1.6743 -0.0725 -0.0959 -0.2214 1012 ASP A CB  
98   C CG  . ASP A 12  ? 0.9608 1.4196 1.9997 -0.1058 -0.0993 -0.2523 1012 ASP A CG  
99   O OD1 . ASP A 12  ? 0.9558 1.4693 2.0113 -0.0924 -0.0995 -0.2215 1012 ASP A OD1 
100  O OD2 . ASP A 12  ? 1.0998 1.5565 2.2024 -0.1469 -0.0974 -0.3084 1012 ASP A OD2 
101  N N   . ASN A 13  ? 0.6676 0.9980 1.4480 -0.0035 -0.1056 -0.1766 1013 ASN A N   
102  C CA  . ASN A 13  ? 0.6717 0.9821 1.4023 0.0147  -0.1062 -0.1830 1013 ASN A CA  
103  C C   . ASN A 13  ? 0.6944 1.0540 1.3648 0.0485  -0.1182 -0.1516 1013 ASN A C   
104  O O   . ASN A 13  ? 0.7139 1.0968 1.3452 0.0648  -0.1231 -0.1667 1013 ASN A O   
105  C CB  . ASN A 13  ? 0.6532 0.8723 1.3793 0.0145  -0.0804 -0.1560 1013 ASN A CB  
106  C CG  . ASN A 13  ? 0.9389 1.1012 1.7168 -0.0099 -0.0634 -0.1882 1013 ASN A CG  
107  O OD1 . ASN A 13  ? 0.9177 1.0694 1.7018 -0.0113 -0.0629 -0.2340 1013 ASN A OD1 
108  N ND2 . ASN A 13  ? 0.8101 0.9327 1.6282 -0.0293 -0.0445 -0.1661 1013 ASN A ND2 
109  N N   . LEU A 14  ? 0.6147 0.9879 1.2793 0.0609  -0.1180 -0.1077 1014 LEU A N   
110  C CA  . LEU A 14  ? 0.6102 1.0185 1.2269 0.0934  -0.1222 -0.0699 1014 LEU A CA  
111  C C   . LEU A 14  ? 0.6816 1.1901 1.2799 0.1123  -0.1484 -0.0947 1014 LEU A C   
112  O O   . LEU A 14  ? 0.6992 1.2368 1.2443 0.1382  -0.1490 -0.0791 1014 LEU A O   
113  C CB  . LEU A 14  ? 0.5924 0.9839 1.2173 0.1036  -0.1123 -0.0247 1014 LEU A CB  
114  C CG  . LEU A 14  ? 0.6444 0.9578 1.2499 0.1018  -0.0892 0.0114  1014 LEU A CG  
115  C CD1 . LEU A 14  ? 0.6411 0.9271 1.2651 0.1029  -0.0767 0.0332  1014 LEU A CD1 
116  C CD2 . LEU A 14  ? 0.6969 1.0123 1.2609 0.1224  -0.0822 0.0427  1014 LEU A CD2 
117  N N   . LYS A 15  ? 0.6345 1.2041 1.2786 0.0978  -0.1695 -0.1354 1015 LYS A N   
118  C CA  . LYS A 15  ? 0.6603 1.3472 1.2947 0.1111  -0.2033 -0.1727 1015 LYS A CA  
119  C C   . LYS A 15  ? 0.7300 1.4245 1.3328 0.1032  -0.2092 -0.2300 1015 LYS A C   
120  O O   . LYS A 15  ? 0.7589 1.5361 1.3057 0.1315  -0.2276 -0.2408 1015 LYS A O   
121  C CB  . LYS A 15  ? 0.6842 1.4365 1.3965 0.0861  -0.2234 -0.2117 1015 LYS A CB  
122  C CG  . LYS A 15  ? 0.8029 1.5547 1.5544 0.0968  -0.2131 -0.1610 1015 LYS A CG  
123  C CD  . LYS A 15  ? 0.8961 1.7396 1.7331 0.0741  -0.2333 -0.2005 1015 LYS A CD  
124  C CE  . LYS A 15  ? 0.9014 1.7251 1.7901 0.0763  -0.2107 -0.1592 1015 LYS A CE  
125  N NZ  . LYS A 15  ? 0.9640 1.8922 1.9487 0.0520  -0.2277 -0.1982 1015 LYS A NZ  
126  N N   . VAL A 16  ? 0.6816 1.2883 1.3168 0.0701  -0.1897 -0.2630 1016 VAL A N   
127  C CA  . VAL A 16  ? 0.7265 1.3135 1.3450 0.0623  -0.1854 -0.3213 1016 VAL A CA  
128  C C   . VAL A 16  ? 0.7956 1.3831 1.3354 0.1004  -0.1725 -0.2864 1016 VAL A C   
129  O O   . VAL A 16  ? 0.8506 1.4956 1.3449 0.1160  -0.1817 -0.3285 1016 VAL A O   
130  C CB  . VAL A 16  ? 0.7703 1.2450 1.4469 0.0279  -0.1584 -0.3423 1016 VAL A CB  
131  C CG1 . VAL A 16  ? 0.8232 1.2618 1.4842 0.0293  -0.1463 -0.3964 1016 VAL A CG1 
132  C CG2 . VAL A 16  ? 0.7720 1.2499 1.5329 -0.0144 -0.1639 -0.3776 1016 VAL A CG2 
133  N N   . ILE A 17  ? 0.7044 1.2369 1.2304 0.1137  -0.1501 -0.2132 1017 ILE A N   
134  C CA  . ILE A 17  ? 0.7095 1.2407 1.1793 0.1424  -0.1313 -0.1725 1017 ILE A CA  
135  C C   . ILE A 17  ? 0.8365 1.4683 1.2438 0.1778  -0.1451 -0.1549 1017 ILE A C   
136  O O   . ILE A 17  ? 0.8763 1.5439 1.2301 0.2002  -0.1353 -0.1603 1017 ILE A O   
137  C CB  . ILE A 17  ? 0.6870 1.1453 1.1702 0.1394  -0.1080 -0.1059 1017 ILE A CB  
138  C CG1 . ILE A 17  ? 0.6605 1.0362 1.1880 0.1155  -0.0945 -0.1199 1017 ILE A CG1 
139  C CG2 . ILE A 17  ? 0.7015 1.1721 1.1407 0.1632  -0.0870 -0.0595 1017 ILE A CG2 
140  C CD1 . ILE A 17  ? 0.6428 0.9600 1.1936 0.1034  -0.0842 -0.0735 1017 ILE A CD1 
141  N N   . GLU A 18  ? 0.8182 1.5021 1.2319 0.1875  -0.1659 -0.1329 1018 GLU A N   
142  C CA  . GLU A 18  ? 0.8844 1.6708 1.2392 0.2297  -0.1808 -0.1045 1018 GLU A CA  
143  C C   . GLU A 18  ? 1.0297 1.9221 1.3463 0.2378  -0.2108 -0.1779 1018 GLU A C   
144  O O   . GLU A 18  ? 1.0845 2.0538 1.3243 0.2773  -0.2117 -0.1592 1018 GLU A O   
145  C CB  . GLU A 18  ? 0.8890 1.7065 1.2723 0.2432  -0.1959 -0.0631 1018 GLU A CB  
146  C CG  . GLU A 18  ? 1.0462 1.7984 1.4224 0.2636  -0.1641 0.0257  1018 GLU A CG  
147  C CD  . GLU A 18  ? 1.3877 2.0227 1.8179 0.2284  -0.1410 0.0351  1018 GLU A CD  
148  O OE1 . GLU A 18  ? 1.4077 2.0281 1.8845 0.2210  -0.1463 0.0401  1018 GLU A OE1 
149  O OE2 . GLU A 18  ? 1.3352 1.9034 1.7604 0.2110  -0.1178 0.0370  1018 GLU A OE2 
150  N N   . LYS A 19  ? 1.0069 1.9035 1.3763 0.1997  -0.2324 -0.2622 1019 LYS A N   
151  C CA  . LYS A 19  ? 1.0835 2.0764 1.4294 0.1964  -0.2635 -0.3529 1019 LYS A CA  
152  C C   . LYS A 19  ? 1.1919 2.1318 1.5146 0.1865  -0.2407 -0.4123 1019 LYS A C   
153  O O   . LYS A 19  ? 1.2653 2.2747 1.5596 0.1848  -0.2607 -0.4974 1019 LYS A O   
154  C CB  . LYS A 19  ? 1.1093 2.1385 1.5398 0.1544  -0.2964 -0.4195 1019 LYS A CB  
155  C CG  . LYS A 19  ? 1.2943 2.4370 1.7387 0.1757  -0.3308 -0.3848 1019 LYS A CG  
156  C CD  . LYS A 19  ? 1.4897 2.8042 1.8724 0.2070  -0.3765 -0.4272 1019 LYS A CD  
157  C CE  . LYS A 19  ? 1.5705 3.0061 1.9652 0.2419  -0.4097 -0.3774 1019 LYS A CE  
158  N NZ  . LYS A 19  ? 1.7425 3.3589 2.0614 0.2840  -0.4559 -0.4054 1019 LYS A NZ  
159  N N   . ALA A 20  ? 1.1185 1.9443 1.4535 0.1833  -0.1996 -0.3708 1020 ALA A N   
160  C CA  . ALA A 20  ? 1.1577 1.9297 1.4803 0.1827  -0.1721 -0.4144 1020 ALA A CA  
161  C C   . ALA A 20  ? 1.2751 2.1213 1.5021 0.2279  -0.1593 -0.4023 1020 ALA A C   
162  O O   . ALA A 20  ? 1.2611 2.1516 1.4409 0.2587  -0.1535 -0.3226 1020 ALA A O   
163  C CB  . ALA A 20  ? 1.1037 1.7531 1.4753 0.1703  -0.1372 -0.3658 1020 ALA A CB  
164  N N   . ASP A 21  ? 1.3089 2.1629 1.5090 0.2331  -0.1491 -0.4802 1021 ASP A N   
165  C CA  . ASP A 21  ? 1.3842 2.3134 1.4897 0.2772  -0.1308 -0.4802 1021 ASP A CA  
166  C C   . ASP A 21  ? 1.4194 2.2733 1.5362 0.2882  -0.0806 -0.4684 1021 ASP A C   
167  O O   . ASP A 21  ? 1.4437 2.3458 1.4986 0.3246  -0.0515 -0.4257 1021 ASP A O   
168  C CB  . ASP A 21  ? 1.5233 2.5502 1.5747 0.2826  -0.1599 -0.5901 1021 ASP A CB  
169  C CG  . ASP A 21  ? 1.7284 2.8798 1.7481 0.2879  -0.2120 -0.5928 1021 ASP A CG  
170  O OD1 . ASP A 21  ? 1.6999 2.8348 1.7970 0.2501  -0.2426 -0.6100 1021 ASP A OD1 
171  O OD2 . ASP A 21  ? 1.8882 3.1618 1.8064 0.3330  -0.2209 -0.5761 1021 ASP A OD2 
172  N N   . ASN A 22  ? 1.3376 2.0807 1.5361 0.2601  -0.0681 -0.5009 1022 ASN A N   
173  C CA  . ASN A 22  ? 1.3258 2.0009 1.5507 0.2742  -0.0242 -0.4899 1022 ASN A CA  
174  C C   . ASN A 22  ? 1.2501 1.8398 1.5478 0.2568  -0.0131 -0.4100 1022 ASN A C   
175  O O   . ASN A 22  ? 1.1869 1.7406 1.5261 0.2269  -0.0367 -0.3900 1022 ASN A O   
176  C CB  . ASN A 22  ? 1.4298 2.0488 1.6835 0.2690  -0.0128 -0.5936 1022 ASN A CB  
177  C CG  . ASN A 22  ? 1.8206 2.3752 2.1418 0.2237  -0.0384 -0.6533 1022 ASN A CG  
178  O OD1 . ASN A 22  ? 1.8022 2.4186 2.1078 0.2027  -0.0758 -0.7013 1022 ASN A OD1 
179  N ND2 . ASN A 22  ? 1.7194 2.1555 2.1205 0.2093  -0.0165 -0.6527 1022 ASN A ND2 
180  N N   . ALA A 23  ? 1.1699 1.7400 1.4829 0.2769  0.0228  -0.3673 1023 ALA A N   
181  C CA  . ALA A 23  ? 1.0736 1.5833 1.4501 0.2642  0.0320  -0.2977 1023 ALA A CA  
182  C C   . ALA A 23  ? 1.0810 1.4919 1.5280 0.2460  0.0286  -0.3254 1023 ALA A C   
183  O O   . ALA A 23  ? 1.0063 1.3710 1.4971 0.2284  0.0224  -0.2747 1023 ALA A O   
184  C CB  . ALA A 23  ? 1.0801 1.6199 1.4605 0.2908  0.0689  -0.2557 1023 ALA A CB  
185  N N   . ALA A 24  ? 1.0979 1.4743 1.5540 0.2510  0.0358  -0.4058 1024 ALA A N   
186  C CA  . ALA A 24  ? 1.1070 1.3786 1.6316 0.2355  0.0409  -0.4332 1024 ALA A CA  
187  C C   . ALA A 24  ? 1.1211 1.3663 1.6702 0.1919  0.0108  -0.4352 1024 ALA A C   
188  O O   . ALA A 24  ? 1.1017 1.2681 1.7071 0.1753  0.0150  -0.4092 1024 ALA A O   
189  C CB  . ALA A 24  ? 1.2227 1.4607 1.7513 0.2498  0.0613  -0.5259 1024 ALA A CB  
190  N N   . GLN A 25  ? 1.0641 1.3858 1.5700 0.1778  -0.0180 -0.4608 1025 GLN A N   
191  C CA  . GLN A 25  ? 1.0246 1.3523 1.5541 0.1407  -0.0483 -0.4624 1025 GLN A CA  
192  C C   . GLN A 25  ? 0.9716 1.2932 1.5098 0.1358  -0.0537 -0.3704 1025 GLN A C   
193  O O   . GLN A 25  ? 0.9371 1.2143 1.5220 0.1084  -0.0605 -0.3545 1025 GLN A O   
194  C CB  . GLN A 25  ? 1.0785 1.5156 1.5541 0.1401  -0.0795 -0.5090 1025 GLN A CB  
195  C CG  . GLN A 25  ? 1.3841 1.8239 1.8917 0.1082  -0.0970 -0.6109 1025 GLN A CG  
196  C CD  . GLN A 25  ? 1.6429 2.2101 2.1096 0.1042  -0.1398 -0.6378 1025 GLN A CD  
197  O OE1 . GLN A 25  ? 1.6321 2.2946 2.0193 0.1342  -0.1503 -0.6623 1025 GLN A OE1 
198  N NE2 . GLN A 25  ? 1.5092 2.0906 2.0287 0.0715  -0.1643 -0.6294 1025 GLN A NE2 
199  N N   . VAL A 26  ? 0.8862 1.2522 1.3814 0.1609  -0.0466 -0.3131 1026 VAL A N   
200  C CA  . VAL A 26  ? 0.8062 1.1686 1.3049 0.1570  -0.0482 -0.2337 1026 VAL A CA  
201  C C   . VAL A 26  ? 0.8238 1.1090 1.3722 0.1505  -0.0333 -0.2011 1026 VAL A C   
202  O O   . VAL A 26  ? 0.7849 1.0386 1.3560 0.1316  -0.0414 -0.1679 1026 VAL A O   
203  C CB  . VAL A 26  ? 0.8457 1.2730 1.2934 0.1815  -0.0378 -0.1882 1026 VAL A CB  
204  C CG1 . VAL A 26  ? 0.7825 1.1916 1.2444 0.1718  -0.0349 -0.1157 1026 VAL A CG1 
205  C CG2 . VAL A 26  ? 0.8872 1.3993 1.2751 0.1961  -0.0534 -0.2078 1026 VAL A CG2 
206  N N   . LYS A 27  ? 0.7991 1.0620 1.3620 0.1710  -0.0113 -0.2101 1027 LYS A N   
207  C CA  . LYS A 27  ? 0.7754 0.9821 1.3823 0.1755  0.0006  -0.1759 1027 LYS A CA  
208  C C   . LYS A 27  ? 0.8329 0.9622 1.4795 0.1556  -0.0014 -0.1878 1027 LYS A C   
209  O O   . LYS A 27  ? 0.7887 0.8844 1.4560 0.1509  -0.0014 -0.1425 1027 LYS A O   
210  C CB  . LYS A 27  ? 0.8469 1.0550 1.4670 0.2103  0.0259  -0.1874 1027 LYS A CB  
211  C CG  . LYS A 27  ? 1.0242 1.2178 1.6828 0.2245  0.0329  -0.1346 1027 LYS A CG  
212  C CD  . LYS A 27  ? 1.2012 1.3797 1.8912 0.2647  0.0590  -0.1484 1027 LYS A CD  
213  C CE  . LYS A 27  ? 1.3056 1.4575 2.0388 0.2805  0.0593  -0.0979 1027 LYS A CE  
214  N NZ  . LYS A 27  ? 1.4623 1.6187 2.2328 0.3298  0.0847  -0.0973 1027 LYS A NZ  
215  N N   . ASP A 28  ? 0.8523 0.9594 1.5097 0.1421  -0.0017 -0.2503 1028 ASP A N   
216  C CA  . ASP A 28  ? 0.8856 0.9190 1.5921 0.1162  0.0037  -0.2683 1028 ASP A CA  
217  C C   . ASP A 28  ? 0.8798 0.9242 1.5917 0.0870  -0.0135 -0.2338 1028 ASP A C   
218  O O   . ASP A 28  ? 0.8800 0.8657 1.6257 0.0757  -0.0017 -0.2033 1028 ASP A O   
219  C CB  . ASP A 28  ? 0.9903 1.0152 1.7120 0.1004  0.0048  -0.3562 1028 ASP A CB  
220  C CG  . ASP A 28  ? 1.2827 1.2000 2.0701 0.0881  0.0327  -0.3817 1028 ASP A CG  
221  O OD1 . ASP A 28  ? 1.3720 1.2362 2.1723 0.1175  0.0597  -0.3974 1028 ASP A OD1 
222  O OD2 . ASP A 28  ? 1.3771 1.2613 2.2081 0.0509  0.0322  -0.3828 1028 ASP A OD2 
223  N N   . ALA A 29  ? 0.7832 0.9041 1.4600 0.0804  -0.0372 -0.2343 1029 ALA A N   
224  C CA  . ALA A 29  ? 0.7250 0.8653 1.4062 0.0606  -0.0514 -0.2038 1029 ALA A CA  
225  C C   . ALA A 29  ? 0.7067 0.8297 1.3739 0.0697  -0.0462 -0.1366 1029 ALA A C   
226  O O   . ALA A 29  ? 0.6817 0.7796 1.3661 0.0549  -0.0439 -0.1110 1029 ALA A O   
227  C CB  . ALA A 29  ? 0.7232 0.9510 1.3708 0.0628  -0.0756 -0.2189 1029 ALA A CB  
228  N N   . LEU A 30  ? 0.6405 0.7824 1.2798 0.0922  -0.0428 -0.1127 1030 LEU A N   
229  C CA  . LEU A 30  ? 0.5947 0.7334 1.2251 0.0966  -0.0414 -0.0610 1030 LEU A CA  
230  C C   . LEU A 30  ? 0.6754 0.7618 1.3301 0.1009  -0.0309 -0.0394 1030 LEU A C   
231  O O   . LEU A 30  ? 0.6556 0.7363 1.3034 0.0958  -0.0344 -0.0048 1030 LEU A O   
232  C CB  . LEU A 30  ? 0.5795 0.7631 1.1898 0.1139  -0.0381 -0.0469 1030 LEU A CB  
233  C CG  . LEU A 30  ? 0.6211 0.8534 1.1997 0.1127  -0.0433 -0.0373 1030 LEU A CG  
234  C CD1 . LEU A 30  ? 0.6381 0.9160 1.2010 0.1310  -0.0303 -0.0331 1030 LEU A CD1 
235  C CD2 . LEU A 30  ? 0.6191 0.8419 1.1957 0.0982  -0.0470 0.0001  1030 LEU A CD2 
236  N N   . THR A 31  ? 0.6849 0.7324 1.3651 0.1133  -0.0162 -0.0599 1031 THR A N   
237  C CA  . THR A 31  ? 0.7192 0.7117 1.4235 0.1269  -0.0010 -0.0310 1031 THR A CA  
238  C C   . THR A 31  ? 0.7882 0.7375 1.5061 0.1029  0.0054  -0.0183 1031 THR A C   
239  O O   . THR A 31  ? 0.7840 0.7163 1.4950 0.1101  0.0104  0.0273  1031 THR A O   
240  C CB  . THR A 31  ? 0.8751 0.8268 1.6085 0.1507  0.0198  -0.0576 1031 THR A CB  
241  O OG1 . THR A 31  ? 0.8703 0.8763 1.5902 0.1753  0.0174  -0.0645 1031 THR A OG1 
242  C CG2 . THR A 31  ? 0.8987 0.7854 1.6604 0.1742  0.0410  -0.0178 1031 THR A CG2 
243  N N   . LYS A 32  ? 0.7591 0.7045 1.4959 0.0750  0.0049  -0.0591 1032 LYS A N   
244  C CA  . LYS A 32  ? 0.7637 0.6828 1.5269 0.0472  0.0144  -0.0528 1032 LYS A CA  
245  C C   . LYS A 32  ? 0.7627 0.7216 1.4929 0.0421  0.0020  -0.0187 1032 LYS A C   
246  O O   . LYS A 32  ? 0.7755 0.7123 1.5131 0.0325  0.0162  0.0093  1032 LYS A O   
247  C CB  . LYS A 32  ? 0.7998 0.7310 1.6014 0.0169  0.0109  -0.1136 1032 LYS A CB  
248  C CG  . LYS A 32  ? 0.9028 0.7793 1.7457 0.0134  0.0287  -0.1610 1032 LYS A CG  
249  C CD  . LYS A 32  ? 1.0041 0.8946 1.8981 -0.0280 0.0250  -0.2255 1032 LYS A CD  
250  C CE  . LYS A 32  ? 1.0968 0.9571 2.0167 -0.0323 0.0321  -0.2983 1032 LYS A CE  
251  N NZ  . LYS A 32  ? 1.1101 1.0543 1.9770 -0.0154 0.0019  -0.3421 1032 LYS A NZ  
252  N N   . MET A 33  ? 0.6641 0.6769 1.3587 0.0498  -0.0191 -0.0206 1033 MET A N   
253  C CA  . MET A 33  ? 0.6288 0.6692 1.2946 0.0466  -0.0280 0.0038  1033 MET A CA  
254  C C   . MET A 33  ? 0.6841 0.7120 1.3245 0.0587  -0.0254 0.0417  1033 MET A C   
255  O O   . MET A 33  ? 0.6815 0.7040 1.3072 0.0528  -0.0203 0.0608  1033 MET A O   
256  C CB  . MET A 33  ? 0.6304 0.7197 1.2730 0.0518  -0.0443 -0.0061 1033 MET A CB  
257  C CG  . MET A 33  ? 0.6723 0.7975 1.3267 0.0442  -0.0532 -0.0332 1033 MET A CG  
258  S SD  . MET A 33  ? 0.7067 0.8866 1.3248 0.0614  -0.0659 -0.0289 1033 MET A SD  
259  C CE  . MET A 33  ? 0.6423 0.8125 1.2484 0.0605  -0.0619 0.0076  1033 MET A CE  
260  N N   . ARG A 34  ? 0.6442 0.6792 1.2795 0.0777  -0.0296 0.0498  1034 ARG A N   
261  C CA  . ARG A 34  ? 0.6437 0.6913 1.2591 0.0919  -0.0350 0.0816  1034 ARG A CA  
262  C C   . ARG A 34  ? 0.7597 0.7719 1.3701 0.0995  -0.0204 0.1126  1034 ARG A C   
263  O O   . ARG A 34  ? 0.7710 0.8013 1.3478 0.1010  -0.0261 0.1335  1034 ARG A O   
264  C CB  . ARG A 34  ? 0.6110 0.6838 1.2390 0.1149  -0.0398 0.0848  1034 ARG A CB  
265  C CG  . ARG A 34  ? 0.6804 0.8029 1.2930 0.1214  -0.0566 0.1064  1034 ARG A CG  
266  C CD  . ARG A 34  ? 0.7148 0.8698 1.3505 0.1529  -0.0594 0.1220  1034 ARG A CD  
267  N NE  . ARG A 34  ? 0.6761 0.9062 1.3124 0.1481  -0.0809 0.1263  1034 ARG A NE  
268  C CZ  . ARG A 34  ? 0.7712 1.0423 1.3924 0.1569  -0.0987 0.1471  1034 ARG A CZ  
269  N NH1 . ARG A 34  ? 0.6189 0.8601 1.2146 0.1777  -0.0937 0.1764  1034 ARG A NH1 
270  N NH2 . ARG A 34  ? 0.5504 0.8983 1.1829 0.1440  -0.1208 0.1385  1034 ARG A NH2 
271  N N   . ALA A 35  ? 0.7557 0.7162 1.3985 0.1031  0.0015  0.1137  1035 ALA A N   
272  C CA  . ALA A 35  ? 0.8118 0.7275 1.4569 0.1104  0.0261  0.1522  1035 ALA A CA  
273  C C   . ALA A 35  ? 0.8532 0.7731 1.4834 0.0868  0.0348  0.1566  1035 ALA A C   
274  O O   . ALA A 35  ? 0.8793 0.8045 1.4726 0.0979  0.0425  0.1940  1035 ALA A O   
275  C CB  . ALA A 35  ? 0.8765 0.7244 1.5747 0.1105  0.0536  0.1439  1035 ALA A CB  
276  N N   . ALA A 36  ? 0.7724 0.7019 1.4278 0.0590  0.0323  0.1181  1036 ALA A N   
277  C CA  . ALA A 36  ? 0.7536 0.6969 1.4090 0.0394  0.0420  0.1167  1036 ALA A CA  
278  C C   . ALA A 36  ? 0.7900 0.7697 1.3894 0.0467  0.0282  0.1249  1036 ALA A C   
279  O O   . ALA A 36  ? 0.8074 0.7893 1.3870 0.0451  0.0452  0.1418  1036 ALA A O   
280  C CB  . ALA A 36  ? 0.7270 0.6922 1.4254 0.0167  0.0342  0.0729  1036 ALA A CB  
281  N N   . ALA A 37  ? 0.7187 0.7251 1.2957 0.0534  0.0020  0.1107  1037 ALA A N   
282  C CA  . ALA A 37  ? 0.7041 0.7370 1.2381 0.0540  -0.0109 0.1076  1037 ALA A CA  
283  C C   . ALA A 37  ? 0.8053 0.8484 1.2943 0.0690  -0.0115 0.1343  1037 ALA A C   
284  O O   . ALA A 37  ? 0.8217 0.8783 1.2705 0.0670  -0.0097 0.1309  1037 ALA A O   
285  C CB  . ALA A 37  ? 0.6766 0.7319 1.2141 0.0517  -0.0324 0.0884  1037 ALA A CB  
286  N N   . LEU A 38  ? 0.7980 0.8383 1.2915 0.0886  -0.0133 0.1603  1038 LEU A N   
287  C CA  . LEU A 38  ? 0.8523 0.9157 1.3018 0.1129  -0.0167 0.1953  1038 LEU A CA  
288  C C   . LEU A 38  ? 0.9895 1.0266 1.4161 0.1194  0.0158  0.2297  1038 LEU A C   
289  O O   . LEU A 38  ? 1.0444 1.1130 1.4111 0.1340  0.0151  0.2495  1038 LEU A O   
290  C CB  . LEU A 38  ? 0.8637 0.9314 1.3347 0.1411  -0.0238 0.2208  1038 LEU A CB  
291  C CG  . LEU A 38  ? 0.8746 0.9943 1.3601 0.1427  -0.0548 0.1986  1038 LEU A CG  
292  C CD1 . LEU A 38  ? 0.8804 0.9863 1.4095 0.1679  -0.0495 0.2126  1038 LEU A CD1 
293  C CD2 . LEU A 38  ? 0.9336 1.1276 1.3773 0.1521  -0.0829 0.2036  1038 LEU A CD2 
294  N N   . ASP A 39  ? 0.9512 0.9374 1.4272 0.1068  0.0454  0.2346  1039 ASP A N   
295  C CA  . ASP A 39  ? 1.0034 0.9604 1.4802 0.1054  0.0860  0.2690  1039 ASP A CA  
296  C C   . ASP A 39  ? 1.0270 1.0096 1.4797 0.0891  0.0953  0.2490  1039 ASP A C   
297  O O   . ASP A 39  ? 1.0875 1.0705 1.5120 0.0958  0.1271  0.2813  1039 ASP A O   
298  C CB  . ASP A 39  ? 1.0410 0.9398 1.5979 0.0877  0.1130  0.2679  1039 ASP A CB  
299  C CG  . ASP A 39  ? 1.2923 1.1418 1.8729 0.1110  0.1251  0.3017  1039 ASP A CG  
300  O OD1 . ASP A 39  ? 1.3496 1.2145 1.8818 0.1487  0.1188  0.3454  1039 ASP A OD1 
301  O OD2 . ASP A 39  ? 1.4044 1.2038 2.0533 0.0940  0.1399  0.2813  1039 ASP A OD2 
302  N N   . ALA A 40  ? 0.9017 0.9053 1.3631 0.0729  0.0721  0.2003  1040 ALA A N   
303  C CA  . ALA A 40  ? 0.8837 0.9064 1.3290 0.0640  0.0816  0.1775  1040 ALA A CA  
304  C C   . ALA A 40  ? 0.9611 1.0134 1.3286 0.0762  0.0674  0.1660  1040 ALA A C   
305  O O   . ALA A 40  ? 0.9770 1.0396 1.3151 0.0773  0.0862  0.1547  1040 ALA A O   
306  C CB  . ALA A 40  ? 0.8274 0.8535 1.3211 0.0479  0.0675  0.1382  1040 ALA A CB  
307  N N   . GLN A 41  ? 0.9279 1.0003 1.2665 0.0850  0.0353  0.1643  1041 GLN A N   
308  C CA  . GLN A 41  ? 0.9657 1.0787 1.2375 0.0905  0.0144  0.1433  1041 GLN A CA  
309  C C   . GLN A 41  ? 1.1127 1.2515 1.3120 0.1135  0.0332  0.1750  1041 GLN A C   
310  O O   . GLN A 41  ? 1.1511 1.3199 1.2891 0.1148  0.0301  0.1455  1041 GLN A O   
311  C CB  . GLN A 41  ? 0.9674 1.1133 1.2435 0.0924  -0.0251 0.1364  1041 GLN A CB  
312  C CG  . GLN A 41  ? 1.1932 1.3755 1.4401 0.0762  -0.0522 0.0855  1041 GLN A CG  
313  C CD  . GLN A 41  ? 1.4255 1.6711 1.6679 0.0808  -0.0909 0.0835  1041 GLN A CD  
314  O OE1 . GLN A 41  ? 1.2919 1.5424 1.5878 0.0784  -0.1044 0.0905  1041 GLN A OE1 
315  N NE2 . GLN A 41  ? 1.4152 1.7226 1.5947 0.0879  -0.1104 0.0693  1041 GLN A NE2 
316  N N   . LYS A 42  ? 1.1195 1.2441 1.3242 0.1327  0.0563  0.2344  1042 LYS A N   
317  C CA  . LYS A 42  ? 1.2161 1.3642 1.3498 0.1605  0.0819  0.2817  1042 LYS A CA  
318  C C   . LYS A 42  ? 1.3082 1.4404 1.4366 0.1531  0.1308  0.2848  1042 LYS A C   
319  O O   . LYS A 42  ? 1.3869 1.5499 1.4401 0.1751  0.1550  0.3120  1042 LYS A O   
320  C CB  . LYS A 42  ? 1.2858 1.4117 1.4367 0.1865  0.0967  0.3536  1042 LYS A CB  
321  C CG  . LYS A 42  ? 1.4384 1.6016 1.5799 0.2094  0.0529  0.3625  1042 LYS A CG  
322  C CD  . LYS A 42  ? 1.6038 1.7210 1.7870 0.2354  0.0743  0.4284  1042 LYS A CD  
323  C CE  . LYS A 42  ? 1.7560 1.9273 1.9252 0.2700  0.0332  0.4451  1042 LYS A CE  
324  N NZ  . LYS A 42  ? 1.9255 2.0693 2.0973 0.3183  0.0589  0.5306  1042 LYS A NZ  
325  N N   . ALA A 43  ? 1.2100 1.3058 1.4175 0.1256  0.1456  0.2591  1043 ALA A N   
326  C CA  . ALA A 43  ? 1.2222 1.3137 1.4507 0.1171  0.1913  0.2591  1043 ALA A CA  
327  C C   . ALA A 43  ? 1.2986 1.4188 1.4724 0.1211  0.1915  0.2091  1043 ALA A C   
328  O O   . ALA A 43  ? 1.2728 1.3993 1.4235 0.1168  0.1536  0.1609  1043 ALA A O   
329  C CB  . ALA A 43  ? 1.1565 1.2187 1.4938 0.0895  0.1973  0.2445  1043 ALA A CB  
330  N N   . THR A 44  ? 1.3150 1.4496 1.4757 0.1282  0.2397  0.2193  1044 THR A N   
331  C CA  . THR A 44  ? 1.3553 1.5108 1.4679 0.1372  0.2528  0.1709  1044 THR A CA  
332  C C   . THR A 44  ? 1.3658 1.5097 1.5693 0.1253  0.2748  0.1478  1044 THR A C   
333  O O   . THR A 44  ? 1.3469 1.4965 1.6196 0.1169  0.3086  0.1839  1044 THR A O   
334  C CB  . THR A 44  ? 1.5722 1.7674 1.5914 0.1637  0.2946  0.1988  1044 THR A CB  
335  O OG1 . THR A 44  ? 1.5903 1.7848 1.6609 0.1621  0.3491  0.2592  1044 THR A OG1 
336  C CG2 . THR A 44  ? 1.6214 1.8483 1.5391 0.1844  0.2669  0.2208  1044 THR A CG2 
337  N N   . PRO A 45  ? 1.3130 1.4439 1.5234 0.1257  0.2590  0.0904  1045 PRO A N   
338  C CA  . PRO A 45  ? 1.2707 1.4007 1.5685 0.1248  0.2779  0.0767  1045 PRO A CA  
339  C C   . PRO A 45  ? 1.3804 1.5491 1.7044 0.1359  0.3367  0.1006  1045 PRO A C   
340  O O   . PRO A 45  ? 1.4524 1.6408 1.6992 0.1525  0.3696  0.1086  1045 PRO A O   
341  C CB  . PRO A 45  ? 1.3078 1.4107 1.5788 0.1351  0.2654  0.0182  1045 PRO A CB  
342  C CG  . PRO A 45  ? 1.3674 1.4507 1.5821 0.1226  0.2209  -0.0004 1045 PRO A CG  
343  C CD  . PRO A 45  ? 1.3553 1.4712 1.5055 0.1260  0.2237  0.0372  1045 PRO A CD  
344  N N   . PRO A 46  ? 1.3078 1.4997 1.7405 0.1278  0.3512  0.1110  1046 PRO A N   
345  C CA  . PRO A 46  ? 1.3457 1.5881 1.8220 0.1338  0.4103  0.1352  1046 PRO A CA  
346  C C   . PRO A 46  ? 1.4739 1.7367 1.9188 0.1680  0.4482  0.1031  1046 PRO A C   
347  O O   . PRO A 46  ? 1.4841 1.7994 1.9909 0.1772  0.4954  0.1152  1046 PRO A O   
348  C CB  . PRO A 46  ? 1.2904 1.5640 1.9005 0.1114  0.4017  0.1437  1046 PRO A CB  
349  C CG  . PRO A 46  ? 1.2840 1.5289 1.9065 0.1120  0.3455  0.1117  1046 PRO A CG  
350  C CD  . PRO A 46  ? 1.2453 1.4328 1.7667 0.1122  0.3139  0.1025  1046 PRO A CD  
351  N N   . LYS A 47  ? 1.4884 1.7116 1.8410 0.1857  0.4307  0.0588  1047 LYS A N   
352  C CA  . LYS A 47  ? 1.5680 1.7909 1.8738 0.2192  0.4652  0.0145  1047 LYS A CA  
353  C C   . LYS A 47  ? 1.7293 1.9265 1.8972 0.2254  0.4545  -0.0211 1047 LYS A C   
354  O O   . LYS A 47  ? 1.8194 2.0295 1.9206 0.2517  0.4939  -0.0534 1047 LYS A O   
355  C CB  . LYS A 47  ? 1.5599 1.7530 1.9309 0.2350  0.4520  -0.0226 1047 LYS A CB  
356  C CG  . LYS A 47  ? 1.5942 1.8446 2.0875 0.2482  0.4786  0.0013  1047 LYS A CG  
357  C CD  . LYS A 47  ? 1.6648 1.8876 2.2130 0.2750  0.4654  -0.0253 1047 LYS A CD  
358  C CE  . LYS A 47  ? 1.7208 2.0210 2.3958 0.2908  0.4795  0.0012  1047 LYS A CE  
359  N NZ  . LYS A 47  ? 1.7965 2.0733 2.5244 0.3179  0.4535  -0.0076 1047 LYS A NZ  
360  N N   . LEU A 48  ? 1.6782 1.8505 1.8049 0.2024  0.4014  -0.0182 1048 LEU A N   
361  C CA  . LEU A 48  ? 1.7631 1.9328 1.7677 0.2043  0.3796  -0.0523 1048 LEU A CA  
362  C C   . LEU A 48  ? 1.8790 2.0997 1.8098 0.2108  0.3946  0.0039  1048 LEU A C   
363  O O   . LEU A 48  ? 1.9104 2.1450 1.7573 0.2093  0.3598  0.0002  1048 LEU A O   
364  C CB  . LEU A 48  ? 1.7176 1.8468 1.7261 0.1790  0.3150  -0.0805 1048 LEU A CB  
365  C CG  . LEU A 48  ? 1.7710 1.8399 1.8193 0.1740  0.3016  -0.1415 1048 LEU A CG  
366  C CD1 . LEU A 48  ? 1.7415 1.7836 1.7878 0.1448  0.2445  -0.1619 1048 LEU A CD1 
367  C CD2 . LEU A 48  ? 1.9207 1.9732 1.9054 0.1938  0.3335  -0.2114 1048 LEU A CD2 
368  N N   . GLU A 49  ? 1.8592 2.1128 1.8265 0.2200  0.4495  0.0589  1049 GLU A N   
369  C CA  . GLU A 49  ? 1.9278 2.2225 1.8391 0.2298  0.4820  0.1282  1049 GLU A CA  
370  C C   . GLU A 49  ? 2.1222 2.4596 1.8851 0.2616  0.5024  0.1033  1049 GLU A C   
371  O O   . GLU A 49  ? 2.1851 2.5543 1.8558 0.2741  0.4948  0.1435  1049 GLU A O   
372  C CB  . GLU A 49  ? 1.9322 2.2510 1.9375 0.2260  0.5457  0.1843  1049 GLU A CB  
373  C CG  . GLU A 49  ? 1.9608 2.2557 2.1170 0.1938  0.5282  0.1975  1049 GLU A CG  
374  C CD  . GLU A 49  ? 2.2321 2.5679 2.4989 0.1879  0.5857  0.2214  1049 GLU A CD  
375  O OE1 . GLU A 49  ? 2.1510 2.4885 2.5133 0.1581  0.5947  0.2676  1049 GLU A OE1 
376  O OE2 . GLU A 49  ? 2.1748 2.5433 2.4409 0.2121  0.6224  0.1896  1049 GLU A OE2 
377  N N   . ASP A 50  ? 2.1344 2.4750 1.8737 0.2789  0.5291  0.0359  1050 ASP A N   
378  C CA  . ASP A 50  ? 2.2753 2.6570 1.8751 0.3102  0.5541  -0.0093 1050 ASP A CA  
379  C C   . ASP A 50  ? 2.3651 2.7446 1.8647 0.3040  0.4882  -0.0743 1050 ASP A C   
380  O O   . ASP A 50  ? 2.4774 2.9159 1.8411 0.3264  0.4904  -0.0855 1050 ASP A O   
381  C CB  . ASP A 50  ? 2.3386 2.7097 1.9641 0.3302  0.6027  -0.0727 1050 ASP A CB  
382  C CG  . ASP A 50  ? 2.4256 2.8066 2.1837 0.3326  0.6570  -0.0248 1050 ASP A CG  
383  O OD1 . ASP A 50  ? 2.4659 2.8998 2.2265 0.3398  0.7090  0.0474  1050 ASP A OD1 
384  O OD2 . ASP A 50  ? 2.4350 2.7768 2.2962 0.3286  0.6497  -0.0584 1050 ASP A OD2 
385  N N   . LYS A 51  ? 2.2306 2.5520 1.7987 0.2735  0.4311  -0.1172 1051 LYS A N   
386  C CA  . LYS A 51  ? 2.2566 2.5746 1.7630 0.2567  0.3678  -0.1872 1051 LYS A CA  
387  C C   . LYS A 51  ? 2.2950 2.6622 1.7556 0.2515  0.3177  -0.1346 1051 LYS A C   
388  O O   . LYS A 51  ? 2.2030 2.5602 1.7325 0.2453  0.3134  -0.0532 1051 LYS A O   
389  C CB  . LYS A 51  ? 2.1988 2.4352 1.8074 0.2256  0.3352  -0.2406 1051 LYS A CB  
390  C CG  . LYS A 51  ? 2.3305 2.5101 1.9979 0.2378  0.3822  -0.2855 1051 LYS A CG  
391  C CD  . LYS A 51  ? 2.5736 2.7415 2.1544 0.2499  0.3997  -0.3884 1051 LYS A CD  
392  C CE  . LYS A 51  ? 2.7148 2.8311 2.3520 0.2759  0.4592  -0.4200 1051 LYS A CE  
393  N NZ  . LYS A 51  ? 2.8264 3.0018 2.4520 0.3132  0.5245  -0.3677 1051 LYS A NZ  
394  N N   . SER A 52  ? 2.3473 2.7710 1.6951 0.2555  0.2791  -0.1880 1052 SER A N   
395  C CA  . SER A 52  ? 2.3636 2.8569 1.6512 0.2591  0.2243  -0.1540 1052 SER A CA  
396  C C   . SER A 52  ? 2.2800 2.7345 1.6752 0.2245  0.1681  -0.1426 1052 SER A C   
397  O O   . SER A 52  ? 2.2033 2.5869 1.6861 0.1929  0.1596  -0.1951 1052 SER A O   
398  C CB  . SER A 52  ? 2.5449 3.1149 1.7028 0.2646  0.1900  -0.2428 1052 SER A CB  
399  O OG  . SER A 52  ? 2.6577 3.1767 1.8557 0.2264  0.1645  -0.3572 1052 SER A OG  
400  N N   . PRO A 53  ? 2.2142 2.7142 1.6036 0.2341  0.1328  -0.0731 1053 PRO A N   
401  C CA  . PRO A 53  ? 2.0956 2.5622 1.5889 0.2049  0.0860  -0.0632 1053 PRO A CA  
402  C C   . PRO A 53  ? 2.1454 2.6359 1.6425 0.1720  0.0251  -0.1544 1053 PRO A C   
403  O O   . PRO A 53  ? 2.0423 2.4908 1.6378 0.1418  -0.0016 -0.1608 1053 PRO A O   
404  C CB  . PRO A 53  ? 2.1211 2.6344 1.5964 0.2350  0.0745  0.0368  1053 PRO A CB  
405  C CG  . PRO A 53  ? 2.2812 2.8299 1.6635 0.2767  0.1277  0.0956  1053 PRO A CG  
406  C CD  . PRO A 53  ? 2.3182 2.8972 1.6122 0.2777  0.1409  0.0087  1053 PRO A CD  
407  N N   . ASP A 54  ? 2.2163 2.7784 1.6099 0.1753  0.0046  -0.2265 1054 ASP A N   
408  C CA  . ASP A 54  ? 2.2348 2.8301 1.6364 0.1365  -0.0528 -0.3229 1054 ASP A CA  
409  C C   . ASP A 54  ? 2.3022 2.8117 1.7388 0.0999  -0.0314 -0.4274 1054 ASP A C   
410  O O   . ASP A 54  ? 2.3298 2.8485 1.7869 0.0591  -0.0699 -0.5156 1054 ASP A O   
411  C CB  . ASP A 54  ? 2.3863 3.1218 1.6605 0.1570  -0.0959 -0.3524 1054 ASP A CB  
412  C CG  . ASP A 54  ? 2.4984 3.3265 1.7484 0.1947  -0.1287 -0.2535 1054 ASP A CG  
413  O OD1 . ASP A 54  ? 2.3881 3.1713 1.7381 0.1914  -0.1323 -0.1842 1054 ASP A OD1 
414  O OD2 . ASP A 54  ? 2.6972 3.6454 1.8268 0.2305  -0.1515 -0.2476 1054 ASP A OD2 
415  N N   . SER A 55  ? 2.2404 2.6662 1.6955 0.1145  0.0320  -0.4151 1055 SER A N   
416  C CA  . SER A 55  ? 2.2621 2.5942 1.7557 0.0939  0.0642  -0.4984 1055 SER A CA  
417  C C   . SER A 55  ? 2.1968 2.4436 1.8218 0.0517  0.0470  -0.5113 1055 SER A C   
418  O O   . SER A 55  ? 2.0765 2.3226 1.7697 0.0487  0.0295  -0.4362 1055 SER A O   
419  C CB  . SER A 55  ? 2.3111 2.5939 1.8058 0.1293  0.1355  -0.4613 1055 SER A CB  
420  O OG  . SER A 55  ? 2.3035 2.5549 1.8866 0.1374  0.1511  -0.3628 1055 SER A OG  
421  N N   . PRO A 56  ? 2.1932 2.3623 1.8556 0.0214  0.0574  -0.6018 1056 PRO A N   
422  C CA  . PRO A 56  ? 2.1053 2.1927 1.8894 -0.0155 0.0481  -0.6016 1056 PRO A CA  
423  C C   . PRO A 56  ? 2.0234 2.0436 1.8910 0.0064  0.0822  -0.5155 1056 PRO A C   
424  O O   . PRO A 56  ? 1.9347 1.9173 1.8902 -0.0154 0.0673  -0.4868 1056 PRO A O   
425  C CB  . PRO A 56  ? 2.2392 2.2458 2.0349 -0.0434 0.0682  -0.7119 1056 PRO A CB  
426  C CG  . PRO A 56  ? 2.4089 2.4255 2.1064 -0.0072 0.1073  -0.7542 1056 PRO A CG  
427  C CD  . PRO A 56  ? 2.3583 2.5061 1.9539 0.0199  0.0816  -0.7088 1056 PRO A CD  
428  N N   . GLU A 57  ? 1.9688 1.9856 1.8105 0.0487  0.1271  -0.4757 1057 GLU A N   
429  C CA  . GLU A 57  ? 1.8600 1.8377 1.7798 0.0703  0.1565  -0.3989 1057 GLU A CA  
430  C C   . GLU A 57  ? 1.7786 1.8086 1.7227 0.0699  0.1274  -0.3144 1057 GLU A C   
431  O O   . GLU A 57  ? 1.6743 1.6723 1.7019 0.0660  0.1254  -0.2686 1057 GLU A O   
432  C CB  . GLU A 57  ? 1.9197 1.8986 1.8117 0.1116  0.2134  -0.3869 1057 GLU A CB  
433  C CG  . GLU A 57  ? 2.1650 2.0807 2.0447 0.1227  0.2536  -0.4662 1057 GLU A CG  
434  C CD  . GLU A 57  ? 2.5736 2.5305 2.3349 0.1286  0.2609  -0.5405 1057 GLU A CD  
435  O OE1 . GLU A 57  ? 2.5267 2.5544 2.2158 0.1585  0.2829  -0.5092 1057 GLU A OE1 
436  O OE2 . GLU A 57  ? 2.6059 2.5246 2.3472 0.1026  0.2481  -0.6325 1057 GLU A OE2 
437  N N   . MET A 58  ? 1.7484 1.8587 1.6165 0.0786  0.1076  -0.2934 1058 MET A N   
438  C CA  . MET A 58  ? 1.6643 1.8186 1.5484 0.0838  0.0846  -0.2148 1058 MET A CA  
439  C C   . MET A 58  ? 1.6439 1.8133 1.5657 0.0546  0.0313  -0.2239 1058 MET A C   
440  O O   . MET A 58  ? 1.5581 1.7380 1.5249 0.0563  0.0155  -0.1648 1058 MET A O   
441  C CB  . MET A 58  ? 1.7648 1.9959 1.5509 0.1127  0.0902  -0.1804 1058 MET A CB  
442  C CG  . MET A 58  ? 1.8287 2.0535 1.6047 0.1417  0.1488  -0.1336 1058 MET A CG  
443  S SD  . MET A 58  ? 1.7735 1.9747 1.6474 0.1438  0.1655  -0.0362 1058 MET A SD  
444  C CE  . MET A 58  ? 1.7619 2.0243 1.5767 0.1600  0.1377  0.0284  1058 MET A CE  
445  N N   . LYS A 59  ? 1.6413 1.8126 1.5508 0.0262  0.0071  -0.3019 1059 LYS A N   
446  C CA  . LYS A 59  ? 1.5980 1.7950 1.5525 -0.0072 -0.0401 -0.3194 1059 LYS A CA  
447  C C   . LYS A 59  ? 1.5431 1.6656 1.6040 -0.0268 -0.0323 -0.2994 1059 LYS A C   
448  O O   . LYS A 59  ? 1.4669 1.6165 1.5739 -0.0342 -0.0584 -0.2608 1059 LYS A O   
449  C CB  . LYS A 59  ? 1.7235 1.9500 1.6419 -0.0393 -0.0653 -0.4171 1059 LYS A CB  
450  C CG  . LYS A 59  ? 1.9156 2.2581 1.7275 -0.0222 -0.0964 -0.4334 1059 LYS A CG  
451  C CD  . LYS A 59  ? 1.9581 2.3993 1.7817 -0.0188 -0.1480 -0.3866 1059 LYS A CD  
452  C CE  . LYS A 59  ? 2.1262 2.6909 1.8383 0.0111  -0.1775 -0.3863 1059 LYS A CE  
453  N NZ  . LYS A 59  ? 2.1622 2.8221 1.8922 0.0268  -0.2234 -0.3276 1059 LYS A NZ  
454  N N   . ASP A 60  ? 1.4973 1.5316 1.5940 -0.0286 0.0056  -0.3211 1060 ASP A N   
455  C CA  . ASP A 60  ? 1.4208 1.3886 1.6070 -0.0390 0.0167  -0.2962 1060 ASP A CA  
456  C C   . ASP A 60  ? 1.3326 1.3108 1.5486 -0.0126 0.0226  -0.2170 1060 ASP A C   
457  O O   . ASP A 60  ? 1.2594 1.2254 1.5353 -0.0213 0.0127  -0.1865 1060 ASP A O   
458  C CB  . ASP A 60  ? 1.5063 1.3807 1.7186 -0.0376 0.0574  -0.3335 1060 ASP A CB  
459  C CG  . ASP A 60  ? 1.6640 1.4738 1.9597 -0.0563 0.0636  -0.3209 1060 ASP A CG  
460  O OD1 . ASP A 60  ? 1.6021 1.4000 1.9401 -0.0350 0.0728  -0.2594 1060 ASP A OD1 
461  O OD2 . ASP A 60  ? 1.8271 1.6042 2.1463 -0.0937 0.0593  -0.3721 1060 ASP A OD2 
462  N N   . PHE A 61  ? 1.2640 1.2690 1.4393 0.0168  0.0402  -0.1866 1061 PHE A N   
463  C CA  . PHE A 61  ? 1.1798 1.1964 1.3876 0.0355  0.0485  -0.1204 1061 PHE A CA  
464  C C   . PHE A 61  ? 1.1657 1.2227 1.3863 0.0290  0.0145  -0.0845 1061 PHE A C   
465  O O   . PHE A 61  ? 1.0837 1.1287 1.3605 0.0289  0.0115  -0.0514 1061 PHE A O   
466  C CB  . PHE A 61  ? 1.2328 1.2725 1.3979 0.0614  0.0800  -0.0980 1061 PHE A CB  
467  C CG  . PHE A 61  ? 1.1856 1.2398 1.3899 0.0713  0.0885  -0.0350 1061 PHE A CG  
468  C CD1 . PHE A 61  ? 1.1681 1.2015 1.4419 0.0753  0.1079  -0.0174 1061 PHE A CD1 
469  C CD2 . PHE A 61  ? 1.2068 1.2966 1.3841 0.0768  0.0762  0.0049  1061 PHE A CD2 
470  C CE1 . PHE A 61  ? 1.1277 1.1758 1.4461 0.0759  0.1137  0.0277  1061 PHE A CE1 
471  C CE2 . PHE A 61  ? 1.1959 1.2830 1.4193 0.0808  0.0883  0.0563  1061 PHE A CE2 
472  C CZ  . PHE A 61  ? 1.1207 1.1871 1.4154 0.0762  0.1066  0.0620  1061 PHE A CZ  
473  N N   . ARG A 62  ? 1.1652 1.2770 1.3310 0.0291  -0.0098 -0.0910 1062 ARG A N   
474  C CA  . ARG A 62  ? 1.1283 1.2864 1.3044 0.0315  -0.0412 -0.0567 1062 ARG A CA  
475  C C   . ARG A 62  ? 1.1329 1.2909 1.3649 0.0041  -0.0675 -0.0801 1062 ARG A C   
476  O O   . ARG A 62  ? 1.0736 1.2501 1.3444 0.0075  -0.0826 -0.0474 1062 ARG A O   
477  C CB  . ARG A 62  ? 1.2012 1.4326 1.3003 0.0475  -0.0611 -0.0537 1062 ARG A CB  
478  C CG  . ARG A 62  ? 1.3866 1.6249 1.4298 0.0797  -0.0300 -0.0090 1062 ARG A CG  
479  C CD  . ARG A 62  ? 1.6241 1.9427 1.5893 0.1056  -0.0510 0.0145  1062 ARG A CD  
480  N NE  . ARG A 62  ? 1.8392 2.2149 1.7387 0.0951  -0.0773 -0.0528 1062 ARG A NE  
481  C CZ  . ARG A 62  ? 2.0958 2.4879 1.9123 0.1058  -0.0576 -0.0823 1062 ARG A CZ  
482  N NH1 . ARG A 62  ? 1.9510 2.3101 1.7441 0.1284  -0.0075 -0.0426 1062 ARG A NH1 
483  N NH2 . ARG A 62  ? 1.9910 2.4375 1.7506 0.0921  -0.0857 -0.1559 1062 ARG A NH2 
484  N N   . HIS A 63  ? 1.1215 1.2540 1.3618 -0.0229 -0.0669 -0.1369 1063 HIS A N   
485  C CA  . HIS A 63  ? 1.0991 1.2243 1.3995 -0.0553 -0.0817 -0.1597 1063 HIS A CA  
486  C C   . HIS A 63  ? 1.0555 1.1239 1.4180 -0.0525 -0.0608 -0.1256 1063 HIS A C   
487  O O   . HIS A 63  ? 1.0160 1.0991 1.4263 -0.0646 -0.0724 -0.1110 1063 HIS A O   
488  C CB  . HIS A 63  ? 1.1950 1.2959 1.4893 -0.0877 -0.0791 -0.2323 1063 HIS A CB  
489  C CG  . HIS A 63  ? 1.2391 1.3205 1.6060 -0.1269 -0.0836 -0.2537 1063 HIS A CG  
490  N ND1 . HIS A 63  ? 1.2587 1.4180 1.6555 -0.1519 -0.1188 -0.2647 1063 HIS A ND1 
491  C CD2 . HIS A 63  ? 1.2747 1.2720 1.6930 -0.1420 -0.0531 -0.2588 1063 HIS A CD2 
492  C CE1 . HIS A 63  ? 1.2566 1.3754 1.7249 -0.1869 -0.1057 -0.2778 1063 HIS A CE1 
493  N NE2 . HIS A 63  ? 1.2738 1.2901 1.7540 -0.1809 -0.0652 -0.2713 1063 HIS A NE2 
494  N N   . GLY A 64  ? 0.9799 0.9963 1.3398 -0.0340 -0.0302 -0.1140 1064 GLY A N   
495  C CA  . GLY A 64  ? 0.9166 0.8946 1.3250 -0.0237 -0.0132 -0.0820 1064 GLY A CA  
496  C C   . GLY A 64  ? 0.8823 0.8944 1.3118 -0.0121 -0.0264 -0.0391 1064 GLY A C   
497  O O   . GLY A 64  ? 0.8420 0.8443 1.3105 -0.0112 -0.0243 -0.0205 1064 GLY A O   
498  N N   . PHE A 65  ? 0.8209 0.8715 1.2217 -0.0004 -0.0372 -0.0229 1065 PHE A N   
499  C CA  . PHE A 65  ? 0.7708 0.8436 1.1912 0.0120  -0.0459 0.0123  1065 PHE A CA  
500  C C   . PHE A 65  ? 0.8026 0.9158 1.2395 0.0042  -0.0711 0.0129  1065 PHE A C   
501  O O   . PHE A 65  ? 0.7622 0.8825 1.2304 0.0122  -0.0738 0.0333  1065 PHE A O   
502  C CB  . PHE A 65  ? 0.8145 0.8970 1.2052 0.0307  -0.0368 0.0374  1065 PHE A CB  
503  C CG  . PHE A 65  ? 0.8285 0.8836 1.2379 0.0376  -0.0099 0.0489  1065 PHE A CG  
504  C CD1 . PHE A 65  ? 0.8259 0.8734 1.2836 0.0386  -0.0074 0.0626  1065 PHE A CD1 
505  C CD2 . PHE A 65  ? 0.9011 0.9481 1.2834 0.0425  0.0129  0.0405  1065 PHE A CD2 
506  C CE1 . PHE A 65  ? 0.8311 0.8716 1.3177 0.0405  0.0127  0.0668  1065 PHE A CE1 
507  C CE2 . PHE A 65  ? 0.9245 0.9623 1.3383 0.0481  0.0382  0.0509  1065 PHE A CE2 
508  C CZ  . PHE A 65  ? 0.8530 0.8918 1.3227 0.0451  0.0355  0.0636  1065 PHE A CZ  
509  N N   . ASP A 66  ? 0.7874 0.9342 1.2083 -0.0121 -0.0891 -0.0147 1066 ASP A N   
510  C CA  . ASP A 66  ? 0.7716 0.9751 1.2223 -0.0231 -0.1139 -0.0186 1066 ASP A CA  
511  C C   . ASP A 66  ? 0.7800 0.9626 1.2860 -0.0428 -0.1037 -0.0218 1066 ASP A C   
512  O O   . ASP A 66  ? 0.7555 0.9768 1.2985 -0.0413 -0.1117 -0.0072 1066 ASP A O   
513  C CB  . ASP A 66  ? 0.8537 1.1099 1.2806 -0.0423 -0.1379 -0.0577 1066 ASP A CB  
514  C CG  . ASP A 66  ? 1.0437 1.3493 1.4084 -0.0160 -0.1537 -0.0461 1066 ASP A CG  
515  O OD1 . ASP A 66  ? 1.0486 1.3864 1.4143 0.0147  -0.1614 -0.0019 1066 ASP A OD1 
516  O OD2 . ASP A 66  ? 1.1727 1.4865 1.4861 -0.0236 -0.1568 -0.0809 1066 ASP A OD2 
517  N N   . ILE A 67  ? 0.7311 0.8530 1.2415 -0.0558 -0.0815 -0.0360 1067 ILE A N   
518  C CA  . ILE A 67  ? 0.7080 0.7979 1.2611 -0.0675 -0.0630 -0.0275 1067 ILE A CA  
519  C C   . ILE A 67  ? 0.6945 0.7853 1.2543 -0.0396 -0.0564 0.0096  1067 ILE A C   
520  O O   . ILE A 67  ? 0.6720 0.7856 1.2610 -0.0401 -0.0541 0.0253  1067 ILE A O   
521  C CB  . ILE A 67  ? 0.7897 0.8073 1.3397 -0.0767 -0.0378 -0.0456 1067 ILE A CB  
522  C CG1 . ILE A 67  ? 0.8621 0.8738 1.4083 -0.1100 -0.0428 -0.0974 1067 ILE A CG1 
523  C CG2 . ILE A 67  ? 0.7922 0.7706 1.3792 -0.0761 -0.0126 -0.0191 1067 ILE A CG2 
524  C CD1 . ILE A 67  ? 1.0092 0.9461 1.5360 -0.1083 -0.0170 -0.1241 1067 ILE A CD1 
525  N N   . LEU A 68  ? 0.6286 0.7010 1.1629 -0.0175 -0.0520 0.0186  1068 LEU A N   
526  C CA  . LEU A 68  ? 0.5952 0.6700 1.1359 0.0041  -0.0483 0.0396  1068 LEU A CA  
527  C C   . LEU A 68  ? 0.6443 0.7566 1.1961 0.0131  -0.0607 0.0494  1068 LEU A C   
528  O O   . LEU A 68  ? 0.6374 0.7599 1.2048 0.0225  -0.0572 0.0570  1068 LEU A O   
529  C CB  . LEU A 68  ? 0.6008 0.6576 1.1237 0.0161  -0.0410 0.0401  1068 LEU A CB  
530  C CG  . LEU A 68  ? 0.6491 0.7011 1.1887 0.0295  -0.0320 0.0486  1068 LEU A CG  
531  C CD1 . LEU A 68  ? 0.6734 0.7043 1.2079 0.0353  -0.0165 0.0441  1068 LEU A CD1 
532  C CD2 . LEU A 68  ? 0.6644 0.7336 1.2163 0.0365  -0.0370 0.0526  1068 LEU A CD2 
533  N N   . VAL A 69  ? 0.6039 0.7407 1.1453 0.0152  -0.0741 0.0494  1069 VAL A N   
534  C CA  . VAL A 69  ? 0.5864 0.7569 1.1429 0.0319  -0.0832 0.0628  1069 VAL A CA  
535  C C   . VAL A 69  ? 0.6357 0.8481 1.2258 0.0226  -0.0873 0.0596  1069 VAL A C   
536  O O   . VAL A 69  ? 0.6230 0.8530 1.2342 0.0385  -0.0828 0.0678  1069 VAL A O   
537  C CB  . VAL A 69  ? 0.6599 0.8520 1.1934 0.0455  -0.0954 0.0744  1069 VAL A CB  
538  C CG1 . VAL A 69  ? 0.6603 0.8905 1.2173 0.0700  -0.1036 0.0931  1069 VAL A CG1 
539  C CG2 . VAL A 69  ? 0.6726 0.8230 1.1791 0.0560  -0.0811 0.0870  1069 VAL A CG2 
540  N N   . GLY A 70  ? 0.6130 0.8390 1.2119 -0.0047 -0.0914 0.0445  1070 GLY A N   
541  C CA  . GLY A 70  ? 0.6083 0.8748 1.2511 -0.0235 -0.0891 0.0417  1070 GLY A CA  
542  C C   . GLY A 70  ? 0.6403 0.8884 1.2967 -0.0188 -0.0653 0.0570  1070 GLY A C   
543  O O   . GLY A 70  ? 0.6116 0.9035 1.2983 -0.0138 -0.0585 0.0669  1070 GLY A O   
544  N N   . GLN A 71  ? 0.6157 0.8082 1.2470 -0.0151 -0.0519 0.0609  1071 GLN A N   
545  C CA  . GLN A 71  ? 0.6159 0.7977 1.2449 -0.0026 -0.0326 0.0792  1071 GLN A CA  
546  C C   . GLN A 71  ? 0.6404 0.8451 1.2577 0.0262  -0.0366 0.0805  1071 GLN A C   
547  O O   . GLN A 71  ? 0.6432 0.8719 1.2607 0.0381  -0.0238 0.0906  1071 GLN A O   
548  C CB  . GLN A 71  ? 0.6523 0.7814 1.2607 0.0003  -0.0224 0.0839  1071 GLN A CB  
549  C CG  . GLN A 71  ? 0.9802 1.0732 1.6080 -0.0230 -0.0027 0.0891  1071 GLN A CG  
550  C CD  . GLN A 71  ? 1.2706 1.3054 1.8827 -0.0140 0.0093  0.0921  1071 GLN A CD  
551  O OE1 . GLN A 71  ? 1.2444 1.2355 1.8642 -0.0336 0.0173  0.0740  1071 GLN A OE1 
552  N NE2 . GLN A 71  ? 1.1649 1.2036 1.7583 0.0173  0.0113  0.1113  1071 GLN A NE2 
553  N N   . ILE A 72  ? 0.5712 0.7660 1.1778 0.0372  -0.0502 0.0693  1072 ILE A N   
554  C CA  . ILE A 72  ? 0.5596 0.7602 1.1645 0.0596  -0.0509 0.0616  1072 ILE A CA  
555  C C   . ILE A 72  ? 0.6263 0.8700 1.2551 0.0715  -0.0480 0.0639  1072 ILE A C   
556  O O   . ILE A 72  ? 0.6335 0.8940 1.2618 0.0885  -0.0380 0.0563  1072 ILE A O   
557  C CB  . ILE A 72  ? 0.5946 0.7610 1.1929 0.0641  -0.0573 0.0556  1072 ILE A CB  
558  C CG1 . ILE A 72  ? 0.5853 0.7254 1.1712 0.0574  -0.0551 0.0497  1072 ILE A CG1 
559  C CG2 . ILE A 72  ? 0.6289 0.7897 1.2405 0.0836  -0.0536 0.0465  1072 ILE A CG2 
560  C CD1 . ILE A 72  ? 0.6356 0.7450 1.2186 0.0538  -0.0539 0.0513  1072 ILE A CD1 
561  N N   . ASP A 73  ? 0.5949 0.8668 1.2450 0.0641  -0.0569 0.0713  1073 ASP A N   
562  C CA  . ASP A 73  ? 0.6051 0.9352 1.2909 0.0771  -0.0557 0.0765  1073 ASP A CA  
563  C C   . ASP A 73  ? 0.6646 1.0347 1.3706 0.0697  -0.0359 0.0816  1073 ASP A C   
564  O O   . ASP A 73  ? 0.6646 1.0771 1.3919 0.0914  -0.0239 0.0824  1073 ASP A O   
565  C CB  . ASP A 73  ? 0.6415 1.0120 1.3476 0.0668  -0.0762 0.0812  1073 ASP A CB  
566  C CG  . ASP A 73  ? 0.8733 1.2288 1.5611 0.0894  -0.0913 0.0894  1073 ASP A CG  
567  O OD1 . ASP A 73  ? 0.9028 1.2170 1.5814 0.1160  -0.0809 0.0936  1073 ASP A OD1 
568  O OD2 . ASP A 73  ? 0.9814 1.3694 1.6652 0.0809  -0.1120 0.0915  1073 ASP A OD2 
569  N N   . ASP A 74  ? 0.6356 0.9895 1.3363 0.0421  -0.0269 0.0885  1074 ASP A N   
570  C CA  . ASP A 74  ? 0.6528 1.0342 1.3690 0.0341  0.0001  0.1053  1074 ASP A CA  
571  C C   . ASP A 74  ? 0.7274 1.1097 1.4056 0.0654  0.0149  0.1065  1074 ASP A C   
572  O O   . ASP A 74  ? 0.7379 1.1693 1.4262 0.0794  0.0362  0.1139  1074 ASP A O   
573  C CB  . ASP A 74  ? 0.6990 1.0399 1.4163 0.0023  0.0106  0.1173  1074 ASP A CB  
574  C CG  . ASP A 74  ? 0.8889 1.2406 1.6532 -0.0381 0.0035  0.1070  1074 ASP A CG  
575  O OD1 . ASP A 74  ? 0.8941 1.3086 1.6960 -0.0418 -0.0120 0.0956  1074 ASP A OD1 
576  O OD2 . ASP A 74  ? 0.9981 1.2996 1.7654 -0.0648 0.0138  0.1079  1074 ASP A OD2 
577  N N   . ALA A 75  ? 0.6923 1.0297 1.3284 0.0761  0.0031  0.0946  1075 ALA A N   
578  C CA  . ALA A 75  ? 0.7080 1.0519 1.3050 0.1021  0.0069  0.0818  1075 ALA A CA  
579  C C   . ALA A 75  ? 0.7654 1.1268 1.3698 0.1255  0.0067  0.0535  1075 ALA A C   
580  O O   . ALA A 75  ? 0.7912 1.1833 1.3726 0.1472  0.0197  0.0392  1075 ALA A O   
581  C CB  . ALA A 75  ? 0.7116 1.0144 1.2826 0.1004  -0.0102 0.0709  1075 ALA A CB  
582  N N   . LEU A 76  ? 0.7075 1.0492 1.3412 0.1249  -0.0056 0.0466  1076 LEU A N   
583  C CA  . LEU A 76  ? 0.7248 1.0680 1.3761 0.1519  -0.0015 0.0270  1076 LEU A CA  
584  C C   . LEU A 76  ? 0.7875 1.1959 1.4658 0.1694  0.0189  0.0348  1076 LEU A C   
585  O O   . LEU A 76  ? 0.8167 1.2357 1.4930 0.1990  0.0345  0.0117  1076 LEU A O   
586  C CB  . LEU A 76  ? 0.7180 1.0288 1.3925 0.1526  -0.0167 0.0351  1076 LEU A CB  
587  C CG  . LEU A 76  ? 0.7909 1.0337 1.4504 0.1498  -0.0242 0.0209  1076 LEU A CG  
588  C CD1 . LEU A 76  ? 0.7914 1.0136 1.4588 0.1440  -0.0372 0.0455  1076 LEU A CD1 
589  C CD2 . LEU A 76  ? 0.8586 1.0697 1.5282 0.1748  -0.0104 -0.0087 1076 LEU A CD2 
590  N N   . LYS A 77  ? 0.7253 1.1789 1.4344 0.1491  0.0217  0.0631  1077 LYS A N   
591  C CA  . LYS A 77  ? 0.7327 1.2633 1.4833 0.1577  0.0441  0.0758  1077 LYS A CA  
592  C C   . LYS A 77  ? 0.8151 1.3725 1.5314 0.1716  0.0753  0.0744  1077 LYS A C   
593  O O   . LYS A 77  ? 0.8400 1.4521 1.5741 0.1979  0.1001  0.0700  1077 LYS A O   
594  C CB  . LYS A 77  ? 0.7488 1.3182 1.5471 0.1195  0.0398  0.1002  1077 LYS A CB  
595  C CG  . LYS A 77  ? 1.0100 1.6683 1.8817 0.1274  0.0438  0.1074  1077 LYS A CG  
596  C CD  . LYS A 77  ? 1.2233 1.9532 2.1276 0.1258  0.0837  0.1229  1077 LYS A CD  
597  C CE  . LYS A 77  ? 1.4348 2.2674 2.4225 0.1391  0.0891  0.1278  1077 LYS A CE  
598  N NZ  . LYS A 77  ? 1.6042 2.5134 2.6322 0.1322  0.1344  0.1467  1077 LYS A NZ  
599  N N   . LEU A 78  ? 0.7721 1.2977 1.4359 0.1599  0.0748  0.0796  1078 LEU A N   
600  C CA  . LEU A 78  ? 0.8028 1.3600 1.4166 0.1780  0.1001  0.0836  1078 LEU A CA  
601  C C   . LEU A 78  ? 0.8687 1.4215 1.4399 0.2121  0.0968  0.0340  1078 LEU A C   
602  O O   . LEU A 78  ? 0.9064 1.5102 1.4558 0.2397  0.1235  0.0222  1078 LEU A O   
603  C CB  . LEU A 78  ? 0.8078 1.3370 1.3817 0.1616  0.0966  0.1108  1078 LEU A CB  
604  C CG  . LEU A 78  ? 0.8508 1.3694 1.4652 0.1265  0.1087  0.1552  1078 LEU A CG  
605  C CD1 . LEU A 78  ? 0.8568 1.3180 1.4413 0.1150  0.0961  0.1711  1078 LEU A CD1 
606  C CD2 . LEU A 78  ? 0.9125 1.4883 1.5412 0.1272  0.1537  0.1943  1078 LEU A CD2 
607  N N   . ALA A 79  ? 0.7947 1.2866 1.3577 0.2080  0.0676  0.0017  1079 ALA A N   
608  C CA  . ALA A 79  ? 0.8206 1.2917 1.3578 0.2287  0.0623  -0.0555 1079 ALA A CA  
609  C C   . ALA A 79  ? 0.8898 1.3677 1.4597 0.2585  0.0829  -0.0805 1079 ALA A C   
610  O O   . ALA A 79  ? 0.9483 1.4381 1.4886 0.2835  0.0969  -0.1277 1079 ALA A O   
611  C CB  . ALA A 79  ? 0.8071 1.2086 1.3530 0.2090  0.0333  -0.0744 1079 ALA A CB  
612  N N   . ASN A 80  ? 0.8009 1.2784 1.4316 0.2592  0.0845  -0.0513 1080 ASN A N   
613  C CA  . ASN A 80  ? 0.8169 1.3083 1.4923 0.2953  0.1044  -0.0626 1080 ASN A CA  
614  C C   . ASN A 80  ? 0.8714 1.4496 1.5474 0.3189  0.1404  -0.0583 1080 ASN A C   
615  O O   . ASN A 80  ? 0.9058 1.4984 1.6005 0.3588  0.1651  -0.0846 1080 ASN A O   
616  C CB  . ASN A 80  ? 0.7768 1.2656 1.5141 0.2922  0.0895  -0.0256 1080 ASN A CB  
617  C CG  . ASN A 80  ? 1.0189 1.4220 1.7647 0.2978  0.0729  -0.0361 1080 ASN A CG  
618  O OD1 . ASN A 80  ? 0.8190 1.1743 1.5455 0.2677  0.0500  -0.0291 1080 ASN A OD1 
619  N ND2 . ASN A 80  ? 1.0105 1.3903 1.7887 0.3393  0.0898  -0.0494 1080 ASN A ND2 
620  N N   . GLU A 81  ? 0.8021 1.4337 1.4598 0.2965  0.1490  -0.0226 1081 GLU A N   
621  C CA  . GLU A 81  ? 0.8289 1.5472 1.4827 0.3129  0.1899  -0.0067 1081 GLU A CA  
622  C C   . GLU A 81  ? 0.9367 1.6676 1.5009 0.3351  0.2055  -0.0416 1081 GLU A C   
623  O O   . GLU A 81  ? 0.9774 1.7810 1.5203 0.3592  0.2449  -0.0364 1081 GLU A O   
624  C CB  . GLU A 81  ? 0.8117 1.5705 1.4929 0.2748  0.1975  0.0535  1081 GLU A CB  
625  C CG  . GLU A 81  ? 0.9000 1.6935 1.6771 0.2562  0.1919  0.0801  1081 GLU A CG  
626  C CD  . GLU A 81  ? 1.2073 2.0320 2.0223 0.2091  0.2013  0.1274  1081 GLU A CD  
627  O OE1 . GLU A 81  ? 1.0424 1.8080 1.8249 0.1778  0.1838  0.1407  1081 GLU A OE1 
628  O OE2 . GLU A 81  ? 1.2504 2.1583 2.1363 0.2025  0.2287  0.1496  1081 GLU A OE2 
629  N N   . GLY A 82  ? 0.8947 1.5656 1.4091 0.3268  0.1744  -0.0778 1082 GLY A N   
630  C CA  . GLY A 82  ? 0.9558 1.6459 1.3839 0.3434  0.1749  -0.1209 1082 GLY A CA  
631  C C   . GLY A 82  ? 1.0065 1.7410 1.3792 0.3323  0.1760  -0.0716 1082 GLY A C   
632  O O   . GLY A 82  ? 1.0810 1.8858 1.3906 0.3584  0.2028  -0.0687 1082 GLY A O   
633  N N   . LYS A 83  ? 0.8802 1.5732 1.2745 0.2979  0.1509  -0.0290 1083 LYS A N   
634  C CA  . LYS A 83  ? 0.8752 1.5907 1.2309 0.2890  0.1547  0.0284  1083 LYS A CA  
635  C C   . LYS A 83  ? 0.9026 1.5760 1.2320 0.2755  0.1119  0.0153  1083 LYS A C   
636  O O   . LYS A 83  ? 0.8497 1.4673 1.2220 0.2463  0.0942  0.0403  1083 LYS A O   
637  C CB  . LYS A 83  ? 0.8580 1.5656 1.2802 0.2603  0.1755  0.0955  1083 LYS A CB  
638  C CG  . LYS A 83  ? 0.9622 1.7329 1.4235 0.2708  0.2208  0.1137  1083 LYS A CG  
639  C CD  . LYS A 83  ? 0.9770 1.7439 1.5277 0.2323  0.2331  0.1611  1083 LYS A CD  
640  C CE  . LYS A 83  ? 1.0757 1.9236 1.6758 0.2424  0.2788  0.1771  1083 LYS A CE  
641  N NZ  . LYS A 83  ? 1.1308 1.9901 1.8343 0.1993  0.2844  0.2090  1083 LYS A NZ  
642  N N   . VAL A 84  ? 0.8992 1.6095 1.1599 0.2973  0.0952  -0.0293 1084 VAL A N   
643  C CA  . VAL A 84  ? 0.8793 1.5761 1.1196 0.2881  0.0529  -0.0527 1084 VAL A CA  
644  C C   . VAL A 84  ? 0.9040 1.6016 1.1337 0.2844  0.0506  0.0220  1084 VAL A C   
645  O O   . VAL A 84  ? 0.8458 1.4845 1.1201 0.2590  0.0309  0.0346  1084 VAL A O   
646  C CB  . VAL A 84  ? 1.0021 1.7641 1.1730 0.3120  0.0346  -0.1224 1084 VAL A CB  
647  C CG1 . VAL A 84  ? 0.9881 1.7450 1.1630 0.2952  -0.0123 -0.1554 1084 VAL A CG1 
648  C CG2 . VAL A 84  ? 1.0347 1.7850 1.2160 0.3194  0.0469  -0.1999 1084 VAL A CG2 
649  N N   . LYS A 85  ? 0.9104 1.6712 1.0805 0.3134  0.0756  0.0738  1085 LYS A N   
650  C CA  . LYS A 85  ? 0.9160 1.6751 1.0710 0.3207  0.0836  0.1541  1085 LYS A CA  
651  C C   . LYS A 85  ? 0.8949 1.5672 1.1289 0.2842  0.1000  0.2023  1085 LYS A C   
652  O O   . LYS A 85  ? 0.8730 1.5066 1.1188 0.2794  0.0922  0.2408  1085 LYS A O   
653  C CB  . LYS A 85  ? 1.0347 1.8700 1.1174 0.3600  0.1229  0.2106  1085 LYS A CB  
654  C CG  . LYS A 85  ? 1.2388 2.1668 1.2251 0.4049  0.0983  0.2030  1085 LYS A CG  
655  C CD  . LYS A 85  ? 1.3977 2.3997 1.3283 0.4223  0.0828  0.1125  1085 LYS A CD  
656  C CE  . LYS A 85  ? 1.6193 2.7253 1.4597 0.4605  0.0459  0.0898  1085 LYS A CE  
657  N NZ  . LYS A 85  ? 1.7955 2.9643 1.5899 0.4683  0.0262  -0.0192 1085 LYS A NZ  
658  N N   . GLU A 86  ? 0.8238 1.4720 1.1136 0.2605  0.1214  0.1948  1086 GLU A N   
659  C CA  . GLU A 86  ? 0.7729 1.3562 1.1399 0.2215  0.1335  0.2254  1086 GLU A CA  
660  C C   . GLU A 86  ? 0.7650 1.2856 1.1731 0.1955  0.0937  0.1833  1086 GLU A C   
661  O O   . GLU A 86  ? 0.7511 1.2159 1.1923 0.1721  0.0907  0.2078  1086 GLU A O   
662  C CB  . GLU A 86  ? 0.7810 1.3900 1.1960 0.2089  0.1672  0.2310  1086 GLU A CB  
663  C CG  . GLU A 86  ? 0.9358 1.6048 1.3217 0.2290  0.2182  0.2844  1086 GLU A CG  
664  C CD  . GLU A 86  ? 1.1125 1.8619 1.4322 0.2711  0.2289  0.2533  1086 GLU A CD  
665  O OE1 . GLU A 86  ? 1.1759 1.9710 1.5233 0.2745  0.2631  0.2522  1086 GLU A OE1 
666  O OE2 . GLU A 86  ? 0.8820 1.6562 1.1255 0.3008  0.2035  0.2252  1086 GLU A OE2 
667  N N   . ALA A 87  ? 0.6924 1.2180 1.0976 0.2006  0.0680  0.1206  1087 ALA A N   
668  C CA  . ALA A 87  ? 0.6352 1.1043 1.0749 0.1797  0.0363  0.0855  1087 ALA A CA  
669  C C   . ALA A 87  ? 0.6867 1.1423 1.1046 0.1812  0.0118  0.0858  1087 ALA A C   
670  O O   . ALA A 87  ? 0.6531 1.0570 1.1031 0.1603  -0.0021 0.0860  1087 ALA A O   
671  C CB  . ALA A 87  ? 0.6416 1.1126 1.0883 0.1874  0.0258  0.0261  1087 ALA A CB  
672  N N   . GLN A 88  ? 0.6838 1.1970 1.0466 0.2093  0.0069  0.0869  1088 GLN A N   
673  C CA  . GLN A 88  ? 0.6897 1.2168 1.0349 0.2192  -0.0177 0.0914  1088 GLN A CA  
674  C C   . GLN A 88  ? 0.7578 1.2479 1.1137 0.2203  -0.0003 0.1607  1088 GLN A C   
675  O O   . GLN A 88  ? 0.7438 1.2122 1.1158 0.2192  -0.0165 0.1661  1088 GLN A O   
676  C CB  . GLN A 88  ? 0.7675 1.3875 1.0471 0.2539  -0.0308 0.0732  1088 GLN A CB  
677  C CG  . GLN A 88  ? 0.9170 1.5650 1.1940 0.2475  -0.0558 -0.0136 1088 GLN A CG  
678  C CD  . GLN A 88  ? 1.1842 1.9364 1.3901 0.2797  -0.0713 -0.0443 1088 GLN A CD  
679  O OE1 . GLN A 88  ? 1.1817 1.9923 1.3259 0.3140  -0.0536 0.0021  1088 GLN A OE1 
680  N NE2 . GLN A 88  ? 1.0970 1.8779 1.3094 0.2684  -0.1027 -0.1258 1088 GLN A NE2 
681  N N   . ALA A 89  ? 0.7438 1.2242 1.0985 0.2214  0.0371  0.2114  1089 ALA A N   
682  C CA  . ALA A 89  ? 0.7684 1.1967 1.1433 0.2171  0.0643  0.2751  1089 ALA A CA  
683  C C   . ALA A 89  ? 0.8003 1.1476 1.2377 0.1757  0.0609  0.2588  1089 ALA A C   
684  O O   . ALA A 89  ? 0.8051 1.0989 1.2603 0.1725  0.0668  0.2832  1089 ALA A O   
685  C CB  . ALA A 89  ? 0.8273 1.2708 1.1943 0.2218  0.1101  0.3273  1089 ALA A CB  
686  N N   . ALA A 90  ? 0.7360 1.0787 1.2036 0.1491  0.0522  0.2170  1090 ALA A N   
687  C CA  . ALA A 90  ? 0.7061 0.9929 1.2217 0.1137  0.0437  0.1966  1090 ALA A CA  
688  C C   . ALA A 90  ? 0.7747 1.0360 1.2884 0.1140  0.0145  0.1667  1090 ALA A C   
689  O O   . ALA A 90  ? 0.7647 0.9761 1.3032 0.0930  0.0116  0.1609  1090 ALA A O   
690  C CB  . ALA A 90  ? 0.6855 0.9945 1.2281 0.0984  0.0411  0.1692  1090 ALA A CB  
691  N N   . ALA A 91  ? 0.7511 1.0533 1.2373 0.1359  -0.0054 0.1444  1091 ALA A N   
692  C CA  . ALA A 91  ? 0.7335 1.0281 1.2272 0.1351  -0.0294 0.1169  1091 ALA A CA  
693  C C   . ALA A 91  ? 0.8197 1.1012 1.3125 0.1499  -0.0258 0.1489  1091 ALA A C   
694  O O   . ALA A 91  ? 0.8023 1.0594 1.3163 0.1424  -0.0348 0.1357  1091 ALA A O   
695  C CB  . ALA A 91  ? 0.7505 1.1020 1.2265 0.1482  -0.0499 0.0775  1091 ALA A CB  
696  N N   . GLU A 92  ? 0.8310 1.1279 1.3006 0.1749  -0.0078 0.1958  1092 GLU A N   
697  C CA  . GLU A 92  ? 0.8702 1.1478 1.3411 0.1993  0.0031  0.2382  1092 GLU A CA  
698  C C   . GLU A 92  ? 0.9131 1.0981 1.4200 0.1743  0.0252  0.2464  1092 GLU A C   
699  O O   . GLU A 92  ? 0.9251 1.0782 1.4453 0.1891  0.0314  0.2605  1092 GLU A O   
700  C CB  . GLU A 92  ? 0.9608 1.2710 1.3950 0.2361  0.0244  0.2973  1092 GLU A CB  
701  C CG  . GLU A 92  ? 1.1869 1.6035 1.5728 0.2719  -0.0007 0.2904  1092 GLU A CG  
702  C CD  . GLU A 92  ? 1.7131 2.1768 2.0468 0.3149  0.0210  0.3540  1092 GLU A CD  
703  O OE1 . GLU A 92  ? 1.7911 2.1944 2.1328 0.3154  0.0637  0.4128  1092 GLU A OE1 
704  O OE2 . GLU A 92  ? 1.7343 2.2986 2.0186 0.3472  -0.0034 0.3436  1092 GLU A OE2 
705  N N   . GLN A 93  ? 0.8542 1.0038 1.3789 0.1379  0.0365  0.2331  1093 GLN A N   
706  C CA  . GLN A 93  ? 0.8586 0.9334 1.4158 0.1065  0.0520  0.2250  1093 GLN A CA  
707  C C   . GLN A 93  ? 0.8654 0.9249 1.4299 0.0937  0.0306  0.1817  1093 GLN A C   
708  O O   . GLN A 93  ? 0.8978 0.9002 1.4763 0.0830  0.0422  0.1737  1093 GLN A O   
709  C CB  . GLN A 93  ? 0.8760 0.9472 1.4551 0.0715  0.0638  0.2197  1093 GLN A CB  
710  C CG  . GLN A 93  ? 1.2258 1.2759 1.8178 0.0713  0.1034  0.2693  1093 GLN A CG  
711  C CD  . GLN A 93  ? 1.5551 1.6365 2.1739 0.0419  0.1157  0.2684  1093 GLN A CD  
712  O OE1 . GLN A 93  ? 1.5030 1.6159 2.1143 0.0549  0.1414  0.3089  1093 GLN A OE1 
713  N NE2 . GLN A 93  ? 1.4829 1.5658 2.1346 0.0044  0.0996  0.2256  1093 GLN A NE2 
714  N N   . LEU A 94  ? 0.7477 0.8545 1.3027 0.0954  0.0042  0.1537  1094 LEU A N   
715  C CA  . LEU A 94  ? 0.6987 0.7974 1.2602 0.0858  -0.0105 0.1220  1094 LEU A CA  
716  C C   . LEU A 94  ? 0.7296 0.8238 1.2974 0.1074  -0.0069 0.1293  1094 LEU A C   
717  O O   . LEU A 94  ? 0.7156 0.7817 1.2912 0.0994  -0.0030 0.1131  1094 LEU A O   
718  C CB  . LEU A 94  ? 0.6642 0.8057 1.2237 0.0838  -0.0309 0.0974  1094 LEU A CB  
719  C CG  . LEU A 94  ? 0.7141 0.8559 1.2758 0.0668  -0.0346 0.0850  1094 LEU A CG  
720  C CD1 . LEU A 94  ? 0.7081 0.8900 1.2661 0.0769  -0.0441 0.0699  1094 LEU A CD1 
721  C CD2 . LEU A 94  ? 0.7438 0.8595 1.3106 0.0511  -0.0395 0.0696  1094 LEU A CD2 
722  N N   . LYS A 95  ? 0.6959 0.8273 1.2587 0.1393  -0.0073 0.1559  1095 LYS A N   
723  C CA  . LYS A 95  ? 0.7132 0.8596 1.2890 0.1706  -0.0048 0.1713  1095 LYS A CA  
724  C C   . LYS A 95  ? 0.8190 0.8861 1.4063 0.1741  0.0249  0.1856  1095 LYS A C   
725  O O   . LYS A 95  ? 0.8253 0.8858 1.4306 0.1867  0.0305  0.1776  1095 LYS A O   
726  C CB  . LYS A 95  ? 0.7662 0.9774 1.3269 0.2105  -0.0121 0.2060  1095 LYS A CB  
727  C CG  . LYS A 95  ? 0.8537 1.1575 1.4070 0.2120  -0.0453 0.1772  1095 LYS A CG  
728  C CD  . LYS A 95  ? 0.9669 1.3504 1.4942 0.2561  -0.0560 0.2094  1095 LYS A CD  
729  C CE  . LYS A 95  ? 1.0801 1.5604 1.5986 0.2525  -0.0916 0.1652  1095 LYS A CE  
730  N NZ  . LYS A 95  ? 1.2616 1.8409 1.7459 0.2995  -0.1084 0.1921  1095 LYS A NZ  
731  N N   . THR A 96  ? 0.8183 0.8254 1.4011 0.1602  0.0471  0.2017  1096 THR A N   
732  C CA  . THR A 96  ? 0.8779 0.7953 1.4764 0.1550  0.0791  0.2048  1096 THR A CA  
733  C C   . THR A 96  ? 0.9138 0.8012 1.5126 0.1216  0.0747  0.1522  1096 THR A C   
734  O O   . THR A 96  ? 0.9502 0.7836 1.5572 0.1274  0.0951  0.1384  1096 THR A O   
735  C CB  . THR A 96  ? 1.0138 0.8837 1.6185 0.1390  0.1045  0.2321  1096 THR A CB  
736  O OG1 . THR A 96  ? 1.0064 0.9240 1.5958 0.1712  0.1064  0.2834  1096 THR A OG1 
737  C CG2 . THR A 96  ? 1.0801 0.8461 1.7105 0.1368  0.1446  0.2390  1096 THR A CG2 
738  N N   . THR A 97  ? 0.8223 0.7473 1.4086 0.0927  0.0502  0.1250  1097 THR A N   
739  C CA  . THR A 97  ? 0.8114 0.7252 1.3869 0.0671  0.0429  0.0841  1097 THR A CA  
740  C C   . THR A 97  ? 0.8443 0.7830 1.4182 0.0859  0.0405  0.0757  1097 THR A C   
741  O O   . THR A 97  ? 0.8697 0.7798 1.4344 0.0829  0.0533  0.0527  1097 THR A O   
742  C CB  . THR A 97  ? 0.8686 0.8193 1.4352 0.0407  0.0201  0.0710  1097 THR A CB  
743  O OG1 . THR A 97  ? 0.9334 0.8835 1.5130 0.0287  0.0247  0.0867  1097 THR A OG1 
744  C CG2 . THR A 97  ? 0.8267 0.7686 1.3763 0.0168  0.0131  0.0365  1097 THR A CG2 
745  N N   . ARG A 98  ? 0.7542 0.7517 1.3394 0.1030  0.0257  0.0902  1098 ARG A N   
746  C CA  . ARG A 98  ? 0.7295 0.7664 1.3313 0.1150  0.0238  0.0835  1098 ARG A CA  
747  C C   . ARG A 98  ? 0.8367 0.8597 1.4575 0.1467  0.0465  0.0938  1098 ARG A C   
748  O O   . ARG A 98  ? 0.8456 0.8799 1.4780 0.1513  0.0581  0.0809  1098 ARG A O   
749  C CB  . ARG A 98  ? 0.6582 0.7652 1.2772 0.1195  0.0005  0.0878  1098 ARG A CB  
750  C CG  . ARG A 98  ? 0.5711 0.7378 1.2286 0.1329  -0.0027 0.0837  1098 ARG A CG  
751  C CD  . ARG A 98  ? 0.4911 0.7119 1.1628 0.1668  -0.0136 0.1052  1098 ARG A CD  
752  N NE  . ARG A 98  ? 0.4344 0.7312 1.1182 0.1609  -0.0424 0.0902  1098 ARG A NE  
753  C CZ  . ARG A 98  ? 0.6341 0.9986 1.3162 0.1891  -0.0609 0.1040  1098 ARG A CZ  
754  N NH1 . ARG A 98  ? 0.5033 0.9413 1.1939 0.1793  -0.0888 0.0761  1098 ARG A NH1 
755  N NH2 . ARG A 98  ? 0.4387 0.7967 1.1083 0.2291  -0.0500 0.1455  1098 ARG A NH2 
756  N N   . ASN A 99  ? 0.8259 0.8242 1.4520 0.1719  0.0576  0.1215  1099 ASN A N   
757  C CA  . ASN A 99  ? 0.8775 0.8519 1.5252 0.2110  0.0835  0.1381  1099 ASN A CA  
758  C C   . ASN A 99  ? 0.9990 0.8850 1.6347 0.1991  0.1137  0.1095  1099 ASN A C   
759  O O   . ASN A 99  ? 1.0436 0.9159 1.6950 0.2256  0.1374  0.1030  1099 ASN A O   
760  C CB  . ASN A 99  ? 0.9329 0.9021 1.5875 0.2468  0.0901  0.1863  1099 ASN A CB  
761  C CG  . ASN A 99  ? 1.2112 1.2808 1.8678 0.2659  0.0589  0.2105  1099 ASN A CG  
762  O OD1 . ASN A 99  ? 1.0720 1.2219 1.7430 0.2587  0.0334  0.1891  1099 ASN A OD1 
763  N ND2 . ASN A 99  ? 1.1730 1.2408 1.8140 0.2871  0.0621  0.2530  1099 ASN A ND2 
764  N N   . ALA A 100 ? 0.9685 0.8037 1.5791 0.1597  0.1125  0.0873  1100 ALA A N   
765  C CA  . ALA A 100 ? 1.0257 0.7882 1.6200 0.1394  0.1340  0.0453  1100 ALA A CA  
766  C C   . ALA A 100 ? 1.0566 0.8527 1.6249 0.1305  0.1299  0.0103  1100 ALA A C   
767  O O   . ALA A 100 ? 1.1063 0.8605 1.6573 0.1312  0.1528  -0.0253 1100 ALA A O   
768  C CB  . ALA A 100 ? 1.0472 0.7760 1.6314 0.0959  0.1258  0.0292  1100 ALA A CB  
769  N N   . TYR A 101 ? 0.9468 0.8165 1.5131 0.1247  0.1054  0.0220  1101 TYR A N   
770  C CA  . TYR A 101 ? 0.9350 0.8414 1.4825 0.1186  0.1065  0.0059  1101 TYR A CA  
771  C C   . TYR A 101 ? 0.9827 0.9174 1.5618 0.1521  0.1302  0.0144  1101 TYR A C   
772  O O   . TYR A 101 ? 1.0239 0.9495 1.5836 0.1580  0.1551  -0.0075 1101 TYR A O   
773  C CB  . TYR A 101 ? 0.8987 0.8590 1.4453 0.0990  0.0784  0.0194  1101 TYR A CB  
774  C CG  . TYR A 101 ? 0.9320 0.9283 1.4725 0.0963  0.0874  0.0183  1101 TYR A CG  
775  C CD1 . TYR A 101 ? 0.9374 0.9823 1.5252 0.1088  0.0957  0.0332  1101 TYR A CD1 
776  C CD2 . TYR A 101 ? 0.9709 0.9599 1.4613 0.0817  0.0893  0.0051  1101 TYR A CD2 
777  C CE1 . TYR A 101 ? 0.9497 1.0236 1.5416 0.1028  0.1136  0.0366  1101 TYR A CE1 
778  C CE2 . TYR A 101 ? 0.9899 1.0078 1.4711 0.0828  0.1061  0.0150  1101 TYR A CE2 
779  C CZ  . TYR A 101 ? 1.0432 1.0981 1.5787 0.0911  0.1217  0.0318  1101 TYR A CZ  
780  O OH  . TYR A 101 ? 1.0462 1.1272 1.5828 0.0877  0.1458  0.0463  1101 TYR A OH  
781  N N   . ILE A 102 ? 0.8891 0.8728 1.5166 0.1745  0.1214  0.0445  1102 ILE A N   
782  C CA  . ILE A 102 ? 0.8836 0.9227 1.5591 0.2065  0.1377  0.0553  1102 ILE A CA  
783  C C   . ILE A 102 ? 0.9846 0.9733 1.6663 0.2448  0.1758  0.0493  1102 ILE A C   
784  O O   . ILE A 102 ? 0.9914 1.0143 1.6985 0.2671  0.2013  0.0443  1102 ILE A O   
785  C CB  . ILE A 102 ? 0.8798 1.0019 1.6068 0.2215  0.1113  0.0828  1102 ILE A CB  
786  C CG1 . ILE A 102 ? 0.9095 1.0116 1.6360 0.2492  0.1021  0.1113  1102 ILE A CG1 
787  C CG2 . ILE A 102 ? 0.8295 0.9971 1.5579 0.1831  0.0822  0.0758  1102 ILE A CG2 
788  C CD1 . ILE A 102 ? 1.0104 1.1963 1.7892 0.2962  0.0939  0.1420  1102 ILE A CD1 
789  N N   . GLN A 103 ? 0.9778 0.8821 1.6414 0.2510  0.1849  0.0481  1103 GLN A N   
790  C CA  . GLN A 103 ? 1.0583 0.8899 1.7286 0.2850  0.2263  0.0363  1103 GLN A CA  
791  C C   . GLN A 103 ? 1.1609 0.9587 1.7880 0.2684  0.2508  -0.0170 1103 GLN A C   
792  O O   . GLN A 103 ? 1.2205 0.9983 1.8586 0.3028  0.2893  -0.0331 1103 GLN A O   
793  C CB  . GLN A 103 ? 1.1279 0.8641 1.7941 0.2843  0.2344  0.0457  1103 GLN A CB  
794  C CG  . GLN A 103 ? 1.2607 1.0154 1.9664 0.3256  0.2300  0.1072  1103 GLN A CG  
795  C CD  . GLN A 103 ? 1.6093 1.2533 2.3172 0.3302  0.2550  0.1242  1103 GLN A CD  
796  O OE1 . GLN A 103 ? 1.5703 1.1520 2.2540 0.2816  0.2535  0.0978  1103 GLN A OE1 
797  N NE2 . GLN A 103 ? 1.5862 1.2086 2.3303 0.3896  0.2798  0.1737  1103 GLN A NE2 
798  N N   . LYS A 104 ? 1.0982 0.8993 1.6738 0.2210  0.2289  -0.0427 1104 LYS A N   
799  C CA  . LYS A 104 ? 1.1517 0.9352 1.6689 0.2037  0.2441  -0.0921 1104 LYS A CA  
800  C C   . LYS A 104 ? 1.1931 1.0562 1.6974 0.2060  0.2509  -0.0852 1104 LYS A C   
801  O O   . LYS A 104 ? 1.2518 1.1127 1.7304 0.2234  0.2861  -0.1127 1104 LYS A O   
802  C CB  . LYS A 104 ? 1.1824 0.9391 1.6507 0.1562  0.2151  -0.1199 1104 LYS A CB  
803  C CG  . LYS A 104 ? 1.3899 1.0573 1.8694 0.1432  0.2204  -0.1422 1104 LYS A CG  
804  C CD  . LYS A 104 ? 1.4840 1.1514 1.9330 0.0926  0.1873  -0.1674 1104 LYS A CD  
805  C CE  . LYS A 104 ? 1.6044 1.1913 2.0847 0.0710  0.1944  -0.1817 1104 LYS A CE  
806  N NZ  . LYS A 104 ? 1.6425 1.2527 2.1104 0.0206  0.1597  -0.2014 1104 LYS A NZ  
807  N N   . TYR A 105 ? 1.0879 1.0161 1.6107 0.1882  0.2231  -0.0503 1105 TYR A N   
808  C CA  . TYR A 105 ? 1.0765 1.0691 1.5927 0.1815  0.2332  -0.0378 1105 TYR A CA  
809  C C   . TYR A 105 ? 1.0976 1.1636 1.6949 0.1997  0.2457  -0.0065 1105 TYR A C   
810  O O   . TYR A 105 ? 1.0695 1.1876 1.6811 0.1827  0.2501  0.0111  1105 TYR A O   
811  C CB  . TYR A 105 ? 1.0522 1.0581 1.5349 0.1454  0.2005  -0.0255 1105 TYR A CB  
812  C CG  . TYR A 105 ? 1.1334 1.0979 1.5400 0.1284  0.1880  -0.0583 1105 TYR A CG  
813  C CD1 . TYR A 105 ? 1.2286 1.2031 1.5654 0.1300  0.2065  -0.0795 1105 TYR A CD1 
814  C CD2 . TYR A 105 ? 1.1371 1.0614 1.5433 0.1116  0.1596  -0.0712 1105 TYR A CD2 
815  C CE1 . TYR A 105 ? 1.3080 1.2618 1.5756 0.1144  0.1894  -0.1189 1105 TYR A CE1 
816  C CE2 . TYR A 105 ? 1.1997 1.0996 1.5502 0.0911  0.1462  -0.1092 1105 TYR A CE2 
817  C CZ  . TYR A 105 ? 1.3746 1.2933 1.6556 0.0922  0.1574  -0.1363 1105 TYR A CZ  
818  O OH  . TYR A 105 ? 1.4439 1.3565 1.6708 0.0709  0.1375  -0.1812 1105 TYR A OH  
819  N N   . LEU A 106 ? 1.0599 1.1335 1.7138 0.2356  0.2556  0.0005  1106 LEU A N   
820  C CA  . LEU A 106 ? 1.2962 1.4593 2.0360 0.2567  0.2645  0.0246  1106 LEU A CA  
821  C C   . LEU A 106 ? 1.5983 1.7601 2.3707 0.3101  0.3030  0.0198  1106 LEU A C   
822  O O   . LEU A 106 ? 1.1251 1.3276 1.9151 0.3258  0.3428  0.0135  1106 LEU A O   
823  C CB  . LEU A 106 ? 1.2302 1.4411 2.0229 0.2510  0.2207  0.0492  1106 LEU A CB  
824  C CG  . LEU A 106 ? 1.2250 1.4958 2.0458 0.2087  0.1939  0.0570  1106 LEU A CG  
825  C CD1 . LEU A 106 ? 1.2247 1.5696 2.1017 0.1986  0.2229  0.0603  1106 LEU A CD1 
826  C CD2 . LEU A 106 ? 1.2354 1.4454 1.9884 0.1710  0.1733  0.0504  1106 LEU A CD2 
827  N N   . PRO A 115 ? 1.0689 1.2868 1.5912 -0.0330 -0.1890 0.0376  39   PRO A N   
828  C CA  . PRO A 115 ? 1.0598 1.2785 1.6110 -0.0446 -0.1909 0.0287  39   PRO A CA  
829  C C   . PRO A 115 ? 1.1041 1.2977 1.6439 -0.0538 -0.1848 0.0124  39   PRO A C   
830  O O   . PRO A 115 ? 1.1152 1.2932 1.6229 -0.0520 -0.1823 0.0052  39   PRO A O   
831  C CB  . PRO A 115 ? 1.0979 1.3457 1.6611 -0.0497 -0.2138 0.0237  39   PRO A CB  
832  C CG  . PRO A 115 ? 1.1693 1.4340 1.7063 -0.0386 -0.2236 0.0318  39   PRO A CG  
833  C CD  . PRO A 115 ? 1.1022 1.3503 1.6244 -0.0269 -0.2052 0.0463  39   PRO A CD  
834  N N   . SER A 116 ? 1.0370 1.2281 1.6054 -0.0629 -0.1816 0.0082  40   SER A N   
835  C CA  . SER A 116 ? 1.0304 1.1998 1.5953 -0.0715 -0.1753 -0.0046 40   SER A CA  
836  C C   . SER A 116 ? 1.0735 1.2408 1.6210 -0.0785 -0.1904 -0.0233 40   SER A C   
837  O O   . SER A 116 ? 1.0623 1.2079 1.5933 -0.0817 -0.1844 -0.0340 40   SER A O   
838  C CB  . SER A 116 ? 1.0818 1.2546 1.6865 -0.0791 -0.1698 -0.0018 40   SER A CB  
839  O OG  . SER A 116 ? 1.1945 1.3658 1.8093 -0.0713 -0.1532 0.0128  40   SER A OG  
840  N N   . ASP A 117 ? 1.0323 1.2238 1.5826 -0.0798 -0.2101 -0.0274 41   ASP A N   
841  C CA  . ASP A 117 ? 1.0430 1.2388 1.5758 -0.0853 -0.2277 -0.0472 41   ASP A CA  
842  C C   . ASP A 117 ? 1.0722 1.2565 1.5561 -0.0758 -0.2248 -0.0508 41   ASP A C   
843  O O   . ASP A 117 ? 1.1025 1.2914 1.5641 -0.0772 -0.2384 -0.0673 41   ASP A O   
844  C CB  . ASP A 117 ? 1.0772 1.3073 1.6266 -0.0875 -0.2501 -0.0486 41   ASP A CB  
845  N N   . LYS A 118 ? 0.9684 1.1377 1.4368 -0.0665 -0.2068 -0.0368 42   LYS A N   
846  C CA  . LYS A 118 ? 0.9507 1.1063 1.3787 -0.0583 -0.2003 -0.0384 42   LYS A CA  
847  C C   . LYS A 118 ? 0.9400 1.0677 1.3593 -0.0644 -0.1911 -0.0531 42   LYS A C   
848  O O   . LYS A 118 ? 0.9341 1.0476 1.3240 -0.0585 -0.1829 -0.0546 42   LYS A O   
849  C CB  . LYS A 118 ? 0.9622 1.1137 1.3844 -0.0470 -0.1853 -0.0179 42   LYS A CB  
850  C CG  . LYS A 118 ? 1.1918 1.3685 1.6156 -0.0376 -0.1926 -0.0018 42   LYS A CG  
851  C CD  . LYS A 118 ? 1.3412 1.5103 1.7575 -0.0261 -0.1772 0.0166  42   LYS A CD  
852  C CE  . LYS A 118 ? 1.4797 1.6475 1.9271 -0.0243 -0.1664 0.0301  42   LYS A CE  
853  N NZ  . LYS A 118 ? 1.5617 1.7069 2.0186 -0.0306 -0.1532 0.0230  42   LYS A NZ  
854  N N   . HIS A 119 ? 0.8523 0.9735 1.3004 -0.0760 -0.1919 -0.0622 43   HIS A N   
855  C CA  . HIS A 119 ? 0.8284 0.9248 1.2794 -0.0829 -0.1832 -0.0740 43   HIS A CA  
856  C C   . HIS A 119 ? 0.8815 0.9674 1.3025 -0.0829 -0.1888 -0.0934 43   HIS A C   
857  O O   . HIS A 119 ? 0.9013 1.0024 1.3098 -0.0833 -0.2055 -0.1056 43   HIS A O   
858  C CB  . HIS A 119 ? 0.8236 0.9218 1.3168 -0.0954 -0.1867 -0.0792 43   HIS A CB  
859  C CG  . HIS A 119 ? 0.8590 0.9324 1.3621 -0.1021 -0.1765 -0.0880 43   HIS A CG  
860  N ND1 . HIS A 119 ? 0.8990 0.9612 1.3958 -0.1084 -0.1841 -0.1098 43   HIS A ND1 
861  C CD2 . HIS A 119 ? 0.8584 0.9179 1.3773 -0.1024 -0.1592 -0.0771 43   HIS A CD2 
862  C CE1 . HIS A 119 ? 0.8842 0.9245 1.3956 -0.1122 -0.1704 -0.1099 43   HIS A CE1 
863  N NE2 . HIS A 119 ? 0.8642 0.9036 1.3885 -0.1085 -0.1554 -0.0897 43   HIS A NE2 
864  N N   . LEU A 120 ? 0.8073 0.8683 1.2179 -0.0819 -0.1743 -0.0962 44   LEU A N   
865  C CA  . LEU A 120 ? 0.8129 0.8571 1.1987 -0.0811 -0.1731 -0.1132 44   LEU A CA  
866  C C   . LEU A 120 ? 0.8242 0.8444 1.2306 -0.0877 -0.1607 -0.1172 44   LEU A C   
867  O O   . LEU A 120 ? 0.7803 0.7941 1.1997 -0.0861 -0.1468 -0.1013 44   LEU A O   
868  C CB  . LEU A 120 ? 0.8147 0.8552 1.1626 -0.0682 -0.1638 -0.1046 44   LEU A CB  
869  C CG  . LEU A 120 ? 0.8851 0.9471 1.2052 -0.0591 -0.1741 -0.1014 44   LEU A CG  
870  C CD1 . LEU A 120 ? 0.8691 0.9278 1.1679 -0.0472 -0.1603 -0.0838 44   LEU A CD1 
871  C CD2 . LEU A 120 ? 0.9473 1.0118 1.2408 -0.0584 -0.1858 -0.1237 44   LEU A CD2 
872  N N   . ASP A 121 ? 0.8031 0.8108 1.2131 -0.0944 -0.1655 -0.1383 45   ASP A N   
873  C CA  . ASP A 121 ? 0.7974 0.7809 1.2288 -0.0999 -0.1533 -0.1422 45   ASP A CA  
874  C C   . ASP A 121 ? 0.8075 0.7730 1.2138 -0.0903 -0.1365 -0.1360 45   ASP A C   
875  O O   . ASP A 121 ? 0.8099 0.7599 1.2327 -0.0911 -0.1222 -0.1281 45   ASP A O   
876  C CB  . ASP A 121 ? 0.8629 0.8370 1.3058 -0.1094 -0.1639 -0.1693 45   ASP A CB  
877  C CG  . ASP A 121 ? 1.0878 1.0753 1.5690 -0.1223 -0.1792 -0.1777 45   ASP A CG  
878  O OD1 . ASP A 121 ? 1.0791 1.0855 1.5792 -0.1236 -0.1816 -0.1609 45   ASP A OD1 
879  O OD2 . ASP A 121 ? 1.2273 1.2070 1.7211 -0.1310 -0.1888 -0.2018 45   ASP A OD2 
880  N N   . ALA A 122 ? 0.7144 0.6838 1.0817 -0.0807 -0.1380 -0.1385 46   ALA A N   
881  C CA  . ALA A 122 ? 0.6785 0.6343 1.0217 -0.0711 -0.1232 -0.1327 46   ALA A CA  
882  C C   . ALA A 122 ? 0.6398 0.5950 0.9926 -0.0674 -0.1095 -0.1096 46   ALA A C   
883  O O   . ALA A 122 ? 0.6250 0.5653 0.9767 -0.0640 -0.0961 -0.1053 46   ALA A O   
884  C CB  . ALA A 122 ? 0.7025 0.6685 1.0062 -0.0612 -0.1277 -0.1355 46   ALA A CB  
885  N N   . ILE A 123 ? 0.5539 0.5259 0.9164 -0.0675 -0.1129 -0.0957 47   ILE A N   
886  C CA  . ILE A 123 ? 0.5142 0.4879 0.8842 -0.0636 -0.1016 -0.0767 47   ILE A CA  
887  C C   . ILE A 123 ? 0.5530 0.5155 0.9489 -0.0680 -0.0912 -0.0721 47   ILE A C   
888  O O   . ILE A 123 ? 0.5458 0.4993 0.9350 -0.0628 -0.0795 -0.0653 47   ILE A O   
889  C CB  . ILE A 123 ? 0.5355 0.5285 0.9118 -0.0623 -0.1073 -0.0653 47   ILE A CB  
890  C CG1 . ILE A 123 ? 0.5435 0.5446 0.8928 -0.0536 -0.1094 -0.0610 47   ILE A CG1 
891  C CG2 . ILE A 123 ? 0.5304 0.5250 0.9244 -0.0613 -0.0970 -0.0506 47   ILE A CG2 
892  C CD1 . ILE A 123 ? 0.6726 0.6931 1.0222 -0.0532 -0.1223 -0.0594 47   ILE A CD1 
893  N N   . PRO A 124 ? 0.4999 0.4629 0.9255 -0.0766 -0.0944 -0.0749 48   PRO A N   
894  C CA  . PRO A 124 ? 0.4819 0.4353 0.9309 -0.0785 -0.0821 -0.0665 48   PRO A CA  
895  C C   . PRO A 124 ? 0.5338 0.4669 0.9767 -0.0761 -0.0725 -0.0716 48   PRO A C   
896  O O   . PRO A 124 ? 0.5189 0.4478 0.9656 -0.0714 -0.0599 -0.0589 48   PRO A O   
897  C CB  . PRO A 124 ? 0.5064 0.4636 0.9896 -0.0888 -0.0886 -0.0708 48   PRO A CB  
898  C CG  . PRO A 124 ? 0.5605 0.5365 1.0407 -0.0905 -0.1025 -0.0732 48   PRO A CG  
899  C CD  . PRO A 124 ? 0.5208 0.4962 0.9639 -0.0845 -0.1086 -0.0822 48   PRO A CD  
900  N N   . ILE A 125 ? 0.4916 0.4136 0.9234 -0.0781 -0.0786 -0.0902 49   ILE A N   
901  C CA  . ILE A 125 ? 0.4928 0.3942 0.9187 -0.0750 -0.0694 -0.0974 49   ILE A CA  
902  C C   . ILE A 125 ? 0.5545 0.4558 0.9554 -0.0641 -0.0593 -0.0862 49   ILE A C   
903  O O   . ILE A 125 ? 0.5531 0.4439 0.9604 -0.0602 -0.0469 -0.0788 49   ILE A O   
904  C CB  . ILE A 125 ? 0.5498 0.4424 0.9631 -0.0778 -0.0792 -0.1226 49   ILE A CB  
905  C CG1 . ILE A 125 ? 0.5632 0.4552 1.0071 -0.0904 -0.0905 -0.1369 49   ILE A CG1 
906  C CG2 . ILE A 125 ? 0.5623 0.4342 0.9628 -0.0719 -0.0689 -0.1313 49   ILE A CG2 
907  C CD1 . ILE A 125 ? 0.6179 0.4972 1.1073 -0.0977 -0.0811 -0.1304 49   ILE A CD1 
908  N N   . LEU A 126 ? 0.5083 0.4228 0.8846 -0.0593 -0.0647 -0.0836 50   LEU A N   
909  C CA  . LEU A 126 ? 0.4956 0.4124 0.8514 -0.0501 -0.0569 -0.0736 50   LEU A CA  
910  C C   . LEU A 126 ? 0.5158 0.4390 0.8845 -0.0480 -0.0488 -0.0559 50   LEU A C   
911  O O   . LEU A 126 ? 0.5000 0.4212 0.8616 -0.0417 -0.0400 -0.0483 50   LEU A O   
912  C CB  . LEU A 126 ? 0.5006 0.4305 0.8336 -0.0465 -0.0649 -0.0741 50   LEU A CB  
913  C CG  . LEU A 126 ? 0.5885 0.5141 0.8931 -0.0401 -0.0650 -0.0838 50   LEU A CG  
914  C CD1 . LEU A 126 ? 0.6197 0.5333 0.9224 -0.0438 -0.0695 -0.1044 50   LEU A CD1 
915  C CD2 . LEU A 126 ? 0.6322 0.5745 0.9182 -0.0362 -0.0730 -0.0803 50   LEU A CD2 
916  N N   . TYR A 127 ? 0.4724 0.4049 0.8605 -0.0529 -0.0518 -0.0499 51   TYR A N   
917  C CA  . TYR A 127 ? 0.4572 0.3984 0.8561 -0.0503 -0.0447 -0.0349 51   TYR A CA  
918  C C   . TYR A 127 ? 0.5468 0.4789 0.9604 -0.0491 -0.0339 -0.0286 51   TYR A C   
919  O O   . TYR A 127 ? 0.5263 0.4626 0.9371 -0.0430 -0.0262 -0.0180 51   TYR A O   
920  C CB  . TYR A 127 ? 0.4514 0.4059 0.8660 -0.0547 -0.0502 -0.0309 51   TYR A CB  
921  C CG  . TYR A 127 ? 0.4576 0.4246 0.8598 -0.0520 -0.0562 -0.0291 51   TYR A CG  
922  C CD1 . TYR A 127 ? 0.4914 0.4581 0.8752 -0.0508 -0.0635 -0.0364 51   TYR A CD1 
923  C CD2 . TYR A 127 ? 0.4507 0.4300 0.8605 -0.0499 -0.0539 -0.0199 51   TYR A CD2 
924  C CE1 . TYR A 127 ? 0.4927 0.4704 0.8688 -0.0475 -0.0674 -0.0320 51   TYR A CE1 
925  C CE2 . TYR A 127 ? 0.4543 0.4428 0.8569 -0.0472 -0.0583 -0.0184 51   TYR A CE2 
926  C CZ  . TYR A 127 ? 0.5816 0.5689 0.9690 -0.0462 -0.0648 -0.0233 51   TYR A CZ  
927  O OH  . TYR A 127 ? 0.6544 0.6504 1.0382 -0.0428 -0.0678 -0.0193 51   TYR A OH  
928  N N   . TYR A 128 ? 0.5438 0.4636 0.9738 -0.0544 -0.0336 -0.0355 52   TYR A N   
929  C CA  . TYR A 128 ? 0.5506 0.4598 0.9986 -0.0529 -0.0222 -0.0285 52   TYR A CA  
930  C C   . TYR A 128 ? 0.6044 0.5008 1.0380 -0.0464 -0.0154 -0.0316 52   TYR A C   
931  O O   . TYR A 128 ? 0.6087 0.5055 1.0481 -0.0403 -0.0051 -0.0185 52   TYR A O   
932  C CB  . TYR A 128 ? 0.5894 0.4878 1.0659 -0.0615 -0.0234 -0.0353 52   TYR A CB  
933  C CG  . TYR A 128 ? 0.6213 0.5316 1.1248 -0.0655 -0.0217 -0.0227 52   TYR A CG  
934  C CD1 . TYR A 128 ? 0.6475 0.5589 1.1717 -0.0618 -0.0085 -0.0046 52   TYR A CD1 
935  C CD2 . TYR A 128 ? 0.6310 0.5522 1.1417 -0.0723 -0.0325 -0.0280 52   TYR A CD2 
936  C CE1 . TYR A 128 ? 0.6443 0.5678 1.1936 -0.0642 -0.0050 0.0086  52   TYR A CE1 
937  C CE2 . TYR A 128 ? 0.6320 0.5646 1.1702 -0.0755 -0.0294 -0.0157 52   TYR A CE2 
938  C CZ  . TYR A 128 ? 0.7062 0.6399 1.2628 -0.0712 -0.0151 0.0027  52   TYR A CZ  
939  O OH  . TYR A 128 ? 0.7247 0.6715 1.3074 -0.0728 -0.0104 0.0165  52   TYR A OH  
940  N N   . ILE A 129 ? 0.5510 0.4381 0.9655 -0.0464 -0.0206 -0.0478 53   ILE A N   
941  C CA  . ILE A 129 ? 0.5504 0.4248 0.9530 -0.0395 -0.0124 -0.0511 53   ILE A CA  
942  C C   . ILE A 129 ? 0.5905 0.4765 0.9804 -0.0312 -0.0068 -0.0370 53   ILE A C   
943  O O   . ILE A 129 ? 0.5819 0.4611 0.9713 -0.0246 0.0027  -0.0327 53   ILE A O   
944  C CB  . ILE A 129 ? 0.5996 0.4625 0.9821 -0.0391 -0.0169 -0.0715 53   ILE A CB  
945  C CG1 . ILE A 129 ? 0.5984 0.4732 0.9508 -0.0339 -0.0214 -0.0717 53   ILE A CG1 
946  C CG2 . ILE A 129 ? 0.6092 0.4649 1.0007 -0.0482 -0.0269 -0.0897 53   ILE A CG2 
947  C CD1 . ILE A 129 ? 0.6769 0.5454 1.0138 -0.0245 -0.0113 -0.0703 53   ILE A CD1 
948  N N   . ILE A 130 ? 0.5489 0.4521 0.9310 -0.0314 -0.0127 -0.0306 54   ILE A N   
949  C CA  . ILE A 130 ? 0.5406 0.4554 0.9145 -0.0249 -0.0088 -0.0195 54   ILE A CA  
950  C C   . ILE A 130 ? 0.6052 0.5318 0.9943 -0.0234 -0.0049 -0.0051 54   ILE A C   
951  O O   . ILE A 130 ? 0.6068 0.5441 0.9930 -0.0180 -0.0017 0.0037  54   ILE A O   
952  C CB  . ILE A 130 ? 0.5649 0.4905 0.9222 -0.0245 -0.0158 -0.0213 54   ILE A CB  
953  C CG1 . ILE A 130 ? 0.5493 0.4877 0.9128 -0.0287 -0.0227 -0.0182 54   ILE A CG1 
954  C CG2 . ILE A 130 ? 0.5941 0.5123 0.9335 -0.0243 -0.0196 -0.0330 54   ILE A CG2 
955  C CD1 . ILE A 130 ? 0.6740 0.6262 1.0377 -0.0253 -0.0215 -0.0094 54   ILE A CD1 
956  N N   . PHE A 131 ? 0.5599 0.4866 0.9655 -0.0279 -0.0052 -0.0027 55   PHE A N   
957  C CA  . PHE A 131 ? 0.5499 0.4895 0.9683 -0.0250 -0.0001 0.0120  55   PHE A CA  
958  C C   . PHE A 131 ? 0.6556 0.5900 1.0836 -0.0188 0.0106  0.0222  55   PHE A C   
959  O O   . PHE A 131 ? 0.6643 0.6121 1.0881 -0.0120 0.0137  0.0325  55   PHE A O   
960  C CB  . PHE A 131 ? 0.5640 0.5058 1.0001 -0.0309 -0.0017 0.0137  55   PHE A CB  
961  C CG  . PHE A 131 ? 0.5678 0.5165 1.0237 -0.0276 0.0078  0.0304  55   PHE A CG  
962  C CD1 . PHE A 131 ? 0.5841 0.5536 1.0350 -0.0211 0.0103  0.0426  55   PHE A CD1 
963  C CD2 . PHE A 131 ? 0.5958 0.5310 1.0761 -0.0305 0.0145  0.0337  55   PHE A CD2 
964  C CE1 . PHE A 131 ? 0.5904 0.5694 1.0569 -0.0161 0.0199  0.0600  55   PHE A CE1 
965  C CE2 . PHE A 131 ? 0.6264 0.5692 1.1271 -0.0263 0.0250  0.0526  55   PHE A CE2 
966  C CZ  . PHE A 131 ? 0.5869 0.5528 1.0789 -0.0185 0.0279  0.0667  55   PHE A CZ  
967  N N   . VAL A 132 ? 0.6425 0.5578 1.0845 -0.0209 0.0158  0.0183  56   VAL A N   
968  C CA  . VAL A 132 ? 0.6622 0.5694 1.1189 -0.0147 0.0276  0.0289  56   VAL A CA  
969  C C   . VAL A 132 ? 0.7296 0.6389 1.1723 -0.0068 0.0309  0.0309  56   VAL A C   
970  O O   . VAL A 132 ? 0.7257 0.6440 1.1756 0.0011  0.0383  0.0465  56   VAL A O   
971  C CB  . VAL A 132 ? 0.7369 0.6194 1.2137 -0.0196 0.0321  0.0201  56   VAL A CB  
972  C CG1 . VAL A 132 ? 0.7363 0.6200 1.2396 -0.0254 0.0337  0.0272  56   VAL A CG1 
973  C CG2 . VAL A 132 ? 0.7474 0.6156 1.2090 -0.0256 0.0236  -0.0037 56   VAL A CG2 
974  N N   . ILE A 133 ? 0.6984 0.6020 1.1217 -0.0083 0.0254  0.0166  57   ILE A N   
975  C CA  . ILE A 133 ? 0.6994 0.6050 1.1109 -0.0014 0.0287  0.0177  57   ILE A CA  
976  C C   . ILE A 133 ? 0.7143 0.6444 1.1222 0.0027  0.0262  0.0301  57   ILE A C   
977  O O   . ILE A 133 ? 0.7067 0.6444 1.1206 0.0101  0.0323  0.0415  57   ILE A O   
978  C CB  . ILE A 133 ? 0.7527 0.6496 1.1437 -0.0039 0.0235  0.0010  57   ILE A CB  
979  C CG1 . ILE A 133 ? 0.7933 0.6662 1.1854 -0.0053 0.0271  -0.0138 57   ILE A CG1 
980  C CG2 . ILE A 133 ? 0.7536 0.6596 1.1317 0.0022  0.0250  0.0043  57   ILE A CG2 
981  C CD1 . ILE A 133 ? 0.9753 0.8332 1.3797 0.0022  0.0407  -0.0104 57   ILE A CD1 
982  N N   . GLY A 134 ? 0.6443 0.5867 1.0441 -0.0020 0.0170  0.0268  58   GLY A N   
983  C CA  . GLY A 134 ? 0.6251 0.5899 1.0212 0.0005  0.0126  0.0335  58   GLY A CA  
984  C C   . GLY A 134 ? 0.6766 0.6562 1.0836 0.0061  0.0170  0.0486  58   GLY A C   
985  O O   . GLY A 134 ? 0.6767 0.6738 1.0828 0.0117  0.0163  0.0559  58   GLY A O   
986  N N   . PHE A 135 ? 0.6295 0.6038 1.0480 0.0050  0.0213  0.0539  59   PHE A N   
987  C CA  . PHE A 135 ? 0.6336 0.6229 1.0628 0.0117  0.0272  0.0713  59   PHE A CA  
988  C C   . PHE A 135 ? 0.6921 0.6799 1.1306 0.0199  0.0359  0.0830  59   PHE A C   
989  O O   . PHE A 135 ? 0.6847 0.6943 1.1244 0.0280  0.0373  0.0970  59   PHE A O   
990  C CB  . PHE A 135 ? 0.6694 0.6512 1.1136 0.0081  0.0316  0.0758  59   PHE A CB  
991  C CG  . PHE A 135 ? 0.6946 0.6995 1.1394 0.0119  0.0321  0.0878  59   PHE A CG  
992  C CD1 . PHE A 135 ? 0.7304 0.7457 1.1641 0.0079  0.0240  0.0791  59   PHE A CD1 
993  C CD2 . PHE A 135 ? 0.7356 0.7528 1.1924 0.0209  0.0418  0.1087  59   PHE A CD2 
994  C CE1 . PHE A 135 ? 0.7442 0.7815 1.1764 0.0129  0.0257  0.0892  59   PHE A CE1 
995  C CE2 . PHE A 135 ? 0.7699 0.8111 1.2240 0.0263  0.0432  0.1204  59   PHE A CE2 
996  C CZ  . PHE A 135 ? 0.7354 0.7864 1.1764 0.0222  0.0352  0.1095  59   PHE A CZ  
997  N N   . LEU A 136 ? 0.6616 0.6251 1.1063 0.0185  0.0415  0.0766  60   LEU A N   
998  C CA  . LEU A 136 ? 0.6650 0.6230 1.1209 0.0267  0.0515  0.0864  60   LEU A CA  
999  C C   . LEU A 136 ? 0.6894 0.6639 1.1352 0.0318  0.0479  0.0879  60   LEU A C   
1000 O O   . LEU A 136 ? 0.6922 0.6835 1.1459 0.0407  0.0517  0.1037  60   LEU A O   
1001 C CB  . LEU A 136 ? 0.6844 0.6110 1.1469 0.0237  0.0579  0.0743  60   LEU A CB  
1002 C CG  . LEU A 136 ? 0.7694 0.6772 1.2555 0.0217  0.0664  0.0777  60   LEU A CG  
1003 C CD1 . LEU A 136 ? 0.7892 0.6664 1.2785 0.0180  0.0701  0.0594  60   LEU A CD1 
1004 C CD2 . LEU A 136 ? 0.8269 0.7427 1.3352 0.0318  0.0783  0.1024  60   LEU A CD2 
1005 N N   . VAL A 137 ? 0.6128 0.5849 1.0428 0.0263  0.0401  0.0728  61   VAL A N   
1006 C CA  . VAL A 137 ? 0.5956 0.5825 1.0212 0.0300  0.0372  0.0742  61   VAL A CA  
1007 C C   . VAL A 137 ? 0.6165 0.6341 1.0420 0.0328  0.0300  0.0831  61   VAL A C   
1008 O O   . VAL A 137 ? 0.6083 0.6428 1.0406 0.0396  0.0308  0.0929  61   VAL A O   
1009 C CB  . VAL A 137 ? 0.6437 0.6230 1.0564 0.0251  0.0328  0.0599  61   VAL A CB  
1010 C CG1 . VAL A 137 ? 0.6522 0.6072 1.0636 0.0269  0.0418  0.0534  61   VAL A CG1 
1011 C CG2 . VAL A 137 ? 0.6347 0.6139 1.0355 0.0164  0.0230  0.0483  61   VAL A CG2 
1012 N N   . ASN A 138 ? 0.5486 0.5749 0.9674 0.0285  0.0232  0.0798  62   ASN A N   
1013 C CA  . ASN A 138 ? 0.5221 0.5782 0.9376 0.0319  0.0160  0.0852  62   ASN A CA  
1014 C C   . ASN A 138 ? 0.5307 0.6034 0.9551 0.0421  0.0222  0.1050  62   ASN A C   
1015 O O   . ASN A 138 ? 0.5079 0.6084 0.9311 0.0482  0.0171  0.1118  62   ASN A O   
1016 C CB  . ASN A 138 ? 0.5291 0.5889 0.9343 0.0258  0.0087  0.0751  62   ASN A CB  
1017 C CG  . ASN A 138 ? 0.7753 0.8291 1.1734 0.0183  0.0009  0.0588  62   ASN A CG  
1018 O OD1 . ASN A 138 ? 0.6323 0.6990 1.0313 0.0186  -0.0046 0.0555  62   ASN A OD1 
1019 N ND2 . ASN A 138 ? 0.7062 0.7419 1.0998 0.0114  0.0002  0.0493  62   ASN A ND2 
1020 N N   . ILE A 139 ? 0.4962 0.5529 0.9315 0.0442  0.0330  0.1149  63   ILE A N   
1021 C CA  . ILE A 139 ? 0.5122 0.5847 0.9587 0.0552  0.0408  0.1374  63   ILE A CA  
1022 C C   . ILE A 139 ? 0.5642 0.6438 1.0205 0.0635  0.0445  0.1478  63   ILE A C   
1023 O O   . ILE A 139 ? 0.5631 0.6697 1.0237 0.0739  0.0452  0.1655  63   ILE A O   
1024 C CB  . ILE A 139 ? 0.5669 0.6222 1.0292 0.0560  0.0530  0.1488  63   ILE A CB  
1025 C CG1 . ILE A 139 ? 0.5958 0.6154 1.0726 0.0520  0.0619  0.1425  63   ILE A CG1 
1026 C CG2 . ILE A 139 ? 0.5596 0.6164 1.0162 0.0501  0.0501  0.1441  63   ILE A CG2 
1027 C CD1 . ILE A 139 ? 0.7797 0.7945 1.2777 0.0628  0.0752  0.1609  63   ILE A CD1 
1028 N N   . VAL A 140 ? 0.5101 0.5677 0.9695 0.0598  0.0472  0.1374  64   VAL A N   
1029 C CA  . VAL A 140 ? 0.5108 0.5725 0.9813 0.0675  0.0522  0.1460  64   VAL A CA  
1030 C C   . VAL A 140 ? 0.5404 0.6376 1.0059 0.0705  0.0405  0.1483  64   VAL A C   
1031 O O   . VAL A 140 ? 0.5503 0.6680 1.0272 0.0806  0.0427  0.1650  64   VAL A O   
1032 C CB  . VAL A 140 ? 0.5606 0.5924 1.0316 0.0631  0.0576  0.1319  64   VAL A CB  
1033 C CG1 . VAL A 140 ? 0.5528 0.5958 1.0302 0.0687  0.0585  0.1358  64   VAL A CG1 
1034 C CG2 . VAL A 140 ? 0.5730 0.5739 1.0565 0.0645  0.0714  0.1339  64   VAL A CG2 
1035 N N   . VAL A 141 ? 0.4683 0.5739 0.9194 0.0621  0.0278  0.1321  65   VAL A N   
1036 C CA  . VAL A 141 ? 0.4578 0.5957 0.9061 0.0627  0.0148  0.1291  65   VAL A CA  
1037 C C   . VAL A 141 ? 0.5396 0.7105 0.9853 0.0718  0.0107  0.1432  65   VAL A C   
1038 O O   . VAL A 141 ? 0.5354 0.7363 0.9873 0.0788  0.0050  0.1519  65   VAL A O   
1039 C CB  . VAL A 141 ? 0.4866 0.6206 0.9222 0.0512  0.0038  0.1073  65   VAL A CB  
1040 C CG1 . VAL A 141 ? 0.4831 0.6497 0.9172 0.0507  -0.0106 0.1010  65   VAL A CG1 
1041 C CG2 . VAL A 141 ? 0.4772 0.5846 0.9144 0.0441  0.0073  0.0960  65   VAL A CG2 
1042 N N   . VAL A 142 ? 0.5297 0.6973 0.9664 0.0719  0.0134  0.1454  66   VAL A N   
1043 C CA  . VAL A 142 ? 0.5465 0.7448 0.9766 0.0813  0.0114  0.1592  66   VAL A CA  
1044 C C   . VAL A 142 ? 0.6473 0.8581 1.0932 0.0948  0.0210  0.1859  66   VAL A C   
1045 O O   . VAL A 142 ? 0.6389 0.8866 1.0829 0.1045  0.0145  0.1971  66   VAL A O   
1046 C CB  . VAL A 142 ? 0.5876 0.7730 1.0088 0.0778  0.0160  0.1568  66   VAL A CB  
1047 C CG1 . VAL A 142 ? 0.6012 0.8005 1.0264 0.0895  0.0261  0.1817  66   VAL A CG1 
1048 C CG2 . VAL A 142 ? 0.5701 0.7658 0.9729 0.0708  0.0033  0.1362  66   VAL A CG2 
1049 N N   . THR A 143 ? 0.6512 0.8313 1.1133 0.0955  0.0357  0.1946  67   THR A N   
1050 C CA  . THR A 143 ? 0.6793 0.8647 1.1612 0.1083  0.0476  0.2203  67   THR A CA  
1051 C C   . THR A 143 ? 0.7477 0.9494 1.2391 0.1130  0.0432  0.2232  67   THR A C   
1052 O O   . THR A 143 ? 0.7467 0.9747 1.2489 0.1261  0.0456  0.2457  67   THR A O   
1053 C CB  . THR A 143 ? 0.7985 0.9438 1.2978 0.1068  0.0646  0.2250  67   THR A CB  
1054 O OG1 . THR A 143 ? 0.8368 0.9502 1.3327 0.0949  0.0635  0.2014  67   THR A OG1 
1055 C CG2 . THR A 143 ? 0.7638 0.9014 1.2647 0.1067  0.0721  0.2335  67   THR A CG2 
1056 N N   . LEU A 144 ? 0.7200 0.9085 1.2093 0.1033  0.0372  0.2030  68   LEU A N   
1057 C CA  . LEU A 144 ? 0.7329 0.9379 1.2356 0.1078  0.0343  0.2075  68   LEU A CA  
1058 C C   . LEU A 144 ? 0.8469 1.0991 1.3436 0.1113  0.0172  0.2089  68   LEU A C   
1059 O O   . LEU A 144 ? 0.8494 1.1287 1.3604 0.1215  0.0161  0.2254  68   LEU A O   
1060 C CB  . LEU A 144 ? 0.7186 0.8985 1.2254 0.0992  0.0361  0.1907  68   LEU A CB  
1061 C CG  . LEU A 144 ? 0.7636 0.9422 1.2577 0.0864  0.0236  0.1671  68   LEU A CG  
1062 C CD1 . LEU A 144 ? 0.7581 0.9669 1.2633 0.0866  0.0124  0.1658  68   LEU A CD1 
1063 C CD2 . LEU A 144 ? 0.7942 0.9338 1.2856 0.0788  0.0322  0.1535  68   LEU A CD2 
1064 N N   . PHE A 145 ? 0.8528 1.1169 1.3294 0.1045  0.0044  0.1933  69   PHE A N   
1065 C CA  . PHE A 145 ? 0.8813 1.1910 1.3501 0.1085  -0.0124 0.1920  69   PHE A CA  
1066 C C   . PHE A 145 ? 1.0001 1.3400 1.4700 0.1252  -0.0082 0.2199  69   PHE A C   
1067 O O   . PHE A 145 ? 0.9817 1.3614 1.4567 0.1336  -0.0182 0.2290  69   PHE A O   
1068 C CB  . PHE A 145 ? 0.9064 1.2183 1.3526 0.0994  -0.0237 0.1694  69   PHE A CB  
1069 C CG  . PHE A 145 ? 0.9257 1.2272 1.3737 0.0853  -0.0341 0.1433  69   PHE A CG  
1070 C CD1 . PHE A 145 ? 0.9651 1.2467 1.4312 0.0801  -0.0293 0.1410  69   PHE A CD1 
1071 C CD2 . PHE A 145 ? 0.9614 1.2730 1.3945 0.0782  -0.0472 0.1219  69   PHE A CD2 
1072 C CE1 . PHE A 145 ? 0.9686 1.2423 1.4395 0.0681  -0.0372 0.1205  69   PHE A CE1 
1073 C CE2 . PHE A 145 ? 0.9928 1.2938 1.4323 0.0655  -0.0554 0.0998  69   PHE A CE2 
1074 C CZ  . PHE A 145 ? 0.9617 1.2446 1.4209 0.0606  -0.0503 0.1005  69   PHE A CZ  
1075 N N   . CYS A 146 ? 1.0255 1.3465 1.4936 0.1303  0.0071  0.2350  70   CYS A N   
1076 C CA  . CYS A 146 ? 1.0615 1.4062 1.5339 0.1472  0.0154  0.2661  70   CYS A CA  
1077 C C   . CYS A 146 ? 1.1759 1.5297 1.6738 0.1579  0.0219  0.2877  70   CYS A C   
1078 O O   . CYS A 146 ? 1.1850 1.5801 1.6854 0.1718  0.0175  0.3081  70   CYS A O   
1079 C CB  . CYS A 146 ? 1.0705 1.3859 1.5446 0.1481  0.0327  0.2771  70   CYS A CB  
1080 S SG  . CYS A 146 ? 1.1328 1.4778 1.5832 0.1560  0.0311  0.2868  70   CYS A SG  
1081 N N   . CYS A 147 ? 1.1745 1.4907 1.6913 0.1524  0.0329  0.2836  71   CYS A N   
1082 C CA  . CYS A 147 ? 1.2007 1.5195 1.7445 0.1624  0.0419  0.3026  71   CYS A CA  
1083 C C   . CYS A 147 ? 1.2803 1.6386 1.8282 0.1639  0.0251  0.2992  71   CYS A C   
1084 O O   . CYS A 147 ? 1.2896 1.6768 1.8550 0.1775  0.0262  0.3225  71   CYS A O   
1085 C CB  . CYS A 147 ? 1.2051 1.4740 1.7634 0.1556  0.0569  0.2935  71   CYS A CB  
1086 S SG  . CYS A 147 ? 1.2669 1.4896 1.8308 0.1550  0.0778  0.2995  71   CYS A SG  
1087 N N   . GLN A 148 ? 1.2418 1.6016 1.7772 0.1498  0.0095  0.2708  72   GLN A N   
1088 C CA  . GLN A 148 ? 1.2409 1.6366 1.7840 0.1483  -0.0079 0.2635  72   GLN A CA  
1089 C C   . GLN A 148 ? 1.3096 1.7597 1.8437 0.1597  -0.0221 0.2761  72   GLN A C   
1090 O O   . GLN A 148 ? 1.3051 1.7910 1.8566 0.1684  -0.0290 0.2898  72   GLN A O   
1091 C CB  . GLN A 148 ? 1.2461 1.6296 1.7797 0.1304  -0.0203 0.2307  72   GLN A CB  
1092 C CG  . GLN A 148 ? 1.4244 1.8402 1.9743 0.1263  -0.0373 0.2213  72   GLN A CG  
1093 C CD  . GLN A 148 ? 1.6129 2.0451 2.1930 0.1365  -0.0317 0.2429  72   GLN A CD  
1094 O OE1 . GLN A 148 ? 1.5529 1.9543 2.1488 0.1376  -0.0147 0.2499  72   GLN A OE1 
1095 N NE2 . GLN A 148 ? 1.4653 1.9481 2.0539 0.1451  -0.0461 0.2536  72   GLN A NE2 
1096 N N   . LYS A 149 ? 1.2811 1.7393 1.7886 0.1609  -0.0257 0.2730  73   LYS A N   
1097 C CA  . LYS A 149 ? 1.6496 2.1611 2.1432 0.1740  -0.0379 0.2857  73   LYS A CA  
1098 C C   . LYS A 149 ? 2.0696 2.5783 2.5455 0.1840  -0.0255 0.3037  73   LYS A C   
1099 O O   . LYS A 149 ? 1.5919 2.0968 2.0426 0.1786  -0.0293 0.2883  73   LYS A O   
1100 C CB  . LYS A 149 ? 1.6761 2.2206 2.1528 0.1658  -0.0636 0.2571  73   LYS A CB  
1101 C CG  . LYS A 149 ? 1.7794 2.3613 2.2771 0.1662  -0.0805 0.2547  73   LYS A CG  
1102 C CD  . LYS A 149 ? 1.8628 2.5003 2.3627 0.1858  -0.0872 0.2824  73   LYS A CD  
1103 C CE  . LYS A 149 ? 1.9040 2.5500 2.4402 0.1931  -0.0815 0.3049  73   LYS A CE  
1104 N NZ  . LYS A 149 ? 1.9513 2.6186 2.5081 0.1829  -0.1005 0.2857  73   LYS A NZ  
1105 N N   . LYS A 153 ? 1.1054 1.6483 1.6140 0.0688  -0.1629 0.0555  77   LYS A N   
1106 C CA  . LYS A 153 ? 1.0878 1.6160 1.6187 0.0516  -0.1713 0.0286  77   LYS A CA  
1107 C C   . LYS A 153 ? 1.1182 1.6182 1.6270 0.0439  -0.1696 0.0057  77   LYS A C   
1108 O O   . LYS A 153 ? 1.1169 1.5946 1.5986 0.0495  -0.1559 0.0145  77   LYS A O   
1109 C CB  . LYS A 153 ? 1.0975 1.5956 1.6603 0.0448  -0.1574 0.0401  77   LYS A CB  
1110 N N   . VAL A 154 ? 1.0551 1.5563 1.5798 0.0308  -0.1833 -0.0234 78   VAL A N   
1111 C CA  . VAL A 154 ? 1.0420 1.5179 1.5533 0.0225  -0.1832 -0.0479 78   VAL A CA  
1112 C C   . VAL A 154 ? 1.0265 1.4514 1.5378 0.0176  -0.1622 -0.0381 78   VAL A C   
1113 O O   . VAL A 154 ? 1.0181 1.4220 1.5033 0.0193  -0.1540 -0.0412 78   VAL A O   
1114 C CB  . VAL A 154 ? 1.1063 1.5930 1.6438 0.0091  -0.2016 -0.0803 78   VAL A CB  
1115 C CG1 . VAL A 154 ? 1.1300 1.6616 1.6499 0.0145  -0.2230 -0.1007 78   VAL A CG1 
1116 C CG2 . VAL A 154 ? 1.0964 1.5877 1.6813 0.0001  -0.2051 -0.0759 78   VAL A CG2 
1117 N N   . SER A 155 ? 0.9336 1.3411 1.4733 0.0124  -0.1533 -0.0254 79   SER A N   
1118 C CA  . SER A 155 ? 0.8956 1.2586 1.4353 0.0088  -0.1341 -0.0154 79   SER A CA  
1119 C C   . SER A 155 ? 0.8901 1.2393 1.3997 0.0197  -0.1196 0.0041  79   SER A C   
1120 O O   . SER A 155 ? 0.8802 1.1979 1.3744 0.0175  -0.1091 0.0028  79   SER A O   
1121 C CB  . SER A 155 ? 0.9296 1.2848 1.5029 0.0049  -0.1269 -0.0027 79   SER A CB  
1122 O OG  . SER A 155 ? 1.0501 1.4290 1.6585 -0.0031 -0.1413 -0.0149 79   SER A OG  
1123 N N   . SER A 156 ? 0.8095 1.1833 1.3137 0.0315  -0.1194 0.0228  80   SER A N   
1124 C CA  . SER A 156 ? 0.7881 1.1516 1.2700 0.0426  -0.1053 0.0437  80   SER A CA  
1125 C C   . SER A 156 ? 0.7892 1.1536 1.2402 0.0460  -0.1066 0.0359  80   SER A C   
1126 O O   . SER A 156 ? 0.7846 1.1278 1.2198 0.0505  -0.0928 0.0482  80   SER A O   
1127 C CB  . SER A 156 ? 0.8467 1.2406 1.3346 0.0552  -0.1056 0.0662  80   SER A CB  
1128 O OG  . SER A 156 ? 0.9941 1.3846 1.5112 0.0537  -0.1009 0.0765  80   SER A OG  
1129 N N   . ILE A 157 ? 0.7077 1.0966 1.1516 0.0437  -0.1227 0.0145  81   ILE A N   
1130 C CA  . ILE A 157 ? 0.6945 1.0871 1.1087 0.0479  -0.1237 0.0052  81   ILE A CA  
1131 C C   . ILE A 157 ? 0.6961 1.0483 1.1080 0.0377  -0.1157 -0.0079 81   ILE A C   
1132 O O   . ILE A 157 ? 0.6878 1.0284 1.0784 0.0418  -0.1072 -0.0045 81   ILE A O   
1133 C CB  . ILE A 157 ? 0.7468 1.1815 1.1515 0.0508  -0.1436 -0.0148 81   ILE A CB  
1134 C CG1 . ILE A 157 ? 0.7561 1.2361 1.1597 0.0633  -0.1519 0.0016  81   ILE A CG1 
1135 C CG2 . ILE A 157 ? 0.7581 1.1946 1.1321 0.0547  -0.1438 -0.0288 81   ILE A CG2 
1136 C CD1 . ILE A 157 ? 0.8035 1.2849 1.1962 0.0779  -0.1360 0.0375  81   ILE A CD1 
1137 N N   . TYR A 158 ? 0.6183 0.9494 1.0541 0.0254  -0.1168 -0.0192 82   TYR A N   
1138 C CA  . TYR A 158 ? 0.5927 0.8868 1.0278 0.0169  -0.1087 -0.0282 82   TYR A CA  
1139 C C   . TYR A 158 ? 0.5907 0.8546 1.0212 0.0189  -0.0913 -0.0074 82   TYR A C   
1140 O O   . TYR A 158 ? 0.5643 0.8046 0.9830 0.0168  -0.0838 -0.0097 82   TYR A O   
1141 C CB  . TYR A 158 ? 0.6103 0.8929 1.0731 0.0044  -0.1143 -0.0448 82   TYR A CB  
1142 C CG  . TYR A 158 ? 0.6623 0.9695 1.1349 0.0000  -0.1318 -0.0700 82   TYR A CG  
1143 C CD1 . TYR A 158 ? 0.7012 1.0123 1.1558 0.0009  -0.1372 -0.0896 82   TYR A CD1 
1144 C CD2 . TYR A 158 ? 0.6842 1.0091 1.1873 -0.0057 -0.1425 -0.0759 82   TYR A CD2 
1145 C CE1 . TYR A 158 ? 0.7287 1.0611 1.1924 -0.0033 -0.1537 -0.1165 82   TYR A CE1 
1146 C CE2 . TYR A 158 ? 0.7142 1.0613 1.2297 -0.0111 -0.1600 -0.1022 82   TYR A CE2 
1147 C CZ  . TYR A 158 ? 0.8075 1.1576 1.3022 -0.0098 -0.1657 -0.1237 82   TYR A CZ  
1148 O OH  . TYR A 158 ? 0.8289 1.2001 1.3356 -0.0149 -0.1832 -0.1528 82   TYR A OH  
1149 N N   . ILE A 159 ? 0.5371 0.8031 0.9774 0.0235  -0.0851 0.0119  83   ILE A N   
1150 C CA  . ILE A 159 ? 0.5190 0.7576 0.9559 0.0263  -0.0689 0.0297  83   ILE A CA  
1151 C C   . ILE A 159 ? 0.5322 0.7691 0.9471 0.0336  -0.0623 0.0386  83   ILE A C   
1152 O O   . ILE A 159 ? 0.5219 0.7311 0.9300 0.0308  -0.0530 0.0397  83   ILE A O   
1153 C CB  . ILE A 159 ? 0.5548 0.7967 1.0073 0.0316  -0.0624 0.0481  83   ILE A CB  
1154 C CG1 . ILE A 159 ? 0.5600 0.8162 1.0384 0.0267  -0.0704 0.0429  83   ILE A CG1 
1155 C CG2 . ILE A 159 ? 0.5476 0.7546 0.9982 0.0319  -0.0460 0.0591  83   ILE A CG2 
1156 C CD1 . ILE A 159 ? 0.6616 0.8934 1.1553 0.0173  -0.0659 0.0361  83   ILE A CD1 
1157 N N   . PHE A 160 ? 0.4665 0.7352 0.8716 0.0432  -0.0675 0.0451  84   PHE A N   
1158 C CA  . PHE A 160 ? 0.4615 0.7339 0.8481 0.0517  -0.0604 0.0564  84   PHE A CA  
1159 C C   . PHE A 160 ? 0.5321 0.7893 0.9054 0.0462  -0.0598 0.0415  84   PHE A C   
1160 O O   . PHE A 160 ? 0.5368 0.7719 0.9057 0.0461  -0.0486 0.0494  84   PHE A O   
1161 C CB  . PHE A 160 ? 0.4880 0.8030 0.8646 0.0636  -0.0679 0.0638  84   PHE A CB  
1162 C CG  . PHE A 160 ? 0.5063 0.8289 0.8646 0.0739  -0.0593 0.0781  84   PHE A CG  
1163 C CD1 . PHE A 160 ? 0.5468 0.8586 0.9107 0.0809  -0.0444 0.1037  84   PHE A CD1 
1164 C CD2 . PHE A 160 ? 0.5354 0.8754 0.8732 0.0769  -0.0648 0.0661  84   PHE A CD2 
1165 C CE1 . PHE A 160 ? 0.5677 0.8864 0.9196 0.0901  -0.0349 0.1191  84   PHE A CE1 
1166 C CE2 . PHE A 160 ? 0.5833 0.9319 0.9058 0.0873  -0.0549 0.0816  84   PHE A CE2 
1167 C CZ  . PHE A 160 ? 0.5601 0.8985 0.8911 0.0936  -0.0399 0.1093  84   PHE A CZ  
1168 N N   . ASN A 161 ? 0.4759 0.7451 0.8456 0.0418  -0.0719 0.0195  85   ASN A N   
1169 C CA  . ASN A 161 ? 0.4623 0.7192 0.8213 0.0377  -0.0715 0.0044  85   ASN A CA  
1170 C C   . ASN A 161 ? 0.4845 0.7031 0.8523 0.0282  -0.0634 0.0030  85   ASN A C   
1171 O O   . ASN A 161 ? 0.4814 0.6863 0.8406 0.0283  -0.0562 0.0048  85   ASN A O   
1172 C CB  . ASN A 161 ? 0.4387 0.7126 0.7974 0.0341  -0.0856 -0.0206 85   ASN A CB  
1173 C CG  . ASN A 161 ? 0.5837 0.8953 0.9232 0.0451  -0.0928 -0.0231 85   ASN A CG  
1174 O OD1 . ASN A 161 ? 0.4946 0.8354 0.8361 0.0498  -0.1021 -0.0210 85   ASN A OD1 
1175 N ND2 . ASN A 161 ? 0.3858 0.6998 0.7059 0.0505  -0.0880 -0.0258 85   ASN A ND2 
1176 N N   . LEU A 162 ? 0.4110 0.6147 0.7961 0.0210  -0.0640 0.0012  86   LEU A N   
1177 C CA  . LEU A 162 ? 0.3885 0.5591 0.7799 0.0135  -0.0568 0.0007  86   LEU A CA  
1178 C C   . LEU A 162 ? 0.4442 0.5983 0.8300 0.0169  -0.0448 0.0176  86   LEU A C   
1179 O O   . LEU A 162 ? 0.4381 0.5714 0.8202 0.0131  -0.0398 0.0159  86   LEU A O   
1180 C CB  . LEU A 162 ? 0.3738 0.5367 0.7844 0.0073  -0.0588 -0.0020 86   LEU A CB  
1181 C CG  . LEU A 162 ? 0.4091 0.5415 0.8250 0.0019  -0.0504 0.0013  86   LEU A CG  
1182 C CD1 . LEU A 162 ? 0.4112 0.5276 0.8230 -0.0035 -0.0505 -0.0092 86   LEU A CD1 
1183 C CD2 . LEU A 162 ? 0.4077 0.5390 0.8426 -0.0017 -0.0510 0.0016  86   LEU A CD2 
1184 N N   . ALA A 163 ? 0.3996 0.5635 0.7871 0.0241  -0.0406 0.0334  87   ALA A N   
1185 C CA  . ALA A 163 ? 0.4065 0.5541 0.7934 0.0275  -0.0287 0.0489  87   ALA A CA  
1186 C C   . ALA A 163 ? 0.4886 0.6387 0.8652 0.0305  -0.0249 0.0525  87   ALA A C   
1187 O O   . ALA A 163 ? 0.4986 0.6268 0.8765 0.0274  -0.0175 0.0556  87   ALA A O   
1188 C CB  . ALA A 163 ? 0.4183 0.5780 0.8127 0.0358  -0.0245 0.0659  87   ALA A CB  
1189 N N   . VAL A 164 ? 0.4528 0.6306 0.8194 0.0367  -0.0302 0.0514  88   VAL A N   
1190 C CA  . VAL A 164 ? 0.4583 0.6429 0.8145 0.0414  -0.0254 0.0563  88   VAL A CA  
1191 C C   . VAL A 164 ? 0.5146 0.6796 0.8694 0.0329  -0.0258 0.0420  88   VAL A C   
1192 O O   . VAL A 164 ? 0.4997 0.6521 0.8562 0.0322  -0.0178 0.0490  88   VAL A O   
1193 C CB  . VAL A 164 ? 0.5202 0.7420 0.8623 0.0513  -0.0315 0.0559  88   VAL A CB  
1194 C CG1 . VAL A 164 ? 0.5190 0.7483 0.8483 0.0554  -0.0275 0.0548  88   VAL A CG1 
1195 C CG2 . VAL A 164 ? 0.5327 0.7759 0.8764 0.0624  -0.0281 0.0773  88   VAL A CG2 
1196 N N   . ALA A 165 ? 0.4866 0.6490 0.8419 0.0264  -0.0348 0.0231  89   ALA A N   
1197 C CA  . ALA A 165 ? 0.4841 0.6294 0.8402 0.0192  -0.0355 0.0104  89   ALA A CA  
1198 C C   . ALA A 165 ? 0.5437 0.6607 0.9078 0.0129  -0.0295 0.0158  89   ALA A C   
1199 O O   . ALA A 165 ? 0.5484 0.6546 0.9125 0.0104  -0.0259 0.0156  89   ALA A O   
1200 C CB  . ALA A 165 ? 0.4914 0.6381 0.8521 0.0139  -0.0451 -0.0081 89   ALA A CB  
1201 N N   . ASP A 166 ? 0.5003 0.6072 0.8712 0.0110  -0.0284 0.0204  90   ASP A N   
1202 C CA  . ASP A 166 ? 0.5013 0.5828 0.8770 0.0061  -0.0232 0.0234  90   ASP A CA  
1203 C C   . ASP A 166 ? 0.5541 0.6288 0.9313 0.0083  -0.0151 0.0349  90   ASP A C   
1204 O O   . ASP A 166 ? 0.5629 0.6212 0.9423 0.0031  -0.0134 0.0322  90   ASP A O   
1205 C CB  . ASP A 166 ? 0.5347 0.6098 0.9161 0.0059  -0.0221 0.0265  90   ASP A CB  
1206 C CG  . ASP A 166 ? 0.6937 0.7672 1.0796 0.0012  -0.0279 0.0161  90   ASP A CG  
1207 O OD1 . ASP A 166 ? 0.6737 0.7372 1.0589 -0.0040 -0.0302 0.0074  90   ASP A OD1 
1208 O OD2 . ASP A 166 ? 0.7965 0.8784 1.1894 0.0029  -0.0292 0.0183  90   ASP A OD2 
1209 N N   . LEU A 167 ? 0.5091 0.5984 0.8871 0.0160  -0.0105 0.0482  91   LEU A N   
1210 C CA  . LEU A 167 ? 0.5075 0.5916 0.8924 0.0189  -0.0010 0.0621  91   LEU A CA  
1211 C C   . LEU A 167 ? 0.5241 0.6098 0.9084 0.0170  0.0003  0.0606  91   LEU A C   
1212 O O   . LEU A 167 ? 0.5115 0.5814 0.9062 0.0128  0.0053  0.0639  91   LEU A O   
1213 C CB  . LEU A 167 ? 0.5175 0.6225 0.9036 0.0296  0.0037  0.0791  91   LEU A CB  
1214 C CG  . LEU A 167 ? 0.5896 0.6840 0.9902 0.0336  0.0148  0.0963  91   LEU A CG  
1215 C CD1 . LEU A 167 ? 0.5974 0.6621 1.0061 0.0266  0.0168  0.0891  91   LEU A CD1 
1216 C CD2 . LEU A 167 ? 0.5958 0.7124 0.9969 0.0444  0.0162  0.1106  91   LEU A CD2 
1217 N N   . LEU A 168 ? 0.4675 0.5721 0.8412 0.0199  -0.0046 0.0539  92   LEU A N   
1218 C CA  . LEU A 168 ? 0.4670 0.5759 0.8401 0.0199  -0.0022 0.0528  92   LEU A CA  
1219 C C   . LEU A 168 ? 0.5164 0.6054 0.8947 0.0102  -0.0059 0.0409  92   LEU A C   
1220 O O   . LEU A 168 ? 0.4998 0.5856 0.8856 0.0082  -0.0021 0.0437  92   LEU A O   
1221 C CB  . LEU A 168 ? 0.4709 0.6054 0.8297 0.0269  -0.0059 0.0466  92   LEU A CB  
1222 C CG  . LEU A 168 ? 0.5463 0.7081 0.8960 0.0387  -0.0033 0.0588  92   LEU A CG  
1223 C CD1 . LEU A 168 ? 0.5595 0.7462 0.8923 0.0452  -0.0083 0.0478  92   LEU A CD1 
1224 C CD2 . LEU A 168 ? 0.5799 0.7452 0.9380 0.0448  0.0095  0.0819  92   LEU A CD2 
1225 N N   . LEU A 169 ? 0.4679 0.5460 0.8440 0.0048  -0.0129 0.0291  93   LEU A N   
1226 C CA  . LEU A 169 ? 0.4564 0.5183 0.8358 -0.0029 -0.0170 0.0192  93   LEU A CA  
1227 C C   . LEU A 169 ? 0.5011 0.5441 0.8888 -0.0081 -0.0142 0.0234  93   LEU A C   
1228 O O   . LEU A 169 ? 0.5056 0.5413 0.8993 -0.0128 -0.0154 0.0208  93   LEU A O   
1229 C CB  . LEU A 169 ? 0.4523 0.5110 0.8281 -0.0053 -0.0237 0.0086  93   LEU A CB  
1230 C CG  . LEU A 169 ? 0.5187 0.5634 0.8973 -0.0115 -0.0277 0.0005  93   LEU A CG  
1231 C CD1 . LEU A 169 ? 0.5160 0.5664 0.8970 -0.0115 -0.0293 -0.0055 93   LEU A CD1 
1232 C CD2 . LEU A 169 ? 0.5563 0.5974 0.9351 -0.0131 -0.0313 -0.0049 93   LEU A CD2 
1233 N N   . LEU A 170 ? 0.4339 0.4702 0.8234 -0.0067 -0.0105 0.0296  94   LEU A N   
1234 C CA  . LEU A 170 ? 0.4239 0.4411 0.8216 -0.0111 -0.0075 0.0310  94   LEU A CA  
1235 C C   . LEU A 170 ? 0.4977 0.5151 0.9096 -0.0117 -0.0017 0.0397  94   LEU A C   
1236 O O   . LEU A 170 ? 0.5045 0.5087 0.9258 -0.0182 -0.0029 0.0356  94   LEU A O   
1237 C CB  . LEU A 170 ? 0.4145 0.4250 0.8120 -0.0079 -0.0034 0.0352  94   LEU A CB  
1238 C CG  . LEU A 170 ? 0.4535 0.4616 0.8412 -0.0080 -0.0079 0.0276  94   LEU A CG  
1239 C CD1 . LEU A 170 ? 0.4603 0.4703 0.8497 -0.0024 -0.0030 0.0348  94   LEU A CD1 
1240 C CD2 . LEU A 170 ? 0.4692 0.4605 0.8527 -0.0138 -0.0113 0.0175  94   LEU A CD2 
1241 N N   . ALA A 171 ? 0.4621 0.4966 0.8762 -0.0048 0.0042  0.0518  95   ALA A N   
1242 C CA  . ALA A 171 ? 0.4714 0.5101 0.9015 -0.0037 0.0121  0.0642  95   ALA A CA  
1243 C C   . ALA A 171 ? 0.5309 0.5693 0.9680 -0.0096 0.0089  0.0583  95   ALA A C   
1244 O O   . ALA A 171 ? 0.5475 0.5838 1.0041 -0.0121 0.0143  0.0662  95   ALA A O   
1245 C CB  . ALA A 171 ? 0.4843 0.5468 0.9093 0.0072  0.0186  0.0783  95   ALA A CB  
1246 N N   . THR A 172 ? 0.4567 0.4975 0.8819 -0.0118 0.0006  0.0456  96   THR A N   
1247 C CA  . THR A 172 ? 0.4435 0.4851 0.8767 -0.0164 -0.0025 0.0410  96   THR A CA  
1248 C C   . THR A 172 ? 0.5095 0.5335 0.9507 -0.0259 -0.0094 0.0323  96   THR A C   
1249 O O   . THR A 172 ? 0.5100 0.5358 0.9614 -0.0302 -0.0127 0.0299  96   THR A O   
1250 C CB  . THR A 172 ? 0.4259 0.4778 0.8461 -0.0135 -0.0074 0.0321  96   THR A CB  
1251 O OG1 . THR A 172 ? 0.3927 0.4340 0.8031 -0.0171 -0.0153 0.0210  96   THR A OG1 
1252 C CG2 . THR A 172 ? 0.3822 0.4536 0.7913 -0.0039 -0.0029 0.0360  96   THR A CG2 
1253 N N   . LEU A 173 ? 0.4731 0.4821 0.9089 -0.0285 -0.0118 0.0270  97   LEU A N   
1254 C CA  . LEU A 173 ? 0.4727 0.4668 0.9106 -0.0361 -0.0190 0.0165  97   LEU A CA  
1255 C C   . LEU A 173 ? 0.5326 0.5220 0.9940 -0.0429 -0.0189 0.0176  97   LEU A C   
1256 O O   . LEU A 173 ? 0.5441 0.5324 1.0088 -0.0488 -0.0276 0.0091  97   LEU A O   
1257 C CB  . LEU A 173 ? 0.4808 0.4608 0.9077 -0.0357 -0.0192 0.0110  97   LEU A CB  
1258 C CG  . LEU A 173 ? 0.5416 0.5233 0.9485 -0.0328 -0.0235 0.0053  97   LEU A CG  
1259 C CD1 . LEU A 173 ? 0.5543 0.5297 0.9532 -0.0285 -0.0188 0.0068  97   LEU A CD1 
1260 C CD2 . LEU A 173 ? 0.5610 0.5373 0.9608 -0.0371 -0.0322 -0.0047 97   LEU A CD2 
1261 N N   . PRO A 174 ? 0.4747 0.4633 0.9554 -0.0422 -0.0095 0.0287  98   PRO A N   
1262 C CA  . PRO A 174 ? 0.4679 0.4529 0.9776 -0.0499 -0.0094 0.0299  98   PRO A CA  
1263 C C   . PRO A 174 ? 0.4846 0.4850 1.0044 -0.0520 -0.0129 0.0319  98   PRO A C   
1264 O O   . PRO A 174 ? 0.4749 0.4725 1.0135 -0.0605 -0.0195 0.0259  98   PRO A O   
1265 C CB  . PRO A 174 ? 0.4906 0.4753 1.0195 -0.0460 0.0044  0.0464  98   PRO A CB  
1266 C CG  . PRO A 174 ? 0.5411 0.5221 1.0500 -0.0383 0.0086  0.0489  98   PRO A CG  
1267 C CD  . PRO A 174 ? 0.4821 0.4739 0.9627 -0.0344 0.0016  0.0420  98   PRO A CD  
1268 N N   . LEU A 175 ? 0.4189 0.4359 0.9273 -0.0443 -0.0092 0.0388  99   LEU A N   
1269 C CA  . LEU A 175 ? 0.4140 0.4454 0.9317 -0.0446 -0.0111 0.0406  99   LEU A CA  
1270 C C   . LEU A 175 ? 0.4873 0.5159 0.9993 -0.0501 -0.0245 0.0272  99   LEU A C   
1271 O O   . LEU A 175 ? 0.4811 0.5160 1.0125 -0.0552 -0.0290 0.0270  99   LEU A O   
1272 C CB  . LEU A 175 ? 0.4063 0.4537 0.9085 -0.0343 -0.0048 0.0465  99   LEU A CB  
1273 C CG  . LEU A 175 ? 0.4749 0.5335 0.9801 -0.0261 0.0085  0.0619  99   LEU A CG  
1274 C CD1 . LEU A 175 ? 0.4663 0.5394 0.9471 -0.0157 0.0109  0.0607  99   LEU A CD1 
1275 C CD2 . LEU A 175 ? 0.5153 0.5841 1.0495 -0.0269 0.0167  0.0750  99   LEU A CD2 
1276 N N   . TRP A 176 ? 0.4649 0.4862 0.9520 -0.0485 -0.0305 0.0178  100  TRP A N   
1277 C CA  . TRP A 176 ? 0.4697 0.4902 0.9487 -0.0515 -0.0421 0.0079  100  TRP A CA  
1278 C C   . TRP A 176 ? 0.5371 0.5474 1.0214 -0.0597 -0.0514 -0.0016 100  TRP A C   
1279 O O   . TRP A 176 ? 0.5519 0.5675 1.0385 -0.0631 -0.0616 -0.0071 100  TRP A O   
1280 C CB  . TRP A 176 ? 0.4512 0.4688 0.9048 -0.0461 -0.0435 0.0035  100  TRP A CB  
1281 C CG  . TRP A 176 ? 0.4599 0.4848 0.9058 -0.0386 -0.0353 0.0086  100  TRP A CG  
1282 C CD1 . TRP A 176 ? 0.4966 0.5179 0.9272 -0.0344 -0.0320 0.0080  100  TRP A CD1 
1283 C CD2 . TRP A 176 ? 0.4564 0.4955 0.9099 -0.0339 -0.0297 0.0142  100  TRP A CD2 
1284 N NE1 . TRP A 176 ? 0.4908 0.5239 0.9181 -0.0279 -0.0264 0.0114  100  TRP A NE1 
1285 C CE2 . TRP A 176 ? 0.5061 0.5497 0.9455 -0.0269 -0.0243 0.0148  100  TRP A CE2 
1286 C CE3 . TRP A 176 ? 0.4708 0.5205 0.9420 -0.0343 -0.0286 0.0186  100  TRP A CE3 
1287 C CZ2 . TRP A 176 ? 0.4925 0.5505 0.9316 -0.0201 -0.0182 0.0174  100  TRP A CZ2 
1288 C CZ3 . TRP A 176 ? 0.4885 0.5515 0.9605 -0.0269 -0.0207 0.0230  100  TRP A CZ3 
1289 C CH2 . TRP A 176 ? 0.4958 0.5626 0.9502 -0.0197 -0.0157 0.0214  100  TRP A CH2 
1290 N N   . ALA A 177 ? 0.4682 0.4648 0.9536 -0.0622 -0.0482 -0.0045 101  ALA A N   
1291 C CA  . ALA A 177 ? 0.4651 0.4509 0.9563 -0.0699 -0.0566 -0.0167 101  ALA A CA  
1292 C C   . ALA A 177 ? 0.5218 0.5134 1.0476 -0.0782 -0.0594 -0.0155 101  ALA A C   
1293 O O   . ALA A 177 ? 0.5563 0.5458 1.0899 -0.0858 -0.0708 -0.0278 101  ALA A O   
1294 C CB  . ALA A 177 ? 0.4827 0.4511 0.9684 -0.0691 -0.0502 -0.0200 101  ALA A CB  
1295 N N   . THR A 178 ? 0.4342 0.4358 0.9808 -0.0763 -0.0494 -0.0005 102  THR A N   
1296 C CA  . THR A 178 ? 0.4222 0.4324 1.0064 -0.0832 -0.0495 0.0048  102  THR A CA  
1297 C C   . THR A 178 ? 0.4785 0.5075 1.0672 -0.0830 -0.0571 0.0062  102  THR A C   
1298 O O   . THR A 178 ? 0.4708 0.5061 1.0818 -0.0912 -0.0672 0.0008  102  THR A O   
1299 C CB  . THR A 178 ? 0.4198 0.4333 1.0240 -0.0794 -0.0330 0.0228  102  THR A CB  
1300 O OG1 . THR A 178 ? 0.4681 0.4646 1.0720 -0.0790 -0.0258 0.0232  102  THR A OG1 
1301 C CG2 . THR A 178 ? 0.3089 0.3326 0.9551 -0.0859 -0.0310 0.0309  102  THR A CG2 
1302 N N   . TYR A 179 ? 0.4464 0.4847 1.0161 -0.0737 -0.0525 0.0128  103  TYR A N   
1303 C CA  . TYR A 179 ? 0.4360 0.4904 1.0085 -0.0714 -0.0577 0.0148  103  TYR A CA  
1304 C C   . TYR A 179 ? 0.5096 0.5644 1.0744 -0.0762 -0.0746 0.0025  103  TYR A C   
1305 O O   . TYR A 179 ? 0.5283 0.5963 1.1141 -0.0806 -0.0830 0.0027  103  TYR A O   
1306 C CB  . TYR A 179 ? 0.4330 0.4913 0.9826 -0.0604 -0.0497 0.0196  103  TYR A CB  
1307 C CG  . TYR A 179 ? 0.4487 0.5202 0.9997 -0.0560 -0.0527 0.0214  103  TYR A CG  
1308 C CD1 . TYR A 179 ? 0.4690 0.5561 1.0479 -0.0564 -0.0504 0.0295  103  TYR A CD1 
1309 C CD2 . TYR A 179 ? 0.4550 0.5237 0.9825 -0.0502 -0.0552 0.0169  103  TYR A CD2 
1310 C CE1 . TYR A 179 ? 0.4572 0.5562 1.0392 -0.0507 -0.0512 0.0322  103  TYR A CE1 
1311 C CE2 . TYR A 179 ? 0.4571 0.5362 0.9891 -0.0452 -0.0560 0.0195  103  TYR A CE2 
1312 C CZ  . TYR A 179 ? 0.5039 0.5979 1.0625 -0.0451 -0.0541 0.0268  103  TYR A CZ  
1313 O OH  . TYR A 179 ? 0.5001 0.6035 1.0643 -0.0391 -0.0538 0.0297  103  TYR A OH  
1314 N N   . TYR A 180 ? 0.4668 0.5090 1.0028 -0.0750 -0.0794 -0.0073 104  TYR A N   
1315 C CA  . TYR A 180 ? 0.4783 0.5217 1.0007 -0.0774 -0.0943 -0.0184 104  TYR A CA  
1316 C C   . TYR A 180 ? 0.5881 0.6329 1.1311 -0.0880 -0.1060 -0.0287 104  TYR A C   
1317 O O   . TYR A 180 ? 0.6071 0.6631 1.1483 -0.0903 -0.1205 -0.0354 104  TYR A O   
1318 C CB  . TYR A 180 ? 0.4910 0.5196 0.9801 -0.0733 -0.0933 -0.0253 104  TYR A CB  
1319 C CG  . TYR A 180 ? 0.5086 0.5396 0.9790 -0.0736 -0.1068 -0.0355 104  TYR A CG  
1320 C CD1 . TYR A 180 ? 0.5168 0.5576 0.9721 -0.0668 -0.1103 -0.0304 104  TYR A CD1 
1321 C CD2 . TYR A 180 ? 0.5356 0.5600 1.0040 -0.0799 -0.1156 -0.0501 104  TYR A CD2 
1322 C CE1 . TYR A 180 ? 0.5164 0.5627 0.9532 -0.0652 -0.1218 -0.0368 104  TYR A CE1 
1323 C CE2 . TYR A 180 ? 0.5639 0.5942 1.0118 -0.0788 -0.1284 -0.0599 104  TYR A CE2 
1324 C CZ  . TYR A 180 ? 0.6382 0.6805 1.0692 -0.0708 -0.1312 -0.0518 104  TYR A CZ  
1325 O OH  . TYR A 180 ? 0.6792 0.7302 1.0883 -0.0678 -0.1429 -0.0585 104  TYR A OH  
1326 N N   . SER A 181 ? 0.5592 0.5934 1.1227 -0.0942 -0.1000 -0.0302 105  SER A N   
1327 C CA  . SER A 181 ? 0.5743 0.6057 1.1637 -0.1058 -0.1093 -0.0420 105  SER A CA  
1328 C C   . SER A 181 ? 0.6503 0.6998 1.2806 -0.1127 -0.1140 -0.0360 105  SER A C   
1329 O O   . SER A 181 ? 0.6682 0.7198 1.3227 -0.1233 -0.1258 -0.0478 105  SER A O   
1330 C CB  . SER A 181 ? 0.6009 0.6121 1.2014 -0.1088 -0.0982 -0.0432 105  SER A CB  
1331 O OG  . SER A 181 ? 0.6895 0.6838 1.2574 -0.1047 -0.0971 -0.0531 105  SER A OG  
1332 N N   . TYR A 182 ? 0.6004 0.6632 1.2405 -0.1066 -0.1044 -0.0186 106  TYR A N   
1333 C CA  . TYR A 182 ? 0.6024 0.6849 1.2816 -0.1111 -0.1066 -0.0100 106  TYR A CA  
1334 C C   . TYR A 182 ? 0.6449 0.7462 1.3129 -0.1053 -0.1158 -0.0074 106  TYR A C   
1335 O O   . TYR A 182 ? 0.6384 0.7575 1.3300 -0.1033 -0.1128 0.0046  106  TYR A O   
1336 C CB  . TYR A 182 ? 0.6114 0.6957 1.3132 -0.1075 -0.0870 0.0085  106  TYR A CB  
1337 C CG  . TYR A 182 ? 0.6567 0.7265 1.3833 -0.1151 -0.0799 0.0082  106  TYR A CG  
1338 C CD1 . TYR A 182 ? 0.6971 0.7702 1.4674 -0.1281 -0.0877 0.0030  106  TYR A CD1 
1339 C CD2 . TYR A 182 ? 0.6723 0.7260 1.3828 -0.1091 -0.0651 0.0141  106  TYR A CD2 
1340 C CE1 . TYR A 182 ? 0.7294 0.7869 1.5275 -0.1352 -0.0800 0.0032  106  TYR A CE1 
1341 C CE2 . TYR A 182 ? 0.7013 0.7410 1.4374 -0.1150 -0.0573 0.0160  106  TYR A CE2 
1342 C CZ  . TYR A 182 ? 0.8426 0.8829 1.6234 -0.1281 -0.0640 0.0107  106  TYR A CZ  
1343 O OH  . TYR A 182 ? 0.8987 0.9228 1.7091 -0.1340 -0.0552 0.0127  106  TYR A OH  
1344 N N   . ARG A 183 ? 0.5982 0.6955 1.2311 -0.1022 -0.1264 -0.0181 107  ARG A N   
1345 C CA  . ARG A 183 ? 0.5890 0.7013 1.2060 -0.0959 -0.1360 -0.0163 107  ARG A CA  
1346 C C   . ARG A 183 ? 0.6173 0.7373 1.2368 -0.0857 -0.1228 0.0003  107  ARG A C   
1347 O O   . ARG A 183 ? 0.6279 0.7668 1.2639 -0.0831 -0.1269 0.0081  107  ARG A O   
1348 C CB  . ARG A 183 ? 0.5800 0.7129 1.2201 -0.1037 -0.1557 -0.0229 107  ARG A CB  
1349 C CG  . ARG A 183 ? 0.6103 0.7388 1.2316 -0.1096 -0.1727 -0.0433 107  ARG A CG  
1350 C CD  . ARG A 183 ? 0.6071 0.7162 1.2397 -0.1198 -0.1709 -0.0570 107  ARG A CD  
1351 N NE  . ARG A 183 ? 0.6619 0.7705 1.2835 -0.1264 -0.1892 -0.0795 107  ARG A NE  
1352 C CZ  . ARG A 183 ? 0.8453 0.9346 1.4710 -0.1343 -0.1895 -0.0962 107  ARG A CZ  
1353 N NH1 . ARG A 183 ? 0.7299 0.7991 1.3709 -0.1361 -0.1720 -0.0900 107  ARG A NH1 
1354 N NH2 . ARG A 183 ? 0.6468 0.7371 1.2604 -0.1394 -0.2069 -0.1192 107  ARG A NH2 
1355 N N   . TYR A 184 ? 0.5339 0.6393 1.1388 -0.0801 -0.1067 0.0048  108  TYR A N   
1356 C CA  . TYR A 184 ? 0.4989 0.6066 1.1001 -0.0701 -0.0921 0.0161  108  TYR A CA  
1357 C C   . TYR A 184 ? 0.5213 0.6436 1.1576 -0.0700 -0.0832 0.0279  108  TYR A C   
1358 O O   . TYR A 184 ? 0.4923 0.6259 1.1345 -0.0624 -0.0778 0.0360  108  TYR A O   
1359 C CB  . TYR A 184 ? 0.4951 0.6073 1.0783 -0.0617 -0.0954 0.0178  108  TYR A CB  
1360 C CG  . TYR A 184 ? 0.4951 0.5935 1.0442 -0.0600 -0.1001 0.0096  108  TYR A CG  
1361 C CD1 . TYR A 184 ? 0.5144 0.5973 1.0416 -0.0556 -0.0896 0.0081  108  TYR A CD1 
1362 C CD2 . TYR A 184 ? 0.5011 0.6046 1.0404 -0.0619 -0.1149 0.0041  108  TYR A CD2 
1363 C CE1 . TYR A 184 ? 0.5088 0.5803 1.0082 -0.0537 -0.0927 0.0022  108  TYR A CE1 
1364 C CE2 . TYR A 184 ? 0.5062 0.5986 1.0143 -0.0589 -0.1173 -0.0016 108  TYR A CE2 
1365 C CZ  . TYR A 184 ? 0.5332 0.6091 1.0230 -0.0551 -0.1056 -0.0021 108  TYR A CZ  
1366 O OH  . TYR A 184 ? 0.5117 0.5780 0.9742 -0.0518 -0.1067 -0.0061 108  TYR A OH  
1367 N N   . ASP A 185 ? 0.4929 0.6136 1.1527 -0.0773 -0.0792 0.0299  109  ASP A N   
1368 C CA  . ASP A 185 ? 0.4977 0.6319 1.1915 -0.0765 -0.0675 0.0437  109  ASP A CA  
1369 C C   . ASP A 185 ? 0.5853 0.7100 1.2717 -0.0717 -0.0496 0.0510  109  ASP A C   
1370 O O   . ASP A 185 ? 0.5954 0.7082 1.2875 -0.0780 -0.0482 0.0491  109  ASP A O   
1371 C CB  . ASP A 185 ? 0.5275 0.6726 1.2643 -0.0886 -0.0766 0.0440  109  ASP A CB  
1372 C CG  . ASP A 185 ? 0.6733 0.8357 1.4504 -0.0874 -0.0640 0.0608  109  ASP A CG  
1373 O OD1 . ASP A 185 ? 0.6900 0.8629 1.4630 -0.0761 -0.0531 0.0709  109  ASP A OD1 
1374 O OD2 . ASP A 185 ? 0.7401 0.9060 1.5553 -0.0976 -0.0652 0.0634  109  ASP A OD2 
1375 N N   . TRP A 186 ? 0.5502 0.6803 1.2229 -0.0597 -0.0364 0.0586  110  TRP A N   
1376 C CA  . TRP A 186 ? 0.5499 0.6767 1.2106 -0.0521 -0.0198 0.0663  110  TRP A CA  
1377 C C   . TRP A 186 ? 0.6483 0.7857 1.3451 -0.0539 -0.0077 0.0819  110  TRP A C   
1378 O O   . TRP A 186 ? 0.6464 0.8014 1.3689 -0.0515 -0.0027 0.0915  110  TRP A O   
1379 C CB  . TRP A 186 ? 0.5189 0.6514 1.1557 -0.0389 -0.0113 0.0668  110  TRP A CB  
1380 C CG  . TRP A 186 ? 0.5263 0.6557 1.1408 -0.0307 0.0015  0.0701  110  TRP A CG  
1381 C CD1 . TRP A 186 ? 0.5667 0.7092 1.1866 -0.0219 0.0178  0.0828  110  TRP A CD1 
1382 C CD2 . TRP A 186 ? 0.5201 0.6345 1.1045 -0.0302 -0.0012 0.0620  110  TRP A CD2 
1383 N NE1 . TRP A 186 ? 0.5636 0.7018 1.1567 -0.0155 0.0242  0.0827  110  TRP A NE1 
1384 C CE2 . TRP A 186 ? 0.5756 0.6963 1.1483 -0.0209 0.0126  0.0700  110  TRP A CE2 
1385 C CE3 . TRP A 186 ? 0.5314 0.6297 1.0977 -0.0358 -0.0135 0.0496  110  TRP A CE3 
1386 C CZ2 . TRP A 186 ? 0.5656 0.6777 1.1112 -0.0178 0.0131  0.0657  110  TRP A CZ2 
1387 C CZ3 . TRP A 186 ? 0.5503 0.6385 1.0912 -0.0328 -0.0115 0.0458  110  TRP A CZ3 
1388 C CH2 . TRP A 186 ? 0.5618 0.6572 1.0935 -0.0242 0.0010  0.0536  110  TRP A CH2 
1389 N N   . LEU A 187 ? 0.6498 0.7768 1.3516 -0.0576 -0.0022 0.0859  111  LEU A N   
1390 C CA  . LEU A 187 ? 0.6685 0.8033 1.4080 -0.0596 0.0108  0.1032  111  LEU A CA  
1391 C C   . LEU A 187 ? 0.7548 0.8904 1.4788 -0.0483 0.0294  0.1170  111  LEU A C   
1392 O O   . LEU A 187 ? 0.7537 0.8917 1.5057 -0.0494 0.0413  0.1328  111  LEU A O   
1393 C CB  . LEU A 187 ? 0.6745 0.7969 1.4444 -0.0750 0.0013  0.0976  111  LEU A CB  
1394 C CG  . LEU A 187 ? 0.7350 0.8649 1.5362 -0.0868 -0.0147 0.0893  111  LEU A CG  
1395 C CD1 . LEU A 187 ? 0.7496 0.8632 1.5675 -0.1012 -0.0271 0.0760  111  LEU A CD1 
1396 C CD2 . LEU A 187 ? 0.7759 0.9274 1.6240 -0.0874 -0.0051 0.1071  111  LEU A CD2 
1397 N N   . PHE A 188 ? 0.7353 0.8709 1.4172 -0.0372 0.0318  0.1118  112  PHE A N   
1398 C CA  . PHE A 188 ? 0.7492 0.8893 1.4102 -0.0252 0.0465  0.1226  112  PHE A CA  
1399 C C   . PHE A 188 ? 0.8077 0.9704 1.4612 -0.0107 0.0607  0.1328  112  PHE A C   
1400 O O   . PHE A 188 ? 0.8194 0.9928 1.4644 0.0001  0.0754  0.1469  112  PHE A O   
1401 C CB  . PHE A 188 ? 0.7720 0.8983 1.3920 -0.0227 0.0388  0.1084  112  PHE A CB  
1402 C CG  . PHE A 188 ? 0.7932 0.8974 1.4144 -0.0342 0.0269  0.0977  112  PHE A CG  
1403 C CD1 . PHE A 188 ? 0.8448 0.9395 1.4743 -0.0358 0.0332  0.1060  112  PHE A CD1 
1404 C CD2 . PHE A 188 ? 0.8146 0.9083 1.4278 -0.0421 0.0104  0.0799  112  PHE A CD2 
1405 C CE1 . PHE A 188 ? 0.8596 0.9329 1.4897 -0.0454 0.0233  0.0942  112  PHE A CE1 
1406 C CE2 . PHE A 188 ? 0.8563 0.9309 1.4669 -0.0511 0.0002  0.0689  112  PHE A CE2 
1407 C CZ  . PHE A 188 ? 0.8442 0.9081 1.4632 -0.0529 0.0068  0.0749  112  PHE A CZ  
1408 N N   . GLY A 189 ? 0.7531 0.9239 1.4095 -0.0093 0.0568  0.1261  113  GLY A N   
1409 C CA  . GLY A 189 ? 0.7590 0.9500 1.4087 0.0048  0.0702  0.1327  113  GLY A CA  
1410 C C   . GLY A 189 ? 0.8097 0.9986 1.4252 0.0119  0.0643  0.1146  113  GLY A C   
1411 O O   . GLY A 189 ? 0.7910 0.9654 1.3793 0.0096  0.0542  0.1008  113  GLY A O   
1412 N N   . PRO A 190 ? 0.7777 0.9806 1.3962 0.0210  0.0713  0.1143  114  PRO A N   
1413 C CA  . PRO A 190 ? 0.7788 0.9773 1.3696 0.0274  0.0663  0.0957  114  PRO A CA  
1414 C C   . PRO A 190 ? 0.8317 1.0318 1.3831 0.0381  0.0710  0.0874  114  PRO A C   
1415 O O   . PRO A 190 ? 0.8302 1.0213 1.3595 0.0399  0.0634  0.0693  114  PRO A O   
1416 C CB  . PRO A 190 ? 0.8079 1.0221 1.4171 0.0357  0.0758  0.0999  114  PRO A CB  
1417 C CG  . PRO A 190 ? 0.8668 1.0985 1.5018 0.0386  0.0907  0.1220  114  PRO A CG  
1418 C CD  . PRO A 190 ? 0.7990 1.0215 1.4501 0.0256  0.0847  0.1308  114  PRO A CD  
1419 N N   . VAL A 191 ? 0.7844 0.9971 1.3290 0.0454  0.0832  0.1012  115  VAL A N   
1420 C CA  . VAL A 191 ? 0.7842 1.0035 1.2916 0.0562  0.0869  0.0952  115  VAL A CA  
1421 C C   . VAL A 191 ? 0.8165 1.0172 1.3098 0.0466  0.0729  0.0868  115  VAL A C   
1422 O O   . VAL A 191 ? 0.8240 1.0199 1.2901 0.0492  0.0656  0.0699  115  VAL A O   
1423 C CB  . VAL A 191 ? 0.8462 1.0891 1.3509 0.0692  0.1055  0.1160  115  VAL A CB  
1424 C CG1 . VAL A 191 ? 0.8572 1.1109 1.3205 0.0814  0.1072  0.1087  115  VAL A CG1 
1425 C CG2 . VAL A 191 ? 0.8523 1.1141 1.3730 0.0792  0.1208  0.1251  115  VAL A CG2 
1426 N N   . MET A 192 ? 0.7577 0.9469 1.2723 0.0350  0.0688  0.0970  116  MET A N   
1427 C CA  . MET A 192 ? 0.7456 0.9162 1.2506 0.0259  0.0568  0.0901  116  MET A CA  
1428 C C   . MET A 192 ? 0.7262 0.8803 1.2222 0.0187  0.0416  0.0696  116  MET A C   
1429 O O   . MET A 192 ? 0.7137 0.8567 1.1914 0.0159  0.0332  0.0601  116  MET A O   
1430 C CB  . MET A 192 ? 0.7842 0.9446 1.3184 0.0148  0.0561  0.1027  116  MET A CB  
1431 C CG  . MET A 192 ? 0.8573 1.0307 1.4059 0.0208  0.0719  0.1260  116  MET A CG  
1432 S SD  . MET A 192 ? 0.9307 1.0951 1.4702 0.0205  0.0730  0.1343  116  MET A SD  
1433 C CE  . MET A 192 ? 0.8765 1.0118 1.4388 0.0016  0.0588  0.1243  116  MET A CE  
1434 N N   . CYS A 193 ? 0.6519 0.8061 1.1628 0.0166  0.0389  0.0650  117  CYS A N   
1435 C CA  . CYS A 193 ? 0.6311 0.7721 1.1375 0.0115  0.0265  0.0493  117  CYS A CA  
1436 C C   . CYS A 193 ? 0.6506 0.7919 1.1299 0.0196  0.0261  0.0344  117  CYS A C   
1437 O O   . CYS A 193 ? 0.6382 0.7657 1.1066 0.0149  0.0161  0.0228  117  CYS A O   
1438 C CB  . CYS A 193 ? 0.6323 0.7779 1.1641 0.0098  0.0259  0.0519  117  CYS A CB  
1439 S SG  . CYS A 193 ? 0.6779 0.8100 1.2088 0.0051  0.0121  0.0379  117  CYS A SG  
1440 N N   . LYS A 194 ? 0.5921 0.7498 1.0609 0.0319  0.0373  0.0343  118  LYS A N   
1441 C CA  . LYS A 194 ? 0.5866 0.7470 1.0303 0.0399  0.0368  0.0176  118  LYS A CA  
1442 C C   . LYS A 194 ? 0.6425 0.8050 1.0636 0.0409  0.0340  0.0166  118  LYS A C   
1443 O O   . LYS A 194 ? 0.6311 0.7859 1.0381 0.0392  0.0254  0.0014  118  LYS A O   
1444 C CB  . LYS A 194 ? 0.6215 0.8005 1.0601 0.0537  0.0496  0.0158  118  LYS A CB  
1445 C CG  . LYS A 194 ? 0.6745 0.8488 1.1276 0.0553  0.0504  0.0068  118  LYS A CG  
1446 C CD  . LYS A 194 ? 0.7044 0.8937 1.1466 0.0702  0.0621  -0.0025 118  LYS A CD  
1447 C CE  . LYS A 194 ? 0.8208 1.0024 1.2801 0.0721  0.0632  -0.0124 118  LYS A CE  
1448 N NZ  . LYS A 194 ? 1.0158 1.1998 1.5069 0.0687  0.0668  0.0049  118  LYS A NZ  
1449 N N   . VAL A 195 ? 0.5968 0.7708 1.0181 0.0441  0.0419  0.0342  119  VAL A N   
1450 C CA  . VAL A 195 ? 0.5931 0.7732 0.9957 0.0473  0.0414  0.0384  119  VAL A CA  
1451 C C   . VAL A 195 ? 0.6505 0.8105 1.0547 0.0357  0.0295  0.0346  119  VAL A C   
1452 O O   . VAL A 195 ? 0.6544 0.8130 1.0412 0.0363  0.0223  0.0228  119  VAL A O   
1453 C CB  . VAL A 195 ? 0.6362 0.8330 1.0445 0.0542  0.0549  0.0622  119  VAL A CB  
1454 C CG1 . VAL A 195 ? 0.6337 0.8347 1.0280 0.0566  0.0538  0.0700  119  VAL A CG1 
1455 C CG2 . VAL A 195 ? 0.6473 0.8685 1.0465 0.0690  0.0680  0.0656  119  VAL A CG2 
1456 N N   . PHE A 196 ? 0.6144 0.7599 1.0397 0.0254  0.0273  0.0435  120  PHE A N   
1457 C CA  . PHE A 196 ? 0.6153 0.7418 1.0412 0.0155  0.0175  0.0398  120  PHE A CA  
1458 C C   . PHE A 196 ? 0.6378 0.7505 1.0603 0.0098  0.0065  0.0230  120  PHE A C   
1459 O O   . PHE A 196 ? 0.6294 0.7306 1.0443 0.0051  -0.0007 0.0173  120  PHE A O   
1460 C CB  . PHE A 196 ? 0.6484 0.7647 1.0968 0.0072  0.0187  0.0521  120  PHE A CB  
1461 C CG  . PHE A 196 ? 0.6975 0.8218 1.1482 0.0120  0.0284  0.0688  120  PHE A CG  
1462 C CD1 . PHE A 196 ? 0.7567 0.8784 1.1931 0.0140  0.0266  0.0695  120  PHE A CD1 
1463 C CD2 . PHE A 196 ? 0.7443 0.8806 1.2134 0.0157  0.0404  0.0858  120  PHE A CD2 
1464 C CE1 . PHE A 196 ? 0.7851 0.9157 1.2251 0.0201  0.0364  0.0874  120  PHE A CE1 
1465 C CE2 . PHE A 196 ? 0.8021 0.9466 1.2756 0.0215  0.0510  0.1044  120  PHE A CE2 
1466 C CZ  . PHE A 196 ? 0.7847 0.9262 1.2432 0.0239  0.0489  0.1053  120  PHE A CZ  
1467 N N   . GLY A 197 ? 0.5741 0.6890 1.0033 0.0112  0.0068  0.0168  121  GLY A N   
1468 C CA  . GLY A 197 ? 0.5610 0.6644 0.9901 0.0077  -0.0014 0.0034  121  GLY A CA  
1469 C C   . GLY A 197 ? 0.5889 0.6935 1.0006 0.0116  -0.0044 -0.0104 121  GLY A C   
1470 O O   . GLY A 197 ? 0.5740 0.6663 0.9835 0.0064  -0.0119 -0.0174 121  GLY A O   
1471 N N   . SER A 198 ? 0.5402 0.6612 0.9399 0.0212  0.0017  -0.0142 122  SER A N   
1472 C CA  . SER A 198 ? 0.5383 0.6650 0.9219 0.0255  -0.0021 -0.0295 122  SER A CA  
1473 C C   . SER A 198 ? 0.5639 0.6929 0.9359 0.0239  -0.0064 -0.0257 122  SER A C   
1474 O O   . SER A 198 ? 0.5626 0.6874 0.9302 0.0212  -0.0140 -0.0373 122  SER A O   
1475 C CB  . SER A 198 ? 0.6036 0.7504 0.9754 0.0374  0.0054  -0.0353 122  SER A CB  
1476 O OG  . SER A 198 ? 0.7306 0.8762 1.1151 0.0401  0.0115  -0.0367 122  SER A OG  
1477 N N   . PHE A 199 ? 0.5040 0.6399 0.8746 0.0258  -0.0009 -0.0086 123  PHE A N   
1478 C CA  . PHE A 199 ? 0.5059 0.6445 0.8685 0.0256  -0.0030 -0.0014 123  PHE A CA  
1479 C C   . PHE A 199 ? 0.5386 0.6568 0.9079 0.0156  -0.0111 -0.0050 123  PHE A C   
1480 O O   . PHE A 199 ? 0.5315 0.6512 0.8936 0.0154  -0.0161 -0.0088 123  PHE A O   
1481 C CB  . PHE A 199 ? 0.5357 0.6812 0.9033 0.0288  0.0065  0.0199  123  PHE A CB  
1482 C CG  . PHE A 199 ? 0.5650 0.7169 0.9256 0.0319  0.0070  0.0304  123  PHE A CG  
1483 C CD1 . PHE A 199 ? 0.6183 0.7940 0.9606 0.0426  0.0078  0.0308  123  PHE A CD1 
1484 C CD2 . PHE A 199 ? 0.5874 0.7230 0.9600 0.0251  0.0072  0.0403  123  PHE A CD2 
1485 C CE1 . PHE A 199 ? 0.6327 0.8167 0.9705 0.0465  0.0085  0.0429  123  PHE A CE1 
1486 C CE2 . PHE A 199 ? 0.6283 0.7695 0.9973 0.0291  0.0092  0.0514  123  PHE A CE2 
1487 C CZ  . PHE A 199 ? 0.6157 0.7816 0.9681 0.0399  0.0099  0.0540  123  PHE A CZ  
1488 N N   . LEU A 200 ? 0.4953 0.5967 0.8781 0.0081  -0.0125 -0.0040 124  LEU A N   
1489 C CA  . LEU A 200 ? 0.4921 0.5751 0.8795 -0.0001 -0.0191 -0.0069 124  LEU A CA  
1490 C C   . LEU A 200 ? 0.5802 0.6607 0.9647 -0.0009 -0.0253 -0.0210 124  LEU A C   
1491 O O   . LEU A 200 ? 0.5969 0.6721 0.9790 -0.0036 -0.0292 -0.0224 124  LEU A O   
1492 C CB  . LEU A 200 ? 0.4848 0.5561 0.8855 -0.0060 -0.0199 -0.0038 124  LEU A CB  
1493 C CG  . LEU A 200 ? 0.5370 0.5919 0.9399 -0.0128 -0.0266 -0.0072 124  LEU A CG  
1494 C CD1 . LEU A 200 ? 0.5423 0.5885 0.9430 -0.0164 -0.0269 -0.0011 124  LEU A CD1 
1495 C CD2 . LEU A 200 ? 0.5544 0.6047 0.9685 -0.0160 -0.0291 -0.0071 124  LEU A CD2 
1496 N N   . THR A 201 ? 0.5395 0.6234 0.9271 0.0016  -0.0252 -0.0312 125  THR A N   
1497 C CA  . THR A 201 ? 0.5391 0.6191 0.9305 0.0005  -0.0301 -0.0456 125  THR A CA  
1498 C C   . THR A 201 ? 0.5942 0.6876 0.9754 0.0039  -0.0335 -0.0548 125  THR A C   
1499 O O   . THR A 201 ? 0.5909 0.6792 0.9774 -0.0001 -0.0391 -0.0619 125  THR A O   
1500 C CB  . THR A 201 ? 0.6239 0.7034 1.0242 0.0033  -0.0274 -0.0535 125  THR A CB  
1501 O OG1 . THR A 201 ? 0.6241 0.6954 1.0343 0.0005  -0.0254 -0.0429 125  THR A OG1 
1502 C CG2 . THR A 201 ? 0.5954 0.6663 1.0065 0.0012  -0.0313 -0.0674 125  THR A CG2 
1503 N N   . LEU A 202 ? 0.5445 0.6569 0.9123 0.0115  -0.0302 -0.0532 126  LEU A N   
1504 C CA  . LEU A 202 ? 0.5436 0.6747 0.8989 0.0165  -0.0344 -0.0609 126  LEU A CA  
1505 C C   . LEU A 202 ? 0.5853 0.7150 0.9409 0.0128  -0.0389 -0.0539 126  LEU A C   
1506 O O   . LEU A 202 ? 0.5967 0.7337 0.9529 0.0119  -0.0462 -0.0648 126  LEU A O   
1507 C CB  . LEU A 202 ? 0.5536 0.7068 0.8927 0.0271  -0.0279 -0.0537 126  LEU A CB  
1508 C CG  . LEU A 202 ? 0.6242 0.8029 0.9463 0.0352  -0.0324 -0.0646 126  LEU A CG  
1509 C CD1 . LEU A 202 ? 0.6483 0.8451 0.9564 0.0462  -0.0255 -0.0678 126  LEU A CD1 
1510 C CD2 . LEU A 202 ? 0.6361 0.8283 0.9500 0.0383  -0.0336 -0.0499 126  LEU A CD2 
1511 N N   . ASN A 203 ? 0.5238 0.6451 0.8810 0.0108  -0.0345 -0.0365 127  ASN A N   
1512 C CA  . ASN A 203 ? 0.5029 0.6214 0.8612 0.0086  -0.0364 -0.0280 127  ASN A CA  
1513 C C   . ASN A 203 ? 0.5459 0.6447 0.9159 0.0003  -0.0398 -0.0313 127  ASN A C   
1514 O O   . ASN A 203 ? 0.5415 0.6409 0.9140 -0.0011 -0.0426 -0.0295 127  ASN A O   
1515 C CB  . ASN A 203 ? 0.4289 0.5457 0.7856 0.0108  -0.0289 -0.0094 127  ASN A CB  
1516 C CG  . ASN A 203 ? 0.4818 0.6216 0.8278 0.0207  -0.0244 -0.0012 127  ASN A CG  
1517 O OD1 . ASN A 203 ? 0.4600 0.6026 0.8061 0.0240  -0.0170 0.0069  127  ASN A OD1 
1518 N ND2 . ASN A 203 ? 0.2935 0.4527 0.6310 0.0263  -0.0285 -0.0022 127  ASN A ND2 
1519 N N   . MET A 204 ? 0.5105 0.5939 0.8882 -0.0042 -0.0390 -0.0345 128  MET A N   
1520 C CA  . MET A 204 ? 0.5122 0.5792 0.8999 -0.0103 -0.0412 -0.0357 128  MET A CA  
1521 C C   . MET A 204 ? 0.5700 0.6414 0.9668 -0.0118 -0.0466 -0.0482 128  MET A C   
1522 O O   . MET A 204 ? 0.5660 0.6338 0.9695 -0.0148 -0.0483 -0.0463 128  MET A O   
1523 C CB  . MET A 204 ? 0.5447 0.5983 0.9383 -0.0132 -0.0395 -0.0342 128  MET A CB  
1524 C CG  . MET A 204 ? 0.6011 0.6406 1.0031 -0.0176 -0.0409 -0.0328 128  MET A CG  
1525 S SD  . MET A 204 ? 0.6754 0.7066 1.0898 -0.0187 -0.0409 -0.0358 128  MET A SD  
1526 C CE  . MET A 204 ? 0.6391 0.6774 1.0644 -0.0171 -0.0425 -0.0515 128  MET A CE  
1527 N N   . PHE A 205 ? 0.5302 0.6103 0.9285 -0.0096 -0.0488 -0.0616 129  PHE A N   
1528 C CA  . PHE A 205 ? 0.5363 0.6211 0.9463 -0.0115 -0.0547 -0.0772 129  PHE A CA  
1529 C C   . PHE A 205 ? 0.6004 0.7036 1.0055 -0.0099 -0.0603 -0.0797 129  PHE A C   
1530 O O   . PHE A 205 ? 0.6054 0.7084 1.0254 -0.0144 -0.0651 -0.0849 129  PHE A O   
1531 C CB  . PHE A 205 ? 0.5714 0.6605 0.9831 -0.0086 -0.0551 -0.0933 129  PHE A CB  
1532 C CG  . PHE A 205 ? 0.5900 0.6610 1.0175 -0.0113 -0.0515 -0.0947 129  PHE A CG  
1533 C CD1 . PHE A 205 ? 0.6279 0.6851 1.0770 -0.0172 -0.0526 -0.0955 129  PHE A CD1 
1534 C CD2 . PHE A 205 ? 0.6230 0.6926 1.0463 -0.0071 -0.0462 -0.0937 129  PHE A CD2 
1535 C CE1 . PHE A 205 ? 0.6383 0.6804 1.1032 -0.0182 -0.0485 -0.0940 129  PHE A CE1 
1536 C CE2 . PHE A 205 ? 0.6595 0.7144 1.0992 -0.0085 -0.0430 -0.0936 129  PHE A CE2 
1537 C CZ  . PHE A 205 ? 0.6294 0.6707 1.0893 -0.0138 -0.0442 -0.0933 129  PHE A CZ  
1538 N N   . ALA A 206 ? 0.5501 0.6702 0.9366 -0.0031 -0.0594 -0.0738 130  ALA A N   
1539 C CA  . ALA A 206 ? 0.5430 0.6845 0.9236 0.0005  -0.0647 -0.0729 130  ALA A CA  
1540 C C   . ALA A 206 ? 0.5712 0.7053 0.9610 -0.0033 -0.0641 -0.0602 130  ALA A C   
1541 O O   . ALA A 206 ? 0.5761 0.7237 0.9727 -0.0037 -0.0705 -0.0634 130  ALA A O   
1542 C CB  . ALA A 206 ? 0.5566 0.7162 0.9167 0.0099  -0.0610 -0.0635 130  ALA A CB  
1543 N N   . SER A 207 ? 0.5083 0.6220 0.8992 -0.0057 -0.0568 -0.0472 131  SER A N   
1544 C CA  . SER A 207 ? 0.4997 0.6037 0.8978 -0.0083 -0.0542 -0.0363 131  SER A CA  
1545 C C   . SER A 207 ? 0.5418 0.6382 0.9594 -0.0147 -0.0574 -0.0435 131  SER A C   
1546 O O   . SER A 207 ? 0.5524 0.6543 0.9800 -0.0156 -0.0590 -0.0402 131  SER A O   
1547 C CB  . SER A 207 ? 0.5482 0.6332 0.9404 -0.0089 -0.0463 -0.0243 131  SER A CB  
1548 O OG  . SER A 207 ? 0.6732 0.7466 1.0711 -0.0110 -0.0432 -0.0169 131  SER A OG  
1549 N N   . ILE A 208 ? 0.4756 0.5602 0.9011 -0.0185 -0.0574 -0.0520 132  ILE A N   
1550 C CA  . ILE A 208 ? 0.4532 0.5289 0.9014 -0.0242 -0.0585 -0.0572 132  ILE A CA  
1551 C C   . ILE A 208 ? 0.4714 0.5632 0.9355 -0.0265 -0.0671 -0.0717 132  ILE A C   
1552 O O   . ILE A 208 ? 0.4579 0.5502 0.9424 -0.0306 -0.0684 -0.0704 132  ILE A O   
1553 C CB  . ILE A 208 ? 0.4851 0.5453 0.9392 -0.0261 -0.0556 -0.0609 132  ILE A CB  
1554 C CG1 . ILE A 208 ? 0.4870 0.5337 0.9276 -0.0245 -0.0492 -0.0473 132  ILE A CG1 
1555 C CG2 . ILE A 208 ? 0.4770 0.5288 0.9584 -0.0311 -0.0555 -0.0641 132  ILE A CG2 
1556 C CD1 . ILE A 208 ? 0.6213 0.6594 1.0628 -0.0242 -0.0474 -0.0497 132  ILE A CD1 
1557 N N   . PHE A 209 ? 0.4275 0.5338 0.8828 -0.0236 -0.0730 -0.0859 133  PHE A N   
1558 C CA  . PHE A 209 ? 0.4367 0.5606 0.9041 -0.0255 -0.0833 -0.1044 133  PHE A CA  
1559 C C   . PHE A 209 ? 0.4877 0.6330 0.9545 -0.0239 -0.0891 -0.0993 133  PHE A C   
1560 O O   . PHE A 209 ? 0.4891 0.6474 0.9755 -0.0280 -0.0983 -0.1118 133  PHE A O   
1561 C CB  . PHE A 209 ? 0.4730 0.6081 0.9257 -0.0209 -0.0871 -0.1217 133  PHE A CB  
1562 C CG  . PHE A 209 ? 0.5004 0.6181 0.9569 -0.0215 -0.0821 -0.1299 133  PHE A CG  
1563 C CD1 . PHE A 209 ? 0.5348 0.6289 1.0122 -0.0270 -0.0763 -0.1240 133  PHE A CD1 
1564 C CD2 . PHE A 209 ? 0.5425 0.6692 0.9823 -0.0152 -0.0824 -0.1424 133  PHE A CD2 
1565 C CE1 . PHE A 209 ? 0.5557 0.6354 1.0386 -0.0264 -0.0714 -0.1295 133  PHE A CE1 
1566 C CE2 . PHE A 209 ? 0.5866 0.6978 1.0323 -0.0149 -0.0768 -0.1492 133  PHE A CE2 
1567 C CZ  . PHE A 209 ? 0.5587 0.6463 1.0268 -0.0206 -0.0717 -0.1424 133  PHE A CZ  
1568 N N   . PHE A 210 ? 0.4342 0.5833 0.8826 -0.0181 -0.0840 -0.0810 134  PHE A N   
1569 C CA  . PHE A 210 ? 0.4311 0.6004 0.8811 -0.0152 -0.0882 -0.0731 134  PHE A CA  
1570 C C   . PHE A 210 ? 0.5041 0.6617 0.9750 -0.0198 -0.0835 -0.0613 134  PHE A C   
1571 O O   . PHE A 210 ? 0.5141 0.6887 0.9988 -0.0200 -0.0887 -0.0592 134  PHE A O   
1572 C CB  . PHE A 210 ? 0.4456 0.6263 0.8706 -0.0057 -0.0842 -0.0585 134  PHE A CB  
1573 C CG  . PHE A 210 ? 0.4668 0.6745 0.8743 0.0013  -0.0915 -0.0679 134  PHE A CG  
1574 C CD1 . PHE A 210 ? 0.5081 0.7441 0.9216 0.0021  -0.1044 -0.0802 134  PHE A CD1 
1575 C CD2 . PHE A 210 ? 0.4829 0.6903 0.8681 0.0079  -0.0853 -0.0635 134  PHE A CD2 
1576 C CE1 . PHE A 210 ? 0.5326 0.7963 0.9259 0.0100  -0.1115 -0.0897 134  PHE A CE1 
1577 C CE2 . PHE A 210 ? 0.5314 0.7656 0.8982 0.0161  -0.0904 -0.0709 134  PHE A CE2 
1578 C CZ  . PHE A 210 ? 0.5192 0.7818 0.8879 0.0177  -0.1036 -0.0844 134  PHE A CZ  
1579 N N   . ILE A 211 ? 0.4525 0.5837 0.9265 -0.0228 -0.0740 -0.0538 135  ILE A N   
1580 C CA  . ILE A 211 ? 0.4421 0.5619 0.9343 -0.0260 -0.0677 -0.0427 135  ILE A CA  
1581 C C   . ILE A 211 ? 0.5067 0.6328 1.0318 -0.0333 -0.0742 -0.0540 135  ILE A C   
1582 O O   . ILE A 211 ? 0.4949 0.6279 1.0409 -0.0351 -0.0738 -0.0474 135  ILE A O   
1583 C CB  . ILE A 211 ? 0.4672 0.5607 0.9511 -0.0262 -0.0571 -0.0334 135  ILE A CB  
1584 C CG1 . ILE A 211 ? 0.4632 0.5506 0.9227 -0.0203 -0.0503 -0.0208 135  ILE A CG1 
1585 C CG2 . ILE A 211 ? 0.4623 0.5451 0.9681 -0.0298 -0.0510 -0.0258 135  ILE A CG2 
1586 C CD1 . ILE A 211 ? 0.5166 0.5832 0.9619 -0.0203 -0.0441 -0.0175 135  ILE A CD1 
1587 N N   . THR A 212 ? 0.4957 0.6198 1.0275 -0.0371 -0.0798 -0.0715 136  THR A N   
1588 C CA  . THR A 212 ? 0.5158 0.6434 1.0814 -0.0449 -0.0867 -0.0869 136  THR A CA  
1589 C C   . THR A 212 ? 0.6189 0.7758 1.1953 -0.0459 -0.0997 -0.0971 136  THR A C   
1590 O O   . THR A 212 ? 0.6197 0.7828 1.2294 -0.0519 -0.1027 -0.0976 136  THR A O   
1591 C CB  . THR A 212 ? 0.5716 0.6890 1.1368 -0.0467 -0.0885 -0.1040 136  THR A CB  
1592 O OG1 . THR A 212 ? 0.5369 0.6316 1.0898 -0.0444 -0.0774 -0.0915 136  THR A OG1 
1593 C CG2 . THR A 212 ? 0.5516 0.6662 1.1563 -0.0552 -0.0933 -0.1198 136  THR A CG2 
1594 N N   . CYS A 213 ? 0.6030 0.7798 1.1521 -0.0394 -0.1068 -0.1029 137  CYS A N   
1595 C CA  . CYS A 213 ? 0.6201 0.8296 1.1726 -0.0379 -0.1201 -0.1109 137  CYS A CA  
1596 C C   . CYS A 213 ? 0.6783 0.8964 1.2466 -0.0376 -0.1176 -0.0922 137  CYS A C   
1597 O O   . CYS A 213 ? 0.6736 0.9112 1.2699 -0.0423 -0.1274 -0.0989 137  CYS A O   
1598 C CB  . CYS A 213 ? 0.6358 0.8635 1.1508 -0.0279 -0.1237 -0.1123 137  CYS A CB  
1599 S SG  . CYS A 213 ? 0.7058 0.9343 1.2045 -0.0269 -0.1295 -0.1390 137  CYS A SG  
1600 N N   . MET A 214 ? 0.6381 0.8414 1.1904 -0.0320 -0.1042 -0.0696 138  MET A N   
1601 C CA  . MET A 214 ? 0.6278 0.8348 1.1908 -0.0294 -0.0979 -0.0499 138  MET A CA  
1602 C C   . MET A 214 ? 0.6525 0.8521 1.2539 -0.0374 -0.0948 -0.0477 138  MET A C   
1603 O O   . MET A 214 ? 0.6510 0.8673 1.2744 -0.0375 -0.0966 -0.0399 138  MET A O   
1604 C CB  . MET A 214 ? 0.6545 0.8414 1.1917 -0.0224 -0.0832 -0.0309 138  MET A CB  
1605 C CG  . MET A 214 ? 0.7105 0.9115 1.2218 -0.0128 -0.0837 -0.0225 138  MET A CG  
1606 S SD  . MET A 214 ? 0.7837 1.0244 1.3076 -0.0076 -0.0943 -0.0176 138  MET A SD  
1607 C CE  . MET A 214 ? 0.7360 0.9695 1.2887 -0.0088 -0.0843 -0.0006 138  MET A CE  
1608 N N   . SER A 215 ? 0.5835 0.7597 1.1952 -0.0433 -0.0893 -0.0526 139  SER A N   
1609 C CA  . SER A 215 ? 0.5709 0.7388 1.2213 -0.0503 -0.0841 -0.0480 139  SER A CA  
1610 C C   . SER A 215 ? 0.5988 0.7865 1.2879 -0.0593 -0.0984 -0.0663 139  SER A C   
1611 O O   . SER A 215 ? 0.5948 0.7903 1.3206 -0.0637 -0.0972 -0.0593 139  SER A O   
1612 C CB  . SER A 215 ? 0.6169 0.7558 1.2661 -0.0523 -0.0736 -0.0455 139  SER A CB  
1613 O OG  . SER A 215 ? 0.7152 0.8383 1.3451 -0.0460 -0.0591 -0.0250 139  SER A OG  
1614 N N   . VAL A 216 ? 0.5387 0.7355 1.2204 -0.0616 -0.1117 -0.0902 140  VAL A N   
1615 C CA  . VAL A 216 ? 0.5352 0.7518 1.2502 -0.0702 -0.1279 -0.1136 140  VAL A CA  
1616 C C   . VAL A 216 ? 0.5815 0.8332 1.3035 -0.0681 -0.1393 -0.1111 140  VAL A C   
1617 O O   . VAL A 216 ? 0.5722 0.8396 1.3367 -0.0763 -0.1480 -0.1182 140  VAL A O   
1618 C CB  . VAL A 216 ? 0.5868 0.8038 1.2851 -0.0710 -0.1382 -0.1412 140  VAL A CB  
1619 C CG1 . VAL A 216 ? 0.5943 0.8341 1.3244 -0.0795 -0.1569 -0.1694 140  VAL A CG1 
1620 C CG2 . VAL A 216 ? 0.5825 0.7660 1.2809 -0.0730 -0.1268 -0.1425 140  VAL A CG2 
1621 N N   . ASP A 217 ? 0.5446 0.8088 1.2284 -0.0572 -0.1387 -0.0996 141  ASP A N   
1622 C CA  . ASP A 217 ? 0.5438 0.8425 1.2298 -0.0524 -0.1482 -0.0932 141  ASP A CA  
1623 C C   . ASP A 217 ? 0.5799 0.8794 1.2978 -0.0536 -0.1392 -0.0714 141  ASP A C   
1624 O O   . ASP A 217 ? 0.5837 0.9102 1.3352 -0.0578 -0.1502 -0.0748 141  ASP A O   
1625 C CB  . ASP A 217 ? 0.5690 0.8764 1.2082 -0.0392 -0.1460 -0.0822 141  ASP A CB  
1626 C CG  . ASP A 217 ? 0.7624 1.1122 1.3982 -0.0336 -0.1618 -0.0852 141  ASP A CG  
1627 O OD1 . ASP A 217 ? 0.7914 1.1623 1.4235 -0.0357 -0.1785 -0.1095 141  ASP A OD1 
1628 O OD2 . ASP A 217 ? 0.8737 1.2369 1.5105 -0.0264 -0.1576 -0.0636 141  ASP A OD2 
1629 N N   . ARG A 218 ? 0.5275 0.7986 1.2359 -0.0497 -0.1194 -0.0502 142  ARG A N   
1630 C CA  . ARG A 218 ? 0.5216 0.7894 1.2557 -0.0489 -0.1068 -0.0283 142  ARG A CA  
1631 C C   . ARG A 218 ? 0.6188 0.8887 1.4065 -0.0608 -0.1093 -0.0344 142  ARG A C   
1632 O O   . ARG A 218 ? 0.6341 0.9196 1.4553 -0.0617 -0.1074 -0.0223 142  ARG A O   
1633 C CB  . ARG A 218 ? 0.4910 0.7263 1.2002 -0.0426 -0.0860 -0.0100 142  ARG A CB  
1634 C CG  . ARG A 218 ? 0.6094 0.8447 1.2804 -0.0306 -0.0800 0.0032  142  ARG A CG  
1635 C CD  . ARG A 218 ? 0.6929 0.8969 1.3413 -0.0254 -0.0612 0.0175  142  ARG A CD  
1636 N NE  . ARG A 218 ? 0.6776 0.8820 1.3020 -0.0144 -0.0535 0.0319  142  ARG A NE  
1637 C CZ  . ARG A 218 ? 0.7500 0.9317 1.3574 -0.0083 -0.0374 0.0448  142  ARG A CZ  
1638 N NH1 . ARG A 218 ? 0.3519 0.5113 0.9599 -0.0111 -0.0275 0.0465  142  ARG A NH1 
1639 N NH2 . ARG A 218 ? 0.7146 0.8965 1.3047 0.0012  -0.0310 0.0558  142  ARG A NH2 
1640 N N   . TYR A 219 ? 0.5887 0.8435 1.3877 -0.0696 -0.1129 -0.0524 143  TYR A N   
1641 C CA  . TYR A 219 ? 0.5956 0.8502 1.4498 -0.0817 -0.1153 -0.0598 143  TYR A CA  
1642 C C   . TYR A 219 ? 0.6587 0.9485 1.5443 -0.0891 -0.1375 -0.0799 143  TYR A C   
1643 O O   . TYR A 219 ? 0.6518 0.9550 1.5879 -0.0963 -0.1392 -0.0758 143  TYR A O   
1644 C CB  . TYR A 219 ? 0.6198 0.8460 1.4769 -0.0877 -0.1115 -0.0726 143  TYR A CB  
1645 C CG  . TYR A 219 ? 0.6508 0.8775 1.5683 -0.1012 -0.1167 -0.0855 143  TYR A CG  
1646 C CD1 . TYR A 219 ? 0.6698 0.8889 1.6315 -0.1051 -0.1029 -0.0656 143  TYR A CD1 
1647 C CD2 . TYR A 219 ? 0.6752 0.9106 1.6074 -0.1097 -0.1348 -0.1177 143  TYR A CD2 
1648 C CE1 . TYR A 219 ? 0.6924 0.9120 1.7161 -0.1181 -0.1068 -0.0760 143  TYR A CE1 
1649 C CE2 . TYR A 219 ? 0.7002 0.9348 1.6929 -0.1230 -0.1399 -0.1315 143  TYR A CE2 
1650 C CZ  . TYR A 219 ? 0.8157 1.0419 1.8563 -0.1276 -0.1256 -0.1097 143  TYR A CZ  
1651 O OH  . TYR A 219 ? 0.8661 1.0907 1.9724 -0.1414 -0.1294 -0.1217 143  TYR A OH  
1652 N N   . GLN A 220 ? 0.6330 0.9395 1.4891 -0.0869 -0.1543 -0.1015 144  GLN A N   
1653 C CA  . GLN A 220 ? 0.6492 0.9929 1.5245 -0.0921 -0.1783 -0.1246 144  GLN A CA  
1654 C C   . GLN A 220 ? 0.7057 1.0829 1.5970 -0.0880 -0.1830 -0.1076 144  GLN A C   
1655 O O   . GLN A 220 ? 0.6973 1.1032 1.6314 -0.0964 -0.1990 -0.1196 144  GLN A O   
1656 C CB  . GLN A 220 ? 0.6790 1.0334 1.5060 -0.0858 -0.1911 -0.1452 144  GLN A CB  
1657 C CG  . GLN A 220 ? 0.9732 1.3466 1.8200 -0.0952 -0.2135 -0.1828 144  GLN A CG  
1658 C CD  . GLN A 220 ? 1.2366 1.6163 2.0335 -0.0878 -0.2225 -0.2035 144  GLN A CD  
1659 O OE1 . GLN A 220 ? 1.1607 1.5233 1.9118 -0.0776 -0.2101 -0.1910 144  GLN A OE1 
1660 N NE2 . GLN A 220 ? 1.2079 1.6134 2.0136 -0.0927 -0.2444 -0.2366 144  GLN A NE2 
1661 N N   . SER A 221 ? 0.6668 1.0402 1.5266 -0.0753 -0.1690 -0.0803 145  SER A N   
1662 C CA  . SER A 221 ? 0.6679 1.0694 1.5394 -0.0686 -0.1695 -0.0601 145  SER A CA  
1663 C C   . SER A 221 ? 0.7292 1.1254 1.6516 -0.0740 -0.1568 -0.0419 145  SER A C   
1664 O O   . SER A 221 ? 0.7361 1.1639 1.6938 -0.0751 -0.1645 -0.0354 145  SER A O   
1665 C CB  . SER A 221 ? 0.6966 1.0915 1.5186 -0.0528 -0.1570 -0.0385 145  SER A CB  
1666 O OG  . SER A 221 ? 0.7767 1.1331 1.5852 -0.0495 -0.1336 -0.0208 145  SER A OG  
1667 N N   . VAL A 222 ? 0.6767 1.0357 1.6033 -0.0765 -0.1373 -0.0325 146  VAL A N   
1668 C CA  . VAL A 222 ? 0.6732 1.0237 1.6442 -0.0800 -0.1213 -0.0128 146  VAL A CA  
1669 C C   . VAL A 222 ? 0.7586 1.1283 1.7963 -0.0954 -0.1348 -0.0274 146  VAL A C   
1670 O O   . VAL A 222 ? 0.7626 1.1469 1.8460 -0.0975 -0.1294 -0.0113 146  VAL A O   
1671 C CB  . VAL A 222 ? 0.7144 1.0227 1.6668 -0.0774 -0.0986 -0.0004 146  VAL A CB  
1672 C CG1 . VAL A 222 ? 0.7113 1.0081 1.7176 -0.0870 -0.0884 0.0058  146  VAL A CG1 
1673 C CG2 . VAL A 222 ? 0.7051 1.0020 1.6203 -0.0627 -0.0797 0.0250  146  VAL A CG2 
1674 N N   . ILE A 223 ? 0.7334 1.1043 1.7785 -0.1058 -0.1525 -0.0584 147  ILE A N   
1675 C CA  . ILE A 223 ? 0.7460 1.1334 1.8562 -0.1217 -0.1671 -0.0772 147  ILE A CA  
1676 C C   . ILE A 223 ? 0.8243 1.2606 1.9495 -0.1234 -0.1927 -0.0906 147  ILE A C   
1677 O O   . ILE A 223 ? 0.8323 1.2918 2.0169 -0.1318 -0.1986 -0.0875 147  ILE A O   
1678 C CB  . ILE A 223 ? 0.7942 1.1583 1.9110 -0.1322 -0.1732 -0.1059 147  ILE A CB  
1679 C CG1 . ILE A 223 ? 0.7889 1.1077 1.8821 -0.1279 -0.1491 -0.0913 147  ILE A CG1 
1680 C CG2 . ILE A 223 ? 0.8241 1.1998 2.0159 -0.1499 -0.1857 -0.1250 147  ILE A CG2 
1681 C CD1 . ILE A 223 ? 0.8667 1.1665 1.9937 -0.1275 -0.1237 -0.0590 147  ILE A CD1 
1682 N N   . TYR A 224 ? 0.7865 1.2402 1.8587 -0.1142 -0.2064 -0.1017 148  TYR A N   
1683 C CA  . TYR A 224 ? 1.1715 1.6743 2.2464 -0.1126 -0.2315 -0.1135 148  TYR A CA  
1684 C C   . TYR A 224 ? 1.2604 1.7939 2.3760 -0.1104 -0.2302 -0.0888 148  TYR A C   
1685 O O   . TYR A 224 ? 0.6546 1.1856 1.7486 -0.0972 -0.2138 -0.0585 148  TYR A O   
1686 C CB  . TYR A 224 ? 1.1900 1.7013 2.1940 -0.0975 -0.2363 -0.1145 148  TYR A CB  
1687 N N   . ALA A 236 ? 1.0268 1.5507 1.4824 0.0032  -0.2556 -0.2388 160  ALA A N   
1688 C CA  . ALA A 236 ? 1.0004 1.4951 1.4452 0.0083  -0.2325 -0.2020 160  ALA A CA  
1689 C C   . ALA A 236 ? 1.0523 1.5505 1.4488 0.0238  -0.2216 -0.1908 160  ALA A C   
1690 O O   . ALA A 236 ? 1.0252 1.4892 1.4136 0.0247  -0.2025 -0.1734 160  ALA A O   
1691 C CB  . ALA A 236 ? 0.9965 1.5057 1.4567 0.0110  -0.2312 -0.1719 160  ALA A CB  
1692 N N   . SER A 237 ? 1.0354 1.5768 1.4009 0.0363  -0.2338 -0.2004 161  SER A N   
1693 C CA  . SER A 237 ? 1.0416 1.5948 1.3608 0.0530  -0.2244 -0.1906 161  SER A CA  
1694 C C   . SER A 237 ? 1.0848 1.6175 1.3905 0.0509  -0.2206 -0.2186 161  SER A C   
1695 O O   . SER A 237 ? 1.0884 1.6276 1.3582 0.0638  -0.2115 -0.2141 161  SER A O   
1696 C CB  . SER A 237 ? 1.1134 1.7244 1.4056 0.0681  -0.2395 -0.1904 161  SER A CB  
1697 O OG  . SER A 237 ? 1.2535 1.8910 1.5459 0.0644  -0.2618 -0.2311 161  SER A OG  
1698 N N   . TYR A 238 ? 1.0252 1.5333 1.3633 0.0349  -0.2267 -0.2460 162  TYR A N   
1699 C CA  . TYR A 238 ? 1.0252 1.5083 1.3633 0.0299  -0.2235 -0.2748 162  TYR A CA  
1700 C C   . TYR A 238 ? 1.0172 1.4481 1.3772 0.0203  -0.2047 -0.2602 162  TYR A C   
1701 O O   . TYR A 238 ? 1.0170 1.4263 1.3643 0.0227  -0.1933 -0.2658 162  TYR A O   
1702 C CB  . TYR A 238 ? 1.0626 1.5563 1.4270 0.0188  -0.2444 -0.3166 162  TYR A CB  
1703 N N   . ILE A 239 ? 0.9269 1.3400 1.3192 0.0103  -0.2014 -0.2412 163  ILE A N   
1704 C CA  . ILE A 239 ? 0.8873 1.2549 1.3012 0.0014  -0.1853 -0.2264 163  ILE A CA  
1705 C C   . ILE A 239 ? 0.8942 1.2472 1.2800 0.0109  -0.1667 -0.1977 163  ILE A C   
1706 O O   . ILE A 239 ? 0.8873 1.2125 1.2704 0.0095  -0.1556 -0.1998 163  ILE A O   
1707 C CB  . ILE A 239 ? 0.9097 1.2684 1.3629 -0.0096 -0.1869 -0.2137 163  ILE A CB  
1708 C CG1 . ILE A 239 ? 0.9322 1.2963 1.4234 -0.0222 -0.2027 -0.2436 163  ILE A CG1 
1709 C CG2 . ILE A 239 ? 0.8918 1.2087 1.3581 -0.0150 -0.1687 -0.1920 163  ILE A CG2 
1710 C CD1 . ILE A 239 ? 1.0554 1.4437 1.5735 -0.0268 -0.2144 -0.2377 163  ILE A CD1 
1711 N N   . VAL A 240 ? 0.8220 1.1939 1.1904 0.0205  -0.1634 -0.1710 164  VAL A N   
1712 C CA  . VAL A 240 ? 0.7986 1.1572 1.1458 0.0288  -0.1459 -0.1432 164  VAL A CA  
1713 C C   . VAL A 240 ? 0.8347 1.1918 1.1551 0.0363  -0.1395 -0.1535 164  VAL A C   
1714 O O   . VAL A 240 ? 0.8158 1.1411 1.1397 0.0328  -0.1266 -0.1470 164  VAL A O   
1715 C CB  . VAL A 240 ? 0.8482 1.2294 1.1831 0.0393  -0.1430 -0.1136 164  VAL A CB  
1716 C CG1 . VAL A 240 ? 0.8697 1.2985 1.1937 0.0475  -0.1594 -0.1214 164  VAL A CG1 
1717 C CG2 . VAL A 240 ? 0.8439 1.2173 1.1556 0.0493  -0.1263 -0.0900 164  VAL A CG2 
1718 N N   . PRO A 241 ? 0.7984 1.1879 1.0939 0.0461  -0.1480 -0.1714 165  PRO A N   
1719 C CA  . PRO A 241 ? 0.7988 1.1839 1.0712 0.0537  -0.1389 -0.1797 165  PRO A CA  
1720 C C   . PRO A 241 ? 0.8272 1.1790 1.1189 0.0432  -0.1364 -0.2025 165  PRO A C   
1721 O O   . PRO A 241 ? 0.8174 1.1516 1.1007 0.0465  -0.1232 -0.1981 165  PRO A O   
1722 C CB  . PRO A 241 ? 0.8541 1.2835 1.0970 0.0664  -0.1504 -0.1972 165  PRO A CB  
1723 C CG  . PRO A 241 ? 0.9212 1.3726 1.1799 0.0607  -0.1696 -0.2097 165  PRO A CG  
1724 C CD  . PRO A 241 ? 0.8374 1.2711 1.1225 0.0524  -0.1654 -0.1833 165  PRO A CD  
1725 N N   . LEU A 242 ? 0.7759 1.1189 1.0973 0.0307  -0.1482 -0.2247 166  LEU A N   
1726 C CA  . LEU A 242 ? 0.7694 1.0797 1.1156 0.0205  -0.1453 -0.2440 166  LEU A CA  
1727 C C   . LEU A 242 ? 0.7944 1.0672 1.1573 0.0140  -0.1303 -0.2198 166  LEU A C   
1728 O O   . LEU A 242 ? 0.7841 1.0332 1.1525 0.0125  -0.1215 -0.2252 166  LEU A O   
1729 C CB  . LEU A 242 ? 0.7765 1.0868 1.1565 0.0083  -0.1605 -0.2701 166  LEU A CB  
1730 C CG  . LEU A 242 ? 0.8692 1.1810 1.2528 0.0075  -0.1680 -0.3104 166  LEU A CG  
1731 C CD1 . LEU A 242 ? 0.9351 1.2652 1.3422 -0.0008 -0.1879 -0.3377 166  LEU A CD1 
1732 C CD2 . LEU A 242 ? 0.8663 1.1383 1.2705 0.0019  -0.1558 -0.3181 166  LEU A CD2 
1733 N N   . VAL A 243 ? 0.7395 1.0083 1.1101 0.0109  -0.1276 -0.1937 167  VAL A N   
1734 C CA  . VAL A 243 ? 0.7127 0.9495 1.0964 0.0053  -0.1150 -0.1711 167  VAL A CA  
1735 C C   . VAL A 243 ? 0.7684 0.9978 1.1290 0.0135  -0.1016 -0.1557 167  VAL A C   
1736 O O   . VAL A 243 ? 0.7564 0.9587 1.1264 0.0094  -0.0923 -0.1490 167  VAL A O   
1737 C CB  . VAL A 243 ? 0.7459 0.9835 1.1405 0.0019  -0.1154 -0.1497 167  VAL A CB  
1738 C CG1 . VAL A 243 ? 0.7223 0.9292 1.1245 -0.0020 -0.1024 -0.1281 167  VAL A CG1 
1739 C CG2 . VAL A 243 ? 0.7467 0.9903 1.1707 -0.0071 -0.1275 -0.1639 167  VAL A CG2 
1740 N N   . TRP A 244 ? 0.7397 0.9952 1.0721 0.0253  -0.1006 -0.1499 168  TRP A N   
1741 C CA  . TRP A 244 ? 0.7317 0.9845 1.0451 0.0336  -0.0875 -0.1348 168  TRP A CA  
1742 C C   . TRP A 244 ? 0.8084 1.0572 1.1165 0.0367  -0.0847 -0.1553 168  TRP A C   
1743 O O   . TRP A 244 ? 0.7930 1.0251 1.1014 0.0376  -0.0733 -0.1460 168  TRP A O   
1744 C CB  . TRP A 244 ? 0.7181 1.0010 1.0066 0.0462  -0.0855 -0.1176 168  TRP A CB  
1745 C CG  . TRP A 244 ? 0.7089 0.9889 1.0048 0.0445  -0.0830 -0.0921 168  TRP A CG  
1746 C CD1 . TRP A 244 ? 0.7459 1.0440 1.0455 0.0449  -0.0921 -0.0884 168  TRP A CD1 
1747 C CD2 . TRP A 244 ? 0.6862 0.9426 0.9895 0.0418  -0.0709 -0.0686 168  TRP A CD2 
1748 N NE1 . TRP A 244 ? 0.7191 1.0053 1.0274 0.0435  -0.0848 -0.0633 168  TRP A NE1 
1749 C CE2 . TRP A 244 ? 0.7232 0.9833 1.0333 0.0414  -0.0720 -0.0520 168  TRP A CE2 
1750 C CE3 . TRP A 244 ? 0.6936 0.9272 0.9998 0.0398  -0.0595 -0.0607 168  TRP A CE3 
1751 C CZ2 . TRP A 244 ? 0.6996 0.9393 1.0179 0.0391  -0.0618 -0.0300 168  TRP A CZ2 
1752 C CZ3 . TRP A 244 ? 0.6987 0.9143 1.0132 0.0368  -0.0511 -0.0390 168  TRP A CZ3 
1753 C CH2 . TRP A 244 ? 0.7004 0.9178 1.0204 0.0364  -0.0521 -0.0251 168  TRP A CH2 
1754 N N   . CYS A 245 ? 0.8053 1.0690 1.1114 0.0377  -0.0953 -0.1843 169  CYS A N   
1755 C CA  . CYS A 245 ? 0.8344 1.0936 1.1374 0.0410  -0.0927 -0.2077 169  CYS A CA  
1756 C C   . CYS A 245 ? 0.8600 1.0821 1.1939 0.0301  -0.0879 -0.2119 169  CYS A C   
1757 O O   . CYS A 245 ? 0.8533 1.0630 1.1862 0.0337  -0.0777 -0.2126 169  CYS A O   
1758 C CB  . CYS A 245 ? 0.8799 1.1633 1.1752 0.0440  -0.1067 -0.2404 169  CYS A CB  
1759 S SG  . CYS A 245 ? 0.9646 1.2377 1.2620 0.0468  -0.1041 -0.2754 169  CYS A SG  
1760 N N   . MET A 246 ? 0.8025 1.0090 1.1645 0.0179  -0.0942 -0.2122 170  MET A N   
1761 C CA  . MET A 246 ? 0.7853 0.9587 1.1782 0.0081  -0.0895 -0.2118 170  MET A CA  
1762 C C   . MET A 246 ? 0.7780 0.9337 1.1685 0.0085  -0.0770 -0.1840 170  MET A C   
1763 O O   . MET A 246 ? 0.7449 0.8790 1.1505 0.0061  -0.0702 -0.1834 170  MET A O   
1764 C CB  . MET A 246 ? 0.8121 0.9779 1.2339 -0.0034 -0.0978 -0.2138 170  MET A CB  
1765 C CG  . MET A 246 ? 0.8868 1.0592 1.3272 -0.0080 -0.1095 -0.2458 170  MET A CG  
1766 S SD  . MET A 246 ? 0.9359 1.0994 1.4177 -0.0222 -0.1173 -0.2443 170  MET A SD  
1767 C CE  . MET A 246 ? 0.8920 1.0896 1.3536 -0.0187 -0.1274 -0.2340 170  MET A CE  
1768 N N   . ALA A 247 ? 0.7238 0.8894 1.0971 0.0119  -0.0743 -0.1613 171  ALA A N   
1769 C CA  . ALA A 247 ? 0.7048 0.8566 1.0753 0.0121  -0.0640 -0.1365 171  ALA A CA  
1770 C C   . ALA A 247 ? 0.7832 0.9393 1.1399 0.0208  -0.0549 -0.1352 171  ALA A C   
1771 O O   . ALA A 247 ? 0.7661 0.9058 1.1307 0.0191  -0.0472 -0.1239 171  ALA A O   
1772 C CB  . ALA A 247 ? 0.7006 0.8617 1.0605 0.0133  -0.0638 -0.1159 171  ALA A CB  
1773 N N   . CYS A 248 ? 0.7731 0.9532 1.1096 0.0305  -0.0558 -0.1470 172  CYS A N   
1774 C CA  . CYS A 248 ? 0.7879 0.9767 1.1101 0.0408  -0.0461 -0.1470 172  CYS A CA  
1775 C C   . CYS A 248 ? 0.8172 0.9885 1.1558 0.0391  -0.0429 -0.1636 172  CYS A C   
1776 O O   . CYS A 248 ? 0.8147 0.9787 1.1563 0.0424  -0.0327 -0.1544 172  CYS A O   
1777 C CB  . CYS A 248 ? 0.8295 1.0510 1.1241 0.0530  -0.0484 -0.1568 172  CYS A CB  
1778 S SG  . CYS A 248 ? 0.8842 1.1301 1.1587 0.0594  -0.0476 -0.1299 172  CYS A SG  
1779 N N   . LEU A 249 ? 0.7637 0.9289 1.1160 0.0341  -0.0515 -0.1882 173  LEU A N   
1780 C CA  . LEU A 249 ? 0.7607 0.9076 1.1339 0.0322  -0.0490 -0.2067 173  LEU A CA  
1781 C C   . LEU A 249 ? 0.7605 0.8796 1.1598 0.0242  -0.0438 -0.1900 173  LEU A C   
1782 O O   . LEU A 249 ? 0.7636 0.8711 1.1737 0.0270  -0.0357 -0.1907 173  LEU A O   
1783 C CB  . LEU A 249 ? 0.7774 0.9248 1.1636 0.0272  -0.0605 -0.2359 173  LEU A CB  
1784 C CG  . LEU A 249 ? 0.8708 1.0358 1.2418 0.0361  -0.0635 -0.2669 173  LEU A CG  
1785 C CD1 . LEU A 249 ? 0.8902 1.0900 1.2232 0.0464  -0.0668 -0.2642 173  LEU A CD1 
1786 C CD2 . LEU A 249 ? 0.9146 1.0741 1.3084 0.0280  -0.0753 -0.2961 173  LEU A CD2 
1787 N N   . SER A 250 ? 0.6689 0.7795 1.0771 0.0154  -0.0482 -0.1744 174  SER A N   
1788 C CA  . SER A 250 ? 0.6356 0.7234 1.0645 0.0085  -0.0446 -0.1578 174  SER A CA  
1789 C C   . SER A 250 ? 0.6578 0.7445 1.0780 0.0118  -0.0364 -0.1359 174  SER A C   
1790 O O   . SER A 250 ? 0.6343 0.7051 1.0700 0.0082  -0.0333 -0.1245 174  SER A O   
1791 C CB  . SER A 250 ? 0.6610 0.7435 1.0980 -0.0001 -0.0509 -0.1487 174  SER A CB  
1792 O OG  . SER A 250 ? 0.7563 0.8405 1.2073 -0.0046 -0.0588 -0.1673 174  SER A OG  
1793 N N   . SER A 251 ? 0.6279 0.7328 1.0252 0.0188  -0.0332 -0.1293 175  SER A N   
1794 C CA  . SER A 251 ? 0.6142 0.7201 1.0071 0.0214  -0.0255 -0.1090 175  SER A CA  
1795 C C   . SER A 251 ? 0.6772 0.7919 1.0668 0.0309  -0.0165 -0.1135 175  SER A C   
1796 O O   . SER A 251 ? 0.6720 0.7922 1.0590 0.0341  -0.0094 -0.0973 175  SER A O   
1797 C CB  . SER A 251 ? 0.6415 0.7598 1.0176 0.0223  -0.0257 -0.0934 175  SER A CB  
1798 O OG  . SER A 251 ? 0.7829 0.9239 1.1391 0.0306  -0.0260 -0.1010 175  SER A OG  
1799 N N   . LEU A 252 ? 0.6600 0.7754 1.0524 0.0353  -0.0163 -0.1359 176  LEU A N   
1800 C CA  . LEU A 252 ? 0.6781 0.8006 1.0684 0.0456  -0.0067 -0.1433 176  LEU A CA  
1801 C C   . LEU A 252 ? 0.7283 0.8352 1.1428 0.0442  0.0000  -0.1326 176  LEU A C   
1802 O O   . LEU A 252 ? 0.7300 0.8461 1.1425 0.0513  0.0094  -0.1228 176  LEU A O   
1803 C CB  . LEU A 252 ? 0.7014 0.8280 1.0881 0.0508  -0.0088 -0.1736 176  LEU A CB  
1804 C CG  . LEU A 252 ? 0.7819 0.9347 1.1383 0.0585  -0.0120 -0.1843 176  LEU A CG  
1805 C CD1 . LEU A 252 ? 0.8093 0.9638 1.1653 0.0597  -0.0192 -0.2175 176  LEU A CD1 
1806 C CD2 . LEU A 252 ? 0.8335 1.0070 1.1694 0.0719  0.0000  -0.1747 176  LEU A CD2 
1807 N N   . PRO A 253 ? 0.6626 0.7485 1.1005 0.0358  -0.0042 -0.1309 177  PRO A N   
1808 C CA  . PRO A 253 ? 0.6409 0.7167 1.1002 0.0358  0.0013  -0.1176 177  PRO A CA  
1809 C C   . PRO A 253 ? 0.6405 0.7221 1.0967 0.0331  0.0022  -0.0930 177  PRO A C   
1810 O O   . PRO A 253 ? 0.6343 0.7167 1.1041 0.0358  0.0077  -0.0826 177  PRO A O   
1811 C CB  . PRO A 253 ? 0.6598 0.7155 1.1409 0.0281  -0.0041 -0.1192 177  PRO A CB  
1812 C CG  . PRO A 253 ? 0.7283 0.7827 1.2048 0.0256  -0.0103 -0.1400 177  PRO A CG  
1813 C CD  . PRO A 253 ? 0.6725 0.7455 1.1203 0.0271  -0.0133 -0.1389 177  PRO A CD  
1814 N N   . THR A 254 ? 0.5733 0.6595 1.0142 0.0281  -0.0031 -0.0845 178  THR A N   
1815 C CA  . THR A 254 ? 0.5532 0.6441 0.9925 0.0250  -0.0023 -0.0639 178  THR A CA  
1816 C C   . THR A 254 ? 0.6006 0.7098 1.0327 0.0339  0.0074  -0.0590 178  THR A C   
1817 O O   . THR A 254 ? 0.5867 0.6996 1.0314 0.0344  0.0123  -0.0454 178  THR A O   
1818 C CB  . THR A 254 ? 0.6283 0.7171 1.0554 0.0182  -0.0092 -0.0579 178  THR A CB  
1819 O OG1 . THR A 254 ? 0.6668 0.7401 1.1017 0.0112  -0.0164 -0.0609 178  THR A OG1 
1820 C CG2 . THR A 254 ? 0.5758 0.6672 1.0039 0.0148  -0.0082 -0.0397 178  THR A CG2 
1821 N N   . PHE A 255 ? 0.5703 0.6929 0.9829 0.0413  0.0102  -0.0697 179  PHE A N   
1822 C CA  . PHE A 255 ? 0.5832 0.7264 0.9849 0.0520  0.0209  -0.0647 179  PHE A CA  
1823 C C   . PHE A 255 ? 0.6417 0.7875 1.0564 0.0597  0.0306  -0.0678 179  PHE A C   
1824 O O   . PHE A 255 ? 0.6409 0.7997 1.0593 0.0653  0.0405  -0.0537 179  PHE A O   
1825 C CB  . PHE A 255 ? 0.6261 0.7852 1.0010 0.0598  0.0204  -0.0780 179  PHE A CB  
1826 C CG  . PHE A 255 ? 0.6582 0.8418 1.0182 0.0727  0.0325  -0.0698 179  PHE A CG  
1827 C CD1 . PHE A 255 ? 0.6872 0.8823 1.0425 0.0734  0.0369  -0.0472 179  PHE A CD1 
1828 C CD2 . PHE A 255 ? 0.7001 0.8950 1.0524 0.0849  0.0410  -0.0838 179  PHE A CD2 
1829 C CE1 . PHE A 255 ? 0.7124 0.9314 1.0561 0.0863  0.0499  -0.0362 179  PHE A CE1 
1830 C CE2 . PHE A 255 ? 0.7536 0.9730 1.0912 0.0984  0.0540  -0.0741 179  PHE A CE2 
1831 C CZ  . PHE A 255 ? 0.7226 0.9547 1.0563 0.0991  0.0586  -0.0491 179  PHE A CZ  
1832 N N   . TYR A 256 ? 0.6098 0.7437 1.0338 0.0605  0.0290  -0.0855 180  TYR A N   
1833 C CA  . TYR A 256 ? 0.6232 0.7581 1.0614 0.0690  0.0391  -0.0899 180  TYR A CA  
1834 C C   . TYR A 256 ? 0.6400 0.7686 1.1060 0.0644  0.0406  -0.0706 180  TYR A C   
1835 O O   . TYR A 256 ? 0.6412 0.7804 1.1176 0.0720  0.0512  -0.0629 180  TYR A O   
1836 C CB  . TYR A 256 ? 0.6696 0.7917 1.1131 0.0712  0.0372  -0.1156 180  TYR A CB  
1837 C CG  . TYR A 256 ? 0.7310 0.8540 1.1882 0.0821  0.0493  -0.1231 180  TYR A CG  
1838 C CD1 . TYR A 256 ? 0.7878 0.9288 1.2271 0.0959  0.0602  -0.1332 180  TYR A CD1 
1839 C CD2 . TYR A 256 ? 0.7402 0.8474 1.2282 0.0800  0.0507  -0.1187 180  TYR A CD2 
1840 C CE1 . TYR A 256 ? 0.8319 0.9738 1.2842 0.1071  0.0731  -0.1400 180  TYR A CE1 
1841 C CE2 . TYR A 256 ? 0.7718 0.8798 1.2753 0.0909  0.0630  -0.1241 180  TYR A CE2 
1842 C CZ  . TYR A 256 ? 0.9059 1.0304 1.3917 0.1044  0.0745  -0.1355 180  TYR A CZ  
1843 O OH  . TYR A 256 ? 0.9269 1.0521 1.4282 0.1164  0.0881  -0.1414 180  TYR A OH  
1844 N N   . PHE A 257 ? 0.5764 0.6905 1.0538 0.0528  0.0300  -0.0624 181  PHE A N   
1845 C CA  . PHE A 257 ? 0.5594 0.6695 1.0622 0.0487  0.0289  -0.0464 181  PHE A CA  
1846 C C   . PHE A 257 ? 0.5995 0.7158 1.1057 0.0409  0.0246  -0.0263 181  PHE A C   
1847 O O   . PHE A 257 ? 0.5889 0.7103 1.1166 0.0405  0.0263  -0.0138 181  PHE A O   
1848 C CB  . PHE A 257 ? 0.5706 0.6619 1.0873 0.0430  0.0210  -0.0503 181  PHE A CB  
1849 C CG  . PHE A 257 ? 0.5963 0.6789 1.1233 0.0501  0.0265  -0.0672 181  PHE A CG  
1850 C CD1 . PHE A 257 ? 0.6350 0.7206 1.1824 0.0587  0.0360  -0.0652 181  PHE A CD1 
1851 C CD2 . PHE A 257 ? 0.6237 0.6947 1.1434 0.0481  0.0224  -0.0855 181  PHE A CD2 
1852 C CE1 . PHE A 257 ? 0.6636 0.7388 1.2229 0.0657  0.0422  -0.0822 181  PHE A CE1 
1853 C CE2 . PHE A 257 ? 0.6722 0.7334 1.2053 0.0539  0.0275  -0.1033 181  PHE A CE2 
1854 C CZ  . PHE A 257 ? 0.6567 0.7189 1.2092 0.0629  0.0377  -0.1019 181  PHE A CZ  
1855 N N   . ARG A 258 ? 0.5565 0.6723 1.0455 0.0347  0.0191  -0.0235 182  ARG A N   
1856 C CA  . ARG A 258 ? 0.5534 0.6723 1.0493 0.0268  0.0153  -0.0068 182  ARG A CA  
1857 C C   . ARG A 258 ? 0.6303 0.7663 1.1394 0.0315  0.0255  0.0064  182  ARG A C   
1858 O O   . ARG A 258 ? 0.6490 0.7975 1.1467 0.0402  0.0358  0.0059  182  ARG A O   
1859 C CB  . ARG A 258 ? 0.5414 0.6570 1.0182 0.0215  0.0106  -0.0060 182  ARG A CB  
1860 C CG  . ARG A 258 ? 0.5957 0.6948 1.0670 0.0130  -0.0009 -0.0107 182  ARG A CG  
1861 C CD  . ARG A 258 ? 0.5977 0.6912 1.0813 0.0041  -0.0085 -0.0005 182  ARG A CD  
1862 N NE  . ARG A 258 ? 0.5990 0.6791 1.0817 -0.0003 -0.0172 -0.0050 182  ARG A NE  
1863 C CZ  . ARG A 258 ? 0.8098 0.8857 1.3006 -0.0063 -0.0251 0.0012  182  ARG A CZ  
1864 N NH1 . ARG A 258 ? 0.7197 0.8027 1.2222 -0.0103 -0.0270 0.0099  182  ARG A NH1 
1865 N NH2 . ARG A 258 ? 0.6455 0.7115 1.1337 -0.0081 -0.0311 -0.0011 182  ARG A NH2 
1866 N N   . ASP A 259 ? 0.5713 0.7101 1.1055 0.0263  0.0228  0.0186  183  ASP A N   
1867 C CA  . ASP A 259 ? 0.5691 0.7249 1.1230 0.0293  0.0323  0.0330  183  ASP A CA  
1868 C C   . ASP A 259 ? 0.5888 0.7457 1.1691 0.0187  0.0235  0.0446  183  ASP A C   
1869 O O   . ASP A 259 ? 0.5641 0.7111 1.1474 0.0121  0.0111  0.0409  183  ASP A O   
1870 C CB  . ASP A 259 ? 0.6093 0.7764 1.1728 0.0417  0.0448  0.0315  183  ASP A CB  
1871 C CG  . ASP A 259 ? 0.7951 0.9824 1.3661 0.0495  0.0601  0.0442  183  ASP A CG  
1872 O OD1 . ASP A 259 ? 0.7986 0.9905 1.3589 0.0482  0.0631  0.0512  183  ASP A OD1 
1873 O OD2 . ASP A 259 ? 0.9049 1.1038 1.4939 0.0576  0.0701  0.0488  183  ASP A OD2 
1874 N N   . VAL A 260 ? 0.5443 0.7146 1.1447 0.0172  0.0298  0.0587  184  VAL A N   
1875 C CA  . VAL A 260 ? 0.5289 0.7026 1.1585 0.0064  0.0207  0.0680  184  VAL A CA  
1876 C C   . VAL A 260 ? 0.5623 0.7478 1.2187 0.0102  0.0213  0.0727  184  VAL A C   
1877 O O   . VAL A 260 ? 0.5543 0.7531 1.2209 0.0205  0.0355  0.0784  184  VAL A O   
1878 C CB  . VAL A 260 ? 0.5765 0.7583 1.2231 0.0017  0.0269  0.0813  184  VAL A CB  
1879 C CG1 . VAL A 260 ? 0.5694 0.7587 1.2541 -0.0089 0.0183  0.0896  184  VAL A CG1 
1880 C CG2 . VAL A 260 ? 0.5749 0.7428 1.1992 -0.0035 0.0234  0.0773  184  VAL A CG2 
1881 N N   . ARG A 261 ? 0.5093 0.6910 1.1753 0.0032  0.0062  0.0706  185  ARG A N   
1882 C CA  . ARG A 261 ? 0.5052 0.6994 1.1987 0.0064  0.0041  0.0768  185  ARG A CA  
1883 C C   . ARG A 261 ? 0.5745 0.7774 1.2936 -0.0057 -0.0111 0.0832  185  ARG A C   
1884 O O   . ARG A 261 ? 0.5748 0.7674 1.2814 -0.0156 -0.0241 0.0771  185  ARG A O   
1885 C CB  . ARG A 261 ? 0.4859 0.6701 1.1668 0.0127  0.0009  0.0686  185  ARG A CB  
1886 C CG  . ARG A 261 ? 0.6122 0.7905 1.2762 0.0253  0.0159  0.0601  185  ARG A CG  
1887 C CD  . ARG A 261 ? 0.6620 0.8562 1.3477 0.0368  0.0315  0.0668  185  ARG A CD  
1888 N NE  . ARG A 261 ? 0.6969 0.8857 1.3614 0.0487  0.0456  0.0550  185  ARG A NE  
1889 C CZ  . ARG A 261 ? 0.7958 0.9903 1.4440 0.0536  0.0571  0.0535  185  ARG A CZ  
1890 N NH1 . ARG A 261 ? 0.6777 0.8821 1.3320 0.0477  0.0580  0.0655  185  ARG A NH1 
1891 N NH2 . ARG A 261 ? 0.4763 0.6676 1.1031 0.0649  0.0678  0.0401  185  ARG A NH2 
1892 N N   . THR A 262 ? 0.5471 0.7701 1.3028 -0.0045 -0.0095 0.0947  186  THR A N   
1893 C CA  . THR A 262 ? 0.5555 0.7917 1.3412 -0.0159 -0.0249 0.1002  186  THR A CA  
1894 C C   . THR A 262 ? 0.6236 0.8611 1.4067 -0.0166 -0.0417 0.0972  186  THR A C   
1895 O O   . THR A 262 ? 0.6287 0.8700 1.4148 -0.0060 -0.0370 0.1006  186  THR A O   
1896 C CB  . THR A 262 ? 0.7049 0.9652 1.5348 -0.0139 -0.0160 0.1152  186  THR A CB  
1897 O OG1 . THR A 262 ? 0.7808 1.0494 1.6177 -0.0002 -0.0063 0.1201  186  THR A OG1 
1898 C CG2 . THR A 262 ? 0.6774 0.9396 1.5138 -0.0130 0.0013  0.1222  186  THR A CG2 
1899 N N   . ILE A 263 ? 0.5857 0.8208 1.3635 -0.0280 -0.0604 0.0911  187  ILE A N   
1900 C CA  . ILE A 263 ? 0.5883 0.8289 1.3624 -0.0285 -0.0775 0.0899  187  ILE A CA  
1901 C C   . ILE A 263 ? 0.6556 0.9213 1.4681 -0.0371 -0.0918 0.0958  187  ILE A C   
1902 O O   . ILE A 263 ? 0.6461 0.9117 1.4615 -0.0497 -0.1044 0.0884  187  ILE A O   
1903 C CB  . ILE A 263 ? 0.6293 0.8494 1.3632 -0.0326 -0.0870 0.0773  187  ILE A CB  
1904 C CG1 . ILE A 263 ? 0.6292 0.8299 1.3336 -0.0224 -0.0743 0.0738  187  ILE A CG1 
1905 C CG2 . ILE A 263 ? 0.6526 0.8827 1.3832 -0.0358 -0.1076 0.0762  187  ILE A CG2 
1906 C CD1 . ILE A 263 ? 0.7083 0.8929 1.3945 -0.0223 -0.0611 0.0674  187  ILE A CD1 
1907 N N   . GLU A 264 ? 0.6341 0.9216 1.4795 -0.0302 -0.0886 0.1089  188  GLU A N   
1908 C CA  . GLU A 264 ? 0.6428 0.9595 1.5327 -0.0366 -0.1006 0.1172  188  GLU A CA  
1909 C C   . GLU A 264 ? 0.7114 1.0388 1.5975 -0.0453 -0.1274 0.1106  188  GLU A C   
1910 O O   . GLU A 264 ? 0.7082 1.0538 1.6245 -0.0567 -0.1411 0.1094  188  GLU A O   
1911 C CB  . GLU A 264 ? 0.6584 0.9951 1.5789 -0.0241 -0.0910 0.1332  188  GLU A CB  
1912 N N   . TYR A 265 ? 0.6816 0.9985 1.5310 -0.0400 -0.1345 0.1058  189  TYR A N   
1913 C CA  . TYR A 265 ? 0.6921 1.0188 1.5275 -0.0451 -0.1585 0.0992  189  TYR A CA  
1914 C C   . TYR A 265 ? 0.7673 1.0854 1.5930 -0.0604 -0.1706 0.0820  189  TYR A C   
1915 O O   . TYR A 265 ? 0.7701 1.1074 1.6077 -0.0691 -0.1923 0.0757  189  TYR A O   
1916 C CB  . TYR A 265 ? 0.7048 1.0170 1.4998 -0.0346 -0.1574 0.0993  189  TYR A CB  
1917 N N   . LEU A 266 ? 0.7296 1.0201 1.5356 -0.0636 -0.1570 0.0737  190  LEU A N   
1918 C CA  . LEU A 266 ? 0.7334 1.0099 1.5300 -0.0767 -0.1641 0.0577  190  LEU A CA  
1919 C C   . LEU A 266 ? 0.7626 1.0373 1.5940 -0.0856 -0.1537 0.0594  190  LEU A C   
1920 O O   . LEU A 266 ? 0.7517 1.0166 1.5853 -0.0974 -0.1600 0.0471  190  LEU A O   
1921 C CB  . LEU A 266 ? 0.7348 0.9817 1.4831 -0.0730 -0.1568 0.0486  190  LEU A CB  
1922 C CG  . LEU A 266 ? 0.8045 1.0502 1.5166 -0.0668 -0.1678 0.0449  190  LEU A CG  
1923 C CD1 . LEU A 266 ? 0.7977 1.0180 1.4740 -0.0586 -0.1529 0.0444  190  LEU A CD1 
1924 C CD2 . LEU A 266 ? 0.8682 1.1161 1.5664 -0.0764 -0.1881 0.0287  190  LEU A CD2 
1925 N N   . GLY A 267 ? 0.7067 0.9907 1.5651 -0.0789 -0.1371 0.0749  191  GLY A N   
1926 C CA  . GLY A 267 ? 0.6911 0.9763 1.5836 -0.0840 -0.1230 0.0818  191  GLY A CA  
1927 C C   . GLY A 267 ? 0.7079 0.9652 1.5736 -0.0849 -0.1094 0.0759  191  GLY A C   
1928 O O   . GLY A 267 ? 0.7087 0.9603 1.5940 -0.0950 -0.1074 0.0737  191  GLY A O   
1929 N N   . VAL A 268 ? 0.6431 0.8831 1.4656 -0.0742 -0.1007 0.0735  192  VAL A N   
1930 C CA  . VAL A 268 ? 0.6313 0.8458 1.4210 -0.0732 -0.0904 0.0670  192  VAL A CA  
1931 C C   . VAL A 268 ? 0.6684 0.8767 1.4377 -0.0589 -0.0708 0.0738  192  VAL A C   
1932 O O   . VAL A 268 ? 0.6649 0.8757 1.4211 -0.0495 -0.0705 0.0750  192  VAL A O   
1933 C CB  . VAL A 268 ? 0.6730 0.8724 1.4274 -0.0776 -0.1060 0.0511  192  VAL A CB  
1934 C CG1 . VAL A 268 ? 0.6640 0.8420 1.3748 -0.0692 -0.0964 0.0470  192  VAL A CG1 
1935 C CG2 . VAL A 268 ? 0.6769 0.8699 1.4430 -0.0918 -0.1164 0.0401  192  VAL A CG2 
1936 N N   . ASN A 269 ? 0.6138 0.8148 1.3825 -0.0571 -0.0545 0.0784  193  ASN A N   
1937 C CA  . ASN A 269 ? 0.6024 0.7979 1.3496 -0.0443 -0.0358 0.0824  193  ASN A CA  
1938 C C   . ASN A 269 ? 0.6282 0.8019 1.3331 -0.0434 -0.0383 0.0705  193  ASN A C   
1939 O O   . ASN A 269 ? 0.6202 0.7821 1.3179 -0.0502 -0.0397 0.0666  193  ASN A O   
1940 C CB  . ASN A 269 ? 0.6370 0.8387 1.4037 -0.0429 -0.0184 0.0945  193  ASN A CB  
1941 C CG  . ASN A 269 ? 0.9981 1.2231 1.8059 -0.0398 -0.0096 0.1094  193  ASN A CG  
1942 O OD1 . ASN A 269 ? 0.9758 1.2148 1.8055 -0.0408 -0.0184 0.1113  193  ASN A OD1 
1943 N ND2 . ASN A 269 ? 0.8751 1.1066 1.6963 -0.0357 0.0086  0.1222  193  ASN A ND2 
1944 N N   . ALA A 270 ? 0.5714 0.7393 1.2513 -0.0354 -0.0389 0.0649  194  ALA A N   
1945 C CA  . ALA A 270 ? 0.5654 0.7139 1.2084 -0.0349 -0.0417 0.0542  194  ALA A CA  
1946 C C   . ALA A 270 ? 0.6252 0.7679 1.2463 -0.0241 -0.0277 0.0522  194  ALA A C   
1947 O O   . ALA A 270 ? 0.6222 0.7738 1.2506 -0.0150 -0.0187 0.0557  194  ALA A O   
1948 C CB  . ALA A 270 ? 0.5724 0.7174 1.2043 -0.0360 -0.0560 0.0483  194  ALA A CB  
1949 N N   . CYS A 271 ? 0.5828 0.7112 1.1776 -0.0249 -0.0263 0.0457  195  CYS A N   
1950 C CA  . CYS A 271 ? 0.5803 0.7030 1.1506 -0.0164 -0.0166 0.0408  195  CYS A CA  
1951 C C   . CYS A 271 ? 0.5865 0.6995 1.1416 -0.0140 -0.0231 0.0317  195  CYS A C   
1952 O O   . CYS A 271 ? 0.5822 0.6836 1.1234 -0.0193 -0.0323 0.0266  195  CYS A O   
1953 C CB  . CYS A 271 ? 0.6010 0.7152 1.1551 -0.0191 -0.0142 0.0399  195  CYS A CB  
1954 S SG  . CYS A 271 ? 0.6660 0.7774 1.1897 -0.0091 -0.0050 0.0331  195  CYS A SG  
1955 N N   . ILE A 272 ? 0.5174 0.6355 1.0787 -0.0058 -0.0178 0.0309  196  ILE A N   
1956 C CA  . ILE A 272 ? 0.5063 0.6157 1.0616 -0.0028 -0.0221 0.0248  196  ILE A CA  
1957 C C   . ILE A 272 ? 0.5461 0.6532 1.0947 0.0071  -0.0115 0.0165  196  ILE A C   
1958 O O   . ILE A 272 ? 0.5604 0.6768 1.1104 0.0133  -0.0009 0.0165  196  ILE A O   
1959 C CB  . ILE A 272 ? 0.5455 0.6627 1.1231 -0.0033 -0.0292 0.0325  196  ILE A CB  
1960 C CG1 . ILE A 272 ? 0.5464 0.6806 1.1508 0.0016  -0.0216 0.0409  196  ILE A CG1 
1961 C CG2 . ILE A 272 ? 0.5656 0.6829 1.1430 -0.0130 -0.0434 0.0354  196  ILE A CG2 
1962 C CD1 . ILE A 272 ? 0.6129 0.7484 1.2276 0.0121  -0.0141 0.0402  196  ILE A CD1 
1963 N N   . MET A 273 ? 0.4796 0.5749 1.0224 0.0088  -0.0142 0.0092  197  MET A N   
1964 C CA  . MET A 273 ? 0.4719 0.5630 1.0128 0.0172  -0.0057 -0.0017 197  MET A CA  
1965 C C   . MET A 273 ? 0.5075 0.6063 1.0729 0.0244  0.0004  0.0034  197  MET A C   
1966 O O   . MET A 273 ? 0.4813 0.5785 1.0627 0.0240  -0.0045 0.0106  197  MET A O   
1967 C CB  . MET A 273 ? 0.5006 0.5757 1.0337 0.0154  -0.0103 -0.0102 197  MET A CB  
1968 C CG  . MET A 273 ? 0.5409 0.6098 1.0508 0.0105  -0.0137 -0.0174 197  MET A CG  
1969 S SD  . MET A 273 ? 0.6039 0.6776 1.0978 0.0168  -0.0057 -0.0330 197  MET A SD  
1970 C CE  . MET A 273 ? 0.5665 0.6257 1.0657 0.0182  -0.0066 -0.0487 197  MET A CE  
1971 N N   . ALA A 274 ? 0.4907 0.6008 1.0594 0.0316  0.0114  0.0022  198  ALA A N   
1972 C CA  . ALA A 274 ? 0.5054 0.6254 1.0983 0.0400  0.0199  0.0075  198  ALA A CA  
1973 C C   . ALA A 274 ? 0.6034 0.7135 1.2006 0.0493  0.0277  -0.0058 198  ALA A C   
1974 O O   . ALA A 274 ? 0.6112 0.7263 1.2053 0.0588  0.0396  -0.0151 198  ALA A O   
1975 C CB  . ALA A 274 ? 0.5179 0.6553 1.1128 0.0446  0.0303  0.0133  198  ALA A CB  
1976 N N   . PHE A 275 ? 0.5848 0.6809 1.1902 0.0471  0.0214  -0.0067 199  PHE A N   
1977 C CA  . PHE A 275 ? 0.6065 0.6897 1.2232 0.0546  0.0282  -0.0186 199  PHE A CA  
1978 C C   . PHE A 275 ? 0.7012 0.7922 1.3455 0.0651  0.0386  -0.0124 199  PHE A C   
1979 O O   . PHE A 275 ? 0.6933 0.7982 1.3534 0.0642  0.0359  0.0055  199  PHE A O   
1980 C CB  . PHE A 275 ? 0.6237 0.6913 1.2472 0.0496  0.0201  -0.0157 199  PHE A CB  
1981 C CG  . PHE A 275 ? 0.6323 0.6910 1.2326 0.0403  0.0113  -0.0216 199  PHE A CG  
1982 C CD1 . PHE A 275 ? 0.6750 0.7274 1.2579 0.0401  0.0136  -0.0407 199  PHE A CD1 
1983 C CD2 . PHE A 275 ? 0.6465 0.7041 1.2431 0.0327  0.0006  -0.0086 199  PHE A CD2 
1984 C CE1 . PHE A 275 ? 0.6835 0.7292 1.2483 0.0321  0.0057  -0.0447 199  PHE A CE1 
1985 C CE2 . PHE A 275 ? 0.6777 0.7272 1.2542 0.0253  -0.0059 -0.0135 199  PHE A CE2 
1986 C CZ  . PHE A 275 ? 0.6637 0.7073 1.2261 0.0249  -0.0032 -0.0307 199  PHE A CZ  
1987 N N   . PRO A 276 ? 0.7022 0.7849 1.3553 0.0751  0.0502  -0.0273 200  PRO A N   
1988 C CA  . PRO A 276 ? 0.7128 0.8026 1.3947 0.0864  0.0614  -0.0204 200  PRO A CA  
1989 C C   . PRO A 276 ? 0.7700 0.8587 1.4807 0.0853  0.0555  -0.0007 200  PRO A C   
1990 O O   . PRO A 276 ? 0.7707 0.8437 1.4847 0.0816  0.0497  -0.0014 200  PRO A O   
1991 C CB  . PRO A 276 ? 0.7557 0.8320 1.4390 0.0961  0.0735  -0.0443 200  PRO A CB  
1992 C CG  . PRO A 276 ? 0.8107 0.8697 1.4766 0.0882  0.0655  -0.0603 200  PRO A CG  
1993 C CD  . PRO A 276 ? 0.7390 0.8063 1.3787 0.0767  0.0532  -0.0519 200  PRO A CD  
1994 N N   . PRO A 277 ? 0.7201 0.8284 1.4486 0.0866  0.0541  0.0193  201  PRO A N   
1995 C CA  . PRO A 277 ? 0.7119 0.8248 1.4648 0.0857  0.0458  0.0397  201  PRO A CA  
1996 C C   . PRO A 277 ? 0.7889 0.8894 1.5704 0.0964  0.0550  0.0406  201  PRO A C   
1997 O O   . PRO A 277 ? 0.7920 0.8939 1.5920 0.0969  0.0487  0.0578  201  PRO A O   
1998 C CB  . PRO A 277 ? 0.7262 0.8654 1.4953 0.0864  0.0444  0.0566  201  PRO A CB  
1999 C CG  . PRO A 277 ? 0.7808 0.9269 1.5272 0.0824  0.0476  0.0476  201  PRO A CG  
2000 C CD  . PRO A 277 ? 0.7382 0.8678 1.4684 0.0894  0.0601  0.0253  201  PRO A CD  
2001 N N   . GLU A 278 ? 0.7576 0.8459 1.5422 0.1054  0.0701  0.0216  202  GLU A N   
2002 C CA  . GLU A 278 ? 0.7693 0.8406 1.5821 0.1158  0.0814  0.0167  202  GLU A CA  
2003 C C   . GLU A 278 ? 0.8220 0.8732 1.6372 0.1098  0.0741  0.0176  202  GLU A C   
2004 O O   . GLU A 278 ? 0.8414 0.8877 1.6875 0.1156  0.0767  0.0327  202  GLU A O   
2005 C CB  . GLU A 278 ? 0.8047 0.8657 1.6107 0.1242  0.0966  -0.0109 202  GLU A CB  
2006 N N   . LYS A 279 ? 0.7469 0.7887 1.5315 0.0987  0.0654  0.0045  203  LYS A N   
2007 C CA  . LYS A 279 ? 0.7292 0.7542 1.5130 0.0917  0.0583  0.0057  203  LYS A CA  
2008 C C   . LYS A 279 ? 0.7501 0.7818 1.4978 0.0786  0.0438  0.0066  203  LYS A C   
2009 O O   . LYS A 279 ? 0.7453 0.7651 1.4738 0.0721  0.0412  -0.0101 203  LYS A O   
2010 C CB  . LYS A 279 ? 0.7651 0.7651 1.5584 0.0938  0.0674  -0.0190 203  LYS A CB  
2011 N N   . TYR A 280 ? 0.6803 0.7320 1.4212 0.0752  0.0344  0.0257  204  TYR A N   
2012 C CA  . TYR A 280 ? 0.6587 0.7184 1.3690 0.0639  0.0213  0.0281  204  TYR A CA  
2013 C C   . TYR A 280 ? 0.7119 0.7612 1.4144 0.0576  0.0129  0.0342  204  TYR A C   
2014 O O   . TYR A 280 ? 0.7058 0.7503 1.3821 0.0492  0.0069  0.0253  204  TYR A O   
2015 C CB  . TYR A 280 ? 0.6615 0.7451 1.3746 0.0626  0.0140  0.0453  204  TYR A CB  
2016 C CG  . TYR A 280 ? 0.6686 0.7601 1.3532 0.0515  0.0031  0.0437  204  TYR A CG  
2017 C CD1 . TYR A 280 ? 0.6914 0.7899 1.3634 0.0497  0.0068  0.0346  204  TYR A CD1 
2018 C CD2 . TYR A 280 ? 0.6730 0.7652 1.3442 0.0439  -0.0099 0.0521  204  TYR A CD2 
2019 C CE1 . TYR A 280 ? 0.6917 0.7952 1.3413 0.0399  -0.0017 0.0339  204  TYR A CE1 
2020 C CE2 . TYR A 280 ? 0.6773 0.7741 1.3242 0.0342  -0.0189 0.0489  204  TYR A CE2 
2021 C CZ  . TYR A 280 ? 0.7546 0.8563 1.3927 0.0319  -0.0147 0.0401  204  TYR A CZ  
2022 O OH  . TYR A 280 ? 0.7198 0.8246 1.3383 0.0227  -0.0223 0.0383  204  TYR A OH  
2023 N N   . ALA A 281 ? 0.6656 0.7133 1.3914 0.0628  0.0133  0.0514  205  ALA A N   
2024 C CA  . ALA A 281 ? 0.6574 0.6975 1.3791 0.0594  0.0077  0.0616  205  ALA A CA  
2025 C C   . ALA A 281 ? 0.6880 0.7049 1.4097 0.0564  0.0139  0.0447  205  ALA A C   
2026 O O   . ALA A 281 ? 0.6829 0.6948 1.3863 0.0492  0.0080  0.0437  205  ALA A O   
2027 C CB  . ALA A 281 ? 0.6755 0.7213 1.4255 0.0682  0.0093  0.0860  205  ALA A CB  
2028 N N   . GLN A 282 ? 0.6342 0.6380 1.3778 0.0621  0.0256  0.0303  206  GLN A N   
2029 C CA  . GLN A 282 ? 0.6320 0.6143 1.3825 0.0596  0.0315  0.0099  206  GLN A CA  
2030 C C   . GLN A 282 ? 0.6189 0.6023 1.3343 0.0504  0.0248  -0.0101 206  GLN A C   
2031 O O   . GLN A 282 ? 0.6061 0.5789 1.3163 0.0438  0.0219  -0.0170 206  GLN A O   
2032 C CB  . GLN A 282 ? 0.6746 0.6458 1.4538 0.0687  0.0448  -0.0046 206  GLN A CB  
2033 C CG  . GLN A 282 ? 1.0798 1.0306 1.8654 0.0657  0.0497  -0.0331 206  GLN A CG  
2034 C CD  . GLN A 282 ? 1.4631 1.4049 2.2703 0.0749  0.0621  -0.0524 206  GLN A CD  
2035 O OE1 . GLN A 282 ? 1.4135 1.3605 2.2005 0.0763  0.0636  -0.0749 206  GLN A OE1 
2036 N NE2 . GLN A 282 ? 1.4267 1.3545 2.2755 0.0823  0.0722  -0.0442 206  GLN A NE2 
2037 N N   . TRP A 283 ? 0.5328 0.5304 1.2270 0.0506  0.0232  -0.0170 207  TRP A N   
2038 C CA  . TRP A 283 ? 0.5064 0.5085 1.1683 0.0441  0.0182  -0.0329 207  TRP A CA  
2039 C C   . TRP A 283 ? 0.5189 0.5253 1.1581 0.0350  0.0072  -0.0224 207  TRP A C   
2040 O O   . TRP A 283 ? 0.5131 0.5146 1.1357 0.0290  0.0037  -0.0344 207  TRP A O   
2041 C CB  . TRP A 283 ? 0.4834 0.5013 1.1332 0.0484  0.0214  -0.0368 207  TRP A CB  
2042 C CG  . TRP A 283 ? 0.5067 0.5207 1.1579 0.0549  0.0309  -0.0601 207  TRP A CG  
2043 C CD1 . TRP A 283 ? 0.5541 0.5687 1.2252 0.0655  0.0421  -0.0641 207  TRP A CD1 
2044 C CD2 . TRP A 283 ? 0.5089 0.5192 1.1402 0.0523  0.0299  -0.0839 207  TRP A CD2 
2045 N NE1 . TRP A 283 ? 0.5594 0.5702 1.2217 0.0699  0.0484  -0.0905 207  TRP A NE1 
2046 C CE2 . TRP A 283 ? 0.5715 0.5809 1.2090 0.0618  0.0402  -0.1031 207  TRP A CE2 
2047 C CE3 . TRP A 283 ? 0.5144 0.5240 1.1232 0.0436  0.0210  -0.0908 207  TRP A CE3 
2048 C CZ2 . TRP A 283 ? 0.5749 0.5843 1.1942 0.0626  0.0406  -0.1300 207  TRP A CZ2 
2049 C CZ3 . TRP A 283 ? 0.5456 0.5559 1.1391 0.0442  0.0212  -0.1154 207  TRP A CZ3 
2050 C CH2 . TRP A 283 ? 0.5735 0.5843 1.1711 0.0535  0.0302  -0.1354 207  TRP A CH2 
2051 N N   . SER A 284 ? 0.4536 0.4699 1.0923 0.0344  0.0015  -0.0011 208  SER A N   
2052 C CA  . SER A 284 ? 0.4325 0.4530 1.0494 0.0270  -0.0086 0.0081  208  SER A CA  
2053 C C   . SER A 284 ? 0.4886 0.4955 1.1095 0.0242  -0.0089 0.0103  208  SER A C   
2054 O O   . SER A 284 ? 0.4789 0.4841 1.0794 0.0177  -0.0139 0.0069  208  SER A O   
2055 C CB  . SER A 284 ? 0.4615 0.4971 1.0796 0.0281  -0.0152 0.0277  208  SER A CB  
2056 O OG  . SER A 284 ? 0.5338 0.5830 1.1515 0.0292  -0.0150 0.0266  208  SER A OG  
2057 N N   . ALA A 285 ? 0.4633 0.4606 1.1136 0.0297  -0.0021 0.0167  209  ALA A N   
2058 C CA  . ALA A 285 ? 0.4670 0.4511 1.1297 0.0280  0.0003  0.0212  209  ALA A CA  
2059 C C   . ALA A 285 ? 0.5335 0.5045 1.1977 0.0229  0.0029  -0.0024 209  ALA A C   
2060 O O   . ALA A 285 ? 0.5390 0.5054 1.1962 0.0170  0.0001  -0.0030 209  ALA A O   
2061 C CB  . ALA A 285 ? 0.4857 0.4637 1.1841 0.0361  0.0082  0.0368  209  ALA A CB  
2062 N N   . GLY A 286 ? 0.4853 0.4528 1.1576 0.0255  0.0077  -0.0220 210  GLY A N   
2063 C CA  . GLY A 286 ? 0.4850 0.4440 1.1575 0.0217  0.0085  -0.0480 210  GLY A CA  
2064 C C   . GLY A 286 ? 0.5274 0.4957 1.1653 0.0149  0.0003  -0.0574 210  GLY A C   
2065 O O   . GLY A 286 ? 0.5155 0.4784 1.1530 0.0091  -0.0025 -0.0687 210  GLY A O   
2066 N N   . ILE A 287 ? 0.4845 0.4675 1.0964 0.0157  -0.0034 -0.0513 211  ILE A N   
2067 C CA  . ILE A 287 ? 0.4720 0.4648 1.0524 0.0106  -0.0099 -0.0564 211  ILE A CA  
2068 C C   . ILE A 287 ? 0.4900 0.4810 1.0609 0.0045  -0.0157 -0.0427 211  ILE A C   
2069 O O   . ILE A 287 ? 0.4821 0.4740 1.0388 -0.0004 -0.0195 -0.0503 211  ILE A O   
2070 C CB  . ILE A 287 ? 0.5095 0.5170 1.0724 0.0137  -0.0099 -0.0532 211  ILE A CB  
2071 C CG1 . ILE A 287 ? 0.5314 0.5430 1.0973 0.0206  -0.0030 -0.0699 211  ILE A CG1 
2072 C CG2 . ILE A 287 ? 0.5103 0.5271 1.0453 0.0086  -0.0160 -0.0499 211  ILE A CG2 
2073 C CD1 . ILE A 287 ? 0.6756 0.6867 1.2317 0.0203  -0.0031 -0.0945 211  ILE A CD1 
2074 N N   . ALA A 288 ? 0.4243 0.4143 1.0033 0.0059  -0.0159 -0.0228 212  ALA A N   
2075 C CA  . ALA A 288 ? 0.4109 0.4000 0.9798 0.0020  -0.0199 -0.0099 212  ALA A CA  
2076 C C   . ALA A 288 ? 0.4868 0.4649 1.0700 -0.0013 -0.0174 -0.0154 212  ALA A C   
2077 O O   . ALA A 288 ? 0.4725 0.4513 1.0414 -0.0059 -0.0206 -0.0149 212  ALA A O   
2078 C CB  . ALA A 288 ? 0.4141 0.4067 0.9895 0.0062  -0.0203 0.0115  212  ALA A CB  
2079 N N   . LEU A 289 ? 0.4664 0.4341 1.0802 0.0008  -0.0113 -0.0215 213  LEU A N   
2080 C CA  . LEU A 289 ? 0.4864 0.4432 1.1221 -0.0032 -0.0087 -0.0282 213  LEU A CA  
2081 C C   . LEU A 289 ? 0.5610 0.5209 1.1843 -0.0090 -0.0139 -0.0514 213  LEU A C   
2082 O O   . LEU A 289 ? 0.5502 0.5086 1.1768 -0.0143 -0.0158 -0.0521 213  LEU A O   
2083 C CB  . LEU A 289 ? 0.5063 0.4503 1.1817 0.0005  -0.0006 -0.0308 213  LEU A CB  
2084 C CG  . LEU A 289 ? 0.5782 0.5145 1.2816 0.0039  0.0064  -0.0064 213  LEU A CG  
2085 C CD1 . LEU A 289 ? 0.5654 0.5120 1.2560 0.0109  0.0061  0.0175  213  LEU A CD1 
2086 C CD2 . LEU A 289 ? 0.6479 0.5686 1.3959 0.0064  0.0152  -0.0130 213  LEU A CD2 
2087 N N   . MET A 290 ? 0.5384 0.5053 1.1470 -0.0070 -0.0159 -0.0683 214  MET A N   
2088 C CA  . MET A 290 ? 0.5451 0.5200 1.1374 -0.0102 -0.0213 -0.0890 214  MET A CA  
2089 C C   . MET A 290 ? 0.5938 0.5782 1.1585 -0.0139 -0.0269 -0.0800 214  MET A C   
2090 O O   . MET A 290 ? 0.6069 0.5961 1.1662 -0.0179 -0.0315 -0.0901 214  MET A O   
2091 C CB  . MET A 290 ? 0.5856 0.5687 1.1645 -0.0045 -0.0201 -0.1035 214  MET A CB  
2092 C CG  . MET A 290 ? 0.6374 0.6352 1.1895 -0.0053 -0.0258 -0.1185 214  MET A CG  
2093 S SD  . MET A 290 ? 0.7059 0.7165 1.2398 0.0036  -0.0220 -0.1305 214  MET A SD  
2094 C CE  . MET A 290 ? 0.6538 0.6839 1.1540 0.0028  -0.0287 -0.1360 214  MET A CE  
2095 N N   . LYS A 291 ? 0.5219 0.5095 1.0709 -0.0123 -0.0268 -0.0615 215  LYS A N   
2096 C CA  . LYS A 291 ? 0.4945 0.4884 1.0193 -0.0151 -0.0308 -0.0526 215  LYS A CA  
2097 C C   . LYS A 291 ? 0.5372 0.5257 1.0710 -0.0192 -0.0310 -0.0465 215  LYS A C   
2098 O O   . LYS A 291 ? 0.5364 0.5302 1.0565 -0.0220 -0.0342 -0.0486 215  LYS A O   
2099 C CB  . LYS A 291 ? 0.4968 0.4936 1.0081 -0.0130 -0.0311 -0.0365 215  LYS A CB  
2100 C CG  . LYS A 291 ? 0.5693 0.5744 1.0709 -0.0099 -0.0310 -0.0397 215  LYS A CG  
2101 C CD  . LYS A 291 ? 0.6118 0.6204 1.1047 -0.0096 -0.0332 -0.0246 215  LYS A CD  
2102 C CE  . LYS A 291 ? 0.5847 0.6022 1.0759 -0.0067 -0.0322 -0.0254 215  LYS A CE  
2103 N NZ  . LYS A 291 ? 0.7067 0.7296 1.1868 -0.0089 -0.0365 -0.0145 215  LYS A NZ  
2104 N N   . ASN A 292 ? 0.4788 0.4576 1.0372 -0.0186 -0.0264 -0.0371 216  ASN A N   
2105 C CA  . ASN A 292 ? 0.4764 0.4505 1.0483 -0.0213 -0.0239 -0.0275 216  ASN A CA  
2106 C C   . ASN A 292 ? 0.5474 0.5195 1.1416 -0.0266 -0.0251 -0.0432 216  ASN A C   
2107 O O   . ASN A 292 ? 0.5239 0.4993 1.1176 -0.0301 -0.0264 -0.0407 216  ASN A O   
2108 C CB  . ASN A 292 ? 0.4725 0.4389 1.0653 -0.0175 -0.0172 -0.0092 216  ASN A CB  
2109 C CG  . ASN A 292 ? 0.7042 0.6754 1.2774 -0.0122 -0.0174 0.0079  216  ASN A CG  
2110 O OD1 . ASN A 292 ? 0.5979 0.5670 1.1849 -0.0073 -0.0140 0.0181  216  ASN A OD1 
2111 N ND2 . ASN A 292 ? 0.6321 0.6103 1.1749 -0.0129 -0.0216 0.0117  216  ASN A ND2 
2112 N N   . ILE A 293 ? 0.5360 0.5033 1.1518 -0.0269 -0.0248 -0.0598 217  ILE A N   
2113 C CA  . ILE A 293 ? 0.5483 0.5140 1.1889 -0.0325 -0.0275 -0.0787 217  ILE A CA  
2114 C C   . ILE A 293 ? 0.6154 0.5962 1.2319 -0.0351 -0.0364 -0.0936 217  ILE A C   
2115 O O   . ILE A 293 ? 0.6108 0.5963 1.2357 -0.0401 -0.0396 -0.0946 217  ILE A O   
2116 C CB  . ILE A 293 ? 0.6047 0.5608 1.2722 -0.0312 -0.0249 -0.0959 217  ILE A CB  
2117 C CG1 . ILE A 293 ? 0.6213 0.5628 1.3169 -0.0274 -0.0149 -0.0781 217  ILE A CG1 
2118 C CG2 . ILE A 293 ? 0.6288 0.5841 1.3223 -0.0377 -0.0297 -0.1207 217  ILE A CG2 
2119 C CD1 . ILE A 293 ? 0.7673 0.7015 1.4901 -0.0296 -0.0085 -0.0556 217  ILE A CD1 
2120 N N   . LEU A 294 ? 0.5882 0.5782 1.1768 -0.0311 -0.0396 -0.1028 218  LEU A N   
2121 C CA  . LEU A 294 ? 0.5933 0.6000 1.1580 -0.0313 -0.0470 -0.1150 218  LEU A CA  
2122 C C   . LEU A 294 ? 0.6251 0.6394 1.1665 -0.0316 -0.0484 -0.0988 218  LEU A C   
2123 O O   . LEU A 294 ? 0.6213 0.6485 1.1536 -0.0330 -0.0541 -0.1051 218  LEU A O   
2124 C CB  . LEU A 294 ? 0.6058 0.6204 1.1489 -0.0251 -0.0472 -0.1259 218  LEU A CB  
2125 C CG  . LEU A 294 ? 0.6928 0.7097 1.2472 -0.0239 -0.0496 -0.1527 218  LEU A CG  
2126 C CD1 . LEU A 294 ? 0.6958 0.7175 1.2317 -0.0158 -0.0456 -0.1576 218  LEU A CD1 
2127 C CD2 . LEU A 294 ? 0.7492 0.7827 1.2976 -0.0266 -0.0595 -0.1704 218  LEU A CD2 
2128 N N   . GLY A 295 ? 0.5606 0.5681 1.0920 -0.0296 -0.0434 -0.0793 219  GLY A N   
2129 C CA  . GLY A 295 ? 0.5277 0.5398 1.0368 -0.0292 -0.0436 -0.0654 219  GLY A CA  
2130 C C   . GLY A 295 ? 0.5163 0.5228 1.0345 -0.0314 -0.0405 -0.0513 219  GLY A C   
2131 O O   . GLY A 295 ? 0.5211 0.5315 1.0219 -0.0308 -0.0405 -0.0429 219  GLY A O   
2132 N N   . PHE A 296 ? 0.4216 0.4187 0.9678 -0.0332 -0.0365 -0.0472 220  PHE A N   
2133 C CA  . PHE A 296 ? 0.4065 0.4001 0.9616 -0.0339 -0.0315 -0.0312 220  PHE A CA  
2134 C C   . PHE A 296 ? 0.4900 0.4798 1.0845 -0.0383 -0.0291 -0.0334 220  PHE A C   
2135 O O   . PHE A 296 ? 0.4953 0.4904 1.0985 -0.0411 -0.0291 -0.0305 220  PHE A O   
2136 C CB  . PHE A 296 ? 0.4172 0.4039 0.9621 -0.0291 -0.0257 -0.0126 220  PHE A CB  
2137 C CG  . PHE A 296 ? 0.4325 0.4188 0.9743 -0.0274 -0.0200 0.0047  220  PHE A CG  
2138 C CD1 . PHE A 296 ? 0.4715 0.4626 0.9865 -0.0260 -0.0209 0.0079  220  PHE A CD1 
2139 C CD2 . PHE A 296 ? 0.4598 0.4407 1.0260 -0.0260 -0.0123 0.0187  220  PHE A CD2 
2140 C CE1 . PHE A 296 ? 0.4845 0.4753 0.9949 -0.0229 -0.0144 0.0227  220  PHE A CE1 
2141 C CE2 . PHE A 296 ? 0.5022 0.4847 1.0635 -0.0226 -0.0055 0.0358  220  PHE A CE2 
2142 C CZ  . PHE A 296 ? 0.4790 0.4665 1.0110 -0.0209 -0.0066 0.0366  220  PHE A CZ  
2143 N N   . ILE A 297 ? 0.4462 0.4266 1.0676 -0.0389 -0.0265 -0.0377 221  ILE A N   
2144 C CA  . ILE A 297 ? 0.4478 0.4218 1.1134 -0.0436 -0.0229 -0.0389 221  ILE A CA  
2145 C C   . ILE A 297 ? 0.5106 0.4941 1.1902 -0.0505 -0.0313 -0.0592 221  ILE A C   
2146 O O   . ILE A 297 ? 0.5087 0.4968 1.2046 -0.0540 -0.0301 -0.0522 221  ILE A O   
2147 C CB  . ILE A 297 ? 0.5026 0.4634 1.1957 -0.0422 -0.0182 -0.0419 221  ILE A CB  
2148 C CG1 . ILE A 297 ? 0.5182 0.4733 1.1998 -0.0345 -0.0106 -0.0190 221  ILE A CG1 
2149 C CG2 . ILE A 297 ? 0.5097 0.4618 1.2553 -0.0481 -0.0143 -0.0458 221  ILE A CG2 
2150 C CD1 . ILE A 297 ? 0.6994 0.6560 1.3760 -0.0309 -0.0031 0.0088  221  ILE A CD1 
2151 N N   . ILE A 298 ? 0.4797 0.4682 1.1529 -0.0517 -0.0396 -0.0838 222  ILE A N   
2152 C CA  . ILE A 298 ? 0.4855 0.4866 1.1698 -0.0575 -0.0498 -0.1060 222  ILE A CA  
2153 C C   . ILE A 298 ? 0.5403 0.5574 1.2033 -0.0575 -0.0540 -0.0982 222  ILE A C   
2154 O O   . ILE A 298 ? 0.5530 0.5769 1.2413 -0.0630 -0.0568 -0.0995 222  ILE A O   
2155 C CB  . ILE A 298 ? 0.5307 0.5369 1.2037 -0.0561 -0.0575 -0.1334 222  ILE A CB  
2156 C CG1 . ILE A 298 ? 0.5388 0.5283 1.2461 -0.0576 -0.0533 -0.1454 222  ILE A CG1 
2157 C CG2 . ILE A 298 ? 0.5464 0.5729 1.2175 -0.0600 -0.0703 -0.1544 222  ILE A CG2 
2158 C CD1 . ILE A 298 ? 0.5682 0.5590 1.2593 -0.0529 -0.0563 -0.1675 222  ILE A CD1 
2159 N N   . PRO A 299 ? 0.4813 0.5039 1.1032 -0.0515 -0.0535 -0.0885 223  PRO A N   
2160 C CA  . PRO A 299 ? 0.4703 0.5063 1.0769 -0.0509 -0.0559 -0.0801 223  PRO A CA  
2161 C C   . PRO A 299 ? 0.5105 0.5423 1.1386 -0.0529 -0.0486 -0.0616 223  PRO A C   
2162 O O   . PRO A 299 ? 0.5055 0.5491 1.1509 -0.0566 -0.0525 -0.0638 223  PRO A O   
2163 C CB  . PRO A 299 ? 0.4866 0.5223 1.0522 -0.0441 -0.0535 -0.0706 223  PRO A CB  
2164 C CG  . PRO A 299 ? 0.5459 0.5769 1.1036 -0.0420 -0.0545 -0.0820 223  PRO A CG  
2165 C CD  . PRO A 299 ? 0.4999 0.5176 1.0915 -0.0453 -0.0508 -0.0850 223  PRO A CD  
2166 N N   . LEU A 300 ? 0.4550 0.4722 1.0850 -0.0500 -0.0381 -0.0435 224  LEU A N   
2167 C CA  . LEU A 300 ? 0.4389 0.4529 1.0863 -0.0497 -0.0286 -0.0232 224  LEU A CA  
2168 C C   . LEU A 300 ? 0.4916 0.5073 1.1879 -0.0569 -0.0284 -0.0270 224  LEU A C   
2169 O O   . LEU A 300 ? 0.4874 0.5088 1.1985 -0.0575 -0.0235 -0.0142 224  LEU A O   
2170 C CB  . LEU A 300 ? 0.4336 0.4343 1.0735 -0.0441 -0.0181 -0.0042 224  LEU A CB  
2171 C CG  . LEU A 300 ? 0.4858 0.4869 1.1168 -0.0389 -0.0079 0.0189  224  LEU A CG  
2172 C CD1 . LEU A 300 ? 0.4895 0.4864 1.1601 -0.0397 0.0023  0.0341  224  LEU A CD1 
2173 C CD2 . LEU A 300 ? 0.4964 0.5087 1.1096 -0.0381 -0.0101 0.0186  224  LEU A CD2 
2174 N N   . ILE A 301 ? 0.4616 0.4725 1.1853 -0.0622 -0.0332 -0.0447 225  ILE A N   
2175 C CA  . ILE A 301 ? 0.4707 0.4825 1.2469 -0.0707 -0.0346 -0.0525 225  ILE A CA  
2176 C C   . ILE A 301 ? 0.5240 0.5563 1.3039 -0.0751 -0.0443 -0.0613 225  ILE A C   
2177 O O   . ILE A 301 ? 0.5196 0.5572 1.3296 -0.0783 -0.0399 -0.0494 225  ILE A O   
2178 C CB  . ILE A 301 ? 0.5252 0.5276 1.3255 -0.0752 -0.0396 -0.0761 225  ILE A CB  
2179 C CG1 . ILE A 301 ? 0.5413 0.5232 1.3578 -0.0716 -0.0270 -0.0612 225  ILE A CG1 
2180 C CG2 . ILE A 301 ? 0.5380 0.5470 1.3864 -0.0859 -0.0479 -0.0962 225  ILE A CG2 
2181 C CD1 . ILE A 301 ? 0.5936 0.5635 1.4224 -0.0724 -0.0296 -0.0823 225  ILE A CD1 
2182 N N   . PHE A 302 ? 0.4781 0.5237 1.2260 -0.0736 -0.0563 -0.0789 226  PHE A N   
2183 C CA  . PHE A 302 ? 0.4739 0.5426 1.2190 -0.0757 -0.0672 -0.0875 226  PHE A CA  
2184 C C   . PHE A 302 ? 0.5005 0.5761 1.2341 -0.0713 -0.0602 -0.0639 226  PHE A C   
2185 O O   . PHE A 302 ? 0.5015 0.5908 1.2630 -0.0754 -0.0627 -0.0616 226  PHE A O   
2186 C CB  . PHE A 302 ? 0.5032 0.5842 1.2094 -0.0717 -0.0782 -0.1051 226  PHE A CB  
2187 C CG  . PHE A 302 ? 0.5411 0.6245 1.2587 -0.0758 -0.0887 -0.1346 226  PHE A CG  
2188 C CD1 . PHE A 302 ? 0.5974 0.7009 1.3361 -0.0819 -0.1029 -0.1561 226  PHE A CD1 
2189 C CD2 . PHE A 302 ? 0.5724 0.6398 1.2787 -0.0729 -0.0848 -0.1419 226  PHE A CD2 
2190 C CE1 . PHE A 302 ? 0.6295 0.7354 1.3771 -0.0852 -0.1130 -0.1868 226  PHE A CE1 
2191 C CE2 . PHE A 302 ? 0.6282 0.6972 1.3438 -0.0755 -0.0933 -0.1709 226  PHE A CE2 
2192 C CZ  . PHE A 302 ? 0.6191 0.7068 1.3542 -0.0815 -0.1073 -0.1942 226  PHE A CZ  
2193 N N   . ILE A 303 ? 0.4327 0.4996 1.1272 -0.0630 -0.0516 -0.0478 227  ILE A N   
2194 C CA  . ILE A 303 ? 0.4192 0.4899 1.0988 -0.0574 -0.0436 -0.0271 227  ILE A CA  
2195 C C   . ILE A 303 ? 0.4438 0.5114 1.1606 -0.0594 -0.0327 -0.0100 227  ILE A C   
2196 O O   . ILE A 303 ? 0.4459 0.5260 1.1742 -0.0589 -0.0308 -0.0011 227  ILE A O   
2197 C CB  . ILE A 303 ? 0.4624 0.5213 1.0970 -0.0488 -0.0361 -0.0153 227  ILE A CB  
2198 C CG1 . ILE A 303 ? 0.4783 0.5344 1.0831 -0.0471 -0.0432 -0.0294 227  ILE A CG1 
2199 C CG2 . ILE A 303 ? 0.4675 0.5335 1.0827 -0.0429 -0.0316 -0.0024 227  ILE A CG2 
2200 C CD1 . ILE A 303 ? 0.6256 0.6997 1.2145 -0.0466 -0.0550 -0.0441 227  ILE A CD1 
2201 N N   . ALA A 304 ? 0.3796 0.4317 1.1173 -0.0610 -0.0248 -0.0039 228  ALA A N   
2202 C CA  . ALA A 304 ? 0.3748 0.4233 1.1492 -0.0619 -0.0122 0.0154  228  ALA A CA  
2203 C C   . ALA A 304 ? 0.4330 0.4930 1.2624 -0.0720 -0.0179 0.0067  228  ALA A C   
2204 O O   . ALA A 304 ? 0.4350 0.5029 1.2900 -0.0720 -0.0098 0.0229  228  ALA A O   
2205 C CB  . ALA A 304 ? 0.3904 0.4206 1.1710 -0.0595 -0.0024 0.0256  228  ALA A CB  
2206 N N   . THR A 305 ? 0.3938 0.4560 1.2425 -0.0804 -0.0316 -0.0195 229  THR A N   
2207 C CA  . THR A 305 ? 0.4031 0.4774 1.3059 -0.0914 -0.0400 -0.0328 229  THR A CA  
2208 C C   . THR A 305 ? 0.4617 0.5614 1.3623 -0.0918 -0.0481 -0.0333 229  THR A C   
2209 O O   . THR A 305 ? 0.4460 0.5569 1.3916 -0.0974 -0.0465 -0.0265 229  THR A O   
2210 C CB  . THR A 305 ? 0.5280 0.5997 1.4439 -0.0989 -0.0540 -0.0647 229  THR A CB  
2211 O OG1 . THR A 305 ? 0.4994 0.5472 1.4211 -0.0974 -0.0445 -0.0609 229  THR A OG1 
2212 C CG2 . THR A 305 ? 0.5342 0.6185 1.5071 -0.1113 -0.0648 -0.0826 229  THR A CG2 
2213 N N   . CYS A 306 ? 0.4428 0.5519 1.2935 -0.0852 -0.0554 -0.0388 230  CYS A N   
2214 C CA  . CYS A 306 ? 0.4412 0.5748 1.2840 -0.0830 -0.0625 -0.0372 230  CYS A CA  
2215 C C   . CYS A 306 ? 0.4763 0.6106 1.3219 -0.0768 -0.0468 -0.0084 230  CYS A C   
2216 O O   . CYS A 306 ? 0.4877 0.6417 1.3612 -0.0791 -0.0495 -0.0039 230  CYS A O   
2217 C CB  . CYS A 306 ? 0.4469 0.5877 1.2372 -0.0763 -0.0715 -0.0472 230  CYS A CB  
2218 S SG  . CYS A 306 ? 0.5124 0.6635 1.2996 -0.0820 -0.0918 -0.0828 230  CYS A SG  
2219 N N   . TYR A 307 ? 0.4091 0.5238 1.2272 -0.0686 -0.0309 0.0103  231  TYR A N   
2220 C CA  . TYR A 307 ? 0.4061 0.5209 1.2232 -0.0611 -0.0146 0.0363  231  TYR A CA  
2221 C C   . TYR A 307 ? 0.4708 0.5907 1.3464 -0.0666 -0.0062 0.0489  231  TYR A C   
2222 O O   . TYR A 307 ? 0.4629 0.5982 1.3574 -0.0648 -0.0015 0.0613  231  TYR A O   
2223 C CB  . TYR A 307 ? 0.4278 0.5221 1.2040 -0.0512 -0.0005 0.0510  231  TYR A CB  
2224 C CG  . TYR A 307 ? 0.4745 0.5684 1.2553 -0.0434 0.0181  0.0769  231  TYR A CG  
2225 C CD1 . TYR A 307 ? 0.4900 0.5962 1.2612 -0.0372 0.0219  0.0852  231  TYR A CD1 
2226 C CD2 . TYR A 307 ? 0.5026 0.5859 1.3014 -0.0414 0.0326  0.0941  231  TYR A CD2 
2227 C CE1 . TYR A 307 ? 0.4879 0.5952 1.2653 -0.0291 0.0401  0.1080  231  TYR A CE1 
2228 C CE2 . TYR A 307 ? 0.5260 0.6121 1.3296 -0.0330 0.0507  0.1185  231  TYR A CE2 
2229 C CZ  . TYR A 307 ? 0.5965 0.6942 1.3882 -0.0268 0.0545  0.1244  231  TYR A CZ  
2230 O OH  . TYR A 307 ? 0.6093 0.7098 1.4034 -0.0171 0.0737  0.1477  231  TYR A OH  
2231 N N   . PHE A 308 ? 0.4367 0.5435 1.3435 -0.0729 -0.0031 0.0474  232  PHE A N   
2232 C CA  . PHE A 308 ? 0.4363 0.5454 1.4042 -0.0787 0.0063  0.0607  232  PHE A CA  
2233 C C   . PHE A 308 ? 0.5174 0.6469 1.5360 -0.0914 -0.0094 0.0427  232  PHE A C   
2234 O O   . PHE A 308 ? 0.5178 0.6560 1.5908 -0.0965 -0.0027 0.0548  232  PHE A O   
2235 C CB  . PHE A 308 ? 0.4562 0.5438 1.4420 -0.0803 0.0156  0.0664  232  PHE A CB  
2236 C CG  . PHE A 308 ? 0.4664 0.5401 1.4144 -0.0671 0.0336  0.0912  232  PHE A CG  
2237 C CD1 . PHE A 308 ? 0.4917 0.5690 1.4525 -0.0597 0.0530  0.1209  232  PHE A CD1 
2238 C CD2 . PHE A 308 ? 0.4856 0.5447 1.3851 -0.0616 0.0311  0.0847  232  PHE A CD2 
2239 C CE1 . PHE A 308 ? 0.5029 0.5703 1.4249 -0.0464 0.0686  0.1420  232  PHE A CE1 
2240 C CE2 . PHE A 308 ? 0.5193 0.5685 1.3835 -0.0496 0.0455  0.1058  232  PHE A CE2 
2241 C CZ  . PHE A 308 ? 0.5001 0.5540 1.3742 -0.0419 0.0637  0.1335  232  PHE A CZ  
2242 N N   . GLY A 309 ? 0.4902 0.6293 1.4902 -0.0957 -0.0299 0.0149  233  GLY A N   
2243 C CA  . GLY A 309 ? 0.5009 0.6639 1.5388 -0.1064 -0.0487 -0.0061 233  GLY A CA  
2244 C C   . GLY A 309 ? 0.5601 0.7489 1.5974 -0.1020 -0.0499 0.0058  233  GLY A C   
2245 O O   . GLY A 309 ? 0.5476 0.7577 1.6362 -0.1100 -0.0562 0.0044  233  GLY A O   
2246 N N   . ILE A 310 ? 0.5222 0.7089 1.5037 -0.0892 -0.0432 0.0181  234  ILE A N   
2247 C CA  . ILE A 310 ? 0.5163 0.7223 1.4889 -0.0815 -0.0401 0.0331  234  ILE A CA  
2248 C C   . ILE A 310 ? 0.5652 0.7681 1.5696 -0.0780 -0.0183 0.0622  234  ILE A C   
2249 O O   . ILE A 310 ? 0.5659 0.7910 1.6100 -0.0802 -0.0184 0.0706  234  ILE A O   
2250 C CB  . ILE A 310 ? 0.5531 0.7524 1.4578 -0.0691 -0.0386 0.0350  234  ILE A CB  
2251 C CG1 . ILE A 310 ? 0.5560 0.7689 1.4373 -0.0715 -0.0603 0.0098  234  ILE A CG1 
2252 C CG2 . ILE A 310 ? 0.5684 0.7773 1.4622 -0.0581 -0.0266 0.0572  234  ILE A CG2 
2253 C CD1 . ILE A 310 ? 0.6299 0.8314 1.4486 -0.0614 -0.0589 0.0092  234  ILE A CD1 
2254 N N   . ARG A 311 ? 0.5223 0.7001 1.5121 -0.0725 -0.0001 0.0776  235  ARG A N   
2255 C CA  . ARG A 311 ? 0.5260 0.7002 1.5394 -0.0669 0.0229  0.1068  235  ARG A CA  
2256 C C   . ARG A 311 ? 0.5823 0.7695 1.6729 -0.0784 0.0233  0.1112  235  ARG A C   
2257 O O   . ARG A 311 ? 0.5794 0.7797 1.6995 -0.0748 0.0364  0.1327  235  ARG A O   
2258 C CB  . ARG A 311 ? 0.5446 0.6922 1.5281 -0.0595 0.0388  0.1193  235  ARG A CB  
2259 C CG  . ARG A 311 ? 0.7008 0.8465 1.6868 -0.0481 0.0641  0.1511  235  ARG A CG  
2260 C CD  . ARG A 311 ? 0.8920 1.0155 1.8465 -0.0402 0.0775  0.1627  235  ARG A CD  
2261 N NE  . ARG A 311 ? 1.1072 1.2293 2.1062 -0.0393 0.0960  0.1874  235  ARG A NE  
2262 C CZ  . ARG A 311 ? 1.4280 1.5358 2.4105 -0.0311 0.1107  0.2043  235  ARG A CZ  
2263 N NH1 . ARG A 311 ? 1.3453 1.4391 2.2682 -0.0239 0.1080  0.1976  235  ARG A NH1 
2264 N NH2 . ARG A 311 ? 1.3190 1.4282 2.3465 -0.0297 0.1285  0.2294  235  ARG A NH2 
2265 N N   . LYS A 312 ? 0.5499 0.7343 1.6751 -0.0922 0.0090  0.0897  236  LYS A N   
2266 C CA  . LYS A 312 ? 0.5641 0.7592 1.7685 -0.1056 0.0070  0.0892  236  LYS A CA  
2267 C C   . LYS A 312 ? 0.6315 0.8600 1.8700 -0.1120 -0.0080 0.0810  236  LYS A C   
2268 O O   . LYS A 312 ? 0.6314 0.8737 1.9368 -0.1197 -0.0038 0.0910  236  LYS A O   
2269 C CB  . LYS A 312 ? 0.6009 0.7820 1.8307 -0.1184 -0.0055 0.0637  236  LYS A CB  
2270 C CG  . LYS A 312 ? 0.7261 0.8947 2.0202 -0.1249 0.0099  0.0794  236  LYS A CG  
2271 C CD  . LYS A 312 ? 0.8569 1.0277 2.2145 -0.1432 -0.0070 0.0516  236  LYS A CD  
2272 C CE  . LYS A 312 ? 0.9652 1.1250 2.3966 -0.1497 0.0106  0.0714  236  LYS A CE  
2273 N NZ  . LYS A 312 ? 0.9850 1.1538 2.4942 -0.1691 -0.0052 0.0469  236  LYS A NZ  
2274 N N   . HIS A 313 ? 0.5878 0.8310 1.7837 -0.1086 -0.0253 0.0641  237  HIS A N   
2275 C CA  . HIS A 313 ? 0.5815 0.8598 1.8022 -0.1129 -0.0421 0.0556  237  HIS A CA  
2276 C C   . HIS A 313 ? 0.6216 0.9152 1.8419 -0.1015 -0.0270 0.0845  237  HIS A C   
2277 O O   . HIS A 313 ? 0.6110 0.9338 1.8788 -0.1064 -0.0336 0.0877  237  HIS A O   
2278 C CB  . HIS A 313 ? 0.5882 0.8773 1.7614 -0.1118 -0.0654 0.0287  237  HIS A CB  
2279 N N   . LEU A 314 ? 0.5768 0.8521 1.7436 -0.0862 -0.0080 0.1035  238  LEU A N   
2280 C CA  . LEU A 314 ? 0.5726 0.8584 1.7316 -0.0731 0.0086  0.1294  238  LEU A CA  
2281 C C   . LEU A 314 ? 0.6318 0.9154 1.8362 -0.0712 0.0329  0.1579  238  LEU A C   
2282 O O   . LEU A 314 ? 0.6332 0.9367 1.8627 -0.0654 0.0428  0.1769  238  LEU A O   
2283 C CB  . LEU A 314 ? 0.5724 0.8389 1.6554 -0.0578 0.0179  0.1341  238  LEU A CB  
2284 C CG  . LEU A 314 ? 0.6356 0.9162 1.6817 -0.0532 0.0017  0.1210  238  LEU A CG  
2285 C CD1 . LEU A 314 ? 0.6398 0.9127 1.6556 -0.0600 -0.0187 0.0929  238  LEU A CD1 
2286 C CD2 . LEU A 314 ? 0.6765 0.9455 1.6713 -0.0362 0.0182  0.1366  238  LEU A CD2 
2287 N N   . LEU A 315 ? 0.5848 0.8463 1.8026 -0.0753 0.0432  0.1623  239  LEU A N   
2288 C CA  . LEU A 315 ? 0.5898 0.8479 1.8510 -0.0729 0.0679  0.1914  239  LEU A CA  
2289 C C   . LEU A 315 ? 0.6480 0.9294 1.9984 -0.0879 0.0618  0.1923  239  LEU A C   
2290 O O   . LEU A 315 ? 0.6528 0.9391 2.0509 -0.0863 0.0823  0.2192  239  LEU A O   
2291 C CB  . LEU A 315 ? 0.5988 0.8267 1.8433 -0.0718 0.0791  0.1957  239  LEU A CB  
2292 C CG  . LEU A 315 ? 0.6646 0.8729 1.8456 -0.0534 0.1009  0.2154  239  LEU A CG  
2293 C CD1 . LEU A 315 ? 0.6577 0.8650 1.7682 -0.0425 0.0949  0.2055  239  LEU A CD1 
2294 C CD2 . LEU A 315 ? 0.6977 0.8797 1.8609 -0.0543 0.1040  0.2129  239  LEU A CD2 
2295 N N   . LYS A 316 ? 0.5976 0.8947 1.9704 -0.1021 0.0333  0.1624  240  LYS A N   
2296 C CA  . LYS A 316 ? 0.5933 0.9167 2.0478 -0.1183 0.0198  0.1544  240  LYS A CA  
2297 C C   . LYS A 316 ? 0.6338 0.9906 2.0809 -0.1173 0.0002  0.1433  240  LYS A C   
2298 O O   . LYS A 316 ? 0.6307 0.9858 2.0132 -0.1033 0.0020  0.1462  240  LYS A O   
2299 C CB  . LYS A 316 ? 0.6280 0.9401 2.1141 -0.1360 0.0017  0.1248  240  LYS A CB  
2300 N N   . THR A 317 ? 0.5869 0.9746 2.1008 -0.1318 -0.0185 0.1309  241  THR A N   
2301 C CA  . THR A 317 ? 0.9828 1.4091 2.5020 -0.1322 -0.0397 0.1210  241  THR A CA  
2302 C C   . THR A 317 ? 1.3751 1.8167 2.8878 -0.1159 -0.0199 0.1544  241  THR A C   
2303 O O   . THR A 317 ? 0.8561 1.2839 2.3022 -0.0990 -0.0075 0.1653  241  THR A O   
2304 C CB  . THR A 317 ? 1.0701 1.4975 2.5254 -0.1306 -0.0646 0.0903  241  THR A CB  
2305 N N   . TYR A 320 ? 1.3038 1.6816 2.6632 0.0047  0.1850  0.3498  244  TYR A N   
2306 C CA  . TYR A 320 ? 1.2990 1.7014 2.6697 0.0152  0.1900  0.3606  244  TYR A CA  
2307 C C   . TYR A 320 ? 1.3447 1.7310 2.6552 0.0396  0.2179  0.3759  244  TYR A C   
2308 O O   . TYR A 320 ? 1.3527 1.7113 2.6137 0.0473  0.2314  0.3772  244  TYR A O   
2309 C CB  . TYR A 320 ? 1.3030 1.7197 2.6642 0.0074  0.1581  0.3350  244  TYR A CB  
2310 C CG  . TYR A 320 ? 1.3246 1.7810 2.7416 0.0074  0.1527  0.3449  244  TYR A CG  
2311 C CD1 . TYR A 320 ? 1.3484 1.8342 2.8483 -0.0092 0.1408  0.3468  244  TYR A CD1 
2312 C CD2 . TYR A 320 ? 1.3348 1.7999 2.7248 0.0237  0.1591  0.3521  244  TYR A CD2 
2313 C CE1 . TYR A 320 ? 1.3558 1.8816 2.9098 -0.0094 0.1345  0.3564  244  TYR A CE1 
2314 C CE2 . TYR A 320 ? 1.3431 1.8469 2.7860 0.0247  0.1539  0.3630  244  TYR A CE2 
2315 C CZ  . TYR A 320 ? 1.4295 1.9650 2.9539 0.0081  0.1412  0.3654  244  TYR A CZ  
2316 O OH  . TYR A 320 ? 1.4252 2.0020 3.0041 0.0089  0.1348  0.3764  244  TYR A OH  
2317 N N   . GLY A 321 ? 1.2828 1.6880 2.6014 0.0518  0.2265  0.3874  245  GLY A N   
2318 C CA  . GLY A 321 ? 1.2858 1.6782 2.5537 0.0753  0.2525  0.3995  245  GLY A CA  
2319 C C   . GLY A 321 ? 1.3032 1.6834 2.5129 0.0813  0.2388  0.3789  245  GLY A C   
2320 O O   . GLY A 321 ? 1.3080 1.6580 2.4498 0.0903  0.2450  0.3689  245  GLY A O   
2321 N N   . LYS A 322 ? 1.2204 1.6257 2.4589 0.0762  0.2196  0.3731  246  LYS A N   
2322 C CA  . LYS A 322 ? 1.1976 1.5967 2.3917 0.0817  0.2059  0.3570  246  LYS A CA  
2323 C C   . LYS A 322 ? 1.1913 1.5794 2.3582 0.0657  0.1751  0.3286  246  LYS A C   
2324 O O   . LYS A 322 ? 1.1815 1.5473 2.2896 0.0712  0.1703  0.3142  246  LYS A O   
2325 C CB  . LYS A 322 ? 1.2215 1.6564 2.4603 0.0857  0.2004  0.3675  246  LYS A CB  
2326 N N   . ASN A 323 ? 1.1075 1.5107 2.3189 0.0463  0.1552  0.3202  247  ASN A N   
2327 C CA  . ASN A 323 ? 1.0766 1.4731 2.2698 0.0307  0.1261  0.2927  247  ASN A CA  
2328 C C   . ASN A 323 ? 1.0826 1.4432 2.2344 0.0269  0.1303  0.2825  247  ASN A C   
2329 O O   . ASN A 323 ? 1.0670 1.4187 2.1994 0.0155  0.1087  0.2598  247  ASN A O   
2330 C CB  . ASN A 323 ? 1.0852 1.5138 2.3453 0.0119  0.1026  0.2852  247  ASN A CB  
2331 N N   . ARG A 324 ? 1.0200 1.3619 2.1571 0.0374  0.1578  0.2993  248  ARG A N   
2332 C CA  . ARG A 324 ? 1.0060 1.3168 2.1026 0.0357  0.1619  0.2918  248  ARG A CA  
2333 C C   . ARG A 324 ? 1.0174 1.3015 2.0371 0.0463  0.1625  0.2788  248  ARG A C   
2334 O O   . ARG A 324 ? 1.0140 1.2764 1.9976 0.0408  0.1537  0.2635  248  ARG A O   
2335 C CB  . ARG A 324 ? 1.0267 1.3315 2.1397 0.0425  0.1897  0.3158  248  ARG A CB  
2336 C CG  . ARG A 324 ? 1.1829 1.4806 2.2625 0.0648  0.2191  0.3342  248  ARG A CG  
2337 C CD  . ARG A 324 ? 1.3231 1.5988 2.3685 0.0731  0.2389  0.3436  248  ARG A CD  
2338 N NE  . ARG A 324 ? 1.4631 1.7265 2.4556 0.0946  0.2611  0.3503  248  ARG A NE  
2339 C CZ  . ARG A 324 ? 1.6415 1.8800 2.5655 0.1012  0.2579  0.3329  248  ARG A CZ  
2340 N NH1 . ARG A 324 ? 1.5027 1.7265 2.4021 0.0887  0.2345  0.3103  248  ARG A NH1 
2341 N NH2 . ARG A 324 ? 1.4500 1.6785 2.3310 0.1205  0.2784  0.3373  248  ARG A NH2 
2342 N N   . ILE A 325 ? 0.9499 1.2359 1.9485 0.0612  0.1730  0.2849  249  ILE A N   
2343 C CA  . ILE A 325 ? 0.9423 1.2033 1.8747 0.0719  0.1757  0.2735  249  ILE A CA  
2344 C C   . ILE A 325 ? 0.9505 1.2081 1.8629 0.0608  0.1478  0.2501  249  ILE A C   
2345 O O   . ILE A 325 ? 0.9402 1.1726 1.8038 0.0603  0.1435  0.2357  249  ILE A O   
2346 C CB  . ILE A 325 ? 0.9924 1.2588 1.9199 0.0899  0.1934  0.2860  249  ILE A CB  
2347 C CG1 . ILE A 325 ? 1.0219 1.2926 1.9670 0.1026  0.2232  0.3095  249  ILE A CG1 
2348 C CG2 . ILE A 325 ? 1.0061 1.2458 1.8716 0.1001  0.1958  0.2727  249  ILE A CG2 
2349 C CD1 . ILE A 325 ? 1.1307 1.4303 2.1255 0.1106  0.2340  0.3291  249  ILE A CD1 
2350 N N   . THR A 326 ? 0.8802 1.1656 1.8318 0.0519  0.1287  0.2467  250  THR A N   
2351 C CA  . THR A 326 ? 0.8563 1.1461 1.7937 0.0427  0.1021  0.2265  250  THR A CA  
2352 C C   . THR A 326 ? 0.8826 1.1615 1.8158 0.0273  0.0868  0.2091  250  THR A C   
2353 O O   . THR A 326 ? 0.8803 1.1430 1.7719 0.0250  0.0756  0.1924  250  THR A O   
2354 C CB  . THR A 326 ? 0.9013 1.2286 1.8810 0.0398  0.0866  0.2291  250  THR A CB  
2355 O OG1 . THR A 326 ? 0.8249 1.1592 1.7908 0.0306  0.0603  0.2091  250  THR A OG1 
2356 C CG2 . THR A 326 ? 0.8973 1.2529 1.9450 0.0316  0.0858  0.2400  250  THR A CG2 
2357 N N   . ARG A 327 ? 0.8147 1.1014 1.7925 0.0173  0.0878  0.2137  251  ARG A N   
2358 C CA  . ARG A 327 ? 0.7956 1.0713 1.7766 0.0032  0.0752  0.1983  251  ARG A CA  
2359 C C   . ARG A 327 ? 0.8308 1.0721 1.7589 0.0085  0.0861  0.1956  251  ARG A C   
2360 O O   . ARG A 327 ? 0.8282 1.0564 1.7321 0.0010  0.0720  0.1774  251  ARG A O   
2361 C CB  . ARG A 327 ? 0.7984 1.0879 1.8445 -0.0075 0.0776  0.2070  251  ARG A CB  
2362 N N   . ASP A 328 ? 0.7840 1.0126 1.6926 0.0222  0.1109  0.2131  252  ASP A N   
2363 C CA  . ASP A 328 ? 0.7860 0.9855 1.6432 0.0292  0.1221  0.2120  252  ASP A CA  
2364 C C   . ASP A 328 ? 0.8043 0.9879 1.6072 0.0315  0.1108  0.1935  252  ASP A C   
2365 O O   . ASP A 328 ? 0.8008 0.9657 1.5729 0.0276  0.1047  0.1818  252  ASP A O   
2366 C CB  . ASP A 328 ? 0.8302 1.0249 1.6762 0.0456  0.1502  0.2331  252  ASP A CB  
2367 C CG  . ASP A 328 ? 0.9788 1.1814 1.8658 0.0456  0.1667  0.2542  252  ASP A CG  
2368 O OD1 . ASP A 328 ? 0.9813 1.1955 1.9178 0.0315  0.1563  0.2538  252  ASP A OD1 
2369 O OD2 . ASP A 328 ? 1.0574 1.2552 1.9284 0.0600  0.1905  0.2713  252  ASP A OD2 
2370 N N   . GLN A 329 ? 0.7357 0.9280 1.5316 0.0376  0.1081  0.1924  253  GLN A N   
2371 C CA  . GLN A 329 ? 0.7215 0.9014 1.4738 0.0407  0.0992  0.1783  253  GLN A CA  
2372 C C   . GLN A 329 ? 0.7233 0.9061 1.4734 0.0273  0.0748  0.1593  253  GLN A C   
2373 O O   . GLN A 329 ? 0.7269 0.8910 1.4371 0.0270  0.0695  0.1470  253  GLN A O   
2374 C CB  . GLN A 329 ? 0.7426 0.9358 1.5009 0.0504  0.1029  0.1857  253  GLN A CB  
2375 C CG  . GLN A 329 ? 1.0523 1.2242 1.7633 0.0602  0.1078  0.1794  253  GLN A CG  
2376 C CD  . GLN A 329 ? 1.4136 1.5947 2.1340 0.0730  0.1188  0.1912  253  GLN A CD  
2377 O OE1 . GLN A 329 ? 1.3742 1.5766 2.1157 0.0722  0.1078  0.1936  253  GLN A OE1 
2378 N NE2 . GLN A 329 ? 1.3703 1.5361 2.0743 0.0860  0.1409  0.1988  253  GLN A NE2 
2379 N N   . VAL A 330 ? 0.6312 0.8380 1.4249 0.0166  0.0603  0.1562  254  VAL A N   
2380 C CA  . VAL A 330 ? 0.6023 0.8154 1.3975 0.0044  0.0371  0.1366  254  VAL A CA  
2381 C C   . VAL A 330 ? 0.6334 0.8245 1.4158 -0.0026 0.0369  0.1278  254  VAL A C   
2382 O O   . VAL A 330 ? 0.6250 0.8057 1.3791 -0.0065 0.0253  0.1120  254  VAL A O   
2383 C CB  . VAL A 330 ? 0.6401 0.8864 1.4885 -0.0050 0.0219  0.1339  254  VAL A CB  
2384 C CG1 . VAL A 330 ? 0.6306 0.8834 1.4782 -0.0168 -0.0017 0.1108  254  VAL A CG1 
2385 C CG2 . VAL A 330 ? 0.6362 0.9074 1.4971 0.0030  0.0210  0.1441  254  VAL A CG2 
2386 N N   . LEU A 331 ? 0.5799 0.7647 1.3834 -0.0029 0.0510  0.1402  255  LEU A N   
2387 C CA  . LEU A 331 ? 0.5741 0.7397 1.3707 -0.0078 0.0533  0.1367  255  LEU A CA  
2388 C C   . LEU A 331 ? 0.6228 0.7636 1.3627 0.0005  0.0604  0.1347  255  LEU A C   
2389 O O   . LEU A 331 ? 0.6117 0.7386 1.3353 -0.0045 0.0539  0.1244  255  LEU A O   
2390 C CB  . LEU A 331 ? 0.5797 0.7475 1.4156 -0.0081 0.0690  0.1552  255  LEU A CB  
2391 C CG  . LEU A 331 ? 0.6294 0.8186 1.5297 -0.0202 0.0604  0.1545  255  LEU A CG  
2392 C CD1 . LEU A 331 ? 0.6365 0.8318 1.5781 -0.0170 0.0806  0.1792  255  LEU A CD1 
2393 C CD2 . LEU A 331 ? 0.6613 0.8447 1.5753 -0.0338 0.0439  0.1352  255  LEU A CD2 
2394 N N   . LYS A 332 ? 0.5951 0.7308 1.3070 0.0130  0.0732  0.1433  256  LYS A N   
2395 C CA  . LYS A 332 ? 0.6053 0.7186 1.2646 0.0209  0.0790  0.1391  256  LYS A CA  
2396 C C   . LYS A 332 ? 0.6535 0.7607 1.2864 0.0159  0.0619  0.1204  256  LYS A C   
2397 O O   . LYS A 332 ? 0.6369 0.7268 1.2386 0.0153  0.0596  0.1123  256  LYS A O   
2398 C CB  . LYS A 332 ? 0.6454 0.7553 1.2862 0.0351  0.0960  0.1496  256  LYS A CB  
2399 C CG  . LYS A 332 ? 0.8806 0.9887 1.5258 0.0441  0.1173  0.1674  256  LYS A CG  
2400 C CD  . LYS A 332 ? 1.0594 1.1556 1.6919 0.0426  0.1209  0.1698  256  LYS A CD  
2401 C CE  . LYS A 332 ? 1.1854 1.2611 1.7643 0.0473  0.1198  0.1590  256  LYS A CE  
2402 N NZ  . LYS A 332 ? 1.2119 1.2811 1.7840 0.0463  0.1222  0.1640  256  LYS A NZ  
2403 N N   . MET A 333 ? 0.6143 0.7383 1.2619 0.0126  0.0498  0.1148  257  MET A N   
2404 C CA  . MET A 333 ? 0.6132 0.7371 1.2408 0.0088  0.0341  0.0997  257  MET A CA  
2405 C C   . MET A 333 ? 0.6797 0.8026 1.3144 -0.0024 0.0205  0.0860  257  MET A C   
2406 O O   . MET A 333 ? 0.6855 0.7989 1.2935 -0.0044 0.0125  0.0743  257  MET A O   
2407 C CB  . MET A 333 ? 0.6385 0.7856 1.2826 0.0103  0.0260  0.1008  257  MET A CB  
2408 C CG  . MET A 333 ? 0.7001 0.8451 1.3336 0.0226  0.0392  0.1128  257  MET A CG  
2409 S SD  . MET A 333 ? 0.7605 0.9388 1.4291 0.0259  0.0340  0.1223  257  MET A SD  
2410 C CE  . MET A 333 ? 0.7140 0.8990 1.3604 0.0253  0.0179  0.1117  257  MET A CE  
2411 N N   . ALA A 334 ? 0.6265 0.7589 1.3002 -0.0096 0.0190  0.0879  258  ALA A N   
2412 C CA  . ALA A 334 ? 0.6114 0.7414 1.2991 -0.0201 0.0083  0.0751  258  ALA A CA  
2413 C C   . ALA A 334 ? 0.6355 0.7418 1.3022 -0.0186 0.0171  0.0778  258  ALA A C   
2414 O O   . ALA A 334 ? 0.6294 0.7271 1.2861 -0.0237 0.0086  0.0652  258  ALA A O   
2415 C CB  . ALA A 334 ? 0.6193 0.7657 1.3610 -0.0282 0.0055  0.0772  258  ALA A CB  
2416 N N   . ALA A 335 ? 0.5707 0.6684 1.2301 -0.0106 0.0343  0.0945  259  ALA A N   
2417 C CA  . ALA A 335 ? 0.5662 0.6458 1.2049 -0.0071 0.0434  0.1001  259  ALA A CA  
2418 C C   . ALA A 335 ? 0.6103 0.6753 1.2008 -0.0032 0.0398  0.0907  259  ALA A C   
2419 O O   . ALA A 335 ? 0.6026 0.6558 1.1784 -0.0043 0.0385  0.0878  259  ALA A O   
2420 C CB  . ALA A 335 ? 0.5866 0.6656 1.2284 0.0023  0.0629  0.1206  259  ALA A CB  
2421 N N   . ALA A 336 ? 0.5819 0.6485 1.1515 0.0015  0.0385  0.0872  260  ALA A N   
2422 C CA  . ALA A 336 ? 0.5806 0.6338 1.1094 0.0052  0.0362  0.0791  260  ALA A CA  
2423 C C   . ALA A 336 ? 0.6494 0.6998 1.1702 -0.0022 0.0218  0.0644  260  ALA A C   
2424 O O   . ALA A 336 ? 0.6540 0.6911 1.1503 -0.0016 0.0213  0.0603  260  ALA A O   
2425 C CB  . ALA A 336 ? 0.5886 0.6455 1.1080 0.0111  0.0385  0.0799  260  ALA A CB  
2426 N N   . VAL A 337 ? 0.6108 0.6753 1.1524 -0.0087 0.0102  0.0562  261  VAL A N   
2427 C CA  . VAL A 337 ? 0.6055 0.6703 1.1398 -0.0144 -0.0028 0.0415  261  VAL A CA  
2428 C C   . VAL A 337 ? 0.6383 0.6929 1.1781 -0.0193 -0.0041 0.0376  261  VAL A C   
2429 O O   . VAL A 337 ? 0.6298 0.6772 1.1514 -0.0206 -0.0096 0.0288  261  VAL A O   
2430 C CB  . VAL A 337 ? 0.6533 0.7388 1.2065 -0.0188 -0.0152 0.0325  261  VAL A CB  
2431 C CG1 . VAL A 337 ? 0.6476 0.7433 1.1903 -0.0125 -0.0148 0.0373  261  VAL A CG1 
2432 C CG2 . VAL A 337 ? 0.6572 0.7554 1.2516 -0.0246 -0.0173 0.0332  261  VAL A CG2 
2433 N N   . VAL A 338 ? 0.5916 0.6458 1.1581 -0.0210 0.0023  0.0460  262  VAL A N   
2434 C CA  . VAL A 338 ? 0.5911 0.6357 1.1678 -0.0245 0.0029  0.0454  262  VAL A CA  
2435 C C   . VAL A 338 ? 0.6442 0.6750 1.1923 -0.0176 0.0121  0.0556  262  VAL A C   
2436 O O   . VAL A 338 ? 0.6472 0.6695 1.1855 -0.0186 0.0090  0.0515  262  VAL A O   
2437 C CB  . VAL A 338 ? 0.6412 0.6916 1.2650 -0.0301 0.0056  0.0502  262  VAL A CB  
2438 C CG1 . VAL A 338 ? 0.6460 0.6981 1.2822 -0.0245 0.0207  0.0709  262  VAL A CG1 
2439 C CG2 . VAL A 338 ? 0.6415 0.6821 1.2808 -0.0346 0.0038  0.0459  262  VAL A CG2 
2440 N N   . LEU A 339 ? 0.5966 0.6264 1.1304 -0.0099 0.0229  0.0676  263  LEU A N   
2441 C CA  . LEU A 339 ? 0.6038 0.6236 1.1079 -0.0024 0.0307  0.0755  263  LEU A CA  
2442 C C   . LEU A 339 ? 0.6527 0.6646 1.1212 -0.0016 0.0233  0.0637  263  LEU A C   
2443 O O   . LEU A 339 ? 0.6609 0.6657 1.1112 0.0003  0.0227  0.0640  263  LEU A O   
2444 C CB  . LEU A 339 ? 0.6185 0.6406 1.1168 0.0065  0.0448  0.0893  263  LEU A CB  
2445 C CG  . LEU A 339 ? 0.6920 0.7163 1.2067 0.0111  0.0576  0.1079  263  LEU A CG  
2446 C CD1 . LEU A 339 ? 0.6911 0.7249 1.2557 0.0045  0.0590  0.1139  263  LEU A CD1 
2447 C CD2 . LEU A 339 ? 0.7295 0.7548 1.2235 0.0228  0.0721  0.1196  263  LEU A CD2 
2448 N N   . ALA A 340 ? 0.5985 0.6131 1.0603 -0.0031 0.0176  0.0545  264  ALA A N   
2449 C CA  . ALA A 340 ? 0.5895 0.5972 1.0240 -0.0030 0.0116  0.0446  264  ALA A CA  
2450 C C   . ALA A 340 ? 0.6345 0.6411 1.0705 -0.0090 0.0015  0.0354  264  ALA A C   
2451 O O   . ALA A 340 ? 0.6264 0.6259 1.0417 -0.0086 -0.0017 0.0306  264  ALA A O   
2452 C CB  . ALA A 340 ? 0.5936 0.6063 1.0270 -0.0022 0.0099  0.0409  264  ALA A CB  
2453 N N   . PHE A 341 ? 0.5909 0.6046 1.0528 -0.0143 -0.0033 0.0320  265  PHE A N   
2454 C CA  . PHE A 341 ? 0.5850 0.5976 1.0505 -0.0189 -0.0113 0.0225  265  PHE A CA  
2455 C C   . PHE A 341 ? 0.6593 0.6631 1.1212 -0.0174 -0.0082 0.0284  265  PHE A C   
2456 O O   . PHE A 341 ? 0.6507 0.6505 1.0994 -0.0179 -0.0130 0.0231  265  PHE A O   
2457 C CB  . PHE A 341 ? 0.6001 0.6219 1.0952 -0.0246 -0.0169 0.0148  265  PHE A CB  
2458 C CG  . PHE A 341 ? 0.6149 0.6360 1.1134 -0.0283 -0.0245 0.0022  265  PHE A CG  
2459 C CD1 . PHE A 341 ? 0.6416 0.6694 1.1265 -0.0286 -0.0317 -0.0088 265  PHE A CD1 
2460 C CD2 . PHE A 341 ? 0.6478 0.6623 1.1649 -0.0304 -0.0231 0.0025  265  PHE A CD2 
2461 C CE1 . PHE A 341 ? 0.6507 0.6787 1.1377 -0.0306 -0.0372 -0.0205 265  PHE A CE1 
2462 C CE2 . PHE A 341 ? 0.6839 0.6970 1.2051 -0.0328 -0.0289 -0.0098 265  PHE A CE2 
2463 C CZ  . PHE A 341 ? 0.6517 0.6718 1.1567 -0.0328 -0.0358 -0.0219 265  PHE A CZ  
2464 N N   . ILE A 342 ? 0.6425 0.6452 1.1174 -0.0148 0.0001  0.0411  266  ILE A N   
2465 C CA  . ILE A 342 ? 0.6592 0.6566 1.1321 -0.0118 0.0035  0.0500  266  ILE A CA  
2466 C C   . ILE A 342 ? 0.7365 0.7304 1.1738 -0.0055 0.0050  0.0536  266  ILE A C   
2467 O O   . ILE A 342 ? 0.7503 0.7421 1.1787 -0.0038 0.0026  0.0558  266  ILE A O   
2468 C CB  . ILE A 342 ? 0.7044 0.7029 1.2060 -0.0103 0.0128  0.0649  266  ILE A CB  
2469 C CG1 . ILE A 342 ? 0.7279 0.7306 1.2274 -0.0048 0.0235  0.0776  266  ILE A CG1 
2470 C CG2 . ILE A 342 ? 0.6984 0.6985 1.2391 -0.0180 0.0093  0.0576  266  ILE A CG2 
2471 C CD1 . ILE A 342 ? 0.8758 0.8797 1.3905 0.0011  0.0360  0.0987  266  ILE A CD1 
2472 N N   . ILE A 343 ? 0.6834 0.6771 1.1018 -0.0022 0.0082  0.0529  267  ILE A N   
2473 C CA  . ILE A 343 ? 0.6969 0.6864 1.0824 0.0030  0.0084  0.0521  267  ILE A CA  
2474 C C   . ILE A 343 ? 0.7513 0.7376 1.1249 -0.0016 -0.0023 0.0391  267  ILE A C   
2475 O O   . ILE A 343 ? 0.7636 0.7486 1.1210 0.0001  -0.0061 0.0383  267  ILE A O   
2476 C CB  . ILE A 343 ? 0.7456 0.7337 1.1165 0.0084  0.0161  0.0533  267  ILE A CB  
2477 C CG1 . ILE A 343 ? 0.7661 0.7591 1.1460 0.0151  0.0287  0.0688  267  ILE A CG1 
2478 C CG2 . ILE A 343 ? 0.7622 0.7441 1.1004 0.0119  0.0139  0.0451  267  ILE A CG2 
2479 C CD1 . ILE A 343 ? 0.9294 0.9256 1.3042 0.0211  0.0334  0.0822  267  ILE A CD1 
2480 N N   . CYS A 344 ? 0.6816 0.6687 1.0650 -0.0069 -0.0070 0.0303  268  CYS A N   
2481 C CA  . CYS A 344 ? 0.6668 0.6524 1.0425 -0.0106 -0.0148 0.0203  268  CYS A CA  
2482 C C   . CYS A 344 ? 0.6755 0.6632 1.0614 -0.0138 -0.0206 0.0179  268  CYS A C   
2483 O O   . CYS A 344 ? 0.6709 0.6574 1.0469 -0.0149 -0.0257 0.0138  268  CYS A O   
2484 C CB  . CYS A 344 ? 0.6710 0.6596 1.0520 -0.0127 -0.0159 0.0149  268  CYS A CB  
2485 S SG  . CYS A 344 ? 0.7350 0.7191 1.1032 -0.0083 -0.0091 0.0166  268  CYS A SG  
2486 N N   . TRP A 345 ? 0.6110 0.6017 1.0194 -0.0154 -0.0198 0.0198  269  TRP A N   
2487 C CA  . TRP A 345 ? 0.6013 0.5929 1.0219 -0.0177 -0.0241 0.0159  269  TRP A CA  
2488 C C   . TRP A 345 ? 0.6117 0.6015 1.0432 -0.0151 -0.0212 0.0260  269  TRP A C   
2489 O O   . TRP A 345 ? 0.5933 0.5831 1.0303 -0.0155 -0.0246 0.0239  269  TRP A O   
2490 C CB  . TRP A 345 ? 0.5873 0.5832 1.0272 -0.0216 -0.0264 0.0068  269  TRP A CB  
2491 C CG  . TRP A 345 ? 0.5996 0.6005 1.0285 -0.0229 -0.0307 -0.0023 269  TRP A CG  
2492 C CD1 . TRP A 345 ? 0.6337 0.6401 1.0606 -0.0229 -0.0306 -0.0042 269  TRP A CD1 
2493 C CD2 . TRP A 345 ? 0.6006 0.6030 1.0201 -0.0232 -0.0345 -0.0080 269  TRP A CD2 
2494 N NE1 . TRP A 345 ? 0.6250 0.6365 1.0416 -0.0228 -0.0339 -0.0099 269  TRP A NE1 
2495 C CE2 . TRP A 345 ? 0.6476 0.6564 1.0596 -0.0231 -0.0359 -0.0122 269  TRP A CE2 
2496 C CE3 . TRP A 345 ? 0.6181 0.6186 1.0370 -0.0229 -0.0364 -0.0083 269  TRP A CE3 
2497 C CZ2 . TRP A 345 ? 0.6374 0.6503 1.0414 -0.0227 -0.0379 -0.0159 269  TRP A CZ2 
2498 C CZ3 . TRP A 345 ? 0.6337 0.6382 1.0457 -0.0232 -0.0389 -0.0131 269  TRP A CZ3 
2499 C CH2 . TRP A 345 ? 0.6400 0.6505 1.0448 -0.0230 -0.0391 -0.0165 269  TRP A CH2 
2500 N N   . LEU A 346 ? 0.5522 0.5416 0.9883 -0.0114 -0.0140 0.0383  270  LEU A N   
2501 C CA  . LEU A 346 ? 0.5431 0.5324 0.9915 -0.0074 -0.0099 0.0514  270  LEU A CA  
2502 C C   . LEU A 346 ? 0.5766 0.5685 1.0035 -0.0032 -0.0141 0.0555  270  LEU A C   
2503 O O   . LEU A 346 ? 0.5856 0.5783 1.0257 -0.0023 -0.0156 0.0592  270  LEU A O   
2504 C CB  . LEU A 346 ? 0.5526 0.5431 1.0108 -0.0031 0.0005  0.0669  270  LEU A CB  
2505 C CG  . LEU A 346 ? 0.6232 0.6148 1.0971 0.0025  0.0072  0.0850  270  LEU A CG  
2506 C CD1 . LEU A 346 ? 0.6183 0.6051 1.1338 -0.0021 0.0094  0.0844  270  LEU A CD1 
2507 C CD2 . LEU A 346 ? 0.6663 0.6623 1.1344 0.0099  0.0180  0.1027  270  LEU A CD2 
2508 N N   . PRO A 347 ? 0.5158 0.5096 0.9126 -0.0008 -0.0168 0.0535  271  PRO A N   
2509 C CA  . PRO A 347 ? 0.5168 0.5157 0.8964 0.0023  -0.0231 0.0555  271  PRO A CA  
2510 C C   . PRO A 347 ? 0.5678 0.5679 0.9580 -0.0018 -0.0306 0.0485  271  PRO A C   
2511 O O   . PRO A 347 ? 0.5845 0.5902 0.9794 0.0017  -0.0328 0.0566  271  PRO A O   
2512 C CB  . PRO A 347 ? 0.5428 0.5411 0.8934 0.0027  -0.0260 0.0472  271  PRO A CB  
2513 C CG  . PRO A 347 ? 0.6018 0.5964 0.9518 0.0046  -0.0170 0.0501  271  PRO A CG  
2514 C CD  . PRO A 347 ? 0.5342 0.5259 0.9133 -0.0003 -0.0143 0.0491  271  PRO A CD  
2515 N N   . PHE A 348 ? 0.5053 0.5016 0.9004 -0.0080 -0.0335 0.0353  272  PHE A N   
2516 C CA  . PHE A 348 ? 0.4929 0.4910 0.8980 -0.0111 -0.0387 0.0286  272  PHE A CA  
2517 C C   . PHE A 348 ? 0.5469 0.5441 0.9789 -0.0099 -0.0352 0.0324  272  PHE A C   
2518 O O   . PHE A 348 ? 0.5564 0.5572 0.9965 -0.0083 -0.0378 0.0346  272  PHE A O   
2519 C CB  . PHE A 348 ? 0.5065 0.5029 0.9088 -0.0161 -0.0405 0.0159  272  PHE A CB  
2520 C CG  . PHE A 348 ? 0.5218 0.5210 0.9370 -0.0180 -0.0427 0.0094  272  PHE A CG  
2521 C CD1 . PHE A 348 ? 0.5599 0.5640 0.9731 -0.0183 -0.0474 0.0092  272  PHE A CD1 
2522 C CD2 . PHE A 348 ? 0.5487 0.5470 0.9790 -0.0190 -0.0399 0.0029  272  PHE A CD2 
2523 C CE1 . PHE A 348 ? 0.5665 0.5743 0.9922 -0.0187 -0.0475 0.0045  272  PHE A CE1 
2524 C CE2 . PHE A 348 ? 0.5730 0.5747 1.0127 -0.0191 -0.0407 -0.0040 272  PHE A CE2 
2525 C CZ  . PHE A 348 ? 0.5467 0.5530 0.9839 -0.0185 -0.0436 -0.0023 272  PHE A CZ  
2526 N N   . HIS A 349 ? 0.4860 0.4784 0.9345 -0.0109 -0.0295 0.0321  273  HIS A N   
2527 C CA  . HIS A 349 ? 0.4806 0.4695 0.9588 -0.0107 -0.0258 0.0326  273  HIS A CA  
2528 C C   . HIS A 349 ? 0.5316 0.5211 1.0217 -0.0047 -0.0213 0.0504  273  HIS A C   
2529 O O   . HIS A 349 ? 0.5230 0.5100 1.0364 -0.0031 -0.0193 0.0522  273  HIS A O   
2530 C CB  . HIS A 349 ? 0.4865 0.4712 0.9817 -0.0146 -0.0223 0.0257  273  HIS A CB  
2531 C CG  . HIS A 349 ? 0.5223 0.5093 1.0126 -0.0190 -0.0272 0.0081  273  HIS A CG  
2532 N ND1 . HIS A 349 ? 0.5428 0.5294 1.0474 -0.0202 -0.0287 -0.0040 273  HIS A ND1 
2533 C CD2 . HIS A 349 ? 0.5433 0.5341 1.0150 -0.0211 -0.0300 0.0022  273  HIS A CD2 
2534 C CE1 . HIS A 349 ? 0.5341 0.5262 1.0263 -0.0225 -0.0327 -0.0163 273  HIS A CE1 
2535 N NE2 . HIS A 349 ? 0.5368 0.5316 1.0105 -0.0232 -0.0335 -0.0120 273  HIS A NE2 
2536 N N   . VAL A 350 ? 0.4970 0.4908 0.9704 -0.0001 -0.0194 0.0639  274  VAL A N   
2537 C CA  . VAL A 350 ? 0.5076 0.5063 0.9871 0.0078  -0.0152 0.0840  274  VAL A CA  
2538 C C   . VAL A 350 ? 0.5308 0.5374 1.0034 0.0105  -0.0227 0.0853  274  VAL A C   
2539 O O   . VAL A 350 ? 0.5121 0.5201 1.0060 0.0149  -0.0201 0.0958  274  VAL A O   
2540 C CB  . VAL A 350 ? 0.5713 0.5756 1.0294 0.0134  -0.0110 0.0970  274  VAL A CB  
2541 C CG1 . VAL A 350 ? 0.5804 0.5959 1.0310 0.0233  -0.0103 0.1169  274  VAL A CG1 
2542 C CG2 . VAL A 350 ? 0.5675 0.5659 1.0447 0.0126  -0.0007 0.1027  274  VAL A CG2 
2543 N N   . LEU A 351 ? 0.4930 0.5044 0.9399 0.0075  -0.0317 0.0744  275  LEU A N   
2544 C CA  . LEU A 351 ? 0.4948 0.5155 0.9351 0.0081  -0.0405 0.0730  275  LEU A CA  
2545 C C   . LEU A 351 ? 0.5371 0.5550 1.0024 0.0061  -0.0401 0.0671  275  LEU A C   
2546 O O   . LEU A 351 ? 0.5352 0.5613 1.0093 0.0099  -0.0432 0.0744  275  LEU A O   
2547 C CB  . LEU A 351 ? 0.4924 0.5153 0.9065 0.0030  -0.0486 0.0597  275  LEU A CB  
2548 C CG  . LEU A 351 ? 0.5649 0.5979 0.9522 0.0066  -0.0551 0.0636  275  LEU A CG  
2549 C CD1 . LEU A 351 ? 0.5752 0.6088 0.9515 0.0134  -0.0480 0.0757  275  LEU A CD1 
2550 C CD2 . LEU A 351 ? 0.6050 0.6351 0.9734 0.0003  -0.0612 0.0476  275  LEU A CD2 
2551 N N   . THR A 352 ? 0.4947 0.5026 0.9709 0.0010  -0.0364 0.0540  276  THR A N   
2552 C CA  . THR A 352 ? 0.4949 0.4993 0.9923 -0.0002 -0.0346 0.0448  276  THR A CA  
2553 C C   . THR A 352 ? 0.5732 0.5726 1.1013 0.0048  -0.0273 0.0547  276  THR A C   
2554 O O   . THR A 352 ? 0.5830 0.5835 1.1281 0.0076  -0.0263 0.0544  276  THR A O   
2555 C CB  . THR A 352 ? 0.5428 0.5412 1.0374 -0.0061 -0.0338 0.0275  276  THR A CB  
2556 O OG1 . THR A 352 ? 0.5549 0.5585 1.0259 -0.0094 -0.0396 0.0213  276  THR A OG1 
2557 C CG2 . THR A 352 ? 0.4565 0.4516 0.9709 -0.0062 -0.0309 0.0156  276  THR A CG2 
2558 N N   . PHE A 353 ? 0.5357 0.5296 1.0738 0.0063  -0.0210 0.0645  277  PHE A N   
2559 C CA  . PHE A 353 ? 0.5391 0.5269 1.1113 0.0112  -0.0125 0.0763  277  PHE A CA  
2560 C C   . PHE A 353 ? 0.6122 0.6107 1.1857 0.0200  -0.0129 0.0974  277  PHE A C   
2561 O O   . PHE A 353 ? 0.6240 0.6200 1.2256 0.0247  -0.0081 0.1043  277  PHE A O   
2562 C CB  . PHE A 353 ? 0.5568 0.5368 1.1444 0.0102  -0.0046 0.0832  277  PHE A CB  
2563 C CG  . PHE A 353 ? 0.5740 0.5449 1.2041 0.0139  0.0053  0.0936  277  PHE A CG  
2564 C CD1 . PHE A 353 ? 0.6048 0.5638 1.2640 0.0101  0.0078  0.0766  277  PHE A CD1 
2565 C CD2 . PHE A 353 ? 0.6079 0.5825 1.2497 0.0221  0.0127  0.1204  277  PHE A CD2 
2566 C CE1 . PHE A 353 ? 0.6230 0.5712 1.3257 0.0134  0.0176  0.0849  277  PHE A CE1 
2567 C CE2 . PHE A 353 ? 0.6443 0.6093 1.3303 0.0259  0.0233  0.1322  277  PHE A CE2 
2568 C CZ  . PHE A 353 ? 0.6148 0.5652 1.3325 0.0210  0.0257  0.1136  277  PHE A CZ  
2569 N N   . LEU A 354 ? 0.5688 0.5801 1.1123 0.0226  -0.0189 0.1069  278  LEU A N   
2570 C CA  . LEU A 354 ? 0.5748 0.6017 1.1129 0.0312  -0.0224 0.1258  278  LEU A CA  
2571 C C   . LEU A 354 ? 0.6461 0.6803 1.1893 0.0311  -0.0295 0.1197  278  LEU A C   
2572 O O   . LEU A 354 ? 0.6561 0.6993 1.2155 0.0388  -0.0289 0.1353  278  LEU A O   
2573 C CB  . LEU A 354 ? 0.5764 0.6158 1.0768 0.0331  -0.0291 0.1307  278  LEU A CB  
2574 C CG  . LEU A 354 ? 0.6331 0.6714 1.1272 0.0376  -0.0208 0.1444  278  LEU A CG  
2575 C CD1 . LEU A 354 ? 0.6306 0.6788 1.0838 0.0382  -0.0276 0.1412  278  LEU A CD1 
2576 C CD2 . LEU A 354 ? 0.6861 0.7315 1.2003 0.0489  -0.0126 0.1721  278  LEU A CD2 
2577 N N   . ASP A 355 ? 0.6033 0.6347 1.1349 0.0231  -0.0351 0.0989  279  ASP A N   
2578 C CA  . ASP A 355 ? 0.6026 0.6407 1.1402 0.0220  -0.0402 0.0915  279  ASP A CA  
2579 C C   . ASP A 355 ? 0.6411 0.6702 1.2127 0.0250  -0.0313 0.0898  279  ASP A C   
2580 O O   . ASP A 355 ? 0.6597 0.6972 1.2459 0.0295  -0.0323 0.0953  279  ASP A O   
2581 C CB  . ASP A 355 ? 0.6243 0.6610 1.1422 0.0132  -0.0458 0.0720  279  ASP A CB  
2582 C CG  . ASP A 355 ? 0.8111 0.8534 1.3392 0.0120  -0.0479 0.0641  279  ASP A CG  
2583 O OD1 . ASP A 355 ? 0.8334 0.8906 1.3625 0.0140  -0.0549 0.0717  279  ASP A OD1 
2584 O OD2 . ASP A 355 ? 0.8892 0.9228 1.4250 0.0096  -0.0424 0.0508  279  ASP A OD2 
2585 N N   . ALA A 356 ? 0.5704 0.5830 1.1563 0.0227  -0.0229 0.0813  280  ALA A N   
2586 C CA  . ALA A 356 ? 0.5688 0.5699 1.1878 0.0252  -0.0141 0.0753  280  ALA A CA  
2587 C C   . ALA A 356 ? 0.6322 0.6348 1.2797 0.0347  -0.0078 0.0974  280  ALA A C   
2588 O O   . ALA A 356 ? 0.6414 0.6425 1.3132 0.0396  -0.0033 0.0971  280  ALA A O   
2589 C CB  . ALA A 356 ? 0.5807 0.5658 1.2089 0.0198  -0.0086 0.0614  280  ALA A CB  
2590 N N   . LEU A 357 ? 0.5761 0.5833 1.2202 0.0386  -0.0069 0.1179  281  LEU A N   
2591 C CA  . LEU A 357 ? 0.5691 0.5807 1.2381 0.0493  -0.0004 0.1443  281  LEU A CA  
2592 C C   . LEU A 357 ? 0.5906 0.6231 1.2541 0.0560  -0.0081 0.1565  281  LEU A C   
2593 O O   . LEU A 357 ? 0.5797 0.6157 1.2716 0.0653  -0.0024 0.1738  281  LEU A O   
2594 C CB  . LEU A 357 ? 0.5709 0.5855 1.2321 0.0525  0.0029  0.1640  281  LEU A CB  
2595 C CG  . LEU A 357 ? 0.6082 0.6050 1.2802 0.0463  0.0110  0.1561  281  LEU A CG  
2596 C CD1 . LEU A 357 ? 0.6077 0.6124 1.2577 0.0483  0.0115  0.1715  281  LEU A CD1 
2597 C CD2 . LEU A 357 ? 0.6314 0.6113 1.3527 0.0489  0.0242  0.1612  281  LEU A CD2 
2598 N N   . ALA A 358 ? 0.5511 0.5977 1.1814 0.0512  -0.0209 0.1478  282  ALA A N   
2599 C CA  . ALA A 358 ? 0.5591 0.6277 1.1845 0.0552  -0.0309 0.1557  282  ALA A CA  
2600 C C   . ALA A 358 ? 0.6261 0.6918 1.2788 0.0566  -0.0267 0.1482  282  ALA A C   
2601 O O   . ALA A 358 ? 0.6324 0.7105 1.3061 0.0654  -0.0263 0.1645  282  ALA A O   
2602 C CB  . ALA A 358 ? 0.5607 0.6409 1.1491 0.0475  -0.0447 0.1437  282  ALA A CB  
2603 N N   . TRP A 359 ? 0.5853 0.6355 1.2383 0.0493  -0.0227 0.1245  283  TRP A N   
2604 C CA  . TRP A 359 ? 0.5912 0.6366 1.2671 0.0512  -0.0164 0.1138  283  TRP A CA  
2605 C C   . TRP A 359 ? 0.6796 0.7124 1.3951 0.0600  -0.0031 0.1228  283  TRP A C   
2606 O O   . TRP A 359 ? 0.6823 0.7184 1.4215 0.0665  0.0016  0.1249  283  TRP A O   
2607 C CB  . TRP A 359 ? 0.5681 0.6012 1.2303 0.0426  -0.0149 0.0870  283  TRP A CB  
2608 C CG  . TRP A 359 ? 0.5735 0.6197 1.2087 0.0361  -0.0249 0.0788  283  TRP A CG  
2609 C CD1 . TRP A 359 ? 0.6022 0.6473 1.2077 0.0277  -0.0314 0.0696  283  TRP A CD1 
2610 C CD2 . TRP A 359 ? 0.5698 0.6324 1.2097 0.0376  -0.0289 0.0807  283  TRP A CD2 
2611 N NE1 . TRP A 359 ? 0.5882 0.6463 1.1805 0.0236  -0.0390 0.0655  283  TRP A NE1 
2612 C CE2 . TRP A 359 ? 0.6070 0.6767 1.2207 0.0291  -0.0377 0.0722  283  TRP A CE2 
2613 C CE3 . TRP A 359 ? 0.5901 0.6626 1.2571 0.0455  -0.0252 0.0899  283  TRP A CE3 
2614 C CZ2 . TRP A 359 ? 0.5937 0.6794 1.2094 0.0274  -0.0428 0.0721  283  TRP A CZ2 
2615 C CZ3 . TRP A 359 ? 0.6051 0.6953 1.2726 0.0442  -0.0307 0.0903  283  TRP A CZ3 
2616 C CH2 . TRP A 359 ? 0.6038 0.7005 1.2468 0.0348  -0.0395 0.0815  283  TRP A CH2 
2617 N N   . MET A 360 ? 0.6555 0.6737 1.3812 0.0604  0.0037  0.1287  284  MET A N   
2618 C CA  . MET A 360 ? 0.6656 0.6690 1.4336 0.0680  0.0174  0.1387  284  MET A CA  
2619 C C   . MET A 360 ? 0.7009 0.7199 1.4879 0.0803  0.0188  0.1707  284  MET A C   
2620 O O   . MET A 360 ? 0.7127 0.7239 1.5387 0.0889  0.0298  0.1797  284  MET A O   
2621 C CB  . MET A 360 ? 0.7053 0.6916 1.4799 0.0637  0.0235  0.1383  284  MET A CB  
2622 C CG  . MET A 360 ? 0.7579 0.7245 1.5356 0.0547  0.0266  0.1080  284  MET A CG  
2623 S SD  . MET A 360 ? 0.8211 0.7796 1.5878 0.0465  0.0262  0.1079  284  MET A SD  
2624 C CE  . MET A 360 ? 0.7722 0.7246 1.5135 0.0344  0.0194  0.0697  284  MET A CE  
2625 N N   . GLY A 361 ? 0.6335 0.6746 1.3927 0.0816  0.0077  0.1871  285  GLY A N   
2626 C CA  . GLY A 361 ? 0.6326 0.6949 1.4017 0.0937  0.0058  0.2185  285  GLY A CA  
2627 C C   . GLY A 361 ? 0.6755 0.7397 1.4419 0.0990  0.0098  0.2420  285  GLY A C   
2628 O O   . GLY A 361 ? 0.6877 0.7681 1.4678 0.1114  0.0116  0.2717  285  GLY A O   
2629 N N   . VAL A 362 ? 0.6158 0.6658 1.3653 0.0906  0.0117  0.2306  286  VAL A N   
2630 C CA  . VAL A 362 ? 0.6292 0.6802 1.3754 0.0951  0.0174  0.2518  286  VAL A CA  
2631 C C   . VAL A 362 ? 0.7178 0.7981 1.4223 0.0994  0.0041  0.2657  286  VAL A C   
2632 O O   . VAL A 362 ? 0.7297 0.8289 1.4392 0.1122  0.0053  0.2956  286  VAL A O   
2633 C CB  . VAL A 362 ? 0.6692 0.6975 1.4128 0.0845  0.0234  0.2343  286  VAL A CB  
2634 C CG1 . VAL A 362 ? 0.6832 0.7104 1.4378 0.0908  0.0342  0.2602  286  VAL A CG1 
2635 C CG2 . VAL A 362 ? 0.6582 0.6605 1.4345 0.0777  0.0314  0.2105  286  VAL A CG2 
2636 N N   . ILE A 363 ? 0.6984 0.7831 1.3626 0.0892  -0.0086 0.2436  287  ILE A N   
2637 C CA  . ILE A 363 ? 0.7197 0.8300 1.3423 0.0912  -0.0229 0.2490  287  ILE A CA  
2638 C C   . ILE A 363 ? 0.7993 0.9288 1.4194 0.0911  -0.0366 0.2438  287  ILE A C   
2639 O O   . ILE A 363 ? 0.7870 0.9067 1.4129 0.0822  -0.0390 0.2217  287  ILE A O   
2640 C CB  . ILE A 363 ? 0.7574 0.8607 1.3416 0.0811  -0.0276 0.2295  287  ILE A CB  
2641 C CG1 . ILE A 363 ? 0.7760 0.9040 1.3172 0.0820  -0.0438 0.2282  287  ILE A CG1 
2642 C CG2 . ILE A 363 ? 0.7440 0.8254 1.3296 0.0673  -0.0272 0.1987  287  ILE A CG2 
2643 C CD1 . ILE A 363 ? 0.9378 1.0845 1.4610 0.0947  -0.0421 0.2544  287  ILE A CD1 
2644 N N   . ASN A 364 ? 0.7901 0.9485 1.4046 0.1020  -0.0447 0.2662  288  ASN A N   
2645 C CA  . ASN A 364 ? 0.7959 0.9777 1.4126 0.1030  -0.0587 0.2654  288  ASN A CA  
2646 C C   . ASN A 364 ? 0.8703 1.0824 1.4469 0.1035  -0.0782 0.2656  288  ASN A C   
2647 O O   . ASN A 364 ? 0.8685 1.1020 1.4457 0.1021  -0.0925 0.2618  288  ASN A O   
2648 C CB  . ASN A 364 ? 0.8327 1.0245 1.4896 0.1165  -0.0516 0.2919  288  ASN A CB  
2649 C CG  . ASN A 364 ? 1.1857 1.3527 1.8833 0.1140  -0.0380 0.2825  288  ASN A CG  
2650 O OD1 . ASN A 364 ? 1.0783 1.2325 1.7739 0.1029  -0.0400 0.2558  288  ASN A OD1 
2651 N ND2 . ASN A 364 ? 1.1262 1.2864 1.8620 0.1254  -0.0233 0.3048  288  ASN A ND2 
2652 N N   . SER A 365 ? 0.8421 1.0561 1.3851 0.1050  -0.0788 0.2678  289  SER A N   
2653 C CA  . SER A 365 ? 0.8524 1.0927 1.3534 0.1060  -0.0963 0.2643  289  SER A CA  
2654 C C   . SER A 365 ? 0.8885 1.1219 1.3703 0.0899  -0.1086 0.2308  289  SER A C   
2655 O O   . SER A 365 ? 0.8766 1.0858 1.3456 0.0808  -0.1024 0.2128  289  SER A O   
2656 C CB  . SER A 365 ? 0.9113 1.1521 1.3835 0.1134  -0.0894 0.2758  289  SER A CB  
2657 O OG  . SER A 365 ? 1.0134 1.2724 1.4398 0.1119  -0.1048 0.2633  289  SER A OG  
2658 N N   . CYS A 366 ? 0.8466 1.1024 1.3292 0.0866  -0.1259 0.2237  290  CYS A N   
2659 C CA  . CYS A 366 ? 0.8313 1.0833 1.3018 0.0715  -0.1382 0.1942  290  CYS A CA  
2660 C C   . CYS A 366 ? 0.8652 1.1172 1.2914 0.0675  -0.1460 0.1786  290  CYS A C   
2661 O O   . CYS A 366 ? 0.8440 1.0805 1.2607 0.0546  -0.1489 0.1539  290  CYS A O   
2662 C CB  . CYS A 366 ? 0.8419 1.1212 1.3289 0.0698  -0.1549 0.1936  290  CYS A CB  
2663 S SG  . CYS A 366 ? 0.8674 1.1335 1.4016 0.0635  -0.1464 0.1890  290  CYS A SG  
2664 N N   . GLU A 367 ? 0.8300 1.0988 1.2300 0.0795  -0.1474 0.1940  291  GLU A N   
2665 C CA  . GLU A 367 ? 0.8378 1.1068 1.1940 0.0792  -0.1515 0.1818  291  GLU A CA  
2666 C C   . GLU A 367 ? 0.8658 1.0992 1.2193 0.0727  -0.1343 0.1716  291  GLU A C   
2667 O O   . GLU A 367 ? 0.8645 1.0853 1.1982 0.0627  -0.1381 0.1476  291  GLU A O   
2668 C CB  . GLU A 367 ? 0.8861 1.1814 1.2185 0.0968  -0.1520 0.2062  291  GLU A CB  
2669 C CG  . GLU A 367 ? 1.0755 1.4118 1.4028 0.1044  -0.1720 0.2151  291  GLU A CG  
2670 C CD  . GLU A 367 ? 1.4164 1.7810 1.7287 0.1249  -0.1693 0.2472  291  GLU A CD  
2671 O OE1 . GLU A 367 ? 1.3830 1.7522 1.6564 0.1322  -0.1666 0.2478  291  GLU A OE1 
2672 O OE2 . GLU A 367 ? 1.3489 1.7320 1.6887 0.1347  -0.1691 0.2731  291  GLU A OE2 
2673 N N   . VAL A 368 ? 0.7980 1.0151 1.1760 0.0778  -0.1156 0.1895  292  VAL A N   
2674 C CA  . VAL A 368 ? 0.7697 0.9556 1.1520 0.0723  -0.0992 0.1825  292  VAL A CA  
2675 C C   . VAL A 368 ? 0.7543 0.9190 1.1541 0.0574  -0.0996 0.1589  292  VAL A C   
2676 O O   . VAL A 368 ? 0.7337 0.8797 1.1210 0.0492  -0.0958 0.1416  292  VAL A O   
2677 C CB  . VAL A 368 ? 0.8230 1.0004 1.2320 0.0820  -0.0807 0.2086  292  VAL A CB  
2678 C CG1 . VAL A 368 ? 0.8068 0.9537 1.2251 0.0749  -0.0656 0.1996  292  VAL A CG1 
2679 C CG2 . VAL A 368 ? 0.8483 1.0480 1.2394 0.0981  -0.0782 0.2353  292  VAL A CG2 
2680 N N   . ILE A 369 ? 0.6777 0.8474 1.1059 0.0552  -0.1036 0.1595  293  ILE A N   
2681 C CA  . ILE A 369 ? 0.6413 0.7957 1.0873 0.0434  -0.1031 0.1405  293  ILE A CA  
2682 C C   . ILE A 369 ? 0.6644 0.8203 1.0872 0.0327  -0.1157 0.1174  293  ILE A C   
2683 O O   . ILE A 369 ? 0.6446 0.7816 1.0686 0.0233  -0.1113 0.1009  293  ILE A O   
2684 C CB  . ILE A 369 ? 0.6705 0.8346 1.1515 0.0459  -0.1041 0.1489  293  ILE A CB  
2685 C CG1 . ILE A 369 ? 0.6713 0.8271 1.1806 0.0555  -0.0889 0.1685  293  ILE A CG1 
2686 C CG2 . ILE A 369 ? 0.6634 0.8165 1.1590 0.0350  -0.1041 0.1298  293  ILE A CG2 
2687 C CD1 . ILE A 369 ? 0.7483 0.9217 1.2880 0.0639  -0.0905 0.1859  293  ILE A CD1 
2688 N N   . ALA A 370 ? 0.6190 0.7976 1.0215 0.0345  -0.1312 0.1163  294  ALA A N   
2689 C CA  . ALA A 370 ? 0.6085 0.7889 0.9917 0.0245  -0.1441 0.0937  294  ALA A CA  
2690 C C   . ALA A 370 ? 0.6485 0.8083 1.0056 0.0211  -0.1369 0.0809  294  ALA A C   
2691 O O   . ALA A 370 ? 0.6303 0.7764 0.9860 0.0106  -0.1382 0.0619  294  ALA A O   
2692 C CB  . ALA A 370 ? 0.6394 0.8499 1.0058 0.0287  -0.1626 0.0949  294  ALA A CB  
2693 N N   . VAL A 371 ? 0.6191 0.7769 0.9587 0.0307  -0.1279 0.0934  295  VAL A N   
2694 C CA  . VAL A 371 ? 0.6250 0.7656 0.9412 0.0300  -0.1192 0.0852  295  VAL A CA  
2695 C C   . VAL A 371 ? 0.6617 0.7757 0.9965 0.0213  -0.1072 0.0766  295  VAL A C   
2696 O O   . VAL A 371 ? 0.6514 0.7520 0.9737 0.0144  -0.1065 0.0600  295  VAL A O   
2697 C CB  . VAL A 371 ? 0.6895 0.8365 0.9900 0.0435  -0.1098 0.1054  295  VAL A CB  
2698 C CG1 . VAL A 371 ? 0.6846 0.8143 0.9654 0.0431  -0.0989 0.0985  295  VAL A CG1 
2699 C CG2 . VAL A 371 ? 0.7159 0.8927 0.9925 0.0534  -0.1225 0.1132  295  VAL A CG2 
2700 N N   . ILE A 372 ? 0.6129 0.7206 0.9777 0.0223  -0.0984 0.0872  296  ILE A N   
2701 C CA  . ILE A 372 ? 0.6017 0.6883 0.9840 0.0153  -0.0883 0.0787  296  ILE A CA  
2702 C C   . ILE A 372 ? 0.6688 0.7514 1.0514 0.0047  -0.0954 0.0596  296  ILE A C   
2703 O O   . ILE A 372 ? 0.6527 0.7209 1.0277 -0.0010 -0.0912 0.0477  296  ILE A O   
2704 C CB  . ILE A 372 ? 0.6304 0.7134 1.0457 0.0187  -0.0796 0.0904  296  ILE A CB  
2705 C CG1 . ILE A 372 ? 0.6382 0.7239 1.0589 0.0294  -0.0710 0.1119  296  ILE A CG1 
2706 C CG2 . ILE A 372 ? 0.6295 0.6932 1.0595 0.0118  -0.0710 0.0781  296  ILE A CG2 
2707 C CD1 . ILE A 372 ? 0.6718 0.7572 1.1275 0.0347  -0.0639 0.1260  296  ILE A CD1 
2708 N N   . ASP A 373 ? 0.6559 0.7531 1.0486 0.0027  -0.1061 0.0586  297  ASP A N   
2709 C CA  . ASP A 373 ? 0.6624 0.7595 1.0623 -0.0070 -0.1128 0.0441  297  ASP A CA  
2710 C C   . ASP A 373 ? 0.7211 0.8130 1.0981 -0.0130 -0.1187 0.0285  297  ASP A C   
2711 O O   . ASP A 373 ? 0.7107 0.7907 1.0928 -0.0206 -0.1160 0.0171  297  ASP A O   
2712 C CB  . ASP A 373 ? 0.7059 0.8243 1.1229 -0.0067 -0.1241 0.0490  297  ASP A CB  
2713 C CG  . ASP A 373 ? 1.0006 1.1243 1.4447 -0.0004 -0.1178 0.0640  297  ASP A CG  
2714 O OD1 . ASP A 373 ? 1.0230 1.1314 1.4801 -0.0006 -0.1052 0.0634  297  ASP A OD1 
2715 O OD2 . ASP A 373 ? 1.1409 1.2848 1.5940 0.0049  -0.1257 0.0753  297  ASP A OD2 
2716 N N   . LEU A 374 ? 0.6953 0.7962 1.0473 -0.0085 -0.1260 0.0281  298  LEU A N   
2717 C CA  . LEU A 374 ? 0.7068 0.8025 1.0355 -0.0128 -0.1316 0.0114  298  LEU A CA  
2718 C C   . LEU A 374 ? 0.7211 0.7950 1.0382 -0.0129 -0.1182 0.0072  298  LEU A C   
2719 O O   . LEU A 374 ? 0.7184 0.7803 1.0324 -0.0197 -0.1181 -0.0072 298  LEU A O   
2720 C CB  . LEU A 374 ? 0.7421 0.8558 1.0439 -0.0054 -0.1419 0.0124  298  LEU A CB  
2721 C CG  . LEU A 374 ? 0.8375 0.9735 1.1383 -0.0081 -0.1614 0.0041  298  LEU A CG  
2722 C CD1 . LEU A 374 ? 0.8309 0.9862 1.1585 -0.0062 -0.1671 0.0189  298  LEU A CD1 
2723 C CD2 . LEU A 374 ? 0.9258 1.0773 1.1917 0.0011  -0.1688 0.0034  298  LEU A CD2 
2724 N N   . ALA A 375 ? 0.6416 0.7112 0.9563 -0.0054 -0.1068 0.0208  299  ALA A N   
2725 C CA  . ALA A 375 ? 0.6193 0.6720 0.9259 -0.0045 -0.0943 0.0197  299  ALA A CA  
2726 C C   . ALA A 375 ? 0.6085 0.6471 0.9355 -0.0110 -0.0867 0.0158  299  ALA A C   
2727 O O   . ALA A 375 ? 0.5890 0.6149 0.9096 -0.0130 -0.0802 0.0093  299  ALA A O   
2728 C CB  . ALA A 375 ? 0.6330 0.6888 0.9359 0.0054  -0.0853 0.0371  299  ALA A CB  
2729 N N   . LEU A 376 ? 0.5280 0.5703 0.8789 -0.0130 -0.0870 0.0202  300  LEU A N   
2730 C CA  . LEU A 376 ? 0.4944 0.5273 0.8631 -0.0170 -0.0798 0.0172  300  LEU A CA  
2731 C C   . LEU A 376 ? 0.5059 0.5296 0.8715 -0.0238 -0.0790 0.0050  300  LEU A C   
2732 O O   . LEU A 376 ? 0.4873 0.5018 0.8543 -0.0240 -0.0709 0.0038  300  LEU A O   
2733 C CB  . LEU A 376 ? 0.4848 0.5256 0.8768 -0.0172 -0.0813 0.0217  300  LEU A CB  
2734 C CG  . LEU A 376 ? 0.5261 0.5597 0.9349 -0.0175 -0.0722 0.0210  300  LEU A CG  
2735 C CD1 . LEU A 376 ? 0.5210 0.5475 0.9322 -0.0130 -0.0640 0.0269  300  LEU A CD1 
2736 C CD2 . LEU A 376 ? 0.5535 0.5956 0.9834 -0.0167 -0.0732 0.0240  300  LEU A CD2 
2737 N N   . PRO A 377 ? 0.4514 0.4773 0.8154 -0.0292 -0.0867 -0.0036 301  PRO A N   
2738 C CA  . PRO A 377 ? 0.4445 0.4597 0.8097 -0.0346 -0.0831 -0.0122 301  PRO A CA  
2739 C C   . PRO A 377 ? 0.5202 0.5237 0.8672 -0.0323 -0.0772 -0.0157 301  PRO A C   
2740 O O   . PRO A 377 ? 0.5102 0.5050 0.8605 -0.0337 -0.0701 -0.0175 301  PRO A O   
2741 C CB  . PRO A 377 ? 0.4696 0.4895 0.8406 -0.0408 -0.0930 -0.0204 301  PRO A CB  
2742 C CG  . PRO A 377 ? 0.5220 0.5582 0.8997 -0.0392 -0.1020 -0.0150 301  PRO A CG  
2743 C CD  . PRO A 377 ? 0.4718 0.5105 0.8361 -0.0308 -0.0990 -0.0058 301  PRO A CD  
2744 N N   . PHE A 378 ? 0.5032 0.5083 0.8310 -0.0274 -0.0792 -0.0150 302  PHE A N   
2745 C CA  . PHE A 378 ? 0.5169 0.5126 0.8271 -0.0236 -0.0723 -0.0171 302  PHE A CA  
2746 C C   . PHE A 378 ? 0.5513 0.5441 0.8674 -0.0197 -0.0620 -0.0072 302  PHE A C   
2747 O O   . PHE A 378 ? 0.5340 0.5184 0.8465 -0.0188 -0.0547 -0.0086 302  PHE A O   
2748 C CB  . PHE A 378 ? 0.5633 0.5644 0.8499 -0.0182 -0.0767 -0.0190 302  PHE A CB  
2749 C CG  . PHE A 378 ? 0.6009 0.6047 0.8804 -0.0225 -0.0882 -0.0331 302  PHE A CG  
2750 C CD1 . PHE A 378 ? 0.6538 0.6451 0.9265 -0.0257 -0.0873 -0.0474 302  PHE A CD1 
2751 C CD2 . PHE A 378 ? 0.6294 0.6490 0.9116 -0.0233 -0.1003 -0.0324 302  PHE A CD2 
2752 C CE1 . PHE A 378 ? 0.6780 0.6709 0.9478 -0.0307 -0.0987 -0.0631 302  PHE A CE1 
2753 C CE2 . PHE A 378 ? 0.6770 0.7011 0.9552 -0.0283 -0.1128 -0.0474 302  PHE A CE2 
2754 C CZ  . PHE A 378 ? 0.6646 0.6746 0.9370 -0.0324 -0.1121 -0.0637 302  PHE A CZ  
2755 N N   . ALA A 379 ? 0.5011 0.5010 0.8294 -0.0176 -0.0615 0.0024  303  ALA A N   
2756 C CA  . ALA A 379 ? 0.4780 0.4754 0.8179 -0.0153 -0.0532 0.0096  303  ALA A CA  
2757 C C   . ALA A 379 ? 0.5188 0.5129 0.8730 -0.0199 -0.0509 0.0044  303  ALA A C   
2758 O O   . ALA A 379 ? 0.5082 0.4992 0.8681 -0.0193 -0.0450 0.0053  303  ALA A O   
2759 C CB  . ALA A 379 ? 0.4833 0.4878 0.8344 -0.0116 -0.0533 0.0201  303  ALA A CB  
2760 N N   . ILE A 380 ? 0.4737 0.4703 0.8337 -0.0240 -0.0558 -0.0007 304  ILE A N   
2761 C CA  . ILE A 380 ? 0.4532 0.4496 0.8238 -0.0270 -0.0533 -0.0044 304  ILE A CA  
2762 C C   . ILE A 380 ? 0.4900 0.4793 0.8527 -0.0279 -0.0494 -0.0079 304  ILE A C   
2763 O O   . ILE A 380 ? 0.4658 0.4555 0.8329 -0.0272 -0.0448 -0.0077 304  ILE A O   
2764 C CB  . ILE A 380 ? 0.4783 0.4811 0.8594 -0.0301 -0.0579 -0.0058 304  ILE A CB  
2765 C CG1 . ILE A 380 ? 0.4768 0.4868 0.8714 -0.0277 -0.0582 -0.0018 304  ILE A CG1 
2766 C CG2 . ILE A 380 ? 0.4657 0.4684 0.8529 -0.0325 -0.0545 -0.0083 304  ILE A CG2 
2767 C CD1 . ILE A 380 ? 0.5695 0.5885 0.9761 -0.0294 -0.0631 -0.0006 304  ILE A CD1 
2768 N N   . LEU A 381 ? 0.4617 0.4454 0.8132 -0.0289 -0.0516 -0.0117 305  LEU A N   
2769 C CA  . LEU A 381 ? 0.4657 0.4405 0.8116 -0.0292 -0.0472 -0.0153 305  LEU A CA  
2770 C C   . LEU A 381 ? 0.5344 0.5064 0.8749 -0.0247 -0.0401 -0.0115 305  LEU A C   
2771 O O   . LEU A 381 ? 0.5253 0.4944 0.8689 -0.0240 -0.0350 -0.0109 305  LEU A O   
2772 C CB  . LEU A 381 ? 0.4771 0.4458 0.8125 -0.0308 -0.0515 -0.0230 305  LEU A CB  
2773 C CG  . LEU A 381 ? 0.5431 0.4999 0.8759 -0.0313 -0.0467 -0.0284 305  LEU A CG  
2774 C CD1 . LEU A 381 ? 0.5372 0.4926 0.8879 -0.0355 -0.0449 -0.0276 305  LEU A CD1 
2775 C CD2 . LEU A 381 ? 0.6102 0.5607 0.9291 -0.0316 -0.0512 -0.0392 305  LEU A CD2 
2776 N N   . LEU A 382 ? 0.4951 0.4697 0.8306 -0.0212 -0.0393 -0.0072 306  LEU A N   
2777 C CA  . LEU A 382 ? 0.4846 0.4586 0.8202 -0.0173 -0.0323 -0.0020 306  LEU A CA  
2778 C C   . LEU A 382 ? 0.5084 0.4876 0.8599 -0.0186 -0.0305 -0.0004 306  LEU A C   
2779 O O   . LEU A 382 ? 0.5027 0.4822 0.8570 -0.0167 -0.0257 0.0017  306  LEU A O   
2780 C CB  . LEU A 382 ? 0.4934 0.4706 0.8259 -0.0134 -0.0312 0.0050  306  LEU A CB  
2781 C CG  . LEU A 382 ? 0.5755 0.5504 0.8873 -0.0086 -0.0298 0.0052  306  LEU A CG  
2782 C CD1 . LEU A 382 ? 0.5876 0.5695 0.8974 -0.0040 -0.0295 0.0150  306  LEU A CD1 
2783 C CD2 . LEU A 382 ? 0.6067 0.5761 0.9117 -0.0046 -0.0210 0.0058  306  LEU A CD2 
2784 N N   . GLY A 383 ? 0.4621 0.4469 0.8235 -0.0211 -0.0346 -0.0020 307  GLY A N   
2785 C CA  . GLY A 383 ? 0.4579 0.4497 0.8313 -0.0219 -0.0343 -0.0037 307  GLY A CA  
2786 C C   . GLY A 383 ? 0.5417 0.5353 0.9129 -0.0215 -0.0324 -0.0045 307  GLY A C   
2787 O O   . GLY A 383 ? 0.5593 0.5592 0.9355 -0.0201 -0.0308 -0.0040 307  GLY A O   
2788 N N   . PHE A 384 ? 0.5036 0.4924 0.8694 -0.0227 -0.0326 -0.0051 308  PHE A N   
2789 C CA  . PHE A 384 ? 0.5030 0.4917 0.8696 -0.0219 -0.0291 -0.0032 308  PHE A CA  
2790 C C   . PHE A 384 ? 0.5644 0.5465 0.9265 -0.0190 -0.0240 -0.0009 308  PHE A C   
2791 O O   . PHE A 384 ? 0.5596 0.5453 0.9255 -0.0163 -0.0201 0.0034  308  PHE A O   
2792 C CB  . PHE A 384 ? 0.5283 0.5118 0.8965 -0.0250 -0.0302 -0.0044 308  PHE A CB  
2793 C CG  . PHE A 384 ? 0.5455 0.5382 0.9221 -0.0264 -0.0324 -0.0037 308  PHE A CG  
2794 C CD1 . PHE A 384 ? 0.5890 0.5914 0.9708 -0.0237 -0.0286 0.0010  308  PHE A CD1 
2795 C CD2 . PHE A 384 ? 0.5692 0.5629 0.9482 -0.0292 -0.0375 -0.0065 308  PHE A CD2 
2796 C CE1 . PHE A 384 ? 0.5973 0.6093 0.9855 -0.0236 -0.0288 0.0022  308  PHE A CE1 
2797 C CE2 . PHE A 384 ? 0.6016 0.6043 0.9899 -0.0296 -0.0380 -0.0051 308  PHE A CE2 
2798 C CZ  . PHE A 384 ? 0.5766 0.5881 0.9690 -0.0267 -0.0331 -0.0012 308  PHE A CZ  
2799 N N   . THR A 385 ? 0.5378 0.5118 0.8915 -0.0183 -0.0233 -0.0026 309  THR A N   
2800 C CA  . THR A 385 ? 0.5503 0.5176 0.8984 -0.0143 -0.0169 -0.0009 309  THR A CA  
2801 C C   . THR A 385 ? 0.5999 0.5766 0.9567 -0.0114 -0.0138 0.0049  309  THR A C   
2802 O O   . THR A 385 ? 0.5950 0.5705 0.9535 -0.0076 -0.0080 0.0087  309  THR A O   
2803 C CB  . THR A 385 ? 0.6656 0.6258 1.0003 -0.0130 -0.0169 -0.0039 309  THR A CB  
2804 O OG1 . THR A 385 ? 0.6925 0.6480 1.0213 -0.0166 -0.0228 -0.0106 309  THR A OG1 
2805 C CG2 . THR A 385 ? 0.6403 0.5923 0.9665 -0.0077 -0.0090 -0.0038 309  THR A CG2 
2806 N N   . ASN A 386 ? 0.5500 0.5367 0.9152 -0.0133 -0.0180 0.0051  310  ASN A N   
2807 C CA  . ASN A 386 ? 0.5419 0.5397 0.9196 -0.0122 -0.0176 0.0079  310  ASN A CA  
2808 C C   . ASN A 386 ? 0.5964 0.6036 0.9782 -0.0100 -0.0172 0.0102  310  ASN A C   
2809 O O   . ASN A 386 ? 0.6006 0.6159 0.9906 -0.0074 -0.0153 0.0143  310  ASN A O   
2810 C CB  . ASN A 386 ? 0.5359 0.5407 0.9236 -0.0156 -0.0230 0.0041  310  ASN A CB  
2811 C CG  . ASN A 386 ? 0.7615 0.7779 1.1661 -0.0161 -0.0244 0.0038  310  ASN A CG  
2812 O OD1 . ASN A 386 ? 0.6612 0.6885 1.0730 -0.0177 -0.0299 -0.0023 310  ASN A OD1 
2813 N ND2 . ASN A 386 ? 0.6419 0.6573 1.0542 -0.0147 -0.0196 0.0096  310  ASN A ND2 
2814 N N   . SER A 387 ? 0.5509 0.5584 0.9285 -0.0103 -0.0185 0.0094  311  SER A N   
2815 C CA  . SER A 387 ? 0.5468 0.5641 0.9272 -0.0067 -0.0170 0.0147  311  SER A CA  
2816 C C   . SER A 387 ? 0.5839 0.5933 0.9648 -0.0025 -0.0093 0.0217  311  SER A C   
2817 O O   . SER A 387 ? 0.5679 0.5879 0.9546 0.0023  -0.0070 0.0292  311  SER A O   
2818 C CB  . SER A 387 ? 0.6074 0.6258 0.9853 -0.0078 -0.0181 0.0144  311  SER A CB  
2819 O OG  . SER A 387 ? 0.7540 0.7805 1.1321 -0.0103 -0.0239 0.0079  311  SER A OG  
2820 N N   . CYS A 388 ? 0.5553 0.5469 0.9299 -0.0033 -0.0053 0.0188  312  CYS A N   
2821 C CA  . CYS A 388 ? 0.5749 0.5554 0.9496 0.0011  0.0031  0.0224  312  CYS A CA  
2822 C C   . CYS A 388 ? 0.6180 0.6032 0.9961 0.0051  0.0069  0.0263  312  CYS A C   
2823 O O   . CYS A 388 ? 0.6398 0.6238 1.0234 0.0108  0.0142  0.0325  312  CYS A O   
2824 C CB  . CYS A 388 ? 0.6010 0.5619 0.9661 -0.0011 0.0049  0.0145  312  CYS A CB  
2825 S SG  . CYS A 388 ? 0.6529 0.6100 1.0179 -0.0079 -0.0015 0.0088  312  CYS A SG  
2826 N N   . VAL A 389 ? 0.5462 0.5368 0.9243 0.0026  0.0031  0.0237  313  VAL A N   
2827 C CA  . VAL A 389 ? 0.5378 0.5342 0.9236 0.0054  0.0071  0.0285  313  VAL A CA  
2828 C C   . VAL A 389 ? 0.6201 0.6366 1.0227 0.0066  0.0038  0.0339  313  VAL A C   
2829 O O   . VAL A 389 ? 0.6324 0.6543 1.0443 0.0115  0.0094  0.0413  313  VAL A O   
2830 C CB  . VAL A 389 ? 0.5698 0.5648 0.9541 0.0023  0.0051  0.0260  313  VAL A CB  
2831 C CG1 . VAL A 389 ? 0.5659 0.5666 0.9616 0.0057  0.0115  0.0333  313  VAL A CG1 
2832 C CG2 . VAL A 389 ? 0.5742 0.5539 0.9398 0.0020  0.0062  0.0207  313  VAL A CG2 
2833 N N   . ASN A 390 ? 0.5841 0.6131 0.9901 0.0027  -0.0054 0.0299  314  ASN A N   
2834 C CA  . ASN A 390 ? 0.5833 0.6352 1.0023 0.0034  -0.0117 0.0314  314  ASN A CA  
2835 C C   . ASN A 390 ? 0.6397 0.7020 1.0655 0.0105  -0.0074 0.0422  314  ASN A C   
2836 O O   . ASN A 390 ? 0.6285 0.7067 1.0697 0.0116  -0.0096 0.0454  314  ASN A O   
2837 C CB  . ASN A 390 ? 0.5989 0.6602 1.0127 0.0009  -0.0200 0.0247  314  ASN A CB  
2838 C CG  . ASN A 390 ? 0.8816 0.9400 1.2966 -0.0054 -0.0258 0.0141  314  ASN A CG  
2839 O OD1 . ASN A 390 ? 0.8120 0.8656 1.2362 -0.0084 -0.0251 0.0126  314  ASN A OD1 
2840 N ND2 . ASN A 390 ? 0.7625 0.8241 1.1701 -0.0067 -0.0304 0.0081  314  ASN A ND2 
2841 N N   . PRO A 391 ? 0.6131 0.6674 1.0322 0.0155  -0.0009 0.0487  315  PRO A N   
2842 C CA  . PRO A 391 ? 0.6176 0.6822 1.0469 0.0235  0.0044  0.0612  315  PRO A CA  
2843 C C   . PRO A 391 ? 0.6527 0.7157 1.0933 0.0269  0.0113  0.0663  315  PRO A C   
2844 O O   . PRO A 391 ? 0.6489 0.7306 1.1042 0.0320  0.0113  0.0755  315  PRO A O   
2845 C CB  . PRO A 391 ? 0.6524 0.6996 1.0750 0.0270  0.0128  0.0659  315  PRO A CB  
2846 C CG  . PRO A 391 ? 0.7048 0.7449 1.1158 0.0209  0.0077  0.0572  315  PRO A CG  
2847 C CD  . PRO A 391 ? 0.6408 0.6774 1.0473 0.0141  0.0020  0.0459  315  PRO A CD  
2848 N N   . PHE A 392 ? 0.5923 0.6357 1.0261 0.0248  0.0173  0.0611  316  PHE A N   
2849 C CA  . PHE A 392 ? 0.5787 0.6192 1.0208 0.0289  0.0263  0.0661  316  PHE A CA  
2850 C C   . PHE A 392 ? 0.5972 0.6554 1.0563 0.0250  0.0207  0.0666  316  PHE A C   
2851 O O   . PHE A 392 ? 0.5854 0.6508 1.0600 0.0292  0.0271  0.0747  316  PHE A O   
2852 C CB  . PHE A 392 ? 0.6046 0.6199 1.0294 0.0293  0.0347  0.0599  316  PHE A CB  
2853 C CG  . PHE A 392 ? 0.6278 0.6236 1.0411 0.0330  0.0415  0.0576  316  PHE A CG  
2854 C CD1 . PHE A 392 ? 0.6650 0.6509 1.0668 0.0279  0.0360  0.0498  316  PHE A CD1 
2855 C CD2 . PHE A 392 ? 0.6643 0.6512 1.0813 0.0416  0.0541  0.0627  316  PHE A CD2 
2856 C CE1 . PHE A 392 ? 0.6892 0.6565 1.0860 0.0301  0.0421  0.0469  316  PHE A CE1 
2857 C CE2 . PHE A 392 ? 0.7106 0.6773 1.1210 0.0444  0.0607  0.0586  316  PHE A CE2 
2858 C CZ  . PHE A 392 ? 0.6853 0.6422 1.0867 0.0381  0.0543  0.0505  316  PHE A CZ  
2859 N N   . LEU A 393 ? 0.5471 0.6119 1.0065 0.0172  0.0096  0.0581  317  LEU A N   
2860 C CA  . LEU A 393 ? 0.5417 0.6205 1.0213 0.0119  0.0038  0.0561  317  LEU A CA  
2861 C C   . LEU A 393 ? 0.5716 0.6783 1.0708 0.0111  -0.0065 0.0568  317  LEU A C   
2862 O O   . LEU A 393 ? 0.5545 0.6748 1.0780 0.0083  -0.0090 0.0580  317  LEU A O   
2863 C CB  . LEU A 393 ? 0.5401 0.6114 1.0135 0.0041  -0.0029 0.0452  317  LEU A CB  
2864 C CG  . LEU A 393 ? 0.6107 0.6604 1.0694 0.0037  0.0043  0.0444  317  LEU A CG  
2865 C CD1 . LEU A 393 ? 0.6088 0.6546 1.0643 -0.0030 -0.0034 0.0350  317  LEU A CD1 
2866 C CD2 . LEU A 393 ? 0.6546 0.7033 1.1262 0.0062  0.0140  0.0530  317  LEU A CD2 
2867 N N   . TYR A 394 ? 0.5372 0.6544 1.0272 0.0134  -0.0130 0.0556  318  TYR A N   
2868 C CA  . TYR A 394 ? 0.5493 0.6967 1.0539 0.0132  -0.0250 0.0543  318  TYR A CA  
2869 C C   . TYR A 394 ? 0.6455 0.8091 1.1514 0.0228  -0.0232 0.0674  318  TYR A C   
2870 O O   . TYR A 394 ? 0.6414 0.8290 1.1680 0.0250  -0.0276 0.0731  318  TYR A O   
2871 C CB  . TYR A 394 ? 0.5697 0.7236 1.0636 0.0080  -0.0371 0.0400  318  TYR A CB  
2872 C CG  . TYR A 394 ? 0.6017 0.7438 1.1011 -0.0011 -0.0401 0.0273  318  TYR A CG  
2873 C CD1 . TYR A 394 ? 0.6299 0.7838 1.1565 -0.0072 -0.0463 0.0216  318  TYR A CD1 
2874 C CD2 . TYR A 394 ? 0.6097 0.7296 1.0909 -0.0036 -0.0367 0.0220  318  TYR A CD2 
2875 C CE1 . TYR A 394 ? 0.6370 0.7788 1.1730 -0.0150 -0.0475 0.0121  318  TYR A CE1 
2876 C CE2 . TYR A 394 ? 0.6204 0.7303 1.1088 -0.0107 -0.0386 0.0128  318  TYR A CE2 
2877 C CZ  . TYR A 394 ? 0.7413 0.8612 1.2574 -0.0161 -0.0434 0.0083  318  TYR A CZ  
2878 O OH  . TYR A 394 ? 0.8135 0.9224 1.3410 -0.0225 -0.0438 0.0011  318  TYR A OH  
2879 N N   . CYS A 395 ? 0.6271 0.7791 1.1144 0.0285  -0.0167 0.0733  319  CYS A N   
2880 C CA  . CYS A 395 ? 0.6306 0.7972 1.1208 0.0386  -0.0136 0.0883  319  CYS A CA  
2881 C C   . CYS A 395 ? 0.6563 0.8143 1.1595 0.0455  -0.0002 0.1014  319  CYS A C   
2882 O O   . CYS A 395 ? 0.6578 0.8387 1.1777 0.0524  -0.0010 0.1134  319  CYS A O   
2883 C CB  . CYS A 395 ? 0.6465 0.8042 1.1178 0.0422  -0.0104 0.0914  319  CYS A CB  
2884 S SG  . CYS A 395 ? 0.7079 0.8863 1.1851 0.0560  -0.0059 0.1133  319  CYS A SG  
2885 N N   . PHE A 396 ? 0.5954 0.7223 1.0905 0.0449  0.0121  0.0992  320  PHE A N   
2886 C CA  . PHE A 396 ? 0.5955 0.7110 1.0995 0.0528  0.0269  0.1096  320  PHE A CA  
2887 C C   . PHE A 396 ? 0.6964 0.8253 1.2222 0.0529  0.0283  0.1134  320  PHE A C   
2888 O O   . PHE A 396 ? 0.7148 0.8434 1.2533 0.0614  0.0398  0.1249  320  PHE A O   
2889 C CB  . PHE A 396 ? 0.6086 0.6882 1.0946 0.0528  0.0389  0.1033  320  PHE A CB  
2890 C CG  . PHE A 396 ? 0.6078 0.6725 1.0786 0.0524  0.0393  0.1006  320  PHE A CG  
2891 C CD1 . PHE A 396 ? 0.6208 0.7011 1.0965 0.0570  0.0363  0.1108  320  PHE A CD1 
2892 C CD2 . PHE A 396 ? 0.6209 0.6580 1.0741 0.0477  0.0428  0.0890  320  PHE A CD2 
2893 C CE1 . PHE A 396 ? 0.6295 0.6969 1.0954 0.0566  0.0382  0.1104  320  PHE A CE1 
2894 C CE2 . PHE A 396 ? 0.6468 0.6715 1.0914 0.0463  0.0430  0.0867  320  PHE A CE2 
2895 C CZ  . PHE A 396 ? 0.6182 0.6572 1.0705 0.0506  0.0415  0.0981  320  PHE A CZ  
2896 N N   . VAL A 397 ? 0.6675 0.8089 1.2013 0.0440  0.0173  0.1048  321  VAL A N   
2897 C CA  . VAL A 397 ? 0.6767 0.8334 1.2377 0.0427  0.0178  0.1092  321  VAL A CA  
2898 C C   . VAL A 397 ? 0.7369 0.9281 1.3179 0.0372  -0.0004 0.1054  321  VAL A C   
2899 O O   . VAL A 397 ? 0.7244 0.9278 1.3293 0.0309  -0.0053 0.1025  321  VAL A O   
2900 C CB  . VAL A 397 ? 0.7304 0.8680 1.2899 0.0375  0.0251  0.1038  321  VAL A CB  
2901 C CG1 . VAL A 397 ? 0.7448 0.8564 1.2891 0.0456  0.0435  0.1089  321  VAL A CG1 
2902 C CG2 . VAL A 397 ? 0.7184 0.8459 1.2628 0.0276  0.0156  0.0890  321  VAL A CG2 
2903 N N   . GLY A 398 ? 0.7097 0.9170 1.2819 0.0402  -0.0099 0.1058  322  GLY A N   
2904 C CA  . GLY A 398 ? 0.7065 0.9488 1.2907 0.0370  -0.0283 0.1004  322  GLY A CA  
2905 C C   . GLY A 398 ? 0.7516 1.0254 1.3674 0.0415  -0.0317 0.1121  322  GLY A C   
2906 O O   . GLY A 398 ? 0.7462 1.0413 1.3862 0.0340  -0.0438 0.1044  322  GLY A O   
2907 N N   . ASN A 399 ? 0.7004 0.9772 1.3192 0.0537  -0.0210 0.1308  323  ASN A N   
2908 C CA  . ASN A 399 ? 0.6977 1.0053 1.3477 0.0604  -0.0224 0.1457  323  ASN A CA  
2909 C C   . ASN A 399 ? 0.7459 1.0507 1.4252 0.0560  -0.0154 0.1473  323  ASN A C   
2910 O O   . ASN A 399 ? 0.7384 1.0745 1.4500 0.0530  -0.0257 0.1490  323  ASN A O   
2911 C CB  . ASN A 399 ? 0.6945 0.9990 1.3412 0.0755  -0.0086 0.1663  323  ASN A CB  
2912 C CG  . ASN A 399 ? 0.9243 1.2327 1.5469 0.0815  -0.0125 0.1698  323  ASN A CG  
2913 O OD1 . ASN A 399 ? 0.8817 1.2079 1.4917 0.0769  -0.0286 0.1593  323  ASN A OD1 
2914 N ND2 . ASN A 399 ? 0.8139 1.1064 1.4317 0.0928  0.0033  0.1855  323  ASN A ND2 
2915 N N   . ARG A 400 ? 0.7055 0.9743 1.3736 0.0556  0.0017  0.1466  324  ARG A N   
2916 C CA  . ARG A 400 ? 0.6987 0.9595 1.3884 0.0536  0.0133  0.1504  324  ARG A CA  
2917 C C   . ARG A 400 ? 0.7312 1.0060 1.4445 0.0399  0.0001  0.1388  324  ARG A C   
2918 O O   . ARG A 400 ? 0.7248 1.0159 1.4744 0.0385  0.0024  0.1464  324  ARG A O   
2919 C CB  . ARG A 400 ? 0.7057 0.9253 1.3675 0.0562  0.0315  0.1483  324  ARG A CB  
2920 C CG  . ARG A 400 ? 0.8201 1.0298 1.4970 0.0580  0.0477  0.1552  324  ARG A CG  
2921 C CD  . ARG A 400 ? 0.9517 1.1242 1.5948 0.0597  0.0614  0.1490  324  ARG A CD  
2922 N NE  . ARG A 400 ? 1.1330 1.2913 1.7714 0.0728  0.0822  0.1596  324  ARG A NE  
2923 C CZ  . ARG A 400 ? 1.3993 1.5267 2.0054 0.0779  0.0941  0.1538  324  ARG A CZ  
2924 N NH1 . ARG A 400 ? 1.2529 1.3617 1.8299 0.0708  0.0869  0.1395  324  ARG A NH1 
2925 N NH2 . ARG A 400 ? 1.2747 1.3903 1.8784 0.0904  0.1131  0.1613  324  ARG A NH2 
2926 N N   . PHE A 401 ? 0.6787 0.9467 1.3745 0.0302  -0.0126 0.1208  325  PHE A N   
2927 C CA  . PHE A 401 ? 0.6700 0.9468 1.3879 0.0168  -0.0249 0.1071  325  PHE A CA  
2928 C C   . PHE A 401 ? 0.7444 1.0627 1.4986 0.0130  -0.0425 0.1052  325  PHE A C   
2929 O O   . PHE A 401 ? 0.7339 1.0633 1.5268 0.0054  -0.0447 0.1047  325  PHE A O   
2930 C CB  . PHE A 401 ? 0.6837 0.9449 1.3732 0.0095  -0.0343 0.0881  325  PHE A CB  
2931 C CG  . PHE A 401 ? 0.6956 0.9559 1.4067 -0.0036 -0.0423 0.0739  325  PHE A CG  
2932 C CD1 . PHE A 401 ? 0.7335 0.9675 1.4466 -0.0070 -0.0294 0.0760  325  PHE A CD1 
2933 C CD2 . PHE A 401 ? 0.7233 1.0093 1.4533 -0.0119 -0.0627 0.0582  325  PHE A CD2 
2934 C CE1 . PHE A 401 ? 0.7433 0.9754 1.4811 -0.0185 -0.0352 0.0651  325  PHE A CE1 
2935 C CE2 . PHE A 401 ? 0.7614 1.0441 1.5162 -0.0243 -0.0694 0.0439  325  PHE A CE2 
2936 C CZ  . PHE A 401 ? 0.7342 0.9891 1.4944 -0.0276 -0.0549 0.0486  325  PHE A CZ  
2937 N N   . GLN A 402 ? 0.7195 1.0620 1.4626 0.0186  -0.0550 0.1051  326  GLN A N   
2938 C CA  . GLN A 402 ? 0.7203 1.1072 1.4917 0.0166  -0.0746 0.1023  326  GLN A CA  
2939 C C   . GLN A 402 ? 0.7549 1.1636 1.5658 0.0222  -0.0683 0.1218  326  GLN A C   
2940 O O   . GLN A 402 ? 0.7513 1.1886 1.6028 0.0145  -0.0810 0.1174  326  GLN A O   
2941 C CB  . GLN A 402 ? 0.7459 1.1528 1.4888 0.0245  -0.0866 0.1010  326  GLN A CB  
2942 N N   . GLN A 403 ? 0.7025 1.0981 1.5042 0.0354  -0.0487 0.1426  327  GLN A N   
2943 C CA  . GLN A 403 ? 0.6978 1.1113 1.5347 0.0435  -0.0389 0.1635  327  GLN A CA  
2944 C C   . GLN A 403 ? 0.7589 1.1646 1.6305 0.0364  -0.0283 0.1662  327  GLN A C   
2945 O O   . GLN A 403 ? 0.7658 1.2005 1.6820 0.0363  -0.0305 0.1764  327  GLN A O   
2946 C CB  . GLN A 403 ? 0.7176 1.1122 1.5329 0.0598  -0.0182 0.1822  327  GLN A CB  
2947 C CG  . GLN A 403 ? 0.9834 1.4079 1.7982 0.0714  -0.0259 0.1949  327  GLN A CG  
2948 C CD  . GLN A 403 ? 1.3060 1.7290 2.0824 0.0714  -0.0379 0.1844  327  GLN A CD  
2949 O OE1 . GLN A 403 ? 1.2430 1.6375 1.9872 0.0784  -0.0255 0.1882  327  GLN A OE1 
2950 N NE2 . GLN A 403 ? 1.2332 1.6881 2.0136 0.0638  -0.0621 0.1706  327  GLN A NE2 
2951 N N   . LYS A 404 ? 0.7196 1.0887 1.5731 0.0311  -0.0168 0.1587  328  LYS A N   
2952 C CA  . LYS A 404 ? 0.7216 1.0816 1.6050 0.0256  -0.0046 0.1635  328  LYS A CA  
2953 C C   . LYS A 404 ? 0.7947 1.1717 1.7139 0.0088  -0.0228 0.1481  328  LYS A C   
2954 O O   . LYS A 404 ? 0.7999 1.1827 1.7612 0.0036  -0.0161 0.1553  328  LYS A O   
2955 C CB  . LYS A 404 ? 0.7514 1.0680 1.5993 0.0286  0.0152  0.1635  328  LYS A CB  
2956 N N   . LEU A 405 ? 0.7543 1.1397 1.6589 0.0007  -0.0448 0.1270  329  LEU A N   
2957 C CA  . LEU A 405 ? 0.7504 1.1513 1.6875 -0.0152 -0.0640 0.1077  329  LEU A CA  
2958 C C   . LEU A 405 ? 0.7942 1.2429 1.7755 -0.0182 -0.0826 0.1077  329  LEU A C   
2959 O O   . LEU A 405 ? 0.7846 1.2488 1.8163 -0.0299 -0.0900 0.1023  329  LEU A O   
2960 C CB  . LEU A 405 ? 0.7528 1.1418 1.6537 -0.0213 -0.0785 0.0835  329  LEU A CB  
2961 N N   . ARG A 406 ? 0.7552 1.2282 1.7207 -0.0072 -0.0897 0.1151  330  ARG A N   
2962 C CA  . ARG A 406 ? 0.7590 1.2816 1.7622 -0.0070 -0.1077 0.1181  330  ARG A CA  
2963 C C   . ARG A 406 ? 0.8261 1.3608 1.8778 -0.0031 -0.0927 0.1422  330  ARG A C   
2964 O O   . ARG A 406 ? 0.8248 1.4016 1.9204 -0.0051 -0.1066 0.1459  330  ARG A O   
2965 C CB  . ARG A 406 ? 0.7521 1.2957 1.7209 0.0062  -0.1167 0.1233  330  ARG A CB  
2966 N N   . SER A 407 ? 0.7897 1.2891 1.8334 0.0028  -0.0646 0.1580  331  SER A N   
2967 C CA  . SER A 407 ? 0.7917 1.2960 1.8754 0.0083  -0.0448 0.1817  331  SER A CA  
2968 C C   . SER A 407 ? 0.8374 1.3418 1.9716 -0.0065 -0.0436 0.1779  331  SER A C   
2969 O O   . SER A 407 ? 0.8287 1.3646 2.0202 -0.0099 -0.0466 0.1878  331  SER A O   
2970 C CB  . SER A 407 ? 0.8533 1.3198 1.8994 0.0229  -0.0152 0.1981  331  SER A CB  
2971 O OG  . SER A 407 ? 1.0058 1.4737 2.0870 0.0289  0.0066  0.2197  331  SER A OG  
2972 N N   . VAL A 408 ? 0.7982 1.2684 1.9141 -0.0149 -0.0387 0.1652  332  VAL A N   
2973 C CA  . VAL A 408 ? 0.7957 1.2595 1.9565 -0.0285 -0.0349 0.1626  332  VAL A CA  
2974 C C   . VAL A 408 ? 0.8514 1.3488 2.0634 -0.0457 -0.0634 0.1427  332  VAL A C   
2975 O O   . VAL A 408 ? 0.8475 1.3593 2.1219 -0.0547 -0.0612 0.1491  332  VAL A O   
2976 C CB  . VAL A 408 ? 0.8398 1.2592 1.9648 -0.0315 -0.0233 0.1547  332  VAL A CB  
2977 C CG1 . VAL A 408 ? 0.8414 1.2322 1.9369 -0.0169 0.0074  0.1768  332  VAL A CG1 
2978 C CG2 . VAL A 408 ? 0.8343 1.2403 1.9070 -0.0338 -0.0397 0.1309  332  VAL A CG2 
2979 N N   . PHE A 409 ? 0.8079 1.3191 1.9951 -0.0498 -0.0893 0.1187  333  PHE A N   
2980 C CA  . PHE A 409 ? 1.1035 1.6474 2.3309 -0.0652 -0.1189 0.0945  333  PHE A CA  
2981 C C   . PHE A 409 ? 1.2872 1.8809 2.5685 -0.0652 -0.1305 0.1049  333  PHE A C   
2982 O O   . PHE A 409 ? 0.6990 1.3101 1.9667 -0.0505 -0.1256 0.1241  333  PHE A O   
2983 C CB  . PHE A 409 ? 1.1312 1.6783 2.3089 -0.0656 -0.1412 0.0681  333  PHE A CB  
2984 N N   . ASP B 2   ? 2.4182 2.2733 1.7715 -0.1078 0.3259  -0.0796 1002 ASP B N   
2985 C CA  . ASP B 2   ? 2.3609 2.2515 1.7357 -0.1277 0.2593  -0.0913 1002 ASP B CA  
2986 C C   . ASP B 2   ? 2.2938 2.2759 1.7921 -0.1295 0.2364  -0.0787 1002 ASP B C   
2987 O O   . ASP B 2   ? 2.2157 2.2446 1.7737 -0.1371 0.2031  -0.0881 1002 ASP B O   
2988 C CB  . ASP B 2   ? 2.4663 2.3096 1.7353 -0.1417 0.2197  -0.0959 1002 ASP B CB  
2989 C CG  . ASP B 2   ? 2.6858 2.4461 1.8329 -0.1521 0.2195  -0.1208 1002 ASP B CG  
2990 O OD1 . ASP B 2   ? 2.6701 2.4360 1.8268 -0.1699 0.1923  -0.1436 1002 ASP B OD1 
2991 O OD2 . ASP B 2   ? 2.8701 2.5539 1.9063 -0.1448 0.2480  -0.1187 1002 ASP B OD2 
2992 N N   . LEU B 3   ? 2.2433 2.2428 1.7741 -0.1245 0.2581  -0.0588 1003 LEU B N   
2993 C CA  . LEU B 3   ? 2.1454 2.2185 1.7833 -0.1298 0.2427  -0.0500 1003 LEU B CA  
2994 C C   . LEU B 3   ? 2.1289 2.2667 1.8698 -0.1230 0.2655  -0.0528 1003 LEU B C   
2995 O O   . LEU B 3   ? 2.0407 2.2405 1.8603 -0.1285 0.2369  -0.0576 1003 LEU B O   
2996 C CB  . LEU B 3   ? 2.1793 2.2344 1.8071 -0.1309 0.2632  -0.0296 1003 LEU B CB  
2997 C CG  . LEU B 3   ? 2.1629 2.2698 1.8740 -0.1407 0.2421  -0.0234 1003 LEU B CG  
2998 C CD1 . LEU B 3   ? 2.1905 2.2725 1.8501 -0.1402 0.2003  -0.0153 1003 LEU B CD1 
2999 C CD2 . LEU B 3   ? 2.1997 2.3144 1.9599 -0.1461 0.2900  -0.0105 1003 LEU B CD2 
3000 N N   . GLU B 4   ? 2.1269 2.2514 1.8643 -0.1081 0.3171  -0.0488 1004 GLU B N   
3001 C CA  . GLU B 4   ? 2.0700 2.2618 1.9025 -0.0942 0.3403  -0.0481 1004 GLU B CA  
3002 C C   . GLU B 4   ? 2.1000 2.2996 1.9346 -0.0837 0.3168  -0.0605 1004 GLU B C   
3003 O O   . GLU B 4   ? 2.0298 2.2994 1.9489 -0.0735 0.3106  -0.0599 1004 GLU B O   
3004 C CB  . GLU B 4   ? 2.1511 2.3221 1.9733 -0.0757 0.4061  -0.0376 1004 GLU B CB  
3005 C CG  . GLU B 4   ? 2.2106 2.4758 2.1559 -0.0624 0.4315  -0.0307 1004 GLU B CG  
3006 C CD  . GLU B 4   ? 2.4693 2.7233 2.4165 -0.0389 0.5005  -0.0186 1004 GLU B CD  
3007 O OE1 . GLU B 4   ? 2.4072 2.6360 2.3255 -0.0097 0.5225  -0.0192 1004 GLU B OE1 
3008 O OE2 . GLU B 4   ? 2.3662 2.6341 2.3461 -0.0488 0.5378  -0.0076 1004 GLU B OE2 
3009 N N   . ASP B 5   ? 2.1197 2.2457 1.8578 -0.0880 0.3033  -0.0721 1005 ASP B N   
3010 C CA  . ASP B 5   ? 2.1151 2.2251 1.8374 -0.0841 0.2878  -0.0854 1005 ASP B CA  
3011 C C   . ASP B 5   ? 2.0852 2.2446 1.8583 -0.1001 0.2349  -0.0917 1005 ASP B C   
3012 O O   . ASP B 5   ? 2.0537 2.2241 1.8484 -0.0926 0.2283  -0.0971 1005 ASP B O   
3013 C CB  . ASP B 5   ? 2.2449 2.2546 1.8443 -0.0926 0.2939  -0.1004 1005 ASP B CB  
3014 C CG  . ASP B 5   ? 2.4710 2.4154 2.0042 -0.0734 0.3531  -0.0965 1005 ASP B CG  
3015 O OD1 . ASP B 5   ? 2.4864 2.4319 2.0454 -0.0457 0.3938  -0.0915 1005 ASP B OD1 
3016 O OD2 . ASP B 5   ? 2.6184 2.5079 2.0695 -0.0823 0.3608  -0.0967 1005 ASP B OD2 
3017 N N   . ASN B 6   ? 2.0145 2.1972 1.8027 -0.1183 0.2029  -0.0889 1006 ASN B N   
3018 C CA  . ASN B 6   ? 1.9452 2.1730 1.7824 -0.1306 0.1590  -0.0932 1006 ASN B CA  
3019 C C   . ASN B 6   ? 1.9245 2.2261 1.8567 -0.1247 0.1584  -0.0864 1006 ASN B C   
3020 O O   . ASN B 6   ? 1.8671 2.2060 1.8426 -0.1245 0.1360  -0.0912 1006 ASN B O   
3021 C CB  . ASN B 6   ? 1.9739 2.1867 1.7764 -0.1478 0.1257  -0.0925 1006 ASN B CB  
3022 C CG  . ASN B 6   ? 2.3237 2.4915 2.0545 -0.1613 0.1029  -0.1063 1006 ASN B CG  
3023 O OD1 . ASN B 6   ? 2.3368 2.4559 1.9879 -0.1665 0.1012  -0.1073 1006 ASN B OD1 
3024 N ND2 . ASN B 6   ? 2.1877 2.3703 1.9427 -0.1698 0.0844  -0.1184 1006 ASN B ND2 
3025 N N   . TRP B 7   ? 1.8886 2.2095 1.8504 -0.1225 0.1845  -0.0769 1007 TRP B N   
3026 C CA  . TRP B 7   ? 1.8294 2.2233 1.8822 -0.1237 0.1840  -0.0752 1007 TRP B CA  
3027 C C   . TRP B 7   ? 1.8258 2.2654 1.9236 -0.1015 0.1956  -0.0754 1007 TRP B C   
3028 O O   . TRP B 7   ? 1.7684 2.2696 1.9279 -0.1004 0.1753  -0.0793 1007 TRP B O   
3029 C CB  . TRP B 7   ? 1.8428 2.2427 1.9185 -0.1344 0.2118  -0.0668 1007 TRP B CB  
3030 C CG  . TRP B 7   ? 1.8587 2.2454 1.9324 -0.1541 0.1932  -0.0653 1007 TRP B CG  
3031 C CD1 . TRP B 7   ? 1.9549 2.2816 1.9661 -0.1592 0.2014  -0.0547 1007 TRP B CD1 
3032 C CD2 . TRP B 7   ? 1.8073 2.2334 1.9347 -0.1666 0.1653  -0.0732 1007 TRP B CD2 
3033 N NE1 . TRP B 7   ? 1.9352 2.2622 1.9634 -0.1712 0.1827  -0.0529 1007 TRP B NE1 
3034 C CE2 . TRP B 7   ? 1.8865 2.2712 1.9852 -0.1775 0.1620  -0.0659 1007 TRP B CE2 
3035 C CE3 . TRP B 7   ? 1.7676 2.2545 1.9563 -0.1669 0.1441  -0.0852 1007 TRP B CE3 
3036 C CZ2 . TRP B 7   ? 1.8509 2.2484 1.9831 -0.1890 0.1431  -0.0712 1007 TRP B CZ2 
3037 C CZ3 . TRP B 7   ? 1.7619 2.2610 1.9770 -0.1814 0.1225  -0.0930 1007 TRP B CZ3 
3038 C CH2 . TRP B 7   ? 1.7983 2.2516 1.9880 -0.1928 0.1248  -0.0867 1007 TRP B CH2 
3039 N N   . GLU B 8   ? 1.8074 2.2117 1.8661 -0.0808 0.2281  -0.0709 1008 GLU B N   
3040 C CA  . GLU B 8   ? 1.7875 2.2242 1.8779 -0.0498 0.2437  -0.0660 1008 GLU B CA  
3041 C C   . GLU B 8   ? 1.7741 2.2101 1.8568 -0.0445 0.2128  -0.0720 1008 GLU B C   
3042 O O   . GLU B 8   ? 1.7381 2.2326 1.8729 -0.0248 0.2047  -0.0675 1008 GLU B O   
3043 C CB  . GLU B 8   ? 1.8830 2.2583 1.9151 -0.0269 0.2904  -0.0601 1008 GLU B CB  
3044 C CG  . GLU B 8   ? 2.0210 2.4462 2.1121 -0.0042 0.3328  -0.0463 1008 GLU B CG  
3045 C CD  . GLU B 8   ? 2.2112 2.7210 2.3831 0.0291  0.3318  -0.0367 1008 GLU B CD  
3046 O OE1 . GLU B 8   ? 2.1684 2.6487 2.3133 0.0664  0.3599  -0.0279 1008 GLU B OE1 
3047 O OE2 . GLU B 8   ? 2.0532 2.6561 2.3112 0.0192  0.3034  -0.0380 1008 GLU B OE2 
3048 N N   . THR B 9   ? 1.7171 2.0919 1.7375 -0.0630 0.1944  -0.0817 1009 THR B N   
3049 C CA  . THR B 9   ? 1.6833 2.0485 1.6940 -0.0648 0.1704  -0.0881 1009 THR B CA  
3050 C C   . THR B 9   ? 1.6310 2.0625 1.7040 -0.0729 0.1372  -0.0896 1009 THR B C   
3051 O O   . THR B 9   ? 1.6069 2.0635 1.6999 -0.0572 0.1288  -0.0877 1009 THR B O   
3052 C CB  . THR B 9   ? 1.8132 2.1099 1.7555 -0.0896 0.1588  -0.0999 1009 THR B CB  
3053 O OG1 . THR B 9   ? 1.8700 2.1004 1.7442 -0.0870 0.1888  -0.1025 1009 THR B OG1 
3054 C CG2 . THR B 9   ? 1.7969 2.0747 1.7286 -0.0933 0.1467  -0.1068 1009 THR B CG2 
3055 N N   . LEU B 10  ? 1.5363 1.9869 1.6308 -0.0951 0.1223  -0.0923 1010 LEU B N   
3056 C CA  . LEU B 10  ? 1.4713 1.9702 1.6150 -0.1059 0.0960  -0.0968 1010 LEU B CA  
3057 C C   . LEU B 10  ? 1.4758 2.0449 1.6806 -0.0933 0.0970  -0.0959 1010 LEU B C   
3058 O O   . LEU B 10  ? 1.4412 2.0446 1.6697 -0.0911 0.0752  -0.1013 1010 LEU B O   
3059 C CB  . LEU B 10  ? 1.4692 1.9572 1.6135 -0.1292 0.0891  -0.0978 1010 LEU B CB  
3060 C CG  . LEU B 10  ? 1.5424 1.9866 1.6431 -0.1405 0.0716  -0.0986 1010 LEU B CG  
3061 C CD1 . LEU B 10  ? 1.5788 1.9916 1.6500 -0.1506 0.0776  -0.0917 1010 LEU B CD1 
3062 C CD2 . LEU B 10  ? 1.5405 2.0052 1.6684 -0.1459 0.0470  -0.1036 1010 LEU B CD2 
3063 N N   . ASN B 11  ? 1.4356 2.0290 1.6652 -0.0843 0.1222  -0.0893 1011 ASN B N   
3064 C CA  . ASN B 11  ? 1.4052 2.0824 1.7057 -0.0730 0.1212  -0.0882 1011 ASN B CA  
3065 C C   . ASN B 11  ? 1.4396 2.1374 1.7382 -0.0333 0.1224  -0.0786 1011 ASN B C   
3066 O O   . ASN B 11  ? 1.4134 2.1844 1.7599 -0.0210 0.1027  -0.0792 1011 ASN B O   
3067 C CB  . ASN B 11  ? 1.4296 2.1325 1.7695 -0.0793 0.1521  -0.0831 1011 ASN B CB  
3068 C CG  . ASN B 11  ? 1.7053 2.3968 2.0573 -0.1170 0.1530  -0.0907 1011 ASN B CG  
3069 O OD1 . ASN B 11  ? 1.5848 2.3026 1.9662 -0.1391 0.1279  -0.1032 1011 ASN B OD1 
3070 N ND2 . ASN B 11  ? 1.6456 2.2890 1.9674 -0.1235 0.1859  -0.0826 1011 ASN B ND2 
3071 N N   . ASP B 12  ? 1.4170 2.0465 1.6548 -0.0132 0.1454  -0.0702 1012 ASP B N   
3072 C CA  . ASP B 12  ? 1.4327 2.0573 1.6533 0.0281  0.1556  -0.0578 1012 ASP B CA  
3073 C C   . ASP B 12  ? 1.4330 2.0600 1.6402 0.0309  0.1255  -0.0611 1012 ASP B C   
3074 O O   . ASP B 12  ? 1.4314 2.1100 1.6618 0.0612  0.1145  -0.0522 1012 ASP B O   
3075 C CB  . ASP B 12  ? 1.5214 2.0498 1.6676 0.0397  0.1918  -0.0531 1012 ASP B CB  
3076 C CG  . ASP B 12  ? 1.7316 2.2585 1.8828 0.0712  0.2350  -0.0395 1012 ASP B CG  
3077 O OD1 . ASP B 12  ? 1.7305 2.3059 1.9308 0.0636  0.2455  -0.0380 1012 ASP B OD1 
3078 O OD2 . ASP B 12  ? 1.8733 2.3412 1.9756 0.1022  0.2645  -0.0303 1012 ASP B OD2 
3079 N N   . ASN B 13  ? 1.3466 1.9225 1.5176 0.0011  0.1122  -0.0728 1013 ASN B N   
3080 C CA  . ASN B 13  ? 1.3167 1.8841 1.4713 0.0001  0.0915  -0.0764 1013 ASN B CA  
3081 C C   . ASN B 13  ? 1.3045 1.9432 1.5045 -0.0068 0.0598  -0.0842 1013 ASN B C   
3082 O O   . ASN B 13  ? 1.3050 1.9504 1.4910 0.0068  0.0459  -0.0832 1013 ASN B O   
3083 C CB  . ASN B 13  ? 1.2924 1.7977 1.4104 -0.0300 0.0891  -0.0861 1013 ASN B CB  
3084 C CG  . ASN B 13  ? 1.5003 1.9307 1.5633 -0.0248 0.1156  -0.0829 1013 ASN B CG  
3085 O OD1 . ASN B 13  ? 1.4372 1.8354 1.4724 -0.0081 0.1268  -0.0770 1013 ASN B OD1 
3086 N ND2 . ASN B 13  ? 1.4000 1.7939 1.4389 -0.0389 0.1294  -0.0873 1013 ASN B ND2 
3087 N N   . LEU B 14  ? 1.2171 1.9024 1.4652 -0.0287 0.0518  -0.0929 1014 LEU B N   
3088 C CA  . LEU B 14  ? 1.1872 1.9366 1.4778 -0.0423 0.0236  -0.1058 1014 LEU B CA  
3089 C C   . LEU B 14  ? 1.2294 2.0492 1.5445 -0.0089 0.0100  -0.0988 1014 LEU B C   
3090 O O   . LEU B 14  ? 1.2319 2.0803 1.5426 -0.0064 -0.0175 -0.1070 1014 LEU B O   
3091 C CB  . LEU B 14  ? 1.1738 1.9500 1.5113 -0.0752 0.0267  -0.1160 1014 LEU B CB  
3092 C CG  . LEU B 14  ? 1.2303 1.9620 1.5530 -0.1093 0.0218  -0.1279 1014 LEU B CG  
3093 C CD1 . LEU B 14  ? 1.2367 1.9654 1.5855 -0.1342 0.0400  -0.1291 1014 LEU B CD1 
3094 C CD2 . LEU B 14  ? 1.2652 2.0187 1.5960 -0.1226 -0.0046 -0.1450 1014 LEU B CD2 
3095 N N   . LYS B 15  ? 1.1806 2.0249 1.5150 0.0209  0.0304  -0.0822 1015 LYS B N   
3096 C CA  . LYS B 15  ? 1.1855 2.1024 1.5470 0.0638  0.0205  -0.0684 1015 LYS B CA  
3097 C C   . LYS B 15  ? 1.2386 2.1103 1.5333 0.1004  0.0179  -0.0548 1015 LYS B C   
3098 O O   . LYS B 15  ? 1.2520 2.1785 1.5493 0.1267  -0.0091 -0.0502 1015 LYS B O   
3099 C CB  . LYS B 15  ? 1.2336 2.1726 1.6286 0.0915  0.0542  -0.0501 1015 LYS B CB  
3100 C CG  . LYS B 15  ? 1.3733 2.3499 1.8317 0.0573  0.0676  -0.0599 1015 LYS B CG  
3101 C CD  . LYS B 15  ? 1.5024 2.5087 1.9984 0.0902  0.1054  -0.0403 1015 LYS B CD  
3102 C CE  . LYS B 15  ? 1.5838 2.5891 2.1162 0.0553  0.1335  -0.0473 1015 LYS B CE  
3103 N NZ  . LYS B 15  ? 1.6885 2.7916 2.3125 0.0742  0.1534  -0.0360 1015 LYS B NZ  
3104 N N   . VAL B 16  ? 1.1844 1.9543 1.4163 0.0994  0.0460  -0.0494 1016 VAL B N   
3105 C CA  . VAL B 16  ? 1.2114 1.9155 1.3752 0.1261  0.0564  -0.0369 1016 VAL B CA  
3106 C C   . VAL B 16  ? 1.2375 1.9511 1.3832 0.1136  0.0256  -0.0485 1016 VAL B C   
3107 O O   . VAL B 16  ? 1.2786 1.9937 1.3886 0.1494  0.0192  -0.0353 1016 VAL B O   
3108 C CB  . VAL B 16  ? 1.2753 1.8736 1.3882 0.1107  0.0918  -0.0369 1016 VAL B CB  
3109 C CG1 . VAL B 16  ? 1.3198 1.8460 1.3682 0.1278  0.1070  -0.0271 1016 VAL B CG1 
3110 C CG2 . VAL B 16  ? 1.3016 1.8763 1.4136 0.1276  0.1264  -0.0265 1016 VAL B CG2 
3111 N N   . ILE B 17  ? 1.1310 1.8470 1.2957 0.0672  0.0097  -0.0713 1017 ILE B N   
3112 C CA  . ILE B 17  ? 1.1164 1.8318 1.2617 0.0525  -0.0132 -0.0853 1017 ILE B CA  
3113 C C   . ILE B 17  ? 1.1590 1.9546 1.3176 0.0714  -0.0480 -0.0889 1017 ILE B C   
3114 O O   . ILE B 17  ? 1.1882 1.9714 1.2981 0.0890  -0.0596 -0.0873 1017 ILE B O   
3115 C CB  . ILE B 17  ? 1.1144 1.8142 1.2813 0.0040  -0.0180 -0.1065 1017 ILE B CB  
3116 C CG1 . ILE B 17  ? 1.1143 1.7407 1.2594 -0.0105 0.0079  -0.1021 1017 ILE B CG1 
3117 C CG2 . ILE B 17  ? 1.1323 1.8348 1.2820 -0.0088 -0.0387 -0.1230 1017 ILE B CG2 
3118 C CD1 . ILE B 17  ? 1.1779 1.7959 1.3503 -0.0473 0.0072  -0.1137 1017 ILE B CD1 
3119 N N   . GLU B 18  ? 1.0839 1.9624 1.3064 0.0685  -0.0634 -0.0931 1018 GLU B N   
3120 C CA  . GLU B 18  ? 1.0951 2.0689 1.3444 0.0813  -0.1029 -0.0996 1018 GLU B CA  
3121 C C   . GLU B 18  ? 1.1733 2.1669 1.3874 0.1443  -0.1075 -0.0715 1018 GLU B C   
3122 O O   . GLU B 18  ? 1.2017 2.2398 1.3921 0.1612  -0.1431 -0.0752 1018 GLU B O   
3123 C CB  . GLU B 18  ? 1.0824 2.1459 1.4238 0.0587  -0.1123 -0.1102 1018 GLU B CB  
3124 C CG  . GLU B 18  ? 1.2095 2.2869 1.5826 -0.0006 -0.1289 -0.1441 1018 GLU B CG  
3125 C CD  . GLU B 18  ? 1.4256 2.4253 1.7960 -0.0364 -0.0969 -0.1494 1018 GLU B CD  
3126 O OE1 . GLU B 18  ? 1.3718 2.3910 1.7949 -0.0528 -0.0781 -0.1479 1018 GLU B OE1 
3127 O OE2 . GLU B 18  ? 1.2908 2.2126 1.6063 -0.0455 -0.0897 -0.1534 1018 GLU B OE2 
3128 N N   . LYS B 19  ? 1.1324 2.0866 1.3348 0.1803  -0.0708 -0.0436 1019 LYS B N   
3129 C CA  . LYS B 19  ? 1.1893 2.1466 1.3539 0.2472  -0.0649 -0.0110 1019 LYS B CA  
3130 C C   . LYS B 19  ? 1.2829 2.1278 1.3483 0.2675  -0.0394 0.0034  1019 LYS B C   
3131 O O   . LYS B 19  ? 1.3423 2.1698 1.3590 0.3250  -0.0296 0.0328  1019 LYS B O   
3132 C CB  . LYS B 19  ? 1.2255 2.1928 1.4281 0.2792  -0.0310 0.0122  1019 LYS B CB  
3133 C CG  . LYS B 19  ? 1.3644 2.4653 1.6681 0.2824  -0.0547 0.0096  1019 LYS B CG  
3134 C CD  . LYS B 19  ? 1.5642 2.7608 1.8798 0.3441  -0.0867 0.0324  1019 LYS B CD  
3135 C CE  . LYS B 19  ? 1.7175 3.0675 2.1491 0.3388  -0.1177 0.0250  1019 LYS B CE  
3136 N NZ  . LYS B 19  ? 1.8927 3.3510 2.3376 0.3973  -0.1608 0.0451  1019 LYS B NZ  
3137 N N   . ALA B 20  ? 1.2140 1.9856 1.2525 0.2224  -0.0269 -0.0154 1020 ALA B N   
3138 C CA  . ALA B 20  ? 1.2550 1.9252 1.2137 0.2311  0.0014  -0.0054 1020 ALA B CA  
3139 C C   . ALA B 20  ? 1.3510 2.0317 1.2534 0.2522  -0.0242 -0.0044 1020 ALA B C   
3140 O O   . ALA B 20  ? 1.3278 2.0768 1.2525 0.2327  -0.0663 -0.0267 1020 ALA B O   
3141 C CB  . ALA B 20  ? 1.2176 1.8276 1.1832 0.1764  0.0196  -0.0258 1020 ALA B CB  
3142 N N   . ASP B 21  ? 1.3775 1.9816 1.1998 0.2900  0.0046  0.0204  1021 ASP B N   
3143 C CA  . ASP B 21  ? 1.4420 2.0359 1.1885 0.3176  -0.0109 0.0267  1021 ASP B CA  
3144 C C   . ASP B 21  ? 1.4956 1.9925 1.1892 0.2925  0.0235  0.0206  1021 ASP B C   
3145 O O   . ASP B 21  ? 1.5321 2.0236 1.1746 0.2943  0.0086  0.0123  1021 ASP B O   
3146 C CB  . ASP B 21  ? 1.5598 2.1451 1.2470 0.3926  -0.0031 0.0668  1021 ASP B CB  
3147 C CG  . ASP B 21  ? 1.6846 2.3906 1.4242 0.4268  -0.0474 0.0745  1021 ASP B CG  
3148 O OD1 . ASP B 21  ? 1.6398 2.3796 1.4520 0.4225  -0.0374 0.0767  1021 ASP B OD1 
3149 O OD2 . ASP B 21  ? 1.8098 2.5784 1.5169 0.4589  -0.0914 0.0787  1021 ASP B OD2 
3150 N N   . ASN B 22  ? 1.4192 1.8426 1.1258 0.2683  0.0697  0.0233  1022 ASN B N   
3151 C CA  . ASN B 22  ? 1.4263 1.7691 1.1043 0.2405  0.1064  0.0181  1022 ASN B CA  
3152 C C   . ASN B 22  ? 1.3692 1.7254 1.1208 0.1789  0.1036  -0.0106 1022 ASN B C   
3153 O O   . ASN B 22  ? 1.2992 1.6968 1.1109 0.1599  0.0888  -0.0202 1022 ASN B O   
3154 C CB  . ASN B 22  ? 1.5218 1.7650 1.1498 0.2612  0.1643  0.0451  1022 ASN B CB  
3155 C CG  . ASN B 22  ? 1.9289 2.1559 1.5850 0.2651  0.1835  0.0542  1022 ASN B CG  
3156 O OD1 . ASN B 22  ? 1.9053 2.1693 1.5610 0.3065  0.1697  0.0702  1022 ASN B OD1 
3157 N ND2 . ASN B 22  ? 1.8431 2.0115 1.5199 0.2243  0.2183  0.0447  1022 ASN B ND2 
3158 N N   . ALA B 23  ? 1.3189 1.6402 1.0632 0.1523  0.1199  -0.0216 1023 ALA B N   
3159 C CA  . ALA B 23  ? 1.2393 1.5726 1.0485 0.1018  0.1183  -0.0441 1023 ALA B CA  
3160 C C   . ALA B 23  ? 1.2536 1.5530 1.0982 0.0769  0.1457  -0.0414 1023 ALA B C   
3161 O O   . ALA B 23  ? 1.1791 1.5051 1.0818 0.0412  0.1332  -0.0573 1023 ALA B O   
3162 C CB  . ALA B 23  ? 1.2697 1.5749 1.0599 0.0903  0.1343  -0.0516 1023 ALA B CB  
3163 N N   . ALA B 24  ? 1.2710 1.5065 1.0735 0.0959  0.1834  -0.0216 1024 ALA B N   
3164 C CA  . ALA B 24  ? 1.2678 1.4592 1.0894 0.0709  0.2117  -0.0221 1024 ALA B CA  
3165 C C   . ALA B 24  ? 1.2644 1.4879 1.1126 0.0714  0.1911  -0.0262 1024 ALA B C   
3166 O O   . ALA B 24  ? 1.2265 1.4414 1.1071 0.0367  0.1945  -0.0389 1024 ALA B O   
3167 C CB  . ALA B 24  ? 1.3745 1.4776 1.1332 0.0934  0.2623  -0.0002 1024 ALA B CB  
3168 N N   . GLN B 25  ? 1.2177 1.4827 1.0527 0.1113  0.1694  -0.0157 1025 GLN B N   
3169 C CA  . GLN B 25  ? 1.1790 1.4864 1.0447 0.1188  0.1525  -0.0168 1025 GLN B CA  
3170 C C   . GLN B 25  ? 1.1394 1.5109 1.0685 0.0801  0.1181  -0.0404 1025 GLN B C   
3171 O O   . GLN B 25  ? 1.1070 1.4846 1.0643 0.0624  0.1179  -0.0473 1025 GLN B O   
3172 C CB  . GLN B 25  ? 1.2247 1.5769 1.0715 0.1731  0.1360  0.0020  1025 GLN B CB  
3173 C CG  . GLN B 25  ? 1.4566 1.7645 1.2678 0.2173  0.1683  0.0276  1025 GLN B CG  
3174 C CD  . GLN B 25  ? 1.7101 2.0977 1.5354 0.2667  0.1411  0.0433  1025 GLN B CD  
3175 O OE1 . GLN B 25  ? 1.6624 2.0762 1.4544 0.3052  0.1236  0.0578  1025 GLN B OE1 
3176 N NE2 . GLN B 25  ? 1.6352 2.0677 1.5111 0.2668  0.1364  0.0407  1025 GLN B NE2 
3177 N N   . VAL B 26  ? 1.0654 1.4749 1.0078 0.0689  0.0932  -0.0520 1026 VAL B N   
3178 C CA  . VAL B 26  ? 0.9991 1.4588 0.9930 0.0357  0.0647  -0.0727 1026 VAL B CA  
3179 C C   . VAL B 26  ? 1.0184 1.4487 1.0371 -0.0032 0.0759  -0.0824 1026 VAL B C   
3180 O O   . VAL B 26  ? 0.9753 1.4268 1.0286 -0.0247 0.0640  -0.0911 1026 VAL B O   
3181 C CB  . VAL B 26  ? 1.0530 1.5438 1.0391 0.0375  0.0415  -0.0832 1026 VAL B CB  
3182 C CG1 . VAL B 26  ? 0.9992 1.5237 1.0322 0.0024  0.0205  -0.1043 1026 VAL B CG1 
3183 C CG2 . VAL B 26  ? 1.0862 1.6210 1.0502 0.0735  0.0200  -0.0763 1026 VAL B CG2 
3184 N N   . LYS B 27  ? 0.9972 1.3823 0.9994 -0.0114 0.0990  -0.0797 1027 LYS B N   
3185 C CA  . LYS B 27  ? 0.9705 1.3411 1.0042 -0.0474 0.1062  -0.0883 1027 LYS B CA  
3186 C C   . LYS B 27  ? 1.0273 1.3759 1.0623 -0.0625 0.1128  -0.0899 1027 LYS B C   
3187 O O   . LYS B 27  ? 0.9930 1.3555 1.0584 -0.0908 0.0996  -0.1000 1027 LYS B O   
3188 C CB  . LYS B 27  ? 1.0322 1.3648 1.0548 -0.0522 0.1352  -0.0838 1027 LYS B CB  
3189 C CG  . LYS B 27  ? 1.1469 1.4946 1.2216 -0.0868 0.1336  -0.0935 1027 LYS B CG  
3190 C CD  . LYS B 27  ? 1.2912 1.6031 1.3689 -0.0998 0.1692  -0.0894 1027 LYS B CD  
3191 C CE  . LYS B 27  ? 1.3817 1.7209 1.5216 -0.1380 0.1619  -0.0996 1027 LYS B CE  
3192 N NZ  . LYS B 27  ? 1.5326 1.8549 1.6964 -0.1554 0.1966  -0.0974 1027 LYS B NZ  
3193 N N   . ASP B 28  ? 1.0326 1.3430 1.0276 -0.0401 0.1338  -0.0793 1028 ASP B N   
3194 C CA  . ASP B 28  ? 1.0583 1.3306 1.0371 -0.0495 0.1482  -0.0816 1028 ASP B CA  
3195 C C   . ASP B 28  ? 1.0565 1.3685 1.0567 -0.0529 0.1257  -0.0875 1028 ASP B C   
3196 O O   . ASP B 28  ? 1.0545 1.3483 1.0533 -0.0785 0.1251  -0.0977 1028 ASP B O   
3197 C CB  . ASP B 28  ? 1.1574 1.3742 1.0835 -0.0141 0.1818  -0.0649 1028 ASP B CB  
3198 C CG  . ASP B 28  ? 1.3830 1.5202 1.2760 -0.0342 0.2152  -0.0703 1028 ASP B CG  
3199 O OD1 . ASP B 28  ? 1.4346 1.5234 1.3136 -0.0512 0.2402  -0.0715 1028 ASP B OD1 
3200 O OD2 . ASP B 28  ? 1.4849 1.6048 1.3645 -0.0356 0.2192  -0.0752 1028 ASP B OD2 
3201 N N   . ALA B 29  ? 0.9724 1.3380 0.9903 -0.0292 0.1082  -0.0821 1029 ALA B N   
3202 C CA  . ALA B 29  ? 0.9291 1.3361 0.9745 -0.0329 0.0928  -0.0863 1029 ALA B CA  
3203 C C   . ALA B 29  ? 0.9242 1.3548 1.0016 -0.0664 0.0704  -0.0990 1029 ALA B C   
3204 O O   . ALA B 29  ? 0.9157 1.3456 0.9976 -0.0807 0.0678  -0.1030 1029 ALA B O   
3205 C CB  . ALA B 29  ? 0.9248 1.3904 0.9899 -0.0035 0.0800  -0.0791 1029 ALA B CB  
3206 N N   . LEU B 30  ? 0.8485 1.2941 0.9420 -0.0748 0.0582  -0.1033 1030 LEU B N   
3207 C CA  . LEU B 30  ? 0.8121 1.2757 0.9350 -0.0987 0.0409  -0.1115 1030 LEU B CA  
3208 C C   . LEU B 30  ? 0.8866 1.3250 1.0078 -0.1223 0.0418  -0.1144 1030 LEU B C   
3209 O O   . LEU B 30  ? 0.8747 1.3262 1.0118 -0.1367 0.0268  -0.1169 1030 LEU B O   
3210 C CB  . LEU B 30  ? 0.8010 1.2778 0.9354 -0.0960 0.0356  -0.1143 1030 LEU B CB  
3211 C CG  . LEU B 30  ? 0.8544 1.3628 0.9903 -0.0821 0.0240  -0.1186 1030 LEU B CG  
3212 C CD1 . LEU B 30  ? 0.8674 1.3677 0.9911 -0.0761 0.0267  -0.1217 1030 LEU B CD1 
3213 C CD2 . LEU B 30  ? 0.8609 1.3963 1.0257 -0.0975 0.0093  -0.1271 1030 LEU B CD2 
3214 N N   . THR B 31  ? 0.8773 1.2790 0.9774 -0.1271 0.0589  -0.1144 1031 THR B N   
3215 C CA  . THR B 31  ? 0.8957 1.2777 0.9947 -0.1557 0.0568  -0.1221 1031 THR B CA  
3216 C C   . THR B 31  ? 0.9702 1.3316 1.0382 -0.1626 0.0538  -0.1263 1031 THR B C   
3217 O O   . THR B 31  ? 0.9746 1.3425 1.0443 -0.1834 0.0351  -0.1323 1031 THR B O   
3218 C CB  . THR B 31  ? 1.0487 1.3911 1.1336 -0.1638 0.0819  -0.1237 1031 THR B CB  
3219 O OG1 . THR B 31  ? 1.0689 1.4286 1.1787 -0.1557 0.0885  -0.1182 1031 THR B OG1 
3220 C CG2 . THR B 31  ? 1.0412 1.3696 1.1307 -0.2017 0.0772  -0.1370 1031 THR B CG2 
3221 N N   . LYS B 32  ? 0.9397 1.2784 0.9775 -0.1411 0.0729  -0.1214 1032 LYS B N   
3222 C CA  . LYS B 32  ? 0.9638 1.2766 0.9672 -0.1411 0.0802  -0.1236 1032 LYS B CA  
3223 C C   . LYS B 32  ? 0.9717 1.3228 0.9958 -0.1422 0.0617  -0.1208 1032 LYS B C   
3224 O O   . LYS B 32  ? 0.9965 1.3265 0.9909 -0.1522 0.0608  -0.1240 1032 LYS B O   
3225 C CB  . LYS B 32  ? 1.0205 1.3078 0.9982 -0.1097 0.1104  -0.1146 1032 LYS B CB  
3226 C CG  . LYS B 32  ? 1.1480 1.3732 1.0877 -0.1060 0.1387  -0.1151 1032 LYS B CG  
3227 C CD  . LYS B 32  ? 1.2549 1.4442 1.1602 -0.0703 0.1723  -0.1038 1032 LYS B CD  
3228 C CE  . LYS B 32  ? 1.3808 1.5140 1.2536 -0.0523 0.2034  -0.0956 1032 LYS B CE  
3229 N NZ  . LYS B 32  ? 1.4206 1.5997 1.3194 -0.0186 0.1971  -0.0780 1032 LYS B NZ  
3230 N N   . MET B 33  ? 0.8709 1.2697 0.9381 -0.1333 0.0498  -0.1158 1033 MET B N   
3231 C CA  . MET B 33  ? 0.8421 1.2697 0.9314 -0.1368 0.0379  -0.1134 1033 MET B CA  
3232 C C   . MET B 33  ? 0.8883 1.3145 0.9795 -0.1551 0.0178  -0.1146 1033 MET B C   
3233 O O   . MET B 33  ? 0.8875 1.3041 0.9613 -0.1603 0.0145  -0.1113 1033 MET B O   
3234 C CB  . MET B 33  ? 0.8346 1.3051 0.9637 -0.1264 0.0325  -0.1125 1033 MET B CB  
3235 C CG  . MET B 33  ? 0.8879 1.3816 1.0263 -0.1074 0.0446  -0.1092 1033 MET B CG  
3236 S SD  . MET B 33  ? 0.9206 1.4692 1.0992 -0.1013 0.0290  -0.1143 1033 MET B SD  
3237 C CE  . MET B 33  ? 0.8662 1.4324 1.0755 -0.1241 0.0255  -0.1196 1033 MET B CE  
3238 N N   . ARG B 34  ? 0.8433 1.2808 0.9559 -0.1615 0.0066  -0.1169 1034 ARG B N   
3239 C CA  . ARG B 34  ? 0.8428 1.2939 0.9710 -0.1729 -0.0143 -0.1149 1034 ARG B CA  
3240 C C   . ARG B 34  ? 0.9547 1.3851 1.0452 -0.1879 -0.0260 -0.1182 1034 ARG B C   
3241 O O   . ARG B 34  ? 0.9659 1.4029 1.0496 -0.1887 -0.0433 -0.1114 1034 ARG B O   
3242 C CB  . ARG B 34  ? 0.8200 1.2907 0.9843 -0.1764 -0.0171 -0.1166 1034 ARG B CB  
3243 C CG  . ARG B 34  ? 0.9036 1.4041 1.1028 -0.1758 -0.0352 -0.1094 1034 ARG B CG  
3244 C CD  . ARG B 34  ? 0.9683 1.4947 1.2083 -0.1839 -0.0381 -0.1107 1034 ARG B CD  
3245 N NE  . ARG B 34  ? 1.0590 1.6163 1.3412 -0.1709 -0.0454 -0.1001 1034 ARG B NE  
3246 C CZ  . ARG B 34  ? 1.2198 1.8070 1.5235 -0.1699 -0.0684 -0.0911 1034 ARG B CZ  
3247 N NH1 . ARG B 34  ? 1.0427 1.6353 1.3252 -0.1859 -0.0915 -0.0944 1034 ARG B NH1 
3248 N NH2 . ARG B 34  ? 1.0314 1.6412 1.3731 -0.1505 -0.0683 -0.0783 1034 ARG B NH2 
3249 N N   . ALA B 35  ? 0.9603 1.3586 1.0176 -0.1985 -0.0151 -0.1285 1035 ALA B N   
3250 C CA  . ALA B 35  ? 1.0270 1.3947 1.0340 -0.2170 -0.0249 -0.1379 1035 ALA B CA  
3251 C C   . ALA B 35  ? 1.1348 1.4772 1.0950 -0.2070 -0.0187 -0.1318 1035 ALA B C   
3252 O O   . ALA B 35  ? 1.1618 1.4996 1.0905 -0.2143 -0.0395 -0.1305 1035 ALA B O   
3253 C CB  . ALA B 35  ? 1.0783 1.4011 1.0537 -0.2301 -0.0043 -0.1522 1035 ALA B CB  
3254 N N   . ALA B 36  ? 1.1090 1.4403 1.0677 -0.1885 0.0099  -0.1262 1036 ALA B N   
3255 C CA  . ALA B 36  ? 1.1466 1.4572 1.0727 -0.1782 0.0270  -0.1191 1036 ALA B CA  
3256 C C   . ALA B 36  ? 1.1955 1.5279 1.1381 -0.1752 0.0140  -0.1064 1036 ALA B C   
3257 O O   . ALA B 36  ? 1.2427 1.5462 1.1386 -0.1744 0.0191  -0.1003 1036 ALA B O   
3258 C CB  . ALA B 36  ? 1.1396 1.4564 1.0864 -0.1586 0.0582  -0.1150 1036 ALA B CB  
3259 N N   . ALA B 37  ? 1.1020 1.4750 1.1025 -0.1720 0.0020  -0.1017 1037 ALA B N   
3260 C CA  . ALA B 37  ? 1.0954 1.4790 1.1123 -0.1677 -0.0052 -0.0895 1037 ALA B CA  
3261 C C   . ALA B 37  ? 1.1941 1.5705 1.1806 -0.1699 -0.0325 -0.0823 1037 ALA B C   
3262 O O   . ALA B 37  ? 1.2269 1.5837 1.1852 -0.1625 -0.0315 -0.0683 1037 ALA B O   
3263 C CB  . ALA B 37  ? 1.0503 1.4684 1.1273 -0.1638 -0.0080 -0.0903 1037 ALA B CB  
3264 N N   . LEU B 38  ? 1.1582 1.5518 1.1504 -0.1800 -0.0563 -0.0910 1038 LEU B N   
3265 C CA  . LEU B 38  ? 1.1989 1.6041 1.1717 -0.1837 -0.0905 -0.0865 1038 LEU B CA  
3266 C C   . LEU B 38  ? 1.3606 1.7217 1.2478 -0.1907 -0.0947 -0.0903 1038 LEU B C   
3267 O O   . LEU B 38  ? 1.4053 1.7631 1.2537 -0.1841 -0.1180 -0.0789 1038 LEU B O   
3268 C CB  . LEU B 38  ? 1.1735 1.6185 1.1893 -0.1994 -0.1119 -0.0986 1038 LEU B CB  
3269 C CG  . LEU B 38  ? 1.1643 1.6553 1.2579 -0.1896 -0.1128 -0.0915 1038 LEU B CG  
3270 C CD1 . LEU B 38  ? 1.1381 1.6515 1.2707 -0.2080 -0.1119 -0.1065 1038 LEU B CD1 
3271 C CD2 . LEU B 38  ? 1.2075 1.7334 1.3228 -0.1738 -0.1396 -0.0732 1038 LEU B CD2 
3272 N N   . ASP B 39  ? 1.3672 1.6901 1.2190 -0.2003 -0.0701 -0.1052 1039 ASP B N   
3273 C CA  . ASP B 39  ? 1.4655 1.7321 1.2265 -0.2072 -0.0635 -0.1130 1039 ASP B CA  
3274 C C   . ASP B 39  ? 1.5716 1.8034 1.2916 -0.1887 -0.0372 -0.0953 1039 ASP B C   
3275 O O   . ASP B 39  ? 1.6517 1.8385 1.2867 -0.1885 -0.0391 -0.0940 1039 ASP B O   
3276 C CB  . ASP B 39  ? 1.5076 1.7390 1.2507 -0.2183 -0.0363 -0.1328 1039 ASP B CB  
3277 C CG  . ASP B 39  ? 1.7875 1.9490 1.4308 -0.2284 -0.0246 -0.1471 1039 ASP B CG  
3278 O OD1 . ASP B 39  ? 1.8740 2.0203 1.4543 -0.2368 -0.0528 -0.1494 1039 ASP B OD1 
3279 O OD2 . ASP B 39  ? 1.8916 2.0112 1.5145 -0.2264 0.0120  -0.1567 1039 ASP B OD2 
3280 N N   . ALA B 40  ? 1.4919 1.7422 1.2688 -0.1757 -0.0117 -0.0832 1040 ALA B N   
3281 C CA  . ALA B 40  ? 1.5284 1.7507 1.2842 -0.1635 0.0201  -0.0670 1040 ALA B CA  
3282 C C   . ALA B 40  ? 1.6329 1.8525 1.3759 -0.1530 0.0036  -0.0461 1040 ALA B C   
3283 O O   . ALA B 40  ? 1.6883 1.8637 1.3767 -0.1440 0.0250  -0.0306 1040 ALA B O   
3284 C CB  . ALA B 40  ? 1.4718 1.7224 1.3008 -0.1603 0.0507  -0.0669 1040 ALA B CB  
3285 N N   . GLN B 41  ? 1.5723 1.8353 1.3642 -0.1510 -0.0297 -0.0433 1041 GLN B N   
3286 C CA  . GLN B 41  ? 1.6037 1.8717 1.3962 -0.1342 -0.0478 -0.0213 1041 GLN B CA  
3287 C C   . GLN B 41  ? 1.7926 2.0287 1.4932 -0.1236 -0.0705 -0.0078 1041 GLN B C   
3288 O O   . GLN B 41  ? 1.8420 2.0540 1.5135 -0.1022 -0.0679 0.0180  1041 GLN B O   
3289 C CB  . GLN B 41  ? 1.5587 1.8863 1.4236 -0.1334 -0.0788 -0.0248 1041 GLN B CB  
3290 C CG  . GLN B 41  ? 1.7221 2.0585 1.6156 -0.1106 -0.0835 -0.0017 1041 GLN B CG  
3291 C CD  . GLN B 41  ? 1.8804 2.2759 1.8485 -0.1077 -0.1064 -0.0054 1041 GLN B CD  
3292 O OE1 . GLN B 41  ? 1.7964 2.2345 1.7787 -0.1166 -0.1388 -0.0147 1041 GLN B OE1 
3293 N NE2 . GLN B 41  ? 1.7541 2.1506 1.7702 -0.0965 -0.0873 0.0013  1041 GLN B NE2 
3294 N N   . LYS B 42  ? 1.8142 2.0433 1.4616 -0.1383 -0.0914 -0.0256 1042 LYS B N   
3295 C CA  . LYS B 42  ? 1.9280 2.1316 1.4785 -0.1331 -0.1223 -0.0200 1042 LYS B CA  
3296 C C   . LYS B 42  ? 2.1017 2.2238 1.5481 -0.1295 -0.0853 -0.0164 1042 LYS B C   
3297 O O   . LYS B 42  ? 2.1958 2.2811 1.5474 -0.1158 -0.1010 -0.0022 1042 LYS B O   
3298 C CB  . LYS B 42  ? 1.9680 2.2075 1.5163 -0.1584 -0.1671 -0.0473 1042 LYS B CB  
3299 C CG  . LYS B 42  ? 2.0942 2.4186 1.7359 -0.1585 -0.2081 -0.0452 1042 LYS B CG  
3300 C CD  . LYS B 42  ? 2.1940 2.5564 1.8750 -0.1938 -0.2294 -0.0778 1042 LYS B CD  
3301 C CE  . LYS B 42  ? 2.2360 2.6814 2.0292 -0.1945 -0.2511 -0.0753 1042 LYS B CE  
3302 N NZ  . LYS B 42  ? 2.2808 2.7389 2.1291 -0.2239 -0.2353 -0.1017 1042 LYS B NZ  
3303 N N   . ALA B 43  ? 2.0574 2.1538 1.5212 -0.1382 -0.0352 -0.0268 1043 ALA B N   
3304 C CA  . ALA B 43  ? 2.1462 2.1703 1.5281 -0.1341 0.0117  -0.0238 1043 ALA B CA  
3305 C C   . ALA B 43  ? 2.2561 2.2458 1.6261 -0.1149 0.0504  0.0067  1043 ALA B C   
3306 O O   . ALA B 43  ? 2.1903 2.2125 1.6381 -0.1097 0.0536  0.0197  1043 ALA B O   
3307 C CB  . ALA B 43  ? 2.1067 2.1310 1.5307 -0.1458 0.0513  -0.0433 1043 ALA B CB  
3308 N N   . THR B 44  ? 2.3398 2.2549 1.6059 -0.1059 0.0843  0.0172  1044 THR B N   
3309 C CA  . THR B 44  ? 2.3996 2.2649 1.6391 -0.0905 0.1332  0.0465  1044 THR B CA  
3310 C C   . THR B 44  ? 2.4659 2.3128 1.7335 -0.0994 0.2012  0.0401  1044 THR B C   
3311 O O   . THR B 44  ? 2.5064 2.3214 1.7166 -0.1023 0.2177  0.0249  1044 THR B O   
3312 C CB  . THR B 44  ? 2.6231 2.4167 1.7199 -0.0691 0.1243  0.0685  1044 THR B CB  
3313 O OG1 . THR B 44  ? 2.6886 2.4342 1.6823 -0.0748 0.1281  0.0501  1044 THR B OG1 
3314 C CG2 . THR B 44  ? 2.6135 2.4403 1.6972 -0.0537 0.0562  0.0811  1044 THR B CG2 
3315 N N   . PRO B 45  ? 2.3902 2.2602 1.7500 -0.1049 0.2406  0.0493  1045 PRO B N   
3316 C CA  . PRO B 45  ? 2.3794 2.2546 1.7877 -0.1139 0.3014  0.0430  1045 PRO B CA  
3317 C C   . PRO B 45  ? 2.5725 2.3648 1.8825 -0.1034 0.3616  0.0591  1045 PRO B C   
3318 O O   . PRO B 45  ? 2.6708 2.3959 1.8782 -0.0894 0.3614  0.0806  1045 PRO B O   
3319 C CB  . PRO B 45  ? 2.3230 2.2466 1.8497 -0.1273 0.3188  0.0477  1045 PRO B CB  
3320 C CG  . PRO B 45  ? 2.4047 2.3032 1.9032 -0.1189 0.2928  0.0666  1045 PRO B CG  
3321 C CD  . PRO B 45  ? 2.3665 2.2623 1.7948 -0.1050 0.2313  0.0634  1045 PRO B CD  
3322 N N   . PRO B 46  ? 2.5426 2.3375 1.8799 -0.1059 0.4163  0.0519  1046 PRO B N   
3323 C CA  . PRO B 46  ? 2.6716 2.3840 1.9150 -0.0944 0.4822  0.0681  1046 PRO B CA  
3324 C C   . PRO B 46  ? 2.7795 2.4648 2.0427 -0.0984 0.5357  0.0954  1046 PRO B C   
3325 O O   . PRO B 46  ? 2.8874 2.4979 2.0705 -0.0887 0.5967  0.1131  1046 PRO B O   
3326 C CB  . PRO B 46  ? 2.6659 2.4070 1.9614 -0.0934 0.5249  0.0529  1046 PRO B CB  
3327 C CG  . PRO B 46  ? 2.5738 2.4233 2.0235 -0.1074 0.4982  0.0386  1046 PRO B CG  
3328 C CD  . PRO B 46  ? 2.4609 2.3332 1.9116 -0.1140 0.4223  0.0315  1046 PRO B CD  
3329 N N   . LYS B 47  ? 2.6683 2.4064 2.0336 -0.1141 0.5178  0.0977  1047 LYS B N   
3330 C CA  . LYS B 47  ? 2.7095 2.4189 2.1025 -0.1247 0.5654  0.1198  1047 LYS B CA  
3331 C C   . LYS B 47  ? 2.8507 2.4859 2.1384 -0.1062 0.5395  0.1449  1047 LYS B C   
3332 O O   . LYS B 47  ? 2.9466 2.5062 2.1814 -0.1016 0.5910  0.1726  1047 LYS B O   
3333 C CB  . LYS B 47  ? 2.6223 2.4226 2.1776 -0.1544 0.5610  0.1044  1047 LYS B CB  
3334 C CG  . LYS B 47  ? 2.7302 2.6207 2.4025 -0.1689 0.5803  0.0825  1047 LYS B CG  
3335 C CD  . LYS B 47  ? 2.9002 2.7884 2.6228 -0.1841 0.6638  0.0926  1047 LYS B CD  
3336 C CE  . LYS B 47  ? 2.9452 2.9363 2.7885 -0.1909 0.6768  0.0739  1047 LYS B CE  
3337 N NZ  . LYS B 47  ? 3.0884 3.1059 2.9947 -0.2019 0.7450  0.0871  1047 LYS B NZ  
3338 N N   . LEU B 48  ? 2.7774 2.4363 2.0380 -0.0938 0.4620  0.1371  1048 LEU B N   
3339 C CA  . LEU B 48  ? 2.8491 2.4594 2.0221 -0.0695 0.4244  0.1614  1048 LEU B CA  
3340 C C   . LEU B 48  ? 2.9674 2.5554 2.0166 -0.0477 0.3705  0.1582  1048 LEU B C   
3341 O O   . LEU B 48  ? 2.9713 2.5684 1.9851 -0.0302 0.3102  0.1668  1048 LEU B O   
3342 C CB  . LEU B 48  ? 2.7509 2.4219 2.0216 -0.0753 0.3791  0.1564  1048 LEU B CB  
3343 C CG  . LEU B 48  ? 2.7146 2.4382 2.1288 -0.1071 0.4084  0.1412  1048 LEU B CG  
3344 C CD1 . LEU B 48  ? 2.6274 2.4065 2.1145 -0.1086 0.3552  0.1310  1048 LEU B CD1 
3345 C CD2 . LEU B 48  ? 2.8258 2.4828 2.2389 -0.1173 0.4825  0.1631  1048 LEU B CD2 
3346 N N   . GLU B 49  ? 2.9831 2.5409 1.9660 -0.0490 0.3943  0.1454  1049 GLU B N   
3347 C CA  . GLU B 49  ? 3.0648 2.5907 1.9199 -0.0364 0.3497  0.1351  1049 GLU B CA  
3348 C C   . GLU B 49  ? 3.2886 2.7265 1.9858 -0.0058 0.3431  0.1679  1049 GLU B C   
3349 O O   . GLU B 49  ? 3.3426 2.7753 1.9465 0.0056  0.2798  0.1622  1049 GLU B O   
3350 C CB  . GLU B 49  ? 3.1104 2.6116 1.9302 -0.0452 0.3884  0.1118  1049 GLU B CB  
3351 C CG  . GLU B 49  ? 3.2618 2.7187 2.0910 -0.0454 0.4842  0.1257  1049 GLU B CG  
3352 C CD  . GLU B 49  ? 3.6008 2.9398 2.2663 -0.0242 0.5358  0.1495  1049 GLU B CD  
3353 O OE1 . GLU B 49  ? 3.5854 2.8678 2.1030 -0.0097 0.4976  0.1459  1049 GLU B OE1 
3354 O OE2 . GLU B 49  ? 3.5070 2.8105 2.1914 -0.0242 0.6167  0.1701  1049 GLU B OE2 
3355 N N   . ASP B 50  ? 3.3308 2.7018 1.9995 0.0066  0.4075  0.2024  1050 ASP B N   
3356 C CA  . ASP B 50  ? 3.4975 2.7736 2.0134 0.0416  0.4134  0.2416  1050 ASP B CA  
3357 C C   . ASP B 50  ? 3.5321 2.8346 2.0738 0.0629  0.3616  0.2662  1050 ASP B C   
3358 O O   . ASP B 50  ? 3.6432 2.9029 2.0608 0.0982  0.3238  0.2922  1050 ASP B O   
3359 C CB  . ASP B 50  ? 3.6204 2.8041 2.0976 0.0448  0.5172  0.2700  1050 ASP B CB  
3360 C CG  . ASP B 50  ? 3.6084 2.9165 2.2203 0.0096  0.5348  0.2440  1050 ASP B CG  
3361 O OD1 . ASP B 50  ? 3.6309 2.9659 2.1896 0.0117  0.5075  0.2282  1050 ASP B OD1 
3362 O OD2 . ASP B 50  ? 3.5675 2.9448 2.3318 -0.0160 0.5741  0.2406  1050 ASP B OD2 
3363 N N   . LYS B 51  ? 3.3529 2.7256 2.0525 0.0439  0.3604  0.2580  1051 LYS B N   
3364 C CA  . LYS B 51  ? 3.3206 2.7183 2.0690 0.0622  0.3257  0.2788  1051 LYS B CA  
3365 C C   . LYS B 51  ? 3.3609 2.8194 2.0833 0.0837  0.2283  0.2751  1051 LYS B C   
3366 O O   . LYS B 51  ? 3.3088 2.8211 2.0321 0.0671  0.1813  0.2418  1051 LYS B O   
3367 C CB  . LYS B 51  ? 3.2005 2.6645 2.1220 0.0296  0.3436  0.2588  1051 LYS B CB  
3368 C CG  . LYS B 51  ? 3.3778 2.7949 2.3440 0.0048  0.4354  0.2634  1051 LYS B CG  
3369 C CD  . LYS B 51  ? 3.4116 2.8519 2.4986 -0.0135 0.4533  0.2618  1051 LYS B CD  
3370 C CE  . LYS B 51  ? 3.5410 2.9561 2.6809 -0.0428 0.5283  0.2688  1051 LYS B CE  
3371 N NZ  . LYS B 51  ? 3.5245 3.0123 2.8160 -0.0733 0.5151  0.2571  1051 LYS B NZ  
3372 N N   . SER B 52  ? 3.3699 2.8193 2.0733 0.1210  0.2020  0.3101  1052 SER B N   
3373 C CA  . SER B 52  ? 3.3679 2.8850 2.0596 0.1474  0.1113  0.3142  1052 SER B CA  
3374 C C   . SER B 52  ? 3.2538 2.8812 2.1092 0.1276  0.0729  0.2884  1052 SER B C   
3375 O O   . SER B 52  ? 3.1705 2.7987 2.1265 0.1102  0.1181  0.2841  1052 SER B O   
3376 C CB  . SER B 52  ? 3.5508 3.0090 2.1473 0.2054  0.1047  0.3691  1052 SER B CB  
3377 O OG  . SER B 52  ? 3.6458 3.0657 2.3076 0.2154  0.1584  0.3942  1052 SER B OG  
3378 N N   . PRO B 53  ? 3.1631 2.8827 2.0459 0.1280  -0.0084 0.2704  1053 PRO B N   
3379 C CA  . PRO B 53  ? 3.0062 2.8252 2.0406 0.1096  -0.0375 0.2470  1053 PRO B CA  
3380 C C   . PRO B 53  ? 3.0297 2.8610 2.1245 0.1445  -0.0380 0.2791  1053 PRO B C   
3381 O O   . PRO B 53  ? 2.9040 2.7919 2.1212 0.1280  -0.0378 0.2613  1053 PRO B O   
3382 C CB  . PRO B 53  ? 3.0111 2.9149 2.0429 0.0999  -0.1185 0.2219  1053 PRO B CB  
3383 C CG  . PRO B 53  ? 3.1995 3.0437 2.0805 0.1016  -0.1266 0.2207  1053 PRO B CG  
3384 C CD  . PRO B 53  ? 3.2695 3.0084 2.0489 0.1390  -0.0752 0.2659  1053 PRO B CD  
3385 N N   . ASP B 54  ? 3.1080 2.8811 2.1117 0.1954  -0.0364 0.3268  1054 ASP B N   
3386 C CA  . ASP B 54  ? 3.1150 2.8857 2.1612 0.2379  -0.0321 0.3629  1054 ASP B CA  
3387 C C   . ASP B 54  ? 3.1899 2.8534 2.2360 0.2378  0.0571  0.3819  1054 ASP B C   
3388 O O   . ASP B 54  ? 3.2092 2.8479 2.2827 0.2714  0.0742  0.4107  1054 ASP B O   
3389 C CB  . ASP B 54  ? 3.2687 3.0414 2.2197 0.3010  -0.0838 0.4083  1054 ASP B CB  
3390 C CG  . ASP B 54  ? 3.3528 3.2502 2.3294 0.3015  -0.1789 0.3906  1054 ASP B CG  
3391 O OD1 . ASP B 54  ? 3.2209 3.2080 2.3138 0.2607  -0.2024 0.3490  1054 ASP B OD1 
3392 O OD2 . ASP B 54  ? 3.5196 3.4265 2.4281 0.3145  -0.2336 0.4151  1054 ASP B OD2 
3393 N N   . SER B 55  ? 3.1435 2.7458 2.1654 0.1985  0.1161  0.3642  1055 SER B N   
3394 C CA  . SER B 55  ? 3.1721 2.6791 2.2021 0.1846  0.2035  0.3747  1055 SER B CA  
3395 C C   . SER B 55  ? 3.0812 2.6282 2.2529 0.1541  0.2211  0.3477  1055 SER B C   
3396 O O   . SER B 55  ? 2.9493 2.5962 2.2113 0.1297  0.1770  0.3113  1055 SER B O   
3397 C CB  . SER B 55  ? 3.2446 2.7044 2.2335 0.1465  0.2551  0.3578  1055 SER B CB  
3398 O OG  . SER B 55  ? 3.2331 2.7784 2.3066 0.0999  0.2346  0.3083  1055 SER B OG  
3399 N N   . PRO B 56  ? 3.0667 2.5313 2.2540 0.1523  0.2870  0.3625  1056 PRO B N   
3400 C CA  . PRO B 56  ? 2.9547 2.4521 2.2640 0.1205  0.3011  0.3319  1056 PRO B CA  
3401 C C   . PRO B 56  ? 2.8629 2.4240 2.2612 0.0564  0.3078  0.2795  1056 PRO B C   
3402 O O   . PRO B 56  ? 2.7553 2.3733 2.2512 0.0326  0.2951  0.2488  1056 PRO B O   
3403 C CB  . PRO B 56  ? 3.0870 2.4610 2.3680 0.1264  0.3778  0.3576  1056 PRO B CB  
3404 C CG  . PRO B 56  ? 3.2769 2.5592 2.4424 0.1386  0.4203  0.3895  1056 PRO B CG  
3405 C CD  . PRO B 56  ? 3.2438 2.5744 2.3319 0.1781  0.3533  0.4066  1056 PRO B CD  
3406 N N   . GLU B 57  ? 2.8212 2.3714 2.1818 0.0331  0.3290  0.2715  1057 GLU B N   
3407 C CA  . GLU B 57  ? 2.7038 2.3177 2.1421 -0.0185 0.3357  0.2279  1057 GLU B CA  
3408 C C   . GLU B 57  ? 2.6121 2.3317 2.0905 -0.0190 0.2641  0.2017  1057 GLU B C   
3409 O O   . GLU B 57  ? 2.4929 2.2804 2.0619 -0.0524 0.2555  0.1658  1057 GLU B O   
3410 C CB  . GLU B 57  ? 2.7891 2.3558 2.1691 -0.0334 0.3842  0.2329  1057 GLU B CB  
3411 C CG  . GLU B 57  ? 3.0322 2.4952 2.3840 -0.0432 0.4661  0.2552  1057 GLU B CG  
3412 C CD  . GLU B 57  ? 3.4211 2.7762 2.6329 0.0045  0.4876  0.3062  1057 GLU B CD  
3413 O OE1 . GLU B 57  ? 3.3881 2.7257 2.5057 0.0230  0.4801  0.3190  1057 GLU B OE1 
3414 O OE2 . GLU B 57  ? 3.4123 2.6924 2.6008 0.0247  0.5155  0.3338  1057 GLU B OE2 
3415 N N   . MET B 58  ? 2.5902 2.3219 1.9986 0.0183  0.2128  0.2207  1058 MET B N   
3416 C CA  . MET B 58  ? 2.5000 2.3230 1.9344 0.0186  0.1439  0.1996  1058 MET B CA  
3417 C C   . MET B 58  ? 2.4797 2.3517 1.9687 0.0434  0.1018  0.2071  1058 MET B C   
3418 O O   . MET B 58  ? 2.4594 2.3901 1.9417 0.0615  0.0427  0.2087  1058 MET B O   
3419 C CB  . MET B 58  ? 2.6114 2.4217 1.9360 0.0364  0.1130  0.2102  1058 MET B CB  
3420 C CG  . MET B 58  ? 2.6873 2.4608 1.9657 0.0114  0.1524  0.1960  1058 MET B CG  
3421 S SD  . MET B 58  ? 2.7548 2.5631 1.9658 0.0060  0.0990  0.1731  1058 MET B SD  
3422 C CE  . MET B 58  ? 2.7861 2.5167 1.9244 -0.0089 0.1690  0.1706  1058 MET B CE  
3423 N N   . LYS B 59  ? 2.4047 2.2503 1.9481 0.0423  0.1362  0.2106  1059 LYS B N   
3424 C CA  . LYS B 59  ? 2.3585 2.2357 1.9610 0.0648  0.1155  0.2164  1059 LYS B CA  
3425 C C   . LYS B 59  ? 2.2849 2.1884 1.9837 0.0260  0.1361  0.1799  1059 LYS B C   
3426 O O   . LYS B 59  ? 2.2041 2.1687 1.9686 0.0290  0.1073  0.1662  1059 LYS B O   
3427 C CB  . LYS B 59  ? 2.5047 2.2971 2.0549 0.1094  0.1454  0.2607  1059 LYS B CB  
3428 C CG  . LYS B 59  ? 2.7568 2.5445 2.2218 0.1637  0.1077  0.3027  1059 LYS B CG  
3429 C CD  . LYS B 59  ? 2.9646 2.6830 2.4004 0.2169  0.1333  0.3476  1059 LYS B CD  
3430 C CE  . LYS B 59  ? 3.2046 2.8897 2.5300 0.2745  0.1112  0.3973  1059 LYS B CE  
3431 N NZ  . LYS B 59  ? 3.4121 2.9791 2.6308 0.2716  0.1686  0.4178  1059 LYS B NZ  
3432 N N   . ASP B 60  ? 2.2307 2.0903 1.9372 -0.0108 0.1867  0.1642  1060 ASP B N   
3433 C CA  . ASP B 60  ? 2.1445 2.0275 1.9341 -0.0515 0.2060  0.1277  1060 ASP B CA  
3434 C C   . ASP B 60  ? 2.0858 2.0453 1.9205 -0.0854 0.1862  0.0933  1060 ASP B C   
3435 O O   . ASP B 60  ? 1.9991 2.0112 1.9025 -0.1052 0.1731  0.0645  1060 ASP B O   
3436 C CB  . ASP B 60  ? 2.2323 2.0332 2.0165 -0.0763 0.2710  0.1280  1060 ASP B CB  
3437 C CG  . ASP B 60  ? 2.2922 2.0938 2.1449 -0.1041 0.2871  0.0989  1060 ASP B CG  
3438 O OD1 . ASP B 60  ? 2.3594 2.0934 2.1958 -0.0864 0.3110  0.1134  1060 ASP B OD1 
3439 O OD2 . ASP B 60  ? 2.2687 2.1355 2.1855 -0.1411 0.2756  0.0618  1060 ASP B OD2 
3440 N N   . PHE B 61  ? 2.0551 2.0124 1.8443 -0.0894 0.1890  0.0974  1061 PHE B N   
3441 C CA  . PHE B 61  ? 1.9744 1.9928 1.7960 -0.1141 0.1766  0.0697  1061 PHE B CA  
3442 C C   . PHE B 61  ? 1.9348 2.0197 1.7715 -0.1031 0.1203  0.0588  1061 PHE B C   
3443 O O   . PHE B 61  ? 1.8526 1.9913 1.7356 -0.1220 0.1085  0.0329  1061 PHE B O   
3444 C CB  . PHE B 61  ? 2.0591 2.0423 1.8180 -0.1168 0.2034  0.0793  1061 PHE B CB  
3445 C CG  . PHE B 61  ? 2.0925 2.0567 1.8847 -0.1471 0.2602  0.0710  1061 PHE B CG  
3446 C CD1 . PHE B 61  ? 2.2164 2.1057 1.9855 -0.1507 0.3097  0.0902  1061 PHE B CD1 
3447 C CD2 . PHE B 61  ? 2.0543 2.0766 1.9033 -0.1711 0.2667  0.0457  1061 PHE B CD2 
3448 C CE1 . PHE B 61  ? 2.2421 2.1217 2.0535 -0.1851 0.3641  0.0805  1061 PHE B CE1 
3449 C CE2 . PHE B 61  ? 2.1007 2.1224 1.9949 -0.1994 0.3171  0.0385  1061 PHE B CE2 
3450 C CZ  . PHE B 61  ? 2.1567 2.1102 2.0358 -0.2097 0.3652  0.0542  1061 PHE B CZ  
3451 N N   . ARG B 62  ? 1.9072 1.9900 1.7076 -0.0721 0.0872  0.0799  1062 ARG B N   
3452 C CA  . ARG B 62  ? 1.8427 1.9915 1.6651 -0.0643 0.0347  0.0712  1062 ARG B CA  
3453 C C   . ARG B 62  ? 1.7985 1.9853 1.7010 -0.0652 0.0284  0.0598  1062 ARG B C   
3454 O O   . ARG B 62  ? 1.7211 1.9657 1.6704 -0.0769 0.0049  0.0387  1062 ARG B O   
3455 C CB  . ARG B 62  ? 1.9103 2.0548 1.6696 -0.0318 -0.0010 0.0982  1062 ARG B CB  
3456 C CG  . ARG B 62  ? 2.1191 2.2049 1.7738 -0.0233 0.0093  0.1156  1062 ARG B CG  
3457 C CD  . ARG B 62  ? 2.1998 2.2903 1.8230 -0.0489 0.0091  0.0916  1062 ARG B CD  
3458 N NE  . ARG B 62  ? 2.2567 2.3195 1.9015 -0.0722 0.0626  0.0795  1062 ARG B NE  
3459 C CZ  . ARG B 62  ? 2.3913 2.4526 2.0206 -0.0909 0.0783  0.0612  1062 ARG B CZ  
3460 N NH1 . ARG B 62  ? 2.2448 2.3157 1.8245 -0.0923 0.0474  0.0499  1062 ARG B NH1 
3461 N NH2 . ARG B 62  ? 2.1622 2.2130 1.8270 -0.1085 0.1261  0.0533  1062 ARG B NH2 
3462 N N   . HIS B 63  ? 1.7687 1.9119 1.6796 -0.0531 0.0558  0.0736  1063 HIS B N   
3463 C CA  . HIS B 63  ? 1.7163 1.8711 1.6874 -0.0526 0.0625  0.0633  1063 HIS B CA  
3464 C C   . HIS B 63  ? 1.6625 1.8422 1.6820 -0.0905 0.0754  0.0274  1063 HIS B C   
3465 O O   . HIS B 63  ? 1.6021 1.8193 1.6687 -0.0943 0.0639  0.0101  1063 HIS B O   
3466 C CB  . HIS B 63  ? 1.8064 1.8841 1.7554 -0.0334 0.0992  0.0856  1063 HIS B CB  
3467 C CG  . HIS B 63  ? 1.8288 1.8977 1.8261 -0.0374 0.1165  0.0703  1063 HIS B CG  
3468 N ND1 . HIS B 63  ? 1.8314 1.9340 1.8610 -0.0091 0.0966  0.0771  1063 HIS B ND1 
3469 C CD2 . HIS B 63  ? 1.8549 1.8850 1.8699 -0.0682 0.1523  0.0469  1063 HIS B CD2 
3470 C CE1 . HIS B 63  ? 1.8217 1.8952 1.8776 -0.0208 0.1240  0.0582  1063 HIS B CE1 
3471 N NE2 . HIS B 63  ? 1.8418 1.8715 1.8877 -0.0583 0.1548  0.0378  1063 HIS B NE2 
3472 N N   . GLY B 64  ? 1.6015 1.7650 1.6082 -0.1152 0.0985  0.0183  1064 GLY B N   
3473 C CA  . GLY B 64  ? 1.5304 1.7284 1.5834 -0.1476 0.1073  -0.0122 1064 GLY B CA  
3474 C C   . GLY B 64  ? 1.4776 1.7415 1.5557 -0.1491 0.0745  -0.0284 1064 GLY B C   
3475 O O   . GLY B 64  ? 1.4238 1.7227 1.5451 -0.1632 0.0712  -0.0508 1064 GLY B O   
3476 N N   . PHE B 65  ? 1.4177 1.6940 1.4627 -0.1349 0.0502  -0.0175 1065 PHE B N   
3477 C CA  . PHE B 65  ? 1.3542 1.6795 1.4150 -0.1380 0.0233  -0.0316 1065 PHE B CA  
3478 C C   . PHE B 65  ? 1.3545 1.7113 1.4530 -0.1281 0.0021  -0.0342 1065 PHE B C   
3479 O O   . PHE B 65  ? 1.3036 1.6955 1.4317 -0.1359 -0.0065 -0.0508 1065 PHE B O   
3480 C CB  . PHE B 65  ? 1.4075 1.7271 1.4151 -0.1332 0.0067  -0.0240 1065 PHE B CB  
3481 C CG  . PHE B 65  ? 1.4460 1.7446 1.4232 -0.1444 0.0312  -0.0289 1065 PHE B CG  
3482 C CD1 . PHE B 65  ? 1.4403 1.7663 1.4437 -0.1558 0.0379  -0.0475 1065 PHE B CD1 
3483 C CD2 . PHE B 65  ? 1.5464 1.7954 1.4673 -0.1392 0.0520  -0.0119 1065 PHE B CD2 
3484 C CE1 . PHE B 65  ? 1.4768 1.7877 1.4598 -0.1607 0.0653  -0.0494 1065 PHE B CE1 
3485 C CE2 . PHE B 65  ? 1.6080 1.8377 1.5048 -0.1477 0.0821  -0.0153 1065 PHE B CE2 
3486 C CZ  . PHE B 65  ? 1.5358 1.8000 1.4682 -0.1578 0.0885  -0.0342 1065 PHE B CZ  
3487 N N   . ASP B 66  ? 1.3262 1.6681 1.4228 -0.1074 -0.0020 -0.0155 1066 ASP B N   
3488 C CA  . ASP B 66  ? 1.2915 1.6634 1.4298 -0.0931 -0.0150 -0.0142 1066 ASP B CA  
3489 C C   . ASP B 66  ? 1.2703 1.6393 1.4425 -0.1039 0.0051  -0.0341 1066 ASP B C   
3490 O O   . ASP B 66  ? 1.2295 1.6301 1.4348 -0.1013 -0.0021 -0.0430 1066 ASP B O   
3491 C CB  . ASP B 66  ? 1.3756 1.7280 1.5040 -0.0615 -0.0172 0.0144  1066 ASP B CB  
3492 C CG  . ASP B 66  ? 1.5890 1.9602 1.6854 -0.0456 -0.0491 0.0347  1066 ASP B CG  
3493 O OD1 . ASP B 66  ? 1.5717 1.9980 1.6878 -0.0533 -0.0800 0.0261  1066 ASP B OD1 
3494 O OD2 . ASP B 66  ? 1.7446 2.0737 1.7940 -0.0252 -0.0432 0.0595  1066 ASP B OD2 
3495 N N   . ILE B 67  ? 1.2189 1.5492 1.3804 -0.1183 0.0312  -0.0421 1067 ILE B N   
3496 C CA  . ILE B 67  ? 1.1895 1.5148 1.3730 -0.1354 0.0470  -0.0659 1067 ILE B CA  
3497 C C   . ILE B 67  ? 1.1606 1.5342 1.3603 -0.1502 0.0334  -0.0855 1067 ILE B C   
3498 O O   . ILE B 67  ? 1.1293 1.5218 1.3461 -0.1504 0.0293  -0.0998 1067 ILE B O   
3499 C CB  . ILE B 67  ? 1.2754 1.5515 1.4462 -0.1539 0.0765  -0.0703 1067 ILE B CB  
3500 C CG1 . ILE B 67  ? 1.3523 1.5643 1.4992 -0.1342 0.0971  -0.0482 1067 ILE B CG1 
3501 C CG2 . ILE B 67  ? 1.2735 1.5565 1.4671 -0.1808 0.0852  -0.1017 1067 ILE B CG2 
3502 C CD1 . ILE B 67  ? 1.5243 1.6763 1.6471 -0.1508 0.1308  -0.0434 1067 ILE B CD1 
3503 N N   . LEU B 68  ? 1.0922 1.4787 1.2792 -0.1581 0.0301  -0.0835 1068 LEU B N   
3504 C CA  . LEU B 68  ? 1.0418 1.4658 1.2375 -0.1656 0.0225  -0.0962 1068 LEU B CA  
3505 C C   . LEU B 68  ? 1.0124 1.4607 1.2130 -0.1552 0.0048  -0.0970 1068 LEU B C   
3506 O O   . LEU B 68  ? 0.9794 1.4495 1.1918 -0.1565 0.0031  -0.1094 1068 LEU B O   
3507 C CB  . LEU B 68  ? 1.0632 1.4811 1.2353 -0.1695 0.0294  -0.0887 1068 LEU B CB  
3508 C CG  . LEU B 68  ? 1.1120 1.5585 1.3014 -0.1789 0.0390  -0.1006 1068 LEU B CG  
3509 C CD1 . LEU B 68  ? 1.1481 1.5779 1.3325 -0.1892 0.0637  -0.0948 1068 LEU B CD1 
3510 C CD2 . LEU B 68  ? 1.1322 1.5943 1.3073 -0.1694 0.0305  -0.1011 1068 LEU B CD2 
3511 N N   . VAL B 69  ? 0.9439 1.3903 1.1366 -0.1454 -0.0081 -0.0833 1069 VAL B N   
3512 C CA  . VAL B 69  ? 0.9050 1.3771 1.1120 -0.1417 -0.0223 -0.0845 1069 VAL B CA  
3513 C C   . VAL B 69  ? 0.9372 1.4171 1.1745 -0.1336 -0.0155 -0.0887 1069 VAL B C   
3514 O O   . VAL B 69  ? 0.9239 1.4196 1.1727 -0.1345 -0.0138 -0.0968 1069 VAL B O   
3515 C CB  . VAL B 69  ? 0.9638 1.4441 1.1614 -0.1378 -0.0428 -0.0712 1069 VAL B CB  
3516 C CG1 . VAL B 69  ? 0.9408 1.4560 1.1705 -0.1400 -0.0552 -0.0745 1069 VAL B CG1 
3517 C CG2 . VAL B 69  ? 0.9849 1.4481 1.1367 -0.1472 -0.0473 -0.0714 1069 VAL B CG2 
3518 N N   . GLY B 70  ? 0.9021 1.3610 1.1444 -0.1245 -0.0062 -0.0827 1070 GLY B N   
3519 C CA  . GLY B 70  ? 0.9016 1.3531 1.1617 -0.1147 0.0070  -0.0875 1070 GLY B CA  
3520 C C   . GLY B 70  ? 0.9393 1.3876 1.1909 -0.1252 0.0157  -0.1092 1070 GLY B C   
3521 O O   . GLY B 70  ? 0.9370 1.3904 1.1949 -0.1182 0.0223  -0.1151 1070 GLY B O   
3522 N N   . GLN B 71  ? 0.8804 1.3247 1.1178 -0.1410 0.0156  -0.1202 1071 GLN B N   
3523 C CA  . GLN B 71  ? 0.8666 1.3222 1.0974 -0.1507 0.0154  -0.1404 1071 GLN B CA  
3524 C C   . GLN B 71  ? 0.8673 1.3518 1.0944 -0.1442 0.0069  -0.1400 1071 GLN B C   
3525 O O   . GLN B 71  ? 0.8658 1.3571 1.0815 -0.1402 0.0067  -0.1510 1071 GLN B O   
3526 C CB  . GLN B 71  ? 0.8972 1.3552 1.1297 -0.1699 0.0168  -0.1495 1071 GLN B CB  
3527 C CG  . GLN B 71  ? 1.2068 1.6285 1.4369 -0.1839 0.0307  -0.1616 1071 GLN B CG  
3528 C CD  . GLN B 71  ? 1.4680 1.8898 1.7092 -0.2082 0.0383  -0.1684 1071 GLN B CD  
3529 O OE1 . GLN B 71  ? 1.4511 1.8289 1.6874 -0.2165 0.0570  -0.1634 1071 GLN B OE1 
3530 N NE2 . GLN B 71  ? 1.3585 1.8292 1.6172 -0.2187 0.0279  -0.1783 1071 GLN B NE2 
3531 N N   . ILE B 72  ? 0.7998 1.2934 1.0279 -0.1427 0.0017  -0.1277 1072 ILE B N   
3532 C CA  . ILE B 72  ? 0.7879 1.2931 1.0072 -0.1377 0.0004  -0.1263 1072 ILE B CA  
3533 C C   . ILE B 72  ? 0.8603 1.3627 1.0865 -0.1299 0.0070  -0.1244 1072 ILE B C   
3534 O O   . ILE B 72  ? 0.8633 1.3645 1.0748 -0.1225 0.0141  -0.1277 1072 ILE B O   
3535 C CB  . ILE B 72  ? 0.8231 1.3256 1.0331 -0.1429 -0.0035 -0.1181 1072 ILE B CB  
3536 C CG1 . ILE B 72  ? 0.8301 1.3358 1.0309 -0.1461 -0.0001 -0.1197 1072 ILE B CG1 
3537 C CG2 . ILE B 72  ? 0.8313 1.3297 1.0307 -0.1413 0.0005  -0.1173 1072 ILE B CG2 
3538 C CD1 . ILE B 72  ? 0.8805 1.3696 1.0602 -0.1514 0.0010  -0.1120 1072 ILE B CD1 
3539 N N   . ASP B 73  ? 0.8267 1.3289 1.0758 -0.1284 0.0073  -0.1169 1073 ASP B N   
3540 C CA  . ASP B 73  ? 0.8335 1.3409 1.1039 -0.1209 0.0183  -0.1131 1073 ASP B CA  
3541 C C   . ASP B 73  ? 0.9016 1.3908 1.1559 -0.1103 0.0350  -0.1222 1073 ASP B C   
3542 O O   . ASP B 73  ? 0.9060 1.3924 1.1599 -0.1035 0.0510  -0.1212 1073 ASP B O   
3543 C CB  . ASP B 73  ? 0.8641 1.3860 1.1703 -0.1159 0.0130  -0.1004 1073 ASP B CB  
3544 C CG  . ASP B 73  ? 1.0161 1.5632 1.3375 -0.1263 -0.0066 -0.0924 1073 ASP B CG  
3545 O OD1 . ASP B 73  ? 1.0258 1.5739 1.3349 -0.1401 -0.0086 -0.0985 1073 ASP B OD1 
3546 O OD2 . ASP B 73  ? 1.1110 1.6737 1.4521 -0.1194 -0.0195 -0.0802 1073 ASP B OD2 
3547 N N   . ASP B 74  ? 0.8675 1.3396 1.1041 -0.1114 0.0335  -0.1324 1074 ASP B N   
3548 C CA  . ASP B 74  ? 0.8948 1.3435 1.1024 -0.1060 0.0451  -0.1471 1074 ASP B CA  
3549 C C   . ASP B 74  ? 0.9201 1.3765 1.0943 -0.1033 0.0402  -0.1544 1074 ASP B C   
3550 O O   . ASP B 74  ? 0.9454 1.3854 1.0920 -0.0916 0.0540  -0.1576 1074 ASP B O   
3551 C CB  . ASP B 74  ? 0.9472 1.3746 1.1436 -0.1169 0.0423  -0.1609 1074 ASP B CB  
3552 C CG  . ASP B 74  ? 1.1241 1.5225 1.3364 -0.1110 0.0569  -0.1535 1074 ASP B CG  
3553 O OD1 . ASP B 74  ? 1.1330 1.5366 1.3705 -0.0938 0.0679  -0.1373 1074 ASP B OD1 
3554 O OD2 . ASP B 74  ? 1.2183 1.5887 1.4199 -0.1227 0.0599  -0.1632 1074 ASP B OD2 
3555 N N   . ALA B 75  ? 0.8320 1.3111 1.0061 -0.1100 0.0237  -0.1540 1075 ALA B N   
3556 C CA  . ALA B 75  ? 0.8280 1.3205 0.9750 -0.1008 0.0174  -0.1550 1075 ALA B CA  
3557 C C   . ALA B 75  ? 0.8583 1.3382 0.9964 -0.0889 0.0337  -0.1409 1075 ALA B C   
3558 O O   . ALA B 75  ? 0.8944 1.3644 0.9952 -0.0727 0.0403  -0.1392 1075 ALA B O   
3559 C CB  . ALA B 75  ? 0.8158 1.3364 0.9768 -0.1077 0.0026  -0.1542 1075 ALA B CB  
3560 N N   . LEU B 76  ? 0.7596 1.2387 0.9297 -0.0980 0.0403  -0.1312 1076 LEU B N   
3561 C CA  . LEU B 76  ? 0.7460 1.2130 0.9189 -0.0973 0.0583  -0.1215 1076 LEU B CA  
3562 C C   . LEU B 76  ? 0.7948 1.2451 0.9628 -0.0877 0.0823  -0.1199 1076 LEU B C   
3563 O O   . LEU B 76  ? 0.8082 1.2369 0.9532 -0.0802 0.1037  -0.1136 1076 LEU B O   
3564 C CB  . LEU B 76  ? 0.7196 1.2004 0.9329 -0.1155 0.0521  -0.1167 1076 LEU B CB  
3565 C CG  . LEU B 76  ? 0.7722 1.2507 0.9745 -0.1252 0.0422  -0.1161 1076 LEU B CG  
3566 C CD1 . LEU B 76  ? 0.7528 1.2479 0.9831 -0.1417 0.0255  -0.1149 1076 LEU B CD1 
3567 C CD2 . LEU B 76  ? 0.8399 1.2915 1.0211 -0.1265 0.0620  -0.1130 1076 LEU B CD2 
3568 N N   . LYS B 77  ? 0.7488 1.2008 0.9331 -0.0859 0.0844  -0.1245 1077 LYS B N   
3569 C CA  . LYS B 77  ? 0.7785 1.2104 0.9565 -0.0738 0.1126  -0.1237 1077 LYS B CA  
3570 C C   . LYS B 77  ? 0.8841 1.2847 0.9912 -0.0575 0.1211  -0.1303 1077 LYS B C   
3571 O O   . LYS B 77  ? 0.9122 1.2866 0.9964 -0.0456 0.1514  -0.1245 1077 LYS B O   
3572 C CB  . LYS B 77  ? 0.8047 1.2364 1.0070 -0.0711 0.1143  -0.1277 1077 LYS B CB  
3573 C CG  . LYS B 77  ? 0.9439 1.3764 1.1843 -0.0612 0.1461  -0.1177 1077 LYS B CG  
3574 C CD  . LYS B 77  ? 1.0793 1.4677 1.2699 -0.0434 0.1776  -0.1246 1077 LYS B CD  
3575 C CE  . LYS B 77  ? 1.1524 1.5451 1.3879 -0.0316 0.2172  -0.1120 1077 LYS B CE  
3576 N NZ  . LYS B 77  ? 1.3253 1.6642 1.5010 -0.0121 0.2537  -0.1191 1077 LYS B NZ  
3577 N N   . LEU B 78  ? 0.8579 1.2648 0.9308 -0.0569 0.0942  -0.1416 1078 LEU B N   
3578 C CA  . LEU B 78  ? 0.9152 1.3057 0.9188 -0.0404 0.0901  -0.1487 1078 LEU B CA  
3579 C C   . LEU B 78  ? 0.9991 1.3829 0.9747 -0.0247 0.0980  -0.1323 1078 LEU B C   
3580 O O   . LEU B 78  ? 1.0503 1.4013 0.9687 -0.0042 0.1172  -0.1264 1078 LEU B O   
3581 C CB  . LEU B 78  ? 0.9128 1.3289 0.9062 -0.0492 0.0547  -0.1671 1078 LEU B CB  
3582 C CG  . LEU B 78  ? 0.9803 1.3865 0.9861 -0.0661 0.0514  -0.1860 1078 LEU B CG  
3583 C CD1 . LEU B 78  ? 0.9590 1.3989 0.9850 -0.0858 0.0207  -0.2001 1078 LEU B CD1 
3584 C CD2 . LEU B 78  ? 1.0928 1.4569 1.0359 -0.0571 0.0647  -0.2018 1078 LEU B CD2 
3585 N N   . ALA B 79  ? 0.9317 1.3366 0.9396 -0.0324 0.0878  -0.1240 1079 ALA B N   
3586 C CA  . ALA B 79  ? 0.9537 1.3426 0.9369 -0.0179 0.0997  -0.1080 1079 ALA B CA  
3587 C C   . ALA B 79  ? 1.0485 1.3948 1.0258 -0.0175 0.1413  -0.0953 1079 ALA B C   
3588 O O   . ALA B 79  ? 1.0911 1.4006 1.0161 0.0041  0.1627  -0.0818 1079 ALA B O   
3589 C CB  . ALA B 79  ? 0.9183 1.3293 0.9388 -0.0308 0.0860  -0.1057 1079 ALA B CB  
3590 N N   . ASN B 80  ? 0.9999 1.3534 1.0331 -0.0399 0.1543  -0.0981 1080 ASN B N   
3591 C CA  . ASN B 80  ? 1.0345 1.3628 1.0853 -0.0475 0.1948  -0.0887 1080 ASN B CA  
3592 C C   . ASN B 80  ? 1.1524 1.4444 1.1549 -0.0259 0.2266  -0.0844 1080 ASN B C   
3593 O O   . ASN B 80  ? 1.1773 1.4340 1.1705 -0.0246 0.2688  -0.0726 1080 ASN B O   
3594 C CB  . ASN B 80  ? 1.0266 1.3926 1.1614 -0.0748 0.1921  -0.0927 1080 ASN B CB  
3595 C CG  . ASN B 80  ? 1.3658 1.7458 1.5368 -0.1004 0.1813  -0.0932 1080 ASN B CG  
3596 O OD1 . ASN B 80  ? 1.3065 1.7079 1.4845 -0.1072 0.1488  -0.0990 1080 ASN B OD1 
3597 N ND2 . ASN B 80  ? 1.2808 1.6443 1.4721 -0.1178 0.2114  -0.0886 1080 ASN B ND2 
3598 N N   . GLU B 81  ? 1.1447 1.4398 1.1125 -0.0117 0.2093  -0.0955 1081 GLU B N   
3599 C CA  . GLU B 81  ? 1.2239 1.4778 1.1256 0.0106  0.2345  -0.0960 1081 GLU B CA  
3600 C C   . GLU B 81  ? 1.3660 1.5895 1.1725 0.0397  0.2283  -0.0891 1081 GLU B C   
3601 O O   . GLU B 81  ? 1.4458 1.6248 1.1767 0.0626  0.2512  -0.0858 1081 GLU B O   
3602 C CB  . GLU B 81  ? 1.2368 1.5004 1.1373 0.0088  0.2177  -0.1158 1081 GLU B CB  
3603 C CG  . GLU B 81  ? 1.3421 1.6187 1.3162 -0.0036 0.2393  -0.1161 1081 GLU B CG  
3604 C CD  . GLU B 81  ? 1.6489 1.9186 1.6139 -0.0022 0.2302  -0.1342 1081 GLU B CD  
3605 O OE1 . GLU B 81  ? 1.5581 1.8478 1.5241 -0.0132 0.1908  -0.1482 1081 GLU B OE1 
3606 O OE2 . GLU B 81  ? 1.6570 1.8967 1.6150 0.0092  0.2675  -0.1343 1081 GLU B OE2 
3607 N N   . GLY B 82  ? 1.3086 1.5560 1.1172 0.0420  0.1987  -0.0852 1082 GLY B N   
3608 C CA  . GLY B 82  ? 1.3680 1.6026 1.1000 0.0748  0.1860  -0.0746 1082 GLY B CA  
3609 C C   . GLY B 82  ? 1.4406 1.7096 1.1362 0.0842  0.1404  -0.0930 1082 GLY B C   
3610 O O   . GLY B 82  ? 1.5172 1.7632 1.1268 0.1126  0.1374  -0.0908 1082 GLY B O   
3611 N N   . LYS B 83  ? 1.3332 1.6555 1.0910 0.0582  0.1051  -0.1122 1083 LYS B N   
3612 C CA  . LYS B 83  ? 1.3413 1.7018 1.0831 0.0537  0.0620  -0.1359 1083 LYS B CA  
3613 C C   . LYS B 83  ? 1.3505 1.7753 1.1423 0.0470  0.0249  -0.1374 1083 LYS B C   
3614 O O   . LYS B 83  ? 1.2827 1.7357 1.1411 0.0177  0.0141  -0.1491 1083 LYS B O   
3615 C CB  . LYS B 83  ? 1.3540 1.7047 1.1215 0.0260  0.0662  -0.1593 1083 LYS B CB  
3616 C CG  . LYS B 83  ? 1.5721 1.8607 1.2898 0.0367  0.1071  -0.1584 1083 LYS B CG  
3617 C CD  . LYS B 83  ? 1.6779 1.9526 1.4342 0.0153  0.1219  -0.1744 1083 LYS B CD  
3618 C CE  . LYS B 83  ? 1.9121 2.1260 1.6196 0.0310  0.1687  -0.1715 1083 LYS B CE  
3619 N NZ  . LYS B 83  ? 2.0226 2.2224 1.7761 0.0180  0.1910  -0.1810 1083 LYS B NZ  
3620 N N   . VAL B 84  ? 1.3476 1.7931 1.1052 0.0785  0.0096  -0.1224 1084 VAL B N   
3621 C CA  . VAL B 84  ? 1.3070 1.8156 1.1103 0.0824  -0.0187 -0.1181 1084 VAL B CA  
3622 C C   . VAL B 84  ? 1.3363 1.9103 1.1778 0.0555  -0.0609 -0.1472 1084 VAL B C   
3623 O O   . VAL B 84  ? 1.2712 1.8735 1.1832 0.0277  -0.0649 -0.1546 1084 VAL B O   
3624 C CB  . VAL B 84  ? 1.4137 1.9305 1.1672 0.1317  -0.0236 -0.0923 1084 VAL B CB  
3625 C CG1 . VAL B 84  ? 1.3697 1.9491 1.1817 0.1393  -0.0417 -0.0838 1084 VAL B CG1 
3626 C CG2 . VAL B 84  ? 1.4552 1.8910 1.1598 0.1556  0.0255  -0.0647 1084 VAL B CG2 
3627 N N   . LYS B 85  ? 1.3514 1.9443 1.1418 0.0615  -0.0903 -0.1645 1085 LYS B N   
3628 C CA  . LYS B 85  ? 1.3482 2.0007 1.1667 0.0310  -0.1315 -0.1975 1085 LYS B CA  
3629 C C   . LYS B 85  ? 1.3618 1.9904 1.2283 -0.0164 -0.1181 -0.2206 1085 LYS B C   
3630 O O   . LYS B 85  ? 1.3271 2.0040 1.2504 -0.0476 -0.1391 -0.2397 1085 LYS B O   
3631 C CB  . LYS B 85  ? 1.4718 2.1251 1.2047 0.0423  -0.1602 -0.2159 1085 LYS B CB  
3632 C CG  . LYS B 85  ? 1.6352 2.3700 1.3541 0.0736  -0.2061 -0.2085 1085 LYS B CG  
3633 C CD  . LYS B 85  ? 1.7621 2.4676 1.4155 0.1344  -0.1894 -0.1678 1085 LYS B CD  
3634 C CE  . LYS B 85  ? 1.8663 2.6630 1.5197 0.1721  -0.2354 -0.1549 1085 LYS B CE  
3635 N NZ  . LYS B 85  ? 1.9927 2.7534 1.5896 0.2358  -0.2112 -0.1089 1085 LYS B NZ  
3636 N N   . GLU B 86  ? 1.3272 1.8826 1.1738 -0.0191 -0.0801 -0.2161 1086 GLU B N   
3637 C CA  . GLU B 86  ? 1.3008 1.8248 1.1850 -0.0524 -0.0620 -0.2308 1086 GLU B CA  
3638 C C   . GLU B 86  ? 1.2824 1.8229 1.2437 -0.0640 -0.0507 -0.2145 1086 GLU B C   
3639 O O   . GLU B 86  ? 1.2528 1.8018 1.2587 -0.0930 -0.0542 -0.2276 1086 GLU B O   
3640 C CB  . GLU B 86  ? 1.3571 1.8073 1.1965 -0.0438 -0.0250 -0.2285 1086 GLU B CB  
3641 C CG  . GLU B 86  ? 1.6129 2.0311 1.3629 -0.0355 -0.0309 -0.2490 1086 GLU B CG  
3642 C CD  . GLU B 86  ? 2.0372 2.4402 1.7123 0.0042  -0.0263 -0.2300 1086 GLU B CD  
3643 O OE1 . GLU B 86  ? 2.1123 2.4512 1.7327 0.0201  0.0103  -0.2237 1086 GLU B OE1 
3644 O OE2 . GLU B 86  ? 1.9875 2.4402 1.6575 0.0225  -0.0553 -0.2190 1086 GLU B OE2 
3645 N N   . ALA B 87  ? 1.2155 1.7528 1.1842 -0.0422 -0.0351 -0.1869 1087 ALA B N   
3646 C CA  . ALA B 87  ? 1.1489 1.6959 1.1750 -0.0518 -0.0256 -0.1728 1087 ALA B CA  
3647 C C   . ALA B 87  ? 1.1725 1.7787 1.2381 -0.0586 -0.0491 -0.1760 1087 ALA B C   
3648 O O   . ALA B 87  ? 1.1269 1.7406 1.2385 -0.0782 -0.0451 -0.1756 1087 ALA B O   
3649 C CB  . ALA B 87  ? 1.1573 1.6765 1.1698 -0.0308 -0.0014 -0.1483 1087 ALA B CB  
3650 N N   . GLN B 88  ? 1.1570 1.8081 1.2048 -0.0404 -0.0730 -0.1780 1088 GLN B N   
3651 C CA  . GLN B 88  ? 1.1329 1.8564 1.2285 -0.0440 -0.0956 -0.1808 1088 GLN B CA  
3652 C C   . GLN B 88  ? 1.1818 1.9326 1.3153 -0.0858 -0.1120 -0.2102 1088 GLN B C   
3653 O O   . GLN B 88  ? 1.1401 1.9340 1.3325 -0.1032 -0.1150 -0.2125 1088 GLN B O   
3654 C CB  . GLN B 88  ? 1.1888 1.9615 1.2574 -0.0079 -0.1196 -0.1726 1088 GLN B CB  
3655 C CG  . GLN B 88  ? 1.3071 2.0567 1.3503 0.0356  -0.0980 -0.1392 1088 GLN B CG  
3656 C CD  . GLN B 88  ? 1.5541 2.3449 1.5603 0.0808  -0.1198 -0.1254 1088 GLN B CD  
3657 O OE1 . GLN B 88  ? 1.5633 2.3827 1.5355 0.0840  -0.1512 -0.1401 1088 GLN B OE1 
3658 N NE2 . GLN B 88  ? 1.3974 2.1854 1.4007 0.1198  -0.1025 -0.0958 1088 GLN B NE2 
3659 N N   . ALA B 89  ? 1.1905 1.9073 1.2864 -0.1023 -0.1164 -0.2328 1089 ALA B N   
3660 C CA  . ALA B 89  ? 1.2094 1.9275 1.3261 -0.1448 -0.1247 -0.2639 1089 ALA B CA  
3661 C C   . ALA B 89  ? 1.2280 1.9010 1.3795 -0.1661 -0.0951 -0.2585 1089 ALA B C   
3662 O O   . ALA B 89  ? 1.2104 1.8970 1.4032 -0.1987 -0.0952 -0.2727 1089 ALA B O   
3663 C CB  . ALA B 89  ? 1.2886 1.9642 1.3379 -0.1502 -0.1306 -0.2881 1089 ALA B CB  
3664 N N   . ALA B 90  ? 1.1817 1.8029 1.3168 -0.1477 -0.0697 -0.2371 1090 ALA B N   
3665 C CA  . ALA B 90  ? 1.1598 1.7426 1.3211 -0.1589 -0.0463 -0.2266 1090 ALA B CA  
3666 C C   . ALA B 90  ? 1.1884 1.8025 1.3935 -0.1618 -0.0445 -0.2112 1090 ALA B C   
3667 O O   . ALA B 90  ? 1.1680 1.7612 1.3953 -0.1777 -0.0314 -0.2073 1090 ALA B O   
3668 C CB  . ALA B 90  ? 1.1642 1.7025 1.3030 -0.1383 -0.0263 -0.2094 1090 ALA B CB  
3669 N N   . ALA B 91  ? 1.1526 1.8109 1.3634 -0.1427 -0.0545 -0.2008 1091 ALA B N   
3670 C CA  . ALA B 91  ? 1.1310 1.8178 1.3765 -0.1401 -0.0486 -0.1866 1091 ALA B CA  
3671 C C   . ALA B 91  ? 1.2003 1.9338 1.4941 -0.1668 -0.0551 -0.2012 1091 ALA B C   
3672 O O   . ALA B 91  ? 1.1809 1.9175 1.5040 -0.1750 -0.0395 -0.1920 1091 ALA B O   
3673 C CB  . ALA B 91  ? 1.1412 1.8542 1.3739 -0.1065 -0.0521 -0.1709 1091 ALA B CB  
3674 N N   . GLU B 92  ? 1.1954 1.9627 1.4951 -0.1830 -0.0764 -0.2254 1092 GLU B N   
3675 C CA  . GLU B 92  ? 1.2110 2.0270 1.5635 -0.2180 -0.0835 -0.2456 1092 GLU B CA  
3676 C C   . GLU B 92  ? 1.2744 2.0311 1.6345 -0.2515 -0.0580 -0.2524 1092 GLU B C   
3677 O O   . GLU B 92  ? 1.2773 2.0577 1.6854 -0.2796 -0.0475 -0.2589 1092 GLU B O   
3678 C CB  . GLU B 92  ? 1.2726 2.1332 1.6188 -0.2317 -0.1172 -0.2752 1092 GLU B CB  
3679 C CG  . GLU B 92  ? 1.4284 2.3670 1.7771 -0.1983 -0.1471 -0.2675 1092 GLU B CG  
3680 C CD  . GLU B 92  ? 1.7615 2.7477 2.0910 -0.2076 -0.1879 -0.2960 1092 GLU B CD  
3681 O OE1 . GLU B 92  ? 1.7282 2.6791 2.0363 -0.2453 -0.1923 -0.3277 1092 GLU B OE1 
3682 O OE2 . GLU B 92  ? 1.7182 2.7737 2.0477 -0.1747 -0.2156 -0.2863 1092 GLU B OE2 
3683 N N   . GLN B 93  ? 1.2384 1.9184 1.5527 -0.2461 -0.0451 -0.2487 1093 GLN B N   
3684 C CA  . GLN B 93  ? 1.2539 1.8678 1.5640 -0.2659 -0.0194 -0.2486 1093 GLN B CA  
3685 C C   . GLN B 93  ? 1.2793 1.8787 1.6025 -0.2570 0.0011  -0.2212 1093 GLN B C   
3686 O O   . GLN B 93  ? 1.2962 1.8590 1.6274 -0.2763 0.0230  -0.2191 1093 GLN B O   
3687 C CB  . GLN B 93  ? 1.2917 1.8396 1.5540 -0.2532 -0.0124 -0.2489 1093 GLN B CB  
3688 C CG  . GLN B 93  ? 1.5024 2.0287 1.7408 -0.2752 -0.0180 -0.2819 1093 GLN B CG  
3689 C CD  . GLN B 93  ? 1.7097 2.1819 1.8972 -0.2537 -0.0105 -0.2820 1093 GLN B CD  
3690 O OE1 . GLN B 93  ? 1.6519 2.1257 1.8036 -0.2536 -0.0241 -0.3029 1093 GLN B OE1 
3691 N NE2 . GLN B 93  ? 1.5909 2.0163 1.7733 -0.2343 0.0118  -0.2588 1093 GLN B NE2 
3692 N N   . LEU B 94  ? 1.2054 1.8251 1.5223 -0.2281 -0.0035 -0.2008 1094 LEU B N   
3693 C CA  . LEU B 94  ? 1.1921 1.7965 1.5081 -0.2187 0.0130  -0.1779 1094 LEU B CA  
3694 C C   . LEU B 94  ? 1.2662 1.9049 1.6234 -0.2362 0.0272  -0.1789 1094 LEU B C   
3695 O O   . LEU B 94  ? 1.2722 1.8776 1.6233 -0.2410 0.0500  -0.1653 1094 LEU B O   
3696 C CB  . LEU B 94  ? 1.1649 1.7784 1.4604 -0.1889 0.0064  -0.1628 1094 LEU B CB  
3697 C CG  . LEU B 94  ? 1.2130 1.7868 1.4742 -0.1744 0.0026  -0.1549 1094 LEU B CG  
3698 C CD1 . LEU B 94  ? 1.1996 1.7890 1.4455 -0.1525 -0.0051 -0.1512 1094 LEU B CD1 
3699 C CD2 . LEU B 94  ? 1.2417 1.7782 1.4859 -0.1727 0.0121  -0.1384 1094 LEU B CD2 
3700 N N   . LYS B 95  ? 1.2356 1.9442 1.6352 -0.2449 0.0138  -0.1944 1095 LYS B N   
3701 C CA  . LYS B 95  ? 1.2434 2.0066 1.7024 -0.2640 0.0264  -0.1983 1095 LYS B CA  
3702 C C   . LYS B 95  ? 1.3390 2.0601 1.8108 -0.3029 0.0515  -0.2072 1095 LYS B C   
3703 O O   . LYS B 95  ? 1.3447 2.0603 1.8371 -0.3121 0.0816  -0.1957 1095 LYS B O   
3704 C CB  . LYS B 95  ? 1.2704 2.1265 1.7759 -0.2676 -0.0030 -0.2171 1095 LYS B CB  
3705 C CG  . LYS B 95  ? 1.4300 2.3695 2.0160 -0.2828 0.0062  -0.2197 1095 LYS B CG  
3706 C CD  . LYS B 95  ? 1.5295 2.5741 2.1656 -0.2865 -0.0320 -0.2395 1095 LYS B CD  
3707 C CE  . LYS B 95  ? 1.5905 2.6994 2.2378 -0.2366 -0.0449 -0.2184 1095 LYS B CE  
3708 N NZ  . LYS B 95  ? 1.6516 2.8819 2.3637 -0.2388 -0.0814 -0.2335 1095 LYS B NZ  
3709 N N   . THR B 96  ? 1.3355 2.0138 1.7852 -0.3224 0.0451  -0.2255 1096 THR B N   
3710 C CA  . THR B 96  ? 1.3931 2.0112 1.8419 -0.3576 0.0722  -0.2352 1096 THR B CA  
3711 C C   . THR B 96  ? 1.4713 2.0079 1.8750 -0.3397 0.1014  -0.2050 1096 THR B C   
3712 O O   . THR B 96  ? 1.5070 1.9992 1.9139 -0.3613 0.1351  -0.2005 1096 THR B O   
3713 C CB  . THR B 96  ? 1.5518 2.1358 1.9753 -0.3748 0.0586  -0.2626 1096 THR B CB  
3714 O OG1 . THR B 96  ? 1.5537 2.2143 1.9992 -0.3809 0.0221  -0.2874 1096 THR B OG1 
3715 C CG2 . THR B 96  ? 1.5907 2.1153 2.0196 -0.4189 0.0890  -0.2803 1096 THR B CG2 
3716 N N   . THR B 97  ? 1.4143 1.9321 1.7750 -0.3015 0.0884  -0.1847 1097 THR B N   
3717 C CA  . THR B 97  ? 1.4351 1.8894 1.7501 -0.2812 0.1049  -0.1565 1097 THR B CA  
3718 C C   . THR B 97  ? 1.4927 1.9593 1.8114 -0.2772 0.1241  -0.1396 1097 THR B C   
3719 O O   . THR B 97  ? 1.5319 1.9439 1.8225 -0.2783 0.1515  -0.1222 1097 THR B O   
3720 C CB  . THR B 97  ? 1.5165 1.9595 1.7954 -0.2489 0.0814  -0.1456 1097 THR B CB  
3721 O OG1 . THR B 97  ? 1.5123 1.9546 1.7929 -0.2515 0.0676  -0.1635 1097 THR B OG1 
3722 C CG2 . THR B 97  ? 1.5277 1.9111 1.7629 -0.2303 0.0905  -0.1199 1097 THR B CG2 
3723 N N   . ARG B 98  ? 1.4183 1.9514 1.7665 -0.2693 0.1133  -0.1434 1098 ARG B N   
3724 C CA  . ARG B 98  ? 1.4265 1.9764 1.7813 -0.2616 0.1352  -0.1296 1098 ARG B CA  
3725 C C   . ARG B 98  ? 1.5292 2.0801 1.9235 -0.2919 0.1726  -0.1315 1098 ARG B C   
3726 O O   . ARG B 98  ? 1.5608 2.0782 1.9322 -0.2872 0.2054  -0.1133 1098 ARG B O   
3727 C CB  . ARG B 98  ? 1.3869 2.0106 1.7742 -0.2444 0.1182  -0.1346 1098 ARG B CB  
3728 C CG  . ARG B 98  ? 1.5404 2.1704 1.9223 -0.2262 0.1434  -0.1183 1098 ARG B CG  
3729 C CD  . ARG B 98  ? 1.6896 2.3998 2.1495 -0.2335 0.1588  -0.1234 1098 ARG B CD  
3730 N NE  . ARG B 98  ? 1.8060 2.5889 2.2989 -0.2130 0.1300  -0.1300 1098 ARG B NE  
3731 C CZ  . ARG B 98  ? 2.0009 2.8486 2.5432 -0.2271 0.1010  -0.1492 1098 ARG B CZ  
3732 N NH1 . ARG B 98  ? 1.8331 2.7421 2.3925 -0.2010 0.0748  -0.1502 1098 ARG B NH1 
3733 N NH2 . ARG B 98  ? 1.8613 2.7071 2.4289 -0.2670 0.0992  -0.1676 1098 ARG B NH2 
3734 N N   . ASN B 99  ? 1.4955 2.0806 1.9449 -0.3255 0.1694  -0.1553 1099 ASN B N   
3735 C CA  . ASN B 99  ? 1.5346 2.1273 2.0358 -0.3650 0.2052  -0.1636 1099 ASN B CA  
3736 C C   . ASN B 99  ? 1.6519 2.1391 2.1033 -0.3788 0.2387  -0.1530 1099 ASN B C   
3737 O O   . ASN B 99  ? 1.6989 2.1591 2.1622 -0.3984 0.2838  -0.1441 1099 ASN B O   
3738 C CB  . ASN B 99  ? 1.5269 2.1966 2.1021 -0.4007 0.1833  -0.1980 1099 ASN B CB  
3739 C CG  . ASN B 99  ? 1.7537 2.5334 2.3793 -0.3829 0.1492  -0.2053 1099 ASN B CG  
3740 O OD1 . ASN B 99  ? 1.6462 2.4556 2.2754 -0.3507 0.1561  -0.1851 1099 ASN B OD1 
3741 N ND2 . ASN B 99  ? 1.6512 2.4877 2.3083 -0.4003 0.1122  -0.2337 1099 ASN B ND2 
3742 N N   . ALA B 100 ? 1.6114 2.0379 2.0070 -0.3648 0.2208  -0.1511 1100 ALA B N   
3743 C CA  . ALA B 100 ? 1.6767 1.9998 2.0184 -0.3661 0.2497  -0.1363 1100 ALA B CA  
3744 C C   . ALA B 100 ? 1.7566 2.0248 2.0326 -0.3333 0.2679  -0.0996 1100 ALA B C   
3745 O O   . ALA B 100 ? 1.8296 2.0171 2.0659 -0.3360 0.3050  -0.0816 1100 ALA B O   
3746 C CB  . ALA B 100 ? 1.6836 1.9707 1.9930 -0.3535 0.2246  -0.1434 1100 ALA B CB  
3747 N N   . TYR B 101 ? 1.6639 1.9679 1.9197 -0.3023 0.2426  -0.0890 1101 TYR B N   
3748 C CA  . TYR B 101 ? 2.0705 2.3287 2.2550 -0.2724 0.2511  -0.0598 1101 TYR B CA  
3749 C C   . TYR B 101 ? 2.6389 2.8505 2.8074 -0.2849 0.3058  -0.0438 1101 TYR B C   
3750 O O   . TYR B 101 ? 2.2502 2.3792 2.3603 -0.2776 0.3297  -0.0223 1101 TYR B O   
3751 C CB  . TYR B 101 ? 2.0288 2.3400 2.2096 -0.2510 0.2239  -0.0615 1101 TYR B CB  
3752 C CG  . TYR B 101 ? 2.0835 2.3821 2.2341 -0.2420 0.2535  -0.0470 1101 TYR B CG  
3753 C CD1 . TYR B 101 ? 2.1664 2.3997 2.2267 -0.2195 0.2575  -0.0247 1101 TYR B CD1 
3754 C CD2 . TYR B 101 ? 2.0743 2.4291 2.2849 -0.2537 0.2770  -0.0556 1101 TYR B CD2 
3755 C CE1 . TYR B 101 ? 2.2240 2.4338 2.2424 -0.2109 0.2888  -0.0131 1101 TYR B CE1 
3756 C CE2 . TYR B 101 ? 2.1266 2.4637 2.3073 -0.2423 0.3121  -0.0416 1101 TYR B CE2 
3757 C CZ  . TYR B 101 ? 2.2802 2.5383 2.3586 -0.2216 0.3195  -0.0214 1101 TYR B CZ  
3758 O OH  . TYR B 101 ? 2.3364 2.5660 2.3711 -0.2097 0.3570  -0.0094 1101 TYR B OH  
3759 N N   . LEU B 120 ? 1.8868 3.3776 1.2234 0.8851  -0.1268 0.2372  44   LEU B N   
3760 C CA  . LEU B 120 ? 1.9173 3.3561 1.2158 0.8917  -0.0918 0.2763  44   LEU B CA  
3761 C C   . LEU B 120 ? 1.9490 3.3295 1.2748 0.8930  -0.0544 0.3406  44   LEU B C   
3762 O O   . LEU B 120 ? 1.9115 3.3230 1.2785 0.9035  -0.0410 0.3532  44   LEU B O   
3763 C CB  . LEU B 120 ? 1.9093 3.3654 1.1986 0.8877  -0.0792 0.2490  44   LEU B CB  
3764 C CG  . LEU B 120 ? 1.9733 3.4010 1.2448 0.8457  -0.1110 0.1832  44   LEU B CG  
3765 C CD1 . LEU B 120 ? 1.9468 3.4132 1.2351 0.8420  -0.1070 0.1448  44   LEU B CD1 
3766 C CD2 . LEU B 120 ? 2.0493 3.3995 1.2692 0.8278  -0.1035 0.1954  44   LEU B CD2 
3767 N N   . ASP B 121 ? 1.9400 3.2930 1.2284 0.9170  -0.0328 0.3902  45   ASP B N   
3768 C CA  . ASP B 121 ? 1.9329 3.2494 1.2409 0.9338  0.0067  0.4573  45   ASP B CA  
3769 C C   . ASP B 121 ? 1.9430 3.2357 1.2661 0.9285  0.0465  0.4787  45   ASP B C   
3770 O O   . ASP B 121 ? 1.9271 3.2018 1.2870 0.9385  0.0787  0.5260  45   ASP B O   
3771 C CB  . ASP B 121 ? 1.9981 3.2350 1.2799 0.9193  0.0085  0.4861  45   ASP B CB  
3772 C CG  . ASP B 121 ? 2.1021 3.2453 1.4333 0.8754  -0.0067 0.4969  45   ASP B CG  
3773 O OD1 . ASP B 121 ? 2.0785 3.2206 1.4538 0.8866  0.0160  0.5271  45   ASP B OD1 
3774 O OD2 . ASP B 121 ? 2.1981 3.2709 1.5209 0.8348  -0.0378 0.4810  45   ASP B OD2 
3775 N N   . ALA B 122 ? 1.8973 3.2394 1.1797 0.9469  0.0509  0.4570  46   ALA B N   
3776 C CA  . ALA B 122 ? 1.8769 3.2208 1.1659 0.9555  0.0891  0.4784  46   ALA B CA  
3777 C C   . ALA B 122 ? 1.8228 3.1361 1.1841 0.9145  0.0902  0.4640  46   ALA B C   
3778 O O   . ALA B 122 ? 1.7972 3.0501 1.1958 0.8938  0.1230  0.4963  46   ALA B O   
3779 C CB  . ALA B 122 ? 1.8997 3.2500 1.1504 0.9418  0.0770  0.4295  46   ALA B CB  
3780 N N   . ILE B 123 ? 1.7095 3.0394 1.0994 0.8859  0.0518  0.4100  47   ILE B N   
3781 C CA  . ILE B 123 ? 1.6208 2.8982 1.0820 0.8290  0.0463  0.3850  47   ILE B CA  
3782 C C   . ILE B 123 ? 1.6434 2.8652 1.1522 0.8207  0.0700  0.4347  47   ILE B C   
3783 O O   . ILE B 123 ? 1.6140 2.7764 1.1618 0.7905  0.0934  0.4483  47   ILE B O   
3784 C CB  . ILE B 123 ? 1.6195 2.9318 1.0992 0.8046  0.0026  0.3204  47   ILE B CB  
3785 C CG1 . ILE B 123 ? 1.6213 2.9545 1.0825 0.7894  -0.0130 0.2659  47   ILE B CG1 
3786 C CG2 . ILE B 123 ? 1.5556 2.8190 1.1067 0.7572  -0.0015 0.3096  47   ILE B CG2 
3787 C CD1 . ILE B 123 ? 1.7284 3.1330 1.1636 0.8030  -0.0536 0.2146  47   ILE B CD1 
3788 N N   . PRO B 124 ? 1.6099 2.8467 1.1177 0.8482  0.0669  0.4641  48   PRO B N   
3789 C CA  . PRO B 124 ? 1.5868 2.7641 1.1441 0.8381  0.0910  0.5078  48   PRO B CA  
3790 C C   . PRO B 124 ? 1.6443 2.7716 1.2074 0.8446  0.1357  0.5626  48   PRO B C   
3791 O O   . PRO B 124 ? 1.5958 2.6605 1.2150 0.8118  0.1529  0.5751  48   PRO B O   
3792 C CB  . PRO B 124 ? 1.6455 2.8596 1.1857 0.8787  0.0810  0.5320  48   PRO B CB  
3793 C CG  . PRO B 124 ? 1.7029 2.9889 1.2129 0.8868  0.0396  0.4797  48   PRO B CG  
3794 C CD  . PRO B 124 ? 1.6639 2.9710 1.1332 0.8864  0.0387  0.4542  48   PRO B CD  
3795 N N   . ILE B 125 ? 1.6598 2.8163 1.1669 0.8864  0.1543  0.5936  49   ILE B N   
3796 C CA  . ILE B 125 ? 1.6882 2.8060 1.1978 0.8975  0.1998  0.6487  49   ILE B CA  
3797 C C   . ILE B 125 ? 1.6928 2.7658 1.2416 0.8505  0.2102  0.6261  49   ILE B C   
3798 O O   . ILE B 125 ? 1.6825 2.6983 1.2796 0.8323  0.2399  0.6593  49   ILE B O   
3799 C CB  . ILE B 125 ? 1.8059 2.9751 1.2382 0.9535  0.2144  0.6786  49   ILE B CB  
3800 C CG1 . ILE B 125 ? 1.8566 3.0448 1.2554 0.9866  0.2004  0.6985  49   ILE B CG1 
3801 C CG2 . ILE B 125 ? 1.8446 2.9785 1.2793 0.9621  0.2632  0.7305  49   ILE B CG2 
3802 C CD1 . ILE B 125 ? 1.9363 3.0241 1.3932 0.9512  0.2063  0.7258  49   ILE B CD1 
3803 N N   . LEU B 126 ? 1.6160 2.7156 1.1477 0.8310  0.1845  0.5685  50   LEU B N   
3804 C CA  . LEU B 126 ? 1.5663 2.6321 1.1291 0.7891  0.1891  0.5403  50   LEU B CA  
3805 C C   . LEU B 126 ? 1.5313 2.5423 1.1663 0.7391  0.1818  0.5241  50   LEU B C   
3806 O O   . LEU B 126 ? 1.4997 2.4659 1.1739 0.7086  0.1981  0.5259  50   LEU B O   
3807 C CB  . LEU B 126 ? 1.5653 2.6772 1.0897 0.7855  0.1601  0.4810  50   LEU B CB  
3808 C CG  . LEU B 126 ? 1.6713 2.8064 1.1465 0.8091  0.1781  0.4845  50   LEU B CG  
3809 C CD1 . LEU B 126 ? 1.7497 2.9147 1.1702 0.8662  0.2033  0.5395  50   LEU B CD1 
3810 C CD2 . LEU B 126 ? 1.7079 2.8900 1.1473 0.8067  0.1444  0.4200  50   LEU B CD2 
3811 N N   . TYR B 127 ? 1.4521 2.4686 1.1040 0.7329  0.1579  0.5094  51   TYR B N   
3812 C CA  . TYR B 127 ? 1.3856 2.3549 1.0998 0.6903  0.1497  0.4938  51   TYR B CA  
3813 C C   . TYR B 127 ? 1.4430 2.3562 1.1996 0.6890  0.1815  0.5452  51   TYR B C   
3814 O O   . TYR B 127 ? 1.3961 2.2586 1.2038 0.6520  0.1887  0.5402  51   TYR B O   
3815 C CB  . TYR B 127 ? 1.3767 2.3757 1.0923 0.6895  0.1166  0.4640  51   TYR B CB  
3816 C CG  . TYR B 127 ? 1.3568 2.3865 1.0662 0.6652  0.0840  0.4018  51   TYR B CG  
3817 C CD1 . TYR B 127 ? 1.4045 2.4763 1.0691 0.6781  0.0754  0.3774  51   TYR B CD1 
3818 C CD2 . TYR B 127 ? 1.3118 2.3285 1.0611 0.6303  0.0626  0.3671  51   TYR B CD2 
3819 C CE1 . TYR B 127 ? 1.3851 2.4809 1.0506 0.6541  0.0466  0.3194  51   TYR B CE1 
3820 C CE2 . TYR B 127 ? 1.2929 2.3352 1.0423 0.6070  0.0354  0.3126  51   TYR B CE2 
3821 C CZ  . TYR B 127 ? 1.3957 2.4765 1.1055 0.6183  0.0271  0.2885  51   TYR B CZ  
3822 O OH  . TYR B 127 ? 1.3579 2.4611 1.0735 0.5944  0.0010  0.2340  51   TYR B OH  
3823 N N   . TYR B 128 ? 1.4579 2.3809 1.1934 0.7305  0.2015  0.5952  52   TYR B N   
3824 C CA  . TYR B 128 ? 1.4707 2.3415 1.2479 0.7333  0.2342  0.6474  52   TYR B CA  
3825 C C   . TYR B 128 ? 1.5340 2.3767 1.3248 0.7282  0.2687  0.6760  52   TYR B C   
3826 O O   . TYR B 128 ? 1.5059 2.2932 1.3562 0.7009  0.2856  0.6902  52   TYR B O   
3827 C CB  . TYR B 128 ? 1.5410 2.4314 1.2928 0.7814  0.2451  0.6936  52   TYR B CB  
3828 N N   . ILE B 129 ? 1.5348 2.4155 1.2733 0.7549  0.2798  0.6847  53   ILE B N   
3829 C CA  . ILE B 129 ? 1.5563 2.4142 1.3082 0.7533  0.3161  0.7154  53   ILE B CA  
3830 C C   . ILE B 129 ? 1.5566 2.3751 1.3621 0.7015  0.3113  0.6818  53   ILE B C   
3831 O O   . ILE B 129 ? 1.5522 2.3291 1.4055 0.6874  0.3402  0.7110  53   ILE B O   
3832 C CB  . ILE B 129 ? 1.6510 2.5593 1.3330 0.7925  0.3294  0.7274  53   ILE B CB  
3833 C CG1 . ILE B 129 ? 1.6400 2.5966 1.2747 0.7879  0.2933  0.6649  53   ILE B CG1 
3834 C CG2 . ILE B 129 ? 1.7293 2.6659 1.3661 0.8477  0.3475  0.7802  53   ILE B CG2 
3835 C CD1 . ILE B 129 ? 1.7435 2.7010 1.3722 0.7742  0.3027  0.6452  53   ILE B CD1 
3836 N N   . ILE B 130 ? 1.4691 2.2993 1.2717 0.6731  0.2751  0.6224  54   ILE B N   
3837 C CA  . ILE B 130 ? 1.4128 2.2081 1.2622 0.6267  0.2690  0.5910  54   ILE B CA  
3838 C C   . ILE B 130 ? 1.4104 2.1570 1.3215 0.5944  0.2607  0.5866  54   ILE B C   
3839 O O   . ILE B 130 ? 1.3679 2.0786 1.3252 0.5578  0.2595  0.5701  54   ILE B O   
3840 C CB  . ILE B 130 ? 1.4259 2.2509 1.2475 0.6101  0.2394  0.5324  54   ILE B CB  
3841 C CG1 . ILE B 130 ? 1.3989 2.2367 1.2198 0.5949  0.2018  0.4902  54   ILE B CG1 
3842 C CG2 . ILE B 130 ? 1.4829 2.3586 1.2399 0.6436  0.2440  0.5294  54   ILE B CG2 
3843 C CD1 . ILE B 130 ? 1.4491 2.2534 1.3147 0.5484  0.1859  0.4537  54   ILE B CD1 
3844 N N   . PHE B 131 ? 1.3662 2.1135 1.2768 0.6093  0.2537  0.5992  55   PHE B N   
3845 C CA  . PHE B 131 ? 1.3293 2.0321 1.2941 0.5834  0.2466  0.5946  55   PHE B CA  
3846 C C   . PHE B 131 ? 1.4104 2.0626 1.4293 0.5769  0.2796  0.6368  55   PHE B C   
3847 O O   . PHE B 131 ? 1.3723 1.9856 1.4415 0.5409  0.2779  0.6214  55   PHE B O   
3848 C CB  . PHE B 131 ? 1.3598 2.0801 1.3086 0.6047  0.2316  0.5970  55   PHE B CB  
3849 C CG  . PHE B 131 ? 1.3709 2.0441 1.3704 0.5972  0.2390  0.6161  55   PHE B CG  
3850 C CD1 . PHE B 131 ? 1.3611 2.0001 1.4030 0.5593  0.2220  0.5830  55   PHE B CD1 
3851 C CD2 . PHE B 131 ? 1.4380 2.1012 1.4411 0.6301  0.2630  0.6669  55   PHE B CD2 
3852 C CE1 . PHE B 131 ? 1.3719 1.9678 1.4589 0.5538  0.2278  0.5967  55   PHE B CE1 
3853 C CE2 . PHE B 131 ? 1.4729 2.0899 1.5256 0.6234  0.2697  0.6819  55   PHE B CE2 
3854 C CZ  . PHE B 131 ? 1.4031 1.9871 1.4969 0.5853  0.2514  0.6448  55   PHE B CZ  
3855 N N   . VAL B 132 ? 1.4323 2.0870 1.4415 0.6123  0.3096  0.6899  56   VAL B N   
3856 C CA  . VAL B 132 ? 1.4543 2.0625 1.5187 0.6106  0.3451  0.7365  56   VAL B CA  
3857 C C   . VAL B 132 ? 1.4935 2.0844 1.5907 0.5853  0.3608  0.7345  56   VAL B C   
3858 O O   . VAL B 132 ? 1.4756 2.0195 1.6405 0.5582  0.3714  0.7414  56   VAL B O   
3859 C CB  . VAL B 132 ? 1.5687 2.1890 1.6092 0.6579  0.3765  0.7969  56   VAL B CB  
3860 C CG1 . VAL B 132 ? 1.5815 2.1959 1.6219 0.6760  0.3672  0.8076  56   VAL B CG1 
3861 C CG2 . VAL B 132 ? 1.6008 2.2805 1.5644 0.6937  0.3802  0.8035  56   VAL B CG2 
3862 N N   . ILE B 133 ? 1.4513 2.0813 1.5026 0.5940  0.3601  0.7216  57   ILE B N   
3863 C CA  . ILE B 133 ? 1.4346 2.0567 1.5094 0.5746  0.3743  0.7179  57   ILE B CA  
3864 C C   . ILE B 133 ? 1.4267 2.0186 1.5490 0.5268  0.3490  0.6725  57   ILE B C   
3865 O O   . ILE B 133 ? 1.4032 1.9583 1.5883 0.5026  0.3630  0.6824  57   ILE B O   
3866 C CB  . ILE B 133 ? 1.4930 2.1678 1.4986 0.5983  0.3745  0.7070  57   ILE B CB  
3867 C CG1 . ILE B 133 ? 1.5667 2.2679 1.5309 0.6471  0.4088  0.7612  57   ILE B CG1 
3868 C CG2 . ILE B 133 ? 1.4769 2.1488 1.5002 0.5725  0.3755  0.6818  57   ILE B CG2 
3869 C CD1 . ILE B 133 ? 1.6882 2.3587 1.7030 0.6525  0.4572  0.8204  57   ILE B CD1 
3870 N N   . GLY B 134 ? 1.3605 1.9700 1.4534 0.5150  0.3124  0.6247  58   GLY B N   
3871 C CA  . GLY B 134 ? 1.3058 1.8928 1.4307 0.4740  0.2854  0.5798  58   GLY B CA  
3872 C C   . GLY B 134 ? 1.3388 1.8773 1.5256 0.4515  0.2838  0.5844  58   GLY B C   
3873 O O   . GLY B 134 ? 1.2975 1.8084 1.5273 0.4183  0.2744  0.5626  58   GLY B O   
3874 N N   . PHE B 135 ? 1.3273 1.8556 1.5178 0.4710  0.2921  0.6115  59   PHE B N   
3875 C CA  . PHE B 135 ? 1.3249 1.8060 1.5733 0.4543  0.2926  0.6170  59   PHE B CA  
3876 C C   . PHE B 135 ? 1.3921 1.8383 1.7020 0.4456  0.3228  0.6506  59   PHE B C   
3877 O O   . PHE B 135 ? 1.3642 1.7719 1.7325 0.4159  0.3170  0.6371  59   PHE B O   
3878 C CB  . PHE B 135 ? 1.3830 1.8656 1.6153 0.4817  0.2939  0.6370  59   PHE B CB  
3879 C CG  . PHE B 135 ? 1.3853 1.8434 1.6399 0.4630  0.2696  0.6069  59   PHE B CG  
3880 C CD1 . PHE B 135 ? 1.4017 1.8865 1.6198 0.4560  0.2378  0.5646  59   PHE B CD1 
3881 C CD2 . PHE B 135 ? 1.4304 1.8390 1.7444 0.4528  0.2794  0.6204  59   PHE B CD2 
3882 C CE1 . PHE B 135 ? 1.3946 1.8584 1.6317 0.4405  0.2179  0.5381  59   PHE B CE1 
3883 C CE2 . PHE B 135 ? 1.4503 1.8370 1.7813 0.4377  0.2574  0.5906  59   PHE B CE2 
3884 C CZ  . PHE B 135 ? 1.3951 1.8104 1.6857 0.4324  0.2276  0.5507  59   PHE B CZ  
3885 N N   . LEU B 136 ? 1.3903 1.8528 1.6873 0.4719  0.3550  0.6932  60   LEU B N   
3886 C CA  . LEU B 136 ? 1.4099 1.8453 1.7663 0.4667  0.3891  0.7306  60   LEU B CA  
3887 C C   . LEU B 136 ? 1.4194 1.8496 1.8098 0.4338  0.3829  0.7044  60   LEU B C   
3888 O O   . LEU B 136 ? 1.4058 1.7983 1.8686 0.4075  0.3872  0.7050  60   LEU B O   
3889 C CB  . LEU B 136 ? 1.4671 1.9273 1.7928 0.5065  0.4266  0.7837  60   LEU B CB  
3890 C CG  . LEU B 136 ? 1.5789 2.0260 1.9070 0.5378  0.4495  0.8320  60   LEU B CG  
3891 C CD1 . LEU B 136 ? 1.6394 2.1184 1.9245 0.5798  0.4847  0.8824  60   LEU B CD1 
3892 C CD2 . LEU B 136 ? 1.6158 2.0054 2.0345 0.5181  0.4677  0.8544  60   LEU B CD2 
3893 N N   . VAL B 137 ? 1.3513 1.8181 1.6936 0.4349  0.3716  0.6798  61   VAL B N   
3894 C CA  . VAL B 137 ? 1.3119 1.7756 1.6846 0.4065  0.3660  0.6559  61   VAL B CA  
3895 C C   . VAL B 137 ? 1.3070 1.7419 1.7172 0.3684  0.3324  0.6123  61   VAL B C   
3896 O O   . VAL B 137 ? 1.2800 1.6941 1.7481 0.3427  0.3335  0.6062  61   VAL B O   
3897 C CB  . VAL B 137 ? 1.3532 1.8595 1.6681 0.4172  0.3624  0.6382  61   VAL B CB  
3898 C CG1 . VAL B 137 ? 1.3984 1.9291 1.6915 0.4503  0.4009  0.6825  61   VAL B CG1 
3899 C CG2 . VAL B 137 ? 1.3361 1.8709 1.5827 0.4249  0.3307  0.6014  61   VAL B CG2 
3900 N N   . ASN B 138 ? 1.2443 1.6797 1.6236 0.3663  0.3038  0.5838  62   ASN B N   
3901 C CA  . ASN B 138 ? 1.2011 1.6122 1.6067 0.3346  0.2731  0.5438  62   ASN B CA  
3902 C C   . ASN B 138 ? 1.2652 1.6322 1.7336 0.3228  0.2772  0.5548  62   ASN B C   
3903 O O   . ASN B 138 ? 1.2364 1.5796 1.7432 0.2943  0.2582  0.5269  62   ASN B O   
3904 C CB  . ASN B 138 ? 1.1740 1.6050 1.5245 0.3365  0.2433  0.5090  62   ASN B CB  
3905 C CG  . ASN B 138 ? 1.3918 1.8534 1.7021 0.3309  0.2284  0.4795  62   ASN B CG  
3906 O OD1 . ASN B 138 ? 1.2789 1.7307 1.6079 0.3047  0.2122  0.4514  62   ASN B OD1 
3907 N ND2 . ASN B 138 ? 1.2968 1.7963 1.5516 0.3563  0.2329  0.4846  62   ASN B ND2 
3908 N N   . ILE B 139 ? 1.2610 1.6164 1.7412 0.3450  0.3017  0.5945  63   ILE B N   
3909 C CA  . ILE B 139 ? 1.2735 1.5833 1.8202 0.3335  0.3079  0.6048  63   ILE B CA  
3910 C C   . ILE B 139 ? 1.3372 1.6281 1.9553 0.3162  0.3285  0.6225  63   ILE B C   
3911 O O   . ILE B 139 ? 1.3219 1.5762 2.0060 0.2937  0.3237  0.6135  63   ILE B O   
3912 C CB  . ILE B 139 ? 1.3560 1.6538 1.8976 0.3617  0.3253  0.6390  63   ILE B CB  
3913 C CG1 . ILE B 139 ? 1.3660 1.6149 1.9671 0.3460  0.3185  0.6300  63   ILE B CG1 
3914 C CG2 . ILE B 139 ? 1.4115 1.7171 1.9574 0.3893  0.3666  0.6960  63   ILE B CG2 
3915 C CD1 . ILE B 139 ? 1.3999 1.6461 1.9720 0.3394  0.2844  0.5876  63   ILE B CD1 
3916 N N   . VAL B 140 ? 1.3216 1.6399 1.9268 0.3260  0.3495  0.6436  64   VAL B N   
3917 C CA  . VAL B 140 ? 1.3339 1.6434 2.0041 0.3112  0.3707  0.6607  64   VAL B CA  
3918 C C   . VAL B 140 ? 1.3671 1.6715 2.0652 0.2763  0.3399  0.6147  64   VAL B C   
3919 O O   . VAL B 140 ? 1.3664 1.6455 2.1412 0.2534  0.3420  0.6135  64   VAL B O   
3920 C CB  . VAL B 140 ? 1.4051 1.7495 2.0441 0.3364  0.4029  0.6961  64   VAL B CB  
3921 C CG1 . VAL B 140 ? 1.3883 1.7389 2.0742 0.3179  0.4129  0.6949  64   VAL B CG1 
3922 C CG2 . VAL B 140 ? 1.4573 1.7947 2.1055 0.3654  0.4425  0.7530  64   VAL B CG2 
3923 N N   . VAL B 141 ? 1.3059 1.6334 1.9442 0.2728  0.3107  0.5768  65   VAL B N   
3924 C CA  . VAL B 141 ? 1.2703 1.5959 1.9217 0.2441  0.2802  0.5340  65   VAL B CA  
3925 C C   . VAL B 141 ? 1.3345 1.6241 2.0295 0.2217  0.2569  0.5092  65   VAL B C   
3926 O O   . VAL B 141 ? 1.3229 1.5965 2.0790 0.1982  0.2494  0.4972  65   VAL B O   
3927 C CB  . VAL B 141 ? 1.2894 1.6457 1.8653 0.2483  0.2574  0.5031  65   VAL B CB  
3928 C CG1 . VAL B 141 ? 1.2483 1.5983 1.8368 0.2203  0.2258  0.4613  65   VAL B CG1 
3929 C CG2 . VAL B 141 ? 1.2968 1.6876 1.8364 0.2678  0.2782  0.5208  65   VAL B CG2 
3930 N N   . VAL B 142 ? 1.3126 1.5914 1.9778 0.2305  0.2457  0.5011  66   VAL B N   
3931 C CA  . VAL B 142 ? 1.3145 1.5596 2.0118 0.2141  0.2246  0.4763  66   VAL B CA  
3932 C C   . VAL B 142 ? 1.4147 1.6255 2.1996 0.2036  0.2422  0.4963  66   VAL B C   
3933 O O   . VAL B 142 ? 1.4031 1.5906 2.2368 0.1798  0.2229  0.4692  66   VAL B O   
3934 C CB  . VAL B 142 ? 1.3689 1.6115 2.0188 0.2314  0.2166  0.4715  66   VAL B CB  
3935 C CG1 . VAL B 142 ? 1.3668 1.5737 2.0498 0.2166  0.1971  0.4452  66   VAL B CG1 
3936 C CG2 . VAL B 142 ? 1.3400 1.6178 1.9127 0.2389  0.1984  0.4495  66   VAL B CG2 
3937 N N   . THR B 143 ? 1.4211 1.6303 2.2270 0.2213  0.2790  0.5431  67   THR B N   
3938 C CA  . THR B 143 ? 1.4570 1.6328 2.3520 0.2114  0.2995  0.5655  67   THR B CA  
3939 C C   . THR B 143 ? 1.5213 1.7021 2.4777 0.1893  0.3032  0.5635  67   THR B C   
3940 O O   . THR B 143 ? 1.5255 1.6785 2.5585 0.1666  0.2959  0.5506  67   THR B O   
3941 C CB  . THR B 143 ? 1.5962 1.7659 2.4967 0.2387  0.3401  0.6200  67   THR B CB  
3942 O OG1 . THR B 143 ? 1.5877 1.7972 2.4330 0.2614  0.3601  0.6467  67   THR B OG1 
3943 C CG2 . THR B 143 ? 1.6039 1.7545 2.4767 0.2564  0.3368  0.6229  67   THR B CG2 
3944 N N   . LEU B 144 ? 1.4791 1.6955 2.4059 0.1959  0.3134  0.5738  68   LEU B N   
3945 C CA  . LEU B 144 ? 1.4727 1.6959 2.4622 0.1765  0.3186  0.5738  68   LEU B CA  
3946 C C   . LEU B 144 ? 1.4953 1.7143 2.5003 0.1485  0.2764  0.5222  68   LEU B C   
3947 O O   . LEU B 144 ? 1.4882 1.6941 2.5731 0.1263  0.2719  0.5140  68   LEU B O   
3948 C CB  . LEU B 144 ? 1.4752 1.7360 2.4339 0.1926  0.3432  0.5991  68   LEU B CB  
3949 C CG  . LEU B 144 ? 1.5080 1.8023 2.3894 0.1976  0.3229  0.5724  68   LEU B CG  
3950 C CD1 . LEU B 144 ? 1.4862 1.7911 2.4079 0.1751  0.3091  0.5502  68   LEU B CD1 
3951 C CD2 . LEU B 144 ? 1.5637 1.8894 2.3876 0.2282  0.3525  0.6046  68   LEU B CD2 
3952 N N   . PHE B 145 ? 1.4379 1.6664 2.3705 0.1501  0.2456  0.4880  69   PHE B N   
3953 C CA  . PHE B 145 ? 1.4109 1.6355 2.3459 0.1278  0.2055  0.4407  69   PHE B CA  
3954 C C   . PHE B 145 ? 1.4774 1.6652 2.4698 0.1117  0.1901  0.4220  69   PHE B C   
3955 O O   . PHE B 145 ? 1.4668 1.6486 2.4976 0.0902  0.1639  0.3906  69   PHE B O   
3956 C CB  . PHE B 145 ? 1.4100 1.6507 2.2550 0.1360  0.1820  0.4146  69   PHE B CB  
3957 N N   . CYS B 146 ? 1.4532 1.6172 2.4524 0.1238  0.2067  0.4414  70   CYS B N   
3958 C CA  . CYS B 146 ? 1.7146 1.8398 2.7691 0.1118  0.1967  0.4260  70   CYS B CA  
3959 C C   . CYS B 146 ? 1.9251 2.0341 3.0840 0.0948  0.2126  0.4407  70   CYS B C   
3960 O O   . CYS B 146 ? 1.3860 1.4771 2.6021 0.0725  0.1891  0.4087  70   CYS B O   
3961 C CB  . CYS B 146 ? 1.7456 1.8513 2.7726 0.1331  0.2119  0.4450  70   CYS B CB  
3962 S SG  . CYS B 146 ? 1.7849 1.8781 2.7546 0.1344  0.1755  0.3995  70   CYS B SG  
3963 N N   . LYS B 153 ? 1.0201 1.3091 1.9747 0.0305  -0.0054 0.2273  77   LYS B N   
3964 C CA  . LYS B 153 ? 0.9949 1.3052 1.9031 0.0361  -0.0109 0.2249  77   LYS B CA  
3965 C C   . LYS B 153 ? 1.0388 1.3467 1.8587 0.0470  -0.0143 0.2176  77   LYS B C   
3966 O O   . LYS B 153 ? 1.0425 1.3391 1.8355 0.0546  -0.0015 0.2253  77   LYS B O   
3967 C CB  . LYS B 153 ? 1.0196 1.3490 1.9487 0.0428  0.0195  0.2543  77   LYS B CB  
3968 N N   . VAL B 154 ? 0.9860 1.3052 1.7647 0.0480  -0.0309 0.2039  78   VAL B N   
3969 C CA  . VAL B 154 ? 0.9734 1.2932 1.6746 0.0559  -0.0353 0.1956  78   VAL B CA  
3970 C C   . VAL B 154 ? 1.0141 1.3424 1.6815 0.0687  -0.0063 0.2168  78   VAL B C   
3971 O O   . VAL B 154 ? 1.0080 1.3315 1.6307 0.0757  -0.0028 0.2152  78   VAL B O   
3972 C CB  . VAL B 154 ? 1.0126 1.3422 1.6884 0.0540  -0.0555 0.1810  78   VAL B CB  
3973 C CG1 . VAL B 154 ? 1.0212 1.3419 1.6964 0.0470  -0.0875 0.1558  78   VAL B CG1 
3974 C CG2 . VAL B 154 ? 1.0033 1.3488 1.7195 0.0529  -0.0494 0.1918  78   VAL B CG2 
3975 N N   . SER B 155 ? 0.9657 1.3085 1.6564 0.0730  0.0140  0.2359  79   SER B N   
3976 C CA  . SER B 155 ? 0.9586 1.3138 1.6210 0.0874  0.0421  0.2560  79   SER B CA  
3977 C C   . SER B 155 ? 0.9916 1.3381 1.6559 0.0949  0.0597  0.2726  79   SER B C   
3978 O O   . SER B 155 ? 0.9908 1.3438 1.6063 0.1078  0.0707  0.2785  79   SER B O   
3979 C CB  . SER B 155 ? 1.0151 1.3864 1.7134 0.0907  0.0609  0.2731  79   SER B CB  
3980 O OG  . SER B 155 ? 1.1355 1.5139 1.8434 0.0843  0.0450  0.2599  79   SER B OG  
3981 N N   . SER B 156 ? 0.9321 1.2639 1.6551 0.0870  0.0609  0.2788  80   SER B N   
3982 C CA  . SER B 156 ? 0.9303 1.2485 1.6679 0.0933  0.0782  0.2967  80   SER B CA  
3983 C C   . SER B 156 ? 0.9378 1.2417 1.6325 0.0958  0.0635  0.2804  80   SER B C   
3984 O O   . SER B 156 ? 0.9463 1.2445 1.6275 0.1077  0.0796  0.2963  80   SER B O   
3985 C CB  . SER B 156 ? 0.9850 1.2891 1.8058 0.0812  0.0816  0.3040  80   SER B CB  
3986 O OG  . SER B 156 ? 1.0846 1.4045 1.9499 0.0807  0.1005  0.3237  80   SER B OG  
3987 N N   . ILE B 157 ? 0.8472 1.1467 1.5197 0.0865  0.0343  0.2505  81   ILE B N   
3988 C CA  . ILE B 157 ? 0.8281 1.1165 1.4590 0.0891  0.0203  0.2333  81   ILE B CA  
3989 C C   . ILE B 157 ? 0.8210 1.1266 1.3858 0.1026  0.0289  0.2375  81   ILE B C   
3990 O O   . ILE B 157 ? 0.8263 1.1279 1.3633 0.1115  0.0317  0.2378  81   ILE B O   
3991 C CB  . ILE B 157 ? 0.8617 1.1415 1.4903 0.0765  -0.0119 0.2015  81   ILE B CB  
3992 C CG1 . ILE B 157 ? 0.8826 1.1467 1.5801 0.0637  -0.0234 0.1931  81   ILE B CG1 
3993 C CG2 . ILE B 157 ? 0.8637 1.1362 1.4417 0.0811  -0.0242 0.1837  81   ILE B CG2 
3994 C CD1 . ILE B 157 ? 1.0325 1.2765 1.7804 0.0646  -0.0064 0.2079  81   ILE B CD1 
3995 N N   . TYR B 158 ? 0.7330 1.0584 1.2772 0.1049  0.0338  0.2405  82   TYR B N   
3996 C CA  . TYR B 158 ? 0.7144 1.0579 1.2022 0.1169  0.0412  0.2417  82   TYR B CA  
3997 C C   . TYR B 158 ? 0.7880 1.1410 1.2723 0.1340  0.0677  0.2684  82   TYR B C   
3998 O O   . TYR B 158 ? 0.7976 1.1619 1.2391 0.1462  0.0713  0.2689  82   TYR B O   
3999 C CB  . TYR B 158 ? 0.7035 1.0625 1.1714 0.1143  0.0373  0.2331  82   TYR B CB  
4000 C CG  . TYR B 158 ? 0.7020 1.0535 1.1662 0.1009  0.0129  0.2106  82   TYR B CG  
4001 C CD1 . TYR B 158 ? 0.7237 1.0702 1.1528 0.0983  -0.0026 0.1930  82   TYR B CD1 
4002 C CD2 . TYR B 158 ? 0.7061 1.0584 1.1994 0.0931  0.0068  0.2086  82   TYR B CD2 
4003 C CE1 . TYR B 158 ? 0.7309 1.0715 1.1526 0.0887  -0.0229 0.1756  82   TYR B CE1 
4004 C CE2 . TYR B 158 ? 0.7111 1.0581 1.1975 0.0840  -0.0154 0.1907  82   TYR B CE2 
4005 C CZ  . TYR B 158 ? 0.7984 1.1391 1.2472 0.0821  -0.0297 0.1750  82   TYR B CZ  
4006 O OH  . TYR B 158 ? 0.7739 1.1100 1.2128 0.0755  -0.0496 0.1606  82   TYR B OH  
4007 N N   . ILE B 159 ? 0.7526 1.1029 1.2832 0.1359  0.0865  0.2914  83   ILE B N   
4008 C CA  . ILE B 159 ? 0.7701 1.1285 1.3000 0.1542  0.1150  0.3222  83   ILE B CA  
4009 C C   . ILE B 159 ? 0.8272 1.1718 1.3505 0.1622  0.1165  0.3284  83   ILE B C   
4010 O O   . ILE B 159 ? 0.8267 1.1855 1.3113 0.1810  0.1281  0.3409  83   ILE B O   
4011 C CB  . ILE B 159 ? 0.8205 1.1772 1.4079 0.1542  0.1381  0.3491  83   ILE B CB  
4012 C CG1 . ILE B 159 ? 0.8116 1.1769 1.4250 0.1425  0.1331  0.3405  83   ILE B CG1 
4013 C CG2 . ILE B 159 ? 0.8452 1.2179 1.4144 0.1779  0.1698  0.3821  83   ILE B CG2 
4014 C CD1 . ILE B 159 ? 0.8972 1.2881 1.4729 0.1532  0.1423  0.3409  83   ILE B CD1 
4015 N N   . PHE B 160 ? 0.7895 1.1076 1.3502 0.1491  0.1037  0.3181  84   PHE B N   
4016 C CA  . PHE B 160 ? 0.8066 1.1067 1.3669 0.1557  0.1039  0.3207  84   PHE B CA  
4017 C C   . PHE B 160 ? 0.8474 1.1613 1.3444 0.1656  0.0929  0.3060  84   PHE B C   
4018 O O   . PHE B 160 ? 0.8660 1.1864 1.3408 0.1840  0.1055  0.3222  84   PHE B O   
4019 C CB  . PHE B 160 ? 0.8346 1.1051 1.4415 0.1381  0.0863  0.3017  84   PHE B CB  
4020 C CG  . PHE B 160 ? 0.8764 1.1254 1.4843 0.1449  0.0855  0.3002  84   PHE B CG  
4021 C CD1 . PHE B 160 ? 0.9471 1.1807 1.5891 0.1556  0.1091  0.3293  84   PHE B CD1 
4022 C CD2 . PHE B 160 ? 0.9042 1.1480 1.4797 0.1422  0.0631  0.2713  84   PHE B CD2 
4023 C CE1 . PHE B 160 ? 0.9825 1.1943 1.6270 0.1635  0.1091  0.3283  84   PHE B CE1 
4024 C CE2 . PHE B 160 ? 0.9621 1.1863 1.5391 0.1502  0.0634  0.2691  84   PHE B CE2 
4025 C CZ  . PHE B 160 ? 0.9649 1.1723 1.5772 0.1608  0.0857  0.2968  84   PHE B CZ  
4026 N N   . ASN B 161 ? 0.7694 1.0892 1.2399 0.1541  0.0703  0.2769  85   ASN B N   
4027 C CA  . ASN B 161 ? 0.7535 1.0876 1.1712 0.1602  0.0595  0.2609  85   ASN B CA  
4028 C C   . ASN B 161 ? 0.7931 1.1574 1.1713 0.1773  0.0727  0.2736  85   ASN B C   
4029 O O   . ASN B 161 ? 0.7934 1.1687 1.1424 0.1909  0.0738  0.2749  85   ASN B O   
4030 C CB  . ASN B 161 ? 0.7279 1.0627 1.1296 0.1447  0.0372  0.2324  85   ASN B CB  
4031 C CG  . ASN B 161 ? 1.0028 1.3135 1.4219 0.1343  0.0202  0.2142  85   ASN B CG  
4032 O OD1 . ASN B 161 ? 0.9803 1.2747 1.4380 0.1223  0.0125  0.2089  85   ASN B OD1 
4033 N ND2 . ASN B 161 ? 0.8586 1.1681 1.2515 0.1404  0.0145  0.2038  85   ASN B ND2 
4034 N N   . LEU B 162 ? 0.7338 1.1127 1.1122 0.1782  0.0824  0.2820  86   LEU B N   
4035 C CA  . LEU B 162 ? 0.7358 1.1449 1.0761 0.1956  0.0943  0.2911  86   LEU B CA  
4036 C C   . LEU B 162 ? 0.8132 1.2268 1.1527 0.2182  0.1152  0.3215  86   LEU B C   
4037 O O   . LEU B 162 ? 0.8128 1.2501 1.1124 0.2357  0.1169  0.3235  86   LEU B O   
4038 C CB  . LEU B 162 ? 0.7312 1.1516 1.0763 0.1924  0.1014  0.2925  86   LEU B CB  
4039 C CG  . LEU B 162 ? 0.8107 1.2617 1.1214 0.2123  0.1170  0.3029  86   LEU B CG  
4040 C CD1 . LEU B 162 ? 0.8133 1.2877 1.0747 0.2182  0.1041  0.2816  86   LEU B CD1 
4041 C CD2 . LEU B 162 ? 0.8396 1.2960 1.1630 0.2080  0.1246  0.3030  86   LEU B CD2 
4042 N N   . ALA B 163 ? 0.7907 1.1822 1.1762 0.2180  0.1304  0.3450  87   ALA B N   
4043 C CA  . ALA B 163 ? 0.8214 1.2113 1.2137 0.2393  0.1533  0.3789  87   ALA B CA  
4044 C C   . ALA B 163 ? 0.8835 1.2661 1.2612 0.2481  0.1455  0.3756  87   ALA B C   
4045 O O   . ALA B 163 ? 0.8956 1.2930 1.2492 0.2724  0.1584  0.3968  87   ALA B O   
4046 C CB  . ALA B 163 ? 0.8449 1.2084 1.3006 0.2320  0.1704  0.4017  87   ALA B CB  
4047 N N   . VAL B 164 ? 0.8335 1.1955 1.2238 0.2304  0.1245  0.3490  88   VAL B N   
4048 C CA  . VAL B 164 ? 0.8415 1.1961 1.2196 0.2374  0.1157  0.3410  88   VAL B CA  
4049 C C   . VAL B 164 ? 0.8863 1.2772 1.2073 0.2494  0.1063  0.3283  88   VAL B C   
4050 O O   . VAL B 164 ? 0.9024 1.3051 1.2045 0.2701  0.1118  0.3405  88   VAL B O   
4051 C CB  . VAL B 164 ? 0.8778 1.2028 1.2818 0.2163  0.0963  0.3138  88   VAL B CB  
4052 C CG1 . VAL B 164 ? 0.8728 1.1986 1.2515 0.2230  0.0842  0.2975  88   VAL B CG1 
4053 C CG2 . VAL B 164 ? 0.8925 1.1817 1.3576 0.2086  0.1054  0.3264  88   VAL B CG2 
4054 N N   . ALA B 165 ? 0.8155 1.2243 1.1134 0.2367  0.0924  0.3042  89   ALA B N   
4055 C CA  . ALA B 165 ? 0.8028 1.2465 1.0550 0.2436  0.0824  0.2880  89   ALA B CA  
4056 C C   . ALA B 165 ? 0.8800 1.3556 1.1043 0.2688  0.0966  0.3085  89   ALA B C   
4057 O O   . ALA B 165 ? 0.8729 1.3769 1.0654 0.2833  0.0908  0.3030  89   ALA B O   
4058 C CB  . ALA B 165 ? 0.7854 1.2351 1.0291 0.2236  0.0687  0.2620  89   ALA B CB  
4059 N N   . ASP B 166 ? 0.8673 1.3407 1.1038 0.2752  0.1151  0.3318  90   ASP B N   
4060 C CA  . ASP B 166 ? 0.8966 1.3993 1.1049 0.3020  0.1314  0.3545  90   ASP B CA  
4061 C C   . ASP B 166 ? 0.9805 1.4813 1.1885 0.3261  0.1437  0.3832  90   ASP B C   
4062 O O   . ASP B 166 ? 0.9884 1.5221 1.1582 0.3501  0.1440  0.3890  90   ASP B O   
4063 C CB  . ASP B 166 ? 0.9324 1.4314 1.1574 0.3023  0.1509  0.3734  90   ASP B CB  
4064 C CG  . ASP B 166 ? 1.1045 1.6176 1.3161 0.2894  0.1425  0.3491  90   ASP B CG  
4065 O OD1 . ASP B 166 ? 1.1151 1.6566 1.2878 0.2933  0.1290  0.3261  90   ASP B OD1 
4066 O OD2 . ASP B 166 ? 1.1913 1.6883 1.4344 0.2764  0.1503  0.3535  90   ASP B OD2 
4067 N N   . LEU B 167 ? 0.9561 1.4188 1.2078 0.3200  0.1522  0.3988  91   LEU B N   
4068 C CA  . LEU B 167 ? 0.9942 1.4462 1.2551 0.3415  0.1659  0.4279  91   LEU B CA  
4069 C C   . LEU B 167 ? 1.0456 1.5155 1.2772 0.3529  0.1497  0.4130  91   LEU B C   
4070 O O   . LEU B 167 ? 1.0802 1.5702 1.2891 0.3819  0.1585  0.4353  91   LEU B O   
4071 C CB  . LEU B 167 ? 1.0044 1.4073 1.3259 0.3259  0.1737  0.4373  91   LEU B CB  
4072 C CG  . LEU B 167 ? 1.1124 1.4933 1.4679 0.3429  0.2030  0.4820  91   LEU B CG  
4073 C CD1 . LEU B 167 ? 1.1387 1.5472 1.4708 0.3659  0.2268  0.5153  91   LEU B CD1 
4074 C CD2 . LEU B 167 ? 1.1529 1.4900 1.5758 0.3186  0.2084  0.4828  91   LEU B CD2 
4075 N N   . LEU B 168 ? 0.9561 1.4222 1.1870 0.3318  0.1268  0.3765  92   LEU B N   
4076 C CA  . LEU B 168 ? 0.9422 1.4262 1.1512 0.3400  0.1119  0.3601  92   LEU B CA  
4077 C C   . LEU B 168 ? 1.0000 1.5363 1.1624 0.3557  0.1039  0.3519  92   LEU B C   
4078 O O   . LEU B 168 ? 1.0037 1.5639 1.1478 0.3747  0.0986  0.3528  92   LEU B O   
4079 C CB  . LEU B 168 ? 0.9072 1.3740 1.1282 0.3135  0.0925  0.3252  92   LEU B CB  
4080 C CG  . LEU B 168 ? 0.9602 1.3782 1.2249 0.2981  0.0942  0.3241  92   LEU B CG  
4081 C CD1 . LEU B 168 ? 0.9338 1.3431 1.1982 0.2767  0.0742  0.2889  92   LEU B CD1 
4082 C CD2 . LEU B 168 ? 1.0180 1.4155 1.3022 0.3173  0.1065  0.3468  92   LEU B CD2 
4083 N N   . LEU B 169 ? 0.9595 1.5139 1.1054 0.3481  0.1022  0.3420  93   LEU B N   
4084 C CA  . LEU B 169 ? 0.9663 1.5692 1.0710 0.3603  0.0930  0.3285  93   LEU B CA  
4085 C C   . LEU B 169 ? 1.0703 1.6995 1.1491 0.3963  0.1080  0.3605  93   LEU B C   
4086 O O   . LEU B 169 ? 1.0870 1.7571 1.1346 0.4167  0.0985  0.3552  93   LEU B O   
4087 C CB  . LEU B 169 ? 0.9487 1.5548 1.0491 0.3404  0.0885  0.3079  93   LEU B CB  
4088 C CG  . LEU B 169 ? 1.0152 1.6670 1.0784 0.3474  0.0774  0.2860  93   LEU B CG  
4089 C CD1 . LEU B 169 ? 0.9997 1.6722 1.0566 0.3374  0.0554  0.2539  93   LEU B CD1 
4090 C CD2 . LEU B 169 ? 1.0510 1.6973 1.1153 0.3316  0.0794  0.2734  93   LEU B CD2 
4091 N N   . LEU B 170 ? 1.0473 1.6541 1.1413 0.4050  0.1318  0.3947  94   LEU B N   
4092 C CA  . LEU B 170 ? 1.0857 1.7130 1.1563 0.4408  0.1511  0.4320  94   LEU B CA  
4093 C C   . LEU B 170 ? 1.1690 1.7958 1.2407 0.4641  0.1539  0.4535  94   LEU B C   
4094 O O   . LEU B 170 ? 1.1978 1.8617 1.2333 0.4970  0.1562  0.4697  94   LEU B O   
4095 C CB  . LEU B 170 ? 1.1007 1.7005 1.1957 0.4410  0.1788  0.4647  94   LEU B CB  
4096 C CG  . LEU B 170 ? 1.1410 1.7478 1.2307 0.4257  0.1798  0.4490  94   LEU B CG  
4097 C CD1 . LEU B 170 ? 1.1467 1.7175 1.2804 0.4148  0.2033  0.4742  94   LEU B CD1 
4098 C CD2 . LEU B 170 ? 1.1923 1.8482 1.2275 0.4517  0.1810  0.4482  94   LEU B CD2 
4099 N N   . ALA B 171 ? 1.1147 1.7020 1.2260 0.4481  0.1516  0.4504  95   ALA B N   
4100 C CA  . ALA B 171 ? 1.1371 1.7166 1.2569 0.4673  0.1540  0.4671  95   ALA B CA  
4101 C C   . ALA B 171 ? 1.1874 1.8159 1.2707 0.4846  0.1334  0.4486  95   ALA B C   
4102 O O   . ALA B 171 ? 1.2046 1.8412 1.2834 0.5120  0.1376  0.4698  95   ALA B O   
4103 C CB  . ALA B 171 ? 1.1279 1.6578 1.2949 0.4422  0.1508  0.4549  95   ALA B CB  
4104 N N   . THR B 172 ? 1.1193 1.7807 1.1806 0.4695  0.1118  0.4102  96   THR B N   
4105 C CA  . THR B 172 ? 1.1129 1.8241 1.1470 0.4828  0.0910  0.3892  96   THR B CA  
4106 C C   . THR B 172 ? 1.1878 1.9526 1.1757 0.5151  0.0905  0.4001  96   THR B C   
4107 O O   . THR B 172 ? 1.1817 1.9935 1.1480 0.5312  0.0730  0.3857  96   THR B O   
4108 C CB  . THR B 172 ? 1.1441 1.8640 1.1836 0.4501  0.0686  0.3422  96   THR B CB  
4109 O OG1 . THR B 172 ? 1.1058 1.8340 1.1321 0.4349  0.0662  0.3261  96   THR B OG1 
4110 C CG2 . THR B 172 ? 1.1000 1.7730 1.1773 0.4227  0.0677  0.3306  96   THR B CG2 
4111 N N   . LEU B 173 ? 1.1634 1.9238 1.1369 0.5264  0.1095  0.4253  97   LEU B N   
4112 C CA  . LEU B 173 ? 1.1928 2.0034 1.1172 0.5594  0.1106  0.4359  97   LEU B CA  
4113 C C   . LEU B 173 ? 1.2940 2.1348 1.1964 0.6015  0.1121  0.4643  97   LEU B C   
4114 O O   . LEU B 173 ? 1.3033 2.2011 1.1668 0.6223  0.0945  0.4489  97   LEU B O   
4115 C CB  . LEU B 173 ? 1.2105 2.0081 1.1252 0.5656  0.1352  0.4618  97   LEU B CB  
4116 C CG  . LEU B 173 ? 1.2367 2.0369 1.1475 0.5388  0.1276  0.4280  97   LEU B CG  
4117 C CD1 . LEU B 173 ? 1.2437 2.0054 1.1759 0.5293  0.1543  0.4527  97   LEU B CD1 
4118 C CD2 . LEU B 173 ? 1.2765 2.1358 1.1353 0.5584  0.1130  0.4061  97   LEU B CD2 
4119 N N   . PRO B 174 ? 1.2816 2.0881 1.2087 0.6156  0.1307  0.5029  98   PRO B N   
4120 C CA  . PRO B 174 ? 1.3268 2.1643 1.2318 0.6585  0.1313  0.5306  98   PRO B CA  
4121 C C   . PRO B 174 ? 1.3632 2.2461 1.2597 0.6613  0.1000  0.4955  98   PRO B C   
4122 O O   . PRO B 174 ? 1.3881 2.3228 1.2501 0.6974  0.0907  0.5040  98   PRO B O   
4123 C CB  . PRO B 174 ? 1.3645 2.1443 1.3124 0.6617  0.1552  0.5689  98   PRO B CB  
4124 C CG  . PRO B 174 ? 1.4017 2.1298 1.3816 0.6320  0.1743  0.5748  98   PRO B CG  
4125 C CD  . PRO B 174 ? 1.2939 2.0330 1.2714 0.5954  0.1517  0.5233  98   PRO B CD  
4126 N N   . LEU B 175 ? 1.2778 2.1439 1.2061 0.6241  0.0842  0.4567  99   LEU B N   
4127 C CA  . LEU B 175 ? 1.2580 2.1634 1.1882 0.6204  0.0569  0.4216  99   LEU B CA  
4128 C C   . LEU B 175 ? 1.3279 2.2988 1.2211 0.6263  0.0340  0.3903  99   LEU B C   
4129 O O   . LEU B 175 ? 1.3396 2.3640 1.2164 0.6513  0.0168  0.3840  99   LEU B O   
4130 C CB  . LEU B 175 ? 1.2051 2.0740 1.1761 0.5777  0.0497  0.3893  99   LEU B CB  
4131 C CG  . LEU B 175 ? 1.2581 2.0809 1.2662 0.5761  0.0607  0.4053  99   LEU B CG  
4132 C CD1 . LEU B 175 ? 1.2683 2.0268 1.2988 0.5686  0.0869  0.4357  99   LEU B CD1 
4133 C CD2 . LEU B 175 ? 1.2477 2.0609 1.2825 0.5435  0.0461  0.3665  99   LEU B CD2 
4134 N N   . TRP B 176 ? 1.2844 2.2522 1.1662 0.6051  0.0332  0.3705  100  TRP B N   
4135 C CA  . TRP B 176 ? 1.2925 2.3178 1.1418 0.6085  0.0116  0.3364  100  TRP B CA  
4136 C C   . TRP B 176 ? 1.4036 2.4729 1.2019 0.6546  0.0152  0.3613  100  TRP B C   
4137 O O   . TRP B 176 ? 1.4124 2.5427 1.1820 0.6692  -0.0080 0.3346  100  TRP B O   
4138 C CB  . TRP B 176 ? 1.2503 2.2548 1.1053 0.5724  0.0110  0.3071  100  TRP B CB  
4139 C CG  . TRP B 176 ? 1.2171 2.1675 1.1174 0.5306  0.0149  0.2945  100  TRP B CG  
4140 C CD1 . TRP B 176 ? 1.2398 2.1385 1.1573 0.5071  0.0316  0.3023  100  TRP B CD1 
4141 C CD2 . TRP B 176 ? 1.1827 2.1274 1.1158 0.5102  0.0022  0.2734  100  TRP B CD2 
4142 N NE1 . TRP B 176 ? 1.1940 2.0558 1.1497 0.4741  0.0282  0.2863  100  TRP B NE1 
4143 C CE2 . TRP B 176 ? 1.2031 2.0914 1.1674 0.4755  0.0115  0.2689  100  TRP B CE2 
4144 C CE3 . TRP B 176 ? 1.1945 2.1788 1.1342 0.5190  -0.0158 0.2581  100  TRP B CE3 
4145 C CZ2 . TRP B 176 ? 1.1634 2.0334 1.1596 0.4510  0.0042  0.2500  100  TRP B CZ2 
4146 C CZ3 . TRP B 176 ? 1.1789 2.1444 1.1541 0.4937  -0.0210 0.2403  100  TRP B CZ3 
4147 C CH2 . TRP B 176 ? 1.1605 2.0691 1.1610 0.4607  -0.0107 0.2367  100  TRP B CH2 
4148 N N   . ALA B 177 ? 1.4013 2.4417 1.1900 0.6786  0.0439  0.4126  101  ALA B N   
4149 C CA  . ALA B 177 ? 1.4628 2.5407 1.2011 0.7269  0.0528  0.4458  101  ALA B CA  
4150 C C   . ALA B 177 ? 1.5483 2.6720 1.2732 0.7638  0.0381  0.4568  101  ALA B C   
4151 O O   . ALA B 177 ? 1.5838 2.7699 1.2624 0.7978  0.0233  0.4526  101  ALA B O   
4152 C CB  . ALA B 177 ? 1.5002 2.5288 1.2422 0.7389  0.0912  0.5006  101  ALA B CB  
4153 N N   . THR B 178 ? 1.4856 2.5798 1.2518 0.7573  0.0410  0.4683  102  THR B N   
4154 C CA  . THR B 178 ? 1.5026 2.6329 1.2677 0.7888  0.0285  0.4789  102  THR B CA  
4155 C C   . THR B 178 ? 1.5333 2.7245 1.2988 0.7778  -0.0096 0.4239  102  THR B C   
4156 O O   . THR B 178 ? 1.5582 2.8127 1.2975 0.8127  -0.0284 0.4225  102  THR B O   
4157 C CB  . THR B 178 ? 1.5498 2.6225 1.3633 0.7812  0.0456  0.5041  102  THR B CB  
4158 O OG1 . THR B 178 ? 1.5427 2.5539 1.3663 0.7807  0.0801  0.5466  102  THR B OG1 
4159 C CG2 . THR B 178 ? 1.5493 2.6527 1.3607 0.8214  0.0398  0.5269  102  THR B CG2 
4160 N N   . TYR B 179 ? 1.4442 2.6179 1.2408 0.7299  -0.0207 0.3794  103  TYR B N   
4161 C CA  . TYR B 179 ? 1.4174 2.6406 1.2251 0.7109  -0.0533 0.3253  103  TYR B CA  
4162 C C   . TYR B 179 ? 1.4850 2.7748 1.2467 0.7314  -0.0739 0.3025  103  TYR B C   
4163 O O   . TYR B 179 ? 1.4780 2.8307 1.2389 0.7408  -0.1027 0.2725  103  TYR B O   
4164 C CB  . TYR B 179 ? 1.3861 2.5669 1.2319 0.6565  -0.0535 0.2906  103  TYR B CB  
4165 C CG  . TYR B 179 ? 1.3968 2.6198 1.2638 0.6318  -0.0824 0.2373  103  TYR B CG  
4166 C CD1 . TYR B 179 ? 1.4032 2.6372 1.3076 0.6237  -0.0923 0.2253  103  TYR B CD1 
4167 C CD2 . TYR B 179 ? 1.4054 2.6527 1.2602 0.6141  -0.0973 0.1987  103  TYR B CD2 
4168 C CE1 . TYR B 179 ? 1.3894 2.6616 1.3198 0.5993  -0.1157 0.1784  103  TYR B CE1 
4169 C CE2 . TYR B 179 ? 1.3918 2.6743 1.2735 0.5891  -0.1218 0.1503  103  TYR B CE2 
4170 C CZ  . TYR B 179 ? 1.4642 2.7596 1.3850 0.5812  -0.1303 0.1414  103  TYR B CZ  
4171 O OH  . TYR B 179 ? 1.4500 2.7803 1.4026 0.5555  -0.1518 0.0958  103  TYR B OH  
4172 N N   . TYR B 180 ? 1.4641 2.7415 1.1893 0.7390  -0.0593 0.3157  104  TYR B N   
4173 C CA  . TYR B 180 ? 1.4974 2.8335 1.1728 0.7612  -0.0760 0.2949  104  TYR B CA  
4174 C C   . TYR B 180 ? 1.6258 3.0101 1.2533 0.8206  -0.0765 0.3313  104  TYR B C   
4175 O O   . TYR B 180 ? 1.6543 3.1078 1.2454 0.8448  -0.1023 0.3061  104  TYR B O   
4176 C CB  . TYR B 180 ? 1.5072 2.8105 1.1628 0.7465  -0.0582 0.2939  104  TYR B CB  
4177 C CG  . TYR B 180 ? 1.5534 2.9139 1.1618 0.7624  -0.0775 0.2605  104  TYR B CG  
4178 C CD1 . TYR B 180 ? 1.5467 2.9327 1.1714 0.7322  -0.1053 0.1993  104  TYR B CD1 
4179 C CD2 . TYR B 180 ? 1.6245 3.0132 1.1721 0.8087  -0.0670 0.2899  104  TYR B CD2 
4180 C CE1 . TYR B 180 ? 1.5866 3.0239 1.1700 0.7466  -0.1243 0.1640  104  TYR B CE1 
4181 C CE2 . TYR B 180 ? 1.6689 3.1114 1.1692 0.8255  -0.0856 0.2560  104  TYR B CE2 
4182 C CZ  . TYR B 180 ? 1.7238 3.1900 1.2432 0.7939  -0.1152 0.1911  104  TYR B CZ  
4183 O OH  . TYR B 180 ? 1.7601 3.2779 1.2350 0.8103  -0.1346 0.1535  104  TYR B OH  
4184 N N   . SER B 181 ? 1.6118 2.9604 1.2407 0.8446  -0.0489 0.3896  105  SER B N   
4185 C CA  . SER B 181 ? 1.6766 3.0629 1.2627 0.9033  -0.0443 0.4337  105  SER B CA  
4186 C C   . SER B 181 ? 1.7323 3.1831 1.3239 0.9248  -0.0767 0.4158  105  SER B C   
4187 O O   . SER B 181 ? 1.7795 3.2763 1.3285 0.9666  -0.0887 0.4295  105  SER B O   
4188 C CB  . SER B 181 ? 1.7418 3.0650 1.3421 0.9170  -0.0053 0.4985  105  SER B CB  
4189 O OG  . SER B 181 ? 1.8732 3.1516 1.4600 0.9101  0.0256  0.5233  105  SER B OG  
4190 N N   . TYR B 182 ? 1.6353 3.0775 1.2827 0.8888  -0.0917 0.3826  106  TYR B N   
4191 C CA  . TYR B 182 ? 1.6301 3.1307 1.2969 0.9006  -0.1218 0.3601  106  TYR B CA  
4192 C C   . TYR B 182 ? 1.6585 3.2145 1.3314 0.8755  -0.1580 0.2924  106  TYR B C   
4193 O O   . TYR B 182 ? 1.6348 3.2339 1.3408 0.8690  -0.1837 0.2616  106  TYR B O   
4194 C CB  . TYR B 182 ? 1.6066 3.0613 1.3331 0.8796  -0.1109 0.3705  106  TYR B CB  
4195 C CG  . TYR B 182 ? 1.6712 3.0870 1.3946 0.9135  -0.0819 0.4340  106  TYR B CG  
4196 C CD1 . TYR B 182 ? 1.7516 3.2158 1.4534 0.9664  -0.0895 0.4632  106  TYR B CD1 
4197 C CD2 . TYR B 182 ? 1.6668 2.9975 1.4121 0.8933  -0.0474 0.4647  106  TYR B CD2 
4198 C CE1 . TYR B 182 ? 1.7989 3.2076 1.5049 0.9881  -0.0631 0.5192  106  TYR B CE1 
4199 C CE2 . TYR B 182 ? 1.7153 3.0069 1.4638 0.9233  -0.0197 0.5223  106  TYR B CE2 
4200 C CZ  . TYR B 182 ? 1.8642 3.1871 1.5946 0.9667  -0.0277 0.5483  106  TYR B CZ  
4201 O OH  . TYR B 182 ? 1.9012 3.1435 1.6483 0.9695  -0.0065 0.5917  106  TYR B OH  
4202 N N   . ARG B 183 ? 1.6247 3.1804 1.2674 0.8629  -0.1589 0.2698  107  ARG B N   
4203 C CA  . ARG B 183 ? 1.6106 3.2105 1.2549 0.8393  -0.1894 0.2060  107  ARG B CA  
4204 C C   . ARG B 183 ? 1.6081 3.1953 1.3212 0.7876  -0.2023 0.1631  107  ARG B C   
4205 O O   . ARG B 183 ? 1.5918 3.2396 1.3277 0.7843  -0.2340 0.1227  107  ARG B O   
4206 C CB  . ARG B 183 ? 1.6634 3.3575 1.2673 0.8825  -0.2233 0.1864  107  ARG B CB  
4207 N N   . TYR B 184 ? 1.5340 3.0438 1.2802 0.7469  -0.1773 0.1710  108  TYR B N   
4208 C CA  . TYR B 184 ? 1.4744 2.9570 1.2816 0.6970  -0.1807 0.1397  108  TYR B CA  
4209 C C   . TYR B 184 ? 1.5122 3.0144 1.3576 0.7046  -0.1877 0.1470  108  TYR B C   
4210 O O   . TYR B 184 ? 1.4925 3.0502 1.3659 0.6978  -0.2144 0.1098  108  TYR B O   
4211 C CB  . TYR B 184 ? 1.4734 2.9896 1.2959 0.6662  -0.2062 0.0783  108  TYR B CB  
4212 C CG  . TYR B 184 ? 1.4945 2.9712 1.2994 0.6429  -0.1949 0.0654  108  TYR B CG  
4213 C CD1 . TYR B 184 ? 1.5649 3.0667 1.3146 0.6698  -0.1982 0.0641  108  TYR B CD1 
4214 C CD2 . TYR B 184 ? 1.4593 2.8796 1.3031 0.5948  -0.1831 0.0505  108  TYR B CD2 
4215 C CE1 . TYR B 184 ? 1.5723 3.0403 1.3081 0.6495  -0.1877 0.0500  108  TYR B CE1 
4216 C CE2 . TYR B 184 ? 1.4669 2.8529 1.2975 0.5746  -0.1736 0.0381  108  TYR B CE2 
4217 C CZ  . TYR B 184 ? 1.6121 3.0219 1.3904 0.6015  -0.1757 0.0372  108  TYR B CZ  
4218 O OH  . TYR B 184 ? 1.6369 3.0140 1.4041 0.5828  -0.1655 0.0240  108  TYR B OH  
4219 N N   . ASP B 185 ? 1.4782 2.9350 1.3273 0.7193  -0.1628 0.1949  109  ASP B N   
4220 C CA  . ASP B 185 ? 1.4703 2.9360 1.3530 0.7308  -0.1638 0.2085  109  ASP B CA  
4221 C C   . ASP B 185 ? 1.4927 2.8779 1.4054 0.7090  -0.1347 0.2338  109  ASP B C   
4222 O O   . ASP B 185 ? 1.5024 2.8337 1.3956 0.7170  -0.1093 0.2715  109  ASP B O   
4223 C CB  . ASP B 185 ? 1.5507 3.0573 1.3996 0.7886  -0.1666 0.2458  109  ASP B CB  
4224 C CG  . ASP B 185 ? 1.7184 3.3168 1.5703 0.8111  -0.2018 0.2177  109  ASP B CG  
4225 O OD1 . ASP B 185 ? 1.7577 3.4090 1.5786 0.8207  -0.2240 0.1911  109  ASP B OD1 
4226 O OD2 . ASP B 185 ? 1.7811 3.4001 1.6679 0.8201  -0.2078 0.2210  109  ASP B OD2 
4227 N N   . TRP B 186 ? 1.4124 2.7910 1.3737 0.6826  -0.1381 0.2133  110  TRP B N   
4228 C CA  . TRP B 186 ? 1.3853 2.6910 1.3743 0.6634  -0.1130 0.2326  110  TRP B CA  
4229 C C   . TRP B 186 ? 1.4451 2.7560 1.4510 0.6940  -0.1076 0.2595  110  TRP B C   
4230 O O   . TRP B 186 ? 1.4309 2.7902 1.4637 0.6978  -0.1240 0.2397  110  TRP B O   
4231 C CB  . TRP B 186 ? 1.3175 2.6016 1.3447 0.6136  -0.1151 0.1950  110  TRP B CB  
4232 N N   . LEU B 187 ? 1.4212 2.6831 1.4142 0.7166  -0.0838 0.3052  111  LEU B N   
4233 C CA  . LEU B 187 ? 1.4378 2.6922 1.4454 0.7488  -0.0738 0.3371  111  LEU B CA  
4234 C C   . LEU B 187 ? 1.4510 2.6210 1.4856 0.7303  -0.0470 0.3540  111  LEU B C   
4235 O O   . LEU B 187 ? 1.4710 2.6180 1.5161 0.7572  -0.0330 0.3859  111  LEU B O   
4236 C CB  . LEU B 187 ? 1.4991 2.7734 1.4673 0.8002  -0.0688 0.3810  111  LEU B CB  
4237 C CG  . LEU B 187 ? 1.5913 2.9567 1.5329 0.8336  -0.0969 0.3709  111  LEU B CG  
4238 C CD1 . LEU B 187 ? 1.6527 3.0283 1.5417 0.8762  -0.0888 0.4120  111  LEU B CD1 
4239 C CD2 . LEU B 187 ? 1.6308 3.0429 1.6012 0.8564  -0.1109 0.3675  111  LEU B CD2 
4240 N N   . PHE B 188 ? 1.3529 2.4777 1.3993 0.6856  -0.0409 0.3317  112  PHE B N   
4241 C CA  . PHE B 188 ? 1.3283 2.3743 1.3982 0.6639  -0.0190 0.3410  112  PHE B CA  
4242 C C   . PHE B 188 ? 1.3210 2.3593 1.4272 0.6384  -0.0226 0.3107  112  PHE B C   
4243 O O   . PHE B 188 ? 1.3152 2.2968 1.4418 0.6310  -0.0066 0.3188  112  PHE B O   
4244 C CB  . PHE B 188 ? 1.3352 2.3360 1.3931 0.6339  -0.0094 0.3386  112  PHE B CB  
4245 N N   . GLY B 189 ? 1.2328 2.3276 1.3477 0.6258  -0.0428 0.2760  113  GLY B N   
4246 C CA  . GLY B 189 ? 1.1910 2.2863 1.3394 0.6028  -0.0448 0.2482  113  GLY B CA  
4247 C C   . GLY B 189 ? 1.1862 2.2814 1.3407 0.5590  -0.0521 0.2126  113  GLY B C   
4248 O O   . GLY B 189 ? 1.1762 2.2393 1.3129 0.5400  -0.0481 0.2126  113  GLY B O   
4249 N N   . PRO B 190 ? 1.1087 2.2384 1.2912 0.5426  -0.0608 0.1832  114  PRO B N   
4250 C CA  . PRO B 190 ? 1.0703 2.1996 1.2617 0.5013  -0.0660 0.1514  114  PRO B CA  
4251 C C   . PRO B 190 ? 1.1005 2.1575 1.2917 0.4720  -0.0495 0.1510  114  PRO B C   
4252 O O   . PRO B 190 ? 1.0719 2.1189 1.2620 0.4406  -0.0521 0.1321  114  PRO B O   
4253 C CB  . PRO B 190 ? 1.0762 2.2588 1.3031 0.4962  -0.0749 0.1271  114  PRO B CB  
4254 C CG  . PRO B 190 ? 1.1532 2.3392 1.3917 0.5277  -0.0676 0.1461  114  PRO B CG  
4255 C CD  . PRO B 190 ? 1.1324 2.3059 1.3420 0.5620  -0.0654 0.1792  114  PRO B CD  
4256 N N   . VAL B 191 ? 1.0643 2.0721 1.2578 0.4829  -0.0337 0.1706  115  VAL B N   
4257 C CA  . VAL B 191 ? 1.0462 1.9858 1.2393 0.4592  -0.0199 0.1701  115  VAL B CA  
4258 C C   . VAL B 191 ? 1.0679 1.9712 1.2384 0.4539  -0.0164 0.1853  115  VAL B C   
4259 O O   . VAL B 191 ? 1.0411 1.9158 1.2078 0.4246  -0.0151 0.1734  115  VAL B O   
4260 C CB  . VAL B 191 ? 1.1175 2.0186 1.3235 0.4734  -0.0060 0.1812  115  VAL B CB  
4261 C CG1 . VAL B 191 ? 1.1087 1.9446 1.3141 0.4479  0.0044  0.1747  115  VAL B CG1 
4262 C CG2 . VAL B 191 ? 1.1113 2.0544 1.3401 0.4826  -0.0082 0.1674  115  VAL B CG2 
4263 N N   . MET B 192 ? 1.0317 1.9409 1.1874 0.4834  -0.0145 0.2125  116  MET B N   
4264 C CA  . MET B 192 ? 1.0288 1.9105 1.1636 0.4833  -0.0086 0.2311  116  MET B CA  
4265 C C   . MET B 192 ? 1.0347 1.9454 1.1546 0.4636  -0.0208 0.2107  116  MET B C   
4266 O O   . MET B 192 ? 1.0235 1.9023 1.1321 0.4496  -0.0150 0.2155  116  MET B O   
4267 C CB  . MET B 192 ? 1.0974 1.9908 1.2180 0.5235  -0.0033 0.2660  116  MET B CB  
4268 N N   . CYS B 193 ? 0.9656 1.9369 1.0893 0.4628  -0.0375 0.1869  117  CYS B N   
4269 C CA  . CYS B 193 ? 0.9387 1.9421 1.0542 0.4443  -0.0512 0.1618  117  CYS B CA  
4270 C C   . CYS B 193 ? 0.9465 1.9108 1.0737 0.4040  -0.0468 0.1423  117  CYS B C   
4271 O O   . CYS B 193 ? 0.9359 1.8897 1.0508 0.3883  -0.0483 0.1352  117  CYS B O   
4272 C CB  . CYS B 193 ? 0.9369 2.0130 1.0644 0.4521  -0.0702 0.1393  117  CYS B CB  
4273 S SG  . CYS B 193 ? 0.9693 2.0883 1.0933 0.4303  -0.0891 0.1031  117  CYS B SG  
4274 N N   . LYS B 194 ? 0.8756 1.8169 1.0243 0.3899  -0.0403 0.1355  118  LYS B N   
4275 C CA  . LYS B 194 ? 0.8419 1.7452 0.9990 0.3557  -0.0352 0.1206  118  LYS B CA  
4276 C C   . LYS B 194 ? 0.9048 1.7439 1.0520 0.3508  -0.0225 0.1390  118  LYS B C   
4277 O O   . LYS B 194 ? 0.8954 1.7094 1.0381 0.3281  -0.0216 0.1321  118  LYS B O   
4278 C CB  . LYS B 194 ? 0.8443 1.7517 1.0244 0.3455  -0.0323 0.1068  118  LYS B CB  
4279 C CG  . LYS B 194 ? 0.8411 1.8022 1.0407 0.3326  -0.0428 0.0813  118  LYS B CG  
4280 C CD  . LYS B 194 ? 0.8678 1.8232 1.0889 0.3154  -0.0351 0.0689  118  LYS B CD  
4281 C CE  . LYS B 194 ? 0.9174 1.9304 1.1674 0.3058  -0.0428 0.0469  118  LYS B CE  
4282 N NZ  . LYS B 194 ? 1.0127 2.0423 1.2674 0.2835  -0.0524 0.0286  118  LYS B NZ  
4283 N N   . VAL B 195 ? 0.8769 1.6899 1.0249 0.3721  -0.0129 0.1618  119  VAL B N   
4284 C CA  . VAL B 195 ? 0.8776 1.6298 1.0253 0.3689  -0.0007 0.1790  119  VAL B CA  
4285 C C   . VAL B 195 ? 0.9199 1.6621 1.0524 0.3702  0.0022  0.1943  119  VAL B C   
4286 O O   . VAL B 195 ? 0.9073 1.6167 1.0405 0.3480  0.0048  0.1899  119  VAL B O   
4287 C CB  . VAL B 195 ? 0.9510 1.6800 1.1091 0.3928  0.0091  0.1983  119  VAL B CB  
4288 C CG1 . VAL B 195 ? 0.9618 1.6311 1.1252 0.3906  0.0212  0.2170  119  VAL B CG1 
4289 C CG2 . VAL B 195 ? 0.9424 1.6709 1.1151 0.3885  0.0091  0.1810  119  VAL B CG2 
4290 N N   . PHE B 196 ? 0.8847 1.6567 1.0030 0.3976  0.0022  0.2127  120  PHE B N   
4291 C CA  . PHE B 196 ? 0.8887 1.6550 0.9896 0.4034  0.0077  0.2298  120  PHE B CA  
4292 C C   . PHE B 196 ? 0.9093 1.7034 0.9969 0.3856  -0.0034 0.2065  120  PHE B C   
4293 O O   . PHE B 196 ? 0.9042 1.6818 0.9819 0.3797  0.0023  0.2134  120  PHE B O   
4294 C CB  . PHE B 196 ? 0.9464 1.7367 1.0321 0.4418  0.0127  0.2592  120  PHE B CB  
4295 N N   . GLY B 197 ? 0.8428 1.6767 0.9346 0.3766  -0.0178 0.1787  121  GLY B N   
4296 C CA  . GLY B 197 ? 0.8198 1.6780 0.9063 0.3574  -0.0288 0.1523  121  GLY B CA  
4297 C C   . GLY B 197 ? 0.8279 1.6419 0.9244 0.3248  -0.0241 0.1419  121  GLY B C   
4298 O O   . GLY B 197 ? 0.8197 1.6281 0.9068 0.3148  -0.0242 0.1368  121  GLY B O   
4299 N N   . SER B 198 ? 0.7636 1.5465 0.8778 0.3105  -0.0197 0.1392  122  SER B N   
4300 C CA  . SER B 198 ? 0.7412 1.4819 0.8640 0.2822  -0.0160 0.1309  122  SER B CA  
4301 C C   . SER B 198 ? 0.7942 1.4891 0.9148 0.2829  -0.0055 0.1518  122  SER B C   
4302 O O   . SER B 198 ? 0.7607 1.4339 0.8820 0.2643  -0.0047 0.1466  122  SER B O   
4303 C CB  . SER B 198 ? 0.7703 1.4970 0.9079 0.2720  -0.0149 0.1220  122  SER B CB  
4304 O OG  . SER B 198 ? 0.8908 1.6625 1.0362 0.2723  -0.0223 0.1052  122  SER B OG  
4305 N N   . PHE B 199 ? 0.7844 1.4645 0.9066 0.3042  0.0032  0.1757  123  PHE B N   
4306 C CA  . PHE B 199 ? 0.7959 1.4335 0.9243 0.3060  0.0151  0.1979  123  PHE B CA  
4307 C C   . PHE B 199 ? 0.8455 1.4921 0.9607 0.3072  0.0183  0.2053  123  PHE B C   
4308 O O   . PHE B 199 ? 0.8243 1.4390 0.9481 0.2937  0.0243  0.2104  123  PHE B O   
4309 C CB  . PHE B 199 ? 0.8465 1.4727 0.9816 0.3319  0.0250  0.2236  123  PHE B CB  
4310 C CG  . PHE B 199 ? 0.8842 1.4620 1.0369 0.3314  0.0386  0.2457  123  PHE B CG  
4311 C CD1 . PHE B 199 ? 0.9168 1.4511 1.0913 0.3129  0.0387  0.2369  123  PHE B CD1 
4312 C CD2 . PHE B 199 ? 0.9397 1.5171 1.0889 0.3507  0.0517  0.2754  123  PHE B CD2 
4313 C CE1 . PHE B 199 ? 0.9424 1.4339 1.1405 0.3109  0.0498  0.2545  123  PHE B CE1 
4314 C CE2 . PHE B 199 ? 0.9905 1.5237 1.1640 0.3488  0.0661  0.2968  123  PHE B CE2 
4315 C CZ  . PHE B 199 ? 0.9564 1.4470 1.1571 0.3279  0.0642  0.2849  123  PHE B CZ  
4316 N N   . LEU B 200 ? 0.8250 1.5176 0.9195 0.3234  0.0132  0.2031  124  LEU B N   
4317 C CA  . LEU B 200 ? 0.8393 1.5486 0.9152 0.3284  0.0152  0.2060  124  LEU B CA  
4318 C C   . LEU B 200 ? 0.8745 1.5738 0.9548 0.2996  0.0095  0.1821  124  LEU B C   
4319 O O   . LEU B 200 ? 0.8676 1.5469 0.9478 0.2944  0.0177  0.1903  124  LEU B O   
4320 C CB  . LEU B 200 ? 0.8590 1.6251 0.9106 0.3519  0.0060  0.2008  124  LEU B CB  
4321 C CG  . LEU B 200 ? 0.9356 1.7280 0.9624 0.3589  0.0046  0.1954  124  LEU B CG  
4322 C CD1 . LEU B 200 ? 0.9741 1.7576 0.9854 0.3837  0.0222  0.2308  124  LEU B CD1 
4323 C CD2 . LEU B 200 ? 0.9812 1.8323 0.9911 0.3709  -0.0129 0.1729  124  LEU B CD2 
4324 N N   . THR B 201 ? 0.8167 1.5293 0.9038 0.2818  -0.0029 0.1545  125  THR B N   
4325 C CA  . THR B 201 ? 0.7920 1.4965 0.8855 0.2550  -0.0084 0.1316  125  THR B CA  
4326 C C   . THR B 201 ? 0.8271 1.4808 0.9370 0.2358  -0.0021 0.1379  125  THR B C   
4327 O O   . THR B 201 ? 0.8246 1.4630 0.9366 0.2224  -0.0006 0.1334  125  THR B O   
4328 C CB  . THR B 201 ? 0.8463 1.5800 0.9472 0.2438  -0.0206 0.1051  125  THR B CB  
4329 O OG1 . THR B 201 ? 0.7857 1.5691 0.8747 0.2637  -0.0285 0.0994  125  THR B OG1 
4330 C CG2 . THR B 201 ? 0.8307 1.5598 0.9395 0.2185  -0.0253 0.0823  125  THR B CG2 
4331 N N   . LEU B 202 ? 0.7676 1.3969 0.8892 0.2362  0.0008  0.1471  126  LEU B N   
4332 C CA  . LEU B 202 ? 0.7484 1.3329 0.8855 0.2205  0.0038  0.1504  126  LEU B CA  
4333 C C   . LEU B 202 ? 0.7774 1.3376 0.9213 0.2218  0.0130  0.1683  126  LEU B C   
4334 O O   . LEU B 202 ? 0.7547 1.2908 0.9089 0.2044  0.0119  0.1636  126  LEU B O   
4335 C CB  . LEU B 202 ? 0.7570 1.3245 0.9034 0.2271  0.0054  0.1563  126  LEU B CB  
4336 C CG  . LEU B 202 ? 0.8106 1.3385 0.9702 0.2106  0.0035  0.1505  126  LEU B CG  
4337 C CD1 . LEU B 202 ? 0.8135 1.3425 0.9729 0.2122  0.0003  0.1401  126  LEU B CD1 
4338 C CD2 . LEU B 202 ? 0.8587 1.3513 1.0357 0.2144  0.0107  0.1683  126  LEU B CD2 
4339 N N   . ASN B 203 ? 0.7417 1.3091 0.8815 0.2433  0.0228  0.1904  127  ASN B N   
4340 C CA  . ASN B 203 ? 0.7362 1.2838 0.8861 0.2473  0.0355  0.2119  127  ASN B CA  
4341 C C   . ASN B 203 ? 0.7577 1.3257 0.8925 0.2485  0.0380  0.2090  127  ASN B C   
4342 O O   . ASN B 203 ? 0.7450 1.2945 0.8921 0.2438  0.0470  0.2198  127  ASN B O   
4343 C CB  . ASN B 203 ? 0.7527 1.2970 0.9062 0.2713  0.0484  0.2405  127  ASN B CB  
4344 C CG  . ASN B 203 ? 0.9553 1.4684 1.1317 0.2690  0.0487  0.2444  127  ASN B CG  
4345 O OD1 . ASN B 203 ? 0.8396 1.3627 1.0108 0.2832  0.0473  0.2465  127  ASN B OD1 
4346 N ND2 . ASN B 203 ? 0.8733 1.3492 1.0762 0.2514  0.0491  0.2427  127  ASN B ND2 
4347 N N   . MET B 204 ? 0.7073 1.3140 0.8182 0.2549  0.0301  0.1930  128  MET B N   
4348 C CA  . MET B 204 ? 0.7094 1.3364 0.8043 0.2564  0.0307  0.1843  128  MET B CA  
4349 C C   . MET B 204 ? 0.7269 1.3323 0.8362 0.2298  0.0257  0.1661  128  MET B C   
4350 O O   . MET B 204 ? 0.7165 1.3118 0.8294 0.2275  0.0334  0.1712  128  MET B O   
4351 C CB  . MET B 204 ? 0.7488 1.4231 0.8185 0.2690  0.0203  0.1668  128  MET B CB  
4352 C CG  . MET B 204 ? 0.8049 1.5009 0.8569 0.2718  0.0195  0.1527  128  MET B CG  
4353 S SD  . MET B 204 ? 0.8609 1.5997 0.9027 0.2656  -0.0007 0.1125  128  MET B SD  
4354 C CE  . MET B 204 ? 0.7895 1.4953 0.8620 0.2289  -0.0069 0.0934  128  MET B CE  
4355 N N   . PHE B 205 ? 0.6633 1.2607 0.7819 0.2114  0.0145  0.1479  129  PHE B N   
4356 C CA  . PHE B 205 ? 0.6491 1.2249 0.7806 0.1877  0.0098  0.1335  129  PHE B CA  
4357 C C   . PHE B 205 ? 0.6964 1.2340 0.8485 0.1799  0.0154  0.1488  129  PHE B C   
4358 O O   . PHE B 205 ? 0.6967 1.2212 0.8575 0.1697  0.0168  0.1462  129  PHE B O   
4359 C CB  . PHE B 205 ? 0.6637 1.2423 0.7983 0.1731  -0.0007 0.1146  129  PHE B CB  
4360 C CG  . PHE B 205 ? 0.6905 1.3023 0.8170 0.1703  -0.0079 0.0921  129  PHE B CG  
4361 C CD1 . PHE B 205 ? 0.7407 1.3557 0.8670 0.1622  -0.0087 0.0783  129  PHE B CD1 
4362 C CD2 . PHE B 205 ? 0.7212 1.3610 0.8448 0.1750  -0.0141 0.0829  129  PHE B CD2 
4363 C CE1 . PHE B 205 ? 0.7594 1.4036 0.8839 0.1580  -0.0163 0.0540  129  PHE B CE1 
4364 C CE2 . PHE B 205 ? 0.7631 1.4354 0.8867 0.1704  -0.0220 0.0596  129  PHE B CE2 
4365 C CZ  . PHE B 205 ? 0.7458 1.4193 0.8705 0.1614  -0.0234 0.0445  129  PHE B CZ  
4366 N N   . ALA B 206 ? 0.6469 1.1675 0.8098 0.1852  0.0182  0.1634  130  ALA B N   
4367 C CA  . ALA B 206 ? 0.6409 1.1270 0.8290 0.1778  0.0217  0.1755  130  ALA B CA  
4368 C C   . ALA B 206 ? 0.7134 1.1967 0.9121 0.1844  0.0347  0.1932  130  ALA B C   
4369 O O   . ALA B 206 ? 0.6995 1.1612 0.9211 0.1731  0.0355  0.1961  130  ALA B O   
4370 C CB  . ALA B 206 ? 0.6579 1.1287 0.8567 0.1846  0.0229  0.1854  130  ALA B CB  
4371 N N   . SER B 207 ? 0.7006 1.2086 0.8820 0.2039  0.0450  0.2047  131  SER B N   
4372 C CA  . SER B 207 ? 0.7115 1.2227 0.8973 0.2138  0.0605  0.2225  131  SER B CA  
4373 C C   . SER B 207 ? 0.7332 1.2507 0.9139 0.2038  0.0575  0.2060  131  SER B C   
4374 O O   . SER B 207 ? 0.7239 1.2281 0.9248 0.1995  0.0659  0.2151  131  SER B O   
4375 C CB  . SER B 207 ? 0.7894 1.3288 0.9501 0.2406  0.0715  0.2386  131  SER B CB  
4376 O OG  . SER B 207 ? 0.9119 1.4602 1.0689 0.2522  0.0874  0.2535  131  SER B OG  
4377 N N   . ILE B 208 ? 0.6711 1.2085 0.8292 0.1998  0.0460  0.1813  132  ILE B N   
4378 C CA  . ILE B 208 ? 0.6566 1.1989 0.8104 0.1904  0.0424  0.1619  132  ILE B CA  
4379 C C   . ILE B 208 ? 0.6742 1.1860 0.8533 0.1684  0.0360  0.1561  132  ILE B C   
4380 O O   . ILE B 208 ? 0.6644 1.1680 0.8549 0.1640  0.0406  0.1560  132  ILE B O   
4381 C CB  . ILE B 208 ? 0.6974 1.2671 0.8282 0.1900  0.0310  0.1358  132  ILE B CB  
4382 C CG1 . ILE B 208 ? 0.7263 1.3322 0.8294 0.2144  0.0344  0.1390  132  ILE B CG1 
4383 C CG2 . ILE B 208 ? 0.7093 1.2778 0.8419 0.1783  0.0276  0.1145  132  ILE B CG2 
4384 C CD1 . ILE B 208 ? 0.8025 1.4392 0.8901 0.2147  0.0200  0.1148  132  ILE B CD1 
4385 N N   . PHE B 209 ? 0.6065 1.1035 0.7930 0.1567  0.0256  0.1516  133  PHE B N   
4386 C CA  . PHE B 209 ? 0.5853 1.0565 0.7896 0.1386  0.0172  0.1457  133  PHE B CA  
4387 C C   . PHE B 209 ? 0.6422 1.0915 0.8751 0.1367  0.0218  0.1625  133  PHE B C   
4388 O O   . PHE B 209 ? 0.6378 1.0712 0.8864 0.1249  0.0160  0.1584  133  PHE B O   
4389 C CB  . PHE B 209 ? 0.5962 1.0612 0.7953 0.1303  0.0061  0.1365  133  PHE B CB  
4390 C CG  . PHE B 209 ? 0.6025 1.0883 0.7827 0.1280  0.0009  0.1192  133  PHE B CG  
4391 C CD1 . PHE B 209 ? 0.6329 1.1389 0.8035 0.1293  0.0024  0.1069  133  PHE B CD1 
4392 C CD2 . PHE B 209 ? 0.6181 1.1037 0.7934 0.1241  -0.0055 0.1134  133  PHE B CD2 
4393 C CE1 . PHE B 209 ? 0.6394 1.1659 0.8007 0.1253  -0.0032 0.0891  133  PHE B CE1 
4394 C CE2 . PHE B 209 ? 0.6462 1.1532 0.8110 0.1209  -0.0090 0.0982  133  PHE B CE2 
4395 C CZ  . PHE B 209 ? 0.6206 1.1483 0.7809 0.1206  -0.0083 0.0859  133  PHE B CZ  
4396 N N   . PHE B 210 ? 0.6064 1.0556 0.8494 0.1487  0.0324  0.1818  134  PHE B N   
4397 C CA  . PHE B 210 ? 0.6050 1.0352 0.8838 0.1457  0.0382  0.1976  134  PHE B CA  
4398 C C   . PHE B 210 ? 0.6930 1.1325 0.9804 0.1519  0.0523  0.2074  134  PHE B C   
4399 O O   . PHE B 210 ? 0.6929 1.1195 1.0134 0.1450  0.0544  0.2146  134  PHE B O   
4400 C CB  . PHE B 210 ? 0.6307 1.0508 0.9258 0.1532  0.0446  0.2147  134  PHE B CB  
4401 C CG  . PHE B 210 ? 0.6375 1.0370 0.9425 0.1431  0.0301  0.2049  134  PHE B CG  
4402 C CD1 . PHE B 210 ? 0.6603 1.0407 0.9891 0.1279  0.0177  0.1959  134  PHE B CD1 
4403 C CD2 . PHE B 210 ? 0.6583 1.0591 0.9488 0.1509  0.0287  0.2043  134  PHE B CD2 
4404 C CE1 . PHE B 210 ? 0.6655 1.0288 0.9984 0.1209  0.0036  0.1843  134  PHE B CE1 
4405 C CE2 . PHE B 210 ? 0.6881 1.0702 0.9853 0.1434  0.0162  0.1931  134  PHE B CE2 
4406 C CZ  . PHE B 210 ? 0.6587 1.0222 0.9753 0.1286  0.0037  0.1824  134  PHE B CZ  
4407 N N   . ILE B 211 ? 0.6727 1.1365 0.9309 0.1652  0.0608  0.2053  135  ILE B N   
4408 C CA  . ILE B 211 ? 0.6860 1.1615 0.9451 0.1736  0.0748  0.2107  135  ILE B CA  
4409 C C   . ILE B 211 ? 0.7222 1.1875 0.9918 0.1587  0.0654  0.1936  135  ILE B C   
4410 O O   . ILE B 211 ? 0.7226 1.1836 1.0155 0.1583  0.0736  0.2009  135  ILE B O   
4411 C CB  . ILE B 211 ? 0.7464 1.2524 0.9658 0.1930  0.0827  0.2073  135  ILE B CB  
4412 C CG1 . ILE B 211 ? 0.7789 1.2953 0.9924 0.2131  0.0983  0.2337  135  ILE B CG1 
4413 C CG2 . ILE B 211 ? 0.7587 1.2769 0.9699 0.1988  0.0910  0.1989  135  ILE B CG2 
4414 C CD1 . ILE B 211 ? 0.9271 1.4757 1.0961 0.2331  0.0985  0.2283  135  ILE B CD1 
4415 N N   . THR B 212 ? 0.6628 1.1241 0.9176 0.1471  0.0492  0.1728  136  THR B N   
4416 C CA  . THR B 212 ? 0.6491 1.0984 0.9105 0.1333  0.0393  0.1574  136  THR B CA  
4417 C C   . THR B 212 ? 0.7196 1.1467 1.0149 0.1225  0.0329  0.1660  136  THR B C   
4418 O O   . THR B 212 ? 0.7214 1.1426 1.0353 0.1194  0.0342  0.1661  136  THR B O   
4419 C CB  . THR B 212 ? 0.6417 1.0932 0.8810 0.1251  0.0268  0.1382  136  THR B CB  
4420 O OG1 . THR B 212 ? 0.6334 1.1100 0.8464 0.1361  0.0310  0.1297  136  THR B OG1 
4421 C CG2 . THR B 212 ? 0.5977 1.0375 0.8418 0.1130  0.0200  0.1243  136  THR B CG2 
4422 N N   . CYS B 213 ? 0.6842 1.1006 0.9893 0.1185  0.0259  0.1723  137  CYS B N   
4423 C CA  . CYS B 213 ? 0.6830 1.0811 1.0212 0.1092  0.0169  0.1774  137  CYS B CA  
4424 C C   . CYS B 213 ? 0.7382 1.1378 1.1123 0.1131  0.0292  0.1930  137  CYS B C   
4425 O O   . CYS B 213 ? 0.7174 1.1096 1.1182 0.1061  0.0227  0.1923  137  CYS B O   
4426 C CB  . CYS B 213 ? 0.6931 1.0818 1.0346 0.1077  0.0103  0.1798  137  CYS B CB  
4427 S SG  . CYS B 213 ? 0.7421 1.1267 1.0498 0.1013  -0.0056 0.1615  137  CYS B SG  
4428 N N   . MET B 214 ? 0.7295 1.1410 1.1042 0.1258  0.0478  0.2083  138  MET B N   
4429 C CA  . MET B 214 ? 0.7472 1.1638 1.1552 0.1322  0.0654  0.2272  138  MET B CA  
4430 C C   . MET B 214 ? 0.8042 1.2292 1.2145 0.1344  0.0711  0.2225  138  MET B C   
4431 O O   . MET B 214 ? 0.7990 1.2225 1.2491 0.1324  0.0767  0.2322  138  MET B O   
4432 C CB  . MET B 214 ? 0.7969 1.2267 1.1934 0.1490  0.0864  0.2459  138  MET B CB  
4433 C CG  . MET B 214 ? 0.8572 1.2745 1.2802 0.1482  0.0894  0.2619  138  MET B CG  
4434 S SD  . MET B 214 ? 0.9180 1.3160 1.4113 0.1322  0.0839  0.2685  138  MET B SD  
4435 C CE  . MET B 214 ? 0.8843 1.2987 1.4082 0.1406  0.1091  0.2881  138  MET B CE  
4436 N N   . SER B 215 ? 0.7660 1.1996 1.1376 0.1385  0.0698  0.2067  139  SER B N   
4437 C CA  . SER B 215 ? 0.7674 1.2063 1.1386 0.1415  0.0751  0.1986  139  SER B CA  
4438 C C   . SER B 215 ? 0.7909 1.2132 1.1836 0.1276  0.0587  0.1895  139  SER B C   
4439 O O   . SER B 215 ? 0.7899 1.2126 1.2070 0.1294  0.0642  0.1925  139  SER B O   
4440 C CB  . SER B 215 ? 0.8288 1.2806 1.1561 0.1491  0.0769  0.1811  139  SER B CB  
4441 O OG  . SER B 215 ? 0.9545 1.4273 1.2654 0.1677  0.0961  0.1900  139  SER B OG  
4442 N N   . VAL B 216 ? 0.7279 1.1369 1.1112 0.1159  0.0396  0.1801  140  VAL B N   
4443 C CA  . VAL B 216 ? 0.7187 1.1126 1.1159 0.1049  0.0227  0.1736  140  VAL B CA  
4444 C C   . VAL B 216 ? 0.7803 1.1704 1.2237 0.1014  0.0181  0.1857  140  VAL B C   
4445 O O   . VAL B 216 ? 0.7739 1.1604 1.2403 0.0991  0.0118  0.1855  140  VAL B O   
4446 C CB  . VAL B 216 ? 0.7573 1.1411 1.1280 0.0960  0.0062  0.1621  140  VAL B CB  
4447 C CG1 . VAL B 216 ? 0.7524 1.1218 1.1342 0.0878  -0.0106 0.1589  140  VAL B CG1 
4448 C CG2 . VAL B 216 ? 0.7561 1.1460 1.0905 0.0975  0.0104  0.1487  140  VAL B CG2 
4449 N N   . ASP B 217 ? 0.7500 1.1414 1.2103 0.1015  0.0214  0.1961  141  ASP B N   
4450 C CA  . ASP B 217 ? 0.7574 1.1462 1.2686 0.0966  0.0171  0.2058  141  ASP B CA  
4451 C C   . ASP B 217 ? 0.8110 1.2121 1.3590 0.1030  0.0345  0.2190  141  ASP B C   
4452 O O   . ASP B 217 ? 0.7902 1.1917 1.3771 0.0984  0.0259  0.2198  141  ASP B O   
4453 C CB  . ASP B 217 ? 0.7904 1.1749 1.3125 0.0953  0.0194  0.2133  141  ASP B CB  
4454 C CG  . ASP B 217 ? 0.9421 1.3176 1.5104 0.0850  0.0035  0.2121  141  ASP B CG  
4455 O OD1 . ASP B 217 ? 0.9422 1.3079 1.4990 0.0777  -0.0198 0.1969  141  ASP B OD1 
4456 O OD2 . ASP B 217 ? 1.0405 1.4197 1.6574 0.0846  0.0144  0.2260  141  ASP B OD2 
4457 N N   . ARG B 218 ? 0.7821 1.1957 1.3161 0.1154  0.0589  0.2288  142  ARG B N   
4458 C CA  . ARG B 218 ? 0.7870 1.2149 1.3483 0.1250  0.0803  0.2419  142  ARG B CA  
4459 C C   . ARG B 218 ? 0.8494 1.2776 1.4120 0.1258  0.0750  0.2310  142  ARG B C   
4460 O O   . ARG B 218 ? 0.8469 1.2833 1.4510 0.1286  0.0831  0.2397  142  ARG B O   
4461 C CB  . ARG B 218 ? 0.7977 1.2399 1.3282 0.1413  0.1057  0.2513  142  ARG B CB  
4462 C CG  . ARG B 218 ? 0.9582 1.4032 1.5059 0.1454  0.1205  0.2730  142  ARG B CG  
4463 C CD  . ARG B 218 ? 1.0947 1.5569 1.6070 0.1653  0.1457  0.2847  142  ARG B CD  
4464 N NE  . ARG B 218 ? 1.2080 1.6736 1.7478 0.1719  0.1665  0.3130  142  ARG B NE  
4465 C CZ  . ARG B 218 ? 1.4281 1.9106 1.9489 0.1920  0.1938  0.3323  142  ARG B CZ  
4466 N NH1 . ARG B 218 ? 1.2915 1.7911 1.7637 0.2078  0.2015  0.3226  142  ARG B NH1 
4467 N NH2 . ARG B 218 ? 1.2668 1.7492 1.8176 0.1972  0.2138  0.3614  142  ARG B NH2 
4468 N N   . TYR B 219 ? 0.8157 1.2347 1.3375 0.1233  0.0624  0.2129  143  TYR B N   
4469 C CA  . TYR B 219 ? 0.8235 1.2378 1.3456 0.1239  0.0571  0.2027  143  TYR B CA  
4470 C C   . TYR B 219 ? 0.8814 1.2871 1.4376 0.1143  0.0359  0.2034  143  TYR B C   
4471 O O   . TYR B 219 ? 0.8842 1.2931 1.4700 0.1179  0.0368  0.2061  143  TYR B O   
4472 C CB  . TYR B 219 ? 0.8487 1.2546 1.3220 0.1231  0.0519  0.1845  143  TYR B CB  
4473 C CG  . TYR B 219 ? 0.8877 1.2814 1.3638 0.1211  0.0434  0.1750  143  TYR B CG  
4474 C CD1 . TYR B 219 ? 0.9265 1.3241 1.4135 0.1312  0.0572  0.1727  143  TYR B CD1 
4475 C CD2 . TYR B 219 ? 0.8973 1.2752 1.3652 0.1110  0.0231  0.1695  143  TYR B CD2 
4476 C CE1 . TYR B 219 ? 0.9527 1.3363 1.4456 0.1305  0.0506  0.1655  143  TYR B CE1 
4477 C CE2 . TYR B 219 ? 0.9175 1.2827 1.3890 0.1109  0.0170  0.1648  143  TYR B CE2 
4478 C CZ  . TYR B 219 ? 1.0544 1.4213 1.5399 0.1203  0.0307  0.1629  143  TYR B CZ  
4479 O OH  . TYR B 219 ? 1.1258 1.4774 1.6173 0.1213  0.0257  0.1596  143  TYR B OH  
4480 N N   . GLN B 220 ? 0.8383 1.2347 1.3893 0.1040  0.0166  0.2000  144  GLN B N   
4481 C CA  . GLN B 220 ? 0.8352 1.2254 1.4110 0.0962  -0.0074 0.1979  144  GLN B CA  
4482 C C   . GLN B 220 ? 0.8813 1.2840 1.5194 0.0959  -0.0063 0.2090  144  GLN B C   
4483 O O   . GLN B 220 ? 0.8711 1.2762 1.5374 0.0950  -0.0213 0.2080  144  GLN B O   
4484 C CB  . GLN B 220 ? 0.8515 1.2318 1.4059 0.0877  -0.0245 0.1907  144  GLN B CB  
4485 C CG  . GLN B 220 ? 1.0368 1.4069 1.5768 0.0833  -0.0493 0.1815  144  GLN B CG  
4486 C CD  . GLN B 220 ? 1.2913 1.6518 1.7989 0.0777  -0.0626 0.1725  144  GLN B CD  
4487 O OE1 . GLN B 220 ? 1.2647 1.6245 1.7542 0.0769  -0.0533 0.1716  144  GLN B OE1 
4488 N NE2 . GLN B 220 ? 1.1354 1.4895 1.6322 0.0757  -0.0843 0.1660  144  GLN B NE2 
4489 N N   . SER B 221 ? 0.8407 1.2527 1.5023 0.0975  0.0121  0.2208  145  SER B N   
4490 C CA  . SER B 221 ? 0.8349 1.2602 1.5624 0.0961  0.0183  0.2335  145  SER B CA  
4491 C C   . SER B 221 ? 0.8990 1.3391 1.6511 0.1066  0.0368  0.2423  145  SER B C   
4492 O O   . SER B 221 ? 0.8895 1.3415 1.6984 0.1050  0.0326  0.2478  145  SER B O   
4493 C CB  . SER B 221 ? 0.8627 1.2900 1.6052 0.0950  0.0353  0.2462  145  SER B CB  
4494 O OG  . SER B 221 ? 0.9357 1.3698 1.6493 0.1075  0.0639  0.2564  145  SER B OG  
4495 N N   . VAL B 222 ? 0.8680 1.3089 1.5789 0.1180  0.0564  0.2415  146  VAL B N   
4496 C CA  . VAL B 222 ? 0.8749 1.3282 1.5992 0.1308  0.0766  0.2466  146  VAL B CA  
4497 C C   . VAL B 222 ? 0.9371 1.3865 1.6770 0.1308  0.0593  0.2384  146  VAL B C   
4498 O O   . VAL B 222 ? 0.9453 1.4083 1.7274 0.1380  0.0689  0.2460  146  VAL B O   
4499 C CB  . VAL B 222 ? 0.9330 1.3866 1.6022 0.1432  0.0976  0.2418  146  VAL B CB  
4500 C CG1 . VAL B 222 ? 0.9370 1.3898 1.5942 0.1534  0.1036  0.2314  146  VAL B CG1 
4501 C CG2 . VAL B 222 ? 0.9413 1.4113 1.6177 0.1530  0.1265  0.2593  146  VAL B CG2 
4502 N N   . ILE B 223 ? 0.8927 1.3249 1.6014 0.1240  0.0348  0.2254  147  ILE B N   
4503 C CA  . ILE B 223 ? 0.8931 1.3197 1.6121 0.1259  0.0181  0.2207  147  ILE B CA  
4504 C C   . ILE B 223 ? 0.9418 1.3766 1.7082 0.1188  -0.0066 0.2241  147  ILE B C   
4505 O O   . ILE B 223 ? 0.9367 1.3833 1.7460 0.1245  -0.0102 0.2292  147  ILE B O   
4506 C CB  . ILE B 223 ? 0.9353 1.3398 1.5985 0.1239  0.0066  0.2079  147  ILE B CB  
4507 C CG1 . ILE B 223 ? 0.9415 1.3393 1.5576 0.1279  0.0262  0.1995  147  ILE B CG1 
4508 C CG2 . ILE B 223 ? 0.9587 1.3557 1.6320 0.1295  -0.0048 0.2072  147  ILE B CG2 
4509 C CD1 . ILE B 223 ? 0.9919 1.3968 1.6127 0.1417  0.0513  0.1984  147  ILE B CD1 
4510 N N   . TYR B 224 ? 0.9022 1.3314 1.6595 0.1076  -0.0252 0.2191  148  TYR B N   
4511 C CA  . TYR B 224 ? 0.9035 1.3397 1.6979 0.1007  -0.0532 0.2163  148  TYR B CA  
4512 C C   . TYR B 224 ? 0.9842 1.4262 1.8107 0.0900  -0.0556 0.2169  148  TYR B C   
4513 O O   . TYR B 224 ? 0.9771 1.4059 1.7675 0.0845  -0.0552 0.2119  148  TYR B O   
4514 C CB  . TYR B 224 ? 0.9143 1.3353 1.6649 0.0988  -0.0809 0.2051  148  TYR B CB  
4515 C CG  . TYR B 224 ? 0.9228 1.3256 1.6162 0.1044  -0.0738 0.2025  148  TYR B CG  
4516 C CD1 . TYR B 224 ? 0.9379 1.3279 1.5836 0.1012  -0.0603 0.1978  148  TYR B CD1 
4517 C CD2 . TYR B 224 ? 0.9408 1.3388 1.6295 0.1125  -0.0830 0.2043  148  TYR B CD2 
4518 C CE1 . TYR B 224 ? 0.9460 1.3205 1.5469 0.1043  -0.0542 0.1935  148  TYR B CE1 
4519 C CE2 . TYR B 224 ? 0.9568 1.3352 1.5992 0.1161  -0.0755 0.2022  148  TYR B CE2 
4520 C CZ  . TYR B 224 ? 1.0309 1.3981 1.6318 0.1109  -0.0610 0.1958  148  TYR B CZ  
4521 O OH  . TYR B 224 ? 1.0505 1.3996 1.6131 0.1125  -0.0542 0.1919  148  TYR B OH  
4522 N N   . PRO B 225 ? 0.9695 1.4303 1.8668 0.0862  -0.0611 0.2215  149  PRO B N   
4523 C CA  . PRO B 225 ? 0.9742 1.4371 1.9086 0.0743  -0.0653 0.2202  149  PRO B CA  
4524 C C   . PRO B 225 ? 1.0477 1.5085 1.9877 0.0664  -0.1044 0.2020  149  PRO B C   
4525 O O   . PRO B 225 ? 1.0442 1.5197 2.0485 0.0590  -0.1194 0.1977  149  PRO B O   
4526 C CB  . PRO B 225 ? 0.9920 1.4778 2.0048 0.0745  -0.0472 0.2350  149  PRO B CB  
4527 C CG  . PRO B 225 ? 1.0461 1.5456 2.0697 0.0859  -0.0479 0.2382  149  PRO B CG  
4528 C CD  . PRO B 225 ? 0.9922 1.4740 1.9450 0.0923  -0.0630 0.2277  149  PRO B CD  
4529 N N   . PHE B 226 ? 1.0169 1.4610 1.8898 0.0688  -0.1209 0.1905  150  PHE B N   
4530 C CA  . PHE B 226 ? 1.3776 1.8189 2.2373 0.0655  -0.1569 0.1727  150  PHE B CA  
4531 C C   . PHE B 226 ? 1.7794 2.1999 2.5860 0.0608  -0.1594 0.1626  150  PHE B C   
4532 O O   . PHE B 226 ? 1.3160 1.7345 2.1402 0.0531  -0.1764 0.1493  150  PHE B O   
4533 C CB  . PHE B 226 ? 1.4080 1.8510 2.2361 0.0763  -0.1738 0.1715  150  PHE B CB  
4534 N N   . ALA B 236 ? 0.7541 1.0568 1.2128 0.0606  -0.1309 0.1033  160  ALA B N   
4535 C CA  . ALA B 236 ? 0.7375 1.0386 1.2009 0.0635  -0.1072 0.1168  160  ALA B CA  
4536 C C   . ALA B 236 ? 0.7845 1.0739 1.2308 0.0671  -0.1079 0.1072  160  ALA B C   
4537 O O   . ALA B 236 ? 0.7673 1.0562 1.2090 0.0723  -0.0895 0.1183  160  ALA B O   
4538 C CB  . ALA B 236 ? 0.7446 1.0465 1.2670 0.0600  -0.0965 0.1303  160  ALA B CB  
4539 N N   . SER B 237 ? 0.7598 1.0409 1.1954 0.0663  -0.1293 0.0863  161  SER B N   
4540 C CA  . SER B 237 ? 0.7692 1.0386 1.1859 0.0711  -0.1314 0.0735  161  SER B CA  
4541 C C   . SER B 237 ? 0.8046 1.0813 1.1603 0.0775  -0.1297 0.0696  161  SER B C   
4542 O O   . SER B 237 ? 0.8172 1.0879 1.1505 0.0834  -0.1290 0.0601  161  SER B O   
4543 C CB  . SER B 237 ? 0.8376 1.0945 1.2768 0.0681  -0.1550 0.0500  161  SER B CB  
4544 O OG  . SER B 237 ? 0.9579 1.2220 1.3698 0.0689  -0.1766 0.0357  161  SER B OG  
4545 N N   . TYR B 238 ? 0.7310 1.0203 1.0643 0.0763  -0.1276 0.0774  162  TYR B N   
4546 C CA  . TYR B 238 ? 0.7154 1.0130 0.9991 0.0799  -0.1233 0.0773  162  TYR B CA  
4547 C C   . TYR B 238 ? 0.7146 1.0237 0.9910 0.0805  -0.1018 0.0928  162  TYR B C   
4548 O O   . TYR B 238 ? 0.7084 1.0245 0.9544 0.0842  -0.0934 0.0919  162  TYR B O   
4549 C CB  . TYR B 238 ? 0.7388 1.0398 1.0070 0.0784  -0.1372 0.0747  162  TYR B CB  
4550 C CG  . TYR B 238 ? 0.7566 1.0658 0.9860 0.0797  -0.1277 0.0816  162  TYR B CG  
4551 C CD1 . TYR B 238 ? 0.7640 1.0796 0.9999 0.0760  -0.1173 0.0947  162  TYR B CD1 
4552 C CD2 . TYR B 238 ? 0.7820 1.0923 0.9715 0.0847  -0.1279 0.0746  162  TYR B CD2 
4553 C CE1 . TYR B 238 ? 0.7784 1.0992 0.9856 0.0755  -0.1076 0.0997  162  TYR B CE1 
4554 C CE2 . TYR B 238 ? 0.7904 1.1080 0.9515 0.0843  -0.1170 0.0822  162  TYR B CE2 
4555 C CZ  . TYR B 238 ? 0.8823 1.2043 1.0543 0.0789  -0.1072 0.0943  162  TYR B CZ  
4556 O OH  . TYR B 238 ? 0.9183 1.2453 1.0687 0.0772  -0.0962 0.1003  162  TYR B OH  
4557 N N   . ILE B 239 ? 0.6367 0.9500 0.9418 0.0777  -0.0935 0.1055  163  ILE B N   
4558 C CA  . ILE B 239 ? 0.6120 0.9380 0.9107 0.0796  -0.0751 0.1177  163  ILE B CA  
4559 C C   . ILE B 239 ? 0.6566 0.9862 0.9533 0.0868  -0.0621 0.1226  163  ILE B C   
4560 O O   . ILE B 239 ? 0.6568 0.9986 0.9263 0.0907  -0.0541 0.1223  163  ILE B O   
4561 C CB  . ILE B 239 ? 0.6387 0.9686 0.9671 0.0771  -0.0694 0.1290  163  ILE B CB  
4562 C CG1 . ILE B 239 ? 0.6476 0.9770 0.9707 0.0726  -0.0799 0.1258  163  ILE B CG1 
4563 C CG2 . ILE B 239 ? 0.6313 0.9750 0.9535 0.0821  -0.0498 0.1396  163  ILE B CG2 
4564 C CD1 . ILE B 239 ? 0.7991 1.1265 1.1618 0.0697  -0.0870 0.1299  163  ILE B CD1 
4565 N N   . VAL B 240 ? 0.6053 0.9248 0.9329 0.0890  -0.0602 0.1273  164  VAL B N   
4566 C CA  . VAL B 240 ? 0.6074 0.9280 0.9359 0.0981  -0.0472 0.1354  164  VAL B CA  
4567 C C   . VAL B 240 ? 0.6617 0.9859 0.9544 0.1034  -0.0498 0.1242  164  VAL B C   
4568 O O   . VAL B 240 ? 0.6575 0.9983 0.9310 0.1103  -0.0387 0.1303  164  VAL B O   
4569 C CB  . VAL B 240 ? 0.6721 0.9759 1.0447 0.0989  -0.0444 0.1425  164  VAL B CB  
4570 C CG1 . VAL B 240 ? 0.6758 0.9749 1.0446 0.1098  -0.0344 0.1479  164  VAL B CG1 
4571 C CG2 . VAL B 240 ? 0.6682 0.9765 1.0745 0.0978  -0.0318 0.1611  164  VAL B CG2 
4572 N N   . PRO B 241 ? 0.6153 0.9286 0.8960 0.1015  -0.0637 0.1075  165  PRO B N   
4573 C CA  . PRO B 241 ? 0.6119 0.9325 0.8596 0.1080  -0.0622 0.0991  165  PRO B CA  
4574 C C   . PRO B 241 ? 0.6417 0.9831 0.8596 0.1060  -0.0573 0.0997  165  PRO B C   
4575 O O   . PRO B 241 ? 0.6379 0.9936 0.8387 0.1123  -0.0497 0.0992  165  PRO B O   
4576 C CB  . PRO B 241 ? 0.6481 0.9535 0.8884 0.1068  -0.0780 0.0809  165  PRO B CB  
4577 C CG  . PRO B 241 ? 0.7048 1.0013 0.9649 0.0982  -0.0906 0.0783  165  PRO B CG  
4578 C CD  . PRO B 241 ? 0.6396 0.9363 0.9362 0.0954  -0.0813 0.0947  165  PRO B CD  
4579 N N   . LEU B 242 ? 0.5825 0.9262 0.7987 0.0975  -0.0608 0.1009  166  LEU B N   
4580 C CA  . LEU B 242 ? 0.5686 0.9286 0.7642 0.0940  -0.0551 0.1012  166  LEU B CA  
4581 C C   . LEU B 242 ? 0.6105 0.9890 0.8091 0.0980  -0.0421 0.1090  166  LEU B C   
4582 O O   . LEU B 242 ? 0.5995 0.9959 0.7819 0.0986  -0.0369 0.1052  166  LEU B O   
4583 C CB  . LEU B 242 ? 0.5657 0.9196 0.7643 0.0856  -0.0612 0.1023  166  LEU B CB  
4584 C CG  . LEU B 242 ? 0.6387 0.9940 0.8140 0.0811  -0.0638 0.0982  166  LEU B CG  
4585 C CD1 . LEU B 242 ? 0.6365 0.9862 0.8219 0.0753  -0.0666 0.1036  166  LEU B CD1 
4586 C CD2 . LEU B 242 ? 0.6669 1.0400 0.8285 0.0798  -0.0518 0.0973  166  LEU B CD2 
4587 N N   . VAL B 243 ? 0.5537 0.9301 0.7740 0.1015  -0.0370 0.1197  167  VAL B N   
4588 C CA  . VAL B 243 ? 0.5462 0.9412 0.7660 0.1087  -0.0249 0.1280  167  VAL B CA  
4589 C C   . VAL B 243 ? 0.5986 1.0071 0.8067 0.1202  -0.0199 0.1288  167  VAL B C   
4590 O O   . VAL B 243 ? 0.5922 1.0245 0.7873 0.1259  -0.0143 0.1283  167  VAL B O   
4591 C CB  . VAL B 243 ? 0.6004 0.9893 0.8457 0.1117  -0.0182 0.1421  167  VAL B CB  
4592 C CG1 . VAL B 243 ? 0.5979 1.0080 0.8363 0.1232  -0.0048 0.1516  167  VAL B CG1 
4593 C CG2 . VAL B 243 ? 0.5935 0.9738 0.8519 0.1018  -0.0230 0.1408  167  VAL B CG2 
4594 N N   . TRP B 244 ? 0.5671 0.9613 0.7807 0.1242  -0.0231 0.1283  168  TRP B N   
4595 C CA  . TRP B 244 ? 0.5785 0.9829 0.7835 0.1366  -0.0187 0.1294  168  TRP B CA  
4596 C C   . TRP B 244 ? 0.6522 1.0717 0.8347 0.1341  -0.0223 0.1155  168  TRP B C   
4597 O O   . TRP B 244 ? 0.6561 1.0988 0.8292 0.1430  -0.0177 0.1154  168  TRP B O   
4598 C CB  . TRP B 244 ? 0.5757 0.9562 0.7986 0.1422  -0.0197 0.1326  168  TRP B CB  
4599 C CG  . TRP B 244 ? 0.5898 0.9603 0.8394 0.1475  -0.0108 0.1507  168  TRP B CG  
4600 C CD1 . TRP B 244 ? 0.6273 0.9773 0.9058 0.1393  -0.0129 0.1548  168  TRP B CD1 
4601 C CD2 . TRP B 244 ? 0.5919 0.9760 0.8427 0.1629  0.0030  0.1692  168  TRP B CD2 
4602 N NE1 . TRP B 244 ? 0.6268 0.9749 0.9273 0.1476  0.0009  0.1757  168  TRP B NE1 
4603 C CE2 . TRP B 244 ? 0.6468 1.0151 0.9279 0.1632  0.0112  0.1859  168  TRP B CE2 
4604 C CE3 . TRP B 244 ? 0.6068 1.0169 0.8367 0.1777  0.0089  0.1738  168  TRP B CE3 
4605 C CZ2 . TRP B 244 ? 0.6470 1.0229 0.9346 0.1787  0.0276  0.2096  168  TRP B CZ2 
4606 C CZ3 . TRP B 244 ? 0.6360 1.0546 0.8703 0.1943  0.0222  0.1956  168  TRP B CZ3 
4607 C CH2 . TRP B 244 ? 0.6529 1.0538 0.9139 0.1952  0.0325  0.2145  168  TRP B CH2 
4608 N N   . CYS B 245 ? 0.6121 1.0212 0.7873 0.1228  -0.0300 0.1051  169  CYS B N   
4609 C CA  . CYS B 245 ? 0.6081 1.0304 0.7644 0.1194  -0.0305 0.0947  169  CYS B CA  
4610 C C   . CYS B 245 ? 0.6384 1.0863 0.7911 0.1147  -0.0255 0.0934  169  CYS B C   
4611 O O   . CYS B 245 ? 0.6327 1.1034 0.7789 0.1174  -0.0220 0.0879  169  CYS B O   
4612 C CB  . CYS B 245 ? 0.6228 1.0273 0.7703 0.1109  -0.0382 0.0877  169  CYS B CB  
4613 S SG  . CYS B 245 ? 0.6781 1.0986 0.8040 0.1060  -0.0342 0.0801  169  CYS B SG  
4614 N N   . MET B 246 ? 0.5881 1.0331 0.7481 0.1080  -0.0253 0.0968  170  MET B N   
4615 C CA  . MET B 246 ? 0.5802 1.0461 0.7396 0.1034  -0.0216 0.0922  170  MET B CA  
4616 C C   . MET B 246 ? 0.6580 1.1513 0.8161 0.1158  -0.0176 0.0932  170  MET B C   
4617 O O   . MET B 246 ? 0.6636 1.1824 0.8192 0.1140  -0.0168 0.0835  170  MET B O   
4618 C CB  . MET B 246 ? 0.6037 1.0572 0.7719 0.0967  -0.0219 0.0955  170  MET B CB  
4619 C CG  . MET B 246 ? 0.6530 1.0886 0.8208 0.0843  -0.0257 0.0929  170  MET B CG  
4620 S SD  . MET B 246 ? 0.7044 1.1268 0.8858 0.0785  -0.0256 0.0969  170  MET B SD  
4621 C CE  . MET B 246 ? 0.6633 1.0662 0.8584 0.0841  -0.0306 0.1081  170  MET B CE  
4622 N N   . ALA B 247 ? 0.6216 1.1102 0.7829 0.1289  -0.0151 0.1050  171  ALA B N   
4623 C CA  . ALA B 247 ? 0.6319 1.1456 0.7888 0.1452  -0.0108 0.1105  171  ALA B CA  
4624 C C   . ALA B 247 ? 0.7235 1.2561 0.8747 0.1523  -0.0121 0.1048  171  ALA B C   
4625 O O   . ALA B 247 ? 0.7238 1.2890 0.8699 0.1617  -0.0121 0.1015  171  ALA B O   
4626 C CB  . ALA B 247 ? 0.6484 1.1467 0.8135 0.1570  -0.0051 0.1288  171  ALA B CB  
4627 N N   . CYS B 248 ? 0.7035 1.2178 0.8558 0.1490  -0.0139 0.1024  172  CYS B N   
4628 C CA  . CYS B 248 ? 0.7167 1.2463 0.8651 0.1558  -0.0135 0.0966  172  CYS B CA  
4629 C C   . CYS B 248 ? 0.7468 1.3033 0.8936 0.1456  -0.0143 0.0828  172  CYS B C   
4630 O O   . CYS B 248 ? 0.7466 1.3339 0.8950 0.1534  -0.0136 0.0782  172  CYS B O   
4631 C CB  . CYS B 248 ? 0.7419 1.2429 0.8898 0.1555  -0.0147 0.0955  172  CYS B CB  
4632 S SG  . CYS B 248 ? 0.8147 1.2894 0.9737 0.1705  -0.0125 0.1088  172  CYS B SG  
4633 N N   . LEU B 249 ? 0.6791 1.2241 0.8264 0.1285  -0.0153 0.0772  173  LEU B N   
4634 C CA  . LEU B 249 ? 0.6608 1.2248 0.8128 0.1157  -0.0140 0.0658  173  LEU B CA  
4635 C C   . LEU B 249 ? 0.6872 1.2826 0.8468 0.1159  -0.0159 0.0577  173  LEU B C   
4636 O O   . LEU B 249 ? 0.6667 1.2924 0.8359 0.1128  -0.0157 0.0467  173  LEU B O   
4637 C CB  . LEU B 249 ? 0.6583 1.1954 0.8092 0.0998  -0.0136 0.0659  173  LEU B CB  
4638 C CG  . LEU B 249 ? 0.7232 1.2473 0.8662 0.0949  -0.0106 0.0661  173  LEU B CG  
4639 C CD1 . LEU B 249 ? 0.7335 1.2373 0.8652 0.1058  -0.0137 0.0707  173  LEU B CD1 
4640 C CD2 . LEU B 249 ? 0.7648 1.2675 0.9065 0.0814  -0.0102 0.0683  173  LEU B CD2 
4641 N N   . SER B 250 ? 0.6468 1.2373 0.8033 0.1205  -0.0176 0.0621  174  SER B N   
4642 C CA  . SER B 250 ? 0.6460 1.2652 0.8044 0.1236  -0.0205 0.0526  174  SER B CA  
4643 C C   . SER B 250 ? 0.6944 1.3501 0.8485 0.1424  -0.0234 0.0523  174  SER B C   
4644 O O   . SER B 250 ? 0.7055 1.3944 0.8610 0.1457  -0.0284 0.0396  174  SER B O   
4645 C CB  . SER B 250 ? 0.7003 1.3027 0.8533 0.1262  -0.0192 0.0594  174  SER B CB  
4646 O OG  . SER B 250 ? 0.8131 1.3847 0.9718 0.1108  -0.0177 0.0600  174  SER B OG  
4647 N N   . SER B 251 ? 0.6335 1.2835 0.7831 0.1560  -0.0210 0.0654  175  SER B N   
4648 C CA  . SER B 251 ? 0.6323 1.3146 0.7782 0.1770  -0.0230 0.0690  175  SER B CA  
4649 C C   . SER B 251 ? 0.6396 1.3435 0.7958 0.1768  -0.0238 0.0608  175  SER B C   
4650 O O   . SER B 251 ? 0.6535 1.3820 0.8089 0.1956  -0.0252 0.0654  175  SER B O   
4651 C CB  . SER B 251 ? 0.7036 1.3651 0.8412 0.1952  -0.0177 0.0912  175  SER B CB  
4652 O OG  . SER B 251 ? 0.8608 1.4866 1.0031 0.1904  -0.0138 0.0976  175  SER B OG  
4653 N N   . LEU B 252 ? 0.5433 1.2401 0.7100 0.1572  -0.0217 0.0503  176  LEU B N   
4654 C CA  . LEU B 252 ? 0.5217 1.2401 0.7010 0.1554  -0.0194 0.0429  176  LEU B CA  
4655 C C   . LEU B 252 ? 0.5789 1.3499 0.7753 0.1564  -0.0259 0.0272  176  LEU B C   
4656 O O   . LEU B 252 ? 0.5591 1.3594 0.7634 0.1689  -0.0264 0.0265  176  LEU B O   
4657 C CB  . LEU B 252 ? 0.5125 1.2073 0.6960 0.1359  -0.0126 0.0399  176  LEU B CB  
4658 C CG  . LEU B 252 ? 0.5659 1.2216 0.7345 0.1398  -0.0080 0.0511  176  LEU B CG  
4659 C CD1 . LEU B 252 ? 0.5708 1.2016 0.7368 0.1220  -0.0033 0.0498  176  LEU B CD1 
4660 C CD2 . LEU B 252 ? 0.5807 1.2482 0.7492 0.1556  -0.0043 0.0532  176  LEU B CD2 
4661 N N   . PRO B 253 ? 0.5618 1.3481 0.7656 0.1457  -0.0320 0.0130  177  PRO B N   
4662 C CA  . PRO B 253 ? 0.5672 1.4072 0.7897 0.1481  -0.0414 -0.0056 177  PRO B CA  
4663 C C   . PRO B 253 ? 0.6512 1.5223 0.8596 0.1764  -0.0497 0.0000  177  PRO B C   
4664 O O   . PRO B 253 ? 0.6628 1.5826 0.8860 0.1844  -0.0583 -0.0121 177  PRO B O   
4665 C CB  . PRO B 253 ? 0.5869 1.4258 0.8165 0.1318  -0.0462 -0.0224 177  PRO B CB  
4666 C CG  . PRO B 253 ? 0.6367 1.4228 0.8583 0.1168  -0.0366 -0.0118 177  PRO B CG  
4667 C CD  . PRO B 253 ? 0.5810 1.3390 0.7790 0.1323  -0.0318 0.0109  177  PRO B CD  
4668 N N   . THR B 254 ? 0.6178 1.4617 0.7999 0.1922  -0.0466 0.0200  178  THR B N   
4669 C CA  . THR B 254 ? 0.6353 1.5014 0.8015 0.2217  -0.0505 0.0327  178  THR B CA  
4670 C C   . THR B 254 ? 0.6895 1.5649 0.8642 0.2349  -0.0470 0.0418  178  THR B C   
4671 O O   . THR B 254 ? 0.6937 1.6125 0.8715 0.2544  -0.0543 0.0404  178  THR B O   
4672 C CB  . THR B 254 ? 0.8043 1.6341 0.9463 0.2326  -0.0440 0.0543  178  THR B CB  
4673 O OG1 . THR B 254 ? 0.8547 1.6623 0.9934 0.2149  -0.0430 0.0469  178  THR B OG1 
4674 C CG2 . THR B 254 ? 0.7808 1.6388 0.9038 0.2631  -0.0475 0.0670  178  THR B CG2 
4675 N N   . PHE B 255 ? 0.6383 1.4751 0.8167 0.2256  -0.0366 0.0497  179  PHE B N   
4676 C CA  . PHE B 255 ? 0.6461 1.4876 0.8321 0.2381  -0.0316 0.0560  179  PHE B CA  
4677 C C   . PHE B 255 ? 0.7111 1.5965 0.9232 0.2302  -0.0343 0.0380  179  PHE B C   
4678 O O   . PHE B 255 ? 0.7223 1.6356 0.9444 0.2470  -0.0343 0.0400  179  PHE B O   
4679 C CB  . PHE B 255 ? 0.6701 1.4587 0.8501 0.2316  -0.0208 0.0658  179  PHE B CB  
4680 C CG  . PHE B 255 ? 0.7111 1.4917 0.8898 0.2542  -0.0156 0.0788  179  PHE B CG  
4681 C CD1 . PHE B 255 ? 0.7703 1.5168 0.9376 0.2685  -0.0119 0.0975  179  PHE B CD1 
4682 C CD2 . PHE B 255 ? 0.7503 1.5583 0.9433 0.2620  -0.0132 0.0727  179  PHE B CD2 
4683 C CE1 . PHE B 255 ? 0.8044 1.5408 0.9744 0.2900  -0.0064 0.1091  179  PHE B CE1 
4684 C CE2 . PHE B 255 ? 0.8080 1.6077 1.0010 0.2849  -0.0079 0.0839  179  PHE B CE2 
4685 C CZ  . PHE B 255 ? 0.8007 1.5629 0.9823 0.2987  -0.0048 0.1017  179  PHE B CZ  
4686 N N   . TYR B 256 ? 0.6582 1.5500 0.8851 0.2051  -0.0355 0.0211  180  TYR B N   
4687 C CA  . TYR B 256 ? 0.6515 1.5835 0.9104 0.1943  -0.0357 0.0046  180  TYR B CA  
4688 C C   . TYR B 256 ? 0.6979 1.6921 0.9738 0.2058  -0.0506 -0.0096 180  TYR B C   
4689 O O   . TYR B 256 ? 0.6806 1.7155 0.9823 0.2110  -0.0514 -0.0162 180  TYR B O   
4690 C CB  . TYR B 256 ? 0.6627 1.5789 0.9367 0.1633  -0.0303 -0.0071 180  TYR B CB  
4691 C CG  . TYR B 256 ? 0.6928 1.5561 0.9528 0.1514  -0.0166 0.0046  180  TYR B CG  
4692 C CD1 . TYR B 256 ? 0.7252 1.5664 0.9700 0.1648  -0.0085 0.0181  180  TYR B CD1 
4693 C CD2 . TYR B 256 ? 0.6974 1.5344 0.9601 0.1280  -0.0124 0.0006  180  TYR B CD2 
4694 C CE1 . TYR B 256 ? 0.7386 1.5349 0.9681 0.1556  0.0013  0.0257  180  TYR B CE1 
4695 C CE2 . TYR B 256 ? 0.7056 1.4983 0.9534 0.1195  -0.0016 0.0116  180  TYR B CE2 
4696 C CZ  . TYR B 256 ? 0.8053 1.5791 1.0351 0.1336  0.0042  0.0232  180  TYR B CZ  
4697 O OH  . TYR B 256 ? 0.8376 1.5711 1.0500 0.1272  0.0123  0.0311  180  TYR B OH  
4698 N N   . PHE B 257 ? 0.6650 1.6695 0.9265 0.2112  -0.0627 -0.0150 181  PHE B N   
4699 C CA  . PHE B 257 ? 0.6732 1.7387 0.9482 0.2210  -0.0800 -0.0333 181  PHE B CA  
4700 C C   . PHE B 257 ? 0.7442 1.8363 0.9955 0.2568  -0.0893 -0.0204 181  PHE B C   
4701 O O   . PHE B 257 ? 0.7469 1.8970 1.0154 0.2700  -0.1023 -0.0323 181  PHE B O   
4702 C CB  . PHE B 257 ? 0.6997 1.7678 0.9768 0.2034  -0.0889 -0.0545 181  PHE B CB  
4703 C CG  . PHE B 257 ? 0.7125 1.7745 1.0261 0.1701  -0.0829 -0.0720 181  PHE B CG  
4704 C CD1 . PHE B 257 ? 0.7597 1.8728 1.1176 0.1597  -0.0907 -0.0955 181  PHE B CD1 
4705 C CD2 . PHE B 257 ? 0.7327 1.7388 1.0395 0.1498  -0.0687 -0.0632 181  PHE B CD2 
4706 C CE1 . PHE B 257 ? 0.7682 1.8733 1.1643 0.1289  -0.0816 -0.1079 181  PHE B CE1 
4707 C CE2 . PHE B 257 ? 0.7657 1.7644 1.1055 0.1213  -0.0607 -0.0747 181  PHE B CE2 
4708 C CZ  . PHE B 257 ? 0.7483 1.7952 1.1333 0.1107  -0.0657 -0.0958 181  PHE B CZ  
4709 N N   . ARG B 258 ? 0.7144 1.7684 0.9298 0.2729  -0.0830 0.0036  182  ARG B N   
4710 C CA  . ARG B 258 ? 0.7360 1.8125 0.9277 0.3086  -0.0890 0.0206  182  ARG B CA  
4711 C C   . ARG B 258 ? 0.8081 1.9131 1.0144 0.3299  -0.0890 0.0296  182  ARG B C   
4712 O O   . ARG B 258 ? 0.8066 1.8813 1.0225 0.3257  -0.0758 0.0398  182  ARG B O   
4713 C CB  . ARG B 258 ? 0.7380 1.7619 0.8968 0.3198  -0.0768 0.0491  182  ARG B CB  
4714 C CG  . ARG B 258 ? 0.8292 1.8415 0.9659 0.3139  -0.0793 0.0450  182  ARG B CG  
4715 C CD  . ARG B 258 ? 0.9117 1.9654 1.0227 0.3440  -0.0898 0.0492  182  ARG B CD  
4716 N NE  . ARG B 258 ? 1.0141 2.0706 1.1092 0.3356  -0.0953 0.0336  182  ARG B NE  
4717 C CZ  . ARG B 258 ? 1.3228 2.4209 1.3936 0.3577  -0.1071 0.0274  182  ARG B CZ  
4718 N NH1 . ARG B 258 ? 1.2162 2.3582 1.2753 0.3901  -0.1156 0.0373  182  ARG B NH1 
4719 N NH2 . ARG B 258 ? 1.2339 2.3310 1.2905 0.3494  -0.1107 0.0107  182  ARG B NH2 
4720 N N   . ASP B 259 ? 0.7746 1.9403 0.9827 0.3537  -0.1047 0.0238  183  ASP B N   
4721 C CA  . ASP B 259 ? 0.7755 1.9771 0.9977 0.3793  -0.1072 0.0328  183  ASP B CA  
4722 C C   . ASP B 259 ? 0.8412 2.1029 1.0492 0.4127  -0.1259 0.0334  183  ASP B C   
4723 O O   . ASP B 259 ? 0.8466 2.1360 1.0428 0.4104  -0.1407 0.0157  183  ASP B O   
4724 C CB  . ASP B 259 ? 0.7796 2.0103 1.0477 0.3610  -0.1075 0.0119  183  ASP B CB  
4725 C CG  . ASP B 259 ? 0.9007 2.1371 1.1817 0.3824  -0.0989 0.0283  183  ASP B CG  
4726 O OD1 . ASP B 259 ? 0.9189 2.1094 1.1767 0.3989  -0.0860 0.0551  183  ASP B OD1 
4727 O OD2 . ASP B 259 ? 0.9480 2.2351 1.2656 0.3830  -0.1047 0.0138  183  ASP B OD2 
4728 N N   . VAL B 260 ? 0.8020 2.0831 1.0097 0.4456  -0.1252 0.0539  184  VAL B N   
4729 C CA  . VAL B 260 ? 0.8218 2.1622 1.0153 0.4833  -0.1423 0.0596  184  VAL B CA  
4730 C C   . VAL B 260 ? 0.8639 2.2801 1.0957 0.4765  -0.1644 0.0244  184  VAL B C   
4731 O O   . VAL B 260 ? 0.8447 2.2753 1.1169 0.4670  -0.1609 0.0161  184  VAL B O   
4732 C CB  . VAL B 260 ? 0.8882 2.2165 1.0718 0.5206  -0.1313 0.0967  184  VAL B CB  
4733 C CG1 . VAL B 260 ? 0.9148 2.3170 1.0970 0.5598  -0.1506 0.0995  184  VAL B CG1 
4734 C CG2 . VAL B 260 ? 0.9028 2.1684 1.0480 0.5319  -0.1138 0.1307  184  VAL B CG2 
4735 N N   . ARG B 261 ? 0.8327 2.2971 1.0538 0.4804  -0.1867 0.0019  185  ARG B N   
4736 C CA  . ARG B 261 ? 0.8267 2.3661 1.0873 0.4727  -0.2111 -0.0362 185  ARG B CA  
4737 C C   . ARG B 261 ? 0.9297 2.5381 1.1667 0.5103  -0.2376 -0.0413 185  ARG B C   
4738 O O   . ARG B 261 ? 0.9490 2.5436 1.1334 0.5367  -0.2364 -0.0193 185  ARG B O   
4739 C CB  . ARG B 261 ? 0.7922 2.3214 1.0747 0.4288  -0.2145 -0.0719 185  ARG B CB  
4740 C CG  . ARG B 261 ? 0.8524 2.3910 1.1971 0.3948  -0.2095 -0.0935 185  ARG B CG  
4741 C CD  . ARG B 261 ? 0.8848 2.3581 1.2335 0.3814  -0.1800 -0.0683 185  ARG B CD  
4742 N NE  . ARG B 261 ? 0.8875 2.3586 1.2869 0.3447  -0.1709 -0.0877 185  ARG B NE  
4743 C CZ  . ARG B 261 ? 1.0257 2.4701 1.4436 0.3372  -0.1499 -0.0735 185  ARG B CZ  
4744 N NH1 . ARG B 261 ? 0.8412 2.2863 1.3032 0.3048  -0.1403 -0.0897 185  ARG B NH1 
4745 N NH2 . ARG B 261 ? 0.8409 2.2584 1.2344 0.3632  -0.1377 -0.0432 185  ARG B NH2 
4746 N N   . THR B 262 ? 0.9047 2.5905 1.1825 0.5133  -0.2614 -0.0705 186  THR B N   
4747 C CA  . THR B 262 ? 0.9429 2.7073 1.2058 0.5492  -0.2917 -0.0816 186  THR B CA  
4748 C C   . THR B 262 ? 1.0016 2.8056 1.2749 0.5277  -0.3168 -0.1306 186  THR B C   
4749 O O   . THR B 262 ? 0.9784 2.8118 1.3110 0.4962  -0.3264 -0.1669 186  THR B O   
4750 C CB  . THR B 262 ? 1.0644 2.8921 1.3689 0.5711  -0.3029 -0.0805 186  THR B CB  
4751 O OG1 . THR B 262 ? 1.0615 2.9238 1.4356 0.5355  -0.3110 -0.1188 186  THR B OG1 
4752 C CG2 . THR B 262 ? 1.0379 2.8208 1.3392 0.5886  -0.2761 -0.0365 186  THR B CG2 
4753 N N   . ILE B 263 ? 0.9864 2.7883 1.2031 0.5448  -0.3253 -0.1310 187  ILE B N   
4754 C CA  . ILE B 263 ? 0.9963 2.8335 1.2133 0.5304  -0.3498 -0.1779 187  ILE B CA  
4755 C C   . ILE B 263 ? 1.0810 3.0179 1.3063 0.5612  -0.3875 -0.2038 187  ILE B C   
4756 O O   . ILE B 263 ? 1.1223 3.0876 1.2920 0.6065  -0.3981 -0.1852 187  ILE B O   
4757 C CB  . ILE B 263 ? 1.0552 2.8467 1.2056 0.5379  -0.3404 -0.1664 187  ILE B CB  
4758 N N   . GLU B 264 ? 1.0145 3.0062 1.3107 0.5379  -0.4073 -0.2450 188  GLU B N   
4759 C CA  . GLU B 264 ? 1.0368 3.1302 1.3556 0.5627  -0.4462 -0.2755 188  GLU B CA  
4760 C C   . GLU B 264 ? 1.1344 3.2716 1.4035 0.5854  -0.4764 -0.3047 188  GLU B C   
4761 O O   . GLU B 264 ? 1.1646 3.3776 1.4151 0.6270  -0.5054 -0.3100 188  GLU B O   
4762 C CB  . GLU B 264 ? 1.0241 3.1592 1.4369 0.5236  -0.4583 -0.3186 188  GLU B CB  
4763 N N   . TYR B 265 ? 1.0944 3.1845 1.3399 0.5605  -0.4695 -0.3233 189  TYR B N   
4764 C CA  . TYR B 265 ? 1.1349 3.2548 1.3296 0.5784  -0.4935 -0.3533 189  TYR B CA  
4765 C C   . TYR B 265 ? 1.2229 3.3527 1.3293 0.6370  -0.4927 -0.3116 189  TYR B C   
4766 O O   . TYR B 265 ? 1.2704 3.4696 1.3422 0.6713  -0.5246 -0.3343 189  TYR B O   
4767 C CB  . TYR B 265 ? 1.1340 3.1834 1.3207 0.5400  -0.4758 -0.3696 189  TYR B CB  
4768 N N   . LEU B 266 ? 1.1572 3.2195 1.2292 0.6492  -0.4564 -0.2505 190  LEU B N   
4769 C CA  . LEU B 266 ? 1.1952 3.2545 1.1887 0.7025  -0.4475 -0.2019 190  LEU B CA  
4770 C C   . LEU B 266 ? 1.2499 3.3249 1.2488 0.7365  -0.4406 -0.1557 190  LEU B C   
4771 O O   . LEU B 266 ? 1.2955 3.3812 1.2353 0.7857  -0.4371 -0.1157 190  LEU B O   
4772 C CB  . LEU B 266 ? 1.1859 3.1532 1.1343 0.6929  -0.4102 -0.1670 190  LEU B CB  
4773 N N   . GLY B 267 ? 1.1539 3.2302 1.2233 0.7113  -0.4372 -0.1608 191  GLY B N   
4774 C CA  . GLY B 267 ? 1.1448 3.2317 1.2306 0.7380  -0.4288 -0.1216 191  GLY B CA  
4775 C C   . GLY B 267 ? 1.1836 3.1894 1.2288 0.7538  -0.3895 -0.0586 191  GLY B C   
4776 O O   . GLY B 267 ? 1.2084 3.2291 1.2221 0.8008  -0.3864 -0.0177 191  GLY B O   
4777 N N   . VAL B 268 ? 1.1037 3.0232 1.1527 0.7149  -0.3593 -0.0502 192  VAL B N   
4778 C CA  . VAL B 268 ? 1.0957 2.9329 1.1114 0.7239  -0.3219 0.0048  192  VAL B CA  
4779 C C   . VAL B 268 ? 1.0813 2.8447 1.1433 0.6795  -0.2938 0.0108  192  VAL B C   
4780 O O   . VAL B 268 ? 1.0360 2.8040 1.1452 0.6382  -0.3004 -0.0279 192  VAL B O   
4781 C CB  . VAL B 268 ? 1.1678 2.9744 1.1195 0.7315  -0.3137 0.0137  192  VAL B CB  
4782 C CG1 . VAL B 268 ? 1.1276 2.8960 1.0950 0.6810  -0.3099 -0.0231 192  VAL B CG1 
4783 C CG2 . VAL B 268 ? 1.1845 2.9282 1.0952 0.7564  -0.2806 0.0746  192  VAL B CG2 
4784 N N   . ASN B 269 ? 1.0405 2.7388 1.0898 0.6898  -0.2631 0.0588  193  ASN B N   
4785 C CA  . ASN B 269 ? 1.0021 2.6269 1.0846 0.6535  -0.2358 0.0677  193  ASN B CA  
4786 C C   . ASN B 269 ? 1.0614 2.6108 1.1131 0.6328  -0.2137 0.0805  193  ASN B C   
4787 O O   . ASN B 269 ? 1.0860 2.5953 1.1007 0.6563  -0.1949 0.1215  193  ASN B O   
4788 C CB  . ASN B 269 ? 1.0193 2.6213 1.1148 0.6760  -0.2182 0.1059  193  ASN B CB  
4789 C CG  . ASN B 269 ? 1.4107 3.0672 1.5574 0.6788  -0.2317 0.0888  193  ASN B CG  
4790 O OD1 . ASN B 269 ? 1.4183 3.1502 1.5854 0.6798  -0.2599 0.0549  193  ASN B OD1 
4791 N ND2 . ASN B 269 ? 1.3037 2.9263 1.4728 0.6837  -0.2121 0.1127  193  ASN B ND2 
4792 N N   . ALA B 270 ? 0.9932 2.5243 1.0636 0.5893  -0.2153 0.0463  194  ALA B N   
4793 C CA  . ALA B 270 ? 0.9866 2.4524 1.0316 0.5689  -0.1969 0.0544  194  ALA B CA  
4794 C C   . ALA B 270 ? 1.0060 2.4076 1.0849 0.5263  -0.1773 0.0511  194  ALA B C   
4795 O O   . ALA B 270 ? 0.9641 2.3801 1.0878 0.5016  -0.1826 0.0266  194  ALA B O   
4796 C CB  . ALA B 270 ? 1.0060 2.5023 1.0325 0.5600  -0.2151 0.0194  194  ALA B CB  
4797 N N   . CYS B 271 ? 0.9829 2.3148 1.0394 0.5194  -0.1541 0.0773  195  CYS B N   
4798 C CA  . CYS B 271 ? 0.9562 2.2204 1.0330 0.4826  -0.1349 0.0782  195  CYS B CA  
4799 C C   . CYS B 271 ? 0.9721 2.2327 1.0518 0.4498  -0.1419 0.0448  195  CYS B C   
4800 O O   . CYS B 271 ? 0.9826 2.2306 1.0296 0.4546  -0.1397 0.0486  195  CYS B O   
4801 C CB  . CYS B 271 ? 0.9798 2.1795 1.0336 0.4936  -0.1105 0.1197  195  CYS B CB  
4802 S SG  . CYS B 271 ? 0.9980 2.1153 1.0714 0.4519  -0.0895 0.1209  195  CYS B SG  
4803 N N   . ILE B 272 ? 0.8890 2.1675 1.0091 0.4198  -0.1510 0.0113  196  ILE B N   
4804 C CA  . ILE B 272 ? 0.8693 2.1486 1.0010 0.3882  -0.1588 -0.0236 196  ILE B CA  
4805 C C   . ILE B 272 ? 0.8873 2.1304 1.0588 0.3479  -0.1478 -0.0355 196  ILE B C   
4806 O O   . ILE B 272 ? 0.8698 2.1016 1.0624 0.3455  -0.1381 -0.0234 196  ILE B O   
4807 C CB  . ILE B 272 ? 0.9201 2.2765 1.0638 0.3949  -0.1872 -0.0607 196  ILE B CB  
4808 C CG1 . ILE B 272 ? 0.9128 2.3221 1.0973 0.4002  -0.1987 -0.0705 196  ILE B CG1 
4809 C CG2 . ILE B 272 ? 0.9739 2.3626 1.0686 0.4309  -0.1991 -0.0554 196  ILE B CG2 
4810 C CD1 . ILE B 272 ? 0.9355 2.3620 1.1749 0.3637  -0.2050 -0.1061 196  ILE B CD1 
4811 N N   . MET B 273 ? 0.8296 2.0579 1.0111 0.3182  -0.1496 -0.0605 197  MET B N   
4812 C CA  . MET B 273 ? 0.7980 1.9952 1.0159 0.2802  -0.1397 -0.0729 197  MET B CA  
4813 C C   . MET B 273 ? 0.8361 2.0884 1.1033 0.2683  -0.1524 -0.1013 197  MET B C   
4814 O O   . MET B 273 ? 0.8378 2.1256 1.1247 0.2568  -0.1685 -0.1346 197  MET B O   
4815 C CB  . MET B 273 ? 0.8237 1.9850 1.0350 0.2563  -0.1363 -0.0865 197  MET B CB  
4816 C CG  . MET B 273 ? 0.8714 1.9757 1.0440 0.2632  -0.1208 -0.0578 197  MET B CG  
4817 S SD  . MET B 273 ? 0.9004 1.9394 1.0801 0.2483  -0.0979 -0.0296 197  MET B SD  
4818 C CE  . MET B 273 ? 0.8412 1.8439 1.0413 0.2090  -0.0922 -0.0485 197  MET B CE  
4819 N N   . ALA B 274 ? 0.7766 2.0372 1.0659 0.2724  -0.1451 -0.0889 198  ALA B N   
4820 C CA  . ALA B 274 ? 0.7667 2.0823 1.1061 0.2652  -0.1541 -0.1099 198  ALA B CA  
4821 C C   . ALA B 274 ? 0.8040 2.1056 1.1884 0.2246  -0.1455 -0.1297 198  ALA B C   
4822 O O   . ALA B 274 ? 0.7852 2.0748 1.1950 0.2130  -0.1298 -0.1206 198  ALA B O   
4823 C CB  . ALA B 274 ? 0.7735 2.0976 1.1178 0.2860  -0.1456 -0.0866 198  ALA B CB  
4824 N N   . PHE B 275 ? 0.7717 2.0761 1.1665 0.2046  -0.1550 -0.1569 199  PHE B N   
4825 C CA  . PHE B 275 ? 0.7596 2.0486 1.1988 0.1663  -0.1465 -0.1753 199  PHE B CA  
4826 C C   . PHE B 275 ? 0.8079 2.1561 1.3111 0.1549  -0.1533 -0.1974 199  PHE B C   
4827 O O   . PHE B 275 ? 0.8161 2.2267 1.3296 0.1744  -0.1742 -0.2122 199  PHE B O   
4828 C CB  . PHE B 275 ? 0.7927 2.0688 1.2266 0.1513  -0.1558 -0.1997 199  PHE B CB  
4829 N N   . PRO B 276 ? 0.7503 2.0831 1.2991 0.1243  -0.1360 -0.1998 200  PRO B N   
4830 C CA  . PRO B 276 ? 0.7410 2.1328 1.3585 0.1119  -0.1404 -0.2205 200  PRO B CA  
4831 C C   . PRO B 276 ? 0.7894 2.2297 1.4474 0.0992  -0.1652 -0.2637 200  PRO B C   
4832 O O   . PRO B 276 ? 0.7880 2.1996 1.4319 0.0870  -0.1699 -0.2781 200  PRO B O   
4833 C CB  . PRO B 276 ? 0.7518 2.1041 1.4004 0.0819  -0.1117 -0.2083 200  PRO B CB  
4834 C CG  . PRO B 276 ? 0.8115 2.0927 1.4196 0.0708  -0.1010 -0.1968 200  PRO B CG  
4835 C CD  . PRO B 276 ? 0.7614 2.0256 1.3025 0.1013  -0.1111 -0.1822 200  PRO B CD  
4836 N N   . PRO B 277 ? 0.7423 2.2546 1.4589 0.0980  -0.1797 -0.2873 201  PRO B N   
4837 C CA  . PRO B 277 ? 0.7853 2.3457 1.5469 0.0839  -0.2054 -0.3336 201  PRO B CA  
4838 C C   . PRO B 277 ? 1.1387 2.6622 1.9420 0.0430  -0.1939 -0.3518 201  PRO B C   
4839 O O   . PRO B 277 ? 0.6374 2.1524 1.4323 0.0360  -0.2087 -0.3785 201  PRO B O   
4840 C CB  . PRO B 277 ? 0.8008 2.4395 1.6280 0.0862  -0.2161 -0.3488 201  PRO B CB  
4841 C CG  . PRO B 277 ? 0.8251 2.4424 1.6571 0.0874  -0.1861 -0.3114 201  PRO B CG  
4842 C CD  . PRO B 277 ? 0.7592 2.3157 1.5058 0.1109  -0.1749 -0.2754 201  PRO B CD  
4843 N N   . TYR B 280 ? 1.0683 2.4786 1.7263 0.0585  -0.2048 -0.3553 204  TYR B N   
4844 C CA  . TYR B 280 ? 1.0729 2.4752 1.6529 0.0946  -0.2124 -0.3367 204  TYR B CA  
4845 C C   . TYR B 280 ? 1.1329 2.5022 1.6769 0.0937  -0.2180 -0.3518 204  TYR B C   
4846 O O   . TYR B 280 ? 1.1261 2.4506 1.6107 0.1093  -0.2071 -0.3234 204  TYR B O   
4847 C CB  . TYR B 280 ? 1.1032 2.5810 1.6751 0.1270  -0.2390 -0.3481 204  TYR B CB  
4848 C CG  . TYR B 280 ? 1.1333 2.6022 1.6285 0.1671  -0.2404 -0.3172 204  TYR B CG  
4849 C CD1 . TYR B 280 ? 1.1819 2.6515 1.6256 0.1869  -0.2543 -0.3271 204  TYR B CD1 
4850 C CD2 . TYR B 280 ? 1.1316 2.5919 1.6078 0.1860  -0.2264 -0.2781 204  TYR B CD2 
4851 C CE1 . TYR B 280 ? 1.2032 2.6632 1.5797 0.2235  -0.2519 -0.2950 204  TYR B CE1 
4852 C CE2 . TYR B 280 ? 1.1550 2.6031 1.5667 0.2216  -0.2253 -0.2479 204  TYR B CE2 
4853 C CZ  . TYR B 280 ? 1.2805 2.7288 1.6434 0.2400  -0.2374 -0.2549 204  TYR B CZ  
4854 O OH  . TYR B 280 ? 1.3145 2.7503 1.6172 0.2751  -0.2332 -0.2219 204  TYR B OH  
4855 N N   . ALA B 281 ? 1.1015 2.4949 1.6835 0.0766  -0.2352 -0.3975 205  ALA B N   
4856 C CA  . ALA B 281 ? 1.1154 2.4823 1.6693 0.0756  -0.2417 -0.4188 205  ALA B CA  
4857 C C   . ALA B 281 ? 1.1400 2.4259 1.6884 0.0531  -0.2135 -0.3964 205  ALA B C   
4858 O O   . ALA B 281 ? 1.1398 2.3874 1.6360 0.0650  -0.2086 -0.3856 205  ALA B O   
4859 C CB  . ALA B 281 ? 1.1497 2.5608 1.7562 0.0596  -0.2661 -0.4762 205  ALA B CB  
4860 N N   . GLN B 282 ? 1.0758 2.3380 1.6777 0.0226  -0.1944 -0.3873 206  GLN B N   
4861 C CA  . GLN B 282 ? 1.0601 2.2496 1.6635 0.0006  -0.1671 -0.3638 206  GLN B CA  
4862 C C   . GLN B 282 ? 1.0609 2.2067 1.5991 0.0208  -0.1507 -0.3164 206  GLN B C   
4863 O O   . GLN B 282 ? 1.0570 2.1495 1.5640 0.0191  -0.1398 -0.3033 206  GLN B O   
4864 C CB  . GLN B 282 ? 1.0714 2.2577 1.7452 -0.0309 -0.1502 -0.3605 206  GLN B CB  
4865 C CG  . GLN B 282 ? 1.3327 2.4482 2.0051 -0.0496 -0.1196 -0.3275 206  GLN B CG  
4866 C CD  . GLN B 282 ? 1.6617 2.7676 2.4092 -0.0852 -0.1054 -0.3386 206  GLN B CD  
4867 O OE1 . GLN B 282 ? 1.6272 2.6930 2.3923 -0.1039 -0.0984 -0.3488 206  GLN B OE1 
4868 N NE2 . GLN B 282 ? 1.5888 2.7293 2.3850 -0.0951 -0.0983 -0.3346 206  GLN B NE2 
4869 N N   . TRP B 283 ? 0.9751 2.1452 1.4959 0.0403  -0.1502 -0.2928 207  TRP B N   
4870 C CA  . TRP B 283 ? 0.9435 2.0779 1.4100 0.0600  -0.1364 -0.2506 207  TRP B CA  
4871 C C   . TRP B 283 ? 0.9726 2.0982 1.3784 0.0867  -0.1448 -0.2451 207  TRP B C   
4872 O O   . TRP B 283 ? 0.9578 2.0322 1.3277 0.0906  -0.1303 -0.2178 207  TRP B O   
4873 C CB  . TRP B 283 ? 0.9143 2.0819 1.3840 0.0754  -0.1353 -0.2325 207  TRP B CB  
4874 C CG  . TRP B 283 ? 0.9069 2.0475 1.4023 0.0574  -0.1125 -0.2108 207  TRP B CG  
4875 C CD1 . TRP B 283 ? 0.9386 2.1094 1.4907 0.0405  -0.1076 -0.2198 207  TRP B CD1 
4876 C CD2 . TRP B 283 ? 0.8928 1.9727 1.3580 0.0552  -0.0911 -0.1772 207  TRP B CD2 
4877 N NE1 . TRP B 283 ? 0.9179 2.0502 1.4720 0.0300  -0.0829 -0.1920 207  TRP B NE1 
4878 C CE2 . TRP B 283 ? 0.9312 2.0077 1.4313 0.0390  -0.0739 -0.1669 207  TRP B CE2 
4879 C CE3 . TRP B 283 ? 0.9067 1.9370 1.3199 0.0664  -0.0851 -0.1550 207  TRP B CE3 
4880 C CZ2 . TRP B 283 ? 0.9144 1.9404 1.3938 0.0351  -0.0528 -0.1372 207  TRP B CZ2 
4881 C CZ3 . TRP B 283 ? 0.9148 1.8955 1.3133 0.0604  -0.0656 -0.1269 207  TRP B CZ3 
4882 C CH2 . TRP B 283 ? 0.9153 1.8941 1.3440 0.0456  -0.0505 -0.1191 207  TRP B CH2 
4883 N N   . SER B 284 ? 0.9325 2.1096 1.3274 0.1058  -0.1678 -0.2704 208  SER B N   
4884 C CA  . SER B 284 ? 0.9404 2.1166 1.2768 0.1342  -0.1750 -0.2655 208  SER B CA  
4885 C C   . SER B 284 ? 0.9865 2.1175 1.3115 0.1215  -0.1684 -0.2754 208  SER B C   
4886 O O   . SER B 284 ? 0.9771 2.0760 1.2553 0.1373  -0.1593 -0.2523 208  SER B O   
4887 C CB  . SER B 284 ? 1.0021 2.2487 1.3311 0.1576  -0.2021 -0.2937 208  SER B CB  
4888 O OG  . SER B 284 ? 1.0950 2.3831 1.4316 0.1736  -0.2077 -0.2807 208  SER B OG  
4889 N N   . ALA B 285 ? 0.9437 2.0702 1.3157 0.0927  -0.1711 -0.3080 209  ALA B N   
4890 C CA  . ALA B 285 ? 0.9474 2.0299 1.3179 0.0785  -0.1643 -0.3203 209  ALA B CA  
4891 C C   . ALA B 285 ? 0.9682 1.9830 1.3341 0.0642  -0.1384 -0.2835 209  ALA B C   
4892 O O   . ALA B 285 ? 0.9736 1.9498 1.3074 0.0701  -0.1300 -0.2720 209  ALA B O   
4893 C CB  . ALA B 285 ? 0.9718 2.0698 1.4009 0.0519  -0.1745 -0.3657 209  ALA B CB  
4894 N N   . GLY B 286 ? 0.8903 1.8949 1.2868 0.0477  -0.1264 -0.2654 210  GLY B N   
4895 C CA  . GLY B 286 ? 0.8630 1.8101 1.2551 0.0358  -0.1038 -0.2311 210  GLY B CA  
4896 C C   . GLY B 286 ? 0.8953 1.8185 1.2337 0.0587  -0.0965 -0.1951 210  GLY B C   
4897 O O   . GLY B 286 ? 0.8913 1.7652 1.2123 0.0549  -0.0839 -0.1763 210  GLY B O   
4898 N N   . ILE B 287 ? 0.8432 1.8020 1.1582 0.0831  -0.1046 -0.1856 211  ILE B N   
4899 C CA  . ILE B 287 ? 0.8339 1.7739 1.1032 0.1065  -0.0979 -0.1519 211  ILE B CA  
4900 C C   . ILE B 287 ? 0.9205 1.8524 1.1523 0.1233  -0.1009 -0.1534 211  ILE B C   
4901 O O   . ILE B 287 ? 0.9096 1.8018 1.1155 0.1295  -0.0888 -0.1268 211  ILE B O   
4902 C CB  . ILE B 287 ? 0.8633 1.8425 1.1247 0.1277  -0.1037 -0.1401 211  ILE B CB  
4903 C CG1 . ILE B 287 ? 0.8461 1.8221 1.1390 0.1129  -0.0944 -0.1303 211  ILE B CG1 
4904 C CG2 . ILE B 287 ? 0.8680 1.8346 1.0827 0.1565  -0.0993 -0.1094 211  ILE B CG2 
4905 C CD1 . ILE B 287 ? 0.8777 1.7943 1.1638 0.1009  -0.0745 -0.1019 211  ILE B CD1 
4906 N N   . ALA B 288 ? 0.9127 1.8823 1.1432 0.1304  -0.1166 -0.1856 212  ALA B N   
4907 C CA  . ALA B 288 ? 0.9333 1.8994 1.1266 0.1482  -0.1184 -0.1900 212  ALA B CA  
4908 C C   . ALA B 288 ? 0.9693 1.8806 1.1669 0.1308  -0.1046 -0.1866 212  ALA B C   
4909 O O   . ALA B 288 ? 0.9702 1.8577 1.1356 0.1446  -0.0954 -0.1675 212  ALA B O   
4910 C CB  . ALA B 288 ? 0.9725 1.9903 1.1668 0.1569  -0.1393 -0.2312 212  ALA B CB  
4911 N N   . LEU B 289 ? 0.9064 1.7982 1.1466 0.1011  -0.1018 -0.2024 213  LEU B N   
4912 C CA  . LEU B 289 ? 0.8936 1.7335 1.1461 0.0825  -0.0889 -0.1992 213  LEU B CA  
4913 C C   . LEU B 289 ? 0.8902 1.6857 1.1280 0.0822  -0.0726 -0.1579 213  LEU B C   
4914 O O   . LEU B 289 ? 0.8848 1.6443 1.1105 0.0825  -0.0635 -0.1470 213  LEU B O   
4915 C CB  . LEU B 289 ? 0.8979 1.7324 1.2034 0.0524  -0.0892 -0.2226 213  LEU B CB  
4916 C CG  . LEU B 289 ? 0.9905 1.8270 1.3174 0.0426  -0.0965 -0.2626 213  LEU B CG  
4917 C CD1 . LEU B 289 ? 1.0162 1.9104 1.3341 0.0588  -0.1180 -0.2979 213  LEU B CD1 
4918 C CD2 . LEU B 289 ? 1.0316 1.8516 1.4165 0.0107  -0.0913 -0.2769 213  LEU B CD2 
4919 N N   . MET B 290 ? 0.8129 1.6129 1.0520 0.0831  -0.0697 -0.1366 214  MET B N   
4920 C CA  . MET B 290 ? 0.7870 1.5484 1.0124 0.0840  -0.0569 -0.1012 214  MET B CA  
4921 C C   . MET B 290 ? 0.8239 1.5803 1.0113 0.1085  -0.0543 -0.0800 214  MET B C   
4922 O O   . MET B 290 ? 0.8121 1.5305 0.9907 0.1078  -0.0443 -0.0566 214  MET B O   
4923 C CB  . MET B 290 ? 0.8021 1.5723 1.0393 0.0801  -0.0548 -0.0888 214  MET B CB  
4924 N N   . LYS B 291 ? 0.7837 1.5795 0.9504 0.1306  -0.0631 -0.0874 215  LYS B N   
4925 C CA  . LYS B 291 ? 0.7889 1.5846 0.9204 0.1563  -0.0586 -0.0661 215  LYS B CA  
4926 C C   . LYS B 291 ? 0.8511 1.6214 0.9721 0.1569  -0.0511 -0.0666 215  LYS B C   
4927 O O   . LYS B 291 ? 0.8455 1.5920 0.9513 0.1667  -0.0400 -0.0400 215  LYS B O   
4928 C CB  . LYS B 291 ? 0.8370 1.6857 0.9480 0.1812  -0.0702 -0.0757 215  LYS B CB  
4929 N N   . ASN B 292 ? 0.8169 1.5923 0.9500 0.1462  -0.0565 -0.0977 216  ASN B N   
4930 C CA  . ASN B 292 ? 0.8232 1.5777 0.9494 0.1471  -0.0500 -0.1043 216  ASN B CA  
4931 C C   . ASN B 292 ? 0.8638 1.5669 1.0100 0.1276  -0.0385 -0.0894 216  ASN B C   
4932 O O   . ASN B 292 ? 0.8760 1.5565 1.0112 0.1349  -0.0284 -0.0741 216  ASN B O   
4933 C CB  . ASN B 292 ? 0.8250 1.6020 0.9605 0.1425  -0.0610 -0.1466 216  ASN B CB  
4934 C CG  . ASN B 292 ? 1.0537 1.8852 1.1668 0.1641  -0.0754 -0.1675 216  ASN B CG  
4935 O OD1 . ASN B 292 ? 0.9524 1.8122 1.0844 0.1557  -0.0900 -0.2028 216  ASN B OD1 
4936 N ND2 . ASN B 292 ? 0.9485 1.7970 1.0222 0.1929  -0.0716 -0.1471 216  ASN B ND2 
4937 N N   . ILE B 293 ? 0.7893 1.4763 0.9652 0.1042  -0.0395 -0.0938 217  ILE B N   
4938 C CA  . ILE B 293 ? 0.7686 1.4099 0.9621 0.0870  -0.0302 -0.0801 217  ILE B CA  
4939 C C   . ILE B 293 ? 0.7777 1.3964 0.9580 0.0939  -0.0228 -0.0449 217  ILE B C   
4940 O O   . ILE B 293 ? 0.7646 1.3567 0.9423 0.0961  -0.0154 -0.0316 217  ILE B O   
4941 C CB  . ILE B 293 ? 0.8063 1.4403 1.0326 0.0629  -0.0314 -0.0908 217  ILE B CB  
4942 C CG1 . ILE B 293 ? 0.8310 1.4861 1.0804 0.0532  -0.0390 -0.1287 217  ILE B CG1 
4943 C CG2 . ILE B 293 ? 0.8106 1.3987 1.0506 0.0482  -0.0217 -0.0726 217  ILE B CG2 
4944 C CD1 . ILE B 293 ? 0.9368 1.5805 1.1872 0.0552  -0.0382 -0.1500 217  ILE B CD1 
4945 N N   . LEU B 294 ? 0.7188 1.3490 0.8937 0.0978  -0.0250 -0.0317 218  LEU B N   
4946 C CA  . LEU B 294 ? 0.7024 1.3112 0.8690 0.1031  -0.0196 -0.0025 218  LEU B CA  
4947 C C   . LEU B 294 ? 0.7488 1.3618 0.8953 0.1243  -0.0149 0.0142  218  LEU B C   
4948 O O   . LEU B 294 ? 0.7384 1.3255 0.8861 0.1257  -0.0087 0.0360  218  LEU B O   
4949 C CB  . LEU B 294 ? 0.6940 1.3144 0.8622 0.1022  -0.0229 0.0032  218  LEU B CB  
4950 C CG  . LEU B 294 ? 0.7439 1.3431 0.9286 0.0832  -0.0212 0.0051  218  LEU B CG  
4951 C CD1 . LEU B 294 ? 0.7429 1.3647 0.9305 0.0840  -0.0239 0.0037  218  LEU B CD1 
4952 C CD2 . LEU B 294 ? 0.7591 1.3197 0.9408 0.0808  -0.0165 0.0264  218  LEU B CD2 
4953 N N   . GLY B 295 ? 0.7088 1.3559 0.8385 0.1412  -0.0177 0.0048  219  GLY B N   
4954 C CA  . GLY B 295 ? 0.7134 1.3691 0.8218 0.1644  -0.0107 0.0235  219  GLY B CA  
4955 C C   . GLY B 295 ? 0.7750 1.4305 0.8732 0.1737  -0.0036 0.0201  219  GLY B C   
4956 O O   . GLY B 295 ? 0.7782 1.4354 0.8620 0.1920  0.0065  0.0412  219  GLY B O   
4957 N N   . PHE B 296 ? 0.7423 1.3953 0.8491 0.1625  -0.0069 -0.0057 220  PHE B N   
4958 C CA  . PHE B 296 ? 0.7648 1.4182 0.8610 0.1733  0.0005  -0.0117 220  PHE B CA  
4959 C C   . PHE B 296 ? 0.7933 1.4164 0.9124 0.1552  0.0029  -0.0246 220  PHE B C   
4960 O O   . PHE B 296 ? 0.7819 1.3844 0.9045 0.1588  0.0139  -0.0101 220  PHE B O   
4961 C CB  . PHE B 296 ? 0.8245 1.5206 0.8957 0.1911  -0.0064 -0.0362 220  PHE B CB  
4962 C CG  . PHE B 296 ? 0.8809 1.5838 0.9308 0.2103  0.0037  -0.0381 220  PHE B CG  
4963 C CD1 . PHE B 296 ? 0.9368 1.6473 0.9640 0.2339  0.0172  -0.0084 220  PHE B CD1 
4964 C CD2 . PHE B 296 ? 0.9298 1.6320 0.9834 0.2058  0.0013  -0.0696 220  PHE B CD2 
4965 C CE1 . PHE B 296 ? 0.9779 1.6971 0.9843 0.2533  0.0293  -0.0086 220  PHE B CE1 
4966 C CE2 . PHE B 296 ? 0.9918 1.7016 1.0236 0.2257  0.0119  -0.0726 220  PHE B CE2 
4967 C CZ  . PHE B 296 ? 0.9797 1.6994 0.9869 0.2498  0.0263  -0.0414 220  PHE B CZ  
4968 N N   . ILE B 297 ? 0.7423 1.3631 0.8798 0.1367  -0.0062 -0.0502 221  ILE B N   
4969 C CA  . ILE B 297 ? 0.7418 1.3331 0.9028 0.1205  -0.0035 -0.0628 221  ILE B CA  
4970 C C   . ILE B 297 ? 0.7656 1.3183 0.9420 0.1111  0.0040  -0.0349 221  ILE B C   
4971 O O   . ILE B 297 ? 0.7693 1.3053 0.9486 0.1164  0.0126  -0.0268 221  ILE B O   
4972 C CB  . ILE B 297 ? 0.7871 1.3821 0.9707 0.1012  -0.0129 -0.0916 221  ILE B CB  
4973 C CG1 . ILE B 297 ? 0.8197 1.4569 0.9924 0.1103  -0.0237 -0.1249 221  ILE B CG1 
4974 C CG2 . ILE B 297 ? 0.7993 1.3581 1.0109 0.0842  -0.0079 -0.1000 221  ILE B CG2 
4975 C CD1 . ILE B 297 ? 0.9752 1.6274 1.1247 0.1308  -0.0214 -0.1422 221  ILE B CD1 
4976 N N   . ILE B 298 ? 0.6939 1.2351 0.8797 0.0987  0.0003  -0.0215 222  ILE B N   
4977 C CA  . ILE B 298 ? 0.6715 1.1794 0.8698 0.0903  0.0039  0.0020  222  ILE B CA  
4978 C C   . ILE B 298 ? 0.7241 1.2284 0.9147 0.1049  0.0108  0.0250  222  ILE B C   
4979 O O   . ILE B 298 ? 0.7165 1.1993 0.9199 0.1035  0.0160  0.0334  222  ILE B O   
4980 C CB  . ILE B 298 ? 0.6885 1.1897 0.8918 0.0782  -0.0013 0.0104  222  ILE B CB  
4981 C CG1 . ILE B 298 ? 0.6976 1.1937 0.9185 0.0607  -0.0035 -0.0074 222  ILE B CG1 
4982 C CG2 . ILE B 298 ? 0.6766 1.1502 0.8847 0.0756  0.0000  0.0349  222  ILE B CG2 
4983 C CD1 . ILE B 298 ? 0.7846 1.2862 1.0085 0.0512  -0.0067 -0.0043 222  ILE B CD1 
4984 N N   . PRO B 299 ? 0.6895 1.2145 0.8630 0.1196  0.0122  0.0359  223  PRO B N   
4985 C CA  . PRO B 299 ? 0.6877 1.2070 0.8613 0.1321  0.0218  0.0595  223  PRO B CA  
4986 C C   . PRO B 299 ? 0.7504 1.2701 0.9248 0.1412  0.0317  0.0559  223  PRO B C   
4987 O O   . PRO B 299 ? 0.7444 1.2440 0.9372 0.1390  0.0377  0.0700  223  PRO B O   
4988 C CB  . PRO B 299 ? 0.7158 1.2603 0.8695 0.1480  0.0230  0.0688  223  PRO B CB  
4989 C CG  . PRO B 299 ? 0.7647 1.3198 0.9144 0.1396  0.0117  0.0559  223  PRO B CG  
4990 C CD  . PRO B 299 ? 0.7125 1.2664 0.8700 0.1261  0.0063  0.0299  223  PRO B CD  
4991 N N   . LEU B 300 ? 0.7210 1.2639 0.8777 0.1510  0.0324  0.0345  224  LEU B N   
4992 C CA  . LEU B 300 ? 0.7399 1.2857 0.8933 0.1626  0.0428  0.0277  224  LEU B CA  
4993 C C   . LEU B 300 ? 0.7876 1.3034 0.9675 0.1489  0.0441  0.0217  224  LEU B C   
4994 O O   . LEU B 300 ? 0.8012 1.3107 0.9885 0.1576  0.0555  0.0299  224  LEU B O   
4995 C CB  . LEU B 300 ? 0.7701 1.3473 0.8977 0.1753  0.0399  -0.0005 224  LEU B CB  
4996 C CG  . LEU B 300 ? 0.8590 1.4535 0.9661 0.1989  0.0532  -0.0023 224  LEU B CG  
4997 C CD1 . LEU B 300 ? 0.8796 1.4609 0.9980 0.1950  0.0557  -0.0269 224  LEU B CD1 
4998 C CD2 . LEU B 300 ? 0.8785 1.4692 0.9871 0.2120  0.0700  0.0346  224  LEU B CD2 
4999 N N   . ILE B 301 ? 0.7220 1.2198 0.9175 0.1292  0.0341  0.0103  225  ILE B N   
5000 C CA  . ILE B 301 ? 0.7090 1.1762 0.9299 0.1172  0.0352  0.0087  225  ILE B CA  
5001 C C   . ILE B 301 ? 0.7412 1.1923 0.9772 0.1196  0.0406  0.0374  225  ILE B C   
5002 O O   . ILE B 301 ? 0.7488 1.1915 0.9975 0.1257  0.0491  0.0400  225  ILE B O   
5003 C CB  . ILE B 301 ? 0.7377 1.1888 0.9715 0.0969  0.0257  -0.0002 225  ILE B CB  
5004 C CG1 . ILE B 301 ? 0.7649 1.2270 0.9983 0.0923  0.0223  -0.0333 225  ILE B CG1 
5005 C CG2 . ILE B 301 ? 0.7334 1.1505 0.9911 0.0868  0.0266  0.0124  225  ILE B CG2 
5006 C CD1 . ILE B 301 ? 0.8622 1.3191 1.1083 0.0730  0.0146  -0.0422 225  ILE B CD1 
5007 N N   . PHE B 302 ? 0.6687 1.1186 0.9047 0.1161  0.0358  0.0569  226  PHE B N   
5008 C CA  . PHE B 302 ? 0.6494 1.0866 0.9034 0.1165  0.0375  0.0816  226  PHE B CA  
5009 C C   . PHE B 302 ? 0.7007 1.1498 0.9587 0.1325  0.0515  0.0944  226  PHE B C   
5010 O O   . PHE B 302 ? 0.6934 1.1311 0.9757 0.1331  0.0564  0.1046  226  PHE B O   
5011 C CB  . PHE B 302 ? 0.6597 1.0964 0.9097 0.1114  0.0294  0.0938  226  PHE B CB  
5012 C CG  . PHE B 302 ? 0.6735 1.0940 0.9253 0.0960  0.0174  0.0894  226  PHE B CG  
5013 C CD1 . PHE B 302 ? 0.7122 1.1408 0.9494 0.0898  0.0128  0.0736  226  PHE B CD1 
5014 C CD2 . PHE B 302 ? 0.7004 1.1006 0.9690 0.0889  0.0107  0.1014  226  PHE B CD2 
5015 C CE1 . PHE B 302 ? 0.7215 1.1364 0.9606 0.0767  0.0052  0.0724  226  PHE B CE1 
5016 C CE2 . PHE B 302 ? 0.7325 1.1194 0.9975 0.0777  0.0012  0.0992  226  PHE B CE2 
5017 C CZ  . PHE B 302 ? 0.7105 1.1041 0.9606 0.0717  0.0001  0.0861  226  PHE B CZ  
5018 N N   . ILE B 303 ? 0.6735 1.1468 0.9088 0.1466  0.0588  0.0956  227  ILE B N   
5019 C CA  . ILE B 303 ? 0.6910 1.1783 0.9265 0.1645  0.0759  0.1114  227  ILE B CA  
5020 C C   . ILE B 303 ? 0.7730 1.2597 1.0152 0.1716  0.0861  0.1013  227  ILE B C   
5021 O O   . ILE B 303 ? 0.7720 1.2561 1.0365 0.1778  0.0984  0.1182  227  ILE B O   
5022 C CB  . ILE B 303 ? 0.7461 1.2618 0.9494 0.1821  0.0825  0.1146  227  ILE B CB  
5023 C CG1 . ILE B 303 ? 0.7418 1.2619 0.9314 0.1762  0.0696  0.1138  227  ILE B CG1 
5024 C CG2 . ILE B 303 ? 0.7711 1.2955 0.9818 0.1984  0.1020  0.1428  227  ILE B CG2 
5025 C CD1 . ILE B 303 ? 0.8381 1.3402 1.0492 0.1665  0.0652  0.1352  227  ILE B CD1 
5026 N N   . ALA B 304 ? 0.7511 1.2400 0.9782 0.1702  0.0811  0.0729  228  ALA B N   
5027 C CA  . ALA B 304 ? 0.7740 1.2605 1.0055 0.1774  0.0898  0.0575  228  ALA B CA  
5028 C C   . ALA B 304 ? 0.8299 1.2878 1.0976 0.1658  0.0880  0.0631  228  ALA B C   
5029 O O   . ALA B 304 ? 0.8450 1.3019 1.1278 0.1758  0.1007  0.0678  228  ALA B O   
5030 C CB  . ALA B 304 ? 0.8011 1.2957 1.0109 0.1771  0.0826  0.0226  228  ALA B CB  
5031 N N   . THR B 305 ? 0.7650 1.2018 1.0458 0.1470  0.0732  0.0637  229  THR B N   
5032 C CA  . THR B 305 ? 0.7532 1.1643 1.0654 0.1380  0.0695  0.0711  229  THR B CA  
5033 C C   . THR B 305 ? 0.7798 1.1919 1.1179 0.1427  0.0749  0.0976  229  THR B C   
5034 O O   . THR B 305 ? 0.7844 1.1884 1.1486 0.1466  0.0804  0.1025  229  THR B O   
5035 C CB  . THR B 305 ? 0.8985 1.2901 1.2137 0.1200  0.0539  0.0692  229  THR B CB  
5036 O OG1 . THR B 305 ? 0.9575 1.3589 1.2546 0.1144  0.0459  0.0728  229  THR B OG1 
5037 C CG2 . THR B 305 ? 0.9156 1.2936 1.2296 0.1131  0.0520  0.0459  229  THR B CG2 
5038 N N   . CYS B 306 ? 0.7080 1.1311 1.0426 0.1430  0.0740  0.1139  230  CYS B N   
5039 C CA  . CYS B 306 ? 0.6861 1.1116 1.0506 0.1455  0.0789  0.1381  230  CYS B CA  
5040 C C   . CYS B 306 ? 0.7308 1.1726 1.1049 0.1626  0.1006  0.1459  230  CYS B C   
5041 O O   . CYS B 306 ? 0.7127 1.1521 1.1235 0.1638  0.1056  0.1591  230  CYS B O   
5042 C CB  . CYS B 306 ? 0.6747 1.1048 1.0338 0.1414  0.0736  0.1508  230  CYS B CB  
5043 S SG  . CYS B 306 ? 0.7034 1.1140 1.0597 0.1227  0.0495  0.1463  230  CYS B SG  
5044 N N   . TYR B 307 ? 0.7085 1.1690 1.0501 0.1770  0.1132  0.1374  231  TYR B N   
5045 C CA  . TYR B 307 ? 0.7338 1.2121 1.0779 0.1964  0.1363  0.1449  231  TYR B CA  
5046 C C   . TYR B 307 ? 0.8160 1.2856 1.1796 0.1999  0.1415  0.1338  231  TYR B C   
5047 O O   . TYR B 307 ? 0.8090 1.2842 1.2034 0.2079  0.1560  0.1495  231  TYR B O   
5048 C CB  . TYR B 307 ? 0.7755 1.2776 1.0733 0.2139  0.1465  0.1351  231  TYR B CB  
5049 C CG  . TYR B 307 ? 0.8294 1.3493 1.1224 0.2363  0.1705  0.1368  231  TYR B CG  
5050 C CD1 . TYR B 307 ? 0.8588 1.3896 1.1768 0.2467  0.1915  0.1668  231  TYR B CD1 
5051 C CD2 . TYR B 307 ? 0.8626 1.3873 1.1312 0.2464  0.1729  0.1075  231  TYR B CD2 
5052 C CE1 . TYR B 307 ? 0.8955 1.4433 1.2110 0.2681  0.2159  0.1699  231  TYR B CE1 
5053 C CE2 . TYR B 307 ? 0.9045 1.4452 1.1676 0.2685  0.1955  0.1073  231  TYR B CE2 
5054 C CZ  . TYR B 307 ? 1.0128 1.5659 1.2977 0.2801  0.2178  0.1397  231  TYR B CZ  
5055 O OH  . TYR B 307 ? 1.0656 1.6368 1.3444 0.3036  0.2429  0.1413  231  TYR B OH  
5056 N N   . PHE B 308 ? 0.8037 1.2601 1.1525 0.1944  0.1311  0.1071  232  PHE B N   
5057 C CA  . PHE B 308 ? 0.8294 1.2734 1.1959 0.1982  0.1357  0.0942  232  PHE B CA  
5058 C C   . PHE B 308 ? 0.8760 1.2996 1.2857 0.1863  0.1259  0.1086  232  PHE B C   
5059 O O   . PHE B 308 ? 0.8807 1.2975 1.3158 0.1928  0.1328  0.1078  232  PHE B O   
5060 C CB  . PHE B 308 ? 0.8734 1.3075 1.2148 0.1952  0.1281  0.0608  232  PHE B CB  
5061 C CG  . PHE B 308 ? 0.9231 1.3811 1.2260 0.2122  0.1385  0.0412  232  PHE B CG  
5062 C CD1 . PHE B 308 ? 0.9925 1.4612 1.2927 0.2324  0.1572  0.0332  232  PHE B CD1 
5063 C CD2 . PHE B 308 ? 0.9490 1.4210 1.2172 0.2098  0.1292  0.0300  232  PHE B CD2 
5064 C CE1 . PHE B 308 ? 1.0341 1.5276 1.2934 0.2509  0.1657  0.0138  232  PHE B CE1 
5065 C CE2 . PHE B 308 ? 1.0135 1.5115 1.2438 0.2279  0.1364  0.0111  232  PHE B CE2 
5066 C CZ  . PHE B 308 ? 1.0213 1.5299 1.2453 0.2486  0.1542  0.0026  232  PHE B CZ  
5067 N N   . GLY B 309 ? 0.8163 1.2324 1.2328 0.1713  0.1097  0.1212  233  GLY B N   
5068 C CA  . GLY B 309 ? 0.7999 1.2016 1.2527 0.1614  0.0972  0.1353  233  GLY B CA  
5069 C C   . GLY B 309 ? 0.8424 1.2591 1.3330 0.1673  0.1064  0.1581  233  GLY B C   
5070 O O   . GLY B 309 ? 0.8316 1.2430 1.3606 0.1646  0.0997  0.1680  233  GLY B O   
5071 N N   . ILE B 310 ? 0.8039 1.2408 1.2860 0.1761  0.1222  0.1676  234  ILE B N   
5072 C CA  . ILE B 310 ? 0.7991 1.2528 1.3192 0.1824  0.1369  0.1911  234  ILE B CA  
5073 C C   . ILE B 310 ? 0.8599 1.3273 1.3884 0.2014  0.1614  0.1906  234  ILE B C   
5074 O O   . ILE B 310 ? 0.8485 1.3244 1.4234 0.2056  0.1709  0.2056  234  ILE B O   
5075 C CB  . ILE B 310 ? 0.8359 1.3013 1.3421 0.1827  0.1432  0.2050  234  ILE B CB  
5076 C CG1 . ILE B 310 ? 0.8223 1.2737 1.3332 0.1644  0.1196  0.2074  234  ILE B CG1 
5077 C CG2 . ILE B 310 ? 0.8488 1.3335 1.3906 0.1930  0.1672  0.2302  234  ILE B CG2 
5078 C CD1 . ILE B 310 ? 0.8989 1.3549 1.3792 0.1642  0.1207  0.2121  234  ILE B CD1 
5079 N N   . ARG B 311 ? 0.8345 1.3056 1.3196 0.2132  0.1709  0.1715  235  ARG B N   
5080 C CA  . ARG B 311 ? 0.8559 1.3394 1.3386 0.2334  0.1937  0.1649  235  ARG B CA  
5081 C C   . ARG B 311 ? 0.9122 1.3810 1.4281 0.2331  0.1901  0.1573  235  ARG B C   
5082 O O   . ARG B 311 ? 0.9287 1.4100 1.4742 0.2467  0.2088  0.1669  235  ARG B O   
5083 C CB  . ARG B 311 ? 0.8785 1.3678 1.3042 0.2447  0.1985  0.1394  235  ARG B CB  
5084 C CG  . ARG B 311 ? 1.0206 1.5287 1.4345 0.2700  0.2249  0.1331  235  ARG B CG  
5085 C CD  . ARG B 311 ? 1.1463 1.6627 1.5027 0.2814  0.2255  0.1038  235  ARG B CD  
5086 N NE  . ARG B 311 ? 1.2853 1.7938 1.6376 0.2919  0.2306  0.0750  235  ARG B NE  
5087 C CZ  . ARG B 311 ? 1.4872 2.0025 1.7960 0.3036  0.2312  0.0425  235  ARG B CZ  
5088 N NH1 . ARG B 311 ? 1.2922 1.8257 1.5560 0.3074  0.2262  0.0358  235  ARG B NH1 
5089 N NH2 . ARG B 311 ? 1.3636 1.8681 1.6751 0.3123  0.2359  0.0151  235  ARG B NH2 
5090 N N   . LYS B 312 ? 0.8564 1.2995 1.3687 0.2194  0.1681  0.1423  236  LYS B N   
5091 C CA  . LYS B 312 ? 0.8615 1.2874 1.4039 0.2204  0.1638  0.1368  236  LYS B CA  
5092 C C   . LYS B 312 ? 0.9185 1.3508 1.5172 0.2181  0.1607  0.1615  236  LYS B C   
5093 O O   . LYS B 312 ? 0.9236 1.3600 1.5548 0.2301  0.1720  0.1645  236  LYS B O   
5094 C CB  . LYS B 312 ? 0.8816 1.2783 1.4080 0.2061  0.1424  0.1206  236  LYS B CB  
5095 N N   . HIS B 313 ? 0.8722 1.3073 1.4842 0.2038  0.1455  0.1775  237  HIS B N   
5096 C CA  . HIS B 313 ? 0.8637 1.3070 1.5309 0.1989  0.1372  0.1976  237  HIS B CA  
5097 C C   . HIS B 313 ? 0.9395 1.4101 1.6455 0.2112  0.1620  0.2146  237  HIS B C   
5098 O O   . HIS B 313 ? 0.9369 1.4160 1.6925 0.2166  0.1644  0.2234  237  HIS B O   
5099 C CB  . HIS B 313 ? 0.8527 1.2922 1.5192 0.1811  0.1153  0.2052  237  HIS B CB  
5100 C CG  . HIS B 313 ? 0.8835 1.3286 1.6036 0.1741  0.0988  0.2188  237  HIS B CG  
5101 N ND1 . HIS B 313 ? 0.9041 1.3338 1.6284 0.1676  0.0735  0.2148  237  HIS B ND1 
5102 C CD2 . HIS B 313 ? 0.8989 1.3648 1.6702 0.1730  0.1038  0.2356  237  HIS B CD2 
5103 C CE1 . HIS B 313 ? 0.8875 1.3311 1.6626 0.1638  0.0615  0.2268  237  HIS B CE1 
5104 N NE2 . HIS B 313 ? 0.8877 1.3529 1.6960 0.1655  0.0788  0.2386  237  HIS B NE2 
5105 N N   . LEU B 314 ? 0.9200 1.4057 1.6051 0.2168  0.1812  0.2209  238  LEU B N   
5106 C CA  . LEU B 314 ? 0.9364 1.4487 1.6569 0.2289  0.2088  0.2411  238  LEU B CA  
5107 C C   . LEU B 314 ? 1.0362 1.5588 1.7539 0.2513  0.2344  0.2342  238  LEU B C   
5108 O O   . LEU B 314 ? 1.0441 1.5898 1.7999 0.2630  0.2587  0.2518  238  LEU B O   
5109 C CB  . LEU B 314 ? 0.9397 1.4636 1.6375 0.2294  0.2222  0.2541  238  LEU B CB  
5110 C CG  . LEU B 314 ? 0.9772 1.5021 1.7114 0.2122  0.2106  0.2728  238  LEU B CG  
5111 C CD1 . LEU B 314 ? 0.9694 1.5057 1.7823 0.2067  0.2087  0.2879  238  LEU B CD1 
5112 C CD2 . LEU B 314 ? 0.9846 1.4870 1.6906 0.1944  0.1789  0.2594  238  LEU B CD2 
5113 N N   . LEU B 315 ? 1.0213 1.5265 1.6987 0.2570  0.2297  0.2083  239  LEU B N   
5114 C CA  . LEU B 315 ? 1.0561 1.5664 1.7287 0.2785  0.2514  0.1959  239  LEU B CA  
5115 C C   . LEU B 315 ? 1.1223 1.6248 1.8459 0.2802  0.2449  0.1966  239  LEU B C   
5116 O O   . LEU B 315 ? 1.1407 1.6565 1.8881 0.2987  0.2671  0.1982  239  LEU B O   
5117 C CB  . LEU B 315 ? 1.0777 1.5723 1.6875 0.2834  0.2487  0.1644  239  LEU B CB  
5118 C CG  . LEU B 315 ? 1.1714 1.6858 1.7421 0.3068  0.2764  0.1545  239  LEU B CG  
5119 C CD1 . LEU B 315 ? 1.1710 1.6942 1.6896 0.3045  0.2744  0.1529  239  LEU B CD1 
5120 C CD2 . LEU B 315 ? 1.2438 1.7433 1.7918 0.3188  0.2789  0.1211  239  LEU B CD2 
5121 N N   . LYS B 316 ? 1.0679 1.5505 1.8075 0.2627  0.2151  0.1968  240  LYS B N   
5122 C CA  . LYS B 316 ? 1.0680 1.5418 1.8526 0.2639  0.2033  0.1995  240  LYS B CA  
5123 C C   . LYS B 316 ? 1.1202 1.6220 1.9747 0.2661  0.2084  0.2243  240  LYS B C   
5124 O O   . LYS B 316 ? 1.1112 1.6141 2.0092 0.2724  0.2031  0.2281  240  LYS B O   
5125 C CB  . LYS B 316 ? 1.0826 1.5294 1.8549 0.2461  0.1701  0.1945  240  LYS B CB  
5126 N N   . THR B 317 ? 1.0884 1.6131 1.9569 0.2615  0.2191  0.2412  241  THR B N   
5127 C CA  . THR B 317 ? 1.0856 1.6389 2.0259 0.2604  0.2255  0.2648  241  THR B CA  
5128 C C   . THR B 317 ? 1.1683 1.7461 2.1430 0.2828  0.2597  0.2726  241  THR B C   
5129 O O   . THR B 317 ? 1.1588 1.7557 2.2017 0.2854  0.2598  0.2856  241  THR B O   
5130 C CB  . THR B 317 ? 1.1979 1.7627 2.1416 0.2473  0.2282  0.2802  241  THR B CB  
5131 O OG1 . THR B 317 ? 1.2308 1.8022 2.1296 0.2594  0.2574  0.2811  241  THR B OG1 
5132 C CG2 . THR B 317 ? 1.1564 1.7000 2.0754 0.2258  0.1944  0.2734  241  THR B CG2 
5133 N N   . ASN B 318 ? 1.1544 1.7342 2.0820 0.3001  0.2880  0.2640  242  ASN B N   
5134 C CA  . ASN B 318 ? 1.1829 1.7855 2.1269 0.3251  0.3247  0.2684  242  ASN B CA  
5135 C C   . ASN B 318 ? 1.2102 1.8491 2.2188 0.3267  0.3477  0.2997  242  ASN B C   
5136 O O   . ASN B 318 ? 1.1979 1.8554 2.2774 0.3300  0.3510  0.3117  242  ASN B O   
5137 C CB  . ASN B 318 ? 1.2515 1.8452 2.2168 0.3387  0.3229  0.2547  242  ASN B CB  
5138 C CG  . ASN B 318 ? 1.6998 2.2779 2.6065 0.3577  0.3382  0.2277  242  ASN B CG  
5139 O OD1 . ASN B 318 ? 1.6660 2.2137 2.5211 0.3505  0.3198  0.2045  242  ASN B OD1 
5140 N ND2 . ASN B 318 ? 1.6296 2.2291 2.5453 0.3827  0.3728  0.2290  242  ASN B ND2 
5141 N N   . SER B 319 ? 1.1550 1.8042 2.1399 0.3249  0.3643  0.3134  243  SER B N   
5142 C CA  . SER B 319 ? 1.1422 1.8223 2.1798 0.3256  0.3910  0.3454  243  SER B CA  
5143 C C   . SER B 319 ? 1.1946 1.9002 2.2259 0.3552  0.4368  0.3540  243  SER B C   
5144 O O   . SER B 319 ? 1.2115 1.9097 2.1708 0.3730  0.4487  0.3360  243  SER B O   
5145 C CB  . SER B 319 ? 1.1796 1.8536 2.1893 0.3114  0.3872  0.3568  243  SER B CB  
5146 O OG  . SER B 319 ? 1.3016 1.9585 2.2213 0.3189  0.3861  0.3382  243  SER B OG  
5147 N N   . TYR B 320 ? 1.1380 1.8753 2.2452 0.3610  0.4626  0.3803  244  TYR B N   
5148 C CA  . TYR B 320 ? 1.1668 1.9319 2.2756 0.3910  0.5088  0.3906  244  TYR B CA  
5149 C C   . TYR B 320 ? 1.2045 1.9993 2.3412 0.3965  0.5483  0.4282  244  TYR B C   
5150 O O   . TYR B 320 ? 1.2321 2.0403 2.3191 0.4219  0.5842  0.4342  244  TYR B O   
5151 C CB  . TYR B 320 ? 1.1870 1.9673 2.3614 0.4016  0.5138  0.3879  244  TYR B CB  
5152 C CG  . TYR B 320 ? 1.1759 1.9585 2.4352 0.3786  0.4818  0.3937  244  TYR B CG  
5153 C CD1 . TYR B 320 ? 1.1806 1.9325 2.4244 0.3625  0.4360  0.3708  244  TYR B CD1 
5154 C CD2 . TYR B 320 ? 1.1773 1.9953 2.5340 0.3755  0.4983  0.4212  244  TYR B CD2 
5155 C CE1 . TYR B 320 ? 1.1661 1.9232 2.4823 0.3448  0.4051  0.3751  244  TYR B CE1 
5156 C CE2 . TYR B 320 ? 1.1586 1.9830 2.5943 0.3562  0.4662  0.4231  244  TYR B CE2 
5157 C CZ  . TYR B 320 ? 1.2424 2.0367 2.6544 0.3420  0.4188  0.3996  244  TYR B CZ  
5158 O OH  . TYR B 320 ? 1.2411 2.0444 2.7254 0.3259  0.3855  0.4008  244  TYR B OH  
5159 N N   . GLY B 321 ? 1.1221 1.9275 2.3383 0.3744  0.5425  0.4528  245  GLY B N   
5160 C CA  . GLY B 321 ? 1.1270 1.9582 2.3853 0.3762  0.5801  0.4918  245  GLY B CA  
5161 C C   . GLY B 321 ? 1.1637 1.9798 2.3620 0.3713  0.5827  0.5020  245  GLY B C   
5162 O O   . GLY B 321 ? 1.1743 1.9755 2.2775 0.3851  0.5807  0.4838  245  GLY B O   
5163 N N   . LYS B 322 ? 1.0956 1.9158 2.3529 0.3516  0.5862  0.5302  246  LYS B N   
5164 C CA  . LYS B 322 ? 1.0927 1.8974 2.3049 0.3456  0.5883  0.5438  246  LYS B CA  
5165 C C   . LYS B 322 ? 1.0849 1.8528 2.2476 0.3245  0.5363  0.5121  246  LYS B C   
5166 O O   . LYS B 322 ? 1.0809 1.8324 2.1914 0.3212  0.5316  0.5152  246  LYS B O   
5167 C CB  . LYS B 322 ? 1.1271 1.9448 2.4256 0.3312  0.6106  0.5840  246  LYS B CB  
5168 C CG  . LYS B 322 ? 1.2741 2.0850 2.6675 0.2963  0.5756  0.5799  246  LYS B CG  
5169 C CD  . LYS B 322 ? 1.3876 2.1648 2.7577 0.2714  0.5386  0.5694  246  LYS B CD  
5170 C CE  . LYS B 322 ? 1.5766 2.3476 2.9368 0.2722  0.5654  0.6010  246  LYS B CE  
5171 N NZ  . LYS B 322 ? 1.7380 2.5291 3.2075 0.2627  0.5962  0.6379  246  LYS B NZ  
5172 N N   . ASN B 323 ? 0.9992 1.7559 2.1805 0.3117  0.4990  0.4837  247  ASN B N   
5173 C CA  . ASN B 323 ? 0.9642 1.6883 2.1026 0.2936  0.4509  0.4530  247  ASN B CA  
5174 C C   . ASN B 323 ? 1.0258 1.7348 2.0588 0.3112  0.4493  0.4288  247  ASN B C   
5175 O O   . ASN B 323 ? 1.0100 1.6937 1.9907 0.2995  0.4206  0.4110  247  ASN B O   
5176 C CB  . ASN B 323 ? 0.9461 1.6665 2.1377 0.2790  0.4161  0.4346  247  ASN B CB  
5177 C CG  . ASN B 323 ? 1.3292 2.0782 2.5862 0.2922  0.4359  0.4421  247  ASN B CG  
5178 O OD1 . ASN B 323 ? 1.2748 2.0517 2.6065 0.2927  0.4629  0.4695  247  ASN B OD1 
5179 N ND2 . ASN B 323 ? 1.2400 1.9823 2.4771 0.3021  0.4221  0.4185  247  ASN B ND2 
5180 N N   . ARG B 324 ? 1.0107 1.7366 2.0142 0.3396  0.4805  0.4268  248  ARG B N   
5181 C CA  . ARG B 324 ? 1.0344 1.7509 1.9415 0.3592  0.4826  0.4019  248  ARG B CA  
5182 C C   . ARG B 324 ? 1.1209 1.8399 1.9706 0.3670  0.4982  0.4168  248  ARG B C   
5183 O O   . ARG B 324 ? 1.1238 1.8275 1.8970 0.3698  0.4818  0.3943  248  ARG B O   
5184 C CB  . ARG B 324 ? 1.0599 1.7960 1.9587 0.3887  0.5128  0.3952  248  ARG B CB  
5185 N N   . ILE B 325 ? 1.0939 1.8330 1.9854 0.3704  0.5300  0.4561  249  ILE B N   
5186 C CA  . ILE B 325 ? 1.1091 1.8519 1.9607 0.3783  0.5486  0.4798  249  ILE B CA  
5187 C C   . ILE B 325 ? 1.1055 1.8208 1.9591 0.3495  0.5125  0.4760  249  ILE B C   
5188 O O   . ILE B 325 ? 1.1117 1.8175 1.8980 0.3542  0.5060  0.4719  249  ILE B O   
5189 C CB  . ILE B 325 ? 1.1741 1.9449 2.0827 0.3899  0.5964  0.5263  249  ILE B CB  
5190 N N   . THR B 326 ? 1.0115 1.7156 1.9407 0.3214  0.4877  0.4749  250  THR B N   
5191 C CA  . THR B 326 ? 0.9739 1.6525 1.9143 0.2935  0.4522  0.4689  250  THR B CA  
5192 C C   . THR B 326 ? 0.9966 1.6505 1.8665 0.2869  0.4131  0.4302  250  THR B C   
5193 O O   . THR B 326 ? 0.9808 1.6185 1.8112 0.2792  0.3978  0.4268  250  THR B O   
5194 C CB  . THR B 326 ? 1.0338 1.7124 2.0747 0.2685  0.4367  0.4754  250  THR B CB  
5195 N N   . ARG B 327 ? 0.9468 1.5977 1.8030 0.2909  0.3993  0.4026  251  ARG B N   
5196 C CA  . ARG B 327 ? 0.9315 1.5585 1.7279 0.2843  0.3652  0.3673  251  ARG B CA  
5197 C C   . ARG B 327 ? 1.0046 1.6319 1.7129 0.3016  0.3738  0.3572  251  ARG B C   
5198 O O   . ARG B 327 ? 0.9847 1.5936 1.6500 0.2908  0.3479  0.3400  251  ARG B O   
5199 C CB  . ARG B 327 ? 0.9262 1.5483 1.7336 0.2862  0.3524  0.3434  251  ARG B CB  
5200 C CG  . ARG B 327 ? 1.0815 1.7183 1.8592 0.3140  0.3796  0.3343  251  ARG B CG  
5201 C CD  . ARG B 327 ? 1.1482 1.7654 1.8604 0.3181  0.3607  0.2972  251  ARG B CD  
5202 N NE  . ARG B 327 ? 1.2082 1.8378 1.8965 0.3446  0.3851  0.2841  251  ARG B NE  
5203 C CZ  . ARG B 327 ? 1.3432 1.9879 1.9734 0.3677  0.4083  0.2803  251  ARG B CZ  
5204 N NH1 . ARG B 327 ? 1.0343 1.6842 1.6241 0.3681  0.4106  0.2910  251  ARG B NH1 
5205 N NH2 . ARG B 327 ? 1.2521 1.9077 1.8630 0.3923  0.4290  0.2652  251  ARG B NH2 
5206 N N   . ASP B 328 ? 0.9996 1.6505 1.6825 0.3291  0.4100  0.3684  252  ASP B N   
5207 C CA  . ASP B 328 ? 1.0300 1.6884 1.6294 0.3500  0.4198  0.3594  252  ASP B CA  
5208 C C   . ASP B 328 ? 1.0792 1.7334 1.6580 0.3438  0.4160  0.3777  252  ASP B C   
5209 O O   . ASP B 328 ? 1.0798 1.7266 1.5962 0.3451  0.3983  0.3582  252  ASP B O   
5210 C CB  . ASP B 328 ? 1.0982 1.7866 1.6814 0.3829  0.4624  0.3731  252  ASP B CB  
5211 N N   . GLN B 329 ? 1.0249 1.6829 1.6617 0.3360  0.4317  0.4141  253  GLN B N   
5212 C CA  . GLN B 329 ? 1.0169 1.6681 1.6491 0.3297  0.4316  0.4363  253  GLN B CA  
5213 C C   . GLN B 329 ? 1.0210 1.6438 1.6452 0.3033  0.3883  0.4133  253  GLN B C   
5214 O O   . GLN B 329 ? 1.0196 1.6365 1.5976 0.3053  0.3803  0.4129  253  GLN B O   
5215 C CB  . GLN B 329 ? 1.0347 1.6926 1.7477 0.3235  0.4571  0.4771  253  GLN B CB  
5216 N N   . VAL B 330 ? 0.9387 1.5458 1.6055 0.2809  0.3611  0.3947  254  VAL B N   
5217 C CA  . VAL B 330 ? 0.9001 1.4813 1.5611 0.2568  0.3206  0.3723  254  VAL B CA  
5218 C C   . VAL B 330 ? 0.9520 1.5273 1.5350 0.2633  0.3037  0.3407  254  VAL B C   
5219 O O   . VAL B 330 ? 0.9314 1.4937 1.4820 0.2542  0.2833  0.3310  254  VAL B O   
5220 C CB  . VAL B 330 ? 0.9149 1.4858 1.6378 0.2364  0.2984  0.3622  254  VAL B CB  
5221 C CG1 . VAL B 330 ? 0.8834 1.4293 1.5913 0.2152  0.2582  0.3387  254  VAL B CG1 
5222 C CG2 . VAL B 330 ? 0.9088 1.4881 1.7150 0.2279  0.3122  0.3903  254  VAL B CG2 
5223 N N   . LEU B 331 ? 0.9286 1.5144 1.4856 0.2795  0.3135  0.3243  255  LEU B N   
5224 C CA  . LEU B 331 ? 0.9354 1.5182 1.4266 0.2869  0.3005  0.2914  255  LEU B CA  
5225 C C   . LEU B 331 ? 0.9944 1.5911 1.4228 0.3038  0.3095  0.2941  255  LEU B C   
5226 O O   . LEU B 331 ? 0.9826 1.5731 1.3638 0.3008  0.2887  0.2685  255  LEU B O   
5227 C CB  . LEU B 331 ? 0.9583 1.5500 1.4457 0.3028  0.3139  0.2754  255  LEU B CB  
5228 C CG  . LEU B 331 ? 1.0055 1.5761 1.5075 0.2892  0.2898  0.2472  255  LEU B CG  
5229 C CD1 . LEU B 331 ? 1.0052 1.5580 1.4592 0.2786  0.2618  0.2170  255  LEU B CD1 
5230 C CD2 . LEU B 331 ? 1.0032 1.5619 1.5741 0.2691  0.2768  0.2607  255  LEU B CD2 
5231 N N   . LYS B 332 ? 0.9647 1.5817 1.3951 0.3222  0.3409  0.3263  256  LYS B N   
5232 C CA  . LYS B 332 ? 0.9845 1.6184 1.3579 0.3427  0.3529  0.3363  256  LYS B CA  
5233 C C   . LYS B 332 ? 1.0131 1.6314 1.3831 0.3263  0.3319  0.3419  256  LYS B C   
5234 O O   . LYS B 332 ? 1.0137 1.6385 1.3274 0.3349  0.3216  0.3295  256  LYS B O   
5235 C CB  . LYS B 332 ? 1.0436 1.7013 1.4269 0.3669  0.3950  0.3752  256  LYS B CB  
5236 N N   . MET B 333 ? 0.9437 1.5427 1.3752 0.3032  0.3239  0.3576  257  MET B N   
5237 C CA  . MET B 333 ? 0.9210 1.5018 1.3580 0.2862  0.3039  0.3616  257  MET B CA  
5238 C C   . MET B 333 ? 0.9249 1.4901 1.3328 0.2700  0.2674  0.3243  257  MET B C   
5239 O O   . MET B 333 ? 0.9092 1.4688 1.2889 0.2662  0.2525  0.3193  257  MET B O   
5240 C CB  . MET B 333 ? 0.9348 1.5003 1.4493 0.2664  0.3048  0.3833  257  MET B CB  
5241 C CG  . MET B 333 ? 1.0137 1.5923 1.5629 0.2800  0.3421  0.4245  257  MET B CG  
5242 S SD  . MET B 333 ? 1.0561 1.6250 1.7115 0.2578  0.3470  0.4437  257  MET B SD  
5243 C CE  . MET B 333 ? 0.9958 1.5374 1.6729 0.2362  0.3242  0.4462  257  MET B CE  
5244 N N   . ALA B 334 ? 0.8624 1.4209 1.2789 0.2616  0.2550  0.2997  258  ALA B N   
5245 C CA  . ALA B 334 ? 0.8392 1.3825 1.2318 0.2471  0.2245  0.2661  258  ALA B CA  
5246 C C   . ALA B 334 ? 0.9218 1.4799 1.2489 0.2626  0.2230  0.2435  258  ALA B C   
5247 O O   . ALA B 334 ? 0.9105 1.4616 1.2101 0.2533  0.2011  0.2238  258  ALA B O   
5248 C CB  . ALA B 334 ? 0.8331 1.3647 1.2581 0.2366  0.2159  0.2515  258  ALA B CB  
5249 N N   . ALA B 335 ? 0.9141 1.4947 1.2173 0.2871  0.2464  0.2456  259  ALA B N   
5250 C CA  . ALA B 335 ? 0.9398 1.5393 1.1815 0.3052  0.2454  0.2214  259  ALA B CA  
5251 C C   . ALA B 335 ? 1.0042 1.6191 1.2062 0.3164  0.2447  0.2320  259  ALA B C   
5252 O O   . ALA B 335 ? 1.0059 1.6309 1.1637 0.3205  0.2292  0.2059  259  ALA B O   
5253 C CB  . ALA B 335 ? 0.9861 1.6066 1.2140 0.3307  0.2719  0.2219  259  ALA B CB  
5254 N N   . ALA B 336 ? 0.9696 1.5870 1.1910 0.3216  0.2618  0.2703  260  ALA B N   
5255 C CA  . ALA B 336 ? 0.9834 1.6142 1.1731 0.3355  0.2660  0.2887  260  ALA B CA  
5256 C C   . ALA B 336 ? 1.0155 1.6338 1.1949 0.3181  0.2363  0.2725  260  ALA B C   
5257 O O   . ALA B 336 ? 1.0267 1.6638 1.1583 0.3315  0.2287  0.2621  260  ALA B O   
5258 C CB  . ALA B 336 ? 0.9985 1.6261 1.2266 0.3400  0.2914  0.3345  260  ALA B CB  
5259 N N   . VAL B 337 ? 0.9422 1.5318 1.1652 0.2899  0.2191  0.2693  261  VAL B N   
5260 C CA  . VAL B 337 ? 0.9180 1.4940 1.1358 0.2727  0.1930  0.2561  261  VAL B CA  
5261 C C   . VAL B 337 ? 0.9540 1.5379 1.1332 0.2695  0.1717  0.2169  261  VAL B C   
5262 O O   . VAL B 337 ? 0.9476 1.5367 1.1037 0.2680  0.1570  0.2083  261  VAL B O   
5263 C CB  . VAL B 337 ? 0.9390 1.4841 1.2090 0.2456  0.1800  0.2604  261  VAL B CB  
5264 C CG1 . VAL B 337 ? 0.9405 1.4782 1.2512 0.2469  0.1974  0.2964  261  VAL B CG1 
5265 C CG2 . VAL B 337 ? 0.9226 1.4551 1.2194 0.2317  0.1731  0.2438  261  VAL B CG2 
5266 N N   . VAL B 338 ? 0.9074 1.4925 1.0831 0.2691  0.1709  0.1936  262  VAL B N   
5267 C CA  . VAL B 338 ? 0.9027 1.4927 1.0504 0.2642  0.1521  0.1551  262  VAL B CA  
5268 C C   . VAL B 338 ? 0.9880 1.6130 1.0837 0.2906  0.1575  0.1434  262  VAL B C   
5269 O O   . VAL B 338 ? 0.9853 1.6225 1.0549 0.2890  0.1396  0.1195  262  VAL B O   
5270 C CB  . VAL B 338 ? 0.9417 1.5130 1.1120 0.2507  0.1468  0.1331  262  VAL B CB  
5271 C CG1 . VAL B 338 ? 0.9658 1.5483 1.1337 0.2693  0.1678  0.1329  262  VAL B CG1 
5272 C CG2 . VAL B 338 ? 0.9354 1.5031 1.0904 0.2383  0.1253  0.0962  262  VAL B CG2 
5273 N N   . LEU B 339 ? 0.9777 1.6214 1.0590 0.3156  0.1818  0.1607  263  LEU B N   
5274 C CA  . LEU B 339 ? 1.0177 1.6977 1.0447 0.3451  0.1880  0.1512  263  LEU B CA  
5275 C C   . LEU B 339 ? 1.0792 1.7776 1.0797 0.3574  0.1850  0.1697  263  LEU B C   
5276 O O   . LEU B 339 ? 1.1014 1.8275 1.0591 0.3713  0.1728  0.1480  263  LEU B O   
5277 C CB  . LEU B 339 ? 1.0519 1.7468 1.0698 0.3704  0.2179  0.1677  263  LEU B CB  
5278 C CG  . LEU B 339 ? 1.1342 1.8375 1.1342 0.3792  0.2189  0.1317  263  LEU B CG  
5279 C CD1 . LEU B 339 ? 1.1019 1.7718 1.1510 0.3538  0.2135  0.1186  263  LEU B CD1 
5280 C CD2 . LEU B 339 ? 1.2110 1.9399 1.1848 0.4127  0.2495  0.1486  263  LEU B CD2 
5281 N N   . ALA B 340 ? 1.0098 1.6927 1.0388 0.3520  0.1942  0.2074  264  ALA B N   
5282 C CA  . ALA B 340 ? 1.0080 1.7028 1.0187 0.3636  0.1930  0.2288  264  ALA B CA  
5283 C C   . ALA B 340 ? 1.0272 1.7204 1.0318 0.3469  0.1628  0.2024  264  ALA B C   
5284 O O   . ALA B 340 ? 1.0450 1.7618 1.0177 0.3625  0.1562  0.2042  264  ALA B O   
5285 C CB  . ALA B 340 ? 1.0044 1.6766 1.0567 0.3583  0.2103  0.2719  264  ALA B CB  
5286 N N   . PHE B 341 ? 0.9258 1.5930 0.9613 0.3168  0.1455  0.1797  265  PHE B N   
5287 C CA  . PHE B 341 ? 0.8900 1.5549 0.9242 0.2996  0.1197  0.1554  265  PHE B CA  
5288 C C   . PHE B 341 ? 0.9588 1.6555 0.9548 0.3095  0.1055  0.1185  265  PHE B C   
5289 O O   . PHE B 341 ? 0.9574 1.6737 0.9356 0.3131  0.0909  0.1096  265  PHE B O   
5290 C CB  . PHE B 341 ? 0.8706 1.5001 0.9454 0.2675  0.1080  0.1436  265  PHE B CB  
5291 C CG  . PHE B 341 ? 0.8623 1.4869 0.9402 0.2489  0.0853  0.1238  265  PHE B CG  
5292 C CD1 . PHE B 341 ? 0.8767 1.4900 0.9674 0.2419  0.0806  0.1412  265  PHE B CD1 
5293 C CD2 . PHE B 341 ? 0.8811 1.5114 0.9528 0.2381  0.0700  0.0876  265  PHE B CD2 
5294 C CE1 . PHE B 341 ? 0.8660 1.4766 0.9594 0.2262  0.0620  0.1238  265  PHE B CE1 
5295 C CE2 . PHE B 341 ? 0.8960 1.5235 0.9743 0.2209  0.0521  0.0719  265  PHE B CE2 
5296 C CZ  . PHE B 341 ? 0.8527 1.4715 0.9403 0.2157  0.0486  0.0905  265  PHE B CZ  
5297 N N   . ILE B 342 ? 0.9271 1.6300 0.9135 0.3142  0.1090  0.0955  266  ILE B N   
5298 C CA  . ILE B 342 ? 0.9435 1.6754 0.8985 0.3221  0.0939  0.0548  266  ILE B CA  
5299 C C   . ILE B 342 ? 1.0391 1.8149 0.9433 0.3580  0.0992  0.0609  266  ILE B C   
5300 O O   . ILE B 342 ? 1.0528 1.8590 0.9312 0.3649  0.0806  0.0317  266  ILE B O   
5301 C CB  . ILE B 342 ? 0.9863 1.7080 0.9494 0.3143  0.0930  0.0218  266  ILE B CB  
5302 C CG1 . ILE B 342 ? 1.0172 1.7395 0.9726 0.3340  0.1182  0.0370  266  ILE B CG1 
5303 C CG2 . ILE B 342 ? 0.9564 1.6393 0.9648 0.2801  0.0830  0.0122  266  ILE B CG2 
5304 C CD1 . ILE B 342 ? 1.1674 1.8976 1.1086 0.3413  0.1175  -0.0024 266  ILE B CD1 
5305 N N   . ILE B 343 ? 1.0164 1.7974 0.9077 0.3811  0.1240  0.0992  267  ILE B N   
5306 C CA  . ILE B 343 ? 1.0601 1.8831 0.8996 0.4184  0.1309  0.1102  267  ILE B CA  
5307 C C   . ILE B 343 ? 1.1164 1.9528 0.9486 0.4214  0.1173  0.1227  267  ILE B C   
5308 O O   . ILE B 343 ? 1.1432 2.0197 0.9355 0.4421  0.1039  0.1067  267  ILE B O   
5309 C CB  . ILE B 343 ? 1.1240 1.9481 0.9541 0.4432  0.1654  0.1521  267  ILE B CB  
5310 C CG1 . ILE B 343 ? 1.1493 1.9715 0.9766 0.4479  0.1787  0.1346  267  ILE B CG1 
5311 C CG2 . ILE B 343 ? 1.1755 2.0382 0.9551 0.4827  0.1762  0.1779  267  ILE B CG2 
5312 C CD1 . ILE B 343 ? 1.2977 2.1497 1.0846 0.4597  0.1619  0.0815  267  ILE B CD1 
5313 N N   . CYS B 344 ? 1.0406 1.8446 0.9127 0.4006  0.1186  0.1474  268  CYS B N   
5314 C CA  . CYS B 344 ? 1.0354 1.8450 0.9078 0.4023  0.1091  0.1628  268  CYS B CA  
5315 C C   . CYS B 344 ? 1.0722 1.8908 0.9507 0.3832  0.0787  0.1250  268  CYS B C   
5316 O O   . CYS B 344 ? 1.0863 1.9336 0.9447 0.3972  0.0670  0.1247  268  CYS B O   
5317 C CB  . CYS B 344 ? 1.0153 1.7852 0.9296 0.3881  0.1232  0.2009  268  CYS B CB  
5318 S SG  . CYS B 344 ? 1.0970 1.8620 1.0099 0.4140  0.1608  0.2541  268  CYS B SG  
5319 N N   . TRP B 345 ? 0.9984 1.7934 0.9072 0.3522  0.0673  0.0962  269  TRP B N   
5320 C CA  . TRP B 345 ? 0.9761 1.7758 0.8987 0.3314  0.0426  0.0652  269  TRP B CA  
5321 C C   . TRP B 345 ? 1.0174 1.8408 0.9297 0.3270  0.0249  0.0163  269  TRP B C   
5322 O O   . TRP B 345 ? 1.0095 1.8507 0.9279 0.3175  0.0049  -0.0075 269  TRP B O   
5323 C CB  . TRP B 345 ? 0.9264 1.6812 0.8944 0.2981  0.0413  0.0704  269  TRP B CB  
5324 C CG  . TRP B 345 ? 0.9311 1.6685 0.9133 0.2981  0.0481  0.1057  269  TRP B CG  
5325 C CD1 . TRP B 345 ? 0.9621 1.6681 0.9649 0.2957  0.0656  0.1384  269  TRP B CD1 
5326 C CD2 . TRP B 345 ? 0.9264 1.6780 0.9058 0.3019  0.0377  0.1105  269  TRP B CD2 
5327 N NE1 . TRP B 345 ? 0.9475 1.6438 0.9611 0.2964  0.0661  0.1612  269  TRP B NE1 
5328 C CE2 . TRP B 345 ? 0.9675 1.6912 0.9653 0.3015  0.0499  0.1457  269  TRP B CE2 
5329 C CE3 . TRP B 345 ? 0.9467 1.7331 0.9131 0.3059  0.0188  0.0872  269  TRP B CE3 
5330 C CZ2 . TRP B 345 ? 0.9536 1.6805 0.9545 0.3060  0.0450  0.1582  269  TRP B CZ2 
5331 C CZ3 . TRP B 345 ? 0.9568 1.7496 0.9271 0.3107  0.0141  0.1014  269  TRP B CZ3 
5332 C CH2 . TRP B 345 ? 0.9558 1.7176 0.9418 0.3112  0.0275  0.1364  269  TRP B CH2 
5333 N N   . LEU B 346 ? 0.9761 1.8001 0.8768 0.3333  0.0321  -0.0001 270  LEU B N   
5334 C CA  . LEU B 346 ? 0.9842 1.8274 0.8791 0.3285  0.0150  -0.0500 270  LEU B CA  
5335 C C   . LEU B 346 ? 1.0631 1.9619 0.9207 0.3525  -0.0024 -0.0712 270  LEU B C   
5336 O O   . LEU B 346 ? 1.0439 1.9574 0.9167 0.3373  -0.0244 -0.1072 270  LEU B O   
5337 C CB  . LEU B 346 ? 1.0031 1.8351 0.8923 0.3332  0.0271  -0.0647 270  LEU B CB  
5338 C CG  . LEU B 346 ? 1.0772 1.9231 0.9649 0.3277  0.0108  -0.1193 270  LEU B CG  
5339 C CD1 . LEU B 346 ? 1.0427 1.8517 0.9806 0.2901  0.0023  -0.1391 270  LEU B CD1 
5340 C CD2 . LEU B 346 ? 1.1475 1.9989 1.0088 0.3491  0.0248  -0.1299 270  LEU B CD2 
5341 N N   . PRO B 347 ? 1.0672 1.9985 0.8793 0.3892  0.0061  -0.0494 271  PRO B N   
5342 C CA  . PRO B 347 ? 1.1044 2.0921 0.8804 0.4132  -0.0140 -0.0716 271  PRO B CA  
5343 C C   . PRO B 347 ? 1.1404 2.1423 0.9403 0.3980  -0.0363 -0.0813 271  PRO B C   
5344 O O   . PRO B 347 ? 1.1462 2.1835 0.9452 0.3963  -0.0606 -0.1237 271  PRO B O   
5345 C CB  . PRO B 347 ? 1.1610 2.1696 0.8911 0.4532  0.0046  -0.0294 271  PRO B CB  
5346 C CG  . PRO B 347 ? 1.2163 2.1899 0.9504 0.4535  0.0332  -0.0055 271  PRO B CG  
5347 C CD  . PRO B 347 ? 1.1056 2.0270 0.8977 0.4121  0.0345  -0.0041 271  PRO B CD  
5348 N N   . PHE B 348 ? 1.0715 2.0459 0.8971 0.3857  -0.0282 -0.0453 272  PHE B N   
5349 C CA  . PHE B 348 ? 1.0474 2.0319 0.8978 0.3717  -0.0453 -0.0506 272  PHE B CA  
5350 C C   . PHE B 348 ? 1.0733 2.0420 0.9681 0.3337  -0.0600 -0.0887 272  PHE B C   
5351 O O   . PHE B 348 ? 1.0719 2.0724 0.9792 0.3275  -0.0810 -0.1164 272  PHE B O   
5352 C CB  . PHE B 348 ? 1.0435 1.9975 0.9093 0.3692  -0.0303 -0.0032 272  PHE B CB  
5353 C CG  . PHE B 348 ? 1.0302 1.9813 0.9296 0.3485  -0.0435 -0.0081 272  PHE B CG  
5354 C CD1 . PHE B 348 ? 1.0796 2.0758 0.9693 0.3643  -0.0600 -0.0145 272  PHE B CD1 
5355 C CD2 . PHE B 348 ? 1.0204 1.9266 0.9605 0.3148  -0.0395 -0.0068 272  PHE B CD2 
5356 C CE1 . PHE B 348 ? 1.0621 2.0579 0.9851 0.3458  -0.0704 -0.0196 272  PHE B CE1 
5357 C CE2 . PHE B 348 ? 1.0309 1.9366 0.9996 0.2973  -0.0498 -0.0118 272  PHE B CE2 
5358 C CZ  . PHE B 348 ? 1.0147 1.9648 0.9759 0.3126  -0.0642 -0.0180 272  PHE B CZ  
5359 N N   . HIS B 349 ? 1.0060 1.9268 0.9273 0.3090  -0.0481 -0.0877 273  HIS B N   
5360 C CA  . HIS B 349 ? 0.9782 1.8774 0.9427 0.2737  -0.0574 -0.1167 273  HIS B CA  
5361 C C   . HIS B 349 ? 1.0493 1.9754 1.0138 0.2714  -0.0738 -0.1679 273  HIS B C   
5362 O O   . HIS B 349 ? 1.0245 1.9515 1.0250 0.2466  -0.0872 -0.1964 273  HIS B O   
5363 C CB  . HIS B 349 ? 0.9622 1.8045 0.9516 0.2524  -0.0403 -0.0982 273  HIS B CB  
5364 C CG  . HIS B 349 ? 0.9737 1.7884 0.9789 0.2436  -0.0316 -0.0609 273  HIS B CG  
5365 N ND1 . HIS B 349 ? 0.9672 1.7690 1.0045 0.2190  -0.0391 -0.0653 273  HIS B ND1 
5366 C CD2 . HIS B 349 ? 0.9932 1.7932 0.9867 0.2575  -0.0163 -0.0209 273  HIS B CD2 
5367 C CE1 .