data_5UNJ
# 
_entry.id   5UNJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5UNJ         
WWPDB D_1000226167 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5UNJ 
_pdbx_database_status.recvd_initial_deposition_date   2017-01-31 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Mays, S.G.'    1 ? 
'Ortlund, E.A.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Mol. Pharmacol.' 
_citation.journal_id_ASTM           MOPMA3 
_citation.journal_id_CSD            0197 
_citation.journal_id_ISSN           1521-0111 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            92 
_citation.language                  ? 
_citation.page_first                1 
_citation.page_last                 11 
_citation.title                     'Structure and Dynamics of the Liver Receptor Homolog 1-PGC1 alpha Complex.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1124/mol.117.108514 
_citation.pdbx_database_id_PubMed   28363985 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Mays, S.G.'      1 ? 
primary 'Okafor, C.D.'    2 ? 
primary 'Tuntland, M.L.'  3 ? 
primary 'Whitby, R.J.'    4 ? 
primary 'Dharmarajan, V.' 5 ? 
primary 'Stec, J.'        6 ? 
primary 'Griffin, P.R.'   7 ? 
primary 'Ortlund, E.A.'   8 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5UNJ 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     66.180 
_cell.length_a_esd                 ? 
_cell.length_b                     84.027 
_cell.length_b_esd                 ? 
_cell.length_c                     45.355 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5UNJ 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Nuclear receptor subfamily 5 group A member 2'                                           28330.693 1  ? ? 
'unp residues 299-541' ? 
2 polymer     syn 'Peroxisome proliferator-activated gamma coactivator 1-alpha'                             1523.854  1  ? ? ? ? 
3 non-polymer syn '(1R,3aR,6aR)-5-hexyl-4-phenyl-3a-(1-phenylethenyl)-1,2,3,3a,6,6a-hexahydropentalen-1-ol' 386.569   1  ? ? ? ? 
4 water       nat water                                                                                     18.015    58 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Alpha-1-fetoprotein transcription factor,B1-binding factor,hB1F,CYP7A promoter-binding factor,Hepatocytic transcription factor,Liver receptor homolog 1,LRH-1
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SNASIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMK
LLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVL
FSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEML
HAKRA
;
;SNASIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMK
LLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVL
FSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEML
HAKRA
;
A ? 
2 'polypeptide(L)' no no EEPSLLKKLLLAPA EEPSLLKKLLLAPA C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASN n 
1 3   ALA n 
1 4   SER n 
1 5   ILE n 
1 6   PRO n 
1 7   HIS n 
1 8   LEU n 
1 9   ILE n 
1 10  LEU n 
1 11  GLU n 
1 12  LEU n 
1 13  LEU n 
1 14  LYS n 
1 15  CYS n 
1 16  GLU n 
1 17  PRO n 
1 18  ASP n 
1 19  GLU n 
1 20  PRO n 
1 21  GLN n 
1 22  VAL n 
1 23  GLN n 
1 24  ALA n 
1 25  LYS n 
1 26  ILE n 
1 27  MET n 
1 28  ALA n 
1 29  TYR n 
1 30  LEU n 
1 31  GLN n 
1 32  GLN n 
1 33  GLU n 
1 34  GLN n 
1 35  ALA n 
1 36  ASN n 
1 37  ARG n 
1 38  SER n 
1 39  LYS n 
1 40  HIS n 
1 41  GLU n 
1 42  LYS n 
1 43  LEU n 
1 44  SER n 
1 45  THR n 
1 46  PHE n 
1 47  GLY n 
1 48  LEU n 
1 49  MET n 
1 50  CYS n 
1 51  LYS n 
1 52  MET n 
1 53  ALA n 
1 54  ASP n 
1 55  GLN n 
1 56  THR n 
1 57  LEU n 
1 58  PHE n 
1 59  SER n 
1 60  ILE n 
1 61  VAL n 
1 62  GLU n 
1 63  TRP n 
1 64  ALA n 
1 65  ARG n 
1 66  SER n 
1 67  SER n 
1 68  ILE n 
1 69  PHE n 
1 70  PHE n 
1 71  ARG n 
1 72  GLU n 
1 73  LEU n 
1 74  LYS n 
1 75  VAL n 
1 76  ASP n 
1 77  ASP n 
1 78  GLN n 
1 79  MET n 
1 80  LYS n 
1 81  LEU n 
1 82  LEU n 
1 83  GLN n 
1 84  ASN n 
1 85  CYS n 
1 86  TRP n 
1 87  SER n 
1 88  GLU n 
1 89  LEU n 
1 90  LEU n 
1 91  ILE n 
1 92  LEU n 
1 93  ASP n 
1 94  HIS n 
1 95  ILE n 
1 96  TYR n 
1 97  ARG n 
1 98  GLN n 
1 99  VAL n 
1 100 VAL n 
1 101 HIS n 
1 102 GLY n 
1 103 LYS n 
1 104 GLU n 
1 105 GLY n 
1 106 SER n 
1 107 ILE n 
1 108 PHE n 
1 109 LEU n 
1 110 VAL n 
1 111 THR n 
1 112 GLY n 
1 113 GLN n 
1 114 GLN n 
1 115 VAL n 
1 116 ASP n 
1 117 TYR n 
1 118 SER n 
1 119 ILE n 
1 120 ILE n 
1 121 ALA n 
1 122 SER n 
1 123 GLN n 
1 124 ALA n 
1 125 GLY n 
1 126 ALA n 
1 127 THR n 
1 128 LEU n 
1 129 ASN n 
1 130 ASN n 
1 131 LEU n 
1 132 MET n 
1 133 SER n 
1 134 HIS n 
1 135 ALA n 
1 136 GLN n 
1 137 GLU n 
1 138 LEU n 
1 139 VAL n 
1 140 ALA n 
1 141 LYS n 
1 142 LEU n 
1 143 ARG n 
1 144 SER n 
1 145 LEU n 
1 146 GLN n 
1 147 PHE n 
1 148 ASP n 
1 149 GLN n 
1 150 ARG n 
1 151 GLU n 
1 152 PHE n 
1 153 VAL n 
1 154 CYS n 
1 155 LEU n 
1 156 LYS n 
1 157 PHE n 
1 158 LEU n 
1 159 VAL n 
1 160 LEU n 
1 161 PHE n 
1 162 SER n 
1 163 LEU n 
1 164 ASP n 
1 165 VAL n 
1 166 LYS n 
1 167 ASN n 
1 168 LEU n 
1 169 GLU n 
1 170 ASN n 
1 171 PHE n 
1 172 GLN n 
1 173 LEU n 
1 174 VAL n 
1 175 GLU n 
1 176 GLY n 
1 177 VAL n 
1 178 GLN n 
1 179 GLU n 
1 180 GLN n 
1 181 VAL n 
1 182 ASN n 
1 183 ALA n 
1 184 ALA n 
1 185 LEU n 
1 186 LEU n 
1 187 ASP n 
1 188 TYR n 
1 189 THR n 
1 190 MET n 
1 191 CYS n 
1 192 ASN n 
1 193 TYR n 
1 194 PRO n 
1 195 GLN n 
1 196 GLN n 
1 197 THR n 
1 198 GLU n 
1 199 LYS n 
1 200 PHE n 
1 201 GLY n 
1 202 GLN n 
1 203 LEU n 
1 204 LEU n 
1 205 LEU n 
1 206 ARG n 
1 207 LEU n 
1 208 PRO n 
1 209 GLU n 
1 210 ILE n 
1 211 ARG n 
1 212 ALA n 
1 213 ILE n 
1 214 SER n 
1 215 MET n 
1 216 GLN n 
1 217 ALA n 
1 218 GLU n 
1 219 GLU n 
1 220 TYR n 
1 221 LEU n 
1 222 TYR n 
1 223 TYR n 
1 224 LYS n 
1 225 HIS n 
1 226 LEU n 
1 227 ASN n 
1 228 GLY n 
1 229 ASP n 
1 230 VAL n 
1 231 PRO n 
1 232 TYR n 
1 233 ASN n 
1 234 ASN n 
1 235 LEU n 
1 236 LEU n 
1 237 ILE n 
1 238 GLU n 
1 239 MET n 
1 240 LEU n 
1 241 HIS n 
1 242 ALA n 
1 243 LYS n 
1 244 ARG n 
1 245 ALA n 
2 1   GLU n 
2 2   GLU n 
2 3   PRO n 
2 4   SER n 
2 5   LEU n 
2 6   LEU n 
2 7   LYS n 
2 8   LYS n 
2 9   LEU n 
2 10  LEU n 
2 11  LEU n 
2 12  ALA n 
2 13  PRO n 
2 14  ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   245 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'NR5A2, B1F, CPF, FTF' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       14 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP NR5A2_HUMAN O00482 ? 1 
;ASIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKLL
QNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFS
LDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHA
KRA
;
299 
2 PDB 5UNJ        5UNJ   ? 2 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5UNJ A 3 ? 245 ? O00482 299 ? 541 ? 299 541 
2 2 5UNJ C 1 ? 14  ? 5UNJ   740 ? 753 ? 740 753 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5UNJ SER A 1 ? UNP O00482 ? ? 'expression tag' 297 1 
1 5UNJ ASN A 2 ? UNP O00482 ? ? 'expression tag' 298 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                   ? 'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                                                                  ? 
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                ? 
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                           ? 'C4 H7 N O4' 
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                  ? 
'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                                 ? 
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                           ? 'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                                                                   ? 'C2 H5 N O2' 
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                 ? 
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                                                     ? 'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                ? 
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                   ? 
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                                                    ? 
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                                                ? 
'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                             ? 
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                                                   ? 'C5 H9 N O2' 
115.130 
RJW non-polymer         . '(1R,3aR,6aR)-5-hexyl-4-phenyl-3a-(1-phenylethenyl)-1,2,3,3a,6,6a-hexahydropentalen-1-ol' ? 'C28 H34 O' 
386.569 
SER 'L-peptide linking' y SERINE                                                                                    ? 'C3 H7 N O3' 
105.093 
THR 'L-peptide linking' y THREONINE                                                                                 ? 'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                ? 
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                  ? 
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                                                    ? 
'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5UNJ 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.11 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         41.76 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.05M Sodium acetate, pH 4.6; PEG4000 14%, glycerol 15-21%' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MAR CCD 130 mm' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-06-18 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            32.190 
_reflns.entry_id                         5UNJ 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.950 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       18170 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             96.800 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.100 
_reflns.pdbx_Rmerge_I_obs                0.099 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            7.000 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 0.819 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.108 
_reflns.pdbx_Rpim_I_all                  0.042 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         111677 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
1.950 2.020  ? ? ? ? ? ? ? 83.800  ? ? ? ? 0.384 ? ? ? ? ? ? ? ? 5.000 ? 0.488 ? ? 0.425 0.176 ? 1  1 0.915 ? 
2.020 2.100  ? ? ? ? ? ? ? 91.600  ? ? ? ? 0.333 ? ? ? ? ? ? ? ? 5.300 ? 0.529 ? ? 0.368 0.152 ? 2  1 0.692 ? 
2.100 2.200  ? ? ? ? ? ? ? 96.100  ? ? ? ? 0.245 ? ? ? ? ? ? ? ? 5.500 ? 0.621 ? ? 0.270 0.111 ? 3  1 0.932 ? 
2.200 2.310  ? ? ? ? ? ? ? 98.100  ? ? ? ? 0.199 ? ? ? ? ? ? ? ? 5.800 ? 0.702 ? ? 0.218 0.088 ? 4  1 0.984 ? 
2.310 2.460  ? ? ? ? ? ? ? 98.600  ? ? ? ? 0.180 ? ? ? ? ? ? ? ? 6.100 ? 0.801 ? ? 0.197 0.078 ? 5  1 0.983 ? 
2.460 2.650  ? ? ? ? ? ? ? 99.400  ? ? ? ? 0.161 ? ? ? ? ? ? ? ? 6.300 ? 0.943 ? ? 0.176 0.070 ? 6  1 0.984 ? 
2.650 2.910  ? ? ? ? ? ? ? 99.900  ? ? ? ? 0.143 ? ? ? ? ? ? ? ? 6.600 ? 0.965 ? ? 0.155 0.060 ? 7  1 0.988 ? 
2.910 3.330  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.126 ? ? ? ? ? ? ? ? 6.800 ? 1.074 ? ? 0.137 0.052 ? 8  1 0.994 ? 
3.330 4.200  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.094 ? ? ? ? ? ? ? ? 6.900 ? 1.043 ? ? 0.102 0.038 ? 9  1 0.995 ? 
4.200 50.000 ? ? ? ? ? ? ? 99.900  ? ? ? ? 0.071 ? ? ? ? ? ? ? ? 6.700 ? 0.715 ? ? 0.077 0.030 ? 10 1 0.996 ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                133.100 
_refine.B_iso_mean                               46.7829 
_refine.B_iso_min                                22.980 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5UNJ 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.9590 
_refine.ls_d_res_low                             42.0140 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     18122 
_refine.ls_number_reflns_R_free                  1270 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    96.3400 
_refine.ls_percent_reflns_R_free                 7.0100 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2012 
_refine.ls_R_factor_R_free                       0.2265 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1993 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.390 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5L11 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 23.8400 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.1700 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       1.9590 
_refine_hist.d_res_low                        42.0140 
_refine_hist.pdbx_number_atoms_ligand         63 
_refine_hist.number_atoms_solvent             58 
_refine_hist.number_atoms_total               2031 
_refine_hist.pdbx_number_residues_total       236 
_refine_hist.pdbx_B_iso_mean_ligand           35.22 
_refine_hist.pdbx_B_iso_mean_solvent          42.68 
_refine_hist.pdbx_number_atoms_protein        1910 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.003  ? 1974 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.489  ? 2666 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.034  ? 307  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003  ? 333  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 13.783 ? 1190 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.9590 2.0375  1640 . 115 1525 80.0000  . . . 0.2873 0.0000 0.2492 . . . . . . 9 . . . 
'X-RAY DIFFRACTION' 2.0375 2.1302  1885 . 132 1753 92.0000  . . . 0.2115 0.0000 0.2310 . . . . . . 9 . . . 
'X-RAY DIFFRACTION' 2.1302 2.2425  2001 . 141 1860 97.0000  . . . 0.2227 0.0000 0.2052 . . . . . . 9 . . . 
'X-RAY DIFFRACTION' 2.2425 2.3830  2033 . 142 1891 98.0000  . . . 0.2289 0.0000 0.2054 . . . . . . 9 . . . 
'X-RAY DIFFRACTION' 2.3830 2.5670  2035 . 143 1892 99.0000  . . . 0.2150 0.0000 0.2017 . . . . . . 9 . . . 
'X-RAY DIFFRACTION' 2.5670 2.8252  2079 . 145 1934 100.0000 . . . 0.2515 0.0000 0.1969 . . . . . . 9 . . . 
'X-RAY DIFFRACTION' 2.8252 3.2339  2102 . 147 1955 100.0000 . . . 0.2314 0.0000 0.2111 . . . . . . 9 . . . 
'X-RAY DIFFRACTION' 3.2339 4.0739  2110 . 147 1963 100.0000 . . . 0.2412 0.0000 0.1883 . . . . . . 9 . . . 
'X-RAY DIFFRACTION' 4.0739 42.0231 2237 . 158 2079 100.0000 . . . 0.2078 0.0000 0.1916 . . . . . . 9 . . . 
# 
_struct.entry_id                     5UNJ 
_struct.title                        'Structure of Human Liver Receptor Homolog 1 in complex with PGC1a and RJW100' 
_struct.pdbx_descriptor              
'Nuclear receptor subfamily 5 group A member 2, Peroxisome proliferator-activated gamma coactivator 1-alpha' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5UNJ 
_struct_keywords.text            'Nuclear receptor, agonist, coregulator, NUCLEAR PROTEIN' 
_struct_keywords.pdbx_keywords   'NUCLEAR PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 PRO A 6   ? CYS A 15  ? PRO A 302 CYS A 311 1 ? 10 
HELX_P HELX_P2  AA2 ASP A 18  ? GLN A 32  ? ASP A 314 GLN A 328 1 ? 15 
HELX_P HELX_P3  AA3 SER A 44  ? SER A 67  ? SER A 340 SER A 363 1 ? 24 
HELX_P HELX_P4  AA4 PHE A 69  ? LEU A 73  ? PHE A 365 LEU A 369 5 ? 5  
HELX_P HELX_P5  AA5 LYS A 74  ? GLY A 102 ? LYS A 370 GLY A 398 1 ? 29 
HELX_P HELX_P6  AA6 TYR A 117 ? LEU A 145 ? TYR A 413 LEU A 441 1 ? 29 
HELX_P HELX_P7  AA7 ASP A 148 ? PHE A 161 ? ASP A 444 PHE A 457 1 ? 14 
HELX_P HELX_P8  AA8 ASN A 170 ? TYR A 193 ? ASN A 466 TYR A 489 1 ? 24 
HELX_P HELX_P9  AA9 GLU A 198 ? LEU A 205 ? GLU A 494 LEU A 501 1 ? 8  
HELX_P HELX_P10 AB1 LEU A 205 ? ASN A 227 ? LEU A 501 ASN A 523 1 ? 23 
HELX_P HELX_P11 AB2 ASN A 233 ? ALA A 242 ? ASN A 529 ALA A 538 1 ? 10 
HELX_P HELX_P12 AB3 LEU B 5   ? ALA B 12  ? LEU C 744 ALA C 751 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     AA1 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 SER A 106 ? PHE A 108 ? SER A 402 PHE A 404 
AA1 2 GLN A 114 ? ASP A 116 ? GLN A 410 ASP A 412 
# 
_pdbx_struct_sheet_hbond.sheet_id                AA1 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   ILE 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    107 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    ILE 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     403 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   VAL 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    115 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    VAL 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     411 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    RJW 
_struct_site.pdbx_auth_seq_id     601 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    8 
_struct_site.details              'binding site for residue RJW A 601' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 8 PHE A 46  ? PHE A 342 . ? 1_555 ? 
2 AC1 8 ALA A 53  ? ALA A 349 . ? 1_555 ? 
3 AC1 8 HIS A 94  ? HIS A 390 . ? 1_555 ? 
4 AC1 8 ILE A 120 ? ILE A 416 . ? 1_555 ? 
5 AC1 8 GLN A 123 ? GLN A 419 . ? 1_555 ? 
6 AC1 8 ALA A 124 ? ALA A 420 . ? 1_555 ? 
7 AC1 8 LEU A 221 ? LEU A 517 . ? 1_555 ? 
8 AC1 8 HOH D .   ? HOH A 719 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5UNJ 
_atom_sites.fract_transf_matrix[1][1]   0.015110 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011901 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.022048 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N    . SER A 1 4   ? -5.939  39.041 -35.274 1.00 79.59  ? 300 SER A N    1 
ATOM   2    C CA   . SER A 1 4   ? -7.171  38.261 -35.313 1.00 78.24  ? 300 SER A CA   1 
ATOM   3    C C    . SER A 1 4   ? -6.900  36.822 -34.875 1.00 73.64  ? 300 SER A C    1 
ATOM   4    O O    . SER A 1 4   ? -5.779  36.486 -34.490 1.00 76.36  ? 300 SER A O    1 
ATOM   5    C CB   . SER A 1 4   ? -7.777  38.295 -36.717 1.00 79.93  ? 300 SER A CB   1 
ATOM   6    O OG   . SER A 1 4   ? -9.107  37.806 -36.712 1.00 80.27  ? 300 SER A OG   1 
ATOM   7    H HA   . SER A 1 4   ? -7.812  38.649 -34.697 1.00 93.89  ? 300 SER A HA   1 
ATOM   8    H HB2  . SER A 1 4   ? -7.780  39.211 -37.037 1.00 95.92  ? 300 SER A HB2  1 
ATOM   9    H HB3  . SER A 1 4   ? -7.241  37.741 -37.305 1.00 95.92  ? 300 SER A HB3  1 
ATOM   10   H HG   . SER A 1 4   ? -9.585  38.278 -36.207 1.00 96.32  ? 300 SER A HG   1 
ATOM   11   N N    . ILE A 1 5   ? -7.920  35.979 -34.937 1.00 61.94  ? 301 ILE A N    1 
ATOM   12   C CA   . ILE A 1 5   ? -7.848  34.597 -34.462 1.00 48.95  ? 301 ILE A CA   1 
ATOM   13   C C    . ILE A 1 5   ? -7.821  33.674 -35.675 1.00 46.28  ? 301 ILE A C    1 
ATOM   14   O O    . ILE A 1 5   ? -8.714  33.765 -36.524 1.00 44.26  ? 301 ILE A O    1 
ATOM   15   C CB   . ILE A 1 5   ? -9.037  34.245 -33.546 1.00 43.29  ? 301 ILE A CB   1 
ATOM   16   C CG1  . ILE A 1 5   ? -9.092  35.209 -32.358 1.00 45.48  ? 301 ILE A CG1  1 
ATOM   17   C CG2  . ILE A 1 5   ? -8.922  32.801 -33.064 1.00 39.12  ? 301 ILE A CG2  1 
ATOM   18   C CD1  . ILE A 1 5   ? -10.287 35.002 -31.443 1.00 46.88  ? 301 ILE A CD1  1 
ATOM   19   H H    . ILE A 1 5   ? -8.689  36.187 -35.260 1.00 74.33  ? 301 ILE A H    1 
ATOM   20   H HA   . ILE A 1 5   ? -7.027  34.471 -33.961 1.00 58.74  ? 301 ILE A HA   1 
ATOM   21   H HB   . ILE A 1 5   ? -9.857  34.336 -34.056 1.00 51.95  ? 301 ILE A HB   1 
ATOM   22   H HG12 . ILE A 1 5   ? -8.289  35.094 -31.826 1.00 54.57  ? 301 ILE A HG12 1 
ATOM   23   H HG13 . ILE A 1 5   ? -9.133  36.117 -32.697 1.00 54.57  ? 301 ILE A HG13 1 
ATOM   24   H HG21 . ILE A 1 5   ? -9.678  32.600 -32.490 1.00 46.95  ? 301 ILE A HG21 1 
ATOM   25   H HG22 . ILE A 1 5   ? -8.924  32.211 -33.833 1.00 46.95  ? 301 ILE A HG22 1 
ATOM   26   H HG23 . ILE A 1 5   ? -8.094  32.699 -32.569 1.00 46.95  ? 301 ILE A HG23 1 
ATOM   27   H HD11 . ILE A 1 5   ? -10.247 35.649 -30.722 1.00 56.26  ? 301 ILE A HD11 1 
ATOM   28   H HD12 . ILE A 1 5   ? -11.101 35.127 -31.955 1.00 56.26  ? 301 ILE A HD12 1 
ATOM   29   H HD13 . ILE A 1 5   ? -10.256 34.102 -31.084 1.00 56.26  ? 301 ILE A HD13 1 
ATOM   30   N N    . PRO A 1 6   ? -6.839  32.777 -35.793 1.00 39.25  ? 302 PRO A N    1 
ATOM   31   C CA   . PRO A 1 6   ? -6.861  31.815 -36.902 1.00 40.00  ? 302 PRO A CA   1 
ATOM   32   C C    . PRO A 1 6   ? -8.160  31.021 -36.925 1.00 34.54  ? 302 PRO A C    1 
ATOM   33   O O    . PRO A 1 6   ? -8.715  30.669 -35.881 1.00 35.06  ? 302 PRO A O    1 
ATOM   34   C CB   . PRO A 1 6   ? -5.653  30.914 -36.618 1.00 39.57  ? 302 PRO A CB   1 
ATOM   35   C CG   . PRO A 1 6   ? -4.738  31.751 -35.792 1.00 42.01  ? 302 PRO A CG   1 
ATOM   36   C CD   . PRO A 1 6   ? -5.635  32.626 -34.959 1.00 41.35  ? 302 PRO A CD   1 
ATOM   37   H HA   . PRO A 1 6   ? -6.738  32.267 -37.752 1.00 48.01  ? 302 PRO A HA   1 
ATOM   38   H HB2  . PRO A 1 6   ? -5.939  30.129 -36.125 1.00 47.49  ? 302 PRO A HB2  1 
ATOM   39   H HB3  . PRO A 1 6   ? -5.229  30.661 -37.452 1.00 47.49  ? 302 PRO A HB3  1 
ATOM   40   H HG2  . PRO A 1 6   ? -4.196  31.180 -35.226 1.00 50.41  ? 302 PRO A HG2  1 
ATOM   41   H HG3  . PRO A 1 6   ? -4.178  32.290 -36.372 1.00 50.41  ? 302 PRO A HG3  1 
ATOM   42   H HD2  . PRO A 1 6   ? -5.855  32.185 -34.124 1.00 49.62  ? 302 PRO A HD2  1 
ATOM   43   H HD3  . PRO A 1 6   ? -5.218  33.489 -34.807 1.00 49.62  ? 302 PRO A HD3  1 
ATOM   44   N N    . HIS A 1 7   ? -8.644  30.739 -38.137 1.00 36.59  ? 303 HIS A N    1 
ATOM   45   C CA   . HIS A 1 7   ? -9.887  29.986 -38.279 1.00 33.91  ? 303 HIS A CA   1 
ATOM   46   C C    . HIS A 1 7   ? -9.783  28.612 -37.638 1.00 28.94  ? 303 HIS A C    1 
ATOM   47   O O    . HIS A 1 7   ? -10.777 28.092 -37.118 1.00 31.12  ? 303 HIS A O    1 
ATOM   48   C CB   . HIS A 1 7   ? -10.253 29.852 -39.758 1.00 37.78  ? 303 HIS A CB   1 
ATOM   49   C CG   . HIS A 1 7   ? -10.681 31.137 -40.392 1.00 45.40  ? 303 HIS A CG   1 
ATOM   50   N ND1  . HIS A 1 7   ? -10.825 31.283 -41.755 1.00 50.12  ? 303 HIS A ND1  1 
ATOM   51   C CD2  . HIS A 1 7   ? -11.002 32.336 -39.850 1.00 48.69  ? 303 HIS A CD2  1 
ATOM   52   C CE1  . HIS A 1 7   ? -11.213 32.516 -42.025 1.00 52.90  ? 303 HIS A CE1  1 
ATOM   53   N NE2  . HIS A 1 7   ? -11.329 33.175 -40.887 1.00 52.07  ? 303 HIS A NE2  1 
ATOM   54   H H    . HIS A 1 7   ? -8.277  30.970 -38.880 1.00 43.91  ? 303 HIS A H    1 
ATOM   55   H HA   . HIS A 1 7   ? -10.601 30.470 -37.836 1.00 40.69  ? 303 HIS A HA   1 
ATOM   56   H HB2  . HIS A 1 7   ? -9.479  29.525 -40.243 1.00 45.33  ? 303 HIS A HB2  1 
ATOM   57   H HB3  . HIS A 1 7   ? -10.985 29.221 -39.842 1.00 45.33  ? 303 HIS A HB3  1 
ATOM   58   H HD2  . HIS A 1 7   ? -11.001 32.550 -38.945 1.00 58.43  ? 303 HIS A HD2  1 
ATOM   59   H HE1  . HIS A 1 7   ? -11.377 32.861 -42.873 1.00 63.49  ? 303 HIS A HE1  1 
ATOM   60   H HE2  . HIS A 1 7   ? -11.569 33.997 -40.807 1.00 62.48  ? 303 HIS A HE2  1 
ATOM   61   N N    . LEU A 1 8   ? -8.594  28.008 -37.664 1.00 28.38  ? 304 LEU A N    1 
ATOM   62   C CA   . LEU A 1 8   ? -8.414  26.710 -37.025 1.00 30.21  ? 304 LEU A CA   1 
ATOM   63   C C    . LEU A 1 8   ? -8.745  26.780 -35.540 1.00 26.40  ? 304 LEU A C    1 
ATOM   64   O O    . LEU A 1 8   ? -9.413  25.889 -35.002 1.00 28.31  ? 304 LEU A O    1 
ATOM   65   C CB   . LEU A 1 8   ? -6.981  26.222 -37.234 1.00 32.03  ? 304 LEU A CB   1 
ATOM   66   C CG   . LEU A 1 8   ? -6.591  24.928 -36.513 1.00 35.42  ? 304 LEU A CG   1 
ATOM   67   C CD1  . LEU A 1 8   ? -7.558  23.803 -36.831 1.00 37.57  ? 304 LEU A CD1  1 
ATOM   68   C CD2  . LEU A 1 8   ? -5.169  24.521 -36.887 1.00 41.80  ? 304 LEU A CD2  1 
ATOM   69   H H    . LEU A 1 8   ? -7.888  28.324 -38.039 1.00 34.06  ? 304 LEU A H    1 
ATOM   70   H HA   . LEU A 1 8   ? -9.014  26.069 -37.437 1.00 36.25  ? 304 LEU A HA   1 
ATOM   71   H HB2  . LEU A 1 8   ? -6.845  26.074 -38.183 1.00 38.44  ? 304 LEU A HB2  1 
ATOM   72   H HB3  . LEU A 1 8   ? -6.376  26.915 -36.927 1.00 38.44  ? 304 LEU A HB3  1 
ATOM   73   H HG   . LEU A 1 8   ? -6.615  25.082 -35.556 1.00 42.50  ? 304 LEU A HG   1 
ATOM   74   H HD11 . LEU A 1 8   ? -7.278  23.004 -36.358 1.00 45.08  ? 304 LEU A HD11 1 
ATOM   75   H HD12 . LEU A 1 8   ? -8.448  24.062 -36.546 1.00 45.08  ? 304 LEU A HD12 1 
ATOM   76   H HD13 . LEU A 1 8   ? -7.550  23.641 -37.787 1.00 45.08  ? 304 LEU A HD13 1 
ATOM   77   H HD21 . LEU A 1 8   ? -4.943  23.701 -36.421 1.00 50.16  ? 304 LEU A HD21 1 
ATOM   78   H HD22 . LEU A 1 8   ? -5.124  24.381 -37.846 1.00 50.16  ? 304 LEU A HD22 1 
ATOM   79   H HD23 . LEU A 1 8   ? -4.560  25.230 -36.627 1.00 50.16  ? 304 LEU A HD23 1 
ATOM   80   N N    . ILE A 1 9   ? -8.289  27.834 -34.859 1.00 30.36  ? 305 ILE A N    1 
ATOM   81   C CA   . ILE A 1 9   ? -8.564  27.963 -33.433 1.00 27.03  ? 305 ILE A CA   1 
ATOM   82   C C    . ILE A 1 9   ? -10.043 28.230 -33.194 1.00 28.46  ? 305 ILE A C    1 
ATOM   83   O O    . ILE A 1 9   ? -10.610 27.762 -32.198 1.00 30.87  ? 305 ILE A O    1 
ATOM   84   C CB   . ILE A 1 9   ? -7.671  29.058 -32.820 1.00 29.06  ? 305 ILE A CB   1 
ATOM   85   C CG1  . ILE A 1 9   ? -6.197  28.632 -32.917 1.00 28.26  ? 305 ILE A CG1  1 
ATOM   86   C CG2  . ILE A 1 9   ? -8.068  29.326 -31.364 1.00 29.84  ? 305 ILE A CG2  1 
ATOM   87   C CD1  . ILE A 1 9   ? -5.203  29.649 -32.391 1.00 28.16  ? 305 ILE A CD1  1 
ATOM   88   H H    . ILE A 1 9   ? -7.826  28.475 -35.196 1.00 36.43  ? 305 ILE A H    1 
ATOM   89   H HA   . ILE A 1 9   ? -8.342  27.125 -32.997 1.00 32.43  ? 305 ILE A HA   1 
ATOM   90   H HB   . ILE A 1 9   ? -7.791  29.876 -33.328 1.00 34.87  ? 305 ILE A HB   1 
ATOM   91   H HG12 . ILE A 1 9   ? -6.077  27.815 -32.408 1.00 33.92  ? 305 ILE A HG12 1 
ATOM   92   H HG13 . ILE A 1 9   ? -5.984  28.469 -33.849 1.00 33.92  ? 305 ILE A HG13 1 
ATOM   93   H HG21 . ILE A 1 9   ? -7.493  30.017 -31.002 1.00 35.80  ? 305 ILE A HG21 1 
ATOM   94   H HG22 . ILE A 1 9   ? -8.993  29.617 -31.338 1.00 35.80  ? 305 ILE A HG22 1 
ATOM   95   H HG23 . ILE A 1 9   ? -7.965  28.508 -30.853 1.00 35.80  ? 305 ILE A HG23 1 
ATOM   96   H HD11 . ILE A 1 9   ? -4.306  29.295 -32.493 1.00 33.79  ? 305 ILE A HD11 1 
ATOM   97   H HD12 . ILE A 1 9   ? -5.295  30.471 -32.897 1.00 33.79  ? 305 ILE A HD12 1 
ATOM   98   H HD13 . ILE A 1 9   ? -5.389  29.815 -31.453 1.00 33.79  ? 305 ILE A HD13 1 
ATOM   99   N N    . LEU A 1 10  ? -10.701 28.967 -34.092 1.00 30.91  ? 306 LEU A N    1 
ATOM   100  C CA   . LEU A 1 10  ? -12.138 29.181 -33.944 1.00 32.25  ? 306 LEU A CA   1 
ATOM   101  C C    . LEU A 1 10  ? -12.892 27.861 -33.986 1.00 30.48  ? 306 LEU A C    1 
ATOM   102  O O    . LEU A 1 10  ? -13.884 27.681 -33.270 1.00 35.62  ? 306 LEU A O    1 
ATOM   103  C CB   . LEU A 1 10  ? -12.651 30.124 -35.033 1.00 36.67  ? 306 LEU A CB   1 
ATOM   104  C CG   . LEU A 1 10  ? -12.167 31.574 -34.962 1.00 38.68  ? 306 LEU A CG   1 
ATOM   105  C CD1  . LEU A 1 10  ? -12.715 32.372 -36.130 1.00 40.73  ? 306 LEU A CD1  1 
ATOM   106  C CD2  . LEU A 1 10  ? -12.572 32.226 -33.649 1.00 40.01  ? 306 LEU A CD2  1 
ATOM   107  H H    . LEU A 1 10  ? -10.347 29.345 -34.779 1.00 37.09  ? 306 LEU A H    1 
ATOM   108  H HA   . LEU A 1 10  ? -12.308 29.596 -33.084 1.00 38.70  ? 306 LEU A HA   1 
ATOM   109  H HB2  . LEU A 1 10  ? -12.378 29.771 -35.894 1.00 44.00  ? 306 LEU A HB2  1 
ATOM   110  H HB3  . LEU A 1 10  ? -13.620 30.142 -34.986 1.00 44.00  ? 306 LEU A HB3  1 
ATOM   111  H HG   . LEU A 1 10  ? -11.199 31.587 -35.017 1.00 46.41  ? 306 LEU A HG   1 
ATOM   112  H HD11 . LEU A 1 10  ? -12.397 33.286 -36.065 1.00 48.87  ? 306 LEU A HD11 1 
ATOM   113  H HD12 . LEU A 1 10  ? -12.407 31.972 -36.958 1.00 48.87  ? 306 LEU A HD12 1 
ATOM   114  H HD13 . LEU A 1 10  ? -13.685 32.356 -36.096 1.00 48.87  ? 306 LEU A HD13 1 
ATOM   115  H HD21 . LEU A 1 10  ? -12.250 33.140 -33.639 1.00 48.01  ? 306 LEU A HD21 1 
ATOM   116  H HD22 . LEU A 1 10  ? -13.540 32.214 -33.577 1.00 48.01  ? 306 LEU A HD22 1 
ATOM   117  H HD23 . LEU A 1 10  ? -12.179 31.728 -32.915 1.00 48.01  ? 306 LEU A HD23 1 
ATOM   118  N N    . GLU A 1 11  ? -12.438 26.919 -34.814 1.00 29.50  ? 307 GLU A N    1 
ATOM   119  C CA   . GLU A 1 11  ? -13.082 25.612 -34.848 1.00 32.32  ? 307 GLU A CA   1 
ATOM   120  C C    . GLU A 1 11  ? -12.810 24.824 -33.569 1.00 32.18  ? 307 GLU A C    1 
ATOM   121  O O    . GLU A 1 11  ? -13.677 24.069 -33.112 1.00 35.51  ? 307 GLU A O    1 
ATOM   122  C CB   . GLU A 1 11  ? -12.614 24.835 -36.082 1.00 39.05  ? 307 GLU A CB   1 
ATOM   123  C CG   . GLU A 1 11  ? -13.716 24.094 -36.842 1.00 48.25  ? 307 GLU A CG   1 
ATOM   124  C CD   . GLU A 1 11  ? -14.895 24.976 -37.224 1.00 51.23  ? 307 GLU A CD   1 
ATOM   125  O OE1  . GLU A 1 11  ? -14.678 26.143 -37.621 1.00 48.54  ? 307 GLU A OE1  1 
ATOM   126  O OE2  . GLU A 1 11  ? -16.043 24.500 -37.122 1.00 56.63  ? 307 GLU A OE2  1 
ATOM   127  H H    . GLU A 1 11  ? -11.774 27.011 -35.352 1.00 35.40  ? 307 GLU A H    1 
ATOM   128  H HA   . GLU A 1 11  ? -14.041 25.737 -34.922 1.00 38.79  ? 307 GLU A HA   1 
ATOM   129  H HB2  . GLU A 1 11  ? -12.202 25.459 -36.701 1.00 46.85  ? 307 GLU A HB2  1 
ATOM   130  H HB3  . GLU A 1 11  ? -11.959 24.177 -35.802 1.00 46.85  ? 307 GLU A HB3  1 
ATOM   131  H HG2  . GLU A 1 11  ? -13.342 23.729 -37.659 1.00 57.90  ? 307 GLU A HG2  1 
ATOM   132  H HG3  . GLU A 1 11  ? -14.052 23.375 -36.284 1.00 57.90  ? 307 GLU A HG3  1 
ATOM   133  N N    . LEU A 1 12  ? -11.629 24.994 -32.969 1.00 35.07  ? 308 LEU A N    1 
ATOM   134  C CA   . LEU A 1 12  ? -11.344 24.330 -31.700 1.00 31.50  ? 308 LEU A CA   1 
ATOM   135  C C    . LEU A 1 12  ? -12.222 24.879 -30.581 1.00 34.69  ? 308 LEU A C    1 
ATOM   136  O O    . LEU A 1 12  ? -12.673 24.123 -29.711 1.00 35.47  ? 308 LEU A O    1 
ATOM   137  C CB   . LEU A 1 12  ? -9.866  24.492 -31.347 1.00 31.38  ? 308 LEU A CB   1 
ATOM   138  C CG   . LEU A 1 12  ? -8.838  24.024 -32.385 1.00 33.19  ? 308 LEU A CG   1 
ATOM   139  C CD1  . LEU A 1 12  ? -7.441  24.047 -31.786 1.00 31.38  ? 308 LEU A CD1  1 
ATOM   140  C CD2  . LEU A 1 12  ? -9.169  22.638 -32.931 1.00 33.86  ? 308 LEU A CD2  1 
ATOM   141  H H    . LEU A 1 12  ? -10.988 25.480 -33.272 1.00 42.08  ? 308 LEU A H    1 
ATOM   142  H HA   . LEU A 1 12  ? -11.529 23.383 -31.790 1.00 37.80  ? 308 LEU A HA   1 
ATOM   143  H HB2  . LEU A 1 12  ? -9.697  25.433 -31.184 1.00 37.66  ? 308 LEU A HB2  1 
ATOM   144  H HB3  . LEU A 1 12  ? -9.695  23.993 -30.533 1.00 37.66  ? 308 LEU A HB3  1 
ATOM   145  H HG   . LEU A 1 12  ? -8.848  24.644 -33.131 1.00 39.82  ? 308 LEU A HG   1 
ATOM   146  H HD11 . LEU A 1 12  ? -6.806  23.749 -32.456 1.00 37.66  ? 308 LEU A HD11 1 
ATOM   147  H HD12 . LEU A 1 12  ? -7.231  24.953 -31.511 1.00 37.66  ? 308 LEU A HD12 1 
ATOM   148  H HD13 . LEU A 1 12  ? -7.417  23.454 -31.019 1.00 37.66  ? 308 LEU A HD13 1 
ATOM   149  H HD21 . LEU A 1 12  ? -8.495  22.386 -33.581 1.00 40.64  ? 308 LEU A HD21 1 
ATOM   150  H HD22 . LEU A 1 12  ? -9.176  22.004 -32.197 1.00 40.64  ? 308 LEU A HD22 1 
ATOM   151  H HD23 . LEU A 1 12  ? -10.042 22.666 -33.353 1.00 40.64  ? 308 LEU A HD23 1 
ATOM   152  N N    . LEU A 1 13  ? -12.479 26.190 -30.585 1.00 31.38  ? 309 LEU A N    1 
ATOM   153  C CA   . LEU A 1 13  ? -13.302 26.790 -29.539 1.00 30.90  ? 309 LEU A CA   1 
ATOM   154  C C    . LEU A 1 13  ? -14.737 26.282 -29.594 1.00 32.09  ? 309 LEU A C    1 
ATOM   155  O O    . LEU A 1 13  ? -15.400 26.186 -28.557 1.00 34.90  ? 309 LEU A O    1 
ATOM   156  C CB   . LEU A 1 13  ? -13.265 28.314 -29.658 1.00 29.29  ? 309 LEU A CB   1 
ATOM   157  C CG   . LEU A 1 13  ? -11.935 28.959 -29.243 1.00 30.05  ? 309 LEU A CG   1 
ATOM   158  C CD1  . LEU A 1 13  ? -11.816 30.377 -29.772 1.00 30.25  ? 309 LEU A CD1  1 
ATOM   159  C CD2  . LEU A 1 13  ? -11.790 28.959 -27.728 1.00 32.42  ? 309 LEU A CD2  1 
ATOM   160  H H    . LEU A 1 13  ? -12.191 26.745 -31.175 1.00 37.66  ? 309 LEU A H    1 
ATOM   161  H HA   . LEU A 1 13  ? -12.934 26.549 -28.674 1.00 37.08  ? 309 LEU A HA   1 
ATOM   162  H HB2  . LEU A 1 13  ? -13.433 28.556 -30.582 1.00 35.15  ? 309 LEU A HB2  1 
ATOM   163  H HB3  . LEU A 1 13  ? -13.960 28.686 -29.092 1.00 35.15  ? 309 LEU A HB3  1 
ATOM   164  H HG   . LEU A 1 13  ? -11.204 28.439 -29.613 1.00 36.06  ? 309 LEU A HG   1 
ATOM   165  H HD11 . LEU A 1 13  ? -10.966 30.749 -29.489 1.00 36.30  ? 309 LEU A HD11 1 
ATOM   166  H HD12 . LEU A 1 13  ? -11.864 30.358 -30.740 1.00 36.30  ? 309 LEU A HD12 1 
ATOM   167  H HD13 . LEU A 1 13  ? -12.545 30.909 -29.415 1.00 36.30  ? 309 LEU A HD13 1 
ATOM   168  H HD21 . LEU A 1 13  ? -10.944 29.371 -27.493 1.00 38.91  ? 309 LEU A HD21 1 
ATOM   169  H HD22 . LEU A 1 13  ? -12.523 29.464 -27.341 1.00 38.91  ? 309 LEU A HD22 1 
ATOM   170  H HD23 . LEU A 1 13  ? -11.813 28.044 -27.409 1.00 38.91  ? 309 LEU A HD23 1 
ATOM   171  N N    . LYS A 1 14  ? -15.230 25.948 -30.787 1.00 36.96  ? 310 LYS A N    1 
ATOM   172  C CA   . LYS A 1 14  ? -16.578 25.404 -30.911 1.00 40.81  ? 310 LYS A CA   1 
ATOM   173  C C    . LYS A 1 14  ? -16.741 24.091 -30.161 1.00 42.75  ? 310 LYS A C    1 
ATOM   174  O O    . LYS A 1 14  ? -17.851 23.757 -29.732 1.00 44.77  ? 310 LYS A O    1 
ATOM   175  C CB   . LYS A 1 14  ? -16.919 25.188 -32.382 1.00 47.96  ? 310 LYS A CB   1 
ATOM   176  C CG   . LYS A 1 14  ? -17.087 26.462 -33.160 1.00 54.01  ? 310 LYS A CG   1 
ATOM   177  C CD   . LYS A 1 14  ? -17.129 26.183 -34.645 1.00 61.17  ? 310 LYS A CD   1 
ATOM   178  C CE   . LYS A 1 14  ? -17.349 27.458 -35.423 1.00 66.27  ? 310 LYS A CE   1 
ATOM   179  N NZ   . LYS A 1 14  ? -17.374 27.200 -36.882 1.00 70.51  ? 310 LYS A NZ   1 
ATOM   180  H H    . LYS A 1 14  ? -14.807 26.026 -31.532 1.00 44.35  ? 310 LYS A H    1 
ATOM   181  H HA   . LYS A 1 14  ? -17.212 26.041 -30.545 1.00 48.97  ? 310 LYS A HA   1 
ATOM   182  H HB2  . LYS A 1 14  ? -16.204 24.680 -32.796 1.00 57.55  ? 310 LYS A HB2  1 
ATOM   183  H HB3  . LYS A 1 14  ? -17.751 24.693 -32.440 1.00 57.55  ? 310 LYS A HB3  1 
ATOM   184  H HG2  . LYS A 1 14  ? -17.920 26.888 -32.905 1.00 64.81  ? 310 LYS A HG2  1 
ATOM   185  H HG3  . LYS A 1 14  ? -16.338 27.051 -32.980 1.00 64.81  ? 310 LYS A HG3  1 
ATOM   186  H HD2  . LYS A 1 14  ? -16.285 25.795 -34.924 1.00 73.41  ? 310 LYS A HD2  1 
ATOM   187  H HD3  . LYS A 1 14  ? -17.860 25.575 -34.838 1.00 73.41  ? 310 LYS A HD3  1 
ATOM   188  H HE2  . LYS A 1 14  ? -18.201 27.847 -35.167 1.00 79.53  ? 310 LYS A HE2  1 
ATOM   189  H HE3  . LYS A 1 14  ? -16.627 28.077 -35.235 1.00 79.53  ? 310 LYS A HE3  1 
ATOM   190  H HZ1  . LYS A 1 14  ? -17.505 27.962 -37.323 1.00 84.61  ? 310 LYS A HZ1  1 
ATOM   191  H HZ2  . LYS A 1 14  ? -16.601 26.845 -37.142 1.00 84.61  ? 310 LYS A HZ2  1 
ATOM   192  H HZ3  . LYS A 1 14  ? -18.033 26.635 -37.080 1.00 84.61  ? 310 LYS A HZ3  1 
ATOM   193  N N    . CYS A 1 15  ? -15.669 23.317 -30.025 1.00 41.02  ? 311 CYS A N    1 
ATOM   194  C CA   . CYS A 1 15  ? -15.748 22.029 -29.353 1.00 44.23  ? 311 CYS A CA   1 
ATOM   195  C C    . CYS A 1 15  ? -15.776 22.157 -27.838 1.00 40.34  ? 311 CYS A C    1 
ATOM   196  O O    . CYS A 1 15  ? -15.988 21.152 -27.152 1.00 43.19  ? 311 CYS A O    1 
ATOM   197  C CB   . CYS A 1 15  ? -14.566 21.153 -29.779 1.00 50.95  ? 311 CYS A CB   1 
ATOM   198  S SG   . CYS A 1 15  ? -14.486 20.885 -31.562 1.00 60.25  ? 311 CYS A SG   1 
ATOM   199  H H    . CYS A 1 15  ? -14.884 23.517 -30.315 1.00 49.23  ? 311 CYS A H    1 
ATOM   200  H HA   . CYS A 1 15  ? -16.564 21.582 -29.629 1.00 53.08  ? 311 CYS A HA   1 
ATOM   201  H HB2  . CYS A 1 15  ? -13.742 21.583 -29.504 1.00 61.14  ? 311 CYS A HB2  1 
ATOM   202  H HB3  . CYS A 1 15  ? -14.646 20.287 -29.350 1.00 61.14  ? 311 CYS A HB3  1 
ATOM   203  H HG   . CYS A 1 15  ? -14.374 21.946 -32.112 1.00 72.29  ? 311 CYS A HG   1 
ATOM   204  N N    . GLU A 1 16  ? -15.584 23.358 -27.302 1.00 34.64  ? 312 GLU A N    1 
ATOM   205  C CA   . GLU A 1 16  ? -15.525 23.513 -25.859 1.00 34.16  ? 312 GLU A CA   1 
ATOM   206  C C    . GLU A 1 16  ? -16.882 23.183 -25.241 1.00 31.35  ? 312 GLU A C    1 
ATOM   207  O O    . GLU A 1 16  ? -17.920 23.584 -25.778 1.00 34.48  ? 312 GLU A O    1 
ATOM   208  C CB   . GLU A 1 16  ? -15.113 24.936 -25.483 1.00 30.87  ? 312 GLU A CB   1 
ATOM   209  C CG   . GLU A 1 16  ? -13.618 25.180 -25.607 1.00 33.00  ? 312 GLU A CG   1 
ATOM   210  C CD   . GLU A 1 16  ? -12.815 24.328 -24.640 1.00 35.74  ? 312 GLU A CD   1 
ATOM   211  O OE1  . GLU A 1 16  ? -12.641 24.751 -23.478 1.00 37.68  ? 312 GLU A OE1  1 
ATOM   212  O OE2  . GLU A 1 16  ? -12.387 23.223 -25.037 1.00 33.16  ? 312 GLU A OE2  1 
ATOM   213  H H    . GLU A 1 16  ? -15.486 24.087 -27.747 1.00 41.57  ? 312 GLU A H    1 
ATOM   214  H HA   . GLU A 1 16  ? -14.868 22.898 -25.496 1.00 40.99  ? 312 GLU A HA   1 
ATOM   215  H HB2  . GLU A 1 16  ? -15.567 25.560 -26.069 1.00 37.05  ? 312 GLU A HB2  1 
ATOM   216  H HB3  . GLU A 1 16  ? -15.367 25.103 -24.561 1.00 37.05  ? 312 GLU A HB3  1 
ATOM   217  H HG2  . GLU A 1 16  ? -13.335 24.962 -26.509 1.00 39.60  ? 312 GLU A HG2  1 
ATOM   218  H HG3  . GLU A 1 16  ? -13.432 26.113 -25.415 1.00 39.60  ? 312 GLU A HG3  1 
ATOM   219  N N    . PRO A 1 17  ? -16.913 22.457 -24.126 1.00 40.74  ? 313 PRO A N    1 
ATOM   220  C CA   . PRO A 1 17  ? -18.198 22.159 -23.486 1.00 41.76  ? 313 PRO A CA   1 
ATOM   221  C C    . PRO A 1 17  ? -18.847 23.409 -22.915 1.00 40.23  ? 313 PRO A C    1 
ATOM   222  O O    . PRO A 1 17  ? -18.180 24.390 -22.580 1.00 36.22  ? 313 PRO A O    1 
ATOM   223  C CB   . PRO A 1 17  ? -17.826 21.173 -22.370 1.00 42.36  ? 313 PRO A CB   1 
ATOM   224  C CG   . PRO A 1 17  ? -16.459 20.683 -22.709 1.00 43.52  ? 313 PRO A CG   1 
ATOM   225  C CD   . PRO A 1 17  ? -15.793 21.795 -23.430 1.00 42.31  ? 313 PRO A CD   1 
ATOM   226  H HA   . PRO A 1 17  ? -18.803 21.731 -24.113 1.00 50.12  ? 313 PRO A HA   1 
ATOM   227  H HB2  . PRO A 1 17  ? -17.822 21.635 -21.516 1.00 50.83  ? 313 PRO A HB2  1 
ATOM   228  H HB3  . PRO A 1 17  ? -18.460 20.439 -22.359 1.00 50.83  ? 313 PRO A HB3  1 
ATOM   229  H HG2  . PRO A 1 17  ? -15.979 20.471 -21.893 1.00 52.23  ? 313 PRO A HG2  1 
ATOM   230  H HG3  . PRO A 1 17  ? -16.527 19.901 -23.278 1.00 52.23  ? 313 PRO A HG3  1 
ATOM   231  H HD2  . PRO A 1 17  ? -15.376 22.406 -22.802 1.00 50.77  ? 313 PRO A HD2  1 
ATOM   232  H HD3  . PRO A 1 17  ? -15.153 21.449 -24.071 1.00 50.77  ? 313 PRO A HD3  1 
ATOM   233  N N    . ASP A 1 18  ? -20.171 23.363 -22.800 1.00 36.88  ? 314 ASP A N    1 
ATOM   234  C CA   . ASP A 1 18  ? -20.912 24.433 -22.141 1.00 37.49  ? 314 ASP A CA   1 
ATOM   235  C C    . ASP A 1 18  ? -20.589 24.399 -20.652 1.00 35.35  ? 314 ASP A C    1 
ATOM   236  O O    . ASP A 1 18  ? -20.973 23.460 -19.947 1.00 36.56  ? 314 ASP A O    1 
ATOM   237  C CB   . ASP A 1 18  ? -22.408 24.266 -22.396 1.00 39.20  ? 314 ASP A CB   1 
ATOM   238  C CG   . ASP A 1 18  ? -23.235 25.381 -21.790 1.00 39.83  ? 314 ASP A CG   1 
ATOM   239  O OD1  . ASP A 1 18  ? -23.603 25.264 -20.603 1.00 40.20  ? 314 ASP A OD1  1 
ATOM   240  O OD2  . ASP A 1 18  ? -23.528 26.366 -22.500 1.00 42.09  ? 314 ASP A OD2  1 
ATOM   241  H H    . ASP A 1 18  ? -20.664 22.723 -23.096 1.00 44.26  ? 314 ASP A H    1 
ATOM   242  H HA   . ASP A 1 18  ? -20.632 25.290 -22.498 1.00 44.99  ? 314 ASP A HA   1 
ATOM   243  H HB2  . ASP A 1 18  ? -22.567 24.261 -23.352 1.00 47.04  ? 314 ASP A HB2  1 
ATOM   244  H HB3  . ASP A 1 18  ? -22.704 23.428 -22.006 1.00 47.04  ? 314 ASP A HB3  1 
ATOM   245  N N    . GLU A 1 19  ? -19.868 25.413 -20.172 1.00 38.80  ? 315 GLU A N    1 
ATOM   246  C CA   . GLU A 1 19  ? -19.388 25.396 -18.792 1.00 41.38  ? 315 GLU A CA   1 
ATOM   247  C C    . GLU A 1 19  ? -20.521 25.350 -17.778 1.00 44.72  ? 315 GLU A C    1 
ATOM   248  O O    . GLU A 1 19  ? -20.464 24.511 -16.861 1.00 42.38  ? 315 GLU A O    1 
ATOM   249  C CB   . GLU A 1 19  ? -18.477 26.605 -18.555 1.00 52.65  ? 315 GLU A CB   1 
ATOM   250  C CG   . GLU A 1 19  ? -17.755 26.597 -17.221 1.00 60.45  ? 315 GLU A CG   1 
ATOM   251  C CD   . GLU A 1 19  ? -16.829 27.788 -17.065 1.00 68.75  ? 315 GLU A CD   1 
ATOM   252  O OE1  . GLU A 1 19  ? -15.901 27.928 -17.890 1.00 69.21  ? 315 GLU A OE1  1 
ATOM   253  O OE2  . GLU A 1 19  ? -17.038 28.591 -16.132 1.00 73.97  ? 315 GLU A OE2  1 
ATOM   254  H H    . GLU A 1 19  ? -19.647 26.113 -20.619 1.00 46.56  ? 315 GLU A H    1 
ATOM   255  H HA   . GLU A 1 19  ? -18.851 24.598 -18.664 1.00 49.66  ? 315 GLU A HA   1 
ATOM   256  H HB2  . GLU A 1 19  ? -17.804 26.627 -19.253 1.00 63.17  ? 315 GLU A HB2  1 
ATOM   257  H HB3  . GLU A 1 19  ? -19.015 27.411 -18.593 1.00 63.17  ? 315 GLU A HB3  1 
ATOM   258  H HG2  . GLU A 1 19  ? -18.409 26.627 -16.505 1.00 72.54  ? 315 GLU A HG2  1 
ATOM   259  H HG3  . GLU A 1 19  ? -17.222 25.790 -17.152 1.00 72.54  ? 315 GLU A HG3  1 
ATOM   260  N N    . PRO A 1 20  ? -21.559 26.188 -17.864 1.00 45.85  ? 316 PRO A N    1 
ATOM   261  C CA   . PRO A 1 20  ? -22.625 26.105 -16.851 1.00 47.63  ? 316 PRO A CA   1 
ATOM   262  C C    . PRO A 1 20  ? -23.311 24.753 -16.821 1.00 43.31  ? 316 PRO A C    1 
ATOM   263  O O    . PRO A 1 20  ? -23.680 24.278 -15.742 1.00 40.32  ? 316 PRO A O    1 
ATOM   264  C CB   . PRO A 1 20  ? -23.591 27.228 -17.261 1.00 49.90  ? 316 PRO A CB   1 
ATOM   265  C CG   . PRO A 1 20  ? -22.781 28.140 -18.125 1.00 51.11  ? 316 PRO A CG   1 
ATOM   266  C CD   . PRO A 1 20  ? -21.820 27.256 -18.845 1.00 48.33  ? 316 PRO A CD   1 
ATOM   267  H HA   . PRO A 1 20  ? -22.266 26.300 -15.971 1.00 57.16  ? 316 PRO A HA   1 
ATOM   268  H HB2  . PRO A 1 20  ? -24.335 26.854 -17.759 1.00 59.89  ? 316 PRO A HB2  1 
ATOM   269  H HB3  . PRO A 1 20  ? -23.906 27.693 -16.471 1.00 59.89  ? 316 PRO A HB3  1 
ATOM   270  H HG2  . PRO A 1 20  ? -23.362 28.596 -18.753 1.00 61.34  ? 316 PRO A HG2  1 
ATOM   271  H HG3  . PRO A 1 20  ? -22.307 28.779 -17.570 1.00 61.34  ? 316 PRO A HG3  1 
ATOM   272  H HD2  . PRO A 1 20  ? -22.229 26.890 -19.645 1.00 58.00  ? 316 PRO A HD2  1 
ATOM   273  H HD3  . PRO A 1 20  ? -21.003 27.737 -19.049 1.00 58.00  ? 316 PRO A HD3  1 
ATOM   274  N N    . GLN A 1 21  ? -23.486 24.109 -17.977 1.00 42.94  ? 317 GLN A N    1 
ATOM   275  C CA   . GLN A 1 21  ? -24.187 22.829 -18.000 1.00 41.21  ? 317 GLN A CA   1 
ATOM   276  C C    . GLN A 1 21  ? -23.316 21.710 -17.441 1.00 40.24  ? 317 GLN A C    1 
ATOM   277  O O    . GLN A 1 21  ? -23.827 20.781 -16.803 1.00 40.34  ? 317 GLN A O    1 
ATOM   278  C CB   . GLN A 1 21  ? -24.636 22.504 -19.424 1.00 42.93  ? 317 GLN A CB   1 
ATOM   279  C CG   . GLN A 1 21  ? -25.627 21.355 -19.517 1.00 46.66  ? 317 GLN A CG   1 
ATOM   280  C CD   . GLN A 1 21  ? -26.867 21.579 -18.668 1.00 50.35  ? 317 GLN A CD   1 
ATOM   281  O OE1  . GLN A 1 21  ? -27.815 22.244 -19.091 1.00 56.96  ? 317 GLN A OE1  1 
ATOM   282  N NE2  . GLN A 1 21  ? -26.863 21.025 -17.460 1.00 46.19  ? 317 GLN A NE2  1 
ATOM   283  H H    . GLN A 1 21  ? -23.215 24.386 -18.744 1.00 51.53  ? 317 GLN A H    1 
ATOM   284  H HA   . GLN A 1 21  ? -24.979 22.895 -17.445 1.00 49.45  ? 317 GLN A HA   1 
ATOM   285  H HB2  . GLN A 1 21  ? -25.058 23.290 -19.805 1.00 51.52  ? 317 GLN A HB2  1 
ATOM   286  H HB3  . GLN A 1 21  ? -23.856 22.264 -19.950 1.00 51.52  ? 317 GLN A HB3  1 
ATOM   287  H HG2  . GLN A 1 21  ? -25.910 21.255 -20.440 1.00 55.99  ? 317 GLN A HG2  1 
ATOM   288  H HG3  . GLN A 1 21  ? -25.197 20.541 -19.212 1.00 55.99  ? 317 GLN A HG3  1 
ATOM   289  H HE21 . GLN A 1 21  ? -26.182 20.570 -17.198 1.00 55.43  ? 317 GLN A HE21 1 
ATOM   290  H HE22 . GLN A 1 21  ? -27.541 21.123 -16.940 1.00 55.43  ? 317 GLN A HE22 1 
ATOM   291  N N    . VAL A 1 22  ? -22.002 21.770 -17.674 1.00 34.77  ? 318 VAL A N    1 
ATOM   292  C CA   . VAL A 1 22  ? -21.105 20.786 -17.073 1.00 34.89  ? 318 VAL A CA   1 
ATOM   293  C C    . VAL A 1 22  ? -21.110 20.931 -15.558 1.00 32.12  ? 318 VAL A C    1 
ATOM   294  O O    . VAL A 1 22  ? -21.174 19.937 -14.824 1.00 33.77  ? 318 VAL A O    1 
ATOM   295  C CB   . VAL A 1 22  ? -19.683 20.924 -17.651 1.00 37.46  ? 318 VAL A CB   1 
ATOM   296  C CG1  . VAL A 1 22  ? -18.720 19.967 -16.953 1.00 37.00  ? 318 VAL A CG1  1 
ATOM   297  C CG2  . VAL A 1 22  ? -19.683 20.654 -19.150 1.00 41.38  ? 318 VAL A CG2  1 
ATOM   298  H H    . VAL A 1 22  ? -21.614 22.358 -18.167 1.00 41.72  ? 318 VAL A H    1 
ATOM   299  H HA   . VAL A 1 22  ? -21.428 19.897 -17.287 1.00 41.87  ? 318 VAL A HA   1 
ATOM   300  H HB   . VAL A 1 22  ? -19.367 21.830 -17.507 1.00 44.95  ? 318 VAL A HB   1 
ATOM   301  H HG11 . VAL A 1 22  ? -17.835 20.076 -17.335 1.00 44.39  ? 318 VAL A HG11 1 
ATOM   302  H HG12 . VAL A 1 22  ? -18.699 20.176 -16.006 1.00 44.39  ? 318 VAL A HG12 1 
ATOM   303  H HG13 . VAL A 1 22  ? -19.029 19.057 -17.084 1.00 44.39  ? 318 VAL A HG13 1 
ATOM   304  H HG21 . VAL A 1 22  ? -18.778 20.747 -19.487 1.00 49.65  ? 318 VAL A HG21 1 
ATOM   305  H HG22 . VAL A 1 22  ? -20.004 19.753 -19.308 1.00 49.65  ? 318 VAL A HG22 1 
ATOM   306  H HG23 . VAL A 1 22  ? -20.266 21.295 -19.585 1.00 49.65  ? 318 VAL A HG23 1 
ATOM   307  N N    . GLN A 1 23  ? -21.052 22.170 -15.063 1.00 34.42  ? 319 GLN A N    1 
ATOM   308  C CA   . GLN A 1 23  ? -21.051 22.389 -13.620 1.00 37.97  ? 319 GLN A CA   1 
ATOM   309  C C    . GLN A 1 23  ? -22.324 21.845 -12.987 1.00 38.43  ? 319 GLN A C    1 
ATOM   310  O O    . GLN A 1 23  ? -22.273 21.118 -11.988 1.00 37.48  ? 319 GLN A O    1 
ATOM   311  C CB   . GLN A 1 23  ? -20.892 23.880 -13.313 1.00 47.54  ? 319 GLN A CB   1 
ATOM   312  C CG   . GLN A 1 23  ? -19.549 24.460 -13.728 1.00 55.20  ? 319 GLN A CG   1 
ATOM   313  C CD   . GLN A 1 23  ? -19.374 25.904 -13.298 1.00 63.68  ? 319 GLN A CD   1 
ATOM   314  O OE1  . GLN A 1 23  ? -20.220 26.464 -12.601 1.00 66.31  ? 319 GLN A OE1  1 
ATOM   315  N NE2  . GLN A 1 23  ? -18.267 26.512 -13.708 1.00 66.95  ? 319 GLN A NE2  1 
ATOM   316  H H    . GLN A 1 23  ? -21.012 22.887 -15.535 1.00 41.31  ? 319 GLN A H    1 
ATOM   317  H HA   . GLN A 1 23  ? -20.297 21.920 -13.230 1.00 45.56  ? 319 GLN A HA   1 
ATOM   318  H HB2  . GLN A 1 23  ? -21.584 24.370 -13.783 1.00 57.04  ? 319 GLN A HB2  1 
ATOM   319  H HB3  . GLN A 1 23  ? -20.989 24.013 -12.357 1.00 57.04  ? 319 GLN A HB3  1 
ATOM   320  H HG2  . GLN A 1 23  ? -18.840 23.938 -13.321 1.00 66.24  ? 319 GLN A HG2  1 
ATOM   321  H HG3  . GLN A 1 23  ? -19.475 24.424 -14.694 1.00 66.24  ? 319 GLN A HG3  1 
ATOM   322  H HE21 . GLN A 1 23  ? -17.697 26.086 -14.191 1.00 80.34  ? 319 GLN A HE21 1 
ATOM   323  H HE22 . GLN A 1 23  ? -18.120 27.331 -13.491 1.00 80.34  ? 319 GLN A HE22 1 
ATOM   324  N N    . ALA A 1 24  ? -23.481 22.186 -13.560 1.00 38.49  ? 320 ALA A N    1 
ATOM   325  C CA   . ALA A 1 24  ? -24.748 21.734 -12.997 1.00 36.99  ? 320 ALA A CA   1 
ATOM   326  C C    . ALA A 1 24  ? -24.839 20.214 -12.992 1.00 34.45  ? 320 ALA A C    1 
ATOM   327  O O    . ALA A 1 24  ? -25.397 19.620 -12.061 1.00 34.48  ? 320 ALA A O    1 
ATOM   328  C CB   . ALA A 1 24  ? -25.913 22.335 -13.786 1.00 41.72  ? 320 ALA A CB   1 
ATOM   329  H H    . ALA A 1 24  ? -23.556 22.672 -14.266 1.00 46.18  ? 320 ALA A H    1 
ATOM   330  H HA   . ALA A 1 24  ? -24.816 22.043 -12.080 1.00 44.39  ? 320 ALA A HA   1 
ATOM   331  H HB1  . ALA A 1 24  ? -26.747 22.025 -13.401 1.00 50.06  ? 320 ALA A HB1  1 
ATOM   332  H HB2  . ALA A 1 24  ? -25.862 23.302 -13.735 1.00 50.06  ? 320 ALA A HB2  1 
ATOM   333  H HB3  . ALA A 1 24  ? -25.848 22.048 -14.711 1.00 50.06  ? 320 ALA A HB3  1 
ATOM   334  N N    . LYS A 1 25  ? -24.294 19.568 -14.022 1.00 33.70  ? 321 LYS A N    1 
ATOM   335  C CA   . LYS A 1 25  ? -24.402 18.118 -14.133 1.00 36.47  ? 321 LYS A CA   1 
ATOM   336  C C    . LYS A 1 25  ? -23.543 17.416 -13.086 1.00 32.75  ? 321 LYS A C    1 
ATOM   337  O O    . LYS A 1 25  ? -24.017 16.516 -12.385 1.00 32.86  ? 321 LYS A O    1 
ATOM   338  C CB   . LYS A 1 25  ? -24.011 17.682 -15.542 1.00 40.79  ? 321 LYS A CB   1 
ATOM   339  C CG   . LYS A 1 25  ? -23.914 16.181 -15.745 1.00 45.54  ? 321 LYS A CG   1 
ATOM   340  C CD   . LYS A 1 25  ? -22.516 15.796 -16.178 1.00 49.93  ? 321 LYS A CD   1 
ATOM   341  C CE   . LYS A 1 25  ? -22.304 14.302 -16.113 1.00 52.40  ? 321 LYS A CE   1 
ATOM   342  N NZ   . LYS A 1 25  ? -20.921 13.932 -16.530 1.00 53.85  ? 321 LYS A NZ   1 
ATOM   343  H H    . LYS A 1 25  ? -23.861 19.944 -14.663 1.00 40.44  ? 321 LYS A H    1 
ATOM   344  H HA   . LYS A 1 25  ? -25.325 17.858 -13.984 1.00 43.76  ? 321 LYS A HA   1 
ATOM   345  H HB2  . LYS A 1 25  ? -24.674 18.019 -16.165 1.00 48.95  ? 321 LYS A HB2  1 
ATOM   346  H HB3  . LYS A 1 25  ? -23.144 18.062 -15.753 1.00 48.95  ? 321 LYS A HB3  1 
ATOM   347  H HG2  . LYS A 1 25  ? -24.113 15.729 -14.910 1.00 54.64  ? 321 LYS A HG2  1 
ATOM   348  H HG3  . LYS A 1 25  ? -24.537 15.907 -16.436 1.00 54.64  ? 321 LYS A HG3  1 
ATOM   349  H HD2  . LYS A 1 25  ? -22.376 16.083 -17.094 1.00 59.92  ? 321 LYS A HD2  1 
ATOM   350  H HD3  . LYS A 1 25  ? -21.871 16.220 -15.591 1.00 59.92  ? 321 LYS A HD3  1 
ATOM   351  H HE2  . LYS A 1 25  ? -22.438 13.999 -15.202 1.00 62.88  ? 321 LYS A HE2  1 
ATOM   352  H HE3  . LYS A 1 25  ? -22.930 13.863 -16.710 1.00 62.88  ? 321 LYS A HE3  1 
ATOM   353  H HZ1  . LYS A 1 25  ? -20.775 14.199 -17.367 1.00 64.62  ? 321 LYS A HZ1  1 
ATOM   354  H HZ2  . LYS A 1 25  ? -20.327 14.322 -15.994 1.00 64.62  ? 321 LYS A HZ2  1 
ATOM   355  H HZ3  . LYS A 1 25  ? -20.816 13.050 -16.485 1.00 64.62  ? 321 LYS A HZ3  1 
ATOM   356  N N    . ILE A 1 26  ? -22.272 17.805 -12.971 1.00 31.85  ? 322 ILE A N    1 
ATOM   357  C CA   . ILE A 1 26  ? -21.390 17.162 -11.999 1.00 30.71  ? 322 ILE A CA   1 
ATOM   358  C C    . ILE A 1 26  ? -21.827 17.511 -10.583 1.00 33.19  ? 322 ILE A C    1 
ATOM   359  O O    . ILE A 1 26  ? -21.740 16.682 -9.666  1.00 34.77  ? 322 ILE A O    1 
ATOM   360  C CB   . ILE A 1 26  ? -19.923 17.553 -12.264 1.00 34.24  ? 322 ILE A CB   1 
ATOM   361  C CG1  . ILE A 1 26  ? -19.522 17.133 -13.680 1.00 32.14  ? 322 ILE A CG1  1 
ATOM   362  C CG2  . ILE A 1 26  ? -19.003 16.904 -11.226 1.00 34.67  ? 322 ILE A CG2  1 
ATOM   363  C CD1  . ILE A 1 26  ? -18.096 17.491 -14.066 1.00 33.98  ? 322 ILE A CD1  1 
ATOM   364  H H    . ILE A 1 26  ? -21.902 18.427 -13.435 1.00 38.22  ? 322 ILE A H    1 
ATOM   365  H HA   . ILE A 1 26  ? -21.463 16.200 -12.101 1.00 36.85  ? 322 ILE A HA   1 
ATOM   366  H HB   . ILE A 1 26  ? -19.841 18.516 -12.192 1.00 41.09  ? 322 ILE A HB   1 
ATOM   367  H HG12 . ILE A 1 26  ? -19.614 16.171 -13.756 1.00 38.57  ? 322 ILE A HG12 1 
ATOM   368  H HG13 . ILE A 1 26  ? -20.115 17.569 -14.312 1.00 38.57  ? 322 ILE A HG13 1 
ATOM   369  H HG21 . ILE A 1 26  ? -18.087 17.163 -11.412 1.00 41.60  ? 322 ILE A HG21 1 
ATOM   370  H HG22 . ILE A 1 26  ? -19.261 17.209 -10.342 1.00 41.60  ? 322 ILE A HG22 1 
ATOM   371  H HG23 . ILE A 1 26  ? -19.093 15.940 -11.283 1.00 41.60  ? 322 ILE A HG23 1 
ATOM   372  H HD11 . ILE A 1 26  ? -17.930 17.190 -14.973 1.00 40.78  ? 322 ILE A HD11 1 
ATOM   373  H HD12 . ILE A 1 26  ? -17.986 18.453 -14.011 1.00 40.78  ? 322 ILE A HD12 1 
ATOM   374  H HD13 . ILE A 1 26  ? -17.484 17.052 -13.455 1.00 40.78  ? 322 ILE A HD13 1 
ATOM   375  N N    . MET A 1 27  ? -22.319 18.735 -10.382 1.00 34.25  ? 323 MET A N    1 
ATOM   376  C CA   . MET A 1 27  ? -22.863 19.116 -9.083  1.00 38.29  ? 323 MET A CA   1 
ATOM   377  C C    . MET A 1 27  ? -23.980 18.169 -8.659  1.00 37.75  ? 323 MET A C    1 
ATOM   378  O O    . MET A 1 27  ? -24.025 17.723 -7.506  1.00 37.92  ? 323 MET A O    1 
ATOM   379  C CB   . MET A 1 27  ? -23.369 20.556 -9.145  1.00 47.83  ? 323 MET A CB   1 
ATOM   380  C CG   . MET A 1 27  ? -23.511 21.245 -7.796  1.00 59.39  ? 323 MET A CG   1 
ATOM   381  S SD   . MET A 1 27  ? -24.308 22.862 -7.932  1.00 69.19  ? 323 MET A SD   1 
ATOM   382  C CE   . MET A 1 27  ? -23.314 23.653 -9.199  1.00 67.33  ? 323 MET A CE   1 
ATOM   383  H H    . MET A 1 27  ? -22.348 19.356 -10.977 1.00 41.10  ? 323 MET A H    1 
ATOM   384  H HA   . MET A 1 27  ? -22.153 19.078 -8.423  1.00 45.94  ? 323 MET A HA   1 
ATOM   385  H HB2  . MET A 1 27  ? -22.748 21.079 -9.676  1.00 57.40  ? 323 MET A HB2  1 
ATOM   386  H HB3  . MET A 1 27  ? -24.241 20.559 -9.568  1.00 57.40  ? 323 MET A HB3  1 
ATOM   387  H HG2  . MET A 1 27  ? -24.053 20.690 -7.212  1.00 71.27  ? 323 MET A HG2  1 
ATOM   388  H HG3  . MET A 1 27  ? -22.631 21.374 -7.411  1.00 71.27  ? 323 MET A HG3  1 
ATOM   389  H HE1  . MET A 1 27  ? -23.658 24.546 -9.357  1.00 80.80  ? 323 MET A HE1  1 
ATOM   390  H HE2  . MET A 1 27  ? -22.395 23.701 -8.894  1.00 80.80  ? 323 MET A HE2  1 
ATOM   391  H HE3  . MET A 1 27  ? -23.366 23.129 -10.013 1.00 80.80  ? 323 MET A HE3  1 
ATOM   392  N N    . ALA A 1 28  ? -24.888 17.844 -9.582  1.00 34.54  ? 324 ALA A N    1 
ATOM   393  C CA   . ALA A 1 28  ? -25.976 16.924 -9.270  1.00 35.89  ? 324 ALA A CA   1 
ATOM   394  C C    . ALA A 1 28  ? -25.445 15.543 -8.907  1.00 35.19  ? 324 ALA A C    1 
ATOM   395  O O    . ALA A 1 28  ? -25.947 14.902 -7.975  1.00 36.39  ? 324 ALA A O    1 
ATOM   396  C CB   . ALA A 1 28  ? -26.935 16.832 -10.457 1.00 40.07  ? 324 ALA A CB   1 
ATOM   397  H H    . ALA A 1 28  ? -24.895 18.142 -10.389 1.00 41.45  ? 324 ALA A H    1 
ATOM   398  H HA   . ALA A 1 28  ? -26.471 17.265 -8.509  1.00 43.07  ? 324 ALA A HA   1 
ATOM   399  H HB1  . ALA A 1 28  ? -27.652 16.218 -10.236 1.00 48.09  ? 324 ALA A HB1  1 
ATOM   400  H HB2  . ALA A 1 28  ? -27.297 17.713 -10.639 1.00 48.09  ? 324 ALA A HB2  1 
ATOM   401  H HB3  . ALA A 1 28  ? -26.448 16.508 -11.231 1.00 48.09  ? 324 ALA A HB3  1 
ATOM   402  N N    . TYR A 1 29  ? -24.430 15.067 -9.633  1.00 36.39  ? 325 TYR A N    1 
ATOM   403  C CA   . TYR A 1 29  ? -23.875 13.743 -9.364  1.00 41.02  ? 325 TYR A CA   1 
ATOM   404  C C    . TYR A 1 29  ? -23.306 13.659 -7.955  1.00 41.60  ? 325 TYR A C    1 
ATOM   405  O O    . TYR A 1 29  ? -23.556 12.690 -7.228  1.00 45.45  ? 325 TYR A O    1 
ATOM   406  C CB   . TYR A 1 29  ? -22.792 13.402 -10.389 1.00 38.68  ? 325 TYR A CB   1 
ATOM   407  C CG   . TYR A 1 29  ? -23.274 12.507 -11.503 1.00 43.73  ? 325 TYR A CG   1 
ATOM   408  C CD1  . TYR A 1 29  ? -23.500 11.155 -11.282 1.00 44.25  ? 325 TYR A CD1  1 
ATOM   409  C CD2  . TYR A 1 29  ? -23.502 13.011 -12.776 1.00 44.70  ? 325 TYR A CD2  1 
ATOM   410  C CE1  . TYR A 1 29  ? -23.945 10.330 -12.296 1.00 45.64  ? 325 TYR A CE1  1 
ATOM   411  C CE2  . TYR A 1 29  ? -23.945 12.195 -13.796 1.00 49.76  ? 325 TYR A CE2  1 
ATOM   412  C CZ   . TYR A 1 29  ? -24.165 10.857 -13.552 1.00 49.49  ? 325 TYR A CZ   1 
ATOM   413  O OH   . TYR A 1 29  ? -24.609 10.047 -14.572 1.00 49.48  ? 325 TYR A OH   1 
ATOM   414  H H    . TYR A 1 29  ? -24.051 15.488 -10.280 1.00 43.67  ? 325 TYR A H    1 
ATOM   415  H HA   . TYR A 1 29  ? -24.581 13.082 -9.443  1.00 49.22  ? 325 TYR A HA   1 
ATOM   416  H HB2  . TYR A 1 29  ? -22.468 14.225 -10.788 1.00 46.42  ? 325 TYR A HB2  1 
ATOM   417  H HB3  . TYR A 1 29  ? -22.064 12.947 -9.937  1.00 46.42  ? 325 TYR A HB3  1 
ATOM   418  H HD1  . TYR A 1 29  ? -23.354 10.799 -10.435 1.00 53.09  ? 325 TYR A HD1  1 
ATOM   419  H HD2  . TYR A 1 29  ? -23.356 13.914 -12.944 1.00 53.64  ? 325 TYR A HD2  1 
ATOM   420  H HE1  . TYR A 1 29  ? -24.094 9.426  -12.134 1.00 54.77  ? 325 TYR A HE1  1 
ATOM   421  H HE2  . TYR A 1 29  ? -24.095 12.546 -14.644 1.00 59.72  ? 325 TYR A HE2  1 
ATOM   422  H HH   . TYR A 1 29  ? -24.699 10.496 -15.276 1.00 59.38  ? 325 TYR A HH   1 
ATOM   423  N N    . LEU A 1 30  ? -22.525 14.661 -7.554  1.00 43.02  ? 326 LEU A N    1 
ATOM   424  C CA   . LEU A 1 30  ? -21.903 14.617 -6.236  1.00 45.93  ? 326 LEU A CA   1 
ATOM   425  C C    . LEU A 1 30  ? -22.942 14.767 -5.134  1.00 47.66  ? 326 LEU A C    1 
ATOM   426  O O    . LEU A 1 30  ? -22.835 14.125 -4.083  1.00 49.20  ? 326 LEU A O    1 
ATOM   427  C CB   . LEU A 1 30  ? -20.835 15.702 -6.119  1.00 47.54  ? 326 LEU A CB   1 
ATOM   428  C CG   . LEU A 1 30  ? -19.745 15.719 -7.196  1.00 50.02  ? 326 LEU A CG   1 
ATOM   429  C CD1  . LEU A 1 30  ? -18.652 16.686 -6.788  1.00 53.28  ? 326 LEU A CD1  1 
ATOM   430  C CD2  . LEU A 1 30  ? -19.167 14.336 -7.451  1.00 48.15  ? 326 LEU A CD2  1 
ATOM   431  H H    . LEU A 1 30  ? -22.343 15.363 -8.017  1.00 51.62  ? 326 LEU A H    1 
ATOM   432  H HA   . LEU A 1 30  ? -21.468 13.757 -6.122  1.00 55.12  ? 326 LEU A HA   1 
ATOM   433  H HB2  . LEU A 1 30  ? -21.277 16.565 -6.146  1.00 57.05  ? 326 LEU A HB2  1 
ATOM   434  H HB3  . LEU A 1 30  ? -20.390 15.598 -5.264  1.00 57.05  ? 326 LEU A HB3  1 
ATOM   435  H HG   . LEU A 1 30  ? -20.130 16.039 -8.027  1.00 60.03  ? 326 LEU A HG   1 
ATOM   436  H HD11 . LEU A 1 30  ? -17.965 16.693 -7.473  1.00 63.94  ? 326 LEU A HD11 1 
ATOM   437  H HD12 . LEU A 1 30  ? -19.034 17.573 -6.693  1.00 63.94  ? 326 LEU A HD12 1 
ATOM   438  H HD13 . LEU A 1 30  ? -18.274 16.396 -5.943  1.00 63.94  ? 326 LEU A HD13 1 
ATOM   439  H HD21 . LEU A 1 30  ? -18.485 14.401 -8.138  1.00 57.78  ? 326 LEU A HD21 1 
ATOM   440  H HD22 . LEU A 1 30  ? -18.777 14.000 -6.629  1.00 57.78  ? 326 LEU A HD22 1 
ATOM   441  H HD23 . LEU A 1 30  ? -19.878 13.746 -7.746  1.00 57.78  ? 326 LEU A HD23 1 
ATOM   442  N N    . GLN A 1 31  ? -23.954 15.611 -5.353  1.00 48.41  ? 327 GLN A N    1 
ATOM   443  C CA   . GLN A 1 31  ? -25.018 15.760 -4.366  1.00 50.35  ? 327 GLN A CA   1 
ATOM   444  C C    . GLN A 1 31  ? -25.830 14.479 -4.222  1.00 48.51  ? 327 GLN A C    1 
ATOM   445  O O    . GLN A 1 31  ? -26.362 14.202 -3.142  1.00 49.55  ? 327 GLN A O    1 
ATOM   446  C CB   . GLN A 1 31  ? -25.928 16.929 -4.746  1.00 56.90  ? 327 GLN A CB   1 
ATOM   447  C CG   . GLN A 1 31  ? -25.336 18.294 -4.429  1.00 64.72  ? 327 GLN A CG   1 
ATOM   448  C CD   . GLN A 1 31  ? -25.276 18.571 -2.936  1.00 71.74  ? 327 GLN A CD   1 
ATOM   449  O OE1  . GLN A 1 31  ? -26.252 18.364 -2.214  1.00 75.67  ? 327 GLN A OE1  1 
ATOM   450  N NE2  . GLN A 1 31  ? -24.123 19.037 -2.466  1.00 72.50  ? 327 GLN A NE2  1 
ATOM   451  H H    . GLN A 1 31  ? -24.045 16.099 -6.055  1.00 58.09  ? 327 GLN A H    1 
ATOM   452  H HA   . GLN A 1 31  ? -24.621 15.959 -3.504  1.00 60.42  ? 327 GLN A HA   1 
ATOM   453  H HB2  . GLN A 1 31  ? -26.100 16.894 -5.700  1.00 68.27  ? 327 GLN A HB2  1 
ATOM   454  H HB3  . GLN A 1 31  ? -26.763 16.847 -4.258  1.00 68.27  ? 327 GLN A HB3  1 
ATOM   455  H HG2  . GLN A 1 31  ? -24.433 18.336 -4.779  1.00 77.66  ? 327 GLN A HG2  1 
ATOM   456  H HG3  . GLN A 1 31  ? -25.885 18.980 -4.840  1.00 77.66  ? 327 GLN A HG3  1 
ATOM   457  H HE21 . GLN A 1 31  ? -23.462 19.165 -3.000  1.00 87.00  ? 327 GLN A HE21 1 
ATOM   458  H HE22 . GLN A 1 31  ? -24.039 19.210 -1.628  1.00 87.00  ? 327 GLN A HE22 1 
ATOM   459  N N    . GLN A 1 32  ? -25.937 13.695 -5.289  1.00 49.00  ? 328 GLN A N    1 
ATOM   460  C CA   . GLN A 1 32  ? -26.604 12.401 -5.236  1.00 54.20  ? 328 GLN A CA   1 
ATOM   461  C C    . GLN A 1 32  ? -25.903 11.500 -4.226  1.00 54.38  ? 328 GLN A C    1 
ATOM   462  O O    . GLN A 1 32  ? -26.535 10.936 -3.337  1.00 53.28  ? 328 GLN A O    1 
ATOM   463  C CB   . GLN A 1 32  ? -26.609 11.746 -6.620  1.00 57.44  ? 328 GLN A CB   1 
ATOM   464  C CG   . GLN A 1 32  ? -27.326 10.403 -6.697  1.00 61.15  ? 328 GLN A CG   1 
ATOM   465  C CD   . GLN A 1 32  ? -26.855 9.561  -7.870  1.00 64.44  ? 328 GLN A CD   1 
ATOM   466  O OE1  . GLN A 1 32  ? -25.671 9.558  -8.212  1.00 63.13  ? 328 GLN A OE1  1 
ATOM   467  N NE2  . GLN A 1 32  ? -27.783 8.846  -8.497  1.00 68.65  ? 328 GLN A NE2  1 
ATOM   468  H H    . GLN A 1 32  ? -25.626 13.893 -6.066  1.00 58.80  ? 328 GLN A H    1 
ATOM   469  H HA   . GLN A 1 32  ? -27.523 12.523 -4.952  1.00 65.04  ? 328 GLN A HA   1 
ATOM   470  H HB2  . GLN A 1 32  ? -27.046 12.347 -7.243  1.00 68.93  ? 328 GLN A HB2  1 
ATOM   471  H HB3  . GLN A 1 32  ? -25.690 11.603 -6.896  1.00 68.93  ? 328 GLN A HB3  1 
ATOM   472  H HG2  . GLN A 1 32  ? -27.155 9.905  -5.882  1.00 73.38  ? 328 GLN A HG2  1 
ATOM   473  H HG3  . GLN A 1 32  ? -28.278 10.557 -6.800  1.00 73.38  ? 328 GLN A HG3  1 
ATOM   474  H HE21 . GLN A 1 32  ? -28.600 8.876  -8.232  1.00 82.38  ? 328 GLN A HE21 1 
ATOM   475  H HE22 . GLN A 1 32  ? -27.566 8.354  -9.167  1.00 82.38  ? 328 GLN A HE22 1 
ATOM   476  N N    . LEU A 1 43  ? -18.187 8.195  2.805   1.00 59.42  ? 339 LEU A N    1 
ATOM   477  C CA   . LEU A 1 43  ? -17.393 8.599  1.649   1.00 57.51  ? 339 LEU A CA   1 
ATOM   478  C C    . LEU A 1 43  ? -16.430 9.724  2.021   1.00 55.93  ? 339 LEU A C    1 
ATOM   479  O O    . LEU A 1 43  ? -16.853 10.821 2.387   1.00 55.70  ? 339 LEU A O    1 
ATOM   480  C CB   . LEU A 1 43  ? -18.301 9.048  0.503   1.00 60.15  ? 339 LEU A CB   1 
ATOM   481  C CG   . LEU A 1 43  ? -17.663 9.076  -0.889  1.00 60.58  ? 339 LEU A CG   1 
ATOM   482  C CD1  . LEU A 1 43  ? -17.581 7.671  -1.472  1.00 61.78  ? 339 LEU A CD1  1 
ATOM   483  C CD2  . LEU A 1 43  ? -18.431 9.999  -1.820  1.00 61.39  ? 339 LEU A CD2  1 
ATOM   484  H HA   . LEU A 1 43  ? -16.870 7.842  1.341   1.00 69.01  ? 339 LEU A HA   1 
ATOM   485  H HB2  . LEU A 1 43  ? -19.060 8.445  0.461   1.00 72.18  ? 339 LEU A HB2  1 
ATOM   486  H HB3  . LEU A 1 43  ? -18.614 9.946  0.696   1.00 72.18  ? 339 LEU A HB3  1 
ATOM   487  H HG   . LEU A 1 43  ? -16.758 9.418  -0.811  1.00 72.70  ? 339 LEU A HG   1 
ATOM   488  H HD11 . LEU A 1 43  ? -17.174 7.717  -2.351  1.00 74.13  ? 339 LEU A HD11 1 
ATOM   489  H HD12 . LEU A 1 43  ? -17.042 7.117  -0.886  1.00 74.13  ? 339 LEU A HD12 1 
ATOM   490  H HD13 . LEU A 1 43  ? -18.478 7.306  -1.541  1.00 74.13  ? 339 LEU A HD13 1 
ATOM   491  H HD21 . LEU A 1 43  ? -18.004 9.995  -2.691  1.00 73.67  ? 339 LEU A HD21 1 
ATOM   492  H HD22 . LEU A 1 43  ? -19.344 9.679  -1.898  1.00 73.67  ? 339 LEU A HD22 1 
ATOM   493  H HD23 . LEU A 1 43  ? -18.424 10.896 -1.451  1.00 73.67  ? 339 LEU A HD23 1 
ATOM   494  N N    . SER A 1 44  ? -15.134 9.444  1.928   1.00 52.31  ? 340 SER A N    1 
ATOM   495  C CA   . SER A 1 44  ? -14.125 10.445 2.233   1.00 49.93  ? 340 SER A CA   1 
ATOM   496  C C    . SER A 1 44  ? -14.151 11.565 1.198   1.00 45.32  ? 340 SER A C    1 
ATOM   497  O O    . SER A 1 44  ? -14.693 11.422 0.098   1.00 41.54  ? 340 SER A O    1 
ATOM   498  C CB   . SER A 1 44  ? -12.735 9.813  2.263   1.00 52.52  ? 340 SER A CB   1 
ATOM   499  O OG   . SER A 1 44  ? -12.482 9.100  1.067   1.00 48.75  ? 340 SER A OG   1 
ATOM   500  H H    . SER A 1 44  ? -14.815 8.681  1.691   1.00 62.77  ? 340 SER A H    1 
ATOM   501  H HA   . SER A 1 44  ? -14.306 10.830 3.105   1.00 59.92  ? 340 SER A HA   1 
ATOM   502  H HB2  . SER A 1 44  ? -12.071 10.514 2.360   1.00 63.03  ? 340 SER A HB2  1 
ATOM   503  H HB3  . SER A 1 44  ? -12.682 9.200  3.013   1.00 63.03  ? 340 SER A HB3  1 
ATOM   504  H HG   . SER A 1 44  ? -11.716 8.757  1.093   1.00 58.50  ? 340 SER A HG   1 
ATOM   505  N N    . THR A 1 45  ? -13.551 12.701 1.563   1.00 42.59  ? 341 THR A N    1 
ATOM   506  C CA   . THR A 1 45  ? -13.387 13.777 0.593   1.00 43.31  ? 341 THR A CA   1 
ATOM   507  C C    . THR A 1 45  ? -12.564 13.306 -0.598  1.00 36.39  ? 341 THR A C    1 
ATOM   508  O O    . THR A 1 45  ? -12.903 13.597 -1.752  1.00 36.30  ? 341 THR A O    1 
ATOM   509  C CB   . THR A 1 45  ? -12.734 14.992 1.249   1.00 42.81  ? 341 THR A CB   1 
ATOM   510  O OG1  . THR A 1 45  ? -13.505 15.393 2.386   1.00 47.13  ? 341 THR A OG1  1 
ATOM   511  C CG2  . THR A 1 45  ? -12.659 16.160 0.264   1.00 44.62  ? 341 THR A CG2  1 
ATOM   512  H H    . THR A 1 45  ? -13.238 12.867 2.346   1.00 51.11  ? 341 THR A H    1 
ATOM   513  H HA   . THR A 1 45  ? -14.261 14.045 0.267   1.00 51.97  ? 341 THR A HA   1 
ATOM   514  H HB   . THR A 1 45  ? -11.833 14.766 1.530   1.00 51.37  ? 341 THR A HB   1 
ATOM   515  H HG1  . THR A 1 45  ? -13.151 16.061 2.752   1.00 56.55  ? 341 THR A HG1  1 
ATOM   516  H HG21 . THR A 1 45  ? -12.243 16.926 0.690   1.00 53.54  ? 341 THR A HG21 1 
ATOM   517  H HG22 . THR A 1 45  ? -12.134 15.907 -0.511  1.00 53.54  ? 341 THR A HG22 1 
ATOM   518  H HG23 . THR A 1 45  ? -13.551 16.407 -0.026  1.00 53.54  ? 341 THR A HG23 1 
ATOM   519  N N    . PHE A 1 46  ? -11.477 12.574 -0.339  1.00 38.20  ? 342 PHE A N    1 
ATOM   520  C CA   . PHE A 1 46  ? -10.730 11.955 -1.428  1.00 39.20  ? 342 PHE A CA   1 
ATOM   521  C C    . PHE A 1 46  ? -11.642 11.084 -2.282  1.00 40.10  ? 342 PHE A C    1 
ATOM   522  O O    . PHE A 1 46  ? -11.581 11.127 -3.515  1.00 38.25  ? 342 PHE A O    1 
ATOM   523  C CB   . PHE A 1 46  ? -9.568  11.130 -0.868  1.00 42.18  ? 342 PHE A CB   1 
ATOM   524  C CG   . PHE A 1 46  ? -8.891  10.269 -1.895  1.00 40.26  ? 342 PHE A CG   1 
ATOM   525  C CD1  . PHE A 1 46  ? -7.976  10.813 -2.780  1.00 40.47  ? 342 PHE A CD1  1 
ATOM   526  C CD2  . PHE A 1 46  ? -9.174  8.914  -1.980  1.00 42.40  ? 342 PHE A CD2  1 
ATOM   527  C CE1  . PHE A 1 46  ? -7.356  10.023 -3.735  1.00 42.21  ? 342 PHE A CE1  1 
ATOM   528  C CE2  . PHE A 1 46  ? -8.556  8.119  -2.932  1.00 42.19  ? 342 PHE A CE2  1 
ATOM   529  C CZ   . PHE A 1 46  ? -7.646  8.676  -3.810  1.00 40.95  ? 342 PHE A CZ   1 
ATOM   530  H H    . PHE A 1 46  ? -11.160 12.423 0.446   1.00 45.84  ? 342 PHE A H    1 
ATOM   531  H HA   . PHE A 1 46  ? -10.361 12.651 -1.994  1.00 47.04  ? 342 PHE A HA   1 
ATOM   532  H HB2  . PHE A 1 46  ? -8.903  11.735 -0.502  1.00 50.62  ? 342 PHE A HB2  1 
ATOM   533  H HB3  . PHE A 1 46  ? -9.905  10.549 -0.169  1.00 50.62  ? 342 PHE A HB3  1 
ATOM   534  H HD1  . PHE A 1 46  ? -7.778  11.720 -2.736  1.00 48.57  ? 342 PHE A HD1  1 
ATOM   535  H HD2  . PHE A 1 46  ? -9.788  8.536  -1.393  1.00 50.89  ? 342 PHE A HD2  1 
ATOM   536  H HE1  . PHE A 1 46  ? -6.742  10.401 -4.323  1.00 50.65  ? 342 PHE A HE1  1 
ATOM   537  H HE2  . PHE A 1 46  ? -8.754  7.212  -2.979  1.00 50.63  ? 342 PHE A HE2  1 
ATOM   538  H HZ   . PHE A 1 46  ? -7.228  8.143  -4.448  1.00 49.14  ? 342 PHE A HZ   1 
ATOM   539  N N    . GLY A 1 47  ? -12.502 10.291 -1.640  1.00 42.25  ? 343 GLY A N    1 
ATOM   540  C CA   . GLY A 1 47  ? -13.448 9.483  -2.390  1.00 44.07  ? 343 GLY A CA   1 
ATOM   541  C C    . GLY A 1 47  ? -14.405 10.322 -3.214  1.00 40.14  ? 343 GLY A C    1 
ATOM   542  O O    . GLY A 1 47  ? -14.745 9.965  -4.344  1.00 38.05  ? 343 GLY A O    1 
ATOM   543  H H    . GLY A 1 47  ? -12.554 10.208 -0.785  1.00 50.70  ? 343 GLY A H    1 
ATOM   544  H HA2  . GLY A 1 47  ? -12.964 8.892  -2.989  1.00 52.88  ? 343 GLY A HA2  1 
ATOM   545  H HA3  . GLY A 1 47  ? -13.967 8.940  -1.776  1.00 52.88  ? 343 GLY A HA3  1 
ATOM   546  N N    . LEU A 1 48  ? -14.852 11.451 -2.660  1.00 42.27  ? 344 LEU A N    1 
ATOM   547  C CA   . LEU A 1 48  ? -15.718 12.350 -3.415  1.00 37.76  ? 344 LEU A CA   1 
ATOM   548  C C    . LEU A 1 48  ? -14.986 12.933 -4.618  1.00 35.53  ? 344 LEU A C    1 
ATOM   549  O O    . LEU A 1 48  ? -15.582 13.137 -5.683  1.00 32.74  ? 344 LEU A O    1 
ATOM   550  C CB   . LEU A 1 48  ? -16.227 13.467 -2.506  1.00 41.16  ? 344 LEU A CB   1 
ATOM   551  C CG   . LEU A 1 48  ? -17.299 14.379 -3.106  1.00 47.22  ? 344 LEU A CG   1 
ATOM   552  C CD1  . LEU A 1 48  ? -18.610 13.621 -3.290  1.00 49.93  ? 344 LEU A CD1  1 
ATOM   553  C CD2  . LEU A 1 48  ? -17.504 15.607 -2.228  1.00 52.13  ? 344 LEU A CD2  1 
ATOM   554  H H    . LEU A 1 48  ? -14.671 11.714 -1.862  1.00 50.72  ? 344 LEU A H    1 
ATOM   555  H HA   . LEU A 1 48  ? -16.485 11.853 -3.741  1.00 45.32  ? 344 LEU A HA   1 
ATOM   556  H HB2  . LEU A 1 48  ? -16.604 13.064 -1.708  1.00 49.39  ? 344 LEU A HB2  1 
ATOM   557  H HB3  . LEU A 1 48  ? -15.475 14.028 -2.260  1.00 49.39  ? 344 LEU A HB3  1 
ATOM   558  H HG   . LEU A 1 48  ? -17.004 14.682 -3.979  1.00 56.67  ? 344 LEU A HG   1 
ATOM   559  H HD11 . LEU A 1 48  ? -19.270 14.220 -3.670  1.00 59.92  ? 344 LEU A HD11 1 
ATOM   560  H HD12 . LEU A 1 48  ? -18.459 12.871 -3.887  1.00 59.92  ? 344 LEU A HD12 1 
ATOM   561  H HD13 . LEU A 1 48  ? -18.912 13.300 -2.425  1.00 59.92  ? 344 LEU A HD13 1 
ATOM   562  H HD21 . LEU A 1 48  ? -18.186 16.169 -2.626  1.00 62.55  ? 344 LEU A HD21 1 
ATOM   563  H HD22 . LEU A 1 48  ? -17.785 15.319 -1.345  1.00 62.55  ? 344 LEU A HD22 1 
ATOM   564  H HD23 . LEU A 1 48  ? -16.667 16.093 -2.167  1.00 62.55  ? 344 LEU A HD23 1 
ATOM   565  N N    . MET A 1 49  ? -13.690 13.210 -4.466  1.00 35.61  ? 345 MET A N    1 
ATOM   566  C CA   . MET A 1 49  ? -12.909 13.733 -5.582  1.00 34.57  ? 345 MET A CA   1 
ATOM   567  C C    . MET A 1 49  ? -12.678 12.672 -6.650  1.00 32.16  ? 345 MET A C    1 
ATOM   568  O O    . MET A 1 49  ? -12.576 13.003 -7.837  1.00 35.99  ? 345 MET A O    1 
ATOM   569  C CB   . MET A 1 49  ? -11.575 14.275 -5.074  1.00 36.31  ? 345 MET A CB   1 
ATOM   570  C CG   . MET A 1 49  ? -11.702 15.460 -4.129  1.00 42.73  ? 345 MET A CG   1 
ATOM   571  S SD   . MET A 1 49  ? -12.425 16.934 -4.882  1.00 42.94  ? 345 MET A SD   1 
ATOM   572  C CE   . MET A 1 49  ? -14.125 16.801 -4.332  1.00 51.91  ? 345 MET A CE   1 
ATOM   573  H H    . MET A 1 49  ? -13.246 13.106 -3.736  1.00 42.73  ? 345 MET A H    1 
ATOM   574  H HA   . MET A 1 49  ? -13.394 14.472 -5.980  1.00 41.49  ? 345 MET A HA   1 
ATOM   575  H HB2  . MET A 1 49  ? -11.112 13.567 -4.599  1.00 43.57  ? 345 MET A HB2  1 
ATOM   576  H HB3  . MET A 1 49  ? -11.045 14.560 -5.835  1.00 43.57  ? 345 MET A HB3  1 
ATOM   577  H HG2  . MET A 1 49  ? -12.266 15.203 -3.382  1.00 51.27  ? 345 MET A HG2  1 
ATOM   578  H HG3  . MET A 1 49  ? -10.819 15.697 -3.806  1.00 51.27  ? 345 MET A HG3  1 
ATOM   579  H HE1  . MET A 1 49  ? -14.629 17.553 -4.680  1.00 62.30  ? 345 MET A HE1  1 
ATOM   580  H HE2  . MET A 1 49  ? -14.500 15.970 -4.664  1.00 62.30  ? 345 MET A HE2  1 
ATOM   581  H HE3  . MET A 1 49  ? -14.145 16.809 -3.362  1.00 62.30  ? 345 MET A HE3  1 
ATOM   582  N N    . CYS A 1 50  ? -12.581 11.400 -6.257  1.00 35.25  ? 346 CYS A N    1 
ATOM   583  C CA   . CYS A 1 50  ? -12.539 10.332 -7.249  1.00 32.30  ? 346 CYS A CA   1 
ATOM   584  C C    . CYS A 1 50  ? -13.810 10.325 -8.086  1.00 31.40  ? 346 CYS A C    1 
ATOM   585  O O    . CYS A 1 50  ? -13.760 10.145 -9.310  1.00 36.96  ? 346 CYS A O    1 
ATOM   586  C CB   . CYS A 1 50  ? -12.345 8.981  -6.562  1.00 36.84  ? 346 CYS A CB   1 
ATOM   587  S SG   . CYS A 1 50  ? -10.701 8.744  -5.837  1.00 36.73  ? 346 CYS A SG   1 
ATOM   588  H H    . CYS A 1 50  ? -12.540 11.136 -5.439  1.00 42.30  ? 346 CYS A H    1 
ATOM   589  H HA   . CYS A 1 50  ? -11.787 10.479 -7.843  1.00 38.76  ? 346 CYS A HA   1 
ATOM   590  H HB2  . CYS A 1 50  ? -12.997 8.899  -5.848  1.00 44.21  ? 346 CYS A HB2  1 
ATOM   591  H HB3  . CYS A 1 50  ? -12.484 8.278  -7.215  1.00 44.21  ? 346 CYS A HB3  1 
ATOM   592  H HG   . CYS A 1 50  ? -10.511 9.594  -5.012  1.00 44.07  ? 346 CYS A HG   1 
ATOM   593  N N    . LYS A 1 51  ? -14.960 10.526 -7.440  1.00 37.74  ? 347 LYS A N    1 
ATOM   594  C CA   . LYS A 1 51  ? -16.223 10.625 -8.162  1.00 37.28  ? 347 LYS A CA   1 
ATOM   595  C C    . LYS A 1 51  ? -16.239 11.842 -9.078  1.00 36.99  ? 347 LYS A C    1 
ATOM   596  O O    . LYS A 1 51  ? -16.681 11.757 -10.228 1.00 34.59  ? 347 LYS A O    1 
ATOM   597  C CB   . LYS A 1 51  ? -17.380 10.692 -7.165  1.00 45.45  ? 347 LYS A CB   1 
ATOM   598  C CG   . LYS A 1 51  ? -18.755 10.895 -7.790  1.00 59.38  ? 347 LYS A CG   1 
ATOM   599  C CD   . LYS A 1 51  ? -19.053 9.891  -8.893  1.00 71.10  ? 347 LYS A CD   1 
ATOM   600  C CE   . LYS A 1 51  ? -19.043 8.453  -8.387  1.00 80.06  ? 347 LYS A CE   1 
ATOM   601  N NZ   . LYS A 1 51  ? -18.942 7.483  -9.507  1.00 83.05  ? 347 LYS A NZ   1 
ATOM   602  H H    . LYS A 1 51  ? -15.033 10.607 -6.586  1.00 45.29  ? 347 LYS A H    1 
ATOM   603  H HA   . LYS A 1 51  ? -16.340 9.833  -8.710  1.00 44.74  ? 347 LYS A HA   1 
ATOM   604  H HB2  . LYS A 1 51  ? -17.406 9.861  -6.665  1.00 54.53  ? 347 LYS A HB2  1 
ATOM   605  H HB3  . LYS A 1 51  ? -17.222 11.432 -6.559  1.00 54.53  ? 347 LYS A HB3  1 
ATOM   606  H HG2  . LYS A 1 51  ? -19.432 10.796 -7.103  1.00 71.26  ? 347 LYS A HG2  1 
ATOM   607  H HG3  . LYS A 1 51  ? -18.799 11.784 -8.175  1.00 71.26  ? 347 LYS A HG3  1 
ATOM   608  H HD2  . LYS A 1 51  ? -19.932 10.075 -9.260  1.00 85.32  ? 347 LYS A HD2  1 
ATOM   609  H HD3  . LYS A 1 51  ? -18.379 9.971  -9.586  1.00 85.32  ? 347 LYS A HD3  1 
ATOM   610  H HE2  . LYS A 1 51  ? -18.280 8.324  -7.803  1.00 96.07  ? 347 LYS A HE2  1 
ATOM   611  H HE3  . LYS A 1 51  ? -19.867 8.277  -7.906  1.00 96.07  ? 347 LYS A HE3  1 
ATOM   612  H HZ1  . LYS A 1 51  ? -18.937 6.651  -9.190  1.00 99.66  ? 347 LYS A HZ1  1 
ATOM   613  H HZ2  . LYS A 1 51  ? -19.635 7.579  -10.057 1.00 99.66  ? 347 LYS A HZ2  1 
ATOM   614  H HZ3  . LYS A 1 51  ? -18.190 7.622  -9.963  1.00 99.66  ? 347 LYS A HZ3  1 
ATOM   615  N N    . MET A 1 52  ? -15.759 12.984 -8.583  1.00 36.54  ? 348 MET A N    1 
ATOM   616  C CA   . MET A 1 52  ? -15.729 14.196 -9.394  1.00 36.23  ? 348 MET A CA   1 
ATOM   617  C C    . MET A 1 52  ? -14.826 14.020 -10.607 1.00 33.74  ? 348 MET A C    1 
ATOM   618  O O    . MET A 1 52  ? -15.173 14.442 -11.716 1.00 34.52  ? 348 MET A O    1 
ATOM   619  C CB   . MET A 1 52  ? -15.259 15.371 -8.537  1.00 36.50  ? 348 MET A CB   1 
ATOM   620  C CG   . MET A 1 52  ? -15.445 16.741 -9.172  1.00 39.66  ? 348 MET A CG   1 
ATOM   621  S SD   . MET A 1 52  ? -14.737 18.060 -8.160  1.00 40.01  ? 348 MET A SD   1 
ATOM   622  C CE   . MET A 1 52  ? -12.993 17.671 -8.274  1.00 39.53  ? 348 MET A CE   1 
ATOM   623  H H    . MET A 1 52  ? -15.449 13.081 -7.787  1.00 43.84  ? 348 MET A H    1 
ATOM   624  H HA   . MET A 1 52  ? -16.629 14.392 -9.699  1.00 43.48  ? 348 MET A HA   1 
ATOM   625  H HB2  . MET A 1 52  ? -15.757 15.364 -7.704  1.00 43.80  ? 348 MET A HB2  1 
ATOM   626  H HB3  . MET A 1 52  ? -14.314 15.259 -8.352  1.00 43.80  ? 348 MET A HB3  1 
ATOM   627  H HG2  . MET A 1 52  ? -15.005 16.753 -10.036 1.00 47.59  ? 348 MET A HG2  1 
ATOM   628  H HG3  . MET A 1 52  ? -16.393 16.917 -9.277  1.00 47.59  ? 348 MET A HG3  1 
ATOM   629  H HE1  . MET A 1 52  ? -12.490 18.322 -7.760  1.00 47.43  ? 348 MET A HE1  1 
ATOM   630  H HE2  . MET A 1 52  ? -12.844 16.781 -7.917  1.00 47.43  ? 348 MET A HE2  1 
ATOM   631  H HE3  . MET A 1 52  ? -12.722 17.703 -9.205  1.00 47.43  ? 348 MET A HE3  1 
ATOM   632  N N    . ALA A 1 53  ? -13.659 13.400 -10.415 1.00 36.48  ? 349 ALA A N    1 
ATOM   633  C CA   . ALA A 1 53  ? -12.750 13.162 -11.531 1.00 26.91  ? 349 ALA A CA   1 
ATOM   634  C C    . ALA A 1 53  ? -13.351 12.175 -12.525 1.00 30.42  ? 349 ALA A C    1 
ATOM   635  O O    . ALA A 1 53  ? -13.226 12.356 -13.742 1.00 26.01  ? 349 ALA A O    1 
ATOM   636  C CB   . ALA A 1 53  ? -11.405 12.655 -11.007 1.00 34.54  ? 349 ALA A CB   1 
ATOM   637  H H    . ALA A 1 53  ? -13.375 13.111 -9.656  1.00 43.77  ? 349 ALA A H    1 
ATOM   638  H HA   . ALA A 1 53  ? -12.595 13.999 -11.996 1.00 32.30  ? 349 ALA A HA   1 
ATOM   639  H HB1  . ALA A 1 53  ? -10.812 12.502 -11.759 1.00 41.45  ? 349 ALA A HB1  1 
ATOM   640  H HB2  . ALA A 1 53  ? -11.025 13.324 -10.416 1.00 41.45  ? 349 ALA A HB2  1 
ATOM   641  H HB3  . ALA A 1 53  ? -11.547 11.827 -10.523 1.00 41.45  ? 349 ALA A HB3  1 
ATOM   642  N N    . ASP A 1 54  ? -14.006 11.127 -12.023 1.00 32.97  ? 350 ASP A N    1 
ATOM   643  C CA   . ASP A 1 54  ? -14.686 10.178 -12.900 1.00 28.37  ? 350 ASP A CA   1 
ATOM   644  C C    . ASP A 1 54  ? -15.685 10.895 -13.802 1.00 34.11  ? 350 ASP A C    1 
ATOM   645  O O    . ASP A 1 54  ? -15.729 10.658 -15.015 1.00 27.00  ? 350 ASP A O    1 
ATOM   646  C CB   . ASP A 1 54  ? -15.376 9.106  -12.051 1.00 35.49  ? 350 ASP A CB   1 
ATOM   647  C CG   . ASP A 1 54  ? -15.929 7.957  -12.879 1.00 38.92  ? 350 ASP A CG   1 
ATOM   648  O OD1  . ASP A 1 54  ? -15.130 7.165  -13.423 1.00 39.42  ? 350 ASP A OD1  1 
ATOM   649  O OD2  . ASP A 1 54  ? -17.168 7.829  -12.964 1.00 44.26  ? 350 ASP A OD2  1 
ATOM   650  H H    . ASP A 1 54  ? -14.071 10.945 -11.185 1.00 39.56  ? 350 ASP A H    1 
ATOM   651  H HA   . ASP A 1 54  ? -14.030 9.740  -13.464 1.00 34.05  ? 350 ASP A HA   1 
ATOM   652  H HB2  . ASP A 1 54  ? -14.733 8.739  -11.423 1.00 42.59  ? 350 ASP A HB2  1 
ATOM   653  H HB3  . ASP A 1 54  ? -16.114 9.511  -11.570 1.00 42.59  ? 350 ASP A HB3  1 
ATOM   654  N N    . GLN A 1 55  ? -16.489 11.793 -13.225 1.00 33.64  ? 351 GLN A N    1 
ATOM   655  C CA   . GLN A 1 55  ? -17.451 12.545 -14.023 1.00 30.77  ? 351 GLN A CA   1 
ATOM   656  C C    . GLN A 1 55  ? -16.763 13.502 -14.989 1.00 34.67  ? 351 GLN A C    1 
ATOM   657  O O    . GLN A 1 55  ? -17.256 13.714 -16.103 1.00 27.33  ? 351 GLN A O    1 
ATOM   658  C CB   . GLN A 1 55  ? -18.401 13.316 -13.110 1.00 36.14  ? 351 GLN A CB   1 
ATOM   659  C CG   . GLN A 1 55  ? -19.438 12.439 -12.427 1.00 41.13  ? 351 GLN A CG   1 
ATOM   660  C CD   . GLN A 1 55  ? -20.363 11.758 -13.415 1.00 45.44  ? 351 GLN A CD   1 
ATOM   661  O OE1  . GLN A 1 55  ? -20.695 12.319 -14.461 1.00 48.99  ? 351 GLN A OE1  1 
ATOM   662  N NE2  . GLN A 1 55  ? -20.770 10.536 -13.098 1.00 49.69  ? 351 GLN A NE2  1 
ATOM   663  H H    . GLN A 1 55  ? -16.496 11.980 -12.386 1.00 40.37  ? 351 GLN A H    1 
ATOM   664  H HA   . GLN A 1 55  ? -17.979 11.923 -14.547 1.00 36.92  ? 351 GLN A HA   1 
ATOM   665  H HB2  . GLN A 1 55  ? -17.882 13.755 -12.418 1.00 43.36  ? 351 GLN A HB2  1 
ATOM   666  H HB3  . GLN A 1 55  ? -18.873 13.978 -13.637 1.00 43.36  ? 351 GLN A HB3  1 
ATOM   667  H HG2  . GLN A 1 55  ? -18.984 11.750 -11.917 1.00 49.35  ? 351 GLN A HG2  1 
ATOM   668  H HG3  . GLN A 1 55  ? -19.979 12.988 -11.838 1.00 49.35  ? 351 GLN A HG3  1 
ATOM   669  H HE21 . GLN A 1 55  ? -20.509 10.173 -12.363 1.00 59.62  ? 351 GLN A HE21 1 
ATOM   670  H HE22 . GLN A 1 55  ? -21.296 10.108 -13.626 1.00 59.62  ? 351 GLN A HE22 1 
ATOM   671  N N    . THR A 1 56  ? -15.638 14.094 -14.586 1.00 27.85  ? 352 THR A N    1 
ATOM   672  C CA   . THR A 1 56  ? -14.906 14.968 -15.496 1.00 27.28  ? 352 THR A CA   1 
ATOM   673  C C    . THR A 1 56  ? -14.394 14.184 -16.695 1.00 30.01  ? 352 THR A C    1 
ATOM   674  O O    . THR A 1 56  ? -14.413 14.680 -17.828 1.00 30.63  ? 352 THR A O    1 
ATOM   675  C CB   . THR A 1 56  ? -13.751 15.643 -14.757 1.00 29.75  ? 352 THR A CB   1 
ATOM   676  O OG1  . THR A 1 56  ? -14.256 16.329 -13.603 1.00 30.81  ? 352 THR A OG1  1 
ATOM   677  C CG2  . THR A 1 56  ? -13.041 16.643 -15.660 1.00 29.57  ? 352 THR A CG2  1 
ATOM   678  H H    . THR A 1 56  ? -15.285 14.008 -13.806 1.00 33.42  ? 352 THR A H    1 
ATOM   679  H HA   . THR A 1 56  ? -15.503 15.660 -15.821 1.00 32.74  ? 352 THR A HA   1 
ATOM   680  H HB   . THR A 1 56  ? -13.109 14.971 -14.478 1.00 35.70  ? 352 THR A HB   1 
ATOM   681  H HG1  . THR A 1 56  ? -14.633 15.785 -13.087 1.00 36.97  ? 352 THR A HG1  1 
ATOM   682  H HG21 . THR A 1 56  ? -12.311 17.063 -15.179 1.00 35.48  ? 352 THR A HG21 1 
ATOM   683  H HG22 . THR A 1 56  ? -12.685 16.190 -16.440 1.00 35.48  ? 352 THR A HG22 1 
ATOM   684  H HG23 . THR A 1 56  ? -13.664 17.328 -15.950 1.00 35.48  ? 352 THR A HG23 1 
ATOM   685  N N    . LEU A 1 57  ? -13.944 12.946 -16.467 1.00 30.32  ? 353 LEU A N    1 
ATOM   686  C CA   . LEU A 1 57  ? -13.469 12.119 -17.571 1.00 27.09  ? 353 LEU A CA   1 
ATOM   687  C C    . LEU A 1 57  ? -14.578 11.853 -18.579 1.00 26.01  ? 353 LEU A C    1 
ATOM   688  O O    . LEU A 1 57  ? -14.329 11.824 -19.791 1.00 26.89  ? 353 LEU A O    1 
ATOM   689  C CB   . LEU A 1 57  ? -12.899 10.804 -17.038 1.00 25.92  ? 353 LEU A CB   1 
ATOM   690  C CG   . LEU A 1 57  ? -11.564 10.895 -16.298 1.00 31.07  ? 353 LEU A CG   1 
ATOM   691  C CD1  . LEU A 1 57  ? -11.155 9.518  -15.799 1.00 32.95  ? 353 LEU A CD1  1 
ATOM   692  C CD2  . LEU A 1 57  ? -10.473 11.485 -17.184 1.00 35.15  ? 353 LEU A CD2  1 
ATOM   693  H H    . LEU A 1 57  ? -13.906 12.571 -15.695 1.00 36.39  ? 353 LEU A H    1 
ATOM   694  H HA   . LEU A 1 57  ? -12.755 12.589 -18.030 1.00 32.51  ? 353 LEU A HA   1 
ATOM   695  H HB2  . LEU A 1 57  ? -13.543 10.420 -16.423 1.00 31.11  ? 353 LEU A HB2  1 
ATOM   696  H HB3  . LEU A 1 57  ? -12.772 10.201 -17.788 1.00 31.11  ? 353 LEU A HB3  1 
ATOM   697  H HG   . LEU A 1 57  ? -11.670 11.474 -15.527 1.00 37.29  ? 353 LEU A HG   1 
ATOM   698  H HD11 . LEU A 1 57  ? -10.308 9.590  -15.332 1.00 39.54  ? 353 LEU A HD11 1 
ATOM   699  H HD12 . LEU A 1 57  ? -11.838 9.185  -15.196 1.00 39.54  ? 353 LEU A HD12 1 
ATOM   700  H HD13 . LEU A 1 57  ? -11.064 8.921  -16.559 1.00 39.54  ? 353 LEU A HD13 1 
ATOM   701  H HD21 . LEU A 1 57  ? -9.645  11.526 -16.679 1.00 42.18  ? 353 LEU A HD21 1 
ATOM   702  H HD22 . LEU A 1 57  ? -10.358 10.919 -17.963 1.00 42.18  ? 353 LEU A HD22 1 
ATOM   703  H HD23 . LEU A 1 57  ? -10.738 12.377 -17.458 1.00 42.18  ? 353 LEU A HD23 1 
ATOM   704  N N    . PHE A 1 58  ? -15.809 11.647 -18.106 1.00 27.92  ? 354 PHE A N    1 
ATOM   705  C CA   . PHE A 1 58  ? -16.930 11.512 -19.030 1.00 30.10  ? 354 PHE A CA   1 
ATOM   706  C C    . PHE A 1 58  ? -17.056 12.751 -19.907 1.00 29.37  ? 354 PHE A C    1 
ATOM   707  O O    . PHE A 1 58  ? -17.231 12.650 -21.127 1.00 29.63  ? 354 PHE A O    1 
ATOM   708  C CB   . PHE A 1 58  ? -18.229 11.267 -18.258 1.00 36.75  ? 354 PHE A CB   1 
ATOM   709  C CG   . PHE A 1 58  ? -18.466 9.823  -17.900 1.00 36.38  ? 354 PHE A CG   1 
ATOM   710  C CD1  . PHE A 1 58  ? -18.867 8.914  -18.866 1.00 37.12  ? 354 PHE A CD1  1 
ATOM   711  C CD2  . PHE A 1 58  ? -18.298 9.381  -16.600 1.00 34.56  ? 354 PHE A CD2  1 
ATOM   712  C CE1  . PHE A 1 58  ? -19.091 7.588  -18.540 1.00 39.83  ? 354 PHE A CE1  1 
ATOM   713  C CE2  . PHE A 1 58  ? -18.523 8.055  -16.267 1.00 37.44  ? 354 PHE A CE2  1 
ATOM   714  C CZ   . PHE A 1 58  ? -18.918 7.159  -17.237 1.00 40.41  ? 354 PHE A CZ   1 
ATOM   715  H H    . PHE A 1 58  ? -16.015 11.584 -17.273 1.00 33.50  ? 354 PHE A H    1 
ATOM   716  H HA   . PHE A 1 58  ? -16.774 10.749 -19.608 1.00 36.12  ? 354 PHE A HA   1 
ATOM   717  H HB2  . PHE A 1 58  ? -18.202 11.776 -17.433 1.00 44.10  ? 354 PHE A HB2  1 
ATOM   718  H HB3  . PHE A 1 58  ? -18.975 11.563 -18.803 1.00 44.10  ? 354 PHE A HB3  1 
ATOM   719  H HD1  . PHE A 1 58  ? -18.985 9.197  -19.744 1.00 44.54  ? 354 PHE A HD1  1 
ATOM   720  H HD2  . PHE A 1 58  ? -18.033 9.981  -15.941 1.00 41.47  ? 354 PHE A HD2  1 
ATOM   721  H HE1  . PHE A 1 58  ? -19.358 6.986  -19.197 1.00 47.80  ? 354 PHE A HE1  1 
ATOM   722  H HE2  . PHE A 1 58  ? -18.405 7.769  -15.390 1.00 44.93  ? 354 PHE A HE2  1 
ATOM   723  H HZ   . PHE A 1 58  ? -19.067 6.268  -17.015 1.00 48.49  ? 354 PHE A HZ   1 
ATOM   724  N N    . SER A 1 59  ? -16.972 13.937 -19.298 1.00 30.83  ? 355 SER A N    1 
ATOM   725  C CA   . SER A 1 59  ? -17.044 15.170 -20.073 1.00 30.49  ? 355 SER A CA   1 
ATOM   726  C C    . SER A 1 59  ? -15.875 15.275 -21.046 1.00 30.49  ? 355 SER A C    1 
ATOM   727  O O    . SER A 1 59  ? -16.033 15.784 -22.163 1.00 29.73  ? 355 SER A O    1 
ATOM   728  C CB   . SER A 1 59  ? -17.075 16.379 -19.135 1.00 33.26  ? 355 SER A CB   1 
ATOM   729  O OG   . SER A 1 59  ? -18.253 16.375 -18.347 1.00 43.29  ? 355 SER A OG   1 
ATOM   730  H H    . SER A 1 59  ? -16.875 14.050 -18.451 1.00 36.99  ? 355 SER A H    1 
ATOM   731  H HA   . SER A 1 59  ? -17.865 15.171 -20.590 1.00 36.59  ? 355 SER A HA   1 
ATOM   732  H HB2  . SER A 1 59  ? -16.302 16.344 -18.550 1.00 39.91  ? 355 SER A HB2  1 
ATOM   733  H HB3  . SER A 1 59  ? -17.053 17.191 -19.666 1.00 39.91  ? 355 SER A HB3  1 
ATOM   734  H HG   . SER A 1 59  ? -18.259 17.042 -17.836 1.00 51.95  ? 355 SER A HG   1 
ATOM   735  N N    . ILE A 1 60  ? -14.696 14.795 -20.643 1.00 28.03  ? 356 ILE A N    1 
ATOM   736  C CA   . ILE A 1 60  ? -13.526 14.858 -21.517 1.00 28.93  ? 356 ILE A CA   1 
ATOM   737  C C    . ILE A 1 60  ? -13.714 13.948 -22.725 1.00 28.73  ? 356 ILE A C    1 
ATOM   738  O O    . ILE A 1 60  ? -13.423 14.331 -23.864 1.00 30.55  ? 356 ILE A O    1 
ATOM   739  C CB   . ILE A 1 60  ? -12.252 14.500 -20.731 1.00 29.51  ? 356 ILE A CB   1 
ATOM   740  C CG1  . ILE A 1 60  ? -11.896 15.642 -19.773 1.00 29.92  ? 356 ILE A CG1  1 
ATOM   741  C CG2  . ILE A 1 60  ? -11.089 14.215 -21.681 1.00 30.79  ? 356 ILE A CG2  1 
ATOM   742  C CD1  . ILE A 1 60  ? -10.774 15.324 -18.811 1.00 31.98  ? 356 ILE A CD1  1 
ATOM   743  H H    . ILE A 1 60  ? -14.549 14.432 -19.877 1.00 33.64  ? 356 ILE A H    1 
ATOM   744  H HA   . ILE A 1 60  ? -13.428 15.767 -21.843 1.00 34.72  ? 356 ILE A HA   1 
ATOM   745  H HB   . ILE A 1 60  ? -12.427 13.702 -20.208 1.00 35.42  ? 356 ILE A HB   1 
ATOM   746  H HG12 . ILE A 1 60  ? -11.626 16.413 -20.296 1.00 35.90  ? 356 ILE A HG12 1 
ATOM   747  H HG13 . ILE A 1 60  ? -12.681 15.862 -19.247 1.00 35.90  ? 356 ILE A HG13 1 
ATOM   748  H HG21 . ILE A 1 60  ? -10.302 13.993 -21.159 1.00 36.95  ? 356 ILE A HG21 1 
ATOM   749  H HG22 . ILE A 1 60  ? -11.326 13.470 -22.255 1.00 36.95  ? 356 ILE A HG22 1 
ATOM   750  H HG23 . ILE A 1 60  ? -10.918 15.005 -22.217 1.00 36.95  ? 356 ILE A HG23 1 
ATOM   751  H HD11 . ILE A 1 60  ? -10.615 16.097 -18.246 1.00 38.38  ? 356 ILE A HD11 1 
ATOM   752  H HD12 . ILE A 1 60  ? -11.031 14.563 -18.268 1.00 38.38  ? 356 ILE A HD12 1 
ATOM   753  H HD13 . ILE A 1 60  ? -9.974  15.115 -19.318 1.00 38.38  ? 356 ILE A HD13 1 
ATOM   754  N N    . VAL A 1 61  ? -14.181 12.719 -22.493 1.00 29.43  ? 357 VAL A N    1 
ATOM   755  C CA   . VAL A 1 61  ? -14.425 11.795 -23.599 1.00 29.73  ? 357 VAL A CA   1 
ATOM   756  C C    . VAL A 1 61  ? -15.429 12.387 -24.578 1.00 29.63  ? 357 VAL A C    1 
ATOM   757  O O    . VAL A 1 61  ? -15.266 12.276 -25.799 1.00 31.18  ? 357 VAL A O    1 
ATOM   758  C CB   . VAL A 1 61  ? -14.899 10.432 -23.060 1.00 29.15  ? 357 VAL A CB   1 
ATOM   759  C CG1  . VAL A 1 61  ? -15.358 9.527  -24.194 1.00 32.05  ? 357 VAL A CG1  1 
ATOM   760  C CG2  . VAL A 1 61  ? -13.781 9.761  -22.278 1.00 29.52  ? 357 VAL A CG2  1 
ATOM   761  H H    . VAL A 1 61  ? -14.361 12.401 -21.715 1.00 35.31  ? 357 VAL A H    1 
ATOM   762  H HA   . VAL A 1 61  ? -13.593 11.652 -24.077 1.00 35.67  ? 357 VAL A HA   1 
ATOM   763  H HB   . VAL A 1 61  ? -15.648 10.569 -22.460 1.00 34.98  ? 357 VAL A HB   1 
ATOM   764  H HG11 . VAL A 1 61  ? -15.649 8.679  -23.823 1.00 38.46  ? 357 VAL A HG11 1 
ATOM   765  H HG12 . VAL A 1 61  ? -16.094 9.954  -24.660 1.00 38.46  ? 357 VAL A HG12 1 
ATOM   766  H HG13 . VAL A 1 61  ? -14.618 9.384  -24.804 1.00 38.46  ? 357 VAL A HG13 1 
ATOM   767  H HG21 . VAL A 1 61  ? -14.097 8.906  -21.947 1.00 35.42  ? 357 VAL A HG21 1 
ATOM   768  H HG22 . VAL A 1 61  ? -13.020 9.629  -22.866 1.00 35.42  ? 357 VAL A HG22 1 
ATOM   769  H HG23 . VAL A 1 61  ? -13.530 10.331 -21.535 1.00 35.42  ? 357 VAL A HG23 1 
ATOM   770  N N    . GLU A 1 62  ? -16.488 13.016 -24.067 1.00 30.72  ? 358 GLU A N    1 
ATOM   771  C CA   . GLU A 1 62  ? -17.471 13.614 -24.964 1.00 35.31  ? 358 GLU A CA   1 
ATOM   772  C C    . GLU A 1 62  ? -16.883 14.802 -25.713 1.00 34.80  ? 358 GLU A C    1 
ATOM   773  O O    . GLU A 1 62  ? -17.162 14.991 -26.903 1.00 32.96  ? 358 GLU A O    1 
ATOM   774  C CB   . GLU A 1 62  ? -18.714 14.042 -24.191 1.00 37.65  ? 358 GLU A CB   1 
ATOM   775  C CG   . GLU A 1 62  ? -19.776 14.658 -25.085 1.00 42.07  ? 358 GLU A CG   1 
ATOM   776  C CD   . GLU A 1 62  ? -20.332 13.681 -26.104 1.00 44.55  ? 358 GLU A CD   1 
ATOM   777  O OE1  . GLU A 1 62  ? -20.327 12.462 -25.830 1.00 47.96  ? 358 GLU A OE1  1 
ATOM   778  O OE2  . GLU A 1 62  ? -20.761 14.128 -27.187 1.00 43.37  ? 358 GLU A OE2  1 
ATOM   779  H H    . GLU A 1 62  ? -16.655 13.109 -23.229 1.00 36.86  ? 358 GLU A H    1 
ATOM   780  H HA   . GLU A 1 62  ? -17.741 12.952 -25.619 1.00 42.37  ? 358 GLU A HA   1 
ATOM   781  H HB2  . GLU A 1 62  ? -19.101 13.265 -23.757 1.00 45.18  ? 358 GLU A HB2  1 
ATOM   782  H HB3  . GLU A 1 62  ? -18.461 14.701 -23.526 1.00 45.18  ? 358 GLU A HB3  1 
ATOM   783  H HG2  . GLU A 1 62  ? -20.512 14.967 -24.533 1.00 50.48  ? 358 GLU A HG2  1 
ATOM   784  H HG3  . GLU A 1 62  ? -19.387 15.405 -25.567 1.00 50.48  ? 358 GLU A HG3  1 
ATOM   785  N N    . TRP A 1 63  ? -16.080 15.621 -25.031 1.00 30.68  ? 359 TRP A N    1 
ATOM   786  C CA   . TRP A 1 63  ? -15.393 16.721 -25.702 1.00 30.66  ? 359 TRP A CA   1 
ATOM   787  C C    . TRP A 1 63  ? -14.600 16.221 -26.904 1.00 34.95  ? 359 TRP A C    1 
ATOM   788  O O    . TRP A 1 63  ? -14.764 16.717 -28.025 1.00 37.98  ? 359 TRP A O    1 
ATOM   789  C CB   . TRP A 1 63  ? -14.474 17.441 -24.714 1.00 31.12  ? 359 TRP A CB   1 
ATOM   790  C CG   . TRP A 1 63  ? -13.394 18.237 -25.382 1.00 32.10  ? 359 TRP A CG   1 
ATOM   791  C CD1  . TRP A 1 63  ? -13.525 19.453 -25.987 1.00 37.84  ? 359 TRP A CD1  1 
ATOM   792  C CD2  . TRP A 1 63  ? -12.018 17.868 -25.518 1.00 30.82  ? 359 TRP A CD2  1 
ATOM   793  N NE1  . TRP A 1 63  ? -12.314 19.866 -26.486 1.00 36.51  ? 359 TRP A NE1  1 
ATOM   794  C CE2  . TRP A 1 63  ? -11.373 18.909 -26.216 1.00 33.98  ? 359 TRP A CE2  1 
ATOM   795  C CE3  . TRP A 1 63  ? -11.268 16.758 -25.119 1.00 28.84  ? 359 TRP A CE3  1 
ATOM   796  C CZ2  . TRP A 1 63  ? -10.016 18.872 -26.522 1.00 33.47  ? 359 TRP A CZ2  1 
ATOM   797  C CZ3  . TRP A 1 63  ? -9.922  16.725 -25.422 1.00 30.08  ? 359 TRP A CZ3  1 
ATOM   798  C CH2  . TRP A 1 63  ? -9.308  17.776 -26.115 1.00 33.02  ? 359 TRP A CH2  1 
ATOM   799  H H    . TRP A 1 63  ? -15.920 15.562 -24.188 1.00 36.81  ? 359 TRP A H    1 
ATOM   800  H HA   . TRP A 1 63  ? -16.052 17.358 -26.020 1.00 36.79  ? 359 TRP A HA   1 
ATOM   801  H HB2  . TRP A 1 63  ? -15.005 18.051 -24.178 1.00 37.35  ? 359 TRP A HB2  1 
ATOM   802  H HB3  . TRP A 1 63  ? -14.050 16.783 -24.143 1.00 37.35  ? 359 TRP A HB3  1 
ATOM   803  H HD1  . TRP A 1 63  ? -14.319 19.935 -26.048 1.00 45.41  ? 359 TRP A HD1  1 
ATOM   804  H HE1  . TRP A 1 63  ? -12.171 20.603 -26.906 1.00 43.81  ? 359 TRP A HE1  1 
ATOM   805  H HE3  . TRP A 1 63  ? -11.668 16.056 -24.659 1.00 34.60  ? 359 TRP A HE3  1 
ATOM   806  H HZ2  . TRP A 1 63  ? -9.605  19.570 -26.980 1.00 40.17  ? 359 TRP A HZ2  1 
ATOM   807  H HZ3  . TRP A 1 63  ? -9.413  15.991 -25.161 1.00 36.09  ? 359 TRP A HZ3  1 
ATOM   808  H HH2  . TRP A 1 63  ? -8.399  17.725 -26.305 1.00 39.63  ? 359 TRP A HH2  1 
ATOM   809  N N    . ALA A 1 64  ? -13.732 15.230 -26.688 1.00 31.01  ? 360 ALA A N    1 
ATOM   810  C CA   . ALA A 1 64  ? -12.952 14.678 -27.789 1.00 29.91  ? 360 ALA A CA   1 
ATOM   811  C C    . ALA A 1 64  ? -13.857 14.048 -28.840 1.00 31.30  ? 360 ALA A C    1 
ATOM   812  O O    . ALA A 1 64  ? -13.650 14.235 -30.043 1.00 33.41  ? 360 ALA A O    1 
ATOM   813  C CB   . ALA A 1 64  ? -11.952 13.653 -27.259 1.00 29.24  ? 360 ALA A CB   1 
ATOM   814  H H    . ALA A 1 64  ? -13.581 14.866 -25.924 1.00 37.21  ? 360 ALA A H    1 
ATOM   815  H HA   . ALA A 1 64  ? -12.452 15.393 -28.213 1.00 35.90  ? 360 ALA A HA   1 
ATOM   816  H HB1  . ALA A 1 64  ? -11.442 13.296 -28.003 1.00 35.09  ? 360 ALA A HB1  1 
ATOM   817  H HB2  . ALA A 1 64  ? -11.358 14.089 -26.628 1.00 35.09  ? 360 ALA A HB2  1 
ATOM   818  H HB3  . ALA A 1 64  ? -12.437 12.938 -26.817 1.00 35.09  ? 360 ALA A HB3  1 
ATOM   819  N N    . ARG A 1 65  ? -14.864 13.292 -28.401 1.00 34.10  ? 361 ARG A N    1 
ATOM   820  C CA   . ARG A 1 65  ? -15.827 12.714 -29.333 1.00 35.79  ? 361 ARG A CA   1 
ATOM   821  C C    . ARG A 1 65  ? -16.477 13.793 -30.188 1.00 41.97  ? 361 ARG A C    1 
ATOM   822  O O    . ARG A 1 65  ? -16.635 13.626 -31.403 1.00 45.42  ? 361 ARG A O    1 
ATOM   823  C CB   . ARG A 1 65  ? -16.895 11.942 -28.561 1.00 40.74  ? 361 ARG A CB   1 
ATOM   824  C CG   . ARG A 1 65  ? -17.096 10.518 -29.014 1.00 47.02  ? 361 ARG A CG   1 
ATOM   825  C CD   . ARG A 1 65  ? -18.230 9.880  -28.232 1.00 50.53  ? 361 ARG A CD   1 
ATOM   826  N NE   . ARG A 1 65  ? -19.530 10.285 -28.754 1.00 53.86  ? 361 ARG A NE   1 
ATOM   827  C CZ   . ARG A 1 65  ? -20.139 9.705  -29.784 1.00 60.06  ? 361 ARG A CZ   1 
ATOM   828  N NH1  . ARG A 1 65  ? -19.567 8.687  -30.409 1.00 62.47  ? 361 ARG A NH1  1 
ATOM   829  N NH2  . ARG A 1 65  ? -21.322 10.146 -30.191 1.00 63.03  ? 361 ARG A NH2  1 
ATOM   830  H H    . ARG A 1 65  ? -15.010 13.101 -27.575 1.00 40.92  ? 361 ARG A H    1 
ATOM   831  H HA   . ARG A 1 65  ? -15.369 12.094 -29.922 1.00 42.95  ? 361 ARG A HA   1 
ATOM   832  H HB2  . ARG A 1 65  ? -16.644 11.919 -27.624 1.00 48.89  ? 361 ARG A HB2  1 
ATOM   833  H HB3  . ARG A 1 65  ? -17.742 12.404 -28.660 1.00 48.89  ? 361 ARG A HB3  1 
ATOM   834  H HG2  . ARG A 1 65  ? -17.326 10.506 -29.956 1.00 56.42  ? 361 ARG A HG2  1 
ATOM   835  H HG3  . ARG A 1 65  ? -16.286 10.009 -28.855 1.00 56.42  ? 361 ARG A HG3  1 
ATOM   836  H HD2  . ARG A 1 65  ? -18.163 8.915  -28.299 1.00 60.64  ? 361 ARG A HD2  1 
ATOM   837  H HD3  . ARG A 1 65  ? -18.175 10.157 -27.304 1.00 60.64  ? 361 ARG A HD3  1 
ATOM   838  H HE   . ARG A 1 65  ? -19.929 10.943 -28.370 1.00 64.63  ? 361 ARG A HE   1 
ATOM   839  H HH11 . ARG A 1 65  ? -18.800 8.399  -30.149 1.00 74.96  ? 361 ARG A HH11 1 
ATOM   840  H HH12 . ARG A 1 65  ? -19.964 8.314  -31.075 1.00 74.96  ? 361 ARG A HH12 1 
ATOM   841  H HH21 . ARG A 1 65  ? -21.697 10.806 -29.788 1.00 75.63  ? 361 ARG A HH21 1 
ATOM   842  H HH22 . ARG A 1 65  ? -21.715 9.769  -30.857 1.00 75.63  ? 361 ARG A HH22 1 
ATOM   843  N N    . SER A 1 66  ? -16.868 14.906 -29.565 1.00 49.08  ? 362 SER A N    1 
ATOM   844  C CA   . SER A 1 66  ? -17.470 16.015 -30.294 1.00 55.10  ? 362 SER A CA   1 
ATOM   845  C C    . SER A 1 66  ? -16.510 16.629 -31.297 1.00 48.89  ? 362 SER A C    1 
ATOM   846  O O    . SER A 1 66  ? -16.949 17.323 -32.222 1.00 45.46  ? 362 SER A O    1 
ATOM   847  C CB   . SER A 1 66  ? -17.912 17.108 -29.318 1.00 63.43  ? 362 SER A CB   1 
ATOM   848  O OG   . SER A 1 66  ? -16.878 18.065 -29.140 1.00 63.71  ? 362 SER A OG   1 
ATOM   849  H H    . SER A 1 66  ? -16.794 15.041 -28.719 1.00 58.89  ? 362 SER A H    1 
ATOM   850  H HA   . SER A 1 66  ? -18.251 15.698 -30.774 1.00 66.12  ? 362 SER A HA   1 
ATOM   851  H HB2  . SER A 1 66  ? -18.697 17.552 -29.674 1.00 76.12  ? 362 SER A HB2  1 
ATOM   852  H HB3  . SER A 1 66  ? -18.119 16.702 -28.461 1.00 76.12  ? 362 SER A HB3  1 
ATOM   853  H HG   . SER A 1 66  ? -16.190 17.692 -28.833 1.00 76.46  ? 362 SER A HG   1 
ATOM   854  N N    . SER A 1 67  ? -15.218 16.371 -31.145 1.00 41.79  ? 363 SER A N    1 
ATOM   855  C CA   . SER A 1 67  ? -14.200 17.264 -31.671 1.00 43.55  ? 363 SER A CA   1 
ATOM   856  C C    . SER A 1 67  ? -14.003 17.077 -33.166 1.00 41.25  ? 363 SER A C    1 
ATOM   857  O O    . SER A 1 67  ? -13.923 15.950 -33.668 1.00 36.45  ? 363 SER A O    1 
ATOM   858  C CB   . SER A 1 67  ? -12.874 17.049 -30.938 1.00 49.06  ? 363 SER A CB   1 
ATOM   859  O OG   . SER A 1 67  ? -11.792 17.579 -31.677 1.00 55.90  ? 363 SER A OG   1 
ATOM   860  H H    . SER A 1 67  ? -14.904 15.680 -30.739 1.00 50.14  ? 363 SER A H    1 
ATOM   861  H HA   . SER A 1 67  ? -14.479 18.181 -31.520 1.00 52.26  ? 363 SER A HA   1 
ATOM   862  H HB2  . SER A 1 67  ? -12.915 17.493 -30.077 1.00 58.87  ? 363 SER A HB2  1 
ATOM   863  H HB3  . SER A 1 67  ? -12.734 16.097 -30.813 1.00 58.87  ? 363 SER A HB3  1 
ATOM   864  H HG   . SER A 1 67  ? -11.072 17.454 -31.263 1.00 67.08  ? 363 SER A HG   1 
ATOM   865  N N    . ILE A 1 68  ? -13.946 18.200 -33.877 1.00 42.37  ? 364 ILE A N    1 
ATOM   866  C CA   . ILE A 1 68  ? -13.356 18.218 -35.202 1.00 45.87  ? 364 ILE A CA   1 
ATOM   867  C C    . ILE A 1 68  ? -12.025 17.476 -35.157 1.00 39.07  ? 364 ILE A C    1 
ATOM   868  O O    . ILE A 1 68  ? -11.300 17.527 -34.156 1.00 40.86  ? 364 ILE A O    1 
ATOM   869  C CB   . ILE A 1 68  ? -13.197 19.679 -35.657 1.00 52.46  ? 364 ILE A CB   1 
ATOM   870  C CG1  . ILE A 1 68  ? -12.762 19.754 -37.117 1.00 56.15  ? 364 ILE A CG1  1 
ATOM   871  C CG2  . ILE A 1 68  ? -12.220 20.419 -34.732 1.00 53.07  ? 364 ILE A CG2  1 
ATOM   872  C CD1  . ILE A 1 68  ? -12.888 21.137 -37.698 1.00 62.78  ? 364 ILE A CD1  1 
ATOM   873  H H    . ILE A 1 68  ? -14.242 18.962 -33.611 1.00 50.84  ? 364 ILE A H    1 
ATOM   874  H HA   . ILE A 1 68  ? -13.943 17.762 -35.826 1.00 55.04  ? 364 ILE A HA   1 
ATOM   875  H HB   . ILE A 1 68  ? -14.063 20.111 -35.582 1.00 62.96  ? 364 ILE A HB   1 
ATOM   876  H HG12 . ILE A 1 68  ? -11.833 19.485 -37.183 1.00 67.38  ? 364 ILE A HG12 1 
ATOM   877  H HG13 . ILE A 1 68  ? -13.318 19.157 -37.643 1.00 67.38  ? 364 ILE A HG13 1 
ATOM   878  H HG21 . ILE A 1 68  ? -12.133 21.336 -35.034 1.00 63.68  ? 364 ILE A HG21 1 
ATOM   879  H HG22 . ILE A 1 68  ? -12.567 20.399 -33.827 1.00 63.68  ? 364 ILE A HG22 1 
ATOM   880  H HG23 . ILE A 1 68  ? -11.358 19.975 -34.766 1.00 63.68  ? 364 ILE A HG23 1 
ATOM   881  H HD11 . ILE A 1 68  ? -12.598 21.118 -38.623 1.00 75.34  ? 364 ILE A HD11 1 
ATOM   882  H HD12 . ILE A 1 68  ? -13.815 21.417 -37.647 1.00 75.34  ? 364 ILE A HD12 1 
ATOM   883  H HD13 . ILE A 1 68  ? -12.330 21.745 -37.188 1.00 75.34  ? 364 ILE A HD13 1 
ATOM   884  N N    . PHE A 1 69  ? -11.718 16.759 -36.241 1.00 34.65  ? 365 PHE A N    1 
ATOM   885  C CA   . PHE A 1 69  ? -10.481 15.990 -36.385 1.00 33.57  ? 365 PHE A CA   1 
ATOM   886  C C    . PHE A 1 69  ? -10.548 14.669 -35.632 1.00 30.73  ? 365 PHE A C    1 
ATOM   887  O O    . PHE A 1 69  ? -10.363 13.603 -36.227 1.00 37.55  ? 365 PHE A O    1 
ATOM   888  C CB   . PHE A 1 69  ? -9.264  16.790 -35.912 1.00 33.72  ? 365 PHE A CB   1 
ATOM   889  C CG   . PHE A 1 69  ? -9.190  18.173 -36.485 1.00 35.27  ? 365 PHE A CG   1 
ATOM   890  C CD1  . PHE A 1 69  ? -9.394  18.387 -37.837 1.00 39.64  ? 365 PHE A CD1  1 
ATOM   891  C CD2  . PHE A 1 69  ? -8.925  19.259 -35.673 1.00 39.18  ? 365 PHE A CD2  1 
ATOM   892  C CE1  . PHE A 1 69  ? -9.329  19.662 -38.369 1.00 43.20  ? 365 PHE A CE1  1 
ATOM   893  C CE2  . PHE A 1 69  ? -8.861  20.533 -36.197 1.00 41.74  ? 365 PHE A CE2  1 
ATOM   894  C CZ   . PHE A 1 69  ? -9.065  20.737 -37.547 1.00 45.83  ? 365 PHE A CZ   1 
ATOM   895  H H    . PHE A 1 69  ? -12.230 16.702 -36.929 1.00 41.58  ? 365 PHE A H    1 
ATOM   896  H HA   . PHE A 1 69  ? -10.351 15.786 -37.324 1.00 40.29  ? 365 PHE A HA   1 
ATOM   897  H HB2  . PHE A 1 69  ? -9.299  16.871 -34.946 1.00 40.46  ? 365 PHE A HB2  1 
ATOM   898  H HB3  . PHE A 1 69  ? -8.458  16.317 -36.173 1.00 40.46  ? 365 PHE A HB3  1 
ATOM   899  H HD1  . PHE A 1 69  ? -9.574  17.665 -38.395 1.00 47.56  ? 365 PHE A HD1  1 
ATOM   900  H HD2  . PHE A 1 69  ? -8.788  19.129 -34.762 1.00 47.01  ? 365 PHE A HD2  1 
ATOM   901  H HE1  . PHE A 1 69  ? -9.467  19.795 -39.279 1.00 51.84  ? 365 PHE A HE1  1 
ATOM   902  H HE2  . PHE A 1 69  ? -8.681  21.256 -35.640 1.00 50.09  ? 365 PHE A HE2  1 
ATOM   903  H HZ   . PHE A 1 69  ? -9.020  21.595 -37.901 1.00 55.00  ? 365 PHE A HZ   1 
ATOM   904  N N    . PHE A 1 70  ? -10.807 14.721 -34.325 1.00 31.12  ? 366 PHE A N    1 
ATOM   905  C CA   . PHE A 1 70  ? -10.836 13.494 -33.537 1.00 30.24  ? 366 PHE A CA   1 
ATOM   906  C C    . PHE A 1 70  ? -11.927 12.551 -34.025 1.00 36.56  ? 366 PHE A C    1 
ATOM   907  O O    . PHE A 1 70  ? -11.727 11.332 -34.074 1.00 39.85  ? 366 PHE A O    1 
ATOM   908  C CB   . PHE A 1 70  ? -11.045 13.827 -32.061 1.00 30.80  ? 366 PHE A CB   1 
ATOM   909  C CG   . PHE A 1 70  ? -10.786 12.672 -31.130 1.00 29.49  ? 366 PHE A CG   1 
ATOM   910  C CD1  . PHE A 1 70  ? -9.498  12.368 -30.727 1.00 32.53  ? 366 PHE A CD1  1 
ATOM   911  C CD2  . PHE A 1 70  ? -11.831 11.901 -30.648 1.00 31.85  ? 366 PHE A CD2  1 
ATOM   912  C CE1  . PHE A 1 70  ? -9.256  11.313 -29.860 1.00 31.06  ? 366 PHE A CE1  1 
ATOM   913  C CE2  . PHE A 1 70  ? -11.592 10.845 -29.781 1.00 30.32  ? 366 PHE A CE2  1 
ATOM   914  C CZ   . PHE A 1 70  ? -10.307 10.553 -29.389 1.00 29.97  ? 366 PHE A CZ   1 
ATOM   915  H H    . PHE A 1 70  ? -10.967 15.439 -33.880 1.00 37.34  ? 366 PHE A H    1 
ATOM   916  H HA   . PHE A 1 70  ? -9.984  13.040 -33.626 1.00 36.28  ? 366 PHE A HA   1 
ATOM   917  H HB2  . PHE A 1 70  ? -10.442 14.546 -31.815 1.00 36.96  ? 366 PHE A HB2  1 
ATOM   918  H HB3  . PHE A 1 70  ? -11.964 14.110 -31.932 1.00 36.96  ? 366 PHE A HB3  1 
ATOM   919  H HD1  . PHE A 1 70  ? -8.787  12.878 -31.039 1.00 39.03  ? 366 PHE A HD1  1 
ATOM   920  H HD2  . PHE A 1 70  ? -12.703 12.095 -30.908 1.00 38.22  ? 366 PHE A HD2  1 
ATOM   921  H HE1  . PHE A 1 70  ? -8.386  11.116 -29.597 1.00 37.27  ? 366 PHE A HE1  1 
ATOM   922  H HE2  . PHE A 1 70  ? -12.302 10.333 -29.466 1.00 36.38  ? 366 PHE A HE2  1 
ATOM   923  H HZ   . PHE A 1 70  ? -10.147 9.843  -28.811 1.00 35.96  ? 366 PHE A HZ   1 
ATOM   924  N N    . ARG A 1 71  ? -13.090 13.094 -34.397 1.00 39.25  ? 367 ARG A N    1 
ATOM   925  C CA   . ARG A 1 71  ? -14.212 12.245 -34.775 1.00 45.59  ? 367 ARG A CA   1 
ATOM   926  C C    . ARG A 1 71  ? -13.981 11.528 -36.097 1.00 47.31  ? 367 ARG A C    1 
ATOM   927  O O    . ARG A 1 71  ? -14.812 10.700 -36.484 1.00 54.89  ? 367 ARG A O    1 
ATOM   928  C CB   . ARG A 1 71  ? -15.504 13.068 -34.837 1.00 55.38  ? 367 ARG A CB   1 
ATOM   929  C CG   . ARG A 1 71  ? -15.518 14.179 -35.878 1.00 69.63  ? 367 ARG A CG   1 
ATOM   930  C CD   . ARG A 1 71  ? -16.773 15.038 -35.742 1.00 84.02  ? 367 ARG A CD   1 
ATOM   931  N NE   . ARG A 1 71  ? -16.670 16.296 -36.480 1.00 96.53  ? 367 ARG A NE   1 
ATOM   932  C CZ   . ARG A 1 71  ? -16.670 17.514 -35.938 1.00 105.10 ? 367 ARG A CZ   1 
ATOM   933  N NH1  . ARG A 1 71  ? -16.781 17.682 -34.628 1.00 105.83 ? 367 ARG A NH1  1 
ATOM   934  N NH2  . ARG A 1 71  ? -16.568 18.580 -36.719 1.00 110.92 ? 367 ARG A NH2  1 
ATOM   935  H H    . ARG A 1 71  ? -13.249 13.938 -34.436 1.00 47.10  ? 367 ARG A H    1 
ATOM   936  H HA   . ARG A 1 71  ? -14.330 11.566 -34.091 1.00 54.71  ? 367 ARG A HA   1 
ATOM   937  H HB2  . ARG A 1 71  ? -16.240 12.470 -35.040 1.00 66.45  ? 367 ARG A HB2  1 
ATOM   938  H HB3  . ARG A 1 71  ? -15.649 13.479 -33.970 1.00 66.45  ? 367 ARG A HB3  1 
ATOM   939  H HG2  . ARG A 1 71  ? -14.743 14.749 -35.751 1.00 83.55  ? 367 ARG A HG2  1 
ATOM   940  H HG3  . ARG A 1 71  ? -15.509 13.789 -36.766 1.00 83.55  ? 367 ARG A HG3  1 
ATOM   941  H HD2  . ARG A 1 71  ? -17.533 14.546 -36.090 1.00 100.82 ? 367 ARG A HD2  1 
ATOM   942  H HD3  . ARG A 1 71  ? -16.913 15.249 -34.806 1.00 100.82 ? 367 ARG A HD3  1 
ATOM   943  H HE   . ARG A 1 71  ? -16.605 16.246 -37.336 1.00 115.83 ? 367 ARG A HE   1 
ATOM   944  H HH11 . ARG A 1 71  ? -16.848 16.999 -34.111 1.00 127.00 ? 367 ARG A HH11 1 
ATOM   945  H HH12 . ARG A 1 71  ? -16.781 18.475 -34.295 1.00 127.00 ? 367 ARG A HH12 1 
ATOM   946  H HH21 . ARG A 1 71  ? -16.498 18.484 -37.571 1.00 133.10 ? 367 ARG A HH21 1 
ATOM   947  H HH22 . ARG A 1 71  ? -16.571 19.368 -36.374 1.00 133.10 ? 367 ARG A HH22 1 
ATOM   948  N N    . GLU A 1 72  ? -12.881 11.817 -36.791 1.00 45.51  ? 368 GLU A N    1 
ATOM   949  C CA   . GLU A 1 72  ? -12.545 11.107 -38.017 1.00 48.34  ? 368 GLU A CA   1 
ATOM   950  C C    . GLU A 1 72  ? -11.732 9.846  -37.761 1.00 48.02  ? 368 GLU A C    1 
ATOM   951  O O    . GLU A 1 72  ? -11.771 8.914  -38.573 1.00 51.77  ? 368 GLU A O    1 
ATOM   952  C CB   . GLU A 1 72  ? -11.770 12.033 -38.957 1.00 49.96  ? 368 GLU A CB   1 
ATOM   953  C CG   . GLU A 1 72  ? -12.542 13.288 -39.330 1.00 51.87  ? 368 GLU A CG   1 
ATOM   954  C CD   . GLU A 1 72  ? -12.164 13.837 -40.690 1.00 54.45  ? 368 GLU A CD   1 
ATOM   955  O OE1  . GLU A 1 72  ? -12.238 15.072 -40.868 1.00 52.98  ? 368 GLU A OE1  1 
ATOM   956  O OE2  . GLU A 1 72  ? -11.802 13.039 -41.580 1.00 56.71  ? 368 GLU A OE2  1 
ATOM   957  H H    . GLU A 1 72  ? -12.312 12.422 -36.569 1.00 54.62  ? 368 GLU A H    1 
ATOM   958  H HA   . GLU A 1 72  ? -13.365 10.847 -38.465 1.00 58.00  ? 368 GLU A HA   1 
ATOM   959  H HB2  . GLU A 1 72  ? -10.947 12.307 -38.521 1.00 59.95  ? 368 GLU A HB2  1 
ATOM   960  H HB3  . GLU A 1 72  ? -11.567 11.553 -39.775 1.00 59.95  ? 368 GLU A HB3  1 
ATOM   961  H HG2  . GLU A 1 72  ? -13.490 13.082 -39.343 1.00 62.25  ? 368 GLU A HG2  1 
ATOM   962  H HG3  . GLU A 1 72  ? -12.362 13.976 -38.670 1.00 62.25  ? 368 GLU A HG3  1 
ATOM   963  N N    . LEU A 1 73  ? -10.985 9.800  -36.662 1.00 43.40  ? 369 LEU A N    1 
ATOM   964  C CA   . LEU A 1 73  ? -10.236 8.601  -36.321 1.00 41.88  ? 369 LEU A CA   1 
ATOM   965  C C    . LEU A 1 73  ? -11.192 7.453  -36.020 1.00 42.55  ? 369 LEU A C    1 
ATOM   966  O O    . LEU A 1 73  ? -12.309 7.656  -35.536 1.00 43.84  ? 369 LEU A O    1 
ATOM   967  C CB   . LEU A 1 73  ? -9.340  8.862  -35.111 1.00 42.11  ? 369 LEU A CB   1 
ATOM   968  C CG   . LEU A 1 73  ? -8.207  9.867  -35.309 1.00 41.95  ? 369 LEU A CG   1 
ATOM   969  C CD1  . LEU A 1 73  ? -7.670  10.332 -33.964 1.00 41.00  ? 369 LEU A CD1  1 
ATOM   970  C CD2  . LEU A 1 73  ? -7.094  9.251  -36.143 1.00 45.11  ? 369 LEU A CD2  1 
ATOM   971  H H    . LEU A 1 73  ? -10.897 10.447 -36.102 1.00 52.08  ? 369 LEU A H    1 
ATOM   972  H HA   . LEU A 1 73  ? -9.675  8.346  -37.070 1.00 50.26  ? 369 LEU A HA   1 
ATOM   973  H HB2  . LEU A 1 73  ? -9.895  9.193  -34.388 1.00 50.53  ? 369 LEU A HB2  1 
ATOM   974  H HB3  . LEU A 1 73  ? -8.935  8.021  -34.846 1.00 50.53  ? 369 LEU A HB3  1 
ATOM   975  H HG   . LEU A 1 73  ? -8.547  10.641 -35.783 1.00 50.34  ? 369 LEU A HG   1 
ATOM   976  H HD11 . LEU A 1 73  ? -6.954  10.968 -34.114 1.00 49.20  ? 369 LEU A HD11 1 
ATOM   977  H HD12 . LEU A 1 73  ? -8.389  10.753 -33.467 1.00 49.20  ? 369 LEU A HD12 1 
ATOM   978  H HD13 . LEU A 1 73  ? -7.335  9.564  -33.476 1.00 49.20  ? 369 LEU A HD13 1 
ATOM   979  H HD21 . LEU A 1 73  ? -6.386  9.904  -36.256 1.00 54.14  ? 369 LEU A HD21 1 
ATOM   980  H HD22 . LEU A 1 73  ? -6.752  8.468  -35.683 1.00 54.14  ? 369 LEU A HD22 1 
ATOM   981  H HD23 . LEU A 1 73  ? -7.452  8.997  -37.008 1.00 54.14  ? 369 LEU A HD23 1 
ATOM   982  N N    . LYS A 1 74  ? -10.749 6.237  -36.320 1.00 44.66  ? 370 LYS A N    1 
ATOM   983  C CA   . LYS A 1 74  ? -11.515 5.064  -35.939 1.00 47.00  ? 370 LYS A CA   1 
ATOM   984  C C    . LYS A 1 74  ? -11.369 4.821  -34.439 1.00 42.43  ? 370 LYS A C    1 
ATOM   985  O O    . LYS A 1 74  ? -10.443 5.315  -33.790 1.00 41.06  ? 370 LYS A O    1 
ATOM   986  C CB   . LYS A 1 74  ? -11.065 3.840  -36.739 1.00 54.60  ? 370 LYS A CB   1 
ATOM   987  C CG   . LYS A 1 74  ? -11.087 4.063  -38.246 1.00 65.53  ? 370 LYS A CG   1 
ATOM   988  C CD   . LYS A 1 74  ? -11.282 2.766  -39.024 1.00 81.57  ? 370 LYS A CD   1 
ATOM   989  C CE   . LYS A 1 74  ? -12.746 2.338  -39.066 1.00 93.54  ? 370 LYS A CE   1 
ATOM   990  N NZ   . LYS A 1 74  ? -13.624 3.336  -39.748 1.00 100.26 ? 370 LYS A NZ   1 
ATOM   991  H H    . LYS A 1 74  ? -10.017 6.068  -36.738 1.00 53.59  ? 370 LYS A H    1 
ATOM   992  H HA   . LYS A 1 74  ? -12.453 5.221  -36.129 1.00 56.40  ? 370 LYS A HA   1 
ATOM   993  H HB2  . LYS A 1 74  ? -10.156 3.615  -36.484 1.00 65.52  ? 370 LYS A HB2  1 
ATOM   994  H HB3  . LYS A 1 74  ? -11.657 3.099  -36.538 1.00 65.52  ? 370 LYS A HB3  1 
ATOM   995  H HG2  . LYS A 1 74  ? -11.818 4.660  -38.467 1.00 78.64  ? 370 LYS A HG2  1 
ATOM   996  H HG3  . LYS A 1 74  ? -10.243 4.454  -38.521 1.00 78.64  ? 370 LYS A HG3  1 
ATOM   997  H HD2  . LYS A 1 74  ? -10.979 2.894  -39.937 1.00 97.88  ? 370 LYS A HD2  1 
ATOM   998  H HD3  . LYS A 1 74  ? -10.773 2.059  -38.598 1.00 97.88  ? 370 LYS A HD3  1 
ATOM   999  H HE2  . LYS A 1 74  ? -12.816 1.499  -39.548 1.00 112.25 ? 370 LYS A HE2  1 
ATOM   1000 H HE3  . LYS A 1 74  ? -13.069 2.226  -38.158 1.00 112.25 ? 370 LYS A HE3  1 
ATOM   1001 H HZ1  . LYS A 1 74  ? -14.466 3.048  -39.751 1.00 120.31 ? 370 LYS A HZ1  1 
ATOM   1002 H HZ2  . LYS A 1 74  ? -13.586 4.116  -39.322 1.00 120.31 ? 370 LYS A HZ2  1 
ATOM   1003 H HZ3  . LYS A 1 74  ? -13.355 3.452  -40.589 1.00 120.31 ? 370 LYS A HZ3  1 
ATOM   1004 N N    . VAL A 1 75  ? -12.312 4.051  -33.888 1.00 42.45  ? 371 VAL A N    1 
ATOM   1005 C CA   . VAL A 1 75  ? -12.420 3.916  -32.435 1.00 41.75  ? 371 VAL A CA   1 
ATOM   1006 C C    . VAL A 1 75  ? -11.096 3.475  -31.827 1.00 40.63  ? 371 VAL A C    1 
ATOM   1007 O O    . VAL A 1 75  ? -10.671 3.991  -30.785 1.00 36.19  ? 371 VAL A O    1 
ATOM   1008 C CB   . VAL A 1 75  ? -13.557 2.942  -32.078 1.00 42.72  ? 371 VAL A CB   1 
ATOM   1009 C CG1  . VAL A 1 75  ? -13.556 2.621  -30.589 1.00 42.37  ? 371 VAL A CG1  1 
ATOM   1010 C CG2  . VAL A 1 75  ? -14.893 3.540  -32.476 1.00 43.61  ? 371 VAL A CG2  1 
ATOM   1011 H H    . VAL A 1 75  ? -12.896 3.601  -34.331 1.00 50.94  ? 371 VAL A H    1 
ATOM   1012 H HA   . VAL A 1 75  ? -12.643 4.782  -32.058 1.00 50.10  ? 371 VAL A HA   1 
ATOM   1013 H HB   . VAL A 1 75  ? -13.436 2.114  -32.568 1.00 51.27  ? 371 VAL A HB   1 
ATOM   1014 H HG11 . VAL A 1 75  ? -14.283 2.008  -30.398 1.00 50.84  ? 371 VAL A HG11 1 
ATOM   1015 H HG12 . VAL A 1 75  ? -12.708 2.214  -30.355 1.00 50.84  ? 371 VAL A HG12 1 
ATOM   1016 H HG13 . VAL A 1 75  ? -13.678 3.444  -30.089 1.00 50.84  ? 371 VAL A HG13 1 
ATOM   1017 H HG21 . VAL A 1 75  ? -15.599 2.916  -32.245 1.00 52.33  ? 371 VAL A HG21 1 
ATOM   1018 H HG22 . VAL A 1 75  ? -15.019 4.375  -32.000 1.00 52.33  ? 371 VAL A HG22 1 
ATOM   1019 H HG23 . VAL A 1 75  ? -14.893 3.701  -33.433 1.00 52.33  ? 371 VAL A HG23 1 
ATOM   1020 N N    . ASP A 1 76  ? -10.427 2.508  -32.457 1.00 46.01  ? 372 ASP A N    1 
ATOM   1021 C CA   . ASP A 1 76  ? -9.173  2.007  -31.905 1.00 48.80  ? 372 ASP A CA   1 
ATOM   1022 C C    . ASP A 1 76  ? -8.177  3.141  -31.696 1.00 43.89  ? 372 ASP A C    1 
ATOM   1023 O O    . ASP A 1 76  ? -7.587  3.270  -30.618 1.00 40.77  ? 372 ASP A O    1 
ATOM   1024 C CB   . ASP A 1 76  ? -8.592  0.926  -32.817 1.00 59.29  ? 372 ASP A CB   1 
ATOM   1025 C CG   . ASP A 1 76  ? -9.394  -0.360 -32.777 1.00 68.72  ? 372 ASP A CG   1 
ATOM   1026 O OD1  . ASP A 1 76  ? -9.790  -0.778 -31.667 1.00 71.37  ? 372 ASP A OD1  1 
ATOM   1027 O OD2  . ASP A 1 76  ? -9.636  -0.951 -33.850 1.00 74.87  ? 372 ASP A OD2  1 
ATOM   1028 H H    . ASP A 1 76  ? -10.673 2.133  -33.190 1.00 55.21  ? 372 ASP A H    1 
ATOM   1029 H HA   . ASP A 1 76  ? -9.350  1.603  -31.041 1.00 58.55  ? 372 ASP A HA   1 
ATOM   1030 H HB2  . ASP A 1 76  ? -8.590  1.251  -33.732 1.00 71.14  ? 372 ASP A HB2  1 
ATOM   1031 H HB3  . ASP A 1 76  ? -7.686  0.725  -32.534 1.00 71.14  ? 372 ASP A HB3  1 
ATOM   1032 N N    . ASP A 1 77  ? -7.989  3.990  -32.710 1.00 40.01  ? 373 ASP A N    1 
ATOM   1033 C CA   . ASP A 1 77  ? -7.090  5.130  -32.553 1.00 36.64  ? 373 ASP A CA   1 
ATOM   1034 C C    . ASP A 1 77  ? -7.609  6.099  -31.496 1.00 35.03  ? 373 ASP A C    1 
ATOM   1035 O O    . ASP A 1 77  ? -6.826  6.660  -30.719 1.00 35.13  ? 373 ASP A O    1 
ATOM   1036 C CB   . ASP A 1 77  ? -6.908  5.851  -33.889 1.00 38.53  ? 373 ASP A CB   1 
ATOM   1037 C CG   . ASP A 1 77  ? -6.015  5.090  -34.850 1.00 41.51  ? 373 ASP A CG   1 
ATOM   1038 O OD1  . ASP A 1 77  ? -5.354  4.122  -34.418 1.00 41.66  ? 373 ASP A OD1  1 
ATOM   1039 O OD2  . ASP A 1 77  ? -5.964  5.472  -36.039 1.00 45.07  ? 373 ASP A OD2  1 
ATOM   1040 H H    . ASP A 1 77  ? -8.362  3.928  -33.482 1.00 48.01  ? 373 ASP A H    1 
ATOM   1041 H HA   . ASP A 1 77  ? -6.221  4.809  -32.264 1.00 43.97  ? 373 ASP A HA   1 
ATOM   1042 H HB2  . ASP A 1 77  ? -7.775  5.961  -34.309 1.00 46.24  ? 373 ASP A HB2  1 
ATOM   1043 H HB3  . ASP A 1 77  ? -6.505  6.718  -33.728 1.00 46.24  ? 373 ASP A HB3  1 
ATOM   1044 N N    . GLN A 1 78  ? -8.926  6.315  -31.454 1.00 36.11  ? 374 GLN A N    1 
ATOM   1045 C CA   . GLN A 1 78  ? -9.499  7.196  -30.441 1.00 34.88  ? 374 GLN A CA   1 
ATOM   1046 C C    . GLN A 1 78  ? -9.188  6.697  -29.037 1.00 33.27  ? 374 GLN A C    1 
ATOM   1047 O O    . GLN A 1 78  ? -8.896  7.494  -28.136 1.00 31.33  ? 374 GLN A O    1 
ATOM   1048 C CB   . GLN A 1 78  ? -11.011 7.310  -30.636 1.00 35.56  ? 374 GLN A CB   1 
ATOM   1049 C CG   . GLN A 1 78  ? -11.424 8.066  -31.887 1.00 34.51  ? 374 GLN A CG   1 
ATOM   1050 C CD   . GLN A 1 78  ? -12.928 8.264  -31.976 1.00 38.09  ? 374 GLN A CD   1 
ATOM   1051 O OE1  . GLN A 1 78  ? -13.702 7.509  -31.388 1.00 37.14  ? 374 GLN A OE1  1 
ATOM   1052 N NE2  . GLN A 1 78  ? -13.347 9.282  -32.713 1.00 42.78  ? 374 GLN A NE2  1 
ATOM   1053 H H    . GLN A 1 78  ? -9.499  5.967  -31.993 1.00 43.33  ? 374 GLN A H    1 
ATOM   1054 H HA   . GLN A 1 78  ? -9.116  8.082  -30.538 1.00 41.86  ? 374 GLN A HA   1 
ATOM   1055 H HB2  . GLN A 1 78  ? -11.385 6.417  -30.694 1.00 42.67  ? 374 GLN A HB2  1 
ATOM   1056 H HB3  . GLN A 1 78  ? -11.388 7.774  -29.873 1.00 42.67  ? 374 GLN A HB3  1 
ATOM   1057 H HG2  . GLN A 1 78  ? -11.005 8.941  -31.881 1.00 41.42  ? 374 GLN A HG2  1 
ATOM   1058 H HG3  . GLN A 1 78  ? -11.139 7.566  -32.668 1.00 41.42  ? 374 GLN A HG3  1 
ATOM   1059 H HE21 . GLN A 1 78  ? -12.776 9.789  -33.110 1.00 51.34  ? 374 GLN A HE21 1 
ATOM   1060 H HE22 . GLN A 1 78  ? -14.189 9.436  -32.795 1.00 51.34  ? 374 GLN A HE22 1 
ATOM   1061 N N    . MET A 1 79  ? -9.246  5.380  -28.830 1.00 35.15  ? 375 MET A N    1 
ATOM   1062 C CA   . MET A 1 79  ? -8.958  4.824  -27.513 1.00 37.29  ? 375 MET A CA   1 
ATOM   1063 C C    . MET A 1 79  ? -7.503  5.046  -27.116 1.00 37.59  ? 375 MET A C    1 
ATOM   1064 O O    . MET A 1 79  ? -7.221  5.420  -25.972 1.00 36.57  ? 375 MET A O    1 
ATOM   1065 C CB   . MET A 1 79  ? -9.290  3.332  -27.482 1.00 43.60  ? 375 MET A CB   1 
ATOM   1066 C CG   . MET A 1 79  ? -10.776 3.017  -27.495 1.00 48.09  ? 375 MET A CG   1 
ATOM   1067 S SD   . MET A 1 79  ? -11.113 1.257  -27.254 1.00 49.10  ? 375 MET A SD   1 
ATOM   1068 C CE   . MET A 1 79  ? -10.606 1.030  -25.552 1.00 46.14  ? 375 MET A CE   1 
ATOM   1069 H H    . MET A 1 79  ? -9.446  4.796  -29.429 1.00 42.19  ? 375 MET A H    1 
ATOM   1070 H HA   . MET A 1 79  ? -9.526  5.264  -26.861 1.00 44.75  ? 375 MET A HA   1 
ATOM   1071 H HB2  . MET A 1 79  ? -8.893  2.910  -28.260 1.00 52.32  ? 375 MET A HB2  1 
ATOM   1072 H HB3  . MET A 1 79  ? -8.914  2.947  -26.675 1.00 52.32  ? 375 MET A HB3  1 
ATOM   1073 H HG2  . MET A 1 79  ? -11.209 3.507  -26.778 1.00 57.71  ? 375 MET A HG2  1 
ATOM   1074 H HG3  . MET A 1 79  ? -11.148 3.281  -28.351 1.00 57.71  ? 375 MET A HG3  1 
ATOM   1075 H HE1  . MET A 1 79  ? -10.744 0.103  -25.303 1.00 55.37  ? 375 MET A HE1  1 
ATOM   1076 H HE2  . MET A 1 79  ? -9.667  1.259  -25.469 1.00 55.37  ? 375 MET A HE2  1 
ATOM   1077 H HE3  . MET A 1 79  ? -11.139 1.608  -24.984 1.00 55.37  ? 375 MET A HE3  1 
ATOM   1078 N N    . LYS A 1 80  ? -6.562  4.811  -28.039 1.00 36.21  ? 376 LYS A N    1 
ATOM   1079 C CA   . LYS A 1 80  ? -5.147  4.960  -27.703 1.00 38.46  ? 376 LYS A CA   1 
ATOM   1080 C C    . LYS A 1 80  ? -4.846  6.382  -27.255 1.00 34.30  ? 376 LYS A C    1 
ATOM   1081 O O    . LYS A 1 80  ? -4.195  6.597  -26.228 1.00 36.81  ? 376 LYS A O    1 
ATOM   1082 C CB   . LYS A 1 80  ? -4.254  4.602  -28.894 1.00 44.15  ? 376 LYS A CB   1 
ATOM   1083 C CG   . LYS A 1 80  ? -4.656  3.382  -29.692 1.00 53.31  ? 376 LYS A CG   1 
ATOM   1084 C CD   . LYS A 1 80  ? -4.975  2.183  -28.818 1.00 61.51  ? 376 LYS A CD   1 
ATOM   1085 C CE   . LYS A 1 80  ? -5.300  0.968  -29.672 1.00 68.26  ? 376 LYS A CE   1 
ATOM   1086 N NZ   . LYS A 1 80  ? -6.505  0.240  -29.181 1.00 70.09  ? 376 LYS A NZ   1 
ATOM   1087 H H    . LYS A 1 80  ? -6.715  4.568  -28.849 1.00 43.45  ? 376 LYS A H    1 
ATOM   1088 H HA   . LYS A 1 80  ? -4.929  4.361  -26.972 1.00 46.15  ? 376 LYS A HA   1 
ATOM   1089 H HB2  . LYS A 1 80  ? -4.246  5.356  -29.505 1.00 52.99  ? 376 LYS A HB2  1 
ATOM   1090 H HB3  . LYS A 1 80  ? -3.356  4.447  -28.564 1.00 52.99  ? 376 LYS A HB3  1 
ATOM   1091 H HG2  . LYS A 1 80  ? -5.447  3.592  -30.213 1.00 63.97  ? 376 LYS A HG2  1 
ATOM   1092 H HG3  . LYS A 1 80  ? -3.926  3.137  -30.282 1.00 63.97  ? 376 LYS A HG3  1 
ATOM   1093 H HD2  . LYS A 1 80  ? -4.206  1.972  -28.265 1.00 73.81  ? 376 LYS A HD2  1 
ATOM   1094 H HD3  . LYS A 1 80  ? -5.745  2.383  -28.263 1.00 73.81  ? 376 LYS A HD3  1 
ATOM   1095 H HE2  . LYS A 1 80  ? -5.472  1.256  -30.582 1.00 81.91  ? 376 LYS A HE2  1 
ATOM   1096 H HE3  . LYS A 1 80  ? -4.549  0.355  -29.653 1.00 81.91  ? 376 LYS A HE3  1 
ATOM   1097 H HZ1  . LYS A 1 80  ? -6.668  -0.463 -29.701 1.00 84.11  ? 376 LYS A HZ1  1 
ATOM   1098 H HZ2  . LYS A 1 80  ? -6.371  -0.041 -28.348 1.00 84.11  ? 376 LYS A HZ2  1 
ATOM   1099 H HZ3  . LYS A 1 80  ? -7.212  0.780  -29.194 1.00 84.11  ? 376 LYS A HZ3  1 
ATOM   1100 N N    . LEU A 1 81  ? -5.300  7.370  -28.029 1.00 33.60  ? 377 LEU A N    1 
ATOM   1101 C CA   . LEU A 1 81  ? -5.010  8.758  -27.695 1.00 31.83  ? 377 LEU A CA   1 
ATOM   1102 C C    . LEU A 1 81  ? -5.569  9.114  -26.325 1.00 29.86  ? 377 LEU A C    1 
ATOM   1103 O O    . LEU A 1 81  ? -4.872  9.705  -25.493 1.00 33.64  ? 377 LEU A O    1 
ATOM   1104 C CB   . LEU A 1 81  ? -5.573  9.689  -28.770 1.00 32.04  ? 377 LEU A CB   1 
ATOM   1105 C CG   . LEU A 1 81  ? -4.971  9.574  -30.176 1.00 34.88  ? 377 LEU A CG   1 
ATOM   1106 C CD1  . LEU A 1 81  ? -5.621  10.589 -31.101 1.00 37.08  ? 377 LEU A CD1  1 
ATOM   1107 C CD2  . LEU A 1 81  ? -3.456  9.761  -30.164 1.00 33.90  ? 377 LEU A CD2  1 
ATOM   1108 H H    . LEU A 1 81  ? -5.771  7.262  -28.741 1.00 40.32  ? 377 LEU A H    1 
ATOM   1109 H HA   . LEU A 1 81  ? -4.048  8.882  -27.667 1.00 38.20  ? 377 LEU A HA   1 
ATOM   1110 H HB2  . LEU A 1 81  ? -6.524  9.514  -28.852 1.00 38.45  ? 377 LEU A HB2  1 
ATOM   1111 H HB3  . LEU A 1 81  ? -5.441  10.604 -28.477 1.00 38.45  ? 377 LEU A HB3  1 
ATOM   1112 H HG   . LEU A 1 81  ? -5.159  8.690  -30.526 1.00 41.85  ? 377 LEU A HG   1 
ATOM   1113 H HD11 . LEU A 1 81  ? -5.231  10.505 -31.985 1.00 44.50  ? 377 LEU A HD11 1 
ATOM   1114 H HD12 . LEU A 1 81  ? -6.574  10.414 -31.142 1.00 44.50  ? 377 LEU A HD12 1 
ATOM   1115 H HD13 . LEU A 1 81  ? -5.463  11.480 -30.753 1.00 44.50  ? 377 LEU A HD13 1 
ATOM   1116 H HD21 . LEU A 1 81  ? -3.122  9.680  -31.071 1.00 40.68  ? 377 LEU A HD21 1 
ATOM   1117 H HD22 . LEU A 1 81  ? -3.249  10.640 -29.812 1.00 40.68  ? 377 LEU A HD22 1 
ATOM   1118 H HD23 . LEU A 1 81  ? -3.059  9.077  -29.603 1.00 40.68  ? 377 LEU A HD23 1 
ATOM   1119 N N    . LEU A 1 82  ? -6.827  8.748  -26.065 1.00 32.32  ? 378 LEU A N    1 
ATOM   1120 C CA   . LEU A 1 82  ? -7.449  9.094  -24.791 1.00 28.66  ? 378 LEU A CA   1 
ATOM   1121 C C    . LEU A 1 82  ? -6.802  8.342  -23.636 1.00 33.91  ? 378 LEU A C    1 
ATOM   1122 O O    . LEU A 1 82  ? -6.615  8.903  -22.549 1.00 33.04  ? 378 LEU A O    1 
ATOM   1123 C CB   . LEU A 1 82  ? -8.951  8.811  -24.845 1.00 32.00  ? 378 LEU A CB   1 
ATOM   1124 C CG   . LEU A 1 82  ? -9.790  9.853  -25.587 1.00 31.74  ? 378 LEU A CG   1 
ATOM   1125 C CD1  . LEU A 1 82  ? -11.203 9.341  -25.821 1.00 33.66  ? 378 LEU A CD1  1 
ATOM   1126 C CD2  . LEU A 1 82  ? -9.825  11.166 -24.812 1.00 31.55  ? 378 LEU A CD2  1 
ATOM   1127 H H    . LEU A 1 82  ? -7.333  8.305  -26.603 1.00 38.79  ? 378 LEU A H    1 
ATOM   1128 H HA   . LEU A 1 82  ? -7.331  10.044 -24.632 1.00 34.39  ? 378 LEU A HA   1 
ATOM   1129 H HB2  . LEU A 1 82  ? -9.087  7.959  -25.289 1.00 38.40  ? 378 LEU A HB2  1 
ATOM   1130 H HB3  . LEU A 1 82  ? -9.287  8.760  -23.937 1.00 38.40  ? 378 LEU A HB3  1 
ATOM   1131 H HG   . LEU A 1 82  ? -9.386  10.026 -26.452 1.00 38.09  ? 378 LEU A HG   1 
ATOM   1132 H HD11 . LEU A 1 82  ? -11.710 10.020 -26.292 1.00 40.39  ? 378 LEU A HD11 1 
ATOM   1133 H HD12 . LEU A 1 82  ? -11.160 8.531  -26.353 1.00 40.39  ? 378 LEU A HD12 1 
ATOM   1134 H HD13 . LEU A 1 82  ? -11.616 9.153  -24.964 1.00 40.39  ? 378 LEU A HD13 1 
ATOM   1135 H HD21 . LEU A 1 82  ? -10.362 11.808 -25.304 1.00 37.86  ? 378 LEU A HD21 1 
ATOM   1136 H HD22 . LEU A 1 82  ? -10.217 11.007 -23.939 1.00 37.86  ? 378 LEU A HD22 1 
ATOM   1137 H HD23 . LEU A 1 82  ? -8.920  11.499 -24.713 1.00 37.86  ? 378 LEU A HD23 1 
ATOM   1138 N N    . GLN A 1 83  ? -6.455  7.072  -23.845 1.00 35.70  ? 379 GLN A N    1 
ATOM   1139 C CA   . GLN A 1 83  ? -5.770  6.322  -22.799 1.00 35.85  ? 379 GLN A CA   1 
ATOM   1140 C C    . GLN A 1 83  ? -4.406  6.921  -22.489 1.00 34.33  ? 379 GLN A C    1 
ATOM   1141 O O    . GLN A 1 83  ? -3.902  6.769  -21.371 1.00 35.37  ? 379 GLN A O    1 
ATOM   1142 C CB   . GLN A 1 83  ? -5.622  4.860  -23.215 1.00 38.60  ? 379 GLN A CB   1 
ATOM   1143 C CG   . GLN A 1 83  ? -6.927  4.081  -23.224 1.00 42.54  ? 379 GLN A CG   1 
ATOM   1144 C CD   . GLN A 1 83  ? -6.782  2.700  -23.836 1.00 48.11  ? 379 GLN A CD   1 
ATOM   1145 O OE1  . GLN A 1 83  ? -5.827  2.426  -24.564 1.00 50.07  ? 379 GLN A OE1  1 
ATOM   1146 N NE2  . GLN A 1 83  ? -7.730  1.819  -23.538 1.00 51.66  ? 379 GLN A NE2  1 
ATOM   1147 H H    . GLN A 1 83  ? -6.602  6.632  -24.569 1.00 42.84  ? 379 GLN A H    1 
ATOM   1148 H HA   . GLN A 1 83  ? -6.303  6.352  -21.989 1.00 43.02  ? 379 GLN A HA   1 
ATOM   1149 H HB2  . GLN A 1 83  ? -5.252  4.826  -24.111 1.00 46.32  ? 379 GLN A HB2  1 
ATOM   1150 H HB3  . GLN A 1 83  ? -5.020  4.419  -22.595 1.00 46.32  ? 379 GLN A HB3  1 
ATOM   1151 H HG2  . GLN A 1 83  ? -7.238  3.974  -22.311 1.00 51.05  ? 379 GLN A HG2  1 
ATOM   1152 H HG3  . GLN A 1 83  ? -7.584  4.571  -23.743 1.00 51.05  ? 379 GLN A HG3  1 
ATOM   1153 H HE21 . GLN A 1 83  ? -8.381  2.046  -23.023 1.00 61.99  ? 379 GLN A HE21 1 
ATOM   1154 H HE22 . GLN A 1 83  ? -7.694  1.023  -23.859 1.00 61.99  ? 379 GLN A HE22 1 
ATOM   1155 N N    . ASN A 1 84  ? -3.800  7.608  -23.457 1.00 37.13  ? 380 ASN A N    1 
ATOM   1156 C CA   . ASN A 1 84  ? -2.456  8.142  -23.290 1.00 35.34  ? 380 ASN A CA   1 
ATOM   1157 C C    . ASN A 1 84  ? -2.422  9.488  -22.575 1.00 37.72  ? 380 ASN A C    1 
ATOM   1158 O O    . ASN A 1 84  ? -1.379  9.844  -22.014 1.00 40.53  ? 380 ASN A O    1 
ATOM   1159 C CB   . ASN A 1 84  ? -1.786  8.287  -24.659 1.00 36.53  ? 380 ASN A CB   1 
ATOM   1160 C CG   . ASN A 1 84  ? -0.441  8.984  -24.582 1.00 41.02  ? 380 ASN A CG   1 
ATOM   1161 O OD1  . ASN A 1 84  ? 0.558   8.387  -24.180 1.00 43.47  ? 380 ASN A OD1  1 
ATOM   1162 N ND2  . ASN A 1 84  ? -0.406  10.253 -24.978 1.00 41.83  ? 380 ASN A ND2  1 
ATOM   1163 H H    . ASN A 1 84  ? -4.151  7.777  -24.224 1.00 44.55  ? 380 ASN A H    1 
ATOM   1164 H HA   . ASN A 1 84  ? -1.932  7.515  -22.768 1.00 42.41  ? 380 ASN A HA   1 
ATOM   1165 H HB2  . ASN A 1 84  ? -1.646  7.405  -25.038 1.00 43.84  ? 380 ASN A HB2  1 
ATOM   1166 H HB3  . ASN A 1 84  ? -2.362  8.810  -25.239 1.00 43.84  ? 380 ASN A HB3  1 
ATOM   1167 H HD21 . ASN A 1 84  ? 0.333   10.691 -24.954 1.00 50.20  ? 380 ASN A HD21 1 
ATOM   1168 H HD22 . ASN A 1 84  ? -1.124  10.635 -25.259 1.00 50.20  ? 380 ASN A HD22 1 
ATOM   1169 N N    . CYS A 1 85  ? -3.523  10.245 -22.578 1.00 35.05  ? 381 CYS A N    1 
ATOM   1170 C CA   . CYS A 1 85  ? -3.490  11.632 -22.129 1.00 35.42  ? 381 CYS A CA   1 
ATOM   1171 C C    . CYS A 1 85  ? -4.598  11.996 -21.147 1.00 33.37  ? 381 CYS A C    1 
ATOM   1172 O O    . CYS A 1 85  ? -4.706  13.170 -20.775 1.00 33.13  ? 381 CYS A O    1 
ATOM   1173 C CB   . CYS A 1 85  ? -3.572  12.572 -23.337 1.00 32.80  ? 381 CYS A CB   1 
ATOM   1174 S SG   . CYS A 1 85  ? -5.239  12.717 -24.052 1.00 38.25  ? 381 CYS A SG   1 
ATOM   1175 H H    . CYS A 1 85  ? -4.298  9.976  -22.836 1.00 42.06  ? 381 CYS A H    1 
ATOM   1176 H HA   . CYS A 1 85  ? -2.641  11.793 -21.687 1.00 42.51  ? 381 CYS A HA   1 
ATOM   1177 H HB2  . CYS A 1 85  ? -3.291  13.459 -23.061 1.00 39.36  ? 381 CYS A HB2  1 
ATOM   1178 H HB3  . CYS A 1 85  ? -2.981  12.241 -24.031 1.00 39.36  ? 381 CYS A HB3  1 
ATOM   1179 H HG   . CYS A 1 85  ? -5.603  11.633 -24.416 1.00 45.90  ? 381 CYS A HG   1 
ATOM   1180 N N    . TRP A 1 86  ? -5.419  11.037 -20.712 1.00 34.00  ? 382 TRP A N    1 
ATOM   1181 C CA   . TRP A 1 86  ? -6.591  11.384 -19.911 1.00 30.82  ? 382 TRP A CA   1 
ATOM   1182 C C    . TRP A 1 86  ? -6.203  12.147 -18.647 1.00 27.88  ? 382 TRP A C    1 
ATOM   1183 O O    . TRP A 1 86  ? -6.837  13.150 -18.302 1.00 32.74  ? 382 TRP A O    1 
ATOM   1184 C CB   . TRP A 1 86  ? -7.384  10.124 -19.557 1.00 31.12  ? 382 TRP A CB   1 
ATOM   1185 C CG   . TRP A 1 86  ? -6.652  9.164  -18.671 1.00 32.27  ? 382 TRP A CG   1 
ATOM   1186 C CD1  . TRP A 1 86  ? -5.811  8.165  -19.063 1.00 35.72  ? 382 TRP A CD1  1 
ATOM   1187 C CD2  . TRP A 1 86  ? -6.697  9.110  -17.238 1.00 34.65  ? 382 TRP A CD2  1 
ATOM   1188 N NE1  . TRP A 1 86  ? -5.326  7.494  -17.965 1.00 35.42  ? 382 TRP A NE1  1 
ATOM   1189 C CE2  . TRP A 1 86  ? -5.858  8.054  -16.833 1.00 33.78  ? 382 TRP A CE2  1 
ATOM   1190 C CE3  . TRP A 1 86  ? -7.362  9.855  -16.259 1.00 32.45  ? 382 TRP A CE3  1 
ATOM   1191 C CZ2  . TRP A 1 86  ? -5.666  7.723  -15.491 1.00 36.29  ? 382 TRP A CZ2  1 
ATOM   1192 C CZ3  . TRP A 1 86  ? -7.172  9.524  -14.929 1.00 32.63  ? 382 TRP A CZ3  1 
ATOM   1193 C CH2  . TRP A 1 86  ? -6.330  8.469  -14.558 1.00 34.92  ? 382 TRP A CH2  1 
ATOM   1194 H H    . TRP A 1 86  ? -5.323  10.196 -20.864 1.00 40.80  ? 382 TRP A H    1 
ATOM   1195 H HA   . TRP A 1 86  ? -7.169  11.959 -20.437 1.00 36.98  ? 382 TRP A HA   1 
ATOM   1196 H HB2  . TRP A 1 86  ? -8.198  10.387 -19.099 1.00 37.34  ? 382 TRP A HB2  1 
ATOM   1197 H HB3  . TRP A 1 86  ? -7.607  9.656  -20.377 1.00 37.34  ? 382 TRP A HB3  1 
ATOM   1198 H HD1  . TRP A 1 86  ? -5.596  7.966  -19.946 1.00 42.87  ? 382 TRP A HD1  1 
ATOM   1199 H HE1  . TRP A 1 86  ? -4.783  6.828  -17.985 1.00 42.50  ? 382 TRP A HE1  1 
ATOM   1200 H HE3  . TRP A 1 86  ? -7.923  10.557 -16.498 1.00 38.94  ? 382 TRP A HE3  1 
ATOM   1201 H HZ2  . TRP A 1 86  ? -5.108  7.023  -15.241 1.00 43.55  ? 382 TRP A HZ2  1 
ATOM   1202 H HZ3  . TRP A 1 86  ? -7.611  10.012 -14.270 1.00 39.15  ? 382 TRP A HZ3  1 
ATOM   1203 H HH2  . TRP A 1 86  ? -6.223  8.270  -13.656 1.00 41.90  ? 382 TRP A HH2  1 
ATOM   1204 N N    . SER A 1 87  ? -5.156  11.703 -17.950 1.00 35.71  ? 383 SER A N    1 
ATOM   1205 C CA   . SER A 1 87  ? -4.761  12.386 -16.723 1.00 30.44  ? 383 SER A CA   1 
ATOM   1206 C C    . SER A 1 87  ? -4.123  13.738 -17.019 1.00 32.52  ? 383 SER A C    1 
ATOM   1207 O O    . SER A 1 87  ? -4.310  14.691 -16.253 1.00 30.71  ? 383 SER A O    1 
ATOM   1208 C CB   . SER A 1 87  ? -3.813  11.506 -15.910 1.00 37.13  ? 383 SER A CB   1 
ATOM   1209 O OG   . SER A 1 87  ? -2.631  11.199 -16.630 1.00 36.62  ? 383 SER A OG   1 
ATOM   1210 H H    . SER A 1 87  ? -4.671  11.025 -18.160 1.00 42.85  ? 383 SER A H    1 
ATOM   1211 H HA   . SER A 1 87  ? -5.553  12.544 -16.185 1.00 36.53  ? 383 SER A HA   1 
ATOM   1212 H HB2  . SER A 1 87  ? -3.571  11.976 -15.096 1.00 44.56  ? 383 SER A HB2  1 
ATOM   1213 H HB3  . SER A 1 87  ? -4.268  10.678 -15.688 1.00 44.56  ? 383 SER A HB3  1 
ATOM   1214 H HG   . SER A 1 87  ? -2.128  10.716 -16.163 1.00 43.94  ? 383 SER A HG   1 
ATOM   1215 N N    . GLU A 1 88  ? -3.384  13.850 -18.124 1.00 30.03  ? 384 GLU A N    1 
ATOM   1216 C CA   . GLU A 1 88  ? -2.816  15.141 -18.494 1.00 28.43  ? 384 GLU A CA   1 
ATOM   1217 C C    . GLU A 1 88  ? -3.916  16.150 -18.808 1.00 31.92  ? 384 GLU A C    1 
ATOM   1218 O O    . GLU A 1 88  ? -3.834  17.316 -18.401 1.00 31.56  ? 384 GLU A O    1 
ATOM   1219 C CB   . GLU A 1 88  ? -1.865  14.970 -19.681 1.00 33.40  ? 384 GLU A CB   1 
ATOM   1220 C CG   . GLU A 1 88  ? -0.946  16.156 -19.921 1.00 39.64  ? 384 GLU A CG   1 
ATOM   1221 C CD   . GLU A 1 88  ? 0.110   15.881 -20.979 1.00 44.88  ? 384 GLU A CD   1 
ATOM   1222 O OE1  . GLU A 1 88  ? 0.168   14.741 -21.494 1.00 48.04  ? 384 GLU A OE1  1 
ATOM   1223 O OE2  . GLU A 1 88  ? 0.884   16.809 -21.294 1.00 41.47  ? 384 GLU A OE2  1 
ATOM   1224 H H    . GLU A 1 88  ? -3.202  13.207 -18.665 1.00 36.04  ? 384 GLU A H    1 
ATOM   1225 H HA   . GLU A 1 88  ? -2.301  15.484 -17.746 1.00 34.11  ? 384 GLU A HA   1 
ATOM   1226 H HB2  . GLU A 1 88  ? -1.308  14.192 -19.524 1.00 40.07  ? 384 GLU A HB2  1 
ATOM   1227 H HB3  . GLU A 1 88  ? -2.392  14.838 -20.485 1.00 40.07  ? 384 GLU A HB3  1 
ATOM   1228 H HG2  . GLU A 1 88  ? -1.477  16.912 -20.216 1.00 47.57  ? 384 GLU A HG2  1 
ATOM   1229 H HG3  . GLU A 1 88  ? -0.490  16.374 -19.092 1.00 47.57  ? 384 GLU A HG3  1 
ATOM   1230 N N    . LEU A 1 89  ? -4.967  15.718 -19.513 1.00 29.12  ? 385 LEU A N    1 
ATOM   1231 C CA   . LEU A 1 89  ? -6.094  16.609 -19.775 1.00 32.80  ? 385 LEU A CA   1 
ATOM   1232 C C    . LEU A 1 89  ? -6.800  16.995 -18.482 1.00 29.80  ? 385 LEU A C    1 
ATOM   1233 O O    . LEU A 1 89  ? -7.260  18.133 -18.331 1.00 29.95  ? 385 LEU A O    1 
ATOM   1234 C CB   . LEU A 1 89  ? -7.082  15.946 -20.740 1.00 28.21  ? 385 LEU A CB   1 
ATOM   1235 C CG   . LEU A 1 89  ? -6.630  15.735 -22.191 1.00 31.45  ? 385 LEU A CG   1 
ATOM   1236 C CD1  . LEU A 1 89  ? -7.699  14.978 -22.970 1.00 27.53  ? 385 LEU A CD1  1 
ATOM   1237 C CD2  . LEU A 1 89  ? -6.319  17.060 -22.876 1.00 28.21  ? 385 LEU A CD2  1 
ATOM   1238 H H    . LEU A 1 89  ? -5.048  14.929 -19.844 1.00 34.94  ? 385 LEU A H    1 
ATOM   1239 H HA   . LEU A 1 89  ? -5.766  17.420 -20.192 1.00 39.36  ? 385 LEU A HA   1 
ATOM   1240 H HB2  . LEU A 1 89  ? -7.307  15.072 -20.384 1.00 33.85  ? 385 LEU A HB2  1 
ATOM   1241 H HB3  . LEU A 1 89  ? -7.883  16.492 -20.770 1.00 33.85  ? 385 LEU A HB3  1 
ATOM   1242 H HG   . LEU A 1 89  ? -5.821  15.199 -22.194 1.00 37.74  ? 385 LEU A HG   1 
ATOM   1243 H HD11 . LEU A 1 89  ? -7.395  14.855 -23.883 1.00 33.03  ? 385 LEU A HD11 1 
ATOM   1244 H HD12 . LEU A 1 89  ? -7.844  14.116 -22.550 1.00 33.03  ? 385 LEU A HD12 1 
ATOM   1245 H HD13 . LEU A 1 89  ? -8.520  15.494 -22.961 1.00 33.03  ? 385 LEU A HD13 1 
ATOM   1246 H HD21 . LEU A 1 89  ? -6.038  16.885 -23.787 1.00 33.85  ? 385 LEU A HD21 1 
ATOM   1247 H HD22 . LEU A 1 89  ? -7.118  17.610 -22.875 1.00 33.85  ? 385 LEU A HD22 1 
ATOM   1248 H HD23 . LEU A 1 89  ? -5.609  17.507 -22.390 1.00 33.85  ? 385 LEU A HD23 1 
ATOM   1249 N N    . LEU A 1 90  ? -6.898  16.059 -17.538 1.00 32.49  ? 386 LEU A N    1 
ATOM   1250 C CA   . LEU A 1 90  ? -7.533  16.354 -16.262 1.00 30.09  ? 386 LEU A CA   1 
ATOM   1251 C C    . LEU A 1 90  ? -6.770  17.443 -15.511 1.00 33.43  ? 386 LEU A C    1 
ATOM   1252 O O    . LEU A 1 90  ? -7.375  18.384 -14.982 1.00 31.84  ? 386 LEU A O    1 
ATOM   1253 C CB   . LEU A 1 90  ? -7.618  15.068 -15.440 1.00 36.38  ? 386 LEU A CB   1 
ATOM   1254 C CG   . LEU A 1 90  ? -8.656  14.941 -14.336 1.00 41.70  ? 386 LEU A CG   1 
ATOM   1255 C CD1  . LEU A 1 90  ? -10.075 14.972 -14.884 1.00 39.47  ? 386 LEU A CD1  1 
ATOM   1256 C CD2  . LEU A 1 90  ? -8.401  13.647 -13.575 1.00 45.16  ? 386 LEU A CD2  1 
ATOM   1257 H H    . LEU A 1 90  ? -6.607  15.253 -17.614 1.00 38.99  ? 386 LEU A H    1 
ATOM   1258 H HA   . LEU A 1 90  ? -8.435  16.673 -16.421 1.00 36.11  ? 386 LEU A HA   1 
ATOM   1259 H HB2  . LEU A 1 90  ? -7.783  14.339 -16.058 1.00 43.65  ? 386 LEU A HB2  1 
ATOM   1260 H HB3  . LEU A 1 90  ? -6.754  14.932 -15.022 1.00 43.65  ? 386 LEU A HB3  1 
ATOM   1261 H HG   . LEU A 1 90  ? -8.554  15.681 -13.717 1.00 50.04  ? 386 LEU A HG   1 
ATOM   1262 H HD11 . LEU A 1 90  ? -10.699 14.888 -14.146 1.00 47.36  ? 386 LEU A HD11 1 
ATOM   1263 H HD12 . LEU A 1 90  ? -10.217 15.814 -15.344 1.00 47.36  ? 386 LEU A HD12 1 
ATOM   1264 H HD13 . LEU A 1 90  ? -10.190 14.233 -15.501 1.00 47.36  ? 386 LEU A HD13 1 
ATOM   1265 H HD21 . LEU A 1 90  ? -9.061  13.561 -12.869 1.00 54.19  ? 386 LEU A HD21 1 
ATOM   1266 H HD22 . LEU A 1 90  ? -8.474  12.900 -14.190 1.00 54.19  ? 386 LEU A HD22 1 
ATOM   1267 H HD23 . LEU A 1 90  ? -7.509  13.676 -13.194 1.00 54.19  ? 386 LEU A HD23 1 
ATOM   1268 N N    . ILE A 1 91  ? -5.438  17.343 -15.478 1.00 28.23  ? 387 ILE A N    1 
ATOM   1269 C CA   . ILE A 1 91  ? -4.618  18.326 -14.772 1.00 32.37  ? 387 ILE A CA   1 
ATOM   1270 C C    . ILE A 1 91  ? -4.592  19.649 -15.526 1.00 30.42  ? 387 ILE A C    1 
ATOM   1271 O O    . ILE A 1 91  ? -4.649  20.725 -14.920 1.00 31.29  ? 387 ILE A O    1 
ATOM   1272 C CB   . ILE A 1 91  ? -3.194  17.778 -14.561 1.00 32.02  ? 387 ILE A CB   1 
ATOM   1273 C CG1  . ILE A 1 91  ? -3.225  16.464 -13.773 1.00 35.80  ? 387 ILE A CG1  1 
ATOM   1274 C CG2  . ILE A 1 91  ? -2.315  18.808 -13.860 1.00 33.27  ? 387 ILE A CG2  1 
ATOM   1275 C CD1  . ILE A 1 91  ? -3.863  16.560 -12.410 1.00 39.93  ? 387 ILE A CD1  1 
ATOM   1276 H H    . ILE A 1 91  ? -4.988  16.715 -15.856 1.00 33.88  ? 387 ILE A H    1 
ATOM   1277 H HA   . ILE A 1 91  ? -5.007  18.489 -13.898 1.00 38.84  ? 387 ILE A HA   1 
ATOM   1278 H HB   . ILE A 1 91  ? -2.809  17.597 -15.433 1.00 38.43  ? 387 ILE A HB   1 
ATOM   1279 H HG12 . ILE A 1 91  ? -3.724  15.808 -14.285 1.00 42.96  ? 387 ILE A HG12 1 
ATOM   1280 H HG13 . ILE A 1 91  ? -2.313  16.156 -13.649 1.00 42.96  ? 387 ILE A HG13 1 
ATOM   1281 H HG21 . ILE A 1 91  ? -1.427  18.436 -13.741 1.00 39.92  ? 387 ILE A HG21 1 
ATOM   1282 H HG22 . ILE A 1 91  ? -2.268  19.608 -14.407 1.00 39.92  ? 387 ILE A HG22 1 
ATOM   1283 H HG23 . ILE A 1 91  ? -2.704  19.020 -12.996 1.00 39.92  ? 387 ILE A HG23 1 
ATOM   1284 H HD11 . ILE A 1 91  ? -3.838  15.688 -11.988 1.00 47.91  ? 387 ILE A HD11 1 
ATOM   1285 H HD12 . ILE A 1 91  ? -3.369  17.202 -11.876 1.00 47.91  ? 387 ILE A HD12 1 
ATOM   1286 H HD13 . ILE A 1 91  ? -4.783  16.853 -12.513 1.00 47.91  ? 387 ILE A HD13 1 
ATOM   1287 N N    . LEU A 1 92  ? -4.472  19.599 -16.854 1.00 30.36  ? 388 LEU A N    1 
ATOM   1288 C CA   . LEU A 1 92  ? -4.492  20.832 -17.634 1.00 29.77  ? 388 LEU A CA   1 
ATOM   1289 C C    . LEU A 1 92  ? -5.799  21.585 -17.427 1.00 31.27  ? 388 LEU A C    1 
ATOM   1290 O O    . LEU A 1 92  ? -5.796  22.806 -17.226 1.00 30.01  ? 388 LEU A O    1 
ATOM   1291 C CB   . LEU A 1 92  ? -4.277  20.517 -19.115 1.00 28.54  ? 388 LEU A CB   1 
ATOM   1292 C CG   . LEU A 1 92  ? -4.368  21.686 -20.102 1.00 27.40  ? 388 LEU A CG   1 
ATOM   1293 C CD1  . LEU A 1 92  ? -3.377  22.784 -19.748 1.00 30.42  ? 388 LEU A CD1  1 
ATOM   1294 C CD2  . LEU A 1 92  ? -4.124  21.201 -21.520 1.00 27.02  ? 388 LEU A CD2  1 
ATOM   1295 H H    . LEU A 1 92  ? -4.381  18.879 -17.316 1.00 36.44  ? 388 LEU A H    1 
ATOM   1296 H HA   . LEU A 1 92  ? -3.766  21.403 -17.340 1.00 35.72  ? 388 LEU A HA   1 
ATOM   1297 H HB2  . LEU A 1 92  ? -3.393  20.129 -19.215 1.00 34.25  ? 388 LEU A HB2  1 
ATOM   1298 H HB3  . LEU A 1 92  ? -4.943  19.865 -19.384 1.00 34.25  ? 388 LEU A HB3  1 
ATOM   1299 H HG   . LEU A 1 92  ? -5.261  22.064 -20.064 1.00 32.88  ? 388 LEU A HG   1 
ATOM   1300 H HD11 . LEU A 1 92  ? -3.462  23.506 -20.391 1.00 36.50  ? 388 LEU A HD11 1 
ATOM   1301 H HD12 . LEU A 1 92  ? -3.573  23.111 -18.856 1.00 36.50  ? 388 LEU A HD12 1 
ATOM   1302 H HD13 . LEU A 1 92  ? -2.479  22.419 -19.777 1.00 36.50  ? 388 LEU A HD13 1 
ATOM   1303 H HD21 . LEU A 1 92  ? -4.186  21.956 -22.126 1.00 32.42  ? 388 LEU A HD21 1 
ATOM   1304 H HD22 . LEU A 1 92  ? -3.238  20.808 -21.570 1.00 32.42  ? 388 LEU A HD22 1 
ATOM   1305 H HD23 . LEU A 1 92  ? -4.794  20.538 -21.747 1.00 32.42  ? 388 LEU A HD23 1 
ATOM   1306 N N    . ASP A 1 93  ? -6.927  20.870 -17.468 1.00 31.45  ? 389 ASP A N    1 
ATOM   1307 C CA   . ASP A 1 93  ? -8.220  21.494 -17.213 1.00 32.09  ? 389 ASP A CA   1 
ATOM   1308 C C    . ASP A 1 93  ? -8.259  22.121 -15.826 1.00 28.46  ? 389 ASP A C    1 
ATOM   1309 O O    . ASP A 1 93  ? -8.734  23.251 -15.657 1.00 33.90  ? 389 ASP A O    1 
ATOM   1310 C CB   . ASP A 1 93  ? -9.327  20.450 -17.368 1.00 35.18  ? 389 ASP A CB   1 
ATOM   1311 C CG   . ASP A 1 93  ? -10.710 21.015 -17.119 1.00 40.99  ? 389 ASP A CG   1 
ATOM   1312 O OD1  . ASP A 1 93  ? -11.105 21.970 -17.823 1.00 41.40  ? 389 ASP A OD1  1 
ATOM   1313 O OD2  . ASP A 1 93  ? -11.405 20.499 -16.217 1.00 43.62  ? 389 ASP A OD2  1 
ATOM   1314 H H    . ASP A 1 93  ? -6.967  20.028 -17.640 1.00 37.74  ? 389 ASP A H    1 
ATOM   1315 H HA   . ASP A 1 93  ? -8.371  22.195 -17.867 1.00 38.51  ? 389 ASP A HA   1 
ATOM   1316 H HB2  . ASP A 1 93  ? -9.306  20.099 -18.272 1.00 42.21  ? 389 ASP A HB2  1 
ATOM   1317 H HB3  . ASP A 1 93  ? -9.177  19.734 -16.731 1.00 42.21  ? 389 ASP A HB3  1 
ATOM   1318 N N    . HIS A 1 94  ? -7.762  21.399 -14.820 1.00 32.11  ? 390 HIS A N    1 
ATOM   1319 C CA   . HIS A 1 94  ? -7.691  21.934 -13.463 1.00 28.49  ? 390 HIS A CA   1 
ATOM   1320 C C    . HIS A 1 94  ? -6.847  23.201 -13.413 1.00 32.60  ? 390 HIS A C    1 
ATOM   1321 O O    . HIS A 1 94  ? -7.242  24.204 -12.804 1.00 29.48  ? 390 HIS A O    1 
ATOM   1322 C CB   . HIS A 1 94  ? -7.115  20.872 -12.526 1.00 30.19  ? 390 HIS A CB   1 
ATOM   1323 C CG   . HIS A 1 94  ? -6.701  21.400 -11.188 1.00 27.04  ? 390 HIS A CG   1 
ATOM   1324 N ND1  . HIS A 1 94  ? -7.610  21.720 -10.203 1.00 32.60  ? 390 HIS A ND1  1 
ATOM   1325 C CD2  . HIS A 1 94  ? -5.477  21.663 -10.669 1.00 28.52  ? 390 HIS A CD2  1 
ATOM   1326 C CE1  . HIS A 1 94  ? -6.965  22.153 -9.134  1.00 29.04  ? 390 HIS A CE1  1 
ATOM   1327 N NE2  . HIS A 1 94  ? -5.669  22.128 -9.390  1.00 32.47  ? 390 HIS A NE2  1 
ATOM   1328 H H    . HIS A 1 94  ? -7.459  20.598 -14.899 1.00 38.53  ? 390 HIS A H    1 
ATOM   1329 H HA   . HIS A 1 94  ? -8.586  22.153 -13.159 1.00 34.19  ? 390 HIS A HA   1 
ATOM   1330 H HB2  . HIS A 1 94  ? -7.787  20.188 -12.379 1.00 36.23  ? 390 HIS A HB2  1 
ATOM   1331 H HB3  . HIS A 1 94  ? -6.333  20.479 -12.944 1.00 36.23  ? 390 HIS A HB3  1 
ATOM   1332 H HD1  . HIS A 1 94  ? -8.464  21.645 -10.272 1.00 39.12  ? 390 HIS A HD1  1 
ATOM   1333 H HD2  . HIS A 1 94  ? -4.659  21.546 -11.097 1.00 34.22  ? 390 HIS A HD2  1 
ATOM   1334 H HE1  . HIS A 1 94  ? -7.356  22.431 -8.338  1.00 34.85  ? 390 HIS A HE1  1 
ATOM   1335 N N    . ILE A 1 95  ? -5.678  23.172 -14.055 1.00 28.88  ? 391 ILE A N    1 
ATOM   1336 C CA   . ILE A 1 95  ? -4.769  24.317 -14.024 1.00 32.73  ? 391 ILE A CA   1 
ATOM   1337 C C    . ILE A 1 95  ? -5.417  25.530 -14.678 1.00 29.14  ? 391 ILE A C    1 
ATOM   1338 O O    . ILE A 1 95  ? -5.411  26.634 -14.122 1.00 31.09  ? 391 ILE A O    1 
ATOM   1339 C CB   . ILE A 1 95  ? -3.431  23.951 -14.694 1.00 29.11  ? 391 ILE A CB   1 
ATOM   1340 C CG1  . ILE A 1 95  ? -2.619  23.054 -13.755 1.00 30.44  ? 391 ILE A CG1  1 
ATOM   1341 C CG2  . ILE A 1 95  ? -2.634  25.203 -15.061 1.00 34.10  ? 391 ILE A CG2  1 
ATOM   1342 C CD1  . ILE A 1 95  ? -1.385  22.433 -14.385 1.00 29.76  ? 391 ILE A CD1  1 
ATOM   1343 H H    . ILE A 1 95  ? -5.389  22.504 -14.513 1.00 34.66  ? 391 ILE A H    1 
ATOM   1344 H HA   . ILE A 1 95  ? -4.585  24.544 -13.099 1.00 39.28  ? 391 ILE A HA   1 
ATOM   1345 H HB   . ILE A 1 95  ? -3.619  23.456 -15.506 1.00 34.93  ? 391 ILE A HB   1 
ATOM   1346 H HG12 . ILE A 1 95  ? -2.327  23.583 -12.996 1.00 36.52  ? 391 ILE A HG12 1 
ATOM   1347 H HG13 . ILE A 1 95  ? -3.188  22.330 -13.449 1.00 36.52  ? 391 ILE A HG13 1 
ATOM   1348 H HG21 . ILE A 1 95  ? -1.801  24.934 -15.479 1.00 40.92  ? 391 ILE A HG21 1 
ATOM   1349 H HG22 . ILE A 1 95  ? -3.156  25.740 -15.678 1.00 40.92  ? 391 ILE A HG22 1 
ATOM   1350 H HG23 . ILE A 1 95  ? -2.451  25.709 -14.254 1.00 40.92  ? 391 ILE A HG23 1 
ATOM   1351 H HD11 . ILE A 1 95  ? -0.935  21.885 -13.723 1.00 35.71  ? 391 ILE A HD11 1 
ATOM   1352 H HD12 . ILE A 1 95  ? -1.656  21.887 -15.139 1.00 35.71  ? 391 ILE A HD12 1 
ATOM   1353 H HD13 . ILE A 1 95  ? -0.794  23.142 -14.685 1.00 35.71  ? 391 ILE A HD13 1 
ATOM   1354 N N    . TYR A 1 96  ? -5.982  25.350 -15.874 1.00 32.37  ? 392 TYR A N    1 
ATOM   1355 C CA   . TYR A 1 96  ? -6.602  26.485 -16.547 1.00 31.88  ? 392 TYR A CA   1 
ATOM   1356 C C    . TYR A 1 96  ? -7.787  27.023 -15.755 1.00 30.13  ? 392 TYR A C    1 
ATOM   1357 O O    . TYR A 1 96  ? -8.041  28.232 -15.770 1.00 32.04  ? 392 TYR A O    1 
ATOM   1358 C CB   . TYR A 1 96  ? -7.046  26.103 -17.959 1.00 29.34  ? 392 TYR A CB   1 
ATOM   1359 C CG   . TYR A 1 96  ? -7.697  27.251 -18.699 1.00 33.54  ? 392 TYR A CG   1 
ATOM   1360 C CD1  . TYR A 1 96  ? -6.962  28.375 -19.054 1.00 33.86  ? 392 TYR A CD1  1 
ATOM   1361 C CD2  . TYR A 1 96  ? -9.046  27.218 -19.034 1.00 33.22  ? 392 TYR A CD2  1 
ATOM   1362 C CE1  . TYR A 1 96  ? -7.550  29.430 -19.725 1.00 33.87  ? 392 TYR A CE1  1 
ATOM   1363 C CE2  . TYR A 1 96  ? -9.639  28.266 -19.705 1.00 33.13  ? 392 TYR A CE2  1 
ATOM   1364 C CZ   . TYR A 1 96  ? -8.885  29.369 -20.049 1.00 35.66  ? 392 TYR A CZ   1 
ATOM   1365 O OH   . TYR A 1 96  ? -9.470  30.420 -20.713 1.00 40.80  ? 392 TYR A OH   1 
ATOM   1366 H H    . TYR A 1 96  ? -6.017  24.605 -16.303 1.00 38.85  ? 392 TYR A H    1 
ATOM   1367 H HA   . TYR A 1 96  ? -5.949  27.197 -16.624 1.00 38.26  ? 392 TYR A HA   1 
ATOM   1368 H HB2  . TYR A 1 96  ? -6.271  25.819 -18.468 1.00 35.21  ? 392 TYR A HB2  1 
ATOM   1369 H HB3  . TYR A 1 96  ? -7.690  25.379 -17.903 1.00 35.21  ? 392 TYR A HB3  1 
ATOM   1370 H HD1  . TYR A 1 96  ? -6.059  28.418 -18.838 1.00 40.64  ? 392 TYR A HD1  1 
ATOM   1371 H HD2  . TYR A 1 96  ? -9.556  26.475 -18.804 1.00 39.87  ? 392 TYR A HD2  1 
ATOM   1372 H HE1  . TYR A 1 96  ? -7.046  30.176 -19.958 1.00 40.64  ? 392 TYR A HE1  1 
ATOM   1373 H HE2  . TYR A 1 96  ? -10.542 28.231 -19.924 1.00 39.76  ? 392 TYR A HE2  1 
ATOM   1374 H HH   . TYR A 1 96  ? -10.283 30.257 -20.849 1.00 48.97  ? 392 TYR A HH   1 
ATOM   1375 N N    . ARG A 1 97  ? -8.520  26.148 -15.061 1.00 36.97  ? 393 ARG A N    1 
ATOM   1376 C CA   . ARG A 1 97  ? -9.635  26.603 -14.238 1.00 31.24  ? 393 ARG A CA   1 
ATOM   1377 C C    . ARG A 1 97  ? -9.159  27.558 -13.148 1.00 34.72  ? 393 ARG A C    1 
ATOM   1378 O O    . ARG A 1 97  ? -9.842  28.540 -12.831 1.00 31.17  ? 393 ARG A O    1 
ATOM   1379 C CB   . ARG A 1 97  ? -10.357 25.399 -13.630 1.00 39.45  ? 393 ARG A CB   1 
ATOM   1380 C CG   . ARG A 1 97  ? -11.560 25.757 -12.761 1.00 40.92  ? 393 ARG A CG   1 
ATOM   1381 C CD   . ARG A 1 97  ? -12.392 24.529 -12.398 1.00 39.85  ? 393 ARG A CD   1 
ATOM   1382 N NE   . ARG A 1 97  ? -12.869 23.836 -13.593 1.00 41.02  ? 393 ARG A NE   1 
ATOM   1383 C CZ   . ARG A 1 97  ? -12.439 22.654 -14.030 1.00 41.54  ? 393 ARG A CZ   1 
ATOM   1384 N NH1  . ARG A 1 97  ? -11.515 21.973 -13.368 1.00 38.12  ? 393 ARG A NH1  1 
ATOM   1385 N NH2  . ARG A 1 97  ? -12.953 22.143 -15.142 1.00 44.02  ? 393 ARG A NH2  1 
ATOM   1386 H H    . ARG A 1 97  ? -8.392  25.298 -15.051 1.00 44.37  ? 393 ARG A H    1 
ATOM   1387 H HA   . ARG A 1 97  ? -10.267 27.080 -14.798 1.00 37.49  ? 393 ARG A HA   1 
ATOM   1388 H HB2  . ARG A 1 97  ? -10.673 24.831 -14.350 1.00 47.34  ? 393 ARG A HB2  1 
ATOM   1389 H HB3  . ARG A 1 97  ? -9.730  24.908 -13.077 1.00 47.34  ? 393 ARG A HB3  1 
ATOM   1390 H HG2  . ARG A 1 97  ? -11.248 26.165 -11.938 1.00 49.11  ? 393 ARG A HG2  1 
ATOM   1391 H HG3  . ARG A 1 97  ? -12.129 26.375 -13.246 1.00 49.11  ? 393 ARG A HG3  1 
ATOM   1392 H HD2  . ARG A 1 97  ? -11.846 23.912 -11.885 1.00 47.82  ? 393 ARG A HD2  1 
ATOM   1393 H HD3  . ARG A 1 97  ? -13.163 24.806 -11.878 1.00 47.82  ? 393 ARG A HD3  1 
ATOM   1394 H HE   . ARG A 1 97  ? -13.482 24.226 -14.054 1.00 49.22  ? 393 ARG A HE   1 
ATOM   1395 H HH11 . ARG A 1 97  ? -11.175 22.297 -12.648 1.00 45.74  ? 393 ARG A HH11 1 
ATOM   1396 H HH12 . ARG A 1 97  ? -11.251 21.209 -13.663 1.00 45.74  ? 393 ARG A HH12 1 
ATOM   1397 H HH21 . ARG A 1 97  ? -13.557 22.576 -15.575 1.00 52.83  ? 393 ARG A HH21 1 
ATOM   1398 H HH22 . ARG A 1 97  ? -12.686 21.377 -15.427 1.00 52.83  ? 393 ARG A HH22 1 
ATOM   1399 N N    . GLN A 1 98  ? -7.986  27.288 -12.561 1.00 34.41  ? 394 GLN A N    1 
ATOM   1400 C CA   . GLN A 1 98  ? -7.433  28.202 -11.566 1.00 34.34  ? 394 GLN A CA   1 
ATOM   1401 C C    . GLN A 1 98  ? -6.986  29.506 -12.211 1.00 35.65  ? 394 GLN A C    1 
ATOM   1402 O O    . GLN A 1 98  ? -7.148  30.582 -11.624 1.00 35.68  ? 394 GLN A O    1 
ATOM   1403 C CB   . GLN A 1 98  ? -6.255  27.556 -10.832 1.00 33.29  ? 394 GLN A CB   1 
ATOM   1404 C CG   . GLN A 1 98  ? -6.498  26.141 -10.346 1.00 30.32  ? 394 GLN A CG   1 
ATOM   1405 C CD   . GLN A 1 98  ? -7.828  25.979 -9.645  1.00 33.40  ? 394 GLN A CD   1 
ATOM   1406 O OE1  . GLN A 1 98  ? -8.184  26.765 -8.764  1.00 30.89  ? 394 GLN A OE1  1 
ATOM   1407 N NE2  . GLN A 1 98  ? -8.579  24.956 -10.038 1.00 34.15  ? 394 GLN A NE2  1 
ATOM   1408 H H    . GLN A 1 98  ? -7.503  26.595 -12.721 1.00 41.29  ? 394 GLN A H    1 
ATOM   1409 H HA   . GLN A 1 98  ? -8.119  28.409 -10.912 1.00 41.21  ? 394 GLN A HA   1 
ATOM   1410 H HB2  . GLN A 1 98  ? -5.494  27.532 -11.433 1.00 39.95  ? 394 GLN A HB2  1 
ATOM   1411 H HB3  . GLN A 1 98  ? -6.040  28.099 -10.057 1.00 39.95  ? 394 GLN A HB3  1 
ATOM   1412 H HG2  . GLN A 1 98  ? -6.485  25.540 -11.107 1.00 36.39  ? 394 GLN A HG2  1 
ATOM   1413 H HG3  . GLN A 1 98  ? -5.798  25.898 -9.720  1.00 36.39  ? 394 GLN A HG3  1 
ATOM   1414 H HE21 . GLN A 1 98  ? -8.300  24.431 -10.659 1.00 40.99  ? 394 GLN A HE21 1 
ATOM   1415 H HE22 . GLN A 1 98  ? -9.345  24.819 -9.671  1.00 40.99  ? 394 GLN A HE22 1 
ATOM   1416 N N    . VAL A 1 99  ? -6.413  29.428 -13.414 1.00 33.16  ? 395 VAL A N    1 
ATOM   1417 C CA   . VAL A 1 99  ? -5.931  30.629 -14.091 1.00 36.26  ? 395 VAL A CA   1 
ATOM   1418 C C    . VAL A 1 99  ? -7.072  31.620 -14.280 1.00 38.92  ? 395 VAL A C    1 
ATOM   1419 O O    . VAL A 1 99  ? -6.934  32.816 -13.996 1.00 40.67  ? 395 VAL A O    1 
ATOM   1420 C CB   . VAL A 1 99  ? -5.275  30.257 -15.434 1.00 34.99  ? 395 VAL A CB   1 
ATOM   1421 C CG1  . VAL A 1 99  ? -4.959  31.503 -16.252 1.00 35.58  ? 395 VAL A CG1  1 
ATOM   1422 C CG2  . VAL A 1 99  ? -4.002  29.448 -15.191 1.00 33.18  ? 395 VAL A CG2  1 
ATOM   1423 H H    . VAL A 1 99  ? -6.294  28.698 -13.854 1.00 39.80  ? 395 VAL A H    1 
ATOM   1424 H HA   . VAL A 1 99  ? -5.257  31.052 -13.537 1.00 43.51  ? 395 VAL A HA   1 
ATOM   1425 H HB   . VAL A 1 99  ? -5.889  29.707 -15.946 1.00 41.99  ? 395 VAL A HB   1 
ATOM   1426 H HG11 . VAL A 1 99  ? -4.548  31.235 -17.089 1.00 42.69  ? 395 VAL A HG11 1 
ATOM   1427 H HG12 . VAL A 1 99  ? -5.783  31.983 -16.426 1.00 42.69  ? 395 VAL A HG12 1 
ATOM   1428 H HG13 . VAL A 1 99  ? -4.349  32.064 -15.748 1.00 42.69  ? 395 VAL A HG13 1 
ATOM   1429 H HG21 . VAL A 1 99  ? -3.603  29.223 -16.046 1.00 39.81  ? 395 VAL A HG21 1 
ATOM   1430 H HG22 . VAL A 1 99  ? -3.384  29.982 -14.668 1.00 39.81  ? 395 VAL A HG22 1 
ATOM   1431 H HG23 . VAL A 1 99  ? -4.230  28.638 -14.709 1.00 39.81  ? 395 VAL A HG23 1 
ATOM   1432 N N    . VAL A 1 100 ? -8.215  31.136 -14.762 1.00 39.19  ? 396 VAL A N    1 
ATOM   1433 C CA   . VAL A 1 100 ? -9.365  31.989 -15.043 1.00 41.49  ? 396 VAL A CA   1 
ATOM   1434 C C    . VAL A 1 100 ? -10.074 32.356 -13.747 1.00 49.42  ? 396 VAL A C    1 
ATOM   1435 O O    . VAL A 1 100 ? -10.023 33.508 -13.303 1.00 50.03  ? 396 VAL A O    1 
ATOM   1436 C CB   . VAL A 1 100 ? -10.337 31.298 -16.018 1.00 38.80  ? 396 VAL A CB   1 
ATOM   1437 C CG1  . VAL A 1 100 ? -11.622 32.114 -16.180 1.00 45.58  ? 396 VAL A CG1  1 
ATOM   1438 C CG2  . VAL A 1 100 ? -9.669  31.096 -17.369 1.00 37.36  ? 396 VAL A CG2  1 
ATOM   1439 H H    . VAL A 1 100 ? -8.350  30.304 -14.936 1.00 47.02  ? 396 VAL A H    1 
ATOM   1440 H HA   . VAL A 1 100 ? -9.056  32.809 -15.458 1.00 49.79  ? 396 VAL A HA   1 
ATOM   1441 H HB   . VAL A 1 100 ? -10.575 30.427 -15.666 1.00 46.55  ? 396 VAL A HB   1 
ATOM   1442 H HG11 . VAL A 1 100 ? -12.212 31.655 -16.798 1.00 54.70  ? 396 VAL A HG11 1 
ATOM   1443 H HG12 . VAL A 1 100 ? -12.052 32.200 -15.315 1.00 54.70  ? 396 VAL A HG12 1 
ATOM   1444 H HG13 . VAL A 1 100 ? -11.397 32.992 -16.527 1.00 54.70  ? 396 VAL A HG13 1 
ATOM   1445 H HG21 . VAL A 1 100 ? -10.295 30.661 -17.968 1.00 44.84  ? 396 VAL A HG21 1 
ATOM   1446 H HG22 . VAL A 1 100 ? -9.414  31.961 -17.727 1.00 44.84  ? 396 VAL A HG22 1 
ATOM   1447 H HG23 . VAL A 1 100 ? -8.882  30.541 -17.252 1.00 44.84  ? 396 VAL A HG23 1 
ATOM   1448 N N    . HIS A 1 101 ? -10.749 31.378 -13.139 1.00 58.00  ? 397 HIS A N    1 
ATOM   1449 C CA   . HIS A 1 101 ? -11.608 31.613 -11.986 1.00 65.25  ? 397 HIS A CA   1 
ATOM   1450 C C    . HIS A 1 101 ? -10.863 31.593 -10.658 1.00 70.11  ? 397 HIS A C    1 
ATOM   1451 O O    . HIS A 1 101 ? -11.469 31.895 -9.626  1.00 72.58  ? 397 HIS A O    1 
ATOM   1452 C CB   . HIS A 1 101 ? -12.722 30.558 -11.929 1.00 67.08  ? 397 HIS A CB   1 
ATOM   1453 C CG   . HIS A 1 101 ? -13.428 30.344 -13.232 1.00 70.31  ? 397 HIS A CG   1 
ATOM   1454 N ND1  . HIS A 1 101 ? -14.429 31.177 -13.684 1.00 72.83  ? 397 HIS A ND1  1 
ATOM   1455 C CD2  . HIS A 1 101 ? -13.288 29.381 -14.174 1.00 69.84  ? 397 HIS A CD2  1 
ATOM   1456 C CE1  . HIS A 1 101 ? -14.869 30.741 -14.851 1.00 73.28  ? 397 HIS A CE1  1 
ATOM   1457 N NE2  . HIS A 1 101 ? -14.192 29.653 -15.171 1.00 71.43  ? 397 HIS A NE2  1 
ATOM   1458 H H    . HIS A 1 101 ? -10.721 30.554 -13.385 1.00 69.60  ? 397 HIS A H    1 
ATOM   1459 H HA   . HIS A 1 101 ? -12.027 32.483 -12.079 1.00 78.30  ? 397 HIS A HA   1 
ATOM   1460 H HB2  . HIS A 1 101 ? -12.334 29.710 -11.661 1.00 80.49  ? 397 HIS A HB2  1 
ATOM   1461 H HB3  . HIS A 1 101 ? -13.383 30.837 -11.277 1.00 80.49  ? 397 HIS A HB3  1 
ATOM   1462 H HD2  . HIS A 1 101 ? -12.687 28.671 -14.152 1.00 83.80  ? 397 HIS A HD2  1 
ATOM   1463 H HE1  . HIS A 1 101 ? -15.540 31.134 -15.361 1.00 87.94  ? 397 HIS A HE1  1 
ATOM   1464 H HE2  . HIS A 1 101 ? -14.301 29.189 -15.887 1.00 85.72  ? 397 HIS A HE2  1 
ATOM   1465 N N    . GLY A 1 102 ? -9.576  31.245 -10.651 1.00 70.36  ? 398 GLY A N    1 
ATOM   1466 C CA   . GLY A 1 102 ? -8.878  31.048 -9.400  1.00 70.60  ? 398 GLY A CA   1 
ATOM   1467 C C    . GLY A 1 102 ? -8.498  32.340 -8.705  1.00 73.69  ? 398 GLY A C    1 
ATOM   1468 O O    . GLY A 1 102 ? -8.354  33.401 -9.312  1.00 76.33  ? 398 GLY A O    1 
ATOM   1469 H H    . GLY A 1 102 ? -9.096  31.119 -11.353 1.00 84.43  ? 398 GLY A H    1 
ATOM   1470 H HA2  . GLY A 1 102 ? -9.440  30.535 -8.799  1.00 84.72  ? 398 GLY A HA2  1 
ATOM   1471 H HA3  . GLY A 1 102 ? -8.067  30.543 -9.564  1.00 84.72  ? 398 GLY A HA3  1 
ATOM   1472 N N    . LYS A 1 103 ? -8.343  32.226 -7.388  1.00 74.58  ? 399 LYS A N    1 
ATOM   1473 C CA   . LYS A 1 103 ? -7.871  33.307 -6.538  1.00 73.28  ? 399 LYS A CA   1 
ATOM   1474 C C    . LYS A 1 103 ? -6.740  32.788 -5.662  1.00 72.06  ? 399 LYS A C    1 
ATOM   1475 O O    . LYS A 1 103 ? -6.501  31.581 -5.566  1.00 66.17  ? 399 LYS A O    1 
ATOM   1476 C CB   . LYS A 1 103 ? -8.998  33.874 -5.664  1.00 71.72  ? 399 LYS A CB   1 
ATOM   1477 C CG   . LYS A 1 103 ? -10.083 34.599 -6.440  1.00 70.67  ? 399 LYS A CG   1 
ATOM   1478 C CD   . LYS A 1 103 ? -11.154 35.153 -5.513  1.00 72.02  ? 399 LYS A CD   1 
ATOM   1479 C CE   . LYS A 1 103 ? -12.224 35.906 -6.290  1.00 73.58  ? 399 LYS A CE   1 
ATOM   1480 N NZ   . LYS A 1 103 ? -13.298 36.437 -5.403  1.00 75.96  ? 399 LYS A NZ   1 
ATOM   1481 H H    . LYS A 1 103 ? -8.512  31.504 -6.952  1.00 89.50  ? 399 LYS A H    1 
ATOM   1482 H HA   . LYS A 1 103 ? -7.524  34.024 -7.092  1.00 87.94  ? 399 LYS A HA   1 
ATOM   1483 H HB2  . LYS A 1 103 ? -9.417  33.143 -5.183  1.00 86.06  ? 399 LYS A HB2  1 
ATOM   1484 H HB3  . LYS A 1 103 ? -8.615  34.504 -5.033  1.00 86.06  ? 399 LYS A HB3  1 
ATOM   1485 H HG2  . LYS A 1 103 ? -9.688  35.340 -6.926  1.00 84.81  ? 399 LYS A HG2  1 
ATOM   1486 H HG3  . LYS A 1 103 ? -10.504 33.979 -7.056  1.00 84.81  ? 399 LYS A HG3  1 
ATOM   1487 H HD2  . LYS A 1 103 ? -11.579 34.421 -5.040  1.00 86.43  ? 399 LYS A HD2  1 
ATOM   1488 H HD3  . LYS A 1 103 ? -10.746 35.768 -4.883  1.00 86.43  ? 399 LYS A HD3  1 
ATOM   1489 H HE2  . LYS A 1 103 ? -11.815 36.656 -6.750  1.00 88.30  ? 399 LYS A HE2  1 
ATOM   1490 H HE3  . LYS A 1 103 ? -12.633 35.304 -6.931  1.00 88.30  ? 399 LYS A HE3  1 
ATOM   1491 H HZ1  . LYS A 1 103 ? -13.906 36.871 -5.887  1.00 91.15  ? 399 LYS A HZ1  1 
ATOM   1492 H HZ2  . LYS A 1 103 ? -13.695 35.768 -4.972  1.00 91.15  ? 399 LYS A HZ2  1 
ATOM   1493 H HZ3  . LYS A 1 103 ? -12.950 36.999 -4.807  1.00 91.15  ? 399 LYS A HZ3  1 
ATOM   1494 N N    . GLU A 1 104 ? -6.039  33.719 -5.019  1.00 76.41  ? 400 GLU A N    1 
ATOM   1495 C CA   . GLU A 1 104 ? -4.958  33.348 -4.116  1.00 75.27  ? 400 GLU A CA   1 
ATOM   1496 C C    . GLU A 1 104 ? -5.501  32.557 -2.934  1.00 66.93  ? 400 GLU A C    1 
ATOM   1497 O O    . GLU A 1 104 ? -6.433  32.993 -2.252  1.00 68.16  ? 400 GLU A O    1 
ATOM   1498 C CB   . GLU A 1 104 ? -4.226  34.595 -3.617  1.00 84.92  ? 400 GLU A CB   1 
ATOM   1499 C CG   . GLU A 1 104 ? -3.031  35.012 -4.464  1.00 90.37  ? 400 GLU A CG   1 
ATOM   1500 C CD   . GLU A 1 104 ? -3.414  35.899 -5.632  1.00 94.21  ? 400 GLU A CD   1 
ATOM   1501 O OE1  . GLU A 1 104 ? -2.611  36.787 -5.990  1.00 98.86  ? 400 GLU A OE1  1 
ATOM   1502 O OE2  . GLU A 1 104 ? -4.518  35.716 -6.187  1.00 92.92  ? 400 GLU A OE2  1 
ATOM   1503 H H    . GLU A 1 104 ? -6.169  34.566 -5.089  1.00 91.69  ? 400 GLU A H    1 
ATOM   1504 H HA   . GLU A 1 104 ? -4.321  32.790 -4.590  1.00 90.33  ? 400 GLU A HA   1 
ATOM   1505 H HB2  . GLU A 1 104 ? -4.851  35.337 -3.605  1.00 101.91 ? 400 GLU A HB2  1 
ATOM   1506 H HB3  . GLU A 1 104 ? -3.904  34.426 -2.718  1.00 101.91 ? 400 GLU A HB3  1 
ATOM   1507 H HG2  . GLU A 1 104 ? -2.406  35.503 -3.908  1.00 108.44 ? 400 GLU A HG2  1 
ATOM   1508 H HG3  . GLU A 1 104 ? -2.604  34.217 -4.820  1.00 108.44 ? 400 GLU A HG3  1 
ATOM   1509 N N    . GLY A 1 105 ? -4.914  31.387 -2.696  1.00 58.17  ? 401 GLY A N    1 
ATOM   1510 C CA   . GLY A 1 105 ? -5.262  30.595 -1.533  1.00 52.43  ? 401 GLY A CA   1 
ATOM   1511 C C    . GLY A 1 105 ? -6.570  29.846 -1.631  1.00 41.50  ? 401 GLY A C    1 
ATOM   1512 O O    . GLY A 1 105 ? -7.099  29.415 -0.601  1.00 38.08  ? 401 GLY A O    1 
ATOM   1513 H H    . GLY A 1 105 ? -4.310  31.033 -3.196  1.00 69.80  ? 401 GLY A H    1 
ATOM   1514 H HA2  . GLY A 1 105 ? -4.558  29.946 -1.375  1.00 62.92  ? 401 GLY A HA2  1 
ATOM   1515 H HA3  . GLY A 1 105 ? -5.310  31.178 -0.760  1.00 62.92  ? 401 GLY A HA3  1 
ATOM   1516 N N    . SER A 1 106 ? -7.112  29.678 -2.834  1.00 39.58  ? 402 SER A N    1 
ATOM   1517 C CA   . SER A 1 106 ? -8.330  28.911 -3.043  1.00 37.02  ? 402 SER A CA   1 
ATOM   1518 C C    . SER A 1 106 ? -8.103  27.897 -4.154  1.00 35.52  ? 402 SER A C    1 
ATOM   1519 O O    . SER A 1 106 ? -7.144  27.988 -4.926  1.00 36.57  ? 402 SER A O    1 
ATOM   1520 C CB   . SER A 1 106 ? -9.522  29.810 -3.408  1.00 40.84  ? 402 SER A CB   1 
ATOM   1521 O OG   . SER A 1 106 ? -9.709  30.844 -2.460  1.00 48.16  ? 402 SER A OG   1 
ATOM   1522 H H    . SER A 1 106 ? -6.784  30.007 -3.558  1.00 47.49  ? 402 SER A H    1 
ATOM   1523 H HA   . SER A 1 106 ? -8.549  28.430 -2.230  1.00 44.43  ? 402 SER A HA   1 
ATOM   1524 H HB2  . SER A 1 106 ? -9.359  30.209 -4.277  1.00 49.01  ? 402 SER A HB2  1 
ATOM   1525 H HB3  . SER A 1 106 ? -10.325 29.267 -3.441  1.00 49.01  ? 402 SER A HB3  1 
ATOM   1526 H HG   . SER A 1 106 ? -9.022  31.326 -2.421  1.00 57.79  ? 402 SER A HG   1 
ATOM   1527 N N    . ILE A 1 107 ? -8.998  26.915 -4.214  1.00 34.22  ? 403 ILE A N    1 
ATOM   1528 C CA   . ILE A 1 107 ? -9.062  25.959 -5.313  1.00 35.69  ? 403 ILE A CA   1 
ATOM   1529 C C    . ILE A 1 107 ? -10.483 25.972 -5.854  1.00 36.03  ? 403 ILE A C    1 
ATOM   1530 O O    . ILE A 1 107 ? -11.447 25.876 -5.083  1.00 36.60  ? 403 ILE A O    1 
ATOM   1531 C CB   . ILE A 1 107 ? -8.665  24.537 -4.868  1.00 39.81  ? 403 ILE A CB   1 
ATOM   1532 C CG1  . ILE A 1 107 ? -7.178  24.478 -4.504  1.00 42.29  ? 403 ILE A CG1  1 
ATOM   1533 C CG2  . ILE A 1 107 ? -9.000  23.508 -5.950  1.00 38.42  ? 403 ILE A CG2  1 
ATOM   1534 C CD1  . ILE A 1 107 ? -6.227  24.727 -5.665  1.00 40.70  ? 403 ILE A CD1  1 
ATOM   1535 H H    . ILE A 1 107 ? -9.596  26.780 -3.611  1.00 41.07  ? 403 ILE A H    1 
ATOM   1536 H HA   . ILE A 1 107 ? -8.460  26.239 -6.021  1.00 42.83  ? 403 ILE A HA   1 
ATOM   1537 H HB   . ILE A 1 107 ? -9.178  24.316 -4.074  1.00 47.77  ? 403 ILE A HB   1 
ATOM   1538 H HG12 . ILE A 1 107 ? -6.999  25.151 -3.828  1.00 50.75  ? 403 ILE A HG12 1 
ATOM   1539 H HG13 . ILE A 1 107 ? -6.982  23.598 -4.147  1.00 50.75  ? 403 ILE A HG13 1 
ATOM   1540 H HG21 . ILE A 1 107 ? -8.739  22.627 -5.639  1.00 46.10  ? 403 ILE A HG21 1 
ATOM   1541 H HG22 . ILE A 1 107 ? -9.955  23.529 -6.120  1.00 46.10  ? 403 ILE A HG22 1 
ATOM   1542 H HG23 . ILE A 1 107 ? -8.514  23.732 -6.759  1.00 46.10  ? 403 ILE A HG23 1 
ATOM   1543 H HD11 . ILE A 1 107 ? -5.314  24.671 -5.342  1.00 48.84  ? 403 ILE A HD11 1 
ATOM   1544 H HD12 . ILE A 1 107 ? -6.379  24.055 -6.347  1.00 48.84  ? 403 ILE A HD12 1 
ATOM   1545 H HD13 . ILE A 1 107 ? -6.396  25.611 -6.027  1.00 48.84  ? 403 ILE A HD13 1 
ATOM   1546 N N    . PHE A 1 108 ? -10.614 26.093 -7.171  1.00 30.32  ? 404 PHE A N    1 
ATOM   1547 C CA   . PHE A 1 108 ? -11.909 26.066 -7.833  1.00 32.50  ? 404 PHE A CA   1 
ATOM   1548 C C    . PHE A 1 108 ? -12.099 24.716 -8.506  1.00 28.79  ? 404 PHE A C    1 
ATOM   1549 O O    . PHE A 1 108 ? -11.228 24.258 -9.252  1.00 34.57  ? 404 PHE A O    1 
ATOM   1550 C CB   . PHE A 1 108 ? -12.031 27.199 -8.852  1.00 37.29  ? 404 PHE A CB   1 
ATOM   1551 C CG   . PHE A 1 108 ? -12.254 28.543 -8.225  1.00 50.64  ? 404 PHE A CG   1 
ATOM   1552 C CD1  . PHE A 1 108 ? -11.248 29.154 -7.496  1.00 56.81  ? 404 PHE A CD1  1 
ATOM   1553 C CD2  . PHE A 1 108 ? -13.471 29.191 -8.351  1.00 55.14  ? 404 PHE A CD2  1 
ATOM   1554 C CE1  . PHE A 1 108 ? -11.447 30.390 -6.912  1.00 59.93  ? 404 PHE A CE1  1 
ATOM   1555 C CE2  . PHE A 1 108 ? -13.675 30.429 -7.768  1.00 59.50  ? 404 PHE A CE2  1 
ATOM   1556 C CZ   . PHE A 1 108 ? -12.661 31.027 -7.048  1.00 60.39  ? 404 PHE A CZ   1 
ATOM   1557 H H    . PHE A 1 108 ? -9.952  26.194 -7.712  1.00 36.39  ? 404 PHE A H    1 
ATOM   1558 H HA   . PHE A 1 108 ? -12.609 26.177 -7.171  1.00 39.00  ? 404 PHE A HA   1 
ATOM   1559 H HB2  . PHE A 1 108 ? -11.212 27.244 -9.370  1.00 44.75  ? 404 PHE A HB2  1 
ATOM   1560 H HB3  . PHE A 1 108 ? -12.782 27.015 -9.437  1.00 44.75  ? 404 PHE A HB3  1 
ATOM   1561 H HD1  . PHE A 1 108 ? -10.426 28.729 -7.402  1.00 68.17  ? 404 PHE A HD1  1 
ATOM   1562 H HD2  . PHE A 1 108 ? -14.157 28.792 -8.836  1.00 66.17  ? 404 PHE A HD2  1 
ATOM   1563 H HE1  . PHE A 1 108 ? -10.762 30.791 -6.428  1.00 71.92  ? 404 PHE A HE1  1 
ATOM   1564 H HE2  . PHE A 1 108 ? -14.495 30.857 -7.861  1.00 71.40  ? 404 PHE A HE2  1 
ATOM   1565 H HZ   . PHE A 1 108 ? -12.797 31.859 -6.655  1.00 72.47  ? 404 PHE A HZ   1 
ATOM   1566 N N    . LEU A 1 109 ? -13.226 24.077 -8.221  1.00 28.71  ? 405 LEU A N    1 
ATOM   1567 C CA   . LEU A 1 109 ? -13.526 22.744 -8.714  1.00 31.42  ? 405 LEU A CA   1 
ATOM   1568 C C    . LEU A 1 109 ? -14.450 22.823 -9.923  1.00 31.60  ? 405 LEU A C    1 
ATOM   1569 O O    . LEU A 1 109 ? -15.159 23.811 -10.132 1.00 34.22  ? 405 LEU A O    1 
ATOM   1570 C CB   . LEU A 1 109 ? -14.168 21.897 -7.610  1.00 32.94  ? 405 LEU A CB   1 
ATOM   1571 C CG   . LEU A 1 109 ? -13.385 21.827 -6.294  1.00 36.46  ? 405 LEU A CG   1 
ATOM   1572 C CD1  . LEU A 1 109 ? -14.134 20.984 -5.265  1.00 35.33  ? 405 LEU A CD1  1 
ATOM   1573 C CD2  . LEU A 1 109 ? -11.983 21.276 -6.521  1.00 32.63  ? 405 LEU A CD2  1 
ATOM   1574 H H    . LEU A 1 109 ? -13.849 24.407 -7.729  1.00 34.45  ? 405 LEU A H    1 
ATOM   1575 H HA   . LEU A 1 109 ? -12.702 22.312 -8.989  1.00 37.70  ? 405 LEU A HA   1 
ATOM   1576 H HB2  . LEU A 1 109 ? -15.042 22.267 -7.409  1.00 39.52  ? 405 LEU A HB2  1 
ATOM   1577 H HB3  . LEU A 1 109 ? -14.268 20.990 -7.938  1.00 39.52  ? 405 LEU A HB3  1 
ATOM   1578 H HG   . LEU A 1 109 ? -13.297 22.724 -5.935  1.00 43.75  ? 405 LEU A HG   1 
ATOM   1579 H HD11 . LEU A 1 109 ? -13.618 20.956 -4.444  1.00 42.39  ? 405 LEU A HD11 1 
ATOM   1580 H HD12 . LEU A 1 109 ? -15.000 21.386 -5.098  1.00 42.39  ? 405 LEU A HD12 1 
ATOM   1581 H HD13 . LEU A 1 109 ? -14.247 20.086 -5.615  1.00 42.39  ? 405 LEU A HD13 1 
ATOM   1582 H HD21 . LEU A 1 109 ? -11.516 21.245 -5.672  1.00 39.15  ? 405 LEU A HD21 1 
ATOM   1583 H HD22 . LEU A 1 109 ? -12.052 20.384 -6.894  1.00 39.15  ? 405 LEU A HD22 1 
ATOM   1584 H HD23 . LEU A 1 109 ? -11.512 21.858 -7.137  1.00 39.15  ? 405 LEU A HD23 1 
ATOM   1585 N N    . VAL A 1 110 ? -14.433 21.750 -10.719 1.00 33.49  ? 406 VAL A N    1 
ATOM   1586 C CA   . VAL A 1 110 ? -15.249 21.675 -11.925 1.00 35.82  ? 406 VAL A CA   1 
ATOM   1587 C C    . VAL A 1 110 ? -16.728 21.854 -11.614 1.00 39.52  ? 406 VAL A C    1 
ATOM   1588 O O    . VAL A 1 110 ? -17.506 22.227 -12.499 1.00 42.04  ? 406 VAL A O    1 
ATOM   1589 C CB   . VAL A 1 110 ? -14.988 20.334 -12.645 1.00 35.49  ? 406 VAL A CB   1 
ATOM   1590 C CG1  . VAL A 1 110 ? -15.441 19.159 -11.784 1.00 34.53  ? 406 VAL A CG1  1 
ATOM   1591 C CG2  . VAL A 1 110 ? -15.664 20.311 -14.020 1.00 38.21  ? 406 VAL A CG2  1 
ATOM   1592 H H    . VAL A 1 110 ? -13.953 21.050 -10.578 1.00 40.19  ? 406 VAL A H    1 
ATOM   1593 H HA   . VAL A 1 110 ? -14.984 22.390 -12.525 1.00 42.98  ? 406 VAL A HA   1 
ATOM   1594 H HB   . VAL A 1 110 ? -14.033 20.241 -12.787 1.00 42.59  ? 406 VAL A HB   1 
ATOM   1595 H HG11 . VAL A 1 110 ? -15.265 18.332 -12.261 1.00 41.43  ? 406 VAL A HG11 1 
ATOM   1596 H HG12 . VAL A 1 110 ? -14.948 19.171 -10.949 1.00 41.43  ? 406 VAL A HG12 1 
ATOM   1597 H HG13 . VAL A 1 110 ? -16.391 19.244 -11.609 1.00 41.43  ? 406 VAL A HG13 1 
ATOM   1598 H HG21 . VAL A 1 110 ? -15.483 19.458 -14.446 1.00 45.85  ? 406 VAL A HG21 1 
ATOM   1599 H HG22 . VAL A 1 110 ? -16.620 20.426 -13.903 1.00 45.85  ? 406 VAL A HG22 1 
ATOM   1600 H HG23 . VAL A 1 110 ? -15.307 21.033 -14.559 1.00 45.85  ? 406 VAL A HG23 1 
ATOM   1601 N N    . THR A 1 111 ? -17.143 21.587 -10.374 1.00 41.67  ? 407 THR A N    1 
ATOM   1602 C CA   . THR A 1 111 ? -18.518 21.824 -9.946  1.00 45.08  ? 407 THR A CA   1 
ATOM   1603 C C    . THR A 1 111 ? -18.826 23.298 -9.732  1.00 46.23  ? 407 THR A C    1 
ATOM   1604 O O    . THR A 1 111 ? -19.981 23.633 -9.447  1.00 45.74  ? 407 THR A O    1 
ATOM   1605 C CB   . THR A 1 111 ? -18.803 21.064 -8.649  1.00 47.75  ? 407 THR A CB   1 
ATOM   1606 O OG1  . THR A 1 111 ? -17.776 21.348 -7.688  1.00 44.53  ? 407 THR A OG1  1 
ATOM   1607 C CG2  . THR A 1 111 ? -18.859 19.571 -8.906  1.00 48.30  ? 407 THR A CG2  1 
ATOM   1608 H H    . THR A 1 111 ? -16.639 21.264 -9.756  1.00 50.01  ? 407 THR A H    1 
ATOM   1609 H HA   . THR A 1 111 ? -19.121 21.489 -10.628 1.00 54.10  ? 407 THR A HA   1 
ATOM   1610 H HB   . THR A 1 111 ? -19.662 21.344 -8.295  1.00 57.30  ? 407 THR A HB   1 
ATOM   1611 H HG1  . THR A 1 111 ? -17.928 20.933 -6.974  1.00 53.44  ? 407 THR A HG1  1 
ATOM   1612 H HG21 . THR A 1 111 ? -19.040 19.099 -8.078  1.00 57.96  ? 407 THR A HG21 1 
ATOM   1613 H HG22 . THR A 1 111 ? -19.561 19.371 -9.544  1.00 57.96  ? 407 THR A HG22 1 
ATOM   1614 H HG23 . THR A 1 111 ? -18.011 19.265 -9.264  1.00 57.96  ? 407 THR A HG23 1 
ATOM   1615 N N    . GLY A 1 112 ? -17.837 24.180 -9.856  1.00 45.46  ? 408 GLY A N    1 
ATOM   1616 C CA   . GLY A 1 112 ? -18.026 25.587 -9.585  1.00 44.63  ? 408 GLY A CA   1 
ATOM   1617 C C    . GLY A 1 112 ? -17.773 25.999 -8.151  1.00 44.00  ? 408 GLY A C    1 
ATOM   1618 O O    . GLY A 1 112 ? -17.831 27.198 -7.851  1.00 47.54  ? 408 GLY A O    1 
ATOM   1619 H H    . GLY A 1 112 ? -17.038 23.977 -10.101 1.00 54.55  ? 408 GLY A H    1 
ATOM   1620 H HA2  . GLY A 1 112 ? -17.430 26.100 -10.153 1.00 53.56  ? 408 GLY A HA2  1 
ATOM   1621 H HA3  . GLY A 1 112 ? -18.938 25.831 -9.809  1.00 53.56  ? 408 GLY A HA3  1 
ATOM   1622 N N    . GLN A 1 113 ? -17.486 25.053 -7.260  1.00 42.63  ? 409 GLN A N    1 
ATOM   1623 C CA   . GLN A 1 113 ? -17.261 25.372 -5.858  1.00 46.55  ? 409 GLN A CA   1 
ATOM   1624 C C    . GLN A 1 113 ? -15.877 25.976 -5.658  1.00 41.03  ? 409 GLN A C    1 
ATOM   1625 O O    . GLN A 1 113 ? -14.904 25.588 -6.311  1.00 38.77  ? 409 GLN A O    1 
ATOM   1626 C CB   . GLN A 1 113 ? -17.378 24.128 -4.978  1.00 57.45  ? 409 GLN A CB   1 
ATOM   1627 C CG   . GLN A 1 113 ? -18.528 23.192 -5.301  1.00 68.79  ? 409 GLN A CG   1 
ATOM   1628 C CD   . GLN A 1 113 ? -18.382 21.855 -4.600  1.00 74.98  ? 409 GLN A CD   1 
ATOM   1629 O OE1  . GLN A 1 113 ? -18.577 20.799 -5.204  1.00 75.25  ? 409 GLN A OE1  1 
ATOM   1630 N NE2  . GLN A 1 113 ? -18.030 21.893 -3.319  1.00 77.84  ? 409 GLN A NE2  1 
ATOM   1631 H H    . GLN A 1 113 ? -17.418 24.216 -7.445  1.00 51.15  ? 409 GLN A H    1 
ATOM   1632 H HA   . GLN A 1 113 ? -17.922 26.018 -5.564  1.00 55.86  ? 409 GLN A HA   1 
ATOM   1633 H HB2  . GLN A 1 113 ? -16.557 23.617 -5.061  1.00 68.94  ? 409 GLN A HB2  1 
ATOM   1634 H HB3  . GLN A 1 113 ? -17.488 24.414 -4.058  1.00 68.94  ? 409 GLN A HB3  1 
ATOM   1635 H HG2  . GLN A 1 113 ? -19.360 23.598 -5.011  1.00 82.55  ? 409 GLN A HG2  1 
ATOM   1636 H HG3  . GLN A 1 113 ? -18.550 23.033 -6.258  1.00 82.55  ? 409 GLN A HG3  1 
ATOM   1637 H HE21 . GLN A 1 113 ? -17.897 22.649 -2.932  1.00 93.41  ? 409 GLN A HE21 1 
ATOM   1638 H HE22 . GLN A 1 113 ? -17.934 21.161 -2.877  1.00 93.41  ? 409 GLN A HE22 1 
ATOM   1639 N N    . GLN A 1 114 ? -15.796 26.918 -4.725  1.00 40.58  ? 410 GLN A N    1 
ATOM   1640 C CA   . GLN A 1 114 ? -14.541 27.528 -4.309  1.00 41.28  ? 410 GLN A CA   1 
ATOM   1641 C C    . GLN A 1 114 ? -14.235 27.058 -2.893  1.00 39.87  ? 410 GLN A C    1 
ATOM   1642 O O    . GLN A 1 114 ? -15.017 27.312 -1.971  1.00 42.70  ? 410 GLN A O    1 
ATOM   1643 C CB   . GLN A 1 114 ? -14.630 29.054 -4.369  1.00 44.80  ? 410 GLN A CB   1 
ATOM   1644 C CG   . GLN A 1 114 ? -13.432 29.781 -3.774  1.00 51.58  ? 410 GLN A CG   1 
ATOM   1645 C CD   . GLN A 1 114 ? -13.504 31.281 -3.977  1.00 61.54  ? 410 GLN A CD   1 
ATOM   1646 O OE1  . GLN A 1 114 ? -14.504 31.806 -4.467  1.00 66.30  ? 410 GLN A OE1  1 
ATOM   1647 N NE2  . GLN A 1 114 ? -12.440 31.980 -3.602  1.00 65.57  ? 410 GLN A NE2  1 
ATOM   1648 H H    . GLN A 1 114 ? -16.479 27.229 -4.306  1.00 48.70  ? 410 GLN A H    1 
ATOM   1649 H HA   . GLN A 1 114 ? -13.825 27.236 -4.895  1.00 49.54  ? 410 GLN A HA   1 
ATOM   1650 H HB2  . GLN A 1 114 ? -14.706 29.323 -5.298  1.00 53.76  ? 410 GLN A HB2  1 
ATOM   1651 H HB3  . GLN A 1 114 ? -15.419 29.338 -3.882  1.00 53.76  ? 410 GLN A HB3  1 
ATOM   1652 H HG2  . GLN A 1 114 ? -13.399 29.608 -2.820  1.00 61.90  ? 410 GLN A HG2  1 
ATOM   1653 H HG3  . GLN A 1 114 ? -12.622 29.459 -4.199  1.00 61.90  ? 410 GLN A HG3  1 
ATOM   1654 H HE21 . GLN A 1 114 ? -11.759 31.579 -3.265  1.00 78.68  ? 410 GLN A HE21 1 
ATOM   1655 H HE22 . GLN A 1 114 ? -12.432 32.835 -3.697  1.00 78.68  ? 410 GLN A HE22 1 
ATOM   1656 N N    . VAL A 1 115 ? -13.110 26.366 -2.726  1.00 39.92  ? 411 VAL A N    1 
ATOM   1657 C CA   . VAL A 1 115 ? -12.690 25.837 -1.434  1.00 43.99  ? 411 VAL A CA   1 
ATOM   1658 C C    . VAL A 1 115 ? -11.346 26.450 -1.067  1.00 41.22  ? 411 VAL A C    1 
ATOM   1659 O O    . VAL A 1 115 ? -10.509 26.701 -1.941  1.00 39.48  ? 411 VAL A O    1 
ATOM   1660 C CB   . VAL A 1 115 ? -12.603 24.295 -1.453  1.00 47.38  ? 411 VAL A CB   1 
ATOM   1661 C CG1  . VAL A 1 115 ? -13.986 23.688 -1.645  1.00 51.54  ? 411 VAL A CG1  1 
ATOM   1662 C CG2  . VAL A 1 115 ? -11.660 23.817 -2.546  1.00 45.98  ? 411 VAL A CG2  1 
ATOM   1663 H H    . VAL A 1 115 ? -12.561 26.188 -3.363  1.00 47.91  ? 411 VAL A H    1 
ATOM   1664 H HA   . VAL A 1 115 ? -13.336 26.095 -0.758  1.00 52.79  ? 411 VAL A HA   1 
ATOM   1665 H HB   . VAL A 1 115 ? -12.256 23.987 -0.601  1.00 56.85  ? 411 VAL A HB   1 
ATOM   1666 H HG11 . VAL A 1 115 ? -13.908 22.721 -1.654  1.00 61.85  ? 411 VAL A HG11 1 
ATOM   1667 H HG12 . VAL A 1 115 ? -14.558 23.968 -0.913  1.00 61.85  ? 411 VAL A HG12 1 
ATOM   1668 H HG13 . VAL A 1 115 ? -14.352 23.999 -2.488  1.00 61.85  ? 411 VAL A HG13 1 
ATOM   1669 H HG21 . VAL A 1 115 ? -11.627 22.848 -2.533  1.00 55.17  ? 411 VAL A HG21 1 
ATOM   1670 H HG22 . VAL A 1 115 ? -11.991 24.125 -3.405  1.00 55.17  ? 411 VAL A HG22 1 
ATOM   1671 H HG23 . VAL A 1 115 ? -10.776 24.181 -2.382  1.00 55.17  ? 411 VAL A HG23 1 
ATOM   1672 N N    . ASP A 1 116 ? -11.147 26.700 0.227   1.00 40.37  ? 412 ASP A N    1 
ATOM   1673 C CA   . ASP A 1 116 ? -9.861  27.187 0.708   1.00 41.74  ? 412 ASP A CA   1 
ATOM   1674 C C    . ASP A 1 116 ? -8.784  26.133 0.473   1.00 37.88  ? 412 ASP A C    1 
ATOM   1675 O O    . ASP A 1 116 ? -9.004  24.938 0.690   1.00 38.21  ? 412 ASP A O    1 
ATOM   1676 C CB   . ASP A 1 116 ? -9.956  27.536 2.196   1.00 47.44  ? 412 ASP A CB   1 
ATOM   1677 C CG   . ASP A 1 116 ? -8.608  27.862 2.812   1.00 55.15  ? 412 ASP A CG   1 
ATOM   1678 O OD1  . ASP A 1 116 ? -8.139  29.011 2.661   1.00 58.63  ? 412 ASP A OD1  1 
ATOM   1679 O OD2  . ASP A 1 116 ? -8.022  26.969 3.459   1.00 56.43  ? 412 ASP A OD2  1 
ATOM   1680 H H    . ASP A 1 116 ? -11.739 26.596 0.842   1.00 48.44  ? 412 ASP A H    1 
ATOM   1681 H HA   . ASP A 1 116 ? -9.617  27.989 0.220   1.00 50.09  ? 412 ASP A HA   1 
ATOM   1682 H HB2  . ASP A 1 116 ? -10.530 28.311 2.302   1.00 56.92  ? 412 ASP A HB2  1 
ATOM   1683 H HB3  . ASP A 1 116 ? -10.330 26.780 2.674   1.00 56.92  ? 412 ASP A HB3  1 
ATOM   1684 N N    . TYR A 1 117 ? -7.611  26.581 0.017   1.00 36.33  ? 413 TYR A N    1 
ATOM   1685 C CA   . TYR A 1 117 ? -6.554  25.641 -0.349  1.00 36.59  ? 413 TYR A CA   1 
ATOM   1686 C C    . TYR A 1 117 ? -6.097  24.824 0.854   1.00 34.23  ? 413 TYR A C    1 
ATOM   1687 O O    . TYR A 1 117 ? -5.918  23.604 0.760   1.00 33.40  ? 413 TYR A O    1 
ATOM   1688 C CB   . TYR A 1 117 ? -5.365  26.383 -0.962  1.00 38.47  ? 413 TYR A CB   1 
ATOM   1689 C CG   . TYR A 1 117 ? -4.264  25.448 -1.412  1.00 39.78  ? 413 TYR A CG   1 
ATOM   1690 C CD1  . TYR A 1 117 ? -3.312  24.980 -0.516  1.00 39.39  ? 413 TYR A CD1  1 
ATOM   1691 C CD2  . TYR A 1 117 ? -4.184  25.026 -2.732  1.00 41.30  ? 413 TYR A CD2  1 
ATOM   1692 C CE1  . TYR A 1 117 ? -2.312  24.118 -0.920  1.00 41.80  ? 413 TYR A CE1  1 
ATOM   1693 C CE2  . TYR A 1 117 ? -3.184  24.167 -3.147  1.00 41.35  ? 413 TYR A CE2  1 
ATOM   1694 C CZ   . TYR A 1 117 ? -2.253  23.715 -2.237  1.00 43.96  ? 413 TYR A CZ   1 
ATOM   1695 O OH   . TYR A 1 117 ? -1.259  22.858 -2.648  1.00 46.67  ? 413 TYR A OH   1 
ATOM   1696 H H    . TYR A 1 117 ? -7.407  27.410 -0.088  1.00 43.60  ? 413 TYR A H    1 
ATOM   1697 H HA   . TYR A 1 117 ? -6.898  25.025 -1.015  1.00 43.91  ? 413 TYR A HA   1 
ATOM   1698 H HB2  . TYR A 1 117 ? -5.669  26.884 -1.735  1.00 46.17  ? 413 TYR A HB2  1 
ATOM   1699 H HB3  . TYR A 1 117 ? -4.994  26.987 -0.300  1.00 46.17  ? 413 TYR A HB3  1 
ATOM   1700 H HD1  . TYR A 1 117 ? -3.352  25.248 0.374   1.00 47.27  ? 413 TYR A HD1  1 
ATOM   1701 H HD2  . TYR A 1 117 ? -4.812  25.327 -3.347  1.00 49.56  ? 413 TYR A HD2  1 
ATOM   1702 H HE1  . TYR A 1 117 ? -1.681  23.814 -0.308  1.00 50.16  ? 413 TYR A HE1  1 
ATOM   1703 H HE2  . TYR A 1 117 ? -3.142  23.892 -4.034  1.00 49.62  ? 413 TYR A HE2  1 
ATOM   1704 H HH   . TYR A 1 117 ? -0.761  22.663 -2.000  1.00 56.01  ? 413 TYR A HH   1 
ATOM   1705 N N    . SER A 1 118 ? -5.878  25.486 1.994   1.00 35.25  ? 414 SER A N    1 
ATOM   1706 C CA   . SER A 1 118 ? -5.346  24.787 3.160   1.00 39.26  ? 414 SER A CA   1 
ATOM   1707 C C    . SER A 1 118 ? -6.308  23.722 3.667   1.00 40.10  ? 414 SER A C    1 
ATOM   1708 O O    . SER A 1 118 ? -5.869  22.685 4.177   1.00 41.48  ? 414 SER A O    1 
ATOM   1709 C CB   . SER A 1 118 ? -5.025  25.785 4.274   1.00 42.55  ? 414 SER A CB   1 
ATOM   1710 O OG   . SER A 1 118 ? -6.171  26.535 4.644   1.00 47.64  ? 414 SER A OG   1 
ATOM   1711 H H    . SER A 1 118 ? -6.027  26.325 2.114   1.00 42.29  ? 414 SER A H    1 
ATOM   1712 H HA   . SER A 1 118 ? -4.519  24.346 2.909   1.00 47.11  ? 414 SER A HA   1 
ATOM   1713 H HB2  . SER A 1 118 ? -4.705  25.298 5.049   1.00 51.06  ? 414 SER A HB2  1 
ATOM   1714 H HB3  . SER A 1 118 ? -4.339  26.395 3.961   1.00 51.06  ? 414 SER A HB3  1 
ATOM   1715 H HG   . SER A 1 118 ? -6.775  26.019 4.919   1.00 57.17  ? 414 SER A HG   1 
ATOM   1716 N N    . ILE A 1 119 ? -7.616  23.954 3.544   1.00 39.27  ? 415 ILE A N    1 
ATOM   1717 C CA   . ILE A 1 119 ? -8.588  22.960 3.989   1.00 38.39  ? 415 ILE A CA   1 
ATOM   1718 C C    . ILE A 1 119 ? -8.547  21.736 3.082   1.00 38.93  ? 415 ILE A C    1 
ATOM   1719 O O    . ILE A 1 119 ? -8.403  20.601 3.552   1.00 40.72  ? 415 ILE A O    1 
ATOM   1720 C CB   . ILE A 1 119 ? -9.997  23.579 4.048   1.00 42.81  ? 415 ILE A CB   1 
ATOM   1721 C CG1  . ILE A 1 119 ? -10.062 24.620 5.172   1.00 46.49  ? 415 ILE A CG1  1 
ATOM   1722 C CG2  . ILE A 1 119 ? -11.054 22.496 4.261   1.00 42.92  ? 415 ILE A CG2  1 
ATOM   1723 C CD1  . ILE A 1 119 ? -11.342 25.429 5.203   1.00 51.64  ? 415 ILE A CD1  1 
ATOM   1724 H H    . ILE A 1 119 ? -7.960  24.668 3.211   1.00 47.12  ? 415 ILE A H    1 
ATOM   1725 H HA   . ILE A 1 119 ? -8.353  22.673 4.885   1.00 46.06  ? 415 ILE A HA   1 
ATOM   1726 H HB   . ILE A 1 119 ? -10.174 24.023 3.205   1.00 51.37  ? 415 ILE A HB   1 
ATOM   1727 H HG12 . ILE A 1 119 ? -9.982  24.163 6.024   1.00 55.78  ? 415 ILE A HG12 1 
ATOM   1728 H HG13 . ILE A 1 119 ? -9.324  25.241 5.063   1.00 55.78  ? 415 ILE A HG13 1 
ATOM   1729 H HG21 . ILE A 1 119 ? -11.930 22.912 4.294   1.00 51.51  ? 415 ILE A HG21 1 
ATOM   1730 H HG22 . ILE A 1 119 ? -11.014 21.867 3.523   1.00 51.51  ? 415 ILE A HG22 1 
ATOM   1731 H HG23 . ILE A 1 119 ? -10.873 22.038 5.096   1.00 51.51  ? 415 ILE A HG23 1 
ATOM   1732 H HD11 . ILE A 1 119 ? -11.300 26.059 5.939   1.00 61.97  ? 415 ILE A HD11 1 
ATOM   1733 H HD12 . ILE A 1 119 ? -11.434 25.907 4.363   1.00 61.97  ? 415 ILE A HD12 1 
ATOM   1734 H HD13 . ILE A 1 119 ? -12.093 24.827 5.325   1.00 61.97  ? 415 ILE A HD13 1 
ATOM   1735 N N    . ILE A 1 120 ? -8.671  21.945 1.769   1.00 34.82  ? 416 ILE A N    1 
ATOM   1736 C CA   . ILE A 1 120 ? -8.703  20.813 0.849   1.00 37.58  ? 416 ILE A CA   1 
ATOM   1737 C C    . ILE A 1 120 ? -7.333  20.157 0.761   1.00 36.89  ? 416 ILE A C    1 
ATOM   1738 O O    . ILE A 1 120 ? -7.233  18.945 0.535   1.00 37.68  ? 416 ILE A O    1 
ATOM   1739 C CB   . ILE A 1 120 ? -9.214  21.252 -0.538  1.00 39.98  ? 416 ILE A CB   1 
ATOM   1740 C CG1  . ILE A 1 120 ? -9.445  20.030 -1.431  1.00 42.83  ? 416 ILE A CG1  1 
ATOM   1741 C CG2  . ILE A 1 120 ? -8.236  22.218 -1.208  1.00 38.88  ? 416 ILE A CG2  1 
ATOM   1742 C CD1  . ILE A 1 120 ? -10.430 20.277 -2.560  1.00 44.78  ? 416 ILE A CD1  1 
ATOM   1743 H H    . ILE A 1 120 ? -8.737  22.717 1.394   1.00 41.79  ? 416 ILE A H    1 
ATOM   1744 H HA   . ILE A 1 120 ? -9.323  20.151 1.194   1.00 45.09  ? 416 ILE A HA   1 
ATOM   1745 H HB   . ILE A 1 120 ? -10.062 21.708 -0.420  1.00 47.97  ? 416 ILE A HB   1 
ATOM   1746 H HG12 . ILE A 1 120 ? -8.599  19.768 -1.827  1.00 51.39  ? 416 ILE A HG12 1 
ATOM   1747 H HG13 . ILE A 1 120 ? -9.792  19.305 -0.887  1.00 51.39  ? 416 ILE A HG13 1 
ATOM   1748 H HG21 . ILE A 1 120 ? -8.589  22.472 -2.075  1.00 46.65  ? 416 ILE A HG21 1 
ATOM   1749 H HG22 . ILE A 1 120 ? -8.135  23.003 -0.648  1.00 46.65  ? 416 ILE A HG22 1 
ATOM   1750 H HG23 . ILE A 1 120 ? -7.380  21.775 -1.316  1.00 46.65  ? 416 ILE A HG23 1 
ATOM   1751 H HD11 . ILE A 1 120 ? -10.525 19.463 -3.080  1.00 53.74  ? 416 ILE A HD11 1 
ATOM   1752 H HD12 . ILE A 1 120 ? -11.287 20.529 -2.181  1.00 53.74  ? 416 ILE A HD12 1 
ATOM   1753 H HD13 . ILE A 1 120 ? -10.093 20.992 -3.122  1.00 53.74  ? 416 ILE A HD13 1 
ATOM   1754 N N    . ALA A 1 121 ? -6.260  20.933 0.937   1.00 36.10  ? 417 ALA A N    1 
ATOM   1755 C CA   . ALA A 1 121 ? -4.923  20.350 0.971   1.00 37.97  ? 417 ALA A CA   1 
ATOM   1756 C C    . ALA A 1 121 ? -4.766  19.411 2.159   1.00 39.23  ? 417 ALA A C    1 
ATOM   1757 O O    . ALA A 1 121 ? -4.157  18.342 2.039   1.00 41.16  ? 417 ALA A O    1 
ATOM   1758 C CB   . ALA A 1 121 ? -3.868  21.455 1.016   1.00 39.26  ? 417 ALA A CB   1 
ATOM   1759 H H    . ALA A 1 121 ? -6.282  21.787 1.038   1.00 43.32  ? 417 ALA A H    1 
ATOM   1760 H HA   . ALA A 1 121 ? -4.783  19.835 0.161   1.00 45.57  ? 417 ALA A HA   1 
ATOM   1761 H HB1  . ALA A 1 121 ? -2.988  21.049 1.038   1.00 47.11  ? 417 ALA A HB1  1 
ATOM   1762 H HB2  . ALA A 1 121 ? -3.958  22.010 0.225   1.00 47.11  ? 417 ALA A HB2  1 
ATOM   1763 H HB3  . ALA A 1 121 ? -4.006  21.990 1.813   1.00 47.11  ? 417 ALA A HB3  1 
ATOM   1764 N N    . SER A 1 122 ? -5.309  19.791 3.318   1.00 40.39  ? 418 SER A N    1 
ATOM   1765 C CA   . SER A 1 122 ? -5.320  18.877 4.455   1.00 39.76  ? 418 SER A CA   1 
ATOM   1766 C C    . SER A 1 122 ? -6.038  17.584 4.095   1.00 40.21  ? 418 SER A C    1 
ATOM   1767 O O    . SER A 1 122 ? -5.501  16.486 4.282   1.00 45.81  ? 418 SER A O    1 
ATOM   1768 C CB   . SER A 1 122 ? -5.986  19.542 5.663   1.00 37.29  ? 418 SER A CB   1 
ATOM   1769 O OG   . SER A 1 122 ? -5.240  20.656 6.118   1.00 39.63  ? 418 SER A OG   1 
ATOM   1770 H H    . SER A 1 122 ? -5.670  20.557 3.468   1.00 48.47  ? 418 SER A H    1 
ATOM   1771 H HA   . SER A 1 122 ? -4.407  18.659 4.696   1.00 47.71  ? 418 SER A HA   1 
ATOM   1772 H HB2  . SER A 1 122 ? -6.873  19.841 5.407   1.00 44.74  ? 418 SER A HB2  1 
ATOM   1773 H HB3  . SER A 1 122 ? -6.052  18.893 6.382   1.00 44.74  ? 418 SER A HB3  1 
ATOM   1774 H HG   . SER A 1 122 ? -5.176  21.228 5.506   1.00 47.55  ? 418 SER A HG   1 
ATOM   1775 N N    . GLN A 1 123 ? -7.257  17.697 3.563   1.00 37.43  ? 419 GLN A N    1 
ATOM   1776 C CA   . GLN A 1 123 ? -8.042  16.517 3.223   1.00 38.42  ? 419 GLN A CA   1 
ATOM   1777 C C    . GLN A 1 123 ? -7.374  15.673 2.147   1.00 38.72  ? 419 GLN A C    1 
ATOM   1778 O O    . GLN A 1 123 ? -7.653  14.472 2.055   1.00 40.98  ? 419 GLN A O    1 
ATOM   1779 C CB   . GLN A 1 123 ? -9.437  16.941 2.759   1.00 39.05  ? 419 GLN A CB   1 
ATOM   1780 C CG   . GLN A 1 123 ? -10.248 17.670 3.827   1.00 38.02  ? 419 GLN A CG   1 
ATOM   1781 C CD   . GLN A 1 123 ? -11.460 18.384 3.260   1.00 41.38  ? 419 GLN A CD   1 
ATOM   1782 O OE1  . GLN A 1 123 ? -11.444 18.851 2.122   1.00 44.59  ? 419 GLN A OE1  1 
ATOM   1783 N NE2  . GLN A 1 123 ? -12.519 18.475 4.054   1.00 44.77  ? 419 GLN A NE2  1 
ATOM   1784 H H    . GLN A 1 123 ? -7.647  18.444 3.391   1.00 44.92  ? 419 GLN A H    1 
ATOM   1785 H HA   . GLN A 1 123 ? -8.144  15.967 4.015   1.00 46.10  ? 419 GLN A HA   1 
ATOM   1786 H HB2  . GLN A 1 123 ? -9.347  17.536 1.998   1.00 46.86  ? 419 GLN A HB2  1 
ATOM   1787 H HB3  . GLN A 1 123 ? -9.934  16.149 2.499   1.00 46.86  ? 419 GLN A HB3  1 
ATOM   1788 H HG2  . GLN A 1 123 ? -10.559 17.025 4.482   1.00 45.63  ? 419 GLN A HG2  1 
ATOM   1789 H HG3  . GLN A 1 123 ? -9.683  18.331 4.255   1.00 45.63  ? 419 GLN A HG3  1 
ATOM   1790 H HE21 . GLN A 1 123 ? -12.494 18.137 4.844   1.00 53.72  ? 419 GLN A HE21 1 
ATOM   1791 H HE22 . GLN A 1 123 ? -13.231 18.871 3.778   1.00 53.72  ? 419 GLN A HE22 1 
ATOM   1792 N N    . ALA A 1 124 ? -6.497  16.269 1.340   1.00 37.49  ? 420 ALA A N    1 
ATOM   1793 C CA   . ALA A 1 124 ? -5.840  15.542 0.262   1.00 37.24  ? 420 ALA A CA   1 
ATOM   1794 C C    . ALA A 1 124 ? -4.653  14.717 0.739   1.00 37.56  ? 420 ALA A C    1 
ATOM   1795 O O    . ALA A 1 124 ? -4.244  13.785 0.039   1.00 38.14  ? 420 ALA A O    1 
ATOM   1796 C CB   . ALA A 1 124 ? -5.374  16.520 -0.818  1.00 37.74  ? 420 ALA A CB   1 
ATOM   1797 H H    . ALA A 1 124 ? -6.267  17.096 1.397   1.00 44.99  ? 420 ALA A H    1 
ATOM   1798 H HA   . ALA A 1 124 ? -6.480  14.935 -0.142  1.00 44.68  ? 420 ALA A HA   1 
ATOM   1799 H HB1  . ALA A 1 124 ? -4.939  16.022 -1.527  1.00 45.29  ? 420 ALA A HB1  1 
ATOM   1800 H HB2  . ALA A 1 124 ? -6.145  16.992 -1.169  1.00 45.29  ? 420 ALA A HB2  1 
ATOM   1801 H HB3  . ALA A 1 124 ? -4.750  17.150 -0.425  1.00 45.29  ? 420 ALA A HB3  1 
ATOM   1802 N N    . GLY A 1 125 ? -4.094  15.029 1.904   1.00 38.50  ? 421 GLY A N    1 
ATOM   1803 C CA   . GLY A 1 125 ? -2.910  14.349 2.382   1.00 40.28  ? 421 GLY A CA   1 
ATOM   1804 C C    . GLY A 1 125 ? -1.636  14.974 1.844   1.00 35.98  ? 421 GLY A C    1 
ATOM   1805 O O    . GLY A 1 125 ? -1.639  15.813 0.941   1.00 38.35  ? 421 GLY A O    1 
ATOM   1806 H H    . GLY A 1 125 ? -4.388  15.637 2.436   1.00 46.20  ? 421 GLY A H    1 
ATOM   1807 H HA2  . GLY A 1 125 ? -2.885  14.384 3.351   1.00 48.34  ? 421 GLY A HA2  1 
ATOM   1808 H HA3  . GLY A 1 125 ? -2.937  13.419 2.108   1.00 48.34  ? 421 GLY A HA3  1 
ATOM   1809 N N    . ALA A 1 126 ? -0.513  14.534 2.413   1.00 44.65  ? 422 ALA A N    1 
ATOM   1810 C CA   . ALA A 1 126 ? 0.773   15.155 2.107   1.00 44.84  ? 422 ALA A CA   1 
ATOM   1811 C C    . ALA A 1 126 ? 1.157   14.959 0.644   1.00 45.65  ? 422 ALA A C    1 
ATOM   1812 O O    . ALA A 1 126 ? 1.504   15.922 -0.050  1.00 43.05  ? 422 ALA A O    1 
ATOM   1813 C CB   . ALA A 1 126 ? 1.853   14.593 3.033   1.00 49.40  ? 422 ALA A CB   1 
ATOM   1814 H H    . ALA A 1 126 ? -0.470  13.883 2.974   1.00 53.58  ? 422 ALA A H    1 
ATOM   1815 H HA   . ALA A 1 126 ? 0.707   16.108 2.272   1.00 53.81  ? 422 ALA A HA   1 
ATOM   1816 H HB1  . ALA A 1 126 ? 2.700   15.013 2.820   1.00 59.28  ? 422 ALA A HB1  1 
ATOM   1817 H HB2  . ALA A 1 126 ? 1.610   14.784 3.953   1.00 59.28  ? 422 ALA A HB2  1 
ATOM   1818 H HB3  . ALA A 1 126 ? 1.915   13.634 2.899   1.00 59.28  ? 422 ALA A HB3  1 
ATOM   1819 N N    . THR A 1 127 ? 1.106   13.717 0.154   1.00 44.96  ? 423 THR A N    1 
ATOM   1820 C CA   . THR A 1 127 ? 1.538   13.443 -1.215  1.00 43.68  ? 423 THR A CA   1 
ATOM   1821 C C    . THR A 1 127 ? 0.767   14.295 -2.214  1.00 38.47  ? 423 THR A C    1 
ATOM   1822 O O    . THR A 1 127 ? 1.358   15.024 -3.019  1.00 39.28  ? 423 THR A O    1 
ATOM   1823 C CB   . THR A 1 127 ? 1.362   11.959 -1.548  1.00 46.26  ? 423 THR A CB   1 
ATOM   1824 O OG1  . THR A 1 127 ? 2.165   11.160 -0.674  1.00 47.19  ? 423 THR A OG1  1 
ATOM   1825 C CG2  . THR A 1 127 ? 1.793   11.674 -2.983  1.00 46.51  ? 423 THR A CG2  1 
ATOM   1826 H H    . THR A 1 127 ? 0.830   13.028 0.587   1.00 53.95  ? 423 THR A H    1 
ATOM   1827 H HA   . THR A 1 127 ? 2.480   13.660 -1.299  1.00 52.42  ? 423 THR A HA   1 
ATOM   1828 H HB   . THR A 1 127 ? 0.429   11.712 -1.451  1.00 55.52  ? 423 THR A HB   1 
ATOM   1829 H HG1  . THR A 1 127 ? 2.067   10.346 -0.858  1.00 56.63  ? 423 THR A HG1  1 
ATOM   1830 H HG21 . THR A 1 127 ? 1.677   10.732 -3.182  1.00 55.81  ? 423 THR A HG21 1 
ATOM   1831 H HG22 . THR A 1 127 ? 1.257   12.196 -3.600  1.00 55.81  ? 423 THR A HG22 1 
ATOM   1832 H HG23 . THR A 1 127 ? 2.727   11.909 -3.101  1.00 55.81  ? 423 THR A HG23 1 
ATOM   1833 N N    . LEU A 1 128 ? -0.564  14.198 -2.191  1.00 38.40  ? 424 LEU A N    1 
ATOM   1834 C CA   . LEU A 1 128 ? -1.365  14.928 -3.167  1.00 34.90  ? 424 LEU A CA   1 
ATOM   1835 C C    . LEU A 1 128 ? -1.174  16.431 -3.026  1.00 36.34  ? 424 LEU A C    1 
ATOM   1836 O O    . LEU A 1 128 ? -1.128  17.153 -4.029  1.00 37.12  ? 424 LEU A O    1 
ATOM   1837 C CB   . LEU A 1 128 ? -2.846  14.569 -3.027  1.00 39.62  ? 424 LEU A CB   1 
ATOM   1838 C CG   . LEU A 1 128 ? -3.435  13.522 -3.974  1.00 41.81  ? 424 LEU A CG   1 
ATOM   1839 C CD1  . LEU A 1 128 ? -4.939  13.402 -3.732  1.00 38.98  ? 424 LEU A CD1  1 
ATOM   1840 C CD2  . LEU A 1 128 ? -3.157  13.840 -5.446  1.00 38.48  ? 424 LEU A CD2  1 
ATOM   1841 H H    . LEU A 1 128 ? -1.017  13.726 -1.632  1.00 46.08  ? 424 LEU A H    1 
ATOM   1842 H HA   . LEU A 1 128 ? -1.081  14.674 -4.059  1.00 41.88  ? 424 LEU A HA   1 
ATOM   1843 H HB2  . LEU A 1 128 ? -2.987  14.242 -2.124  1.00 47.55  ? 424 LEU A HB2  1 
ATOM   1844 H HB3  . LEU A 1 128 ? -3.361  15.381 -3.151  1.00 47.55  ? 424 LEU A HB3  1 
ATOM   1845 H HG   . LEU A 1 128 ? -3.034  12.661 -3.776  1.00 50.18  ? 424 LEU A HG   1 
ATOM   1846 H HD11 . LEU A 1 128 ? -5.303  12.737 -4.336  1.00 46.77  ? 424 LEU A HD11 1 
ATOM   1847 H HD12 . LEU A 1 128 ? -5.089  13.132 -2.812  1.00 46.77  ? 424 LEU A HD12 1 
ATOM   1848 H HD13 . LEU A 1 128 ? -5.354  14.263 -3.897  1.00 46.77  ? 424 LEU A HD13 1 
ATOM   1849 H HD21 . LEU A 1 128 ? -3.552  13.146 -5.998  1.00 46.18  ? 424 LEU A HD21 1 
ATOM   1850 H HD22 . LEU A 1 128 ? -3.550  14.700 -5.662  1.00 46.18  ? 424 LEU A HD22 1 
ATOM   1851 H HD23 . LEU A 1 128 ? -2.198  13.869 -5.586  1.00 46.18  ? 424 LEU A HD23 1 
ATOM   1852 N N    . ASN A 1 129 ? -1.075  16.928 -1.790  1.00 37.17  ? 425 ASN A N    1 
ATOM   1853 C CA   . ASN A 1 129 ? -0.836  18.355 -1.598  1.00 41.35  ? 425 ASN A CA   1 
ATOM   1854 C C    . ASN A 1 129 ? 0.399   18.804 -2.366  1.00 37.74  ? 425 ASN A C    1 
ATOM   1855 O O    . ASN A 1 129 ? 0.416   19.894 -2.948  1.00 36.39  ? 425 ASN A O    1 
ATOM   1856 C CB   . ASN A 1 129 ? -0.678  18.678 -0.112  1.00 47.55  ? 425 ASN A CB   1 
ATOM   1857 C CG   . ASN A 1 129 ? -0.395  20.153 0.132   1.00 51.48  ? 425 ASN A CG   1 
ATOM   1858 O OD1  . ASN A 1 129 ? -0.957  21.022 -0.535  1.00 51.01  ? 425 ASN A OD1  1 
ATOM   1859 N ND2  . ASN A 1 129 ? 0.486   20.439 1.083   1.00 56.33  ? 425 ASN A ND2  1 
ATOM   1860 H H    . ASN A 1 129 ? -1.141  16.471 -1.064  1.00 44.61  ? 425 ASN A H    1 
ATOM   1861 H HA   . ASN A 1 129 ? -1.597  18.852 -1.935  1.00 49.62  ? 425 ASN A HA   1 
ATOM   1862 H HB2  . ASN A 1 129 ? -1.499  18.448 0.351   1.00 57.06  ? 425 ASN A HB2  1 
ATOM   1863 H HB3  . ASN A 1 129 ? 0.062   18.165 0.247   1.00 57.06  ? 425 ASN A HB3  1 
ATOM   1864 H HD21 . ASN A 1 129 ? 0.679   21.259 1.258   1.00 67.60  ? 425 ASN A HD21 1 
ATOM   1865 H HD22 . ASN A 1 129 ? 0.865   19.805 1.524   1.00 67.60  ? 425 ASN A HD22 1 
ATOM   1866 N N    . ASN A 1 130 ? 1.442   17.969 -2.379  1.00 40.01  ? 426 ASN A N    1 
ATOM   1867 C CA   . ASN A 1 130 ? 2.655   18.303 -3.118  1.00 42.98  ? 426 ASN A CA   1 
ATOM   1868 C C    . ASN A 1 130 ? 2.371   18.459 -4.607  1.00 38.49  ? 426 ASN A C    1 
ATOM   1869 O O    . ASN A 1 130 ? 2.854   19.403 -5.243  1.00 33.57  ? 426 ASN A O    1 
ATOM   1870 C CB   . ASN A 1 130 ? 3.719   17.230 -2.891  1.00 55.23  ? 426 ASN A CB   1 
ATOM   1871 C CG   . ASN A 1 130 ? 4.951   17.445 -3.746  1.00 67.37  ? 426 ASN A CG   1 
ATOM   1872 O OD1  . ASN A 1 130 ? 5.440   18.567 -3.879  1.00 72.73  ? 426 ASN A OD1  1 
ATOM   1873 N ND2  . ASN A 1 130 ? 5.450   16.371 -4.345  1.00 71.05  ? 426 ASN A ND2  1 
ATOM   1874 H H    . ASN A 1 130 ? 1.470   17.212 -1.973  1.00 48.02  ? 426 ASN A H    1 
ATOM   1875 H HA   . ASN A 1 130 ? 3.004   19.147 -2.789  1.00 51.58  ? 426 ASN A HA   1 
ATOM   1876 H HB2  . ASN A 1 130 ? 3.992   17.246 -1.960  1.00 66.27  ? 426 ASN A HB2  1 
ATOM   1877 H HB3  . ASN A 1 130 ? 3.346   16.363 -3.114  1.00 66.27  ? 426 ASN A HB3  1 
ATOM   1878 H HD21 . ASN A 1 130 ? 6.149   16.441 -4.841  1.00 85.26  ? 426 ASN A HD21 1 
ATOM   1879 H HD22 . ASN A 1 130 ? 5.074   15.605 -4.237  1.00 85.26  ? 426 ASN A HD22 1 
ATOM   1880 N N    . LEU A 1 131 ? 1.600   17.535 -5.185  1.00 36.46  ? 427 LEU A N    1 
ATOM   1881 C CA   . LEU A 1 131 ? 1.254   17.649 -6.599  1.00 34.27  ? 427 LEU A CA   1 
ATOM   1882 C C    . LEU A 1 131 ? 0.353   18.852 -6.847  1.00 36.43  ? 427 LEU A C    1 
ATOM   1883 O O    . LEU A 1 131 ? 0.518   19.561 -7.848  1.00 33.23  ? 427 LEU A O    1 
ATOM   1884 C CB   . LEU A 1 131 ? 0.582   16.364 -7.082  1.00 32.88  ? 427 LEU A CB   1 
ATOM   1885 C CG   . LEU A 1 131 ? 1.378   15.068 -6.908  1.00 35.30  ? 427 LEU A CG   1 
ATOM   1886 C CD1  . LEU A 1 131 ? 0.569   13.884 -7.417  1.00 35.50  ? 427 LEU A CD1  1 
ATOM   1887 C CD2  . LEU A 1 131 ? 2.722   15.144 -7.614  1.00 37.78  ? 427 LEU A CD2  1 
ATOM   1888 H H    . LEU A 1 131 ? 1.271   16.847 -4.788  1.00 43.75  ? 427 LEU A H    1 
ATOM   1889 H HA   . LEU A 1 131 ? 2.067   17.773 -7.113  1.00 41.12  ? 427 LEU A HA   1 
ATOM   1890 H HB2  . LEU A 1 131 ? -0.251  16.257 -6.596  1.00 39.46  ? 427 LEU A HB2  1 
ATOM   1891 H HB3  . LEU A 1 131 ? 0.391   16.459 -8.028  1.00 39.46  ? 427 LEU A HB3  1 
ATOM   1892 H HG   . LEU A 1 131 ? 1.547   14.929 -5.963  1.00 42.36  ? 427 LEU A HG   1 
ATOM   1893 H HD11 . LEU A 1 131 ? 1.088   13.073 -7.299  1.00 42.60  ? 427 LEU A HD11 1 
ATOM   1894 H HD12 . LEU A 1 131 ? -0.257  13.825 -6.911  1.00 42.60  ? 427 LEU A HD12 1 
ATOM   1895 H HD13 . LEU A 1 131 ? 0.371   14.018 -8.357  1.00 42.60  ? 427 LEU A HD13 1 
ATOM   1896 H HD21 . LEU A 1 131 ? 3.195   14.307 -7.482  1.00 45.34  ? 427 LEU A HD21 1 
ATOM   1897 H HD22 . LEU A 1 131 ? 2.572   15.293 -8.561  1.00 45.34  ? 427 LEU A HD22 1 
ATOM   1898 H HD23 . LEU A 1 131 ? 3.234   15.877 -7.240  1.00 45.34  ? 427 LEU A HD23 1 
ATOM   1899 N N    . MET A 1 132 ? -0.607  19.097 -5.950  1.00 35.97  ? 428 MET A N    1 
ATOM   1900 C CA   . MET A 1 132 ? -1.459  20.275 -6.079  1.00 36.01  ? 428 MET A CA   1 
ATOM   1901 C C    . MET A 1 132 ? -0.634  21.556 -6.012  1.00 34.38  ? 428 MET A C    1 
ATOM   1902 O O    . MET A 1 132 ? -0.904  22.519 -6.741  1.00 33.35  ? 428 MET A O    1 
ATOM   1903 C CB   . MET A 1 132 ? -2.526  20.272 -4.983  1.00 37.30  ? 428 MET A CB   1 
ATOM   1904 C CG   . MET A 1 132 ? -3.502  19.099 -5.040  1.00 36.57  ? 428 MET A CG   1 
ATOM   1905 S SD   . MET A 1 132 ? -4.458  18.909 -3.516  1.00 44.68  ? 428 MET A SD   1 
ATOM   1906 C CE   . MET A 1 132 ? -5.236  20.517 -3.400  1.00 41.99  ? 428 MET A CE   1 
ATOM   1907 H H    . MET A 1 132 ? -0.780  18.603 -5.268  1.00 43.17  ? 428 MET A H    1 
ATOM   1908 H HA   . MET A 1 132 ? -1.913  20.241 -6.936  1.00 43.21  ? 428 MET A HA   1 
ATOM   1909 H HB2  . MET A 1 132 ? -2.083  20.243 -4.121  1.00 44.76  ? 428 MET A HB2  1 
ATOM   1910 H HB3  . MET A 1 132 ? -3.045  21.088 -5.055  1.00 44.76  ? 428 MET A HB3  1 
ATOM   1911 H HG2  . MET A 1 132 ? -4.125  19.241 -5.769  1.00 43.88  ? 428 MET A HG2  1 
ATOM   1912 H HG3  . MET A 1 132 ? -3.003  18.280 -5.185  1.00 43.88  ? 428 MET A HG3  1 
ATOM   1913 H HE1  . MET A 1 132 ? -5.790  20.542 -2.604  1.00 50.39  ? 428 MET A HE1  1 
ATOM   1914 H HE2  . MET A 1 132 ? -4.547  21.197 -3.346  1.00 50.39  ? 428 MET A HE2  1 
ATOM   1915 H HE3  . MET A 1 132 ? -5.782  20.660 -4.189  1.00 50.39  ? 428 MET A HE3  1 
ATOM   1916 N N    . SER A 1 133 ? 0.376   21.583 -5.137  1.00 34.29  ? 429 SER A N    1 
ATOM   1917 C CA   . SER A 1 133 ? 1.225   22.763 -5.008  1.00 35.35  ? 429 SER A CA   1 
ATOM   1918 C C    . SER A 1 133 ? 2.058   22.986 -6.266  1.00 35.67  ? 429 SER A C    1 
ATOM   1919 O O    . SER A 1 133 ? 2.212   24.124 -6.722  1.00 35.69  ? 429 SER A O    1 
ATOM   1920 C CB   . SER A 1 133 ? 2.129   22.620 -3.784  1.00 40.61  ? 429 SER A CB   1 
ATOM   1921 O OG   . SER A 1 133 ? 2.904   23.789 -3.590  1.00 45.35  ? 429 SER A OG   1 
ATOM   1922 H H    . SER A 1 133 ? 0.587   20.935 -4.613  1.00 41.14  ? 429 SER A H    1 
ATOM   1923 H HA   . SER A 1 133 ? 0.664   23.544 -4.878  1.00 42.42  ? 429 SER A HA   1 
ATOM   1924 H HB2  . SER A 1 133 ? 1.577   22.474 -3.000  1.00 48.73  ? 429 SER A HB2  1 
ATOM   1925 H HB3  . SER A 1 133 ? 2.723   21.865 -3.918  1.00 48.73  ? 429 SER A HB3  1 
ATOM   1926 H HG   . SER A 1 133 ? 3.397   23.698 -2.916  1.00 54.42  ? 429 SER A HG   1 
ATOM   1927 N N    . HIS A 1 134 ? 2.619   21.912 -6.826  1.00 37.88  ? 430 HIS A N    1 
ATOM   1928 C CA   . HIS A 1 134 ? 3.317   22.015 -8.104  1.00 37.52  ? 430 HIS A CA   1 
ATOM   1929 C C    . HIS A 1 134 ? 2.400   22.583 -9.183  1.00 36.14  ? 430 HIS A C    1 
ATOM   1930 O O    . HIS A 1 134 ? 2.795   23.481 -9.935  1.00 37.67  ? 430 HIS A O    1 
ATOM   1931 C CB   . HIS A 1 134 ? 3.847   20.638 -8.508  1.00 41.78  ? 430 HIS A CB   1 
ATOM   1932 C CG   . HIS A 1 134 ? 4.818   20.661 -9.649  1.00 47.19  ? 430 HIS A CG   1 
ATOM   1933 N ND1  . HIS A 1 134 ? 5.185   21.820 -10.299 1.00 49.14  ? 430 HIS A ND1  1 
ATOM   1934 C CD2  . HIS A 1 134 ? 5.503   19.660 -10.251 1.00 49.25  ? 430 HIS A CD2  1 
ATOM   1935 C CE1  . HIS A 1 134 ? 6.052   21.531 -11.254 1.00 48.98  ? 430 HIS A CE1  1 
ATOM   1936 N NE2  . HIS A 1 134 ? 6.261   20.227 -11.246 1.00 50.27  ? 430 HIS A NE2  1 
ATOM   1937 H H    . HIS A 1 134 ? 2.609   21.121 -6.489  1.00 45.46  ? 430 HIS A H    1 
ATOM   1938 H HA   . HIS A 1 134 ? 4.074   22.613 -8.006  1.00 45.02  ? 430 HIS A HA   1 
ATOM   1939 H HB2  . HIS A 1 134 ? 4.297   20.242 -7.745  1.00 50.13  ? 430 HIS A HB2  1 
ATOM   1940 H HB3  . HIS A 1 134 ? 3.097   20.081 -8.770  1.00 50.13  ? 430 HIS A HB3  1 
ATOM   1941 H HD2  . HIS A 1 134 ? 5.465   18.756 -10.032 1.00 59.10  ? 430 HIS A HD2  1 
ATOM   1942 H HE1  . HIS A 1 134 ? 6.447   22.142 -11.833 1.00 58.78  ? 430 HIS A HE1  1 
ATOM   1943 H HE2  . HIS A 1 134 ? 6.787   19.802 -11.777 1.00 60.32  ? 430 HIS A HE2  1 
ATOM   1944 N N    . ALA A 1 135 ? 1.163   22.087 -9.262  1.00 34.23  ? 431 ALA A N    1 
ATOM   1945 C CA   . ALA A 1 135 ? 0.223   22.616 -10.242 1.00 30.14  ? 431 ALA A CA   1 
ATOM   1946 C C    . ALA A 1 135 ? -0.044  24.096 -10.005 1.00 32.67  ? 431 ALA A C    1 
ATOM   1947 O O    . ALA A 1 135 ? -0.135  24.879 -10.958 1.00 31.69  ? 431 ALA A O    1 
ATOM   1948 C CB   . ALA A 1 135 ? -1.081  21.822 -10.202 1.00 32.65  ? 431 ALA A CB   1 
ATOM   1949 H H    . ALA A 1 135 ? 0.852   21.457 -8.767  1.00 41.08  ? 431 ALA A H    1 
ATOM   1950 H HA   . ALA A 1 135 ? 0.604   22.519 -11.129 1.00 36.16  ? 431 ALA A HA   1 
ATOM   1951 H HB1  . ALA A 1 135 ? -1.693  22.187 -10.860 1.00 39.18  ? 431 ALA A HB1  1 
ATOM   1952 H HB2  . ALA A 1 135 ? -0.891  20.893 -10.406 1.00 39.18  ? 431 ALA A HB2  1 
ATOM   1953 H HB3  . ALA A 1 135 ? -1.467  21.894 -9.315  1.00 39.18  ? 431 ALA A HB3  1 
ATOM   1954 N N    . GLN A 1 136 ? -0.167  24.503 -8.740  1.00 31.48  ? 432 GLN A N    1 
ATOM   1955 C CA   . GLN A 1 136 ? -0.387  25.916 -8.451  1.00 34.50  ? 432 GLN A CA   1 
ATOM   1956 C C    . GLN A 1 136 ? 0.782   26.768 -8.926  1.00 34.60  ? 432 GLN A C    1 
ATOM   1957 O O    . GLN A 1 136 ? 0.583   27.916 -9.337  1.00 34.60  ? 432 GLN A O    1 
ATOM   1958 C CB   . GLN A 1 136 ? -0.628  26.125 -6.953  1.00 36.66  ? 432 GLN A CB   1 
ATOM   1959 C CG   . GLN A 1 136 ? -1.962  25.585 -6.457  1.00 41.72  ? 432 GLN A CG   1 
ATOM   1960 C CD   . GLN A 1 136 ? -3.151  26.223 -7.159  1.00 41.22  ? 432 GLN A CD   1 
ATOM   1961 O OE1  . GLN A 1 136 ? -3.938  25.539 -7.811  1.00 36.20  ? 432 GLN A OE1  1 
ATOM   1962 N NE2  . GLN A 1 136 ? -3.286  27.537 -7.024  1.00 45.11  ? 432 GLN A NE2  1 
ATOM   1963 H H    . GLN A 1 136 ? -0.128  23.994 -8.048  1.00 37.77  ? 432 GLN A H    1 
ATOM   1964 H HA   . GLN A 1 136 ? -1.181  26.212 -8.923  1.00 41.40  ? 432 GLN A HA   1 
ATOM   1965 H HB2  . GLN A 1 136 ? 0.075   25.674 -6.459  1.00 44.00  ? 432 GLN A HB2  1 
ATOM   1966 H HB3  . GLN A 1 136 ? -0.604  27.076 -6.763  1.00 44.00  ? 432 GLN A HB3  1 
ATOM   1967 H HG2  . GLN A 1 136 ? -1.996  24.629 -6.619  1.00 50.07  ? 432 GLN A HG2  1 
ATOM   1968 H HG3  . GLN A 1 136 ? -2.043  25.765 -5.508  1.00 50.07  ? 432 GLN A HG3  1 
ATOM   1969 H HE21 . GLN A 1 136 ? -2.716  27.983 -6.559  1.00 54.13  ? 432 GLN A HE21 1 
ATOM   1970 H HE22 . GLN A 1 136 ? -3.943  27.943 -7.403  1.00 54.13  ? 432 GLN A HE22 1 
ATOM   1971 N N    . GLU A 1 137 ? 2.005   26.231 -8.881  1.00 38.37  ? 433 GLU A N    1 
ATOM   1972 C CA   . GLU A 1 137 ? 3.142   26.949 -9.444  1.00 40.70  ? 433 GLU A CA   1 
ATOM   1973 C C    . GLU A 1 137 ? 2.940   27.194 -10.933 1.00 40.00  ? 433 GLU A C    1 
ATOM   1974 O O    . GLU A 1 137 ? 3.199   28.295 -11.431 1.00 40.86  ? 433 GLU A O    1 
ATOM   1975 C CB   . GLU A 1 137 ? 4.435   26.168 -9.200  1.00 44.05  ? 433 GLU A CB   1 
ATOM   1976 C CG   . GLU A 1 137 ? 4.783   25.976 -7.728  1.00 50.69  ? 433 GLU A CG   1 
ATOM   1977 C CD   . GLU A 1 137 ? 6.022   25.127 -7.529  1.00 56.96  ? 433 GLU A CD   1 
ATOM   1978 O OE1  . GLU A 1 137 ? 6.842   25.041 -8.467  1.00 57.49  ? 433 GLU A OE1  1 
ATOM   1979 O OE2  . GLU A 1 137 ? 6.173   24.540 -6.437  1.00 61.56  ? 433 GLU A OE2  1 
ATOM   1980 H H    . GLU A 1 137 ? 2.196   25.466 -8.537  1.00 46.05  ? 433 GLU A H    1 
ATOM   1981 H HA   . GLU A 1 137 ? 3.223   27.811 -9.005  1.00 48.84  ? 433 GLU A HA   1 
ATOM   1982 H HB2  . GLU A 1 137 ? 4.347   25.289 -9.600  1.00 52.85  ? 433 GLU A HB2  1 
ATOM   1983 H HB3  . GLU A 1 137 ? 5.170   26.645 -9.617  1.00 52.85  ? 433 GLU A HB3  1 
ATOM   1984 H HG2  . GLU A 1 137 ? 4.945   26.844 -7.325  1.00 60.82  ? 433 GLU A HG2  1 
ATOM   1985 H HG3  . GLU A 1 137 ? 4.042   25.536 -7.283  1.00 60.82  ? 433 GLU A HG3  1 
ATOM   1986 N N    . LEU A 1 138 ? 2.466   26.178 -11.658 1.00 35.77  ? 434 LEU A N    1 
ATOM   1987 C CA   . LEU A 1 138 ? 2.200   26.346 -13.082 1.00 35.08  ? 434 LEU A CA   1 
ATOM   1988 C C    . LEU A 1 138 ? 1.089   27.363 -13.318 1.00 35.68  ? 434 LEU A C    1 
ATOM   1989 O O    . LEU A 1 138 ? 1.149   28.145 -14.273 1.00 35.45  ? 434 LEU A O    1 
ATOM   1990 C CB   . LEU A 1 138 ? 1.844   24.999 -13.712 1.00 40.37  ? 434 LEU A CB   1 
ATOM   1991 C CG   . LEU A 1 138 ? 3.029   24.143 -14.170 1.00 47.73  ? 434 LEU A CG   1 
ATOM   1992 C CD1  . LEU A 1 138 ? 3.902   23.738 -13.000 1.00 51.89  ? 434 LEU A CD1  1 
ATOM   1993 C CD2  . LEU A 1 138 ? 2.546   22.912 -14.921 1.00 49.00  ? 434 LEU A CD2  1 
ATOM   1994 H H    . LEU A 1 138 ? 2.294   25.393 -11.352 1.00 42.92  ? 434 LEU A H    1 
ATOM   1995 H HA   . LEU A 1 138 ? 3.003   26.676 -13.515 1.00 42.10  ? 434 LEU A HA   1 
ATOM   1996 H HB2  . LEU A 1 138 ? 1.345   24.480 -13.061 1.00 48.45  ? 434 LEU A HB2  1 
ATOM   1997 H HB3  . LEU A 1 138 ? 1.287   25.163 -14.489 1.00 48.45  ? 434 LEU A HB3  1 
ATOM   1998 H HG   . LEU A 1 138 ? 3.575   24.666 -14.779 1.00 57.27  ? 434 LEU A HG   1 
ATOM   1999 H HD11 . LEU A 1 138 ? 4.639   23.199 -13.327 1.00 62.27  ? 434 LEU A HD11 1 
ATOM   2000 H HD12 . LEU A 1 138 ? 4.242   24.538 -12.568 1.00 62.27  ? 434 LEU A HD12 1 
ATOM   2001 H HD13 . LEU A 1 138 ? 3.369   23.224 -12.372 1.00 62.27  ? 434 LEU A HD13 1 
ATOM   2002 H HD21 . LEU A 1 138 ? 3.315   22.390 -15.199 1.00 58.80  ? 434 LEU A HD21 1 
ATOM   2003 H HD22 . LEU A 1 138 ? 1.983   22.384 -14.333 1.00 58.80  ? 434 LEU A HD22 1 
ATOM   2004 H HD23 . LEU A 1 138 ? 2.040   23.195 -15.699 1.00 58.80  ? 434 LEU A HD23 1 
ATOM   2005 N N    . VAL A 1 139 ? 0.062   27.362 -12.461 1.00 33.37  ? 435 VAL A N    1 
ATOM   2006 C CA   . VAL A 1 139 ? -0.994  28.371 -12.551 1.00 31.51  ? 435 VAL A CA   1 
ATOM   2007 C C    . VAL A 1 139 ? -0.394  29.772 -12.496 1.00 32.51  ? 435 VAL A C    1 
ATOM   2008 O O    . VAL A 1 139 ? -0.725  30.643 -13.309 1.00 34.23  ? 435 VAL A O    1 
ATOM   2009 C CB   . VAL A 1 139 ? -2.029  28.165 -11.429 1.00 30.05  ? 435 VAL A CB   1 
ATOM   2010 C CG1  . VAL A 1 139 ? -3.031  29.311 -11.397 1.00 29.82  ? 435 VAL A CG1  1 
ATOM   2011 C CG2  . VAL A 1 139 ? -2.756  26.839 -11.606 1.00 29.72  ? 435 VAL A CG2  1 
ATOM   2012 H H    . VAL A 1 139 ? -0.044  26.793 -11.825 1.00 40.05  ? 435 VAL A H    1 
ATOM   2013 H HA   . VAL A 1 139 ? -1.450  28.274 -13.401 1.00 37.81  ? 435 VAL A HA   1 
ATOM   2014 H HB   . VAL A 1 139 ? -1.570  28.143 -10.575 1.00 36.06  ? 435 VAL A HB   1 
ATOM   2015 H HG11 . VAL A 1 139 ? -3.667  29.153 -10.682 1.00 35.78  ? 435 VAL A HG11 1 
ATOM   2016 H HG12 . VAL A 1 139 ? -2.554  30.141 -11.238 1.00 35.78  ? 435 VAL A HG12 1 
ATOM   2017 H HG13 . VAL A 1 139 ? -3.492  29.351 -12.249 1.00 35.78  ? 435 VAL A HG13 1 
ATOM   2018 H HG21 . VAL A 1 139 ? -3.400  26.735 -10.888 1.00 35.67  ? 435 VAL A HG21 1 
ATOM   2019 H HG22 . VAL A 1 139 ? -3.211  26.841 -12.462 1.00 35.67  ? 435 VAL A HG22 1 
ATOM   2020 H HG23 . VAL A 1 139 ? -2.108  26.118 -11.577 1.00 35.67  ? 435 VAL A HG23 1 
ATOM   2021 N N    . ALA A 1 140 ? 0.484   30.014 -11.522 1.00 35.75  ? 436 ALA A N    1 
ATOM   2022 C CA   . ALA A 1 140 ? 1.065   31.342 -11.357 1.00 37.47  ? 436 ALA A CA   1 
ATOM   2023 C C    . ALA A 1 140 ? 1.904   31.737 -12.567 1.00 38.18  ? 436 ALA A C    1 
ATOM   2024 O O    . ALA A 1 140 ? 1.874   32.895 -13.002 1.00 39.54  ? 436 ALA A O    1 
ATOM   2025 C CB   . ALA A 1 140 ? 1.906   31.386 -10.082 1.00 39.71  ? 436 ALA A CB   1 
ATOM   2026 H H    . ALA A 1 140 ? 0.757   29.432 -10.950 1.00 42.90  ? 436 ALA A H    1 
ATOM   2027 H HA   . ALA A 1 140 ? 0.349   31.990 -11.265 1.00 44.96  ? 436 ALA A HA   1 
ATOM   2028 H HB1  . ALA A 1 140 ? 2.286   32.273 -9.985  1.00 47.65  ? 436 ALA A HB1  1 
ATOM   2029 H HB2  . ALA A 1 140 ? 1.338   31.183 -9.323  1.00 47.65  ? 436 ALA A HB2  1 
ATOM   2030 H HB3  . ALA A 1 140 ? 2.616   30.728 -10.151 1.00 47.65  ? 436 ALA A HB3  1 
ATOM   2031 N N    . LYS A 1 141 ? 2.659   30.789 -13.126 1.00 37.66  ? 437 LYS A N    1 
ATOM   2032 C CA   . LYS A 1 141 ? 3.469   31.092 -14.303 1.00 38.76  ? 437 LYS A CA   1 
ATOM   2033 C C    . LYS A 1 141 ? 2.595   31.384 -15.518 1.00 32.72  ? 437 LYS A C    1 
ATOM   2034 O O    . LYS A 1 141 ? 2.870   32.321 -16.276 1.00 34.65  ? 437 LYS A O    1 
ATOM   2035 C CB   . LYS A 1 141 ? 4.421   29.933 -14.595 1.00 44.17  ? 437 LYS A CB   1 
ATOM   2036 C CG   . LYS A 1 141 ? 5.425   29.678 -13.482 1.00 54.09  ? 437 LYS A CG   1 
ATOM   2037 C CD   . LYS A 1 141 ? 6.386   28.552 -13.830 1.00 59.80  ? 437 LYS A CD   1 
ATOM   2038 C CE   . LYS A 1 141 ? 7.331   28.261 -12.675 1.00 63.08  ? 437 LYS A CE   1 
ATOM   2039 N NZ   . LYS A 1 141 ? 8.053   29.482 -12.216 1.00 64.24  ? 437 LYS A NZ   1 
ATOM   2040 H H    . LYS A 1 141 ? 2.719   29.978 -12.848 1.00 45.19  ? 437 LYS A H    1 
ATOM   2041 H HA   . LYS A 1 141 ? 4.004   31.881 -14.123 1.00 46.51  ? 437 LYS A HA   1 
ATOM   2042 H HB2  . LYS A 1 141 ? 3.901   29.123 -14.718 1.00 53.00  ? 437 LYS A HB2  1 
ATOM   2043 H HB3  . LYS A 1 141 ? 4.918   30.131 -15.405 1.00 53.00  ? 437 LYS A HB3  1 
ATOM   2044 H HG2  . LYS A 1 141 ? 5.944   30.483 -13.331 1.00 64.91  ? 437 LYS A HG2  1 
ATOM   2045 H HG3  . LYS A 1 141 ? 4.949   29.430 -12.674 1.00 64.91  ? 437 LYS A HG3  1 
ATOM   2046 H HD2  . LYS A 1 141 ? 5.881   27.747 -14.022 1.00 71.77  ? 437 LYS A HD2  1 
ATOM   2047 H HD3  . LYS A 1 141 ? 6.916   28.809 -14.600 1.00 71.77  ? 437 LYS A HD3  1 
ATOM   2048 H HE2  . LYS A 1 141 ? 6.820   27.913 -11.927 1.00 75.69  ? 437 LYS A HE2  1 
ATOM   2049 H HE3  . LYS A 1 141 ? 7.990   27.609 -12.960 1.00 75.69  ? 437 LYS A HE3  1 
ATOM   2050 H HZ1  . LYS A 1 141 ? 8.596   29.278 -11.541 1.00 77.09  ? 437 LYS A HZ1  1 
ATOM   2051 H HZ2  . LYS A 1 141 ? 8.536   29.819 -12.884 1.00 77.09  ? 437 LYS A HZ2  1 
ATOM   2052 H HZ3  . LYS A 1 141 ? 7.470   30.096 -11.942 1.00 77.09  ? 437 LYS A HZ3  1 
ATOM   2053 N N    . LEU A 1 142 ? 1.540   30.596 -15.724 1.00 29.15  ? 438 LEU A N    1 
ATOM   2054 C CA   . LEU A 1 142 ? 0.670   30.825 -16.872 1.00 29.47  ? 438 LEU A CA   1 
ATOM   2055 C C    . LEU A 1 142 ? -0.061  32.157 -16.759 1.00 30.69  ? 438 LEU A C    1 
ATOM   2056 O O    . LEU A 1 142 ? -0.288  32.832 -17.769 1.00 34.26  ? 438 LEU A O    1 
ATOM   2057 C CB   . LEU A 1 142 ? -0.320  29.669 -17.019 1.00 30.15  ? 438 LEU A CB   1 
ATOM   2058 C CG   . LEU A 1 142 ? 0.297   28.350 -17.490 1.00 34.88  ? 438 LEU A CG   1 
ATOM   2059 C CD1  . LEU A 1 142 ? -0.677  27.207 -17.306 1.00 28.48  ? 438 LEU A CD1  1 
ATOM   2060 C CD2  . LEU A 1 142 ? 0.724   28.443 -18.952 1.00 32.30  ? 438 LEU A CD2  1 
ATOM   2061 H H    . LEU A 1 142 ? 1.311   29.935 -15.223 1.00 34.98  ? 438 LEU A H    1 
ATOM   2062 H HA   . LEU A 1 142 ? 1.214   30.853 -17.675 1.00 35.36  ? 438 LEU A HA   1 
ATOM   2063 H HB2  . LEU A 1 142 ? -0.735  29.507 -16.157 1.00 36.18  ? 438 LEU A HB2  1 
ATOM   2064 H HB3  . LEU A 1 142 ? -0.998  29.923 -17.664 1.00 36.18  ? 438 LEU A HB3  1 
ATOM   2065 H HG   . LEU A 1 142 ? 1.086   28.161 -16.958 1.00 41.85  ? 438 LEU A HG   1 
ATOM   2066 H HD11 . LEU A 1 142 ? -0.261  26.386 -17.612 1.00 34.17  ? 438 LEU A HD11 1 
ATOM   2067 H HD12 . LEU A 1 142 ? -0.903  27.134 -16.366 1.00 34.17  ? 438 LEU A HD12 1 
ATOM   2068 H HD13 . LEU A 1 142 ? -1.476  27.388 -17.826 1.00 34.17  ? 438 LEU A HD13 1 
ATOM   2069 H HD21 . LEU A 1 142 ? 1.111   27.596 -19.222 1.00 38.76  ? 438 LEU A HD21 1 
ATOM   2070 H HD22 . LEU A 1 142 ? -0.054  28.641 -19.496 1.00 38.76  ? 438 LEU A HD22 1 
ATOM   2071 H HD23 . LEU A 1 142 ? 1.381   29.151 -19.043 1.00 38.76  ? 438 LEU A HD23 1 
ATOM   2072 N N    . ARG A 1 143 ? -0.442  32.553 -15.544 1.00 32.44  ? 439 ARG A N    1 
ATOM   2073 C CA   . ARG A 1 143 ? -1.053  33.866 -15.354 1.00 36.24  ? 439 ARG A CA   1 
ATOM   2074 C C    . ARG A 1 143 ? -0.108  34.977 -15.797 1.00 38.21  ? 439 ARG A C    1 
ATOM   2075 O O    . ARG A 1 143 ? -0.512  35.905 -16.508 1.00 39.77  ? 439 ARG A O    1 
ATOM   2076 C CB   . ARG A 1 143 ? -1.446  34.055 -13.890 1.00 41.27  ? 439 ARG A CB   1 
ATOM   2077 C CG   . ARG A 1 143 ? -2.693  33.302 -13.466 1.00 46.31  ? 439 ARG A CG   1 
ATOM   2078 C CD   . ARG A 1 143 ? -2.932  33.483 -11.979 1.00 53.88  ? 439 ARG A CD   1 
ATOM   2079 N NE   . ARG A 1 143 ? -4.233  34.088 -11.699 1.00 66.52  ? 439 ARG A NE   1 
ATOM   2080 C CZ   . ARG A 1 143 ? -5.162  33.581 -10.891 1.00 77.80  ? 439 ARG A CZ   1 
ATOM   2081 N NH1  . ARG A 1 143 ? -4.959  32.445 -10.240 1.00 79.57  ? 439 ARG A NH1  1 
ATOM   2082 N NH2  . ARG A 1 143 ? -6.306  34.231 -10.720 1.00 83.36  ? 439 ARG A NH2  1 
ATOM   2083 H H    . ARG A 1 143 ? -0.360  32.088 -14.825 1.00 38.93  ? 439 ARG A H    1 
ATOM   2084 H HA   . ARG A 1 143 ? -1.858  33.922 -15.892 1.00 43.49  ? 439 ARG A HA   1 
ATOM   2085 H HB2  . ARG A 1 143 ? -0.714  33.749 -13.331 1.00 49.52  ? 439 ARG A HB2  1 
ATOM   2086 H HB3  . ARG A 1 143 ? -1.604  34.998 -13.731 1.00 49.52  ? 439 ARG A HB3  1 
ATOM   2087 H HG2  . ARG A 1 143 ? -3.460  33.650 -13.947 1.00 55.57  ? 439 ARG A HG2  1 
ATOM   2088 H HG3  . ARG A 1 143 ? -2.578  32.356 -13.647 1.00 55.57  ? 439 ARG A HG3  1 
ATOM   2089 H HD2  . ARG A 1 143 ? -2.902  32.617 -11.545 1.00 64.66  ? 439 ARG A HD2  1 
ATOM   2090 H HD3  . ARG A 1 143 ? -2.245  34.063 -11.615 1.00 64.66  ? 439 ARG A HD3  1 
ATOM   2091 H HE   . ARG A 1 143 ? -4.414  34.832 -12.089 1.00 79.82  ? 439 ARG A HE   1 
ATOM   2092 H HH11 . ARG A 1 143 ? -4.220  32.017 -10.343 1.00 95.49  ? 439 ARG A HH11 1 
ATOM   2093 H HH12 . ARG A 1 143 ? -5.568  32.132 -9.719  1.00 95.49  ? 439 ARG A HH12 1 
ATOM   2094 H HH21 . ARG A 1 143 ? -6.447  34.970 -11.136 1.00 100.03 ? 439 ARG A HH21 1 
ATOM   2095 H HH22 . ARG A 1 143 ? -6.909  33.910 -10.197 1.00 100.03 ? 439 ARG A HH22 1 
ATOM   2096 N N    . SER A 1 144 ? 1.159   34.904 -15.379 1.00 42.17  ? 440 SER A N    1 
ATOM   2097 C CA   . SER A 1 144 ? 2.111   35.950 -15.735 1.00 43.15  ? 440 SER A CA   1 
ATOM   2098 C C    . SER A 1 144 ? 2.350   35.992 -17.237 1.00 45.21  ? 440 SER A C    1 
ATOM   2099 O O    . SER A 1 144 ? 2.722   37.038 -17.778 1.00 47.17  ? 440 SER A O    1 
ATOM   2100 C CB   . SER A 1 144 ? 3.432   35.737 -14.994 1.00 46.55  ? 440 SER A CB   1 
ATOM   2101 O OG   . SER A 1 144 ? 4.100   34.580 -15.465 1.00 47.55  ? 440 SER A OG   1 
ATOM   2102 H H    . SER A 1 144 ? 1.484   34.271 -14.897 1.00 50.60  ? 440 SER A H    1 
ATOM   2103 H HA   . SER A 1 144 ? 1.752   36.810 -15.466 1.00 51.78  ? 440 SER A HA   1 
ATOM   2104 H HB2  . SER A 1 144 ? 4.002   36.509 -15.137 1.00 55.86  ? 440 SER A HB2  1 
ATOM   2105 H HB3  . SER A 1 144 ? 3.249   35.632 -14.047 1.00 55.86  ? 440 SER A HB3  1 
ATOM   2106 H HG   . SER A 1 144 ? 3.618   33.902 -15.347 1.00 57.06  ? 440 SER A HG   1 
ATOM   2107 N N    . LEU A 1 145 ? 2.144   34.870 -17.922 1.00 38.29  ? 441 LEU A N    1 
ATOM   2108 C CA   . LEU A 1 145 ? 2.265   34.814 -19.371 1.00 37.06  ? 441 LEU A CA   1 
ATOM   2109 C C    . LEU A 1 145 ? 1.005   35.278 -20.090 1.00 35.47  ? 441 LEU A C    1 
ATOM   2110 O O    . LEU A 1 145 ? 1.013   35.350 -21.323 1.00 38.52  ? 441 LEU A O    1 
ATOM   2111 C CB   . LEU A 1 145 ? 2.604   33.386 -19.813 1.00 36.03  ? 441 LEU A CB   1 
ATOM   2112 C CG   . LEU A 1 145 ? 3.967   32.829 -19.398 1.00 38.33  ? 441 LEU A CG   1 
ATOM   2113 C CD1  . LEU A 1 145 ? 4.066   31.358 -19.771 1.00 40.58  ? 441 LEU A CD1  1 
ATOM   2114 C CD2  . LEU A 1 145 ? 5.105   33.614 -20.035 1.00 39.91  ? 441 LEU A CD2  1 
ATOM   2115 H H    . LEU A 1 145 ? 1.930   34.118 -17.563 1.00 45.95  ? 441 LEU A H    1 
ATOM   2116 H HA   . LEU A 1 145 ? 2.994   35.392 -19.646 1.00 44.47  ? 441 LEU A HA   1 
ATOM   2117 H HB2  . LEU A 1 145 ? 1.930   32.791 -19.449 1.00 43.24  ? 441 LEU A HB2  1 
ATOM   2118 H HB3  . LEU A 1 145 ? 2.566   33.355 -20.782 1.00 43.24  ? 441 LEU A HB3  1 
ATOM   2119 H HG   . LEU A 1 145 ? 4.057   32.901 -18.435 1.00 46.00  ? 441 LEU A HG   1 
ATOM   2120 H HD11 . LEU A 1 145 ? 4.935   31.022 -19.501 1.00 48.69  ? 441 LEU A HD11 1 
ATOM   2121 H HD12 . LEU A 1 145 ? 3.364   30.869 -19.313 1.00 48.69  ? 441 LEU A HD12 1 
ATOM   2122 H HD13 . LEU A 1 145 ? 3.960   31.269 -20.731 1.00 48.69  ? 441 LEU A HD13 1 
ATOM   2123 H HD21 . LEU A 1 145 ? 5.950   33.233 -19.749 1.00 47.90  ? 441 LEU A HD21 1 
ATOM   2124 H HD22 . LEU A 1 145 ? 5.026   33.557 -21.000 1.00 47.90  ? 441 LEU A HD22 1 
ATOM   2125 H HD23 . LEU A 1 145 ? 5.047   34.540 -19.752 1.00 47.90  ? 441 LEU A HD23 1 
ATOM   2126 N N    . GLN A 1 146 ? -0.067  35.589 -19.359 1.00 35.31  ? 442 GLN A N    1 
ATOM   2127 C CA   . GLN A 1 146 ? -1.336  36.000 -19.961 1.00 35.90  ? 442 GLN A CA   1 
ATOM   2128 C C    . GLN A 1 146 ? -1.941  34.867 -20.790 1.00 34.93  ? 442 GLN A C    1 
ATOM   2129 O O    . GLN A 1 146 ? -2.498  35.084 -21.867 1.00 33.70  ? 442 GLN A O    1 
ATOM   2130 C CB   . GLN A 1 146 ? -1.164  37.265 -20.805 1.00 44.89  ? 442 GLN A CB   1 
ATOM   2131 C CG   . GLN A 1 146 ? -0.608  38.450 -20.032 1.00 49.28  ? 442 GLN A CG   1 
ATOM   2132 C CD   . GLN A 1 146 ? -0.525  39.705 -20.876 1.00 53.96  ? 442 GLN A CD   1 
ATOM   2133 O OE1  . GLN A 1 146 ? -1.413  40.556 -20.831 1.00 56.49  ? 442 GLN A OE1  1 
ATOM   2134 N NE2  . GLN A 1 146 ? 0.543   39.825 -21.657 1.00 55.09  ? 442 GLN A NE2  1 
ATOM   2135 H H    . GLN A 1 146 ? -0.084  35.568 -18.500 1.00 42.38  ? 442 GLN A H    1 
ATOM   2136 H HA   . GLN A 1 146 ? -1.961  36.207 -19.249 1.00 43.08  ? 442 GLN A HA   1 
ATOM   2137 H HB2  . GLN A 1 146 ? -0.553  37.073 -21.534 1.00 53.87  ? 442 GLN A HB2  1 
ATOM   2138 H HB3  . GLN A 1 146 ? -2.029  37.523 -21.161 1.00 53.87  ? 442 GLN A HB3  1 
ATOM   2139 H HG2  . GLN A 1 146 ? -1.186  38.634 -19.275 1.00 59.14  ? 442 GLN A HG2  1 
ATOM   2140 H HG3  . GLN A 1 146 ? 0.287   38.235 -19.723 1.00 59.14  ? 442 GLN A HG3  1 
ATOM   2141 H HE21 . GLN A 1 146 ? 1.142   39.208 -21.664 1.00 66.11  ? 442 GLN A HE21 1 
ATOM   2142 H HE22 . GLN A 1 146 ? 0.636   40.520 -22.155 1.00 66.11  ? 442 GLN A HE22 1 
ATOM   2143 N N    . PHE A 1 147 ? -1.816  33.646 -20.277 1.00 32.39  ? 443 PHE A N    1 
ATOM   2144 C CA   . PHE A 1 147 ? -2.462  32.474 -20.858 1.00 30.73  ? 443 PHE A CA   1 
ATOM   2145 C C    . PHE A 1 147 ? -3.961  32.717 -21.024 1.00 29.83  ? 443 PHE A C    1 
ATOM   2146 O O    . PHE A 1 147 ? -4.644  33.080 -20.064 1.00 32.08  ? 443 PHE A O    1 
ATOM   2147 C CB   . PHE A 1 147 ? -2.191  31.286 -19.928 1.00 30.65  ? 443 PHE A CB   1 
ATOM   2148 C CG   . PHE A 1 147 ? -2.608  29.948 -20.465 1.00 33.48  ? 443 PHE A CG   1 
ATOM   2149 C CD1  . PHE A 1 147 ? -2.365  29.591 -21.779 1.00 32.87  ? 443 PHE A CD1  1 
ATOM   2150 C CD2  . PHE A 1 147 ? -3.198  29.019 -19.620 1.00 31.98  ? 443 PHE A CD2  1 
ATOM   2151 C CE1  . PHE A 1 147 ? -2.733  28.346 -22.248 1.00 31.99  ? 443 PHE A CE1  1 
ATOM   2152 C CE2  . PHE A 1 147 ? -3.569  27.776 -20.081 1.00 33.05  ? 443 PHE A CE2  1 
ATOM   2153 C CZ   . PHE A 1 147 ? -3.335  27.437 -21.398 1.00 30.85  ? 443 PHE A CZ   1 
ATOM   2154 H H    . PHE A 1 147 ? -1.351  33.468 -19.575 1.00 38.87  ? 443 PHE A H    1 
ATOM   2155 H HA   . PHE A 1 147 ? -2.077  32.285 -21.729 1.00 36.88  ? 443 PHE A HA   1 
ATOM   2156 H HB2  . PHE A 1 147 ? -1.238  31.245 -19.751 1.00 36.78  ? 443 PHE A HB2  1 
ATOM   2157 H HB3  . PHE A 1 147 ? -2.670  31.430 -19.098 1.00 36.78  ? 443 PHE A HB3  1 
ATOM   2158 H HD1  . PHE A 1 147 ? -1.961  30.199 -22.354 1.00 39.44  ? 443 PHE A HD1  1 
ATOM   2159 H HD2  . PHE A 1 147 ? -3.358  29.245 -18.732 1.00 38.38  ? 443 PHE A HD2  1 
ATOM   2160 H HE1  . PHE A 1 147 ? -2.576  28.119 -23.136 1.00 38.39  ? 443 PHE A HE1  1 
ATOM   2161 H HE2  . PHE A 1 147 ? -3.974  27.167 -19.507 1.00 39.66  ? 443 PHE A HE2  1 
ATOM   2162 H HZ   . PHE A 1 147 ? -3.585  26.598 -21.714 1.00 37.02  ? 443 PHE A HZ   1 
ATOM   2163 N N    . ASP A 1 148 ? -4.477  32.527 -22.244 1.00 28.69  ? 444 ASP A N    1 
ATOM   2164 C CA   . ASP A 1 148 ? -5.893  32.782 -22.520 1.00 29.22  ? 444 ASP A CA   1 
ATOM   2165 C C    . ASP A 1 148 ? -6.552  31.551 -23.140 1.00 30.61  ? 444 ASP A C    1 
ATOM   2166 O O    . ASP A 1 148 ? -5.920  30.510 -23.348 1.00 31.21  ? 444 ASP A O    1 
ATOM   2167 C CB   . ASP A 1 148 ? -6.080  34.023 -23.409 1.00 28.07  ? 444 ASP A CB   1 
ATOM   2168 C CG   . ASP A 1 148 ? -5.624  33.820 -24.852 1.00 30.80  ? 444 ASP A CG   1 
ATOM   2169 O OD1  . ASP A 1 148 ? -5.572  32.673 -25.347 1.00 33.45  ? 444 ASP A OD1  1 
ATOM   2170 O OD2  . ASP A 1 148 ? -5.339  34.842 -25.509 1.00 33.53  ? 444 ASP A OD2  1 
ATOM   2171 H H    . ASP A 1 148 ? -4.030  32.252 -22.925 1.00 34.43  ? 444 ASP A H    1 
ATOM   2172 H HA   . ASP A 1 148 ? -6.341  32.958 -21.678 1.00 35.06  ? 444 ASP A HA   1 
ATOM   2173 H HB2  . ASP A 1 148 ? -7.021  34.257 -23.425 1.00 33.69  ? 444 ASP A HB2  1 
ATOM   2174 H HB3  . ASP A 1 148 ? -5.565  34.756 -23.035 1.00 33.69  ? 444 ASP A HB3  1 
ATOM   2175 N N    . GLN A 1 149 ? -7.851  31.688 -23.442 1.00 32.45  ? 445 GLN A N    1 
ATOM   2176 C CA   . GLN A 1 149 ? -8.662  30.532 -23.818 1.00 28.91  ? 445 GLN A CA   1 
ATOM   2177 C C    . GLN A 1 149 ? -8.274  29.997 -25.190 1.00 28.42  ? 445 GLN A C    1 
ATOM   2178 O O    . GLN A 1 149 ? -8.342  28.785 -25.428 1.00 27.78  ? 445 GLN A O    1 
ATOM   2179 C CB   . GLN A 1 149 ? -10.148 30.896 -23.796 1.00 30.22  ? 445 GLN A CB   1 
ATOM   2180 C CG   . GLN A 1 149 ? -11.072 29.696 -24.000 1.00 31.31  ? 445 GLN A CG   1 
ATOM   2181 C CD   . GLN A 1 149 ? -12.530 30.083 -24.125 1.00 39.51  ? 445 GLN A CD   1 
ATOM   2182 O OE1  . GLN A 1 149 ? -12.857 31.207 -24.506 1.00 45.56  ? 445 GLN A OE1  1 
ATOM   2183 N NE2  . GLN A 1 149 ? -13.418 29.149 -23.804 1.00 41.05  ? 445 GLN A NE2  1 
ATOM   2184 H H    . GLN A 1 149 ? -8.278  32.434 -23.436 1.00 38.94  ? 445 GLN A H    1 
ATOM   2185 H HA   . GLN A 1 149 ? -8.519  29.824 -23.170 1.00 34.69  ? 445 GLN A HA   1 
ATOM   2186 H HB2  . GLN A 1 149 ? -10.361 31.293 -22.937 1.00 36.26  ? 445 GLN A HB2  1 
ATOM   2187 H HB3  . GLN A 1 149 ? -10.325 31.532 -24.506 1.00 36.26  ? 445 GLN A HB3  1 
ATOM   2188 H HG2  . GLN A 1 149 ? -10.815 29.236 -24.814 1.00 37.57  ? 445 GLN A HG2  1 
ATOM   2189 H HG3  . GLN A 1 149 ? -10.985 29.099 -23.241 1.00 37.57  ? 445 GLN A HG3  1 
ATOM   2190 H HE21 . GLN A 1 149 ? -13.152 28.374 -23.543 1.00 49.26  ? 445 GLN A HE21 1 
ATOM   2191 H HE22 . GLN A 1 149 ? -14.259 29.319 -23.858 1.00 49.26  ? 445 GLN A HE22 1 
ATOM   2192 N N    . ARG A 1 150 ? -7.891  30.883 -26.112 1.00 31.58  ? 446 ARG A N    1 
ATOM   2193 C CA   . ARG A 1 150 ? -7.442  30.435 -27.426 1.00 28.30  ? 446 ARG A CA   1 
ATOM   2194 C C    . ARG A 1 150 ? -6.215  29.541 -27.296 1.00 28.61  ? 446 ARG A C    1 
ATOM   2195 O O    . ARG A 1 150 ? -6.133  28.478 -27.923 1.00 29.40  ? 446 ARG A O    1 
ATOM   2196 C CB   . ARG A 1 150 ? -7.139  31.641 -28.320 1.00 28.14  ? 446 ARG A CB   1 
ATOM   2197 C CG   . ARG A 1 150 ? -8.369  32.306 -28.952 1.00 32.90  ? 446 ARG A CG   1 
ATOM   2198 C CD   . ARG A 1 150 ? -9.267  32.970 -27.916 1.00 37.75  ? 446 ARG A CD   1 
ATOM   2199 N NE   . ARG A 1 150 ? -8.582  34.035 -27.189 1.00 41.74  ? 446 ARG A NE   1 
ATOM   2200 C CZ   . ARG A 1 150 ? -9.127  34.742 -26.202 1.00 47.90  ? 446 ARG A CZ   1 
ATOM   2201 N NH1  . ARG A 1 150 ? -10.373 34.499 -25.813 1.00 51.14  ? 446 ARG A NH1  1 
ATOM   2202 N NH2  . ARG A 1 150 ? -8.427  35.695 -25.601 1.00 46.35  ? 446 ARG A NH2  1 
ATOM   2203 H H    . ARG A 1 150 ? -7.883  31.736 -26.001 1.00 37.90  ? 446 ARG A H    1 
ATOM   2204 H HA   . ARG A 1 150 ? -8.149  29.918 -27.844 1.00 33.95  ? 446 ARG A HA   1 
ATOM   2205 H HB2  . ARG A 1 150 ? -6.684  32.312 -27.788 1.00 33.77  ? 446 ARG A HB2  1 
ATOM   2206 H HB3  . ARG A 1 150 ? -6.560  31.351 -29.042 1.00 33.77  ? 446 ARG A HB3  1 
ATOM   2207 H HG2  . ARG A 1 150 ? -8.074  32.988 -29.576 1.00 39.48  ? 446 ARG A HG2  1 
ATOM   2208 H HG3  . ARG A 1 150 ? -8.891  31.633 -29.416 1.00 39.48  ? 446 ARG A HG3  1 
ATOM   2209 H HD2  . ARG A 1 150 ? -10.036 33.357 -28.363 1.00 45.29  ? 446 ARG A HD2  1 
ATOM   2210 H HD3  . ARG A 1 150 ? -9.557  32.304 -27.273 1.00 45.29  ? 446 ARG A HD3  1 
ATOM   2211 H HE   . ARG A 1 150 ? -7.772  34.216 -27.413 1.00 50.09  ? 446 ARG A HE   1 
ATOM   2212 H HH11 . ARG A 1 150 ? -10.832 33.883 -26.200 1.00 61.37  ? 446 ARG A HH11 1 
ATOM   2213 H HH12 . ARG A 1 150 ? -10.721 34.959 -25.175 1.00 61.37  ? 446 ARG A HH12 1 
ATOM   2214 H HH21 . ARG A 1 150 ? -7.619  35.856 -25.849 1.00 55.62  ? 446 ARG A HH21 1 
ATOM   2215 H HH22 . ARG A 1 150 ? -8.780  36.150 -24.963 1.00 55.62  ? 446 ARG A HH22 1 
ATOM   2216 N N    . GLU A 1 151 ? -5.252  29.957 -26.472 1.00 31.15  ? 447 GLU A N    1 
ATOM   2217 C CA   . GLU A 1 151 ? -4.064  29.145 -26.240 1.00 23.35  ? 447 GLU A CA   1 
ATOM   2218 C C    . GLU A 1 151 ? -4.406  27.862 -25.495 1.00 26.45  ? 447 GLU A C    1 
ATOM   2219 O O    . GLU A 1 151 ? -3.801  26.813 -25.750 1.00 25.41  ? 447 GLU A O    1 
ATOM   2220 C CB   . GLU A 1 151 ? -3.034  29.967 -25.465 1.00 28.00  ? 447 GLU A CB   1 
ATOM   2221 C CG   . GLU A 1 151 ? -2.493  31.152 -26.261 1.00 26.68  ? 447 GLU A CG   1 
ATOM   2222 C CD   . GLU A 1 151 ? -2.036  32.314 -25.399 1.00 29.61  ? 447 GLU A CD   1 
ATOM   2223 O OE1  . GLU A 1 151 ? -2.205  32.263 -24.159 1.00 28.83  ? 447 GLU A OE1  1 
ATOM   2224 O OE2  . GLU A 1 151 ? -1.512  33.292 -25.976 1.00 32.67  ? 447 GLU A OE2  1 
ATOM   2225 H H    . GLU A 1 151 ? -5.265  30.701 -26.039 1.00 37.38  ? 447 GLU A H    1 
ATOM   2226 H HA   . GLU A 1 151 ? -3.674  28.903 -27.095 1.00 28.02  ? 447 GLU A HA   1 
ATOM   2227 H HB2  . GLU A 1 151 ? -3.448  30.312 -24.659 1.00 33.59  ? 447 GLU A HB2  1 
ATOM   2228 H HB3  . GLU A 1 151 ? -2.285  29.396 -25.233 1.00 33.59  ? 447 GLU A HB3  1 
ATOM   2229 H HG2  . GLU A 1 151 ? -1.732  30.855 -26.785 1.00 32.01  ? 447 GLU A HG2  1 
ATOM   2230 H HG3  . GLU A 1 151 ? -3.191  31.477 -26.850 1.00 32.01  ? 447 GLU A HG3  1 
ATOM   2231 N N    . PHE A 1 152 ? -5.381  27.926 -24.587 1.00 28.92  ? 448 PHE A N    1 
ATOM   2232 C CA   . PHE A 1 152 ? -5.775  26.755 -23.808 1.00 27.30  ? 448 PHE A CA   1 
ATOM   2233 C C    . PHE A 1 152 ? -6.284  25.635 -24.708 1.00 28.73  ? 448 PHE A C    1 
ATOM   2234 O O    . PHE A 1 152 ? -5.832  24.489 -24.605 1.00 26.67  ? 448 PHE A O    1 
ATOM   2235 C CB   . PHE A 1 152 ? -6.838  27.170 -22.787 1.00 27.29  ? 448 PHE A CB   1 
ATOM   2236 C CG   . PHE A 1 152 ? -7.501  26.023 -22.072 1.00 28.65  ? 448 PHE A CG   1 
ATOM   2237 C CD1  . PHE A 1 152 ? -6.774  25.189 -21.240 1.00 28.11  ? 448 PHE A CD1  1 
ATOM   2238 C CD2  . PHE A 1 152 ? -8.865  25.810 -22.202 1.00 30.60  ? 448 PHE A CD2  1 
ATOM   2239 C CE1  . PHE A 1 152 ? -7.389  24.144 -20.565 1.00 32.17  ? 448 PHE A CE1  1 
ATOM   2240 C CE2  . PHE A 1 152 ? -9.490  24.771 -21.528 1.00 32.74  ? 448 PHE A CE2  1 
ATOM   2241 C CZ   . PHE A 1 152 ? -8.749  23.939 -20.705 1.00 33.48  ? 448 PHE A CZ   1 
ATOM   2242 H H    . PHE A 1 152 ? -5.829  28.637 -24.404 1.00 34.71  ? 448 PHE A H    1 
ATOM   2243 H HA   . PHE A 1 152 ? -5.004  26.424 -23.321 1.00 32.76  ? 448 PHE A HA   1 
ATOM   2244 H HB2  . PHE A 1 152 ? -6.421  27.733 -22.117 1.00 32.74  ? 448 PHE A HB2  1 
ATOM   2245 H HB3  . PHE A 1 152 ? -7.531  27.669 -23.247 1.00 32.74  ? 448 PHE A HB3  1 
ATOM   2246 H HD1  . PHE A 1 152 ? -5.859  25.325 -21.139 1.00 33.73  ? 448 PHE A HD1  1 
ATOM   2247 H HD2  . PHE A 1 152 ? -9.367  26.369 -22.750 1.00 36.72  ? 448 PHE A HD2  1 
ATOM   2248 H HE1  . PHE A 1 152 ? -6.889  23.586 -20.014 1.00 38.60  ? 448 PHE A HE1  1 
ATOM   2249 H HE2  . PHE A 1 152 ? -10.404 24.634 -21.628 1.00 39.29  ? 448 PHE A HE2  1 
ATOM   2250 H HZ   . PHE A 1 152 ? -9.163  23.237 -20.257 1.00 40.18  ? 448 PHE A HZ   1 
ATOM   2251 N N    . VAL A 1 153 ? -7.234  25.943 -25.597 1.00 30.63  ? 449 VAL A N    1 
ATOM   2252 C CA   . VAL A 1 153 ? -7.783  24.898 -26.457 1.00 25.80  ? 449 VAL A CA   1 
ATOM   2253 C C    . VAL A 1 153 ? -6.700  24.333 -27.366 1.00 24.20  ? 449 VAL A C    1 
ATOM   2254 O O    . VAL A 1 153 ? -6.704  23.136 -27.677 1.00 30.85  ? 449 VAL A O    1 
ATOM   2255 C CB   . VAL A 1 153 ? -8.995  25.425 -27.256 1.00 32.57  ? 449 VAL A CB   1 
ATOM   2256 C CG1  . VAL A 1 153 ? -10.122 25.812 -26.302 1.00 31.82  ? 449 VAL A CG1  1 
ATOM   2257 C CG2  . VAL A 1 153 ? -8.617  26.604 -28.154 1.00 34.29  ? 449 VAL A CG2  1 
ATOM   2258 H H    . VAL A 1 153 ? -7.567  26.727 -25.717 1.00 36.76  ? 449 VAL A H    1 
ATOM   2259 H HA   . VAL A 1 153 ? -8.098  24.173 -25.895 1.00 30.95  ? 449 VAL A HA   1 
ATOM   2260 H HB   . VAL A 1 153 ? -9.324  24.713 -27.827 1.00 39.08  ? 449 VAL A HB   1 
ATOM   2261 H HG11 . VAL A 1 153 ? -10.875 26.140 -26.819 1.00 38.18  ? 449 VAL A HG11 1 
ATOM   2262 H HG12 . VAL A 1 153 ? -10.386 25.029 -25.792 1.00 38.18  ? 449 VAL A HG12 1 
ATOM   2263 H HG13 . VAL A 1 153 ? -9.804  26.505 -25.703 1.00 38.18  ? 449 VAL A HG13 1 
ATOM   2264 H HG21 . VAL A 1 153 ? -9.405  26.900 -28.634 1.00 41.14  ? 449 VAL A HG21 1 
ATOM   2265 H HG22 . VAL A 1 153 ? -8.275  27.324 -27.602 1.00 41.14  ? 449 VAL A HG22 1 
ATOM   2266 H HG23 . VAL A 1 153 ? -7.935  26.315 -28.782 1.00 41.14  ? 449 VAL A HG23 1 
ATOM   2267 N N    . CYS A 1 154 ? -5.737  25.162 -27.780 1.00 26.74  ? 450 CYS A N    1 
ATOM   2268 C CA   . CYS A 1 154 ? -4.618  24.650 -28.566 1.00 25.69  ? 450 CYS A CA   1 
ATOM   2269 C C    . CYS A 1 154 ? -3.824  23.612 -27.785 1.00 29.15  ? 450 CYS A C    1 
ATOM   2270 O O    . CYS A 1 154 ? -3.468  22.557 -28.324 1.00 40.48  ? 450 CYS A O    1 
ATOM   2271 C CB   . CYS A 1 154 ? -3.703  25.795 -29.002 1.00 31.70  ? 450 CYS A CB   1 
ATOM   2272 S SG   . CYS A 1 154 ? -4.346  26.807 -30.356 1.00 23.75  ? 450 CYS A SG   1 
ATOM   2273 H H    . CYS A 1 154 ? -5.711  26.007 -27.621 1.00 32.08  ? 450 CYS A H    1 
ATOM   2274 H HA   . CYS A 1 154 ? -4.964  24.223 -29.365 1.00 30.83  ? 450 CYS A HA   1 
ATOM   2275 H HB2  . CYS A 1 154 ? -3.556  26.380 -28.243 1.00 38.04  ? 450 CYS A HB2  1 
ATOM   2276 H HB3  . CYS A 1 154 ? -2.856  25.421 -29.293 1.00 38.04  ? 450 CYS A HB3  1 
ATOM   2277 H HG   . CYS A 1 154 ? -5.386  27.299 -30.015 1.00 28.49  ? 450 CYS A HG   1 
ATOM   2278 N N    . LEU A 1 155 ? -3.532  23.889 -26.511 1.00 26.86  ? 451 LEU A N    1 
ATOM   2279 C CA   . LEU A 1 155 ? -2.759  22.939 -25.719 1.00 28.36  ? 451 LEU A CA   1 
ATOM   2280 C C    . LEU A 1 155 ? -3.544  21.656 -25.487 1.00 24.20  ? 451 LEU A C    1 
ATOM   2281 O O    . LEU A 1 155 ? -2.968  20.562 -25.495 1.00 23.52  ? 451 LEU A O    1 
ATOM   2282 C CB   . LEU A 1 155 ? -2.346  23.570 -24.387 1.00 25.80  ? 451 LEU A CB   1 
ATOM   2283 C CG   . LEU A 1 155 ? -1.377  24.760 -24.442 1.00 29.58  ? 451 LEU A CG   1 
ATOM   2284 C CD1  . LEU A 1 155 ? -0.904  25.118 -23.031 1.00 29.21  ? 451 LEU A CD1  1 
ATOM   2285 C CD2  . LEU A 1 155 ? -0.186  24.500 -25.346 1.00 34.47  ? 451 LEU A CD2  1 
ATOM   2286 H H    . LEU A 1 155 ? -3.766  24.604 -26.094 1.00 32.23  ? 451 LEU A H    1 
ATOM   2287 H HA   . LEU A 1 155 ? -1.950  22.711 -26.204 1.00 34.03  ? 451 LEU A HA   1 
ATOM   2288 H HB2  . LEU A 1 155 ? -3.149  23.877 -23.938 1.00 30.96  ? 451 LEU A HB2  1 
ATOM   2289 H HB3  . LEU A 1 155 ? -1.922  22.883 -23.848 1.00 30.96  ? 451 LEU A HB3  1 
ATOM   2290 H HG   . LEU A 1 155 ? -1.851  25.529 -24.796 1.00 35.49  ? 451 LEU A HG   1 
ATOM   2291 H HD11 . LEU A 1 155 ? -0.294  25.871 -23.084 1.00 35.05  ? 451 LEU A HD11 1 
ATOM   2292 H HD12 . LEU A 1 155 ? -1.674  25.354 -22.490 1.00 35.05  ? 451 LEU A HD12 1 
ATOM   2293 H HD13 . LEU A 1 155 ? -0.451  24.352 -22.646 1.00 35.05  ? 451 LEU A HD13 1 
ATOM   2294 H HD21 . LEU A 1 155 ? 0.390   25.281 -25.342 1.00 41.36  ? 451 LEU A HD21 1 
ATOM   2295 H HD22 . LEU A 1 155 ? 0.300   23.729 -25.012 1.00 41.36  ? 451 LEU A HD22 1 
ATOM   2296 H HD23 . LEU A 1 155 ? -0.504  24.327 -26.245 1.00 41.36  ? 451 LEU A HD23 1 
ATOM   2297 N N    . LYS A 1 156 ? -4.861  21.766 -25.300 1.00 22.98  ? 452 LYS A N    1 
ATOM   2298 C CA   . LYS A 1 156 ? -5.687  20.575 -25.130 1.00 26.58  ? 452 LYS A CA   1 
ATOM   2299 C C    . LYS A 1 156 ? -5.558  19.648 -26.331 1.00 25.31  ? 452 LYS A C    1 
ATOM   2300 O O    . LYS A 1 156 ? -5.423  18.428 -26.179 1.00 30.31  ? 452 LYS A O    1 
ATOM   2301 C CB   . LYS A 1 156 ? -7.149  20.966 -24.934 1.00 29.55  ? 452 LYS A CB   1 
ATOM   2302 C CG   . LYS A 1 156 ? -7.488  21.531 -23.572 1.00 36.37  ? 452 LYS A CG   1 
ATOM   2303 C CD   . LYS A 1 156 ? -8.975  21.852 -23.480 1.00 42.15  ? 452 LYS A CD   1 
ATOM   2304 C CE   . LYS A 1 156 ? -9.832  20.601 -23.406 1.00 49.27  ? 452 LYS A CE   1 
ATOM   2305 N NZ   . LYS A 1 156 ? -11.289 20.928 -23.393 1.00 51.06  ? 452 LYS A NZ   1 
ATOM   2306 H H    . LYS A 1 156 ? -5.293  22.509 -25.268 1.00 27.57  ? 452 LYS A H    1 
ATOM   2307 H HA   . LYS A 1 156 ? -5.393  20.092 -24.342 1.00 31.90  ? 452 LYS A HA   1 
ATOM   2308 H HB2  . LYS A 1 156 ? -7.380  21.638 -25.594 1.00 35.46  ? 452 LYS A HB2  1 
ATOM   2309 H HB3  . LYS A 1 156 ? -7.699  20.178 -25.067 1.00 35.46  ? 452 LYS A HB3  1 
ATOM   2310 H HG2  . LYS A 1 156 ? -7.271  20.879 -22.888 1.00 43.64  ? 452 LYS A HG2  1 
ATOM   2311 H HG3  . LYS A 1 156 ? -6.988  22.350 -23.429 1.00 43.64  ? 452 LYS A HG3  1 
ATOM   2312 H HD2  . LYS A 1 156 ? -9.138  22.375 -22.680 1.00 50.58  ? 452 LYS A HD2  1 
ATOM   2313 H HD3  . LYS A 1 156 ? -9.241  22.353 -24.266 1.00 50.58  ? 452 LYS A HD3  1 
ATOM   2314 H HE2  . LYS A 1 156 ? -9.653  20.045 -24.181 1.00 59.13  ? 452 LYS A HE2  1 
ATOM   2315 H HE3  . LYS A 1 156 ? -9.622  20.118 -22.591 1.00 59.13  ? 452 LYS A HE3  1 
ATOM   2316 H HZ1  . LYS A 1 156 ? -11.768 20.179 -23.350 1.00 61.27  ? 452 LYS A HZ1  1 
ATOM   2317 H HZ2  . LYS A 1 156 ? -11.481 21.435 -22.688 1.00 61.27  ? 452 LYS A HZ2  1 
ATOM   2318 H HZ3  . LYS A 1 156 ? -11.508 21.369 -24.135 1.00 61.27  ? 452 LYS A HZ3  1 
ATOM   2319 N N    . PHE A 1 157 ? -5.614  20.210 -27.539 1.00 26.50  ? 453 PHE A N    1 
ATOM   2320 C CA   . PHE A 1 157 ? -5.511  19.383 -28.735 1.00 26.79  ? 453 PHE A CA   1 
ATOM   2321 C C    . PHE A 1 157 ? -4.095  18.864 -28.943 1.00 26.68  ? 453 PHE A C    1 
ATOM   2322 O O    . PHE A 1 157 ? -3.918  17.744 -29.435 1.00 26.65  ? 453 PHE A O    1 
ATOM   2323 C CB   . PHE A 1 157 ? -5.987  20.166 -29.958 1.00 25.34  ? 453 PHE A CB   1 
ATOM   2324 C CG   . PHE A 1 157 ? -7.471  20.084 -30.178 1.00 27.41  ? 453 PHE A CG   1 
ATOM   2325 C CD1  . PHE A 1 157 ? -8.340  20.838 -29.410 1.00 26.60  ? 453 PHE A CD1  1 
ATOM   2326 C CD2  . PHE A 1 157 ? -7.994  19.245 -31.146 1.00 32.78  ? 453 PHE A CD2  1 
ATOM   2327 C CE1  . PHE A 1 157 ? -9.706  20.758 -29.602 1.00 27.24  ? 453 PHE A CE1  1 
ATOM   2328 C CE2  . PHE A 1 157 ? -9.358  19.163 -31.348 1.00 35.02  ? 453 PHE A CE2  1 
ATOM   2329 C CZ   . PHE A 1 157 ? -10.216 19.919 -30.574 1.00 32.94  ? 453 PHE A CZ   1 
ATOM   2330 H H    . PHE A 1 157 ? -5.709  21.052 -27.689 1.00 31.80  ? 453 PHE A H    1 
ATOM   2331 H HA   . PHE A 1 157 ? -6.094  18.614 -28.632 1.00 32.15  ? 453 PHE A HA   1 
ATOM   2332 H HB2  . PHE A 1 157 ? -5.755  21.101 -29.842 1.00 30.41  ? 453 PHE A HB2  1 
ATOM   2333 H HB3  . PHE A 1 157 ? -5.549  19.813 -30.748 1.00 30.41  ? 453 PHE A HB3  1 
ATOM   2334 H HD1  . PHE A 1 157 ? -8.001  21.403 -28.753 1.00 31.92  ? 453 PHE A HD1  1 
ATOM   2335 H HD2  . PHE A 1 157 ? -7.420  18.732 -31.669 1.00 39.33  ? 453 PHE A HD2  1 
ATOM   2336 H HE1  . PHE A 1 157 ? -10.281 21.271 -29.081 1.00 32.69  ? 453 PHE A HE1  1 
ATOM   2337 H HE2  . PHE A 1 157 ? -9.698  18.596 -32.002 1.00 42.02  ? 453 PHE A HE2  1 
ATOM   2338 H HZ   . PHE A 1 157 ? -11.135 19.866 -30.708 1.00 39.52  ? 453 PHE A HZ   1 
ATOM   2339 N N    . LEU A 1 158 ? -3.078  19.647 -28.572 1.00 28.70  ? 454 LEU A N    1 
ATOM   2340 C CA   . LEU A 1 158 ? -1.707  19.148 -28.654 1.00 29.20  ? 454 LEU A CA   1 
ATOM   2341 C C    . LEU A 1 158 ? -1.502  17.973 -27.707 1.00 28.65  ? 454 LEU A C    1 
ATOM   2342 O O    . LEU A 1 158 ? -0.798  17.012 -28.038 1.00 30.09  ? 454 LEU A O    1 
ATOM   2343 C CB   . LEU A 1 158 ? -0.712  20.268 -28.338 1.00 28.95  ? 454 LEU A CB   1 
ATOM   2344 C CG   . LEU A 1 158 ? -0.562  21.401 -29.358 1.00 32.43  ? 454 LEU A CG   1 
ATOM   2345 C CD1  . LEU A 1 158 ? 0.406   22.461 -28.847 1.00 33.61  ? 454 LEU A CD1  1 
ATOM   2346 C CD2  . LEU A 1 158 ? -0.086  20.871 -30.702 1.00 36.83  ? 454 LEU A CD2  1 
ATOM   2347 H H    . LEU A 1 158 ? -3.153  20.451 -28.276 1.00 34.45  ? 454 LEU A H    1 
ATOM   2348 H HA   . LEU A 1 158 ? -1.536  18.840 -29.558 1.00 35.04  ? 454 LEU A HA   1 
ATOM   2349 H HB2  . LEU A 1 158 ? -0.978  20.676 -27.499 1.00 34.73  ? 454 LEU A HB2  1 
ATOM   2350 H HB3  . LEU A 1 158 ? 0.165   19.866 -28.230 1.00 34.73  ? 454 LEU A HB3  1 
ATOM   2351 H HG   . LEU A 1 158 ? -1.425  21.822 -29.491 1.00 38.91  ? 454 LEU A HG   1 
ATOM   2352 H HD11 . LEU A 1 158 ? 0.482   23.164 -29.511 1.00 40.33  ? 454 LEU A HD11 1 
ATOM   2353 H HD12 . LEU A 1 158 ? 0.064   22.826 -28.016 1.00 40.33  ? 454 LEU A HD12 1 
ATOM   2354 H HD13 . LEU A 1 158 ? 1.272   22.051 -28.698 1.00 40.33  ? 454 LEU A HD13 1 
ATOM   2355 H HD21 . LEU A 1 158 ? -0.002  21.612 -31.321 1.00 44.20  ? 454 LEU A HD21 1 
ATOM   2356 H HD22 . LEU A 1 158 ? 0.775   20.439 -30.584 1.00 44.20  ? 454 LEU A HD22 1 
ATOM   2357 H HD23 . LEU A 1 158 ? -0.734  20.231 -31.036 1.00 44.20  ? 454 LEU A HD23 1 
ATOM   2358 N N    . VAL A 1 159 ? -2.104  18.038 -26.519 1.00 30.35  ? 455 VAL A N    1 
ATOM   2359 C CA   . VAL A 1 159 ? -2.031  16.924 -25.579 1.00 30.74  ? 455 VAL A CA   1 
ATOM   2360 C C    . VAL A 1 159 ? -2.783  15.715 -26.123 1.00 30.72  ? 455 VAL A C    1 
ATOM   2361 O O    . VAL A 1 159 ? -2.306  14.575 -26.033 1.00 28.34  ? 455 VAL A O    1 
ATOM   2362 C CB   . VAL A 1 159 ? -2.578  17.368 -24.210 1.00 35.78  ? 455 VAL A CB   1 
ATOM   2363 C CG1  . VAL A 1 159 ? -2.776  16.181 -23.280 1.00 37.36  ? 455 VAL A CG1  1 
ATOM   2364 C CG2  . VAL A 1 159 ? -1.640  18.386 -23.579 1.00 35.36  ? 455 VAL A CG2  1 
ATOM   2365 H H    . VAL A 1 159 ? -2.557  18.711 -26.237 1.00 36.42  ? 455 VAL A H    1 
ATOM   2366 H HA   . VAL A 1 159 ? -1.102  16.670 -25.462 1.00 36.88  ? 455 VAL A HA   1 
ATOM   2367 H HB   . VAL A 1 159 ? -3.439  17.794 -24.339 1.00 42.94  ? 455 VAL A HB   1 
ATOM   2368 H HG11 . VAL A 1 159 ? -3.120  16.500 -22.431 1.00 44.83  ? 455 VAL A HG11 1 
ATOM   2369 H HG12 . VAL A 1 159 ? -3.408  15.566 -23.684 1.00 44.83  ? 455 VAL A HG12 1 
ATOM   2370 H HG13 . VAL A 1 159 ? -1.923  15.739 -23.147 1.00 44.83  ? 455 VAL A HG13 1 
ATOM   2371 H HG21 . VAL A 1 159 ? -1.999  18.654 -22.719 1.00 42.43  ? 455 VAL A HG21 1 
ATOM   2372 H HG22 . VAL A 1 159 ? -0.767  17.980 -23.462 1.00 42.43  ? 455 VAL A HG22 1 
ATOM   2373 H HG23 . VAL A 1 159 ? -1.571  19.156 -24.165 1.00 42.43  ? 455 VAL A HG23 1 
ATOM   2374 N N    . LEU A 1 160 ? -3.969  15.942 -26.692 1.00 26.18  ? 456 LEU A N    1 
ATOM   2375 C CA   . LEU A 1 160 ? -4.767  14.843 -27.227 1.00 27.19  ? 456 LEU A CA   1 
ATOM   2376 C C    . LEU A 1 160 ? -4.089  14.201 -28.433 1.00 30.59  ? 456 LEU A C    1 
ATOM   2377 O O    . LEU A 1 160 ? -3.976  12.972 -28.509 1.00 34.37  ? 456 LEU A O    1 
ATOM   2378 C CB   . LEU A 1 160 ? -6.166  15.348 -27.595 1.00 28.16  ? 456 LEU A CB   1 
ATOM   2379 C CG   . LEU A 1 160 ? -7.147  14.326 -28.178 1.00 29.92  ? 456 LEU A CG   1 
ATOM   2380 C CD1  . LEU A 1 160 ? -7.410  13.195 -27.193 1.00 34.00  ? 456 LEU A CD1  1 
ATOM   2381 C CD2  . LEU A 1 160 ? -8.459  14.999 -28.579 1.00 31.05  ? 456 LEU A CD2  1 
ATOM   2382 H H    . LEU A 1 160 ? -4.330  16.718 -26.779 1.00 31.41  ? 456 LEU A H    1 
ATOM   2383 H HA   . LEU A 1 160 ? -4.865  14.163 -26.542 1.00 32.63  ? 456 LEU A HA   1 
ATOM   2384 H HB2  . LEU A 1 160 ? -6.575  15.712 -26.794 1.00 33.79  ? 456 LEU A HB2  1 
ATOM   2385 H HB3  . LEU A 1 160 ? -6.068  16.055 -28.252 1.00 33.79  ? 456 LEU A HB3  1 
ATOM   2386 H HG   . LEU A 1 160 ? -6.757  13.939 -28.977 1.00 35.90  ? 456 LEU A HG   1 
ATOM   2387 H HD11 . LEU A 1 160 ? -8.033  12.567 -27.592 1.00 40.80  ? 456 LEU A HD11 1 
ATOM   2388 H HD12 . LEU A 1 160 ? -6.572  12.748 -26.995 1.00 40.80  ? 456 LEU A HD12 1 
ATOM   2389 H HD13 . LEU A 1 160 ? -7.788  13.565 -26.380 1.00 40.80  ? 456 LEU A HD13 1 
ATOM   2390 H HD21 . LEU A 1 160 ? -9.058  14.329 -28.944 1.00 37.26  ? 456 LEU A HD21 1 
ATOM   2391 H HD22 . LEU A 1 160 ? -8.857  15.408 -27.794 1.00 37.26  ? 456 LEU A HD22 1 
ATOM   2392 H HD23 . LEU A 1 160 ? -8.274  15.677 -29.248 1.00 37.26  ? 456 LEU A HD23 1 
ATOM   2393 N N    . PHE A 1 161 ? -3.621  15.017 -29.380 1.00 23.38  ? 457 PHE A N    1 
ATOM   2394 C CA   . PHE A 1 161 ? -3.016  14.513 -30.616 1.00 32.47  ? 457 PHE A CA   1 
ATOM   2395 C C    . PHE A 1 161 ? -1.502  14.400 -30.441 1.00 35.68  ? 457 PHE A C    1 
ATOM   2396 O O    . PHE A 1 161 ? -0.701  15.075 -31.090 1.00 40.11  ? 457 PHE A O    1 
ATOM   2397 C CB   . PHE A 1 161 ? -3.375  15.412 -31.790 1.00 31.25  ? 457 PHE A CB   1 
ATOM   2398 C CG   . PHE A 1 161 ? -4.785  15.237 -32.273 1.00 32.88  ? 457 PHE A CG   1 
ATOM   2399 C CD1  . PHE A 1 161 ? -5.834  15.868 -31.629 1.00 31.80  ? 457 PHE A CD1  1 
ATOM   2400 C CD2  . PHE A 1 161 ? -5.060  14.437 -33.370 1.00 36.47  ? 457 PHE A CD2  1 
ATOM   2401 C CE1  . PHE A 1 161 ? -7.134  15.705 -32.072 1.00 29.84  ? 457 PHE A CE1  1 
ATOM   2402 C CE2  . PHE A 1 161 ? -6.356  14.269 -33.813 1.00 34.67  ? 457 PHE A CE2  1 
ATOM   2403 C CZ   . PHE A 1 161 ? -7.393  14.903 -33.164 1.00 30.66  ? 457 PHE A CZ   1 
ATOM   2404 H H    . PHE A 1 161 ? -3.643  15.875 -29.330 1.00 28.06  ? 457 PHE A H    1 
ATOM   2405 H HA   . PHE A 1 161 ? -3.364  13.626 -30.799 1.00 38.96  ? 457 PHE A HA   1 
ATOM   2406 H HB2  . PHE A 1 161 ? -3.266  16.337 -31.521 1.00 37.50  ? 457 PHE A HB2  1 
ATOM   2407 H HB3  . PHE A 1 161 ? -2.781  15.213 -32.530 1.00 37.50  ? 457 PHE A HB3  1 
ATOM   2408 H HD1  . PHE A 1 161 ? -5.663  16.408 -30.891 1.00 38.16  ? 457 PHE A HD1  1 
ATOM   2409 H HD2  . PHE A 1 161 ? -4.364  14.005 -33.810 1.00 43.76  ? 457 PHE A HD2  1 
ATOM   2410 H HE1  . PHE A 1 161 ? -7.833  16.133 -31.632 1.00 35.81  ? 457 PHE A HE1  1 
ATOM   2411 H HE2  . PHE A 1 161 ? -6.530  13.730 -34.551 1.00 41.61  ? 457 PHE A HE2  1 
ATOM   2412 H HZ   . PHE A 1 161 ? -8.267  14.793 -33.464 1.00 36.79  ? 457 PHE A HZ   1 
ATOM   2413 N N    . SER A 1 162 ? -1.120  13.500 -29.545 1.00 42.04  ? 458 SER A N    1 
ATOM   2414 C CA   . SER A 1 162 ? 0.285   13.300 -29.239 1.00 48.64  ? 458 SER A CA   1 
ATOM   2415 C C    . SER A 1 162 ? 0.983   12.511 -30.345 1.00 52.00  ? 458 SER A C    1 
ATOM   2416 O O    . SER A 1 162 ? 0.390   11.637 -30.982 1.00 53.24  ? 458 SER A O    1 
ATOM   2417 C CB   . SER A 1 162 ? 0.423   12.566 -27.910 1.00 54.31  ? 458 SER A CB   1 
ATOM   2418 O OG   . SER A 1 162 ? 1.731   12.062 -27.764 1.00 60.54  ? 458 SER A OG   1 
ATOM   2419 H HA   . SER A 1 162 ? 0.722   14.163 -29.158 1.00 58.36  ? 458 SER A HA   1 
ATOM   2420 H HB2  . SER A 1 162 ? 0.238   13.184 -27.186 1.00 65.17  ? 458 SER A HB2  1 
ATOM   2421 H HB3  . SER A 1 162 ? -0.206  11.828 -27.888 1.00 65.17  ? 458 SER A HB3  1 
ATOM   2422 H HG   . SER A 1 162 ? 1.803   11.659 -27.031 1.00 72.64  ? 458 SER A HG   1 
ATOM   2423 N N    . LEU A 1 163 ? 2.261   12.831 -30.571 1.00 56.54  ? 459 LEU A N    1 
ATOM   2424 C CA   . LEU A 1 163 ? 3.102   12.079 -31.499 1.00 66.62  ? 459 LEU A CA   1 
ATOM   2425 C C    . LEU A 1 163 ? 3.835   10.919 -30.833 1.00 72.36  ? 459 LEU A C    1 
ATOM   2426 O O    . LEU A 1 163 ? 4.364   10.056 -31.544 1.00 76.59  ? 459 LEU A O    1 
ATOM   2427 C CB   . LEU A 1 163 ? 4.133   13.006 -32.167 1.00 69.56  ? 459 LEU A CB   1 
ATOM   2428 C CG   . LEU A 1 163 ? 3.593   14.222 -32.926 1.00 70.38  ? 459 LEU A CG   1 
ATOM   2429 C CD1  . LEU A 1 163 ? 4.722   14.951 -33.633 1.00 72.75  ? 459 LEU A CD1  1 
ATOM   2430 C CD2  . LEU A 1 163 ? 2.512   13.825 -33.924 1.00 71.85  ? 459 LEU A CD2  1 
ATOM   2431 H H    . LEU A 1 163 ? 2.667   13.487 -30.192 1.00 67.85  ? 459 LEU A H    1 
ATOM   2432 H HA   . LEU A 1 163 ? 2.539   11.710 -32.198 1.00 79.94  ? 459 LEU A HA   1 
ATOM   2433 H HB2  . LEU A 1 163 ? 4.727   13.341 -31.478 1.00 83.47  ? 459 LEU A HB2  1 
ATOM   2434 H HB3  . LEU A 1 163 ? 4.645   12.479 -32.800 1.00 83.47  ? 459 LEU A HB3  1 
ATOM   2435 H HG   . LEU A 1 163 ? 3.197   14.836 -32.289 1.00 84.45  ? 459 LEU A HG   1 
ATOM   2436 H HD11 . LEU A 1 163 ? 4.356   15.715 -34.105 1.00 87.30  ? 459 LEU A HD11 1 
ATOM   2437 H HD12 . LEU A 1 163 ? 5.368   15.248 -32.973 1.00 87.30  ? 459 LEU A HD12 1 
ATOM   2438 H HD13 . LEU A 1 163 ? 5.144   14.345 -34.261 1.00 87.30  ? 459 LEU A HD13 1 
ATOM   2439 H HD21 . LEU A 1 163 ? 2.198   14.621 -34.381 1.00 86.22  ? 459 LEU A HD21 1 
ATOM   2440 H HD22 . LEU A 1 163 ? 2.888   13.201 -34.564 1.00 86.22  ? 459 LEU A HD22 1 
ATOM   2441 H HD23 . LEU A 1 163 ? 1.779   13.408 -33.445 1.00 86.22  ? 459 LEU A HD23 1 
ATOM   2442 N N    . ASP A 1 164 ? 3.889   10.878 -29.499 1.00 72.80  ? 460 ASP A N    1 
ATOM   2443 C CA   . ASP A 1 164 ? 4.544   9.782  -28.791 1.00 76.45  ? 460 ASP A CA   1 
ATOM   2444 C C    . ASP A 1 164 ? 3.647   8.558  -28.636 1.00 70.92  ? 460 ASP A C    1 
ATOM   2445 O O    . ASP A 1 164 ? 4.064   7.586  -27.996 1.00 70.53  ? 460 ASP A O    1 
ATOM   2446 C CB   . ASP A 1 164 ? 5.044   10.247 -27.410 1.00 82.89  ? 460 ASP A CB   1 
ATOM   2447 C CG   . ASP A 1 164 ? 3.944   10.827 -26.535 1.00 85.36  ? 460 ASP A CG   1 
ATOM   2448 O OD1  . ASP A 1 164 ? 2.809   10.304 -26.549 1.00 86.48  ? 460 ASP A OD1  1 
ATOM   2449 O OD2  . ASP A 1 164 ? 4.217   11.817 -25.822 1.00 85.44  ? 460 ASP A OD2  1 
ATOM   2450 H H    . ASP A 1 164 ? 3.552   11.477 -28.981 1.00 87.36  ? 460 ASP A H    1 
ATOM   2451 H HA   . ASP A 1 164 ? 5.320   9.508  -29.304 1.00 91.74  ? 460 ASP A HA   1 
ATOM   2452 H HB2  . ASP A 1 164 ? 5.428   9.488  -26.943 1.00 99.46  ? 460 ASP A HB2  1 
ATOM   2453 H HB3  . ASP A 1 164 ? 5.719   10.933 -27.535 1.00 99.46  ? 460 ASP A HB3  1 
ATOM   2454 N N    . VAL A 1 165 ? 2.440   8.578  -29.196 1.00 66.43  ? 461 VAL A N    1 
ATOM   2455 C CA   . VAL A 1 165 ? 1.589   7.394  -29.226 1.00 65.70  ? 461 VAL A CA   1 
ATOM   2456 C C    . VAL A 1 165 ? 2.014   6.511  -30.394 1.00 67.26  ? 461 VAL A C    1 
ATOM   2457 O O    . VAL A 1 165 ? 1.987   6.936  -31.550 1.00 66.91  ? 461 VAL A O    1 
ATOM   2458 C CB   . VAL A 1 165 ? 0.093   7.770  -29.329 1.00 62.40  ? 461 VAL A CB   1 
ATOM   2459 C CG1  . VAL A 1 165 ? -0.765  6.528  -29.554 1.00 63.66  ? 461 VAL A CG1  1 
ATOM   2460 C CG2  . VAL A 1 165 ? -0.363  8.500  -28.071 1.00 60.51  ? 461 VAL A CG2  1 
ATOM   2461 H H    . VAL A 1 165 ? 2.090   9.270  -29.569 1.00 79.72  ? 461 VAL A H    1 
ATOM   2462 H HA   . VAL A 1 165 ? 1.717   6.891  -28.406 1.00 78.84  ? 461 VAL A HA   1 
ATOM   2463 H HB   . VAL A 1 165 ? -0.033  8.365  -30.085 1.00 74.88  ? 461 VAL A HB   1 
ATOM   2464 H HG11 . VAL A 1 165 ? -1.696  6.796  -29.615 1.00 76.39  ? 461 VAL A HG11 1 
ATOM   2465 H HG12 . VAL A 1 165 ? -0.489  6.100  -30.380 1.00 76.39  ? 461 VAL A HG12 1 
ATOM   2466 H HG13 . VAL A 1 165 ? -0.643  5.921  -28.808 1.00 76.39  ? 461 VAL A HG13 1 
ATOM   2467 H HG21 . VAL A 1 165 ? -1.303  8.725  -28.161 1.00 72.61  ? 461 VAL A HG21 1 
ATOM   2468 H HG22 . VAL A 1 165 ? -0.233  7.920  -27.305 1.00 72.61  ? 461 VAL A HG22 1 
ATOM   2469 H HG23 . VAL A 1 165 ? 0.162   9.309  -27.968 1.00 72.61  ? 461 VAL A HG23 1 
ATOM   2470 N N    . LEU A 1 168 ? -0.870  3.321  -34.511 1.00 60.59  ? 464 LEU A N    1 
ATOM   2471 C CA   . LEU A 1 168 ? -1.957  4.159  -35.007 1.00 59.61  ? 464 LEU A CA   1 
ATOM   2472 C C    . LEU A 1 168 ? -2.284  3.836  -36.461 1.00 62.47  ? 464 LEU A C    1 
ATOM   2473 O O    . LEU A 1 168 ? -1.405  3.855  -37.321 1.00 65.93  ? 464 LEU A O    1 
ATOM   2474 C CB   . LEU A 1 168 ? -1.594  5.641  -34.880 1.00 58.70  ? 464 LEU A CB   1 
ATOM   2475 C CG   . LEU A 1 168 ? -1.486  6.236  -33.473 1.00 58.49  ? 464 LEU A CG   1 
ATOM   2476 C CD1  . LEU A 1 168 ? -1.179  7.722  -33.563 1.00 56.96  ? 464 LEU A CD1  1 
ATOM   2477 C CD2  . LEU A 1 168 ? -2.753  6.013  -32.667 1.00 57.91  ? 464 LEU A CD2  1 
ATOM   2478 H HA   . LEU A 1 168 ? -2.751  3.995  -34.476 1.00 71.53  ? 464 LEU A HA   1 
ATOM   2479 H HB2  . LEU A 1 168 ? -0.736  5.775  -35.311 1.00 70.44  ? 464 LEU A HB2  1 
ATOM   2480 H HB3  . LEU A 1 168 ? -2.269  6.154  -35.352 1.00 70.44  ? 464 LEU A HB3  1 
ATOM   2481 H HG   . LEU A 1 168 ? -0.753  5.807  -33.004 1.00 70.19  ? 464 LEU A HG   1 
ATOM   2482 H HD11 . LEU A 1 168 ? -1.113  8.085  -32.666 1.00 68.36  ? 464 LEU A HD11 1 
ATOM   2483 H HD12 . LEU A 1 168 ? -0.338  7.842  -34.032 1.00 68.36  ? 464 LEU A HD12 1 
ATOM   2484 H HD13 . LEU A 1 168 ? -1.895  8.162  -34.048 1.00 68.36  ? 464 LEU A HD13 1 
ATOM   2485 H HD21 . LEU A 1 168 ? -2.640  6.404  -31.786 1.00 69.49  ? 464 LEU A HD21 1 
ATOM   2486 H HD22 . LEU A 1 168 ? -3.496  6.435  -33.124 1.00 69.49  ? 464 LEU A HD22 1 
ATOM   2487 H HD23 . LEU A 1 168 ? -2.911  5.059  -32.587 1.00 69.49  ? 464 LEU A HD23 1 
ATOM   2488 N N    . GLU A 1 169 ? -3.559  3.547  -36.733 1.00 63.52  ? 465 GLU A N    1 
ATOM   2489 C CA   . GLU A 1 169 ? -3.971  3.266  -38.104 1.00 68.76  ? 465 GLU A CA   1 
ATOM   2490 C C    . GLU A 1 169 ? -3.878  4.508  -38.980 1.00 69.98  ? 465 GLU A C    1 
ATOM   2491 O O    . GLU A 1 169 ? -3.673  4.393  -40.194 1.00 79.46  ? 465 GLU A O    1 
ATOM   2492 C CB   . GLU A 1 169 ? -5.396  2.707  -38.124 1.00 72.40  ? 465 GLU A CB   1 
ATOM   2493 C CG   . GLU A 1 169 ? -5.866  2.220  -39.497 1.00 80.45  ? 465 GLU A CG   1 
ATOM   2494 C CD   . GLU A 1 169 ? -6.392  3.334  -40.390 1.00 84.39  ? 465 GLU A CD   1 
ATOM   2495 O OE1  . GLU A 1 169 ? -6.700  4.427  -39.870 1.00 82.60  ? 465 GLU A OE1  1 
ATOM   2496 O OE2  . GLU A 1 169 ? -6.495  3.112  -41.615 1.00 88.01  ? 465 GLU A OE2  1 
ATOM   2497 H H    . GLU A 1 169 ? -4.192  3.509  -36.152 1.00 76.23  ? 465 GLU A H    1 
ATOM   2498 H HA   . GLU A 1 169 ? -3.381  2.593  -38.478 1.00 82.52  ? 465 GLU A HA   1 
ATOM   2499 H HB2  . GLU A 1 169 ? -5.444  1.956  -37.513 1.00 86.88  ? 465 GLU A HB2  1 
ATOM   2500 H HB3  . GLU A 1 169 ? -6.007  3.403  -37.834 1.00 86.88  ? 465 GLU A HB3  1 
ATOM   2501 H HG2  . GLU A 1 169 ? -5.120  1.801  -39.953 1.00 96.54  ? 465 GLU A HG2  1 
ATOM   2502 H HG3  . GLU A 1 169 ? -6.581  1.576  -39.374 1.00 96.54  ? 465 GLU A HG3  1 
ATOM   2503 N N    . ASN A 1 170 ? -4.017  5.697  -38.390 1.00 56.91  ? 466 ASN A N    1 
ATOM   2504 C CA   . ASN A 1 170 ? -3.989  6.952  -39.137 1.00 52.38  ? 466 ASN A CA   1 
ATOM   2505 C C    . ASN A 1 170 ? -3.055  7.946  -38.442 1.00 46.24  ? 466 ASN A C    1 
ATOM   2506 O O    . ASN A 1 170 ? -3.462  9.014  -37.987 1.00 43.18  ? 466 ASN A O    1 
ATOM   2507 C CB   . ASN A 1 170 ? -5.394  7.537  -39.281 1.00 51.72  ? 466 ASN A CB   1 
ATOM   2508 C CG   . ASN A 1 170 ? -5.466  8.617  -40.345 1.00 52.18  ? 466 ASN A CG   1 
ATOM   2509 O OD1  . ASN A 1 170 ? -4.441  9.117  -40.803 1.00 50.33  ? 466 ASN A OD1  1 
ATOM   2510 N ND2  . ASN A 1 170 ? -6.679  8.987  -40.736 1.00 52.92  ? 466 ASN A ND2  1 
ATOM   2511 H H    . ASN A 1 170 ? -4.131  5.802  -37.544 1.00 68.29  ? 466 ASN A H    1 
ATOM   2512 H HA   . ASN A 1 170 ? -3.641  6.784  -40.026 1.00 62.86  ? 466 ASN A HA   1 
ATOM   2513 H HB2  . ASN A 1 170 ? -6.008  6.828  -39.530 1.00 62.07  ? 466 ASN A HB2  1 
ATOM   2514 H HB3  . ASN A 1 170 ? -5.663  7.928  -38.436 1.00 62.07  ? 466 ASN A HB3  1 
ATOM   2515 H HD21 . ASN A 1 170 ? -6.770  9.596  -41.337 1.00 63.51  ? 466 ASN A HD21 1 
ATOM   2516 H HD22 . ASN A 1 170 ? -7.374  8.618  -40.390 1.00 63.51  ? 466 ASN A HD22 1 
ATOM   2517 N N    . PHE A 1 171 ? -1.772  7.583  -38.363 1.00 47.75  ? 467 PHE A N    1 
ATOM   2518 C CA   . PHE A 1 171 ? -0.775  8.502  -37.828 1.00 48.84  ? 467 PHE A CA   1 
ATOM   2519 C C    . PHE A 1 171 ? -0.638  9.755  -38.685 1.00 49.47  ? 467 PHE A C    1 
ATOM   2520 O O    . PHE A 1 171 ? -0.214  10.797 -38.175 1.00 48.31  ? 467 PHE A O    1 
ATOM   2521 C CB   . PHE A 1 171 ? 0.578   7.795  -37.712 1.00 55.53  ? 467 PHE A CB   1 
ATOM   2522 C CG   . PHE A 1 171 ? 1.685   8.675  -37.195 1.00 60.45  ? 467 PHE A CG   1 
ATOM   2523 C CD1  . PHE A 1 171 ? 1.833   8.899  -35.837 1.00 61.06  ? 467 PHE A CD1  1 
ATOM   2524 C CD2  . PHE A 1 171 ? 2.584   9.269  -38.068 1.00 63.67  ? 467 PHE A CD2  1 
ATOM   2525 C CE1  . PHE A 1 171 ? 2.851   9.705  -35.358 1.00 62.93  ? 467 PHE A CE1  1 
ATOM   2526 C CE2  . PHE A 1 171 ? 3.604   10.077 -37.594 1.00 62.97  ? 467 PHE A CE2  1 
ATOM   2527 C CZ   . PHE A 1 171 ? 3.738   10.293 -36.238 1.00 63.01  ? 467 PHE A CZ   1 
ATOM   2528 H H    . PHE A 1 171 ? -1.461  6.820  -38.609 1.00 57.30  ? 467 PHE A H    1 
ATOM   2529 H HA   . PHE A 1 171 ? -1.045  8.777  -36.938 1.00 58.61  ? 467 PHE A HA   1 
ATOM   2530 H HB2  . PHE A 1 171 ? 0.487   7.045  -37.103 1.00 66.64  ? 467 PHE A HB2  1 
ATOM   2531 H HB3  . PHE A 1 171 ? 0.840   7.475  -38.589 1.00 66.64  ? 467 PHE A HB3  1 
ATOM   2532 H HD1  . PHE A 1 171 ? 1.239   8.506  -35.239 1.00 73.27  ? 467 PHE A HD1  1 
ATOM   2533 H HD2  . PHE A 1 171 ? 2.498   9.126  -38.983 1.00 76.40  ? 467 PHE A HD2  1 
ATOM   2534 H HE1  . PHE A 1 171 ? 2.939   9.850  -34.443 1.00 75.52  ? 467 PHE A HE1  1 
ATOM   2535 H HE2  . PHE A 1 171 ? 4.200   10.471 -38.190 1.00 75.56  ? 467 PHE A HE2  1 
ATOM   2536 H HZ   . PHE A 1 171 ? 4.423   10.835 -35.917 1.00 75.62  ? 467 PHE A HZ   1 
ATOM   2537 N N    . GLN A 1 172 ? -0.992  9.677  -39.971 1.00 52.73  ? 468 GLN A N    1 
ATOM   2538 C CA   . GLN A 1 172 ? -0.913  10.846 -40.842 1.00 51.90  ? 468 GLN A CA   1 
ATOM   2539 C C    . GLN A 1 172 ? -1.845  11.951 -40.366 1.00 45.10  ? 468 GLN A C    1 
ATOM   2540 O O    . GLN A 1 172 ? -1.471  13.130 -40.355 1.00 40.66  ? 468 GLN A O    1 
ATOM   2541 C CB   . GLN A 1 172 ? -1.256  10.450 -42.277 1.00 56.86  ? 468 GLN A CB   1 
ATOM   2542 C CG   . GLN A 1 172 ? -0.385  9.349  -42.839 1.00 64.88  ? 468 GLN A CG   1 
ATOM   2543 C CD   . GLN A 1 172 ? 1.047   9.789  -43.029 1.00 69.58  ? 468 GLN A CD   1 
ATOM   2544 O OE1  . GLN A 1 172 ? 1.714   10.206 -42.084 1.00 70.02  ? 468 GLN A OE1  1 
ATOM   2545 N NE2  . GLN A 1 172 ? 1.529   9.702  -44.263 1.00 74.50  ? 468 GLN A NE2  1 
ATOM   2546 H H    . GLN A 1 172 ? -1.277  8.964  -40.358 1.00 63.28  ? 468 GLN A H    1 
ATOM   2547 H HA   . GLN A 1 172 ? -0.006  11.191 -40.832 1.00 62.28  ? 468 GLN A HA   1 
ATOM   2548 H HB2  . GLN A 1 172 ? -2.175  10.141 -42.304 1.00 68.24  ? 468 GLN A HB2  1 
ATOM   2549 H HB3  . GLN A 1 172 ? -1.154  11.227 -42.848 1.00 68.24  ? 468 GLN A HB3  1 
ATOM   2550 H HG2  . GLN A 1 172 ? -0.390  8.597  -42.227 1.00 77.86  ? 468 GLN A HG2  1 
ATOM   2551 H HG3  . GLN A 1 172 ? -0.733  9.079  -43.703 1.00 77.86  ? 468 GLN A HG3  1 
ATOM   2552 H HE21 . GLN A 1 172 ? 1.031   9.408  -44.899 1.00 89.41  ? 468 GLN A HE21 1 
ATOM   2553 H HE22 . GLN A 1 172 ? 2.339   9.939  -44.426 1.00 89.41  ? 468 GLN A HE22 1 
ATOM   2554 N N    . LEU A 1 173 ? -3.070  11.590 -39.982 1.00 44.59  ? 469 LEU A N    1 
ATOM   2555 C CA   . LEU A 1 173 ? -4.009  12.576 -39.459 1.00 43.19  ? 469 LEU A CA   1 
ATOM   2556 C C    . LEU A 1 173 ? -3.493  13.180 -38.158 1.00 40.09  ? 469 LEU A C    1 
ATOM   2557 O O    . LEU A 1 173 ? -3.490  14.404 -37.985 1.00 38.01  ? 469 LEU A O    1 
ATOM   2558 C CB   . LEU A 1 173 ? -5.379  11.925 -39.252 1.00 46.29  ? 469 LEU A CB   1 
ATOM   2559 C CG   . LEU A 1 173 ? -6.521  12.812 -38.749 1.00 50.55  ? 469 LEU A CG   1 
ATOM   2560 C CD1  . LEU A 1 173 ? -6.818  13.928 -39.733 1.00 52.93  ? 469 LEU A CD1  1 
ATOM   2561 C CD2  . LEU A 1 173 ? -7.769  11.977 -38.503 1.00 54.91  ? 469 LEU A CD2  1 
ATOM   2562 H H    . LEU A 1 173 ? -3.378  10.787 -40.015 1.00 53.50  ? 469 LEU A H    1 
ATOM   2563 H HA   . LEU A 1 173 ? -4.110  13.293 -40.104 1.00 51.83  ? 469 LEU A HA   1 
ATOM   2564 H HB2  . LEU A 1 173 ? -5.664  11.551 -40.101 1.00 55.54  ? 469 LEU A HB2  1 
ATOM   2565 H HB3  . LEU A 1 173 ? -5.274  11.206 -38.609 1.00 55.54  ? 469 LEU A HB3  1 
ATOM   2566 H HG   . LEU A 1 173 ? -6.260  13.217 -37.906 1.00 60.66  ? 469 LEU A HG   1 
ATOM   2567 H HD11 . LEU A 1 173 ? -7.544  14.470 -39.385 1.00 63.51  ? 469 LEU A HD11 1 
ATOM   2568 H HD12 . LEU A 1 173 ? -6.022  14.472 -39.843 1.00 63.51  ? 469 LEU A HD12 1 
ATOM   2569 H HD13 . LEU A 1 173 ? -7.074  13.539 -40.583 1.00 63.51  ? 469 LEU A HD13 1 
ATOM   2570 H HD21 . LEU A 1 173 ? -8.479  12.557 -38.185 1.00 65.89  ? 469 LEU A HD21 1 
ATOM   2571 H HD22 . LEU A 1 173 ? -8.034  11.554 -39.334 1.00 65.89  ? 469 LEU A HD22 1 
ATOM   2572 H HD23 . LEU A 1 173 ? -7.570  11.302 -37.836 1.00 65.89  ? 469 LEU A HD23 1 
ATOM   2573 N N    . VAL A 1 174 ? -3.039  12.331 -37.233 1.00 40.75  ? 470 VAL A N    1 
ATOM   2574 C CA   . VAL A 1 174 ? -2.549  12.819 -35.945 1.00 37.77  ? 470 VAL A CA   1 
ATOM   2575 C C    . VAL A 1 174 ? -1.366  13.757 -36.152 1.00 40.03  ? 470 VAL A C    1 
ATOM   2576 O O    . VAL A 1 174 ? -1.320  14.862 -35.599 1.00 37.10  ? 470 VAL A O    1 
ATOM   2577 C CB   . VAL A 1 174 ? -2.183  11.635 -35.030 1.00 37.44  ? 470 VAL A CB   1 
ATOM   2578 C CG1  . VAL A 1 174 ? -1.570  12.119 -33.720 1.00 37.08  ? 470 VAL A CG1  1 
ATOM   2579 C CG2  . VAL A 1 174 ? -3.414  10.784 -34.746 1.00 36.11  ? 470 VAL A CG2  1 
ATOM   2580 H H    . VAL A 1 174 ? -3.006  11.477 -37.326 1.00 48.90  ? 470 VAL A H    1 
ATOM   2581 H HA   . VAL A 1 174 ? -3.255  13.323 -35.511 1.00 45.33  ? 470 VAL A HA   1 
ATOM   2582 H HB   . VAL A 1 174 ? -1.529  11.077 -35.480 1.00 44.93  ? 470 VAL A HB   1 
ATOM   2583 H HG11 . VAL A 1 174 ? -1.352  11.349 -33.171 1.00 44.50  ? 470 VAL A HG11 1 
ATOM   2584 H HG12 . VAL A 1 174 ? -0.765  12.624 -33.916 1.00 44.50  ? 470 VAL A HG12 1 
ATOM   2585 H HG13 . VAL A 1 174 ? -2.211  12.683 -33.261 1.00 44.50  ? 470 VAL A HG13 1 
ATOM   2586 H HG21 . VAL A 1 174 ? -3.160  10.046 -34.169 1.00 43.33  ? 470 VAL A HG21 1 
ATOM   2587 H HG22 . VAL A 1 174 ? -4.082  11.333 -34.307 1.00 43.33  ? 470 VAL A HG22 1 
ATOM   2588 H HG23 . VAL A 1 174 ? -3.763  10.444 -35.585 1.00 43.33  ? 470 VAL A HG23 1 
ATOM   2589 N N    . GLU A 1 175 ? -0.391  13.330 -36.957 1.00 42.58  ? 471 GLU A N    1 
ATOM   2590 C CA   . GLU A 1 175 ? 0.773   14.170 -37.214 1.00 47.11  ? 471 GLU A CA   1 
ATOM   2591 C C    . GLU A 1 175 ? 0.365   15.489 -37.858 1.00 44.73  ? 471 GLU A C    1 
ATOM   2592 O O    . GLU A 1 175 ? 0.886   16.552 -37.499 1.00 43.17  ? 471 GLU A O    1 
ATOM   2593 C CB   . GLU A 1 175 ? 1.768   13.421 -38.100 1.00 57.54  ? 471 GLU A CB   1 
ATOM   2594 C CG   . GLU A 1 175 ? 3.016   14.213 -38.457 1.00 65.26  ? 471 GLU A CG   1 
ATOM   2595 C CD   . GLU A 1 175 ? 3.882   13.496 -39.468 1.00 71.60  ? 471 GLU A CD   1 
ATOM   2596 O OE1  . GLU A 1 175 ? 3.570   12.332 -39.799 1.00 71.31  ? 471 GLU A OE1  1 
ATOM   2597 O OE2  . GLU A 1 175 ? 4.870   14.098 -39.936 1.00 77.93  ? 471 GLU A OE2  1 
ATOM   2598 H H    . GLU A 1 175 ? -0.381  12.570 -37.359 1.00 51.10  ? 471 GLU A H    1 
ATOM   2599 H HA   . GLU A 1 175 ? 1.211   14.370 -36.372 1.00 56.53  ? 471 GLU A HA   1 
ATOM   2600 H HB2  . GLU A 1 175 ? 2.053   12.618 -37.637 1.00 69.05  ? 471 GLU A HB2  1 
ATOM   2601 H HB3  . GLU A 1 175 ? 1.326   13.181 -38.929 1.00 69.05  ? 471 GLU A HB3  1 
ATOM   2602 H HG2  . GLU A 1 175 ? 2.752   15.066 -38.836 1.00 78.31  ? 471 GLU A HG2  1 
ATOM   2603 H HG3  . GLU A 1 175 ? 3.542   14.354 -37.654 1.00 78.31  ? 471 GLU A HG3  1 
ATOM   2604 N N    . GLY A 1 176 ? -0.569  15.441 -38.809 1.00 41.76  ? 472 GLY A N    1 
ATOM   2605 C CA   . GLY A 1 176 ? -0.999  16.658 -39.475 1.00 40.54  ? 472 GLY A CA   1 
ATOM   2606 C C    . GLY A 1 176 ? -1.741  17.602 -38.549 1.00 36.59  ? 472 GLY A C    1 
ATOM   2607 O O    . GLY A 1 176 ? -1.550  18.820 -38.608 1.00 36.28  ? 472 GLY A O    1 
ATOM   2608 H H    . GLY A 1 176 ? -0.961  14.725 -39.080 1.00 50.11  ? 472 GLY A H    1 
ATOM   2609 H HA2  . GLY A 1 176 ? -0.225  17.123 -39.828 1.00 48.65  ? 472 GLY A HA2  1 
ATOM   2610 H HA3  . GLY A 1 176 ? -1.585  16.431 -40.214 1.00 48.65  ? 472 GLY A HA3  1 
ATOM   2611 N N    . VAL A 1 177 ? -2.602  17.061 -37.687 1.00 38.16  ? 473 VAL A N    1 
ATOM   2612 C CA   . VAL A 1 177 ? -3.285  17.904 -36.711 1.00 34.02  ? 473 VAL A CA   1 
ATOM   2613 C C    . VAL A 1 177 ? -2.265  18.568 -35.795 1.00 33.67  ? 473 VAL A C    1 
ATOM   2614 O O    . VAL A 1 177 ? -2.332  19.775 -35.530 1.00 33.34  ? 473 VAL A O    1 
ATOM   2615 C CB   . VAL A 1 177 ? -4.316  17.081 -35.915 1.00 33.42  ? 473 VAL A CB   1 
ATOM   2616 C CG1  . VAL A 1 177 ? -4.848  17.876 -34.736 1.00 31.36  ? 473 VAL A CG1  1 
ATOM   2617 C CG2  . VAL A 1 177 ? -5.467  16.669 -36.826 1.00 33.99  ? 473 VAL A CG2  1 
ATOM   2618 H H    . VAL A 1 177 ? -2.804  16.226 -37.647 1.00 45.79  ? 473 VAL A H    1 
ATOM   2619 H HA   . VAL A 1 177 ? -3.763  18.604 -37.181 1.00 40.82  ? 473 VAL A HA   1 
ATOM   2620 H HB   . VAL A 1 177 ? -3.893  16.277 -35.576 1.00 40.10  ? 473 VAL A HB   1 
ATOM   2621 H HG11 . VAL A 1 177 ? -5.493  17.334 -34.255 1.00 37.64  ? 473 VAL A HG11 1 
ATOM   2622 H HG12 . VAL A 1 177 ? -4.108  18.107 -34.152 1.00 37.64  ? 473 VAL A HG12 1 
ATOM   2623 H HG13 . VAL A 1 177 ? -5.273  18.683 -35.066 1.00 37.64  ? 473 VAL A HG13 1 
ATOM   2624 H HG21 . VAL A 1 177 ? -6.107  16.153 -36.312 1.00 40.79  ? 473 VAL A HG21 1 
ATOM   2625 H HG22 . VAL A 1 177 ? -5.892  17.468 -37.177 1.00 40.79  ? 473 VAL A HG22 1 
ATOM   2626 H HG23 . VAL A 1 177 ? -5.117  16.133 -37.554 1.00 40.79  ? 473 VAL A HG23 1 
ATOM   2627 N N    . GLN A 1 178 ? -1.294  17.789 -35.311 1.00 36.80  ? 474 GLN A N    1 
ATOM   2628 C CA   . GLN A 1 178 ? -0.266  18.340 -34.433 1.00 36.72  ? 474 GLN A CA   1 
ATOM   2629 C C    . GLN A 1 178 ? 0.469   19.497 -35.103 1.00 38.52  ? 474 GLN A C    1 
ATOM   2630 O O    . GLN A 1 178 ? 0.704   20.538 -34.477 1.00 37.79  ? 474 GLN A O    1 
ATOM   2631 C CB   . GLN A 1 178 ? 0.717   17.238 -34.025 1.00 44.51  ? 474 GLN A CB   1 
ATOM   2632 C CG   . GLN A 1 178 ? 1.930   17.697 -33.200 1.00 53.81  ? 474 GLN A CG   1 
ATOM   2633 C CD   . GLN A 1 178 ? 1.631   17.864 -31.720 1.00 61.54  ? 474 GLN A CD   1 
ATOM   2634 O OE1  . GLN A 1 178 ? 0.637   17.348 -31.211 1.00 63.48  ? 474 GLN A OE1  1 
ATOM   2635 N NE2  . GLN A 1 178 ? 2.503   18.584 -31.019 1.00 65.70  ? 474 GLN A NE2  1 
ATOM   2636 H H    . GLN A 1 178 ? -1.211  16.949 -35.474 1.00 44.16  ? 474 GLN A H    1 
ATOM   2637 H HA   . GLN A 1 178 ? -0.687  18.679 -33.628 1.00 44.07  ? 474 GLN A HA   1 
ATOM   2638 H HB2  . GLN A 1 178 ? 0.238   16.581 -33.496 1.00 53.41  ? 474 GLN A HB2  1 
ATOM   2639 H HB3  . GLN A 1 178 ? 1.057   16.817 -34.831 1.00 53.41  ? 474 GLN A HB3  1 
ATOM   2640 H HG2  . GLN A 1 178 ? 2.636   17.038 -33.288 1.00 64.58  ? 474 GLN A HG2  1 
ATOM   2641 H HG3  . GLN A 1 178 ? 2.234   18.553 -33.541 1.00 64.58  ? 474 GLN A HG3  1 
ATOM   2642 H HE21 . GLN A 1 178 ? 3.190   18.924 -31.408 1.00 78.84  ? 474 GLN A HE21 1 
ATOM   2643 H HE22 . GLN A 1 178 ? 2.379   18.708 -30.178 1.00 78.84  ? 474 GLN A HE22 1 
ATOM   2644 N N    . GLU A 1 179 ? 0.835   19.340 -36.377 1.00 40.07  ? 475 GLU A N    1 
ATOM   2645 C CA   . GLU A 1 179 ? 1.619   20.373 -37.046 1.00 45.20  ? 475 GLU A CA   1 
ATOM   2646 C C    . GLU A 1 179 ? 0.788   21.629 -37.292 1.00 38.19  ? 475 GLU A C    1 
ATOM   2647 O O    . GLU A 1 179 ? 1.294   22.749 -37.157 1.00 35.77  ? 475 GLU A O    1 
ATOM   2648 C CB   . GLU A 1 179 ? 2.194   19.827 -38.355 1.00 53.14  ? 475 GLU A CB   1 
ATOM   2649 C CG   . GLU A 1 179 ? 1.359   20.096 -39.599 1.00 59.95  ? 475 GLU A CG   1 
ATOM   2650 C CD   . GLU A 1 179 ? 1.848   19.311 -40.804 1.00 66.64  ? 475 GLU A CD   1 
ATOM   2651 O OE1  . GLU A 1 179 ? 2.946   18.718 -40.723 1.00 67.95  ? 475 GLU A OE1  1 
ATOM   2652 O OE2  . GLU A 1 179 ? 1.134   19.282 -41.829 1.00 68.33  ? 475 GLU A OE2  1 
ATOM   2653 H H    . GLU A 1 179 ? 0.647   18.658 -36.865 1.00 48.08  ? 475 GLU A H    1 
ATOM   2654 H HA   . GLU A 1 179 ? 2.364   20.619 -36.476 1.00 54.25  ? 475 GLU A HA   1 
ATOM   2655 H HB2  . GLU A 1 179 ? 3.066   20.227 -38.499 1.00 63.77  ? 475 GLU A HB2  1 
ATOM   2656 H HB3  . GLU A 1 179 ? 2.289   18.865 -38.271 1.00 63.77  ? 475 GLU A HB3  1 
ATOM   2657 H HG2  . GLU A 1 179 ? 0.440   19.839 -39.425 1.00 71.94  ? 475 GLU A HG2  1 
ATOM   2658 H HG3  . GLU A 1 179 ? 1.406   21.040 -39.814 1.00 71.94  ? 475 GLU A HG3  1 
ATOM   2659 N N    . GLN A 1 180 ? -0.491  21.469 -37.634 1.00 35.11  ? 476 GLN A N    1 
ATOM   2660 C CA   . GLN A 1 180 ? -1.332  22.628 -37.916 1.00 31.44  ? 476 GLN A CA   1 
ATOM   2661 C C    . GLN A 1 180 ? -1.752  23.355 -36.645 1.00 28.70  ? 476 GLN A C    1 
ATOM   2662 O O    . GLN A 1 180 ? -1.859  24.586 -36.652 1.00 30.32  ? 476 GLN A O    1 
ATOM   2663 C CB   . GLN A 1 180 ? -2.566  22.201 -38.714 1.00 33.20  ? 476 GLN A CB   1 
ATOM   2664 C CG   . GLN A 1 180 ? -2.243  21.676 -40.110 1.00 34.08  ? 476 GLN A CG   1 
ATOM   2665 C CD   . GLN A 1 180 ? -1.674  22.744 -41.022 1.00 35.87  ? 476 GLN A CD   1 
ATOM   2666 O OE1  . GLN A 1 180 ? -1.934  23.933 -40.843 1.00 38.84  ? 476 GLN A OE1  1 
ATOM   2667 N NE2  . GLN A 1 180 ? -0.889  22.324 -42.007 1.00 38.13  ? 476 GLN A NE2  1 
ATOM   2668 H H    . GLN A 1 180 ? -0.890  20.710 -37.708 1.00 42.14  ? 476 GLN A H    1 
ATOM   2669 H HA   . GLN A 1 180 ? -0.828  23.252 -38.461 1.00 37.73  ? 476 GLN A HA   1 
ATOM   2670 H HB2  . GLN A 1 180 ? -3.023  21.496 -38.230 1.00 39.84  ? 476 GLN A HB2  1 
ATOM   2671 H HB3  . GLN A 1 180 ? -3.154  22.966 -38.814 1.00 39.84  ? 476 GLN A HB3  1 
ATOM   2672 H HG2  . GLN A 1 180 ? -1.587  20.965 -40.035 1.00 40.89  ? 476 GLN A HG2  1 
ATOM   2673 H HG3  . GLN A 1 180 ? -3.056  21.337 -40.516 1.00 40.89  ? 476 GLN A HG3  1 
ATOM   2674 H HE21 . GLN A 1 180 ? -0.728  21.485 -42.100 1.00 45.75  ? 476 GLN A HE21 1 
ATOM   2675 H HE22 . GLN A 1 180 ? -0.542  22.892 -42.552 1.00 45.75  ? 476 GLN A HE22 1 
ATOM   2676 N N    . VAL A 1 181 ? -1.996  22.625 -35.556 1.00 24.59  ? 477 VAL A N    1 
ATOM   2677 C CA   . VAL A 1 181 ? -2.314  23.277 -34.290 1.00 29.56  ? 477 VAL A CA   1 
ATOM   2678 C C    . VAL A 1 181 ? -1.104  24.041 -33.769 1.00 26.46  ? 477 VAL A C    1 
ATOM   2679 O O    . VAL A 1 181 ? -1.230  25.177 -33.298 1.00 28.55  ? 477 VAL A O    1 
ATOM   2680 C CB   . VAL A 1 181 ? -2.822  22.242 -33.269 1.00 30.22  ? 477 VAL A CB   1 
ATOM   2681 C CG1  . VAL A 1 181 ? -2.952  22.860 -31.874 1.00 26.50  ? 477 VAL A CG1  1 
ATOM   2682 C CG2  . VAL A 1 181 ? -4.168  21.690 -33.715 1.00 30.05  ? 477 VAL A CG2  1 
ATOM   2683 H H    . VAL A 1 181 ? -1.985  21.766 -35.525 1.00 29.51  ? 477 VAL A H    1 
ATOM   2684 H HA   . VAL A 1 181 ? -3.026  23.918 -34.439 1.00 35.48  ? 477 VAL A HA   1 
ATOM   2685 H HB   . VAL A 1 181 ? -2.192  21.506 -33.218 1.00 36.26  ? 477 VAL A HB   1 
ATOM   2686 H HG11 . VAL A 1 181 ? -3.273  22.183 -31.258 1.00 31.80  ? 477 VAL A HG11 1 
ATOM   2687 H HG12 . VAL A 1 181 ? -2.083  23.182 -31.589 1.00 31.80  ? 477 VAL A HG12 1 
ATOM   2688 H HG13 . VAL A 1 181 ? -3.582  23.597 -31.913 1.00 31.80  ? 477 VAL A HG13 1 
ATOM   2689 H HG21 . VAL A 1 181 ? -4.474  21.040 -33.062 1.00 36.06  ? 477 VAL A HG21 1 
ATOM   2690 H HG22 . VAL A 1 181 ? -4.803  22.420 -33.778 1.00 36.06  ? 477 VAL A HG22 1 
ATOM   2691 H HG23 . VAL A 1 181 ? -4.063  21.265 -34.580 1.00 36.06  ? 477 VAL A HG23 1 
ATOM   2692 N N    . ASN A 1 182 ? 0.085   23.439 -33.845 1.00 30.32  ? 478 ASN A N    1 
ATOM   2693 C CA   . ASN A 1 182 ? 1.300   24.146 -33.453 1.00 31.72  ? 478 ASN A CA   1 
ATOM   2694 C C    . ASN A 1 182 ? 1.460   25.439 -34.245 1.00 32.73  ? 478 ASN A C    1 
ATOM   2695 O O    . ASN A 1 182 ? 1.756   26.496 -33.677 1.00 34.14  ? 478 ASN A O    1 
ATOM   2696 C CB   . ASN A 1 182 ? 2.520   23.244 -33.647 1.00 34.81  ? 478 ASN A CB   1 
ATOM   2697 C CG   . ASN A 1 182 ? 2.931   22.532 -32.371 1.00 37.06  ? 478 ASN A CG   1 
ATOM   2698 O OD1  . ASN A 1 182 ? 2.901   23.111 -31.286 1.00 37.00  ? 478 ASN A OD1  1 
ATOM   2699 N ND2  . ASN A 1 182 ? 3.322   21.270 -32.498 1.00 41.38  ? 478 ASN A ND2  1 
ATOM   2700 H H    . ASN A 1 182 ? 0.211   22.633 -34.117 1.00 36.39  ? 478 ASN A H    1 
ATOM   2701 H HA   . ASN A 1 182 ? 1.242   24.376 -32.512 1.00 38.07  ? 478 ASN A HA   1 
ATOM   2702 H HB2  . ASN A 1 182 ? 2.313   22.570 -34.313 1.00 41.78  ? 478 ASN A HB2  1 
ATOM   2703 H HB3  . ASN A 1 182 ? 3.269   23.784 -33.943 1.00 41.78  ? 478 ASN A HB3  1 
ATOM   2704 H HD21 . ASN A 1 182 ? 3.565   20.823 -31.805 1.00 49.66  ? 478 ASN A HD21 1 
ATOM   2705 H HD22 . ASN A 1 182 ? 3.332   20.899 -33.274 1.00 49.66  ? 478 ASN A HD22 1 
ATOM   2706 N N    . ALA A 1 183 ? 1.256   25.374 -35.563 1.00 30.00  ? 479 ALA A N    1 
ATOM   2707 C CA   . ALA A 1 183 ? 1.417   26.562 -36.397 1.00 35.55  ? 479 ALA A CA   1 
ATOM   2708 C C    . ALA A 1 183 ? 0.381   27.625 -36.052 1.00 25.71  ? 479 ALA A C    1 
ATOM   2709 O O    . ALA A 1 183 ? 0.695   28.822 -36.037 1.00 27.65  ? 479 ALA A O    1 
ATOM   2710 C CB   . ALA A 1 183 ? 1.321   26.181 -37.875 1.00 31.07  ? 479 ALA A CB   1 
ATOM   2711 H H    . ALA A 1 183 ? 1.028   24.664 -35.992 1.00 36.00  ? 479 ALA A H    1 
ATOM   2712 H HA   . ALA A 1 183 ? 2.297   26.939 -36.242 1.00 42.66  ? 479 ALA A HA   1 
ATOM   2713 H HB1  . ALA A 1 183 ? 1.430   26.981 -38.414 1.00 37.29  ? 479 ALA A HB1  1 
ATOM   2714 H HB2  . ALA A 1 183 ? 2.023   25.544 -38.083 1.00 37.29  ? 479 ALA A HB2  1 
ATOM   2715 H HB3  . ALA A 1 183 ? 0.452   25.784 -38.043 1.00 37.29  ? 479 ALA A HB3  1 
ATOM   2716 N N    . ALA A 1 184 ? -0.859  27.210 -35.780 1.00 28.83  ? 480 ALA A N    1 
ATOM   2717 C CA   . ALA A 1 184 ? -1.904  28.163 -35.415 1.00 28.57  ? 480 ALA A CA   1 
ATOM   2718 C C    . ALA A 1 184 ? -1.628  28.796 -34.057 1.00 26.29  ? 480 ALA A C    1 
ATOM   2719 O O    . ALA A 1 184 ? -1.906  29.984 -33.852 1.00 25.44  ? 480 ALA A O    1 
ATOM   2720 C CB   . ALA A 1 184 ? -3.269  27.473 -35.409 1.00 28.94  ? 480 ALA A CB   1 
ATOM   2721 H H    . ALA A 1 184 ? -1.117  26.390 -35.799 1.00 34.59  ? 480 ALA A H    1 
ATOM   2722 H HA   . ALA A 1 184 ? -1.930  28.872 -36.076 1.00 34.28  ? 480 ALA A HA   1 
ATOM   2723 H HB1  . ALA A 1 184 ? -3.949  28.121 -35.165 1.00 34.73  ? 480 ALA A HB1  1 
ATOM   2724 H HB2  . ALA A 1 184 ? -3.449  27.122 -36.295 1.00 34.73  ? 480 ALA A HB2  1 
ATOM   2725 H HB3  . ALA A 1 184 ? -3.254  26.750 -34.763 1.00 34.73  ? 480 ALA A HB3  1 
ATOM   2726 N N    . LEU A 1 185 ? -1.093  28.018 -33.112 1.00 26.74  ? 481 LEU A N    1 
ATOM   2727 C CA   . LEU A 1 185 ? -0.758  28.570 -31.801 1.00 25.82  ? 481 LEU A CA   1 
ATOM   2728 C C    . LEU A 1 185 ? 0.395   29.560 -31.899 1.00 25.96  ? 481 LEU A C    1 
ATOM   2729 O O    . LEU A 1 185 ? 0.365   30.619 -31.262 1.00 29.45  ? 481 LEU A O    1 
ATOM   2730 C CB   . LEU A 1 185 ? -0.411  27.441 -30.828 1.00 25.06  ? 481 LEU A CB   1 
ATOM   2731 C CG   . LEU A 1 185 ? 0.007   27.856 -29.412 1.00 27.35  ? 481 LEU A CG   1 
ATOM   2732 C CD1  . LEU A 1 185 ? -1.121  28.596 -28.703 1.00 26.25  ? 481 LEU A CD1  1 
ATOM   2733 C CD2  . LEU A 1 185 ? 0.442   26.640 -28.608 1.00 27.23  ? 481 LEU A CD2  1 
ATOM   2734 H H    . LEU A 1 185 ? -0.917  27.182 -33.205 1.00 32.09  ? 481 LEU A H    1 
ATOM   2735 H HA   . LEU A 1 185 ? -1.530  29.042 -31.451 1.00 30.98  ? 481 LEU A HA   1 
ATOM   2736 H HB2  . LEU A 1 185 ? -1.188  26.867 -30.740 1.00 30.08  ? 481 LEU A HB2  1 
ATOM   2737 H HB3  . LEU A 1 185 ? 0.322   26.931 -31.205 1.00 30.08  ? 481 LEU A HB3  1 
ATOM   2738 H HG   . LEU A 1 185 ? 0.765   28.458 -29.473 1.00 32.82  ? 481 LEU A HG   1 
ATOM   2739 H HD11 . LEU A 1 185 ? -0.825  28.843 -27.813 1.00 31.50  ? 481 LEU A HD11 1 
ATOM   2740 H HD12 . LEU A 1 185 ? -1.344  29.391 -29.211 1.00 31.50  ? 481 LEU A HD12 1 
ATOM   2741 H HD13 . LEU A 1 185 ? -1.893  28.012 -28.645 1.00 31.50  ? 481 LEU A HD13 1 
ATOM   2742 H HD21 . LEU A 1 185 ? 0.701   26.927 -27.719 1.00 32.67  ? 481 LEU A HD21 1 
ATOM   2743 H HD22 . LEU A 1 185 ? -0.300  26.017 -28.553 1.00 32.67  ? 481 LEU A HD22 1 
ATOM   2744 H HD23 . LEU A 1 185 ? 1.194   26.221 -29.054 1.00 32.67  ? 481 LEU A HD23 1 
ATOM   2745 N N    . LEU A 1 186 ? 1.424   29.233 -32.685 1.00 23.40  ? 482 LEU A N    1 
ATOM   2746 C CA   . LEU A 1 186 ? 2.522   30.172 -32.895 1.00 28.07  ? 482 LEU A CA   1 
ATOM   2747 C C    . LEU A 1 186 ? 2.021   31.455 -33.546 1.00 29.44  ? 482 LEU A C    1 
ATOM   2748 O O    . LEU A 1 186 ? 2.338   32.562 -33.095 1.00 27.52  ? 482 LEU A O    1 
ATOM   2749 C CB   . LEU A 1 186 ? 3.611   29.523 -33.749 1.00 26.86  ? 482 LEU A CB   1 
ATOM   2750 C CG   . LEU A 1 186 ? 4.744   30.446 -34.206 1.00 31.70  ? 482 LEU A CG   1 
ATOM   2751 C CD1  . LEU A 1 186 ? 5.434   31.100 -33.014 1.00 35.08  ? 482 LEU A CD1  1 
ATOM   2752 C CD2  . LEU A 1 186 ? 5.743   29.678 -35.045 1.00 32.76  ? 482 LEU A CD2  1 
ATOM   2753 H H    . LEU A 1 186 ? 1.507   28.485 -33.101 1.00 28.08  ? 482 LEU A H    1 
ATOM   2754 H HA   . LEU A 1 186 ? 2.910   30.402 -32.036 1.00 33.68  ? 482 LEU A HA   1 
ATOM   2755 H HB2  . LEU A 1 186 ? 4.013   28.804 -33.236 1.00 32.23  ? 482 LEU A HB2  1 
ATOM   2756 H HB3  . LEU A 1 186 ? 3.196   29.157 -34.546 1.00 32.23  ? 482 LEU A HB3  1 
ATOM   2757 H HG   . LEU A 1 186 ? 4.371   31.151 -34.758 1.00 38.04  ? 482 LEU A HG   1 
ATOM   2758 H HD11 . LEU A 1 186 ? 6.144   31.676 -33.338 1.00 42.09  ? 482 LEU A HD11 1 
ATOM   2759 H HD12 . LEU A 1 186 ? 4.782   31.622 -32.520 1.00 42.09  ? 482 LEU A HD12 1 
ATOM   2760 H HD13 . LEU A 1 186 ? 5.803   30.407 -32.445 1.00 42.09  ? 482 LEU A HD13 1 
ATOM   2761 H HD21 . LEU A 1 186 ? 6.450   30.280 -35.324 1.00 39.31  ? 482 LEU A HD21 1 
ATOM   2762 H HD22 . LEU A 1 186 ? 6.113   28.956 -34.513 1.00 39.31  ? 482 LEU A HD22 1 
ATOM   2763 H HD23 . LEU A 1 186 ? 5.290   29.317 -35.823 1.00 39.31  ? 482 LEU A HD23 1 
ATOM   2764 N N    . ASP A 1 187 ? 1.226   31.324 -34.609 1.00 31.50  ? 483 ASP A N    1 
ATOM   2765 C CA   . ASP A 1 187 ? 0.678   32.504 -35.266 1.00 32.62  ? 483 ASP A CA   1 
ATOM   2766 C C    . ASP A 1 187 ? -0.122  33.354 -34.288 1.00 27.11  ? 483 ASP A C    1 
ATOM   2767 O O    . ASP A 1 187 ? 0.019   34.582 -34.262 1.00 29.75  ? 483 ASP A O    1 
ATOM   2768 C CB   . ASP A 1 187 ? -0.196  32.086 -36.447 1.00 37.79  ? 483 ASP A CB   1 
ATOM   2769 C CG   . ASP A 1 187 ? -0.520  33.245 -37.369 1.00 50.23  ? 483 ASP A CG   1 
ATOM   2770 O OD1  . ASP A 1 187 ? -1.546  33.920 -37.146 1.00 54.11  ? 483 ASP A OD1  1 
ATOM   2771 O OD2  . ASP A 1 187 ? 0.257   33.480 -38.317 1.00 58.72  ? 483 ASP A OD2  1 
ATOM   2772 H H    . ASP A 1 187 ? 0.993   30.575 -34.962 1.00 37.80  ? 483 ASP A H    1 
ATOM   2773 H HA   . ASP A 1 187 ? 1.408   33.045 -35.607 1.00 39.14  ? 483 ASP A HA   1 
ATOM   2774 H HB2  . ASP A 1 187 ? 0.272   31.412 -36.964 1.00 45.34  ? 483 ASP A HB2  1 
ATOM   2775 H HB3  . ASP A 1 187 ? -1.032  31.727 -36.111 1.00 45.34  ? 483 ASP A HB3  1 
ATOM   2776 N N    . TYR A 1 188 ? -0.963  32.718 -33.471 1.00 28.89  ? 484 TYR A N    1 
ATOM   2777 C CA   . TYR A 1 188 ? -1.824  33.470 -32.564 1.00 28.18  ? 484 TYR A CA   1 
ATOM   2778 C C    . TYR A 1 188 ? -1.009  34.187 -31.493 1.00 28.45  ? 484 TYR A C    1 
ATOM   2779 O O    . TYR A 1 188 ? -1.230  35.374 -31.223 1.00 29.53  ? 484 TYR A O    1 
ATOM   2780 C CB   . TYR A 1 188 ? -2.853  32.540 -31.920 1.00 29.89  ? 484 TYR A CB   1 
ATOM   2781 C CG   . TYR A 1 188 ? -3.694  33.224 -30.866 1.00 28.66  ? 484 TYR A CG   1 
ATOM   2782 C CD1  . TYR A 1 188 ? -4.847  33.920 -31.211 1.00 29.99  ? 484 TYR A CD1  1 
ATOM   2783 C CD2  . TYR A 1 188 ? -3.330  33.182 -29.526 1.00 30.50  ? 484 TYR A CD2  1 
ATOM   2784 C CE1  . TYR A 1 188 ? -5.615  34.550 -30.252 1.00 29.02  ? 484 TYR A CE1  1 
ATOM   2785 C CE2  . TYR A 1 188 ? -4.090  33.809 -28.559 1.00 31.34  ? 484 TYR A CE2  1 
ATOM   2786 C CZ   . TYR A 1 188 ? -5.232  34.490 -28.927 1.00 34.26  ? 484 TYR A CZ   1 
ATOM   2787 O OH   . TYR A 1 188 ? -5.992  35.118 -27.969 1.00 34.96  ? 484 TYR A OH   1 
ATOM   2788 H H    . TYR A 1 188 ? -1.053  31.864 -33.424 1.00 34.67  ? 484 TYR A H    1 
ATOM   2789 H HA   . TYR A 1 188 ? -2.305  34.142 -33.072 1.00 33.82  ? 484 TYR A HA   1 
ATOM   2790 H HB2  . TYR A 1 188 ? -3.450  32.206 -32.608 1.00 35.87  ? 484 TYR A HB2  1 
ATOM   2791 H HB3  . TYR A 1 188 ? -2.388  31.801 -31.498 1.00 35.87  ? 484 TYR A HB3  1 
ATOM   2792 H HD1  . TYR A 1 188 ? -5.107  33.961 -32.103 1.00 35.99  ? 484 TYR A HD1  1 
ATOM   2793 H HD2  . TYR A 1 188 ? -2.561  32.723 -29.275 1.00 36.60  ? 484 TYR A HD2  1 
ATOM   2794 H HE1  . TYR A 1 188 ? -6.385  35.011 -30.496 1.00 34.82  ? 484 TYR A HE1  1 
ATOM   2795 H HE2  . TYR A 1 188 ? -3.835  33.771 -27.666 1.00 37.61  ? 484 TYR A HE2  1 
ATOM   2796 H HH   . TYR A 1 188 ? -5.650  35.005 -27.210 1.00 41.96  ? 484 TYR A HH   1 
ATOM   2797 N N    . THR A 1 189 ? -0.065  33.483 -30.861 1.00 29.02  ? 485 THR A N    1 
ATOM   2798 C CA   . THR A 1 189 ? 0.702   34.103 -29.783 1.00 29.45  ? 485 THR A CA   1 
ATOM   2799 C C    . THR A 1 189 ? 1.589   35.220 -30.313 1.00 29.96  ? 485 THR A C    1 
ATOM   2800 O O    . THR A 1 189 ? 1.715   36.272 -29.677 1.00 32.54  ? 485 THR A O    1 
ATOM   2801 C CB   . THR A 1 189 ? 1.549   33.060 -29.050 1.00 33.79  ? 485 THR A CB   1 
ATOM   2802 O OG1  . THR A 1 189 ? 2.478   32.454 -29.959 1.00 33.91  ? 485 THR A OG1  1 
ATOM   2803 C CG2  . THR A 1 189 ? 0.669   31.988 -28.422 1.00 33.24  ? 485 THR A CG2  1 
ATOM   2804 H H    . THR A 1 189 ? 0.145   32.667 -31.033 1.00 34.82  ? 485 THR A H    1 
ATOM   2805 H HA   . THR A 1 189 ? 0.086   34.490 -29.143 1.00 35.33  ? 485 THR A HA   1 
ATOM   2806 H HB   . THR A 1 189 ? 2.043   33.498 -28.338 1.00 40.55  ? 485 THR A HB   1 
ATOM   2807 H HG1  . THR A 1 189 ? 2.063   32.077 -30.584 1.00 40.70  ? 485 THR A HG1  1 
ATOM   2808 H HG21 . THR A 1 189 ? 1.219   31.336 -27.961 1.00 39.89  ? 485 THR A HG21 1 
ATOM   2809 H HG22 . THR A 1 189 ? 0.058   32.392 -27.785 1.00 39.89  ? 485 THR A HG22 1 
ATOM   2810 H HG23 . THR A 1 189 ? 0.154   31.537 -29.110 1.00 39.89  ? 485 THR A HG23 1 
ATOM   2811 N N    . MET A 1 190 ? 2.208   35.014 -31.479 1.00 32.50  ? 486 MET A N    1 
ATOM   2812 C CA   . MET A 1 190 ? 3.065   36.048 -32.047 1.00 34.50  ? 486 MET A CA   1 
ATOM   2813 C C    . MET A 1 190 ? 2.262   37.285 -32.420 1.00 37.16  ? 486 MET A C    1 
ATOM   2814 O O    . MET A 1 190 ? 2.723   38.416 -32.224 1.00 40.69  ? 486 MET A O    1 
ATOM   2815 C CB   . MET A 1 190 ? 3.805   35.507 -33.269 1.00 39.49  ? 486 MET A CB   1 
ATOM   2816 C CG   . MET A 1 190 ? 5.064   34.730 -32.936 1.00 47.83  ? 486 MET A CG   1 
ATOM   2817 S SD   . MET A 1 190 ? 6.224   34.641 -34.318 1.00 55.69  ? 486 MET A SD   1 
ATOM   2818 C CE   . MET A 1 190 ? 6.740   36.352 -34.450 1.00 59.44  ? 486 MET A CE   1 
ATOM   2819 H H    . MET A 1 190 ? 2.148   34.298 -31.950 1.00 39.00  ? 486 MET A H    1 
ATOM   2820 H HA   . MET A 1 190 ? 3.731   36.297 -31.386 1.00 41.40  ? 486 MET A HA   1 
ATOM   2821 H HB2  . MET A 1 190 ? 3.211   34.913 -33.755 1.00 47.39  ? 486 MET A HB2  1 
ATOM   2822 H HB3  . MET A 1 190 ? 4.059   36.252 -33.836 1.00 47.39  ? 486 MET A HB3  1 
ATOM   2823 H HG2  . MET A 1 190 ? 5.514   35.163 -32.194 1.00 57.40  ? 486 MET A HG2  1 
ATOM   2824 H HG3  . MET A 1 190 ? 4.820   33.823 -32.691 1.00 57.40  ? 486 MET A HG3  1 
ATOM   2825 H HE1  . MET A 1 190 ? 7.379   36.433 -35.175 1.00 71.33  ? 486 MET A HE1  1 
ATOM   2826 H HE2  . MET A 1 190 ? 5.962   36.903 -34.630 1.00 71.33  ? 486 MET A HE2  1 
ATOM   2827 H HE3  . MET A 1 190 ? 7.151   36.622 -33.614 1.00 71.33  ? 486 MET A HE3  1 
ATOM   2828 N N    . CYS A 1 191 ? 1.056   37.095 -32.958 1.00 35.75  ? 487 CYS A N    1 
ATOM   2829 C CA   . CYS A 1 191 ? 0.269   38.231 -33.420 1.00 36.87  ? 487 CYS A CA   1 
ATOM   2830 C C    . CYS A 1 191 ? -0.472  38.922 -32.283 1.00 36.31  ? 487 CYS A C    1 
ATOM   2831 O O    . CYS A 1 191 ? -0.702  40.134 -32.349 1.00 37.63  ? 487 CYS A O    1 
ATOM   2832 C CB   . CYS A 1 191 ? -0.726  37.783 -34.492 1.00 42.57  ? 487 CYS A CB   1 
ATOM   2833 S SG   . CYS A 1 191 ? 0.036   37.366 -36.085 1.00 51.98  ? 487 CYS A SG   1 
ATOM   2834 H H    . CYS A 1 191 ? 0.679   36.330 -33.064 1.00 42.90  ? 487 CYS A H    1 
ATOM   2835 H HA   . CYS A 1 191 ? 0.866   38.882 -33.823 1.00 44.25  ? 487 CYS A HA   1 
ATOM   2836 H HB2  . CYS A 1 191 ? -1.193  36.995 -34.173 1.00 51.08  ? 487 CYS A HB2  1 
ATOM   2837 H HB3  . CYS A 1 191 ? -1.361  38.499 -34.647 1.00 51.08  ? 487 CYS A HB3  1 
ATOM   2838 H HG   . CYS A 1 191 ? -0.823  37.028 -36.852 1.00 62.38  ? 487 CYS A HG   1 
ATOM   2839 N N    . ASN A 1 192 ? -0.844  38.186 -31.237 1.00 34.65  ? 488 ASN A N    1 
ATOM   2840 C CA   . ASN A 1 192 ? -1.667  38.750 -30.175 1.00 36.25  ? 488 ASN A CA   1 
ATOM   2841 C C    . ASN A 1 192 ? -0.895  39.083 -28.907 1.00 36.16  ? 488 ASN A C    1 
ATOM   2842 O O    . ASN A 1 192 ? -1.413  39.833 -28.071 1.00 35.70  ? 488 ASN A O    1 
ATOM   2843 C CB   . ASN A 1 192 ? -2.812  37.792 -29.834 1.00 34.39  ? 488 ASN A CB   1 
ATOM   2844 C CG   . ASN A 1 192 ? -3.898  37.793 -30.893 1.00 37.03  ? 488 ASN A CG   1 
ATOM   2845 O OD1  . ASN A 1 192 ? -4.835  38.586 -30.830 1.00 39.74  ? 488 ASN A OD1  1 
ATOM   2846 N ND2  . ASN A 1 192 ? -3.762  36.921 -31.887 1.00 35.93  ? 488 ASN A ND2  1 
ATOM   2847 H H    . ASN A 1 192 ? -0.633  37.360 -31.120 1.00 41.58  ? 488 ASN A H    1 
ATOM   2848 H HA   . ASN A 1 192 ? -2.063  39.574 -30.500 1.00 43.50  ? 488 ASN A HA   1 
ATOM   2849 H HB2  . ASN A 1 192 ? -2.461  36.890 -29.763 1.00 41.27  ? 488 ASN A HB2  1 
ATOM   2850 H HB3  . ASN A 1 192 ? -3.211  38.061 -28.992 1.00 41.27  ? 488 ASN A HB3  1 
ATOM   2851 H HD21 . ASN A 1 192 ? -4.353  36.885 -32.511 1.00 43.12  ? 488 ASN A HD21 1 
ATOM   2852 H HD22 . ASN A 1 192 ? -3.084  36.393 -31.906 1.00 43.12  ? 488 ASN A HD22 1 
ATOM   2853 N N    . TYR A 1 193 ? 0.317   38.552 -28.740 1.00 35.47  ? 489 TYR A N    1 
ATOM   2854 C CA   . TYR A 1 193 ? 1.172   38.890 -27.600 1.00 35.35  ? 489 TYR A CA   1 
ATOM   2855 C C    . TYR A 1 193 ? 2.604   39.070 -28.090 1.00 34.51  ? 489 TYR A C    1 
ATOM   2856 O O    . TYR A 1 193 ? 3.531   38.406 -27.617 1.00 35.21  ? 489 TYR A O    1 
ATOM   2857 C CB   . TYR A 1 193 ? 1.087   37.814 -26.518 1.00 32.15  ? 489 TYR A CB   1 
ATOM   2858 C CG   . TYR A 1 193 ? -0.308  37.608 -25.979 1.00 33.75  ? 489 TYR A CG   1 
ATOM   2859 C CD1  . TYR A 1 193 ? -1.171  36.698 -26.569 1.00 32.16  ? 489 TYR A CD1  1 
ATOM   2860 C CD2  . TYR A 1 193 ? -0.762  38.325 -24.879 1.00 37.49  ? 489 TYR A CD2  1 
ATOM   2861 C CE1  . TYR A 1 193 ? -2.448  36.503 -26.081 1.00 30.62  ? 489 TYR A CE1  1 
ATOM   2862 C CE2  . TYR A 1 193 ? -2.041  38.139 -24.383 1.00 35.49  ? 489 TYR A CE2  1 
ATOM   2863 C CZ   . TYR A 1 193 ? -2.878  37.224 -24.987 1.00 32.96  ? 489 TYR A CZ   1 
ATOM   2864 O OH   . TYR A 1 193 ? -4.154  37.033 -24.505 1.00 32.54  ? 489 TYR A OH   1 
ATOM   2865 H H    . TYR A 1 193 ? 0.671   37.985 -29.281 1.00 42.57  ? 489 TYR A H    1 
ATOM   2866 H HA   . TYR A 1 193 ? 0.876   39.730 -27.216 1.00 42.42  ? 489 TYR A HA   1 
ATOM   2867 H HB2  . TYR A 1 193 ? 1.388   36.971 -26.891 1.00 38.58  ? 489 TYR A HB2  1 
ATOM   2868 H HB3  . TYR A 1 193 ? 1.657   38.069 -25.776 1.00 38.58  ? 489 TYR A HB3  1 
ATOM   2869 H HD1  . TYR A 1 193 ? -0.884  36.208 -27.306 1.00 38.59  ? 489 TYR A HD1  1 
ATOM   2870 H HD2  . TYR A 1 193 ? -0.198  38.941 -24.469 1.00 44.98  ? 489 TYR A HD2  1 
ATOM   2871 H HE1  . TYR A 1 193 ? -3.015  35.889 -26.489 1.00 36.75  ? 489 TYR A HE1  1 
ATOM   2872 H HE2  . TYR A 1 193 ? -2.333  38.625 -23.645 1.00 42.59  ? 489 TYR A HE2  1 
ATOM   2873 H HH   . TYR A 1 193 ? -4.553  36.455 -24.968 1.00 39.05  ? 489 TYR A HH   1 
ATOM   2874 N N    . PRO A 1 194 ? 2.821   39.981 -29.043 1.00 35.76  ? 490 PRO A N    1 
ATOM   2875 C CA   . PRO A 1 194 ? 4.169   40.117 -29.615 1.00 39.90  ? 490 PRO A CA   1 
ATOM   2876 C C    . PRO A 1 194 ? 5.192   40.662 -28.636 1.00 39.29  ? 490 PRO A C    1 
ATOM   2877 O O    . PRO A 1 194 ? 6.387   40.388 -28.797 1.00 38.85  ? 490 PRO A O    1 
ATOM   2878 C CB   . PRO A 1 194 ? 3.951   41.072 -30.796 1.00 40.88  ? 490 PRO A CB   1 
ATOM   2879 C CG   . PRO A 1 194 ? 2.771   41.875 -30.404 1.00 39.60  ? 490 PRO A CG   1 
ATOM   2880 C CD   . PRO A 1 194 ? 1.882   40.964 -29.607 1.00 37.50  ? 490 PRO A CD   1 
ATOM   2881 H HA   . PRO A 1 194 ? 4.476   39.261 -29.952 1.00 47.88  ? 490 PRO A HA   1 
ATOM   2882 H HB2  . PRO A 1 194 ? 4.731   41.637 -30.910 1.00 49.05  ? 490 PRO A HB2  1 
ATOM   2883 H HB3  . PRO A 1 194 ? 3.770   40.563 -31.602 1.00 49.05  ? 490 PRO A HB3  1 
ATOM   2884 H HG2  . PRO A 1 194 ? 3.058   42.627 -29.863 1.00 47.52  ? 490 PRO A HG2  1 
ATOM   2885 H HG3  . PRO A 1 194 ? 2.313   42.185 -31.200 1.00 47.52  ? 490 PRO A HG3  1 
ATOM   2886 H HD2  . PRO A 1 194 ? 1.441   41.457 -28.897 1.00 45.01  ? 490 PRO A HD2  1 
ATOM   2887 H HD3  . PRO A 1 194 ? 1.240   40.525 -30.187 1.00 45.01  ? 490 PRO A HD3  1 
ATOM   2888 N N    . GLN A 1 195 ? 4.773   41.434 -27.631 1.00 41.13  ? 491 GLN A N    1 
ATOM   2889 C CA   . GLN A 1 195 ? 5.718   41.921 -26.633 1.00 44.97  ? 491 GLN A CA   1 
ATOM   2890 C C    . GLN A 1 195 ? 6.137   40.833 -25.655 1.00 44.71  ? 491 GLN A C    1 
ATOM   2891 O O    . GLN A 1 195 ? 7.198   40.951 -25.033 1.00 47.61  ? 491 GLN A O    1 
ATOM   2892 C CB   . GLN A 1 195 ? 5.118   43.104 -25.868 1.00 45.79  ? 491 GLN A CB   1 
ATOM   2893 C CG   . GLN A 1 195 ? 5.017   44.381 -26.687 1.00 46.70  ? 491 GLN A CG   1 
ATOM   2894 C CD   . GLN A 1 195 ? 6.375   44.918 -27.101 1.00 53.24  ? 491 GLN A CD   1 
ATOM   2895 O OE1  . GLN A 1 195 ? 7.315   44.929 -26.307 1.00 56.78  ? 491 GLN A OE1  1 
ATOM   2896 N NE2  . GLN A 1 195 ? 6.484   45.362 -28.348 1.00 54.54  ? 491 GLN A NE2  1 
ATOM   2897 H H    . GLN A 1 195 ? 3.960   41.686 -27.509 1.00 49.36  ? 491 GLN A H    1 
ATOM   2898 H HA   . GLN A 1 195 ? 6.516   42.235 -27.086 1.00 53.96  ? 491 GLN A HA   1 
ATOM   2899 H HB2  . GLN A 1 195 ? 4.224   42.867 -25.577 1.00 54.95  ? 491 GLN A HB2  1 
ATOM   2900 H HB3  . GLN A 1 195 ? 5.676   43.291 -25.096 1.00 54.95  ? 491 GLN A HB3  1 
ATOM   2901 H HG2  . GLN A 1 195 ? 4.508   44.201 -27.493 1.00 56.04  ? 491 GLN A HG2  1 
ATOM   2902 H HG3  . GLN A 1 195 ? 4.573   45.062 -26.159 1.00 56.04  ? 491 GLN A HG3  1 
ATOM   2903 H HE21 . GLN A 1 195 ? 5.805   45.336 -28.875 1.00 65.45  ? 491 GLN A HE21 1 
ATOM   2904 H HE22 . GLN A 1 195 ? 7.235   45.676 -28.628 1.00 65.45  ? 491 GLN A HE22 1 
ATOM   2905 N N    . GLN A 1 196 ? 5.333   39.783 -25.507 1.00 46.11  ? 492 GLN A N    1 
ATOM   2906 C CA   . GLN A 1 196 ? 5.685   38.636 -24.674 1.00 49.28  ? 492 GLN A CA   1 
ATOM   2907 C C    . GLN A 1 196 ? 6.577   37.718 -25.505 1.00 47.15  ? 492 GLN A C    1 
ATOM   2908 O O    . GLN A 1 196 ? 6.107   36.830 -26.219 1.00 43.62  ? 492 GLN A O    1 
ATOM   2909 C CB   . GLN A 1 196 ? 4.431   37.921 -24.190 1.00 54.72  ? 492 GLN A CB   1 
ATOM   2910 C CG   . GLN A 1 196 ? 4.704   36.835 -23.163 1.00 65.59  ? 492 GLN A CG   1 
ATOM   2911 C CD   . GLN A 1 196 ? 4.562   37.325 -21.733 1.00 75.73  ? 492 GLN A CD   1 
ATOM   2912 O OE1  . GLN A 1 196 ? 3.678   38.123 -21.419 1.00 78.23  ? 492 GLN A OE1  1 
ATOM   2913 N NE2  . GLN A 1 196 ? 5.440   36.849 -20.857 1.00 81.22  ? 492 GLN A NE2  1 
ATOM   2914 H H    . GLN A 1 196 ? 4.564   39.711 -25.886 1.00 55.33  ? 492 GLN A H    1 
ATOM   2915 H HA   . GLN A 1 196 ? 6.187   38.937 -23.901 1.00 59.14  ? 492 GLN A HA   1 
ATOM   2916 H HB2  . GLN A 1 196 ? 3.837   38.571 -23.784 1.00 65.66  ? 492 GLN A HB2  1 
ATOM   2917 H HB3  . GLN A 1 196 ? 3.994   37.506 -24.951 1.00 65.66  ? 492 GLN A HB3  1 
ATOM   2918 H HG2  . GLN A 1 196 ? 4.073   36.110 -23.295 1.00 78.71  ? 492 GLN A HG2  1 
ATOM   2919 H HG3  . GLN A 1 196 ? 5.610   36.511 -23.280 1.00 78.71  ? 492 GLN A HG3  1 
ATOM   2920 H HE21 . GLN A 1 196 ? 6.046   36.295 -21.114 1.00 97.47  ? 492 GLN A HE21 1 
ATOM   2921 H HE22 . GLN A 1 196 ? 5.403   37.095 -20.034 1.00 97.47  ? 492 GLN A HE22 1 
ATOM   2922 N N    . THR A 1 197 ? 7.886   37.939 -25.406 1.00 48.59  ? 493 THR A N    1 
ATOM   2923 C CA   . THR A 1 197 ? 8.837   37.224 -26.247 1.00 47.94  ? 493 THR A CA   1 
ATOM   2924 C C    . THR A 1 197 ? 8.749   35.722 -26.008 1.00 43.66  ? 493 THR A C    1 
ATOM   2925 O O    . THR A 1 197 ? 8.710   35.263 -24.863 1.00 40.77  ? 493 THR A O    1 
ATOM   2926 C CB   . THR A 1 197 ? 10.261  37.708 -25.968 1.00 53.55  ? 493 THR A CB   1 
ATOM   2927 O OG1  . THR A 1 197 ? 10.267  39.134 -25.832 1.00 57.37  ? 493 THR A OG1  1 
ATOM   2928 C CG2  . THR A 1 197 ? 11.193  37.304 -27.108 1.00 51.51  ? 493 THR A CG2  1 
ATOM   2929 H H    . THR A 1 197 ? 8.247   38.498 -24.861 1.00 58.31  ? 493 THR A H    1 
ATOM   2930 H HA   . THR A 1 197 ? 8.634   37.396 -27.180 1.00 57.53  ? 493 THR A HA   1 
ATOM   2931 H HB   . THR A 1 197 ? 10.585  37.304 -25.148 1.00 64.26  ? 493 THR A HB   1 
ATOM   2932 H HG1  . THR A 1 197 ? 11.047  39.405 -25.678 1.00 68.85  ? 493 THR A HG1  1 
ATOM   2933 H HG21 . THR A 1 197 ? 12.094  37.614 -26.925 1.00 61.81  ? 493 THR A HG21 1 
ATOM   2934 H HG22 . THR A 1 197 ? 11.204  36.339 -27.200 1.00 61.81  ? 493 THR A HG22 1 
ATOM   2935 H HG23 . THR A 1 197 ? 10.888  37.697 -27.940 1.00 61.81  ? 493 THR A HG23 1 
ATOM   2936 N N    . GLU A 1 198 ? 8.714   34.957 -27.099 1.00 39.83  ? 494 GLU A N    1 
ATOM   2937 C CA   . GLU A 1 198 ? 8.814   33.501 -27.030 1.00 43.93  ? 494 GLU A CA   1 
ATOM   2938 C C    . GLU A 1 198 ? 7.653   32.887 -26.249 1.00 38.84  ? 494 GLU A C    1 
ATOM   2939 O O    . GLU A 1 198 ? 7.793   31.822 -25.643 1.00 38.88  ? 494 GLU A O    1 
ATOM   2940 C CB   . GLU A 1 198 ? 10.151  33.086 -26.408 1.00 56.67  ? 494 GLU A CB   1 
ATOM   2941 C CG   . GLU A 1 198 ? 10.557  31.642 -26.655 1.00 67.39  ? 494 GLU A CG   1 
ATOM   2942 C CD   . GLU A 1 198 ? 10.980  31.392 -28.087 1.00 73.85  ? 494 GLU A CD   1 
ATOM   2943 O OE1  . GLU A 1 198 ? 10.872  32.320 -28.915 1.00 75.04  ? 494 GLU A OE1  1 
ATOM   2944 O OE2  . GLU A 1 198 ? 11.425  30.267 -28.383 1.00 76.96  ? 494 GLU A OE2  1 
ATOM   2945 H H    . GLU A 1 198 ? 8.633   35.261 -27.899 1.00 47.79  ? 494 GLU A H    1 
ATOM   2946 H HA   . GLU A 1 198 ? 8.784   33.145 -27.931 1.00 52.72  ? 494 GLU A HA   1 
ATOM   2947 H HB2  . GLU A 1 198 ? 10.849  33.652 -26.773 1.00 68.00  ? 494 GLU A HB2  1 
ATOM   2948 H HB3  . GLU A 1 198 ? 10.097  33.214 -25.448 1.00 68.00  ? 494 GLU A HB3  1 
ATOM   2949 H HG2  . GLU A 1 198 ? 11.304  31.420 -26.078 1.00 80.87  ? 494 GLU A HG2  1 
ATOM   2950 H HG3  . GLU A 1 198 ? 9.803   31.063 -26.460 1.00 80.87  ? 494 GLU A HG3  1 
ATOM   2951 N N    . LYS A 1 199 ? 6.491   33.545 -26.248 1.00 27.71  ? 495 LYS A N    1 
ATOM   2952 C CA   . LYS A 1 199 ? 5.355   33.008 -25.501 1.00 30.72  ? 495 LYS A CA   1 
ATOM   2953 C C    . LYS A 1 199 ? 4.994   31.612 -25.991 1.00 26.75  ? 495 LYS A C    1 
ATOM   2954 O O    . LYS A 1 199 ? 4.659   30.730 -25.191 1.00 28.39  ? 495 LYS A O    1 
ATOM   2955 C CB   . LYS A 1 199 ? 4.147   33.940 -25.616 1.00 28.72  ? 495 LYS A CB   1 
ATOM   2956 C CG   . LYS A 1 199 ? 2.951   33.452 -24.805 1.00 30.65  ? 495 LYS A CG   1 
ATOM   2957 C CD   . LYS A 1 199 ? 1.798   34.438 -24.784 1.00 31.43  ? 495 LYS A CD   1 
ATOM   2958 C CE   . LYS A 1 199 ? 0.645   33.882 -23.953 1.00 30.87  ? 495 LYS A CE   1 
ATOM   2959 N NZ   . LYS A 1 199 ? -0.541  34.776 -23.944 1.00 31.44  ? 495 LYS A NZ   1 
ATOM   2960 H H    . LYS A 1 199 ? 6.338   34.285 -26.659 1.00 33.25  ? 495 LYS A H    1 
ATOM   2961 H HA   . LYS A 1 199 ? 5.595   32.944 -24.564 1.00 36.86  ? 495 LYS A HA   1 
ATOM   2962 H HB2  . LYS A 1 199 ? 4.393   34.819 -25.288 1.00 34.47  ? 495 LYS A HB2  1 
ATOM   2963 H HB3  . LYS A 1 199 ? 3.877   33.995 -26.546 1.00 34.47  ? 495 LYS A HB3  1 
ATOM   2964 H HG2  . LYS A 1 199 ? 2.627   32.623 -25.190 1.00 36.78  ? 495 LYS A HG2  1 
ATOM   2965 H HG3  . LYS A 1 199 ? 3.232   33.303 -23.889 1.00 36.78  ? 495 LYS A HG3  1 
ATOM   2966 H HD2  . LYS A 1 199 ? 2.092   35.271 -24.384 1.00 37.72  ? 495 LYS A HD2  1 
ATOM   2967 H HD3  . LYS A 1 199 ? 1.482   34.587 -25.689 1.00 37.72  ? 495 LYS A HD3  1 
ATOM   2968 H HE2  . LYS A 1 199 ? 0.374   33.027 -24.323 1.00 37.05  ? 495 LYS A HE2  1 
ATOM   2969 H HE3  . LYS A 1 199 ? 0.942   33.768 -23.037 1.00 37.05  ? 495 LYS A HE3  1 
ATOM   2970 H HZ1  . LYS A 1 199 ? -1.189  34.417 -23.450 1.00 37.73  ? 495 LYS A HZ1  1 
ATOM   2971 H HZ2  . LYS A 1 199 ? -0.322  35.568 -23.602 1.00 37.73  ? 495 LYS A HZ2  1 
ATOM   2972 H HZ3  . LYS A 1 199 ? -0.841  34.893 -24.774 1.00 37.73  ? 495 LYS A HZ3  1 
ATOM   2973 N N    . PHE A 1 200 ? 5.056   31.398 -27.305 1.00 30.50  ? 496 PHE A N    1 
ATOM   2974 C CA   . PHE A 1 200 ? 4.803   30.079 -27.877 1.00 29.59  ? 496 PHE A CA   1 
ATOM   2975 C C    . PHE A 1 200 ? 5.644   29.007 -27.189 1.00 34.20  ? 496 PHE A C    1 
ATOM   2976 O O    . PHE A 1 200 ? 5.115   28.007 -26.690 1.00 31.30  ? 496 PHE A O    1 
ATOM   2977 C CB   . PHE A 1 200 ? 5.091   30.135 -29.379 1.00 31.83  ? 496 PHE A CB   1 
ATOM   2978 C CG   . PHE A 1 200 ? 4.997   28.812 -30.080 1.00 30.12  ? 496 PHE A CG   1 
ATOM   2979 C CD1  . PHE A 1 200 ? 3.793   28.133 -30.156 1.00 33.92  ? 496 PHE A CD1  1 
ATOM   2980 C CD2  . PHE A 1 200 ? 6.109   28.268 -30.703 1.00 27.75  ? 496 PHE A CD2  1 
ATOM   2981 C CE1  . PHE A 1 200 ? 3.706   26.923 -30.820 1.00 33.66  ? 496 PHE A CE1  1 
ATOM   2982 C CE2  . PHE A 1 200 ? 6.030   27.060 -31.369 1.00 33.30  ? 496 PHE A CE2  1 
ATOM   2983 C CZ   . PHE A 1 200 ? 4.826   26.388 -31.431 1.00 33.60  ? 496 PHE A CZ   1 
ATOM   2984 H H    . PHE A 1 200 ? 5.243   32.002 -27.887 1.00 36.60  ? 496 PHE A H    1 
ATOM   2985 H HA   . PHE A 1 200 ? 3.867   29.854 -27.756 1.00 35.51  ? 496 PHE A HA   1 
ATOM   2986 H HB2  . PHE A 1 200 ? 4.452   30.734 -29.795 1.00 38.20  ? 496 PHE A HB2  1 
ATOM   2987 H HB3  . PHE A 1 200 ? 5.990   30.474 -29.510 1.00 38.20  ? 496 PHE A HB3  1 
ATOM   2988 H HD1  . PHE A 1 200 ? 3.037   28.489 -29.748 1.00 40.70  ? 496 PHE A HD1  1 
ATOM   2989 H HD2  . PHE A 1 200 ? 6.922   28.719 -30.666 1.00 33.30  ? 496 PHE A HD2  1 
ATOM   2990 H HE1  . PHE A 1 200 ? 2.894   26.471 -30.859 1.00 40.39  ? 496 PHE A HE1  1 
ATOM   2991 H HE2  . PHE A 1 200 ? 6.785   26.702 -31.777 1.00 39.96  ? 496 PHE A HE2  1 
ATOM   2992 H HZ   . PHE A 1 200 ? 4.770   25.572 -31.875 1.00 40.31  ? 496 PHE A HZ   1 
ATOM   2993 N N    . GLY A 1 201 ? 6.960   29.210 -27.143 1.00 28.79  ? 497 GLY A N    1 
ATOM   2994 C CA   . GLY A 1 201 ? 7.829   28.229 -26.512 1.00 32.18  ? 497 GLY A CA   1 
ATOM   2995 C C    . GLY A 1 201 ? 7.584   28.099 -25.021 1.00 29.35  ? 497 GLY A C    1 
ATOM   2996 O O    . GLY A 1 201 ? 7.664   27.000 -24.464 1.00 31.24  ? 497 GLY A O    1 
ATOM   2997 H H    . GLY A 1 201 ? 7.366   29.897 -27.464 1.00 34.54  ? 497 GLY A H    1 
ATOM   2998 H HA2  . GLY A 1 201 ? 7.686   27.362 -26.923 1.00 38.62  ? 497 GLY A HA2  1 
ATOM   2999 H HA3  . GLY A 1 201 ? 8.755   28.484 -26.649 1.00 38.62  ? 497 GLY A HA3  1 
ATOM   3000 N N    . GLN A 1 202 ? 7.286   29.215 -24.351 1.00 32.14  ? 498 GLN A N    1 
ATOM   3001 C CA   . GLN A 1 202 ? 7.026   29.166 -22.915 1.00 34.17  ? 498 GLN A CA   1 
ATOM   3002 C C    . GLN A 1 202 ? 5.759   28.384 -22.595 1.00 32.96  ? 498 GLN A C    1 
ATOM   3003 O O    . GLN A 1 202 ? 5.667   27.771 -21.526 1.00 32.67  ? 498 GLN A O    1 
ATOM   3004 C CB   . GLN A 1 202 ? 6.928   30.584 -22.350 1.00 36.53  ? 498 GLN A CB   1 
ATOM   3005 C CG   . GLN A 1 202 ? 8.266   31.310 -22.279 1.00 39.10  ? 498 GLN A CG   1 
ATOM   3006 C CD   . GLN A 1 202 ? 9.187   30.731 -21.222 1.00 45.35  ? 498 GLN A CD   1 
ATOM   3007 O OE1  . GLN A 1 202 ? 8.731   30.171 -20.226 1.00 44.29  ? 498 GLN A OE1  1 
ATOM   3008 N NE2  . GLN A 1 202 ? 10.493  30.859 -21.437 1.00 47.41  ? 498 GLN A NE2  1 
ATOM   3009 H H    . GLN A 1 202 ? 7.229   29.999 -24.700 1.00 38.57  ? 498 GLN A H    1 
ATOM   3010 H HA   . GLN A 1 202 ? 7.769   28.722 -22.477 1.00 41.00  ? 498 GLN A HA   1 
ATOM   3011 H HB2  . GLN A 1 202 ? 6.337   31.105 -22.914 1.00 43.84  ? 498 GLN A HB2  1 
ATOM   3012 H HB3  . GLN A 1 202 ? 6.568   30.537 -21.450 1.00 43.84  ? 498 GLN A HB3  1 
ATOM   3013 H HG2  . GLN A 1 202 ? 8.711   31.239 -23.138 1.00 46.91  ? 498 GLN A HG2  1 
ATOM   3014 H HG3  . GLN A 1 202 ? 8.109   32.243 -22.062 1.00 46.91  ? 498 GLN A HG3  1 
ATOM   3015 H HE21 . GLN A 1 202 ? 10.775  31.255 -22.147 1.00 56.90  ? 498 GLN A HE21 1 
ATOM   3016 H HE22 . GLN A 1 202 ? 11.055  30.546 -20.867 1.00 56.90  ? 498 GLN A HE22 1 
ATOM   3017 N N    . LEU A 1 203 ? 4.774   28.394 -23.493 1.00 33.73  ? 499 LEU A N    1 
ATOM   3018 C CA   . LEU A 1 203 ? 3.576   27.591 -23.272 1.00 27.74  ? 499 LEU A CA   1 
ATOM   3019 C C    . LEU A 1 203 ? 3.874   26.108 -23.463 1.00 28.12  ? 499 LEU A C    1 
ATOM   3020 O O    . LEU A 1 203 ? 3.483   25.275 -22.638 1.00 33.21  ? 499 LEU A O    1 
ATOM   3021 C CB   . LEU A 1 203 ? 2.457   28.047 -24.212 1.00 29.00  ? 499 LEU A CB   1 
ATOM   3022 C CG   . LEU A 1 203 ? 1.854   29.434 -23.956 1.00 32.51  ? 499 LEU A CG   1 
ATOM   3023 C CD1  . LEU A 1 203 ? 0.822   29.762 -25.022 1.00 34.64  ? 499 LEU A CD1  1 
ATOM   3024 C CD2  . LEU A 1 203 ? 1.227   29.525 -22.571 1.00 29.38  ? 499 LEU A CD2  1 
ATOM   3025 H H    . LEU A 1 203 ? 4.774   28.848 -24.223 1.00 40.47  ? 499 LEU A H    1 
ATOM   3026 H HA   . LEU A 1 203 ? 3.273   27.721 -22.360 1.00 33.29  ? 499 LEU A HA   1 
ATOM   3027 H HB2  . LEU A 1 203 ? 2.806   28.050 -25.117 1.00 34.80  ? 499 LEU A HB2  1 
ATOM   3028 H HB3  . LEU A 1 203 ? 1.732   27.405 -24.151 1.00 34.80  ? 499 LEU A HB3  1 
ATOM   3029 H HG   . LEU A 1 203 ? 2.559   30.097 -24.009 1.00 39.01  ? 499 LEU A HG   1 
ATOM   3030 H HD11 . LEU A 1 203 ? 0.453   30.641 -24.844 1.00 41.57  ? 499 LEU A HD11 1 
ATOM   3031 H HD12 . LEU A 1 203 ? 1.253   29.754 -25.891 1.00 41.57  ? 499 LEU A HD12 1 
ATOM   3032 H HD13 . LEU A 1 203 ? 0.118   29.095 -24.995 1.00 41.57  ? 499 LEU A HD13 1 
ATOM   3033 H HD21 . LEU A 1 203 ? 0.859   30.415 -22.449 1.00 35.26  ? 499 LEU A HD21 1 
ATOM   3034 H HD22 . LEU A 1 203 ? 0.523   28.862 -22.499 1.00 35.26  ? 499 LEU A HD22 1 
ATOM   3035 H HD23 . LEU A 1 203 ? 1.911   29.356 -21.903 1.00 35.26  ? 499 LEU A HD23 1 
ATOM   3036 N N    . LEU A 1 204 ? 4.572   25.758 -24.546 1.00 29.83  ? 500 LEU A N    1 
ATOM   3037 C CA   . LEU A 1 204 ? 4.874   24.354 -24.806 1.00 30.47  ? 500 LEU A CA   1 
ATOM   3038 C C    . LEU A 1 204 ? 5.732   23.746 -23.702 1.00 35.83  ? 500 LEU A C    1 
ATOM   3039 O O    . LEU A 1 204 ? 5.636   22.543 -23.434 1.00 37.71  ? 500 LEU A O    1 
ATOM   3040 C CB   . LEU A 1 204 ? 5.575   24.211 -26.156 1.00 32.25  ? 500 LEU A CB   1 
ATOM   3041 C CG   . LEU A 1 204 ? 4.753   24.628 -27.378 1.00 29.41  ? 500 LEU A CG   1 
ATOM   3042 C CD1  . LEU A 1 204 ? 5.562   24.432 -28.643 1.00 33.91  ? 500 LEU A CD1  1 
ATOM   3043 C CD2  . LEU A 1 204 ? 3.447   23.847 -27.456 1.00 31.23  ? 500 LEU A CD2  1 
ATOM   3044 H H    . LEU A 1 204 ? 4.876   26.306 -25.135 1.00 35.79  ? 500 LEU A H    1 
ATOM   3045 H HA   . LEU A 1 204 ? 4.043   23.855 -24.846 1.00 36.56  ? 500 LEU A HA   1 
ATOM   3046 H HB2  . LEU A 1 204 ? 6.376   24.758 -26.145 1.00 38.70  ? 500 LEU A HB2  1 
ATOM   3047 H HB3  . LEU A 1 204 ? 5.821   23.280 -26.276 1.00 38.70  ? 500 LEU A HB3  1 
ATOM   3048 H HG   . LEU A 1 204 ? 4.535   25.570 -27.305 1.00 35.29  ? 500 LEU A HG   1 
ATOM   3049 H HD11 . LEU A 1 204 ? 5.025   24.702 -29.405 1.00 40.69  ? 500 LEU A HD11 1 
ATOM   3050 H HD12 . LEU A 1 204 ? 6.363   24.977 -28.592 1.00 40.69  ? 500 LEU A HD12 1 
ATOM   3051 H HD13 . LEU A 1 204 ? 5.802   23.496 -28.721 1.00 40.69  ? 500 LEU A HD13 1 
ATOM   3052 H HD21 . LEU A 1 204 ? 2.953   24.136 -28.239 1.00 37.48  ? 500 LEU A HD21 1 
ATOM   3053 H HD22 . LEU A 1 204 ? 3.649   22.901 -27.521 1.00 37.48  ? 500 LEU A HD22 1 
ATOM   3054 H HD23 . LEU A 1 204 ? 2.928   24.021 -26.655 1.00 37.48  ? 500 LEU A HD23 1 
ATOM   3055 N N    . LEU A 1 205 ? 6.574   24.554 -23.056 1.00 36.38  ? 501 LEU A N    1 
ATOM   3056 C CA   . LEU A 1 205 ? 7.405   24.044 -21.969 1.00 39.61  ? 501 LEU A CA   1 
ATOM   3057 C C    . LEU A 1 205 ? 6.573   23.440 -20.852 1.00 39.27  ? 501 LEU A C    1 
ATOM   3058 O O    . LEU A 1 205 ? 7.050   22.554 -20.134 1.00 41.74  ? 501 LEU A O    1 
ATOM   3059 C CB   . LEU A 1 205 ? 8.269   25.163 -21.400 1.00 45.19  ? 501 LEU A CB   1 
ATOM   3060 C CG   . LEU A 1 205 ? 9.570   25.453 -22.129 1.00 49.86  ? 501 LEU A CG   1 
ATOM   3061 C CD1  . LEU A 1 205 ? 10.151  26.730 -21.575 1.00 52.23  ? 501 LEU A CD1  1 
ATOM   3062 C CD2  . LEU A 1 205 ? 10.542  24.283 -21.974 1.00 54.78  ? 501 LEU A CD2  1 
ATOM   3063 H H    . LEU A 1 205 ? 6.681   25.390 -23.225 1.00 43.66  ? 501 LEU A H    1 
ATOM   3064 H HA   . LEU A 1 205 ? 7.993   23.354 -22.316 1.00 47.53  ? 501 LEU A HA   1 
ATOM   3065 H HB2  . LEU A 1 205 ? 7.748   25.981 -21.406 1.00 54.23  ? 501 LEU A HB2  1 
ATOM   3066 H HB3  . LEU A 1 205 ? 8.498   24.934 -20.486 1.00 54.23  ? 501 LEU A HB3  1 
ATOM   3067 H HG   . LEU A 1 205 ? 9.390   25.581 -23.074 1.00 59.83  ? 501 LEU A HG   1 
ATOM   3068 H HD11 . LEU A 1 205 ? 10.983  26.923 -22.034 1.00 62.68  ? 501 LEU A HD11 1 
ATOM   3069 H HD12 . LEU A 1 205 ? 9.519   27.451 -21.716 1.00 62.68  ? 501 LEU A HD12 1 
ATOM   3070 H HD13 . LEU A 1 205 ? 10.316  26.615 -20.626 1.00 62.68  ? 501 LEU A HD13 1 
ATOM   3071 H HD21 . LEU A 1 205 ? 11.364  24.491 -22.447 1.00 65.74  ? 501 LEU A HD21 1 
ATOM   3072 H HD22 . LEU A 1 205 ? 10.728  24.150 -21.031 1.00 65.74  ? 501 LEU A HD22 1 
ATOM   3073 H HD23 . LEU A 1 205 ? 10.138  23.485 -22.348 1.00 65.74  ? 501 LEU A HD23 1 
ATOM   3074 N N    . ARG A 1 206 ? 5.339   23.909 -20.678 1.00 35.97  ? 502 ARG A N    1 
ATOM   3075 C CA   . ARG A 1 206 ? 4.523   23.469 -19.556 1.00 35.01  ? 502 ARG A CA   1 
ATOM   3076 C C    . ARG A 1 206 ? 3.923   22.090 -19.794 1.00 36.08  ? 502 ARG A C    1 
ATOM   3077 O O    . ARG A 1 206 ? 3.539   21.421 -18.831 1.00 33.90  ? 502 ARG A O    1 
ATOM   3078 C CB   . ARG A 1 206 ? 3.404   24.481 -19.286 1.00 36.73  ? 502 ARG A CB   1 
ATOM   3079 C CG   . ARG A 1 206 ? 3.776   25.968 -19.456 1.00 41.86  ? 502 ARG A CG   1 
ATOM   3080 C CD   . ARG A 1 206 ? 4.297   26.594 -18.178 1.00 43.44  ? 502 ARG A CD   1 
ATOM   3081 N NE   . ARG A 1 206 ? 5.657   26.172 -17.845 1.00 41.77  ? 502 ARG A NE   1 
ATOM   3082 C CZ   . ARG A 1 206 ? 6.760   26.869 -18.107 1.00 47.33  ? 502 ARG A CZ   1 
ATOM   3083 N NH1  . ARG A 1 206 ? 6.695   28.041 -18.723 1.00 50.38  ? 502 ARG A NH1  1 
ATOM   3084 N NH2  . ARG A 1 206 ? 7.943   26.385 -17.752 1.00 51.55  ? 502 ARG A NH2  1 
ATOM   3085 H H    . ARG A 1 206 ? 4.954   24.479 -21.194 1.00 43.16  ? 502 ARG A H    1 
ATOM   3086 H HA   . ARG A 1 206 ? 5.080   23.420 -18.763 1.00 42.01  ? 502 ARG A HA   1 
ATOM   3087 H HB2  . ARG A 1 206 ? 2.672   24.295 -19.895 1.00 44.08  ? 502 ARG A HB2  1 
ATOM   3088 H HB3  . ARG A 1 206 ? 3.100   24.362 -18.373 1.00 44.08  ? 502 ARG A HB3  1 
ATOM   3089 H HG2  . ARG A 1 206 ? 4.468   26.046 -20.132 1.00 50.23  ? 502 ARG A HG2  1 
ATOM   3090 H HG3  . ARG A 1 206 ? 2.987   26.462 -19.732 1.00 50.23  ? 502 ARG A HG3  1 
ATOM   3091 H HD2  . ARG A 1 206 ? 4.299   27.559 -18.277 1.00 52.13  ? 502 ARG A HD2  1 
ATOM   3092 H HD3  . ARG A 1 206 ? 3.717   26.338 -17.443 1.00 52.13  ? 502 ARG A HD3  1 
ATOM   3093 H HE   . ARG A 1 206 ? 5.751   25.414 -17.449 1.00 50.12  ? 502 ARG A HE   1 
ATOM   3094 H HH11 . ARG A 1 206 ? 5.932   28.363 -18.955 1.00 60.45  ? 502 ARG A HH11 1 
ATOM   3095 H HH12 . ARG A 1 206 ? 7.415   28.481 -18.887 1.00 60.45  ? 502 ARG A HH12 1 
ATOM   3096 H HH21 . ARG A 1 206 ? 7.995   25.625 -17.354 1.00 61.86  ? 502 ARG A HH21 1 
ATOM   3097 H HH22 . ARG A 1 206 ? 8.658   26.831 -17.923 1.00 61.86  ? 502 ARG A HH22 1 
ATOM   3098 N N    . LEU A 1 207 ? 3.856   21.638 -21.053 1.00 34.62  ? 503 LEU A N    1 
ATOM   3099 C CA   . LEU A 1 207 ? 3.239   20.341 -21.322 1.00 34.10  ? 503 LEU A CA   1 
ATOM   3100 C C    . LEU A 1 207 ? 4.047   19.204 -20.714 1.00 32.16  ? 503 LEU A C    1 
ATOM   3101 O O    . LEU A 1 207 ? 3.450   18.337 -20.051 1.00 33.90  ? 503 LEU A O    1 
ATOM   3102 C CB   . LEU A 1 207 ? 3.033   20.157 -22.830 1.00 33.44  ? 503 LEU A CB   1 
ATOM   3103 C CG   . LEU A 1 207 ? 1.994   21.054 -23.505 1.00 32.15  ? 503 LEU A CG   1 
ATOM   3104 C CD1  . LEU A 1 207 ? 1.860   20.667 -24.973 1.00 33.42  ? 503 LEU A CD1  1 
ATOM   3105 C CD2  . LEU A 1 207 ? 0.642   20.982 -22.814 1.00 31.53  ? 503 LEU A CD2  1 
ATOM   3106 H H    . LEU A 1 207 ? 4.151   22.052 -21.747 1.00 41.55  ? 503 LEU A H    1 
ATOM   3107 H HA   . LEU A 1 207 ? 2.362   20.327 -20.906 1.00 40.92  ? 503 LEU A HA   1 
ATOM   3108 H HB2  . LEU A 1 207 ? 3.881   20.321 -23.272 1.00 40.12  ? 503 LEU A HB2  1 
ATOM   3109 H HB3  . LEU A 1 207 ? 2.763   19.239 -22.988 1.00 40.12  ? 503 LEU A HB3  1 
ATOM   3110 H HG   . LEU A 1 207 ? 2.300   21.973 -23.466 1.00 38.59  ? 503 LEU A HG   1 
ATOM   3111 H HD11 . LEU A 1 207 ? 1.199   21.241 -25.391 1.00 40.10  ? 503 LEU A HD11 1 
ATOM   3112 H HD12 . LEU A 1 207 ? 2.719   20.779 -25.408 1.00 40.10  ? 503 LEU A HD12 1 
ATOM   3113 H HD13 . LEU A 1 207 ? 1.578   19.740 -25.030 1.00 40.10  ? 503 LEU A HD13 1 
ATOM   3114 H HD21 . LEU A 1 207 ? 0.020   21.566 -23.277 1.00 37.84  ? 503 LEU A HD21 1 
ATOM   3115 H HD22 . LEU A 1 207 ? 0.321   20.067 -22.843 1.00 37.84  ? 503 LEU A HD22 1 
ATOM   3116 H HD23 . LEU A 1 207 ? 0.742   21.269 -21.893 1.00 37.84  ? 503 LEU A HD23 1 
ATOM   3117 N N    . PRO A 1 208 ? 5.371   19.135 -20.879 1.00 33.56  ? 504 PRO A N    1 
ATOM   3118 C CA   . PRO A 1 208 ? 6.130   18.111 -20.143 1.00 35.42  ? 504 PRO A CA   1 
ATOM   3119 C C    . PRO A 1 208 ? 5.979   18.221 -18.635 1.00 36.03  ? 504 PRO A C    1 
ATOM   3120 O O    . PRO A 1 208 ? 5.967   17.191 -17.948 1.00 35.32  ? 504 PRO A O    1 
ATOM   3121 C CB   . PRO A 1 208 ? 7.578   18.357 -20.590 1.00 37.13  ? 504 PRO A CB   1 
ATOM   3122 C CG   . PRO A 1 208 ? 7.465   19.041 -21.901 1.00 36.31  ? 504 PRO A CG   1 
ATOM   3123 C CD   . PRO A 1 208 ? 6.222   19.873 -21.831 1.00 32.14  ? 504 PRO A CD   1 
ATOM   3124 H HA   . PRO A 1 208 ? 5.855   17.225 -20.427 1.00 42.50  ? 504 PRO A HA   1 
ATOM   3125 H HB2  . PRO A 1 208 ? 8.028   18.925 -19.945 1.00 44.55  ? 504 PRO A HB2  1 
ATOM   3126 H HB3  . PRO A 1 208 ? 8.040   17.510 -20.683 1.00 44.55  ? 504 PRO A HB3  1 
ATOM   3127 H HG2  . PRO A 1 208 ? 8.243   19.603 -22.041 1.00 43.57  ? 504 PRO A HG2  1 
ATOM   3128 H HG3  . PRO A 1 208 ? 7.392   18.378 -22.606 1.00 43.57  ? 504 PRO A HG3  1 
ATOM   3129 H HD2  . PRO A 1 208 ? 6.425   20.757 -21.489 1.00 38.57  ? 504 PRO A HD2  1 
ATOM   3130 H HD3  . PRO A 1 208 ? 5.795   19.917 -22.701 1.00 38.57  ? 504 PRO A HD3  1 
ATOM   3131 N N    . GLU A 1 209 ? 5.857   19.438 -18.097 1.00 37.94  ? 505 GLU A N    1 
ATOM   3132 C CA   . GLU A 1 209 ? 5.681   19.604 -16.655 1.00 39.19  ? 505 GLU A CA   1 
ATOM   3133 C C    . GLU A 1 209 ? 4.332   19.057 -16.202 1.00 32.38  ? 505 GLU A C    1 
ATOM   3134 O O    . GLU A 1 209 ? 4.245   18.338 -15.200 1.00 31.48  ? 505 GLU A O    1 
ATOM   3135 C CB   . GLU A 1 209 ? 5.808   21.082 -16.279 1.00 42.15  ? 505 GLU A CB   1 
ATOM   3136 C CG   . GLU A 1 209 ? 7.153   21.705 -16.609 1.00 46.11  ? 505 GLU A CG   1 
ATOM   3137 C CD   . GLU A 1 209 ? 7.181   23.202 -16.354 1.00 48.77  ? 505 GLU A CD   1 
ATOM   3138 O OE1  . GLU A 1 209 ? 6.106   23.786 -16.104 1.00 48.58  ? 505 GLU A OE1  1 
ATOM   3139 O OE2  . GLU A 1 209 ? 8.278   23.796 -16.405 1.00 51.90  ? 505 GLU A OE2  1 
ATOM   3140 H H    . GLU A 1 209 ? 5.873   20.174 -18.541 1.00 45.52  ? 505 GLU A H    1 
ATOM   3141 H HA   . GLU A 1 209 ? 6.378   19.113 -16.191 1.00 47.03  ? 505 GLU A HA   1 
ATOM   3142 H HB2  . GLU A 1 209 ? 5.127   21.582 -16.755 1.00 50.57  ? 505 GLU A HB2  1 
ATOM   3143 H HB3  . GLU A 1 209 ? 5.669   21.171 -15.323 1.00 50.57  ? 505 GLU A HB3  1 
ATOM   3144 H HG2  . GLU A 1 209 ? 7.836   21.293 -16.058 1.00 55.33  ? 505 GLU A HG2  1 
ATOM   3145 H HG3  . GLU A 1 209 ? 7.348   21.557 -17.548 1.00 55.33  ? 505 GLU A HG3  1 
ATOM   3146 N N    . ILE A 1 210 ? 3.263   19.403 -16.923 1.00 30.63  ? 506 ILE A N    1 
ATOM   3147 C CA   . ILE A 1 210 ? 1.940   18.885 -16.586 1.00 32.20  ? 506 ILE A CA   1 
ATOM   3148 C C    . ILE A 1 210 ? 1.929   17.366 -16.692 1.00 32.19  ? 506 ILE A C    1 
ATOM   3149 O O    . ILE A 1 210 ? 1.330   16.674 -15.861 1.00 34.09  ? 506 ILE A O    1 
ATOM   3150 C CB   . ILE A 1 210 ? 0.868   19.527 -17.487 1.00 32.11  ? 506 ILE A CB   1 
ATOM   3151 C CG1  . ILE A 1 210 ? 0.786   21.037 -17.227 1.00 34.63  ? 506 ILE A CG1  1 
ATOM   3152 C CG2  . ILE A 1 210 ? -0.499  18.881 -17.250 1.00 31.91  ? 506 ILE A CG2  1 
ATOM   3153 C CD1  . ILE A 1 210 ? -0.109  21.794 -18.200 1.00 34.15  ? 506 ILE A CD1  1 
ATOM   3154 H H    . ILE A 1 210 ? 3.278   19.930 -17.603 1.00 36.76  ? 506 ILE A H    1 
ATOM   3155 H HA   . ILE A 1 210 ? 1.736   19.120 -15.667 1.00 38.64  ? 506 ILE A HA   1 
ATOM   3156 H HB   . ILE A 1 210 ? 1.118   19.387 -18.414 1.00 38.54  ? 506 ILE A HB   1 
ATOM   3157 H HG12 . ILE A 1 210 ? 0.437   21.180 -16.333 1.00 41.56  ? 506 ILE A HG12 1 
ATOM   3158 H HG13 . ILE A 1 210 ? 1.678   21.412 -17.294 1.00 41.56  ? 506 ILE A HG13 1 
ATOM   3159 H HG21 . ILE A 1 210 ? -1.152  19.303 -17.829 1.00 38.30  ? 506 ILE A HG21 1 
ATOM   3160 H HG22 . ILE A 1 210 ? -0.439  17.934 -17.453 1.00 38.30  ? 506 ILE A HG22 1 
ATOM   3161 H HG23 . ILE A 1 210 ? -0.749  19.006 -16.321 1.00 38.30  ? 506 ILE A HG23 1 
ATOM   3162 H HD11 . ILE A 1 210 ? -0.104  22.735 -17.965 1.00 40.97  ? 506 ILE A HD11 1 
ATOM   3163 H HD12 . ILE A 1 210 ? 0.232   21.675 -19.100 1.00 40.97  ? 506 ILE A HD12 1 
ATOM   3164 H HD13 . ILE A 1 210 ? -1.011  21.442 -18.137 1.00 40.97  ? 506 ILE A HD13 1 
ATOM   3165 N N    . ARG A 1 211 ? 2.596   16.821 -17.712 1.00 34.16  ? 507 ARG A N    1 
ATOM   3166 C CA   . ARG A 1 211 ? 2.581   15.374 -17.899 1.00 33.36  ? 507 ARG A CA   1 
ATOM   3167 C C    . ARG A 1 211 ? 3.279   14.660 -16.749 1.00 37.49  ? 507 ARG A C    1 
ATOM   3168 O O    . ARG A 1 211 ? 2.822   13.601 -16.303 1.00 29.71  ? 507 ARG A O    1 
ATOM   3169 C CB   . ARG A 1 211 ? 3.229   15.009 -19.233 1.00 36.64  ? 507 ARG A CB   1 
ATOM   3170 C CG   . ARG A 1 211 ? 3.099   13.539 -19.585 1.00 46.85  ? 507 ARG A CG   1 
ATOM   3171 C CD   . ARG A 1 211 ? 3.488   13.276 -21.025 1.00 59.03  ? 507 ARG A CD   1 
ATOM   3172 N NE   . ARG A 1 211 ? 3.367   11.862 -21.373 1.00 74.37  ? 507 ARG A NE   1 
ATOM   3173 C CZ   . ARG A 1 211 ? 2.242   11.268 -21.765 1.00 84.58  ? 507 ARG A CZ   1 
ATOM   3174 N NH1  . ARG A 1 211 ? 1.112   11.955 -21.865 1.00 87.19  ? 507 ARG A NH1  1 
ATOM   3175 N NH2  . ARG A 1 211 ? 2.248   9.974  -22.057 1.00 89.76  ? 507 ARG A NH2  1 
ATOM   3176 H HA   . ARG A 1 211 ? 1.660   15.071 -17.923 1.00 40.03  ? 507 ARG A HA   1 
ATOM   3177 H HB2  . ARG A 1 211 ? 2.806   15.522 -19.939 1.00 43.97  ? 507 ARG A HB2  1 
ATOM   3178 H HB3  . ARG A 1 211 ? 4.175   15.222 -19.192 1.00 43.97  ? 507 ARG A HB3  1 
ATOM   3179 H HG2  . ARG A 1 211 ? 3.684   13.019 -19.012 1.00 56.22  ? 507 ARG A HG2  1 
ATOM   3180 H HG3  . ARG A 1 211 ? 2.177   13.261 -19.464 1.00 56.22  ? 507 ARG A HG3  1 
ATOM   3181 H HD2  . ARG A 1 211 ? 2.904   13.782 -21.611 1.00 70.84  ? 507 ARG A HD2  1 
ATOM   3182 H HD3  . ARG A 1 211 ? 4.410   13.543 -21.160 1.00 70.84  ? 507 ARG A HD3  1 
ATOM   3183 H HE   . ARG A 1 211 ? 4.075   11.377 -21.320 1.00 89.25  ? 507 ARG A HE   1 
ATOM   3184 H HH11 . ARG A 1 211 ? 1.101   12.794 -21.677 1.00 104.63 ? 507 ARG A HH11 1 
ATOM   3185 H HH12 . ARG A 1 211 ? 0.391   11.562 -22.119 1.00 104.63 ? 507 ARG A HH12 1 
ATOM   3186 H HH21 . ARG A 1 211 ? 2.977   9.522  -21.994 1.00 107.71 ? 507 ARG A HH21 1 
ATOM   3187 H HH22 . ARG A 1 211 ? 1.523   9.587  -22.310 1.00 107.71 ? 507 ARG A HH22 1 
ATOM   3188 N N    . ALA A 1 212 ? 4.392   15.214 -16.265 1.00 27.85  ? 508 ALA A N    1 
ATOM   3189 C CA   . ALA A 1 212 ? 5.068   14.622 -15.115 1.00 34.22  ? 508 ALA A CA   1 
ATOM   3190 C C    . ALA A 1 212 ? 4.157   14.628 -13.894 1.00 35.42  ? 508 ALA A C    1 
ATOM   3191 O O    . ALA A 1 212 ? 4.072   13.632 -13.164 1.00 34.58  ? 508 ALA A O    1 
ATOM   3192 C CB   . ALA A 1 212 ? 6.369   15.373 -14.828 1.00 34.33  ? 508 ALA A CB   1 
ATOM   3193 H H    . ALA A 1 212 ? 4.769   15.920 -16.579 1.00 33.41  ? 508 ALA A H    1 
ATOM   3194 H HA   . ALA A 1 212 ? 5.291   13.701 -15.319 1.00 41.07  ? 508 ALA A HA   1 
ATOM   3195 H HB1  . ALA A 1 212 ? 6.805   14.968 -14.062 1.00 41.19  ? 508 ALA A HB1  1 
ATOM   3196 H HB2  . ALA A 1 212 ? 6.945   15.315 -15.606 1.00 41.19  ? 508 ALA A HB2  1 
ATOM   3197 H HB3  . ALA A 1 212 ? 6.162   16.302 -14.638 1.00 41.19  ? 508 ALA A HB3  1 
ATOM   3198 N N    . ILE A 1 213 ? 3.450   15.737 -13.668 1.00 32.84  ? 509 ILE A N    1 
ATOM   3199 C CA   . ILE A 1 213 ? 2.500   15.803 -12.562 1.00 29.72  ? 509 ILE A CA   1 
ATOM   3200 C C    . ILE A 1 213 ? 1.414   14.749 -12.728 1.00 30.63  ? 509 ILE A C    1 
ATOM   3201 O O    . ILE A 1 213 ? 1.036   14.073 -11.765 1.00 31.21  ? 509 ILE A O    1 
ATOM   3202 C CB   . ILE A 1 213 ? 1.905   17.219 -12.454 1.00 32.24  ? 509 ILE A CB   1 
ATOM   3203 C CG1  . ILE A 1 213 ? 3.012   18.225 -12.129 1.00 34.42  ? 509 ILE A CG1  1 
ATOM   3204 C CG2  . ILE A 1 213 ? 0.808   17.266 -11.377 1.00 34.24  ? 509 ILE A CG2  1 
ATOM   3205 C CD1  . ILE A 1 213 ? 2.574   19.676 -12.201 1.00 35.20  ? 509 ILE A CD1  1 
ATOM   3206 H H    . ILE A 1 213 ? 3.502   16.456 -14.137 1.00 39.40  ? 509 ILE A H    1 
ATOM   3207 H HA   . ILE A 1 213 ? 2.971   15.615 -11.734 1.00 35.67  ? 509 ILE A HA   1 
ATOM   3208 H HB   . ILE A 1 213 ? 1.511   17.456 -13.308 1.00 38.69  ? 509 ILE A HB   1 
ATOM   3209 H HG12 . ILE A 1 213 ? 3.330   18.057 -11.228 1.00 41.30  ? 509 ILE A HG12 1 
ATOM   3210 H HG13 . ILE A 1 213 ? 3.738   18.104 -12.761 1.00 41.30  ? 509 ILE A HG13 1 
ATOM   3211 H HG21 . ILE A 1 213 ? 0.451   18.167 -11.330 1.00 41.09  ? 509 ILE A HG21 1 
ATOM   3212 H HG22 . ILE A 1 213 ? 0.105   16.643 -11.617 1.00 41.09  ? 509 ILE A HG22 1 
ATOM   3213 H HG23 . ILE A 1 213 ? 1.194   17.018 -10.523 1.00 41.09  ? 509 ILE A HG23 1 
ATOM   3214 H HD11 . ILE A 1 213 ? 3.330   20.244 -11.983 1.00 42.24  ? 509 ILE A HD11 1 
ATOM   3215 H HD12 . ILE A 1 213 ? 2.264   19.867 -13.100 1.00 42.24  ? 509 ILE A HD12 1 
ATOM   3216 H HD13 . ILE A 1 213 ? 1.856   19.821 -11.565 1.00 42.24  ? 509 ILE A HD13 1 
ATOM   3217 N N    . SER A 1 214 ? 0.888   14.593 -13.949 1.00 28.71  ? 510 SER A N    1 
ATOM   3218 C CA   . SER A 1 214 ? -0.189  13.630 -14.163 1.00 29.06  ? 510 SER A CA   1 
ATOM   3219 C C    . SER A 1 214 ? 0.297   12.192 -14.007 1.00 31.72  ? 510 SER A C    1 
ATOM   3220 O O    . SER A 1 214 ? -0.463  11.332 -13.546 1.00 30.80  ? 510 SER A O    1 
ATOM   3221 C CB   . SER A 1 214 ? -0.823  13.836 -15.543 1.00 31.28  ? 510 SER A CB   1 
ATOM   3222 O OG   . SER A 1 214 ? 0.073   13.491 -16.583 1.00 35.54  ? 510 SER A OG   1 
ATOM   3223 H H    . SER A 1 214 ? 1.133   15.024 -14.652 1.00 34.45  ? 510 SER A H    1 
ATOM   3224 H HA   . SER A 1 214 ? -0.877  13.781 -13.497 1.00 34.87  ? 510 SER A HA   1 
ATOM   3225 H HB2  . SER A 1 214 ? -1.613  13.277 -15.612 1.00 37.53  ? 510 SER A HB2  1 
ATOM   3226 H HB3  . SER A 1 214 ? -1.070  14.769 -15.638 1.00 37.53  ? 510 SER A HB3  1 
ATOM   3227 H HG   . SER A 1 214 ? 0.763   13.968 -16.538 1.00 42.65  ? 510 SER A HG   1 
ATOM   3228 N N    . MET A 1 215 ? 1.547   11.902 -14.377 1.00 30.66  ? 511 MET A N    1 
ATOM   3229 C CA   . MET A 1 215 ? 2.083   10.564 -14.144 1.00 35.54  ? 511 MET A CA   1 
ATOM   3230 C C    . MET A 1 215 ? 2.183   10.266 -12.653 1.00 36.06  ? 511 MET A C    1 
ATOM   3231 O O    . MET A 1 215 ? 1.852   9.161  -12.208 1.00 39.62  ? 511 MET A O    1 
ATOM   3232 C CB   . MET A 1 215 ? 3.455   10.416 -14.800 1.00 41.52  ? 511 MET A CB   1 
ATOM   3233 C CG   . MET A 1 215 ? 3.430   10.354 -16.318 1.00 52.48  ? 511 MET A CG   1 
ATOM   3234 S SD   . MET A 1 215 ? 4.997   9.764  -17.001 1.00 64.80  ? 511 MET A SD   1 
ATOM   3235 C CE   . MET A 1 215 ? 6.177   10.825 -16.169 1.00 68.10  ? 511 MET A CE   1 
ATOM   3236 H H    . MET A 1 215 ? 2.091   12.450 -14.756 1.00 36.79  ? 511 MET A H    1 
ATOM   3237 H HA   . MET A 1 215 ? 1.489   9.915  -14.552 1.00 42.65  ? 511 MET A HA   1 
ATOM   3238 H HB2  . MET A 1 215 ? 4.003   11.176 -14.546 1.00 49.82  ? 511 MET A HB2  1 
ATOM   3239 H HB3  . MET A 1 215 ? 3.865   9.597  -14.479 1.00 49.82  ? 511 MET A HB3  1 
ATOM   3240 H HG2  . MET A 1 215 ? 2.730   9.745  -16.600 1.00 62.97  ? 511 MET A HG2  1 
ATOM   3241 H HG3  . MET A 1 215 ? 3.263   11.242 -16.670 1.00 62.97  ? 511 MET A HG3  1 
ATOM   3242 H HE1  . MET A 1 215 ? 7.072   10.594 -16.464 1.00 81.72  ? 511 MET A HE1  1 
ATOM   3243 H HE2  . MET A 1 215 ? 5.983   11.749 -16.392 1.00 81.72  ? 511 MET A HE2  1 
ATOM   3244 H HE3  . MET A 1 215 ? 6.100   10.692 -15.211 1.00 81.72  ? 511 MET A HE3  1 
ATOM   3245 N N    . GLN A 1 216 ? 2.658   11.234 -11.866 1.00 34.79  ? 512 GLN A N    1 
ATOM   3246 C CA   . GLN A 1 216 ? 2.708   11.050 -10.420 1.00 37.29  ? 512 GLN A CA   1 
ATOM   3247 C C    . GLN A 1 216 ? 1.308   10.907 -9.838  1.00 33.47  ? 512 GLN A C    1 
ATOM   3248 O O    . GLN A 1 216 ? 1.087   10.117 -8.913  1.00 32.98  ? 512 GLN A O    1 
ATOM   3249 C CB   . GLN A 1 216 ? 3.439   12.222 -9.767  1.00 37.53  ? 512 GLN A CB   1 
ATOM   3250 C CG   . GLN A 1 216 ? 4.930   12.276 -10.071 1.00 40.72  ? 512 GLN A CG   1 
ATOM   3251 C CD   . GLN A 1 216 ? 5.614   13.475 -9.438  1.00 47.71  ? 512 GLN A CD   1 
ATOM   3252 O OE1  . GLN A 1 216 ? 5.328   14.623 -9.781  1.00 51.36  ? 512 GLN A OE1  1 
ATOM   3253 N NE2  . GLN A 1 216 ? 6.520   13.214 -8.508  1.00 51.03  ? 512 GLN A NE2  1 
ATOM   3254 H H    . GLN A 1 216 ? 2.951   11.994 -12.142 1.00 41.75  ? 512 GLN A H    1 
ATOM   3255 H HA   . GLN A 1 216 ? 3.201   10.238 -10.220 1.00 44.75  ? 512 GLN A HA   1 
ATOM   3256 H HB2  . GLN A 1 216 ? 3.043   13.050 -10.083 1.00 45.03  ? 512 GLN A HB2  1 
ATOM   3257 H HB3  . GLN A 1 216 ? 3.336   12.156 -8.805  1.00 45.03  ? 512 GLN A HB3  1 
ATOM   3258 H HG2  . GLN A 1 216 ? 5.352   11.473 -9.726  1.00 48.87  ? 512 GLN A HG2  1 
ATOM   3259 H HG3  . GLN A 1 216 ? 5.056   12.331 -11.031 1.00 48.87  ? 512 GLN A HG3  1 
ATOM   3260 H HE21 . GLN A 1 216 ? 6.693   12.400 -8.293  1.00 61.24  ? 512 GLN A HE21 1 
ATOM   3261 H HE22 . GLN A 1 216 ? 6.935   13.859 -8.119  1.00 61.24  ? 512 GLN A HE22 1 
ATOM   3262 N N    . ALA A 1 217 ? 0.349   11.668 -10.365 1.00 32.70  ? 513 ALA A N    1 
ATOM   3263 C CA   . ALA A 1 217 ? -1.024  11.561 -9.884  1.00 35.69  ? 513 ALA A CA   1 
ATOM   3264 C C    . ALA A 1 217 ? -1.603  10.182 -10.175 1.00 33.40  ? 513 ALA A C    1 
ATOM   3265 O O    . ALA A 1 217 ? -2.267  9.588  -9.318  1.00 31.17  ? 513 ALA A O    1 
ATOM   3266 C CB   . ALA A 1 217 ? -1.882  12.653 -10.517 1.00 31.60  ? 513 ALA A CB   1 
ATOM   3267 H H    . ALA A 1 217 ? 0.466   12.245 -10.992 1.00 39.24  ? 513 ALA A H    1 
ATOM   3268 H HA   . ALA A 1 217 ? -1.032  11.693 -8.923  1.00 42.83  ? 513 ALA A HA   1 
ATOM   3269 H HB1  . ALA A 1 217 ? -2.791  12.570 -10.188 1.00 37.92  ? 513 ALA A HB1  1 
ATOM   3270 H HB2  . ALA A 1 217 ? -1.520  13.520 -10.273 1.00 37.92  ? 513 ALA A HB2  1 
ATOM   3271 H HB3  . ALA A 1 217 ? -1.868  12.547 -11.481 1.00 37.92  ? 513 ALA A HB3  1 
ATOM   3272 N N    . GLU A 1 218 ? -1.358  9.653  -11.378 1.00 31.23  ? 514 GLU A N    1 
ATOM   3273 C CA   . GLU A 1 218 ? -1.855  8.323  -11.719 1.00 32.81  ? 514 GLU A CA   1 
ATOM   3274 C C    . GLU A 1 218 ? -1.259  7.256  -10.812 1.00 34.19  ? 514 GLU A C    1 
ATOM   3275 O O    . GLU A 1 218 ? -1.967  6.347  -10.366 1.00 35.28  ? 514 GLU A O    1 
ATOM   3276 C CB   . GLU A 1 218 ? -1.534  7.987  -13.174 1.00 36.58  ? 514 GLU A CB   1 
ATOM   3277 C CG   . GLU A 1 218 ? -2.429  8.639  -14.195 1.00 37.18  ? 514 GLU A CG   1 
ATOM   3278 C CD   . GLU A 1 218 ? -2.314  7.973  -15.553 1.00 38.17  ? 514 GLU A CD   1 
ATOM   3279 O OE1  . GLU A 1 218 ? -2.316  6.723  -15.608 1.00 38.76  ? 514 GLU A OE1  1 
ATOM   3280 O OE2  . GLU A 1 218 ? -2.209  8.699  -16.562 1.00 36.92  ? 514 GLU A OE2  1 
ATOM   3281 H H    . GLU A 1 218 ? -0.913  10.040 -12.004 1.00 37.47  ? 514 GLU A H    1 
ATOM   3282 H HA   . GLU A 1 218 ? -2.818  8.306  -11.610 1.00 39.37  ? 514 GLU A HA   1 
ATOM   3283 H HB2  . GLU A 1 218 ? -0.625  8.268  -13.361 1.00 43.89  ? 514 GLU A HB2  1 
ATOM   3284 H HB3  . GLU A 1 218 ? -1.608  7.027  -13.292 1.00 43.89  ? 514 GLU A HB3  1 
ATOM   3285 H HG2  . GLU A 1 218 ? -3.351  8.570  -13.901 1.00 44.61  ? 514 GLU A HG2  1 
ATOM   3286 H HG3  . GLU A 1 218 ? -2.177  9.570  -14.292 1.00 44.61  ? 514 GLU A HG3  1 
ATOM   3287 N N    . GLU A 1 219 ? 0.051   7.328  -10.563 1.00 32.89  ? 515 GLU A N    1 
ATOM   3288 C CA   . GLU A 1 219 ? 0.697   6.345  -9.702  1.00 39.58  ? 515 GLU A CA   1 
ATOM   3289 C C    . GLU A 1 219 ? 0.109   6.381  -8.299  1.00 37.35  ? 515 GLU A C    1 
ATOM   3290 O O    . GLU A 1 219 ? -0.053  5.338  -7.656  1.00 37.90  ? 515 GLU A O    1 
ATOM   3291 C CB   . GLU A 1 219 ? 2.205   6.601  -9.659  1.00 44.26  ? 515 GLU A CB   1 
ATOM   3292 C CG   . GLU A 1 219 ? 2.933   6.217  -10.932 1.00 52.87  ? 515 GLU A CG   1 
ATOM   3293 C CD   . GLU A 1 219 ? 3.406   4.778  -10.923 1.00 66.01  ? 515 GLU A CD   1 
ATOM   3294 O OE1  . GLU A 1 219 ? 4.317   4.456  -10.130 1.00 73.72  ? 515 GLU A OE1  1 
ATOM   3295 O OE2  . GLU A 1 219 ? 2.864   3.968  -11.704 1.00 68.38  ? 515 GLU A OE2  1 
ATOM   3296 H H    . GLU A 1 219 ? 0.579   7.930  -10.877 1.00 39.47  ? 515 GLU A H    1 
ATOM   3297 H HA   . GLU A 1 219 ? 0.551   5.458  -10.067 1.00 47.49  ? 515 GLU A HA   1 
ATOM   3298 H HB2  . GLU A 1 219 ? 2.356   7.547  -9.505  1.00 53.11  ? 515 GLU A HB2  1 
ATOM   3299 H HB3  . GLU A 1 219 ? 2.588   6.085  -8.932  1.00 53.11  ? 515 GLU A HB3  1 
ATOM   3300 H HG2  . GLU A 1 219 ? 2.333   6.331  -11.686 1.00 63.45  ? 515 GLU A HG2  1 
ATOM   3301 H HG3  . GLU A 1 219 ? 3.710   6.788  -11.037 1.00 63.45  ? 515 GLU A HG3  1 
ATOM   3302 N N    . TYR A 1 220 ? -0.217  7.576  -7.808  1.00 40.08  ? 516 TYR A N    1 
ATOM   3303 C CA   . TYR A 1 220 ? -0.809  7.693  -6.481  1.00 36.93  ? 516 TYR A CA   1 
ATOM   3304 C C    . TYR A 1 220 ? -2.214  7.102  -6.458  1.00 36.57  ? 516 TYR A C    1 
ATOM   3305 O O    . TYR A 1 220 ? -2.561  6.341  -5.548  1.00 35.17  ? 516 TYR A O    1 
ATOM   3306 C CB   . TYR A 1 220 ? -0.835  9.157  -6.047  1.00 36.02  ? 516 TYR A CB   1 
ATOM   3307 C CG   . TYR A 1 220 ? -1.399  9.359  -4.662  1.00 38.23  ? 516 TYR A CG   1 
ATOM   3308 C CD1  . TYR A 1 220 ? -0.644  9.060  -3.538  1.00 40.87  ? 516 TYR A CD1  1 
ATOM   3309 C CD2  . TYR A 1 220 ? -2.685  9.846  -4.476  1.00 36.07  ? 516 TYR A CD2  1 
ATOM   3310 C CE1  . TYR A 1 220 ? -1.148  9.238  -2.268  1.00 45.21  ? 516 TYR A CE1  1 
ATOM   3311 C CE2  . TYR A 1 220 ? -3.201  10.029 -3.202  1.00 39.85  ? 516 TYR A CE2  1 
ATOM   3312 C CZ   . TYR A 1 220 ? -2.424  9.726  -2.104  1.00 43.38  ? 516 TYR A CZ   1 
ATOM   3313 O OH   . TYR A 1 220 ? -2.924  9.901  -0.831  1.00 48.40  ? 516 TYR A OH   1 
ATOM   3314 H H    . TYR A 1 220 ? -0.106  8.324  -8.218  1.00 48.10  ? 516 TYR A H    1 
ATOM   3315 H HA   . TYR A 1 220 ? -0.265  7.200  -5.847  1.00 44.32  ? 516 TYR A HA   1 
ATOM   3316 H HB2  . TYR A 1 220 ? 0.072   9.502  -6.052  1.00 43.23  ? 516 TYR A HB2  1 
ATOM   3317 H HB3  . TYR A 1 220 ? -1.383  9.660  -6.669  1.00 43.23  ? 516 TYR A HB3  1 
ATOM   3318 H HD1  . TYR A 1 220 ? 0.220   8.732  -3.644  1.00 49.04  ? 516 TYR A HD1  1 
ATOM   3319 H HD2  . TYR A 1 220 ? -3.209  10.053 -5.216  1.00 43.28  ? 516 TYR A HD2  1 
ATOM   3320 H HE1  . TYR A 1 220 ? -0.626  9.033  -1.526  1.00 54.26  ? 516 TYR A HE1  1 
ATOM   3321 H HE2  . TYR A 1 220 ? -4.063  10.357 -3.089  1.00 47.81  ? 516 TYR A HE2  1 
ATOM   3322 H HH   . TYR A 1 220 ? -3.707  10.203 -0.869  1.00 58.08  ? 516 TYR A HH   1 
ATOM   3323 N N    . LEU A 1 221 ? -3.035  7.439  -7.455  1.00 37.23  ? 517 LEU A N    1 
ATOM   3324 C CA   . LEU A 1 221 ? -4.391  6.901  -7.507  1.00 36.32  ? 517 LEU A CA   1 
ATOM   3325 C C    . LEU A 1 221 ? -4.378  5.395  -7.735  1.00 34.58  ? 517 LEU A C    1 
ATOM   3326 O O    . LEU A 1 221 ? -5.215  4.671  -7.185  1.00 35.05  ? 517 LEU A O    1 
ATOM   3327 C CB   . LEU A 1 221 ? -5.191  7.600  -8.605  1.00 31.84  ? 517 LEU A CB   1 
ATOM   3328 C CG   . LEU A 1 221 ? -5.426  9.102  -8.438  1.00 30.86  ? 517 LEU A CG   1 
ATOM   3329 C CD1  . LEU A 1 221 ? -6.147  9.664  -9.660  1.00 33.60  ? 517 LEU A CD1  1 
ATOM   3330 C CD2  . LEU A 1 221 ? -6.219  9.394  -7.168  1.00 32.17  ? 517 LEU A CD2  1 
ATOM   3331 H H    . LEU A 1 221 ? -2.833  7.967  -8.102  1.00 44.68  ? 517 LEU A H    1 
ATOM   3332 H HA   . LEU A 1 221 ? -4.831  7.072  -6.659  1.00 43.59  ? 517 LEU A HA   1 
ATOM   3333 H HB2  . LEU A 1 221 ? -4.723  7.476  -9.446  1.00 38.21  ? 517 LEU A HB2  1 
ATOM   3334 H HB3  . LEU A 1 221 ? -6.063  7.178  -8.659  1.00 38.21  ? 517 LEU A HB3  1 
ATOM   3335 H HG   . LEU A 1 221 ? -4.569  9.549  -8.364  1.00 37.03  ? 517 LEU A HG   1 
ATOM   3336 H HD11 . LEU A 1 221 ? -6.286  10.615 -9.534  1.00 40.32  ? 517 LEU A HD11 1 
ATOM   3337 H HD12 . LEU A 1 221 ? -5.600  9.510  -10.447 1.00 40.32  ? 517 LEU A HD12 1 
ATOM   3338 H HD13 . LEU A 1 221 ? -7.001  9.214  -9.758  1.00 40.32  ? 517 LEU A HD13 1 
ATOM   3339 H HD21 . LEU A 1 221 ? -6.350  10.352 -7.092  1.00 38.60  ? 517 LEU A HD21 1 
ATOM   3340 H HD22 . LEU A 1 221 ? -7.077  8.945  -7.222  1.00 38.60  ? 517 LEU A HD22 1 
ATOM   3341 H HD23 . LEU A 1 221 ? -5.721  9.066  -6.403  1.00 38.60  ? 517 LEU A HD23 1 
ATOM   3342 N N    . TYR A 1 222 ? -3.443  4.907  -8.554  1.00 36.12  ? 518 TYR A N    1 
ATOM   3343 C CA   . TYR A 1 222 ? -3.310  3.467  -8.744  1.00 37.52  ? 518 TYR A CA   1 
ATOM   3344 C C    . TYR A 1 222 ? -2.940  2.783  -7.434  1.00 37.79  ? 518 TYR A C    1 
ATOM   3345 O O    . TYR A 1 222 ? -3.473  1.716  -7.105  1.00 38.80  ? 518 TYR A O    1 
ATOM   3346 C CB   . TYR A 1 222 ? -2.264  3.180  -9.821  1.00 41.20  ? 518 TYR A CB   1 
ATOM   3347 C CG   . TYR A 1 222 ? -2.368  1.803  -10.441 1.00 47.40  ? 518 TYR A CG   1 
ATOM   3348 C CD1  . TYR A 1 222 ? -3.222  1.567  -11.507 1.00 53.08  ? 518 TYR A CD1  1 
ATOM   3349 C CD2  . TYR A 1 222 ? -1.606  0.745  -9.969  1.00 52.94  ? 518 TYR A CD2  1 
ATOM   3350 C CE1  . TYR A 1 222 ? -3.320  0.313  -12.082 1.00 56.90  ? 518 TYR A CE1  1 
ATOM   3351 C CE2  . TYR A 1 222 ? -1.697  -0.512 -10.539 1.00 56.75  ? 518 TYR A CE2  1 
ATOM   3352 C CZ   . TYR A 1 222 ? -2.556  -0.721 -11.594 1.00 58.95  ? 518 TYR A CZ   1 
ATOM   3353 O OH   . TYR A 1 222 ? -2.650  -1.970 -12.164 1.00 63.86  ? 518 TYR A OH   1 
ATOM   3354 H H    . TYR A 1 222 ? -2.883  5.381  -9.002  1.00 43.34  ? 518 TYR A H    1 
ATOM   3355 H HA   . TYR A 1 222 ? -4.159  3.105  -9.044  1.00 45.02  ? 518 TYR A HA   1 
ATOM   3356 H HB2  . TYR A 1 222 ? -2.364  3.832  -10.533 1.00 49.43  ? 518 TYR A HB2  1 
ATOM   3357 H HB3  . TYR A 1 222 ? -1.381  3.260  -9.426  1.00 49.43  ? 518 TYR A HB3  1 
ATOM   3358 H HD1  . TYR A 1 222 ? -3.741  2.263  -11.840 1.00 63.69  ? 518 TYR A HD1  1 
ATOM   3359 H HD2  . TYR A 1 222 ? -1.025  0.882  -9.256  1.00 63.53  ? 518 TYR A HD2  1 
ATOM   3360 H HE1  . TYR A 1 222 ? -3.899  0.170  -12.796 1.00 68.28  ? 518 TYR A HE1  1 
ATOM   3361 H HE2  . TYR A 1 222 ? -1.182  -1.213 -10.210 1.00 68.10  ? 518 TYR A HE2  1 
ATOM   3362 H HH   . TYR A 1 222 ? -2.133  -2.504 -11.772 1.00 76.63  ? 518 TYR A HH   1 
ATOM   3363 N N    . TYR A 1 223 ? -2.034  3.390  -6.666  1.00 38.88  ? 519 TYR A N    1 
ATOM   3364 C CA   . TYR A 1 223 ? -1.699  2.854  -5.351  1.00 37.67  ? 519 TYR A CA   1 
ATOM   3365 C C    . TYR A 1 223 ? -2.933  2.792  -4.462  1.00 36.40  ? 519 TYR A C    1 
ATOM   3366 O O    . TYR A 1 223 ? -3.216  1.760  -3.841  1.00 36.14  ? 519 TYR A O    1 
ATOM   3367 C CB   . TYR A 1 223 ? -0.610  3.710  -4.701  1.00 36.15  ? 519 TYR A CB   1 
ATOM   3368 C CG   . TYR A 1 223 ? -0.216  3.250  -3.315  1.00 39.23  ? 519 TYR A CG   1 
ATOM   3369 C CD1  . TYR A 1 223 ? 0.618   2.154  -3.137  1.00 40.60  ? 519 TYR A CD1  1 
ATOM   3370 C CD2  . TYR A 1 223 ? -0.673  3.915  -2.186  1.00 43.67  ? 519 TYR A CD2  1 
ATOM   3371 C CE1  . TYR A 1 223 ? 0.980   1.729  -1.875  1.00 47.95  ? 519 TYR A CE1  1 
ATOM   3372 C CE2  . TYR A 1 223 ? -0.313  3.497  -0.914  1.00 45.66  ? 519 TYR A CE2  1 
ATOM   3373 C CZ   . TYR A 1 223 ? 0.513   2.402  -0.767  1.00 50.16  ? 519 TYR A CZ   1 
ATOM   3374 O OH   . TYR A 1 223 ? 0.877   1.979  0.492   1.00 57.40  ? 519 TYR A OH   1 
ATOM   3375 H H    . TYR A 1 223 ? -1.606  4.104  -6.881  1.00 46.66  ? 519 TYR A H    1 
ATOM   3376 H HA   . TYR A 1 223 ? -1.354  1.953  -5.453  1.00 45.20  ? 519 TYR A HA   1 
ATOM   3377 H HB2  . TYR A 1 223 ? 0.183   3.684  -5.259  1.00 43.38  ? 519 TYR A HB2  1 
ATOM   3378 H HB3  . TYR A 1 223 ? -0.931  4.623  -4.630  1.00 43.38  ? 519 TYR A HB3  1 
ATOM   3379 H HD1  . TYR A 1 223 ? 0.934   1.695  -3.882  1.00 48.72  ? 519 TYR A HD1  1 
ATOM   3380 H HD2  . TYR A 1 223 ? -1.231  4.652  -2.284  1.00 52.40  ? 519 TYR A HD2  1 
ATOM   3381 H HE1  . TYR A 1 223 ? 1.538   0.992  -1.773  1.00 57.53  ? 519 TYR A HE1  1 
ATOM   3382 H HE2  . TYR A 1 223 ? -0.628  3.950  -0.166  1.00 54.79  ? 519 TYR A HE2  1 
ATOM   3383 H HH   . TYR A 1 223 ? 0.526   2.473  1.073   1.00 68.88  ? 519 TYR A HH   1 
ATOM   3384 N N    . LYS A 1 224 ? -3.692  3.889  -4.399  1.00 38.35  ? 520 LYS A N    1 
ATOM   3385 C CA   . LYS A 1 224 ? -4.871  3.925  -3.539  1.00 39.82  ? 520 LYS A CA   1 
ATOM   3386 C C    . LYS A 1 224 ? -5.894  2.882  -3.969  1.00 36.59  ? 520 LYS A C    1 
ATOM   3387 O O    . LYS A 1 224 ? -6.571  2.281  -3.127  1.00 39.47  ? 520 LYS A O    1 
ATOM   3388 C CB   . LYS A 1 224 ? -5.496  5.321  -3.558  1.00 39.99  ? 520 LYS A CB   1 
ATOM   3389 C CG   . LYS A 1 224 ? -4.529  6.457  -3.264  1.00 42.77  ? 520 LYS A CG   1 
ATOM   3390 C CD   . LYS A 1 224 ? -4.650  6.961  -1.837  1.00 49.18  ? 520 LYS A CD   1 
ATOM   3391 C CE   . LYS A 1 224 ? -4.129  5.952  -0.831  1.00 57.35  ? 520 LYS A CE   1 
ATOM   3392 N NZ   . LYS A 1 224 ? -3.693  6.617  0.431   1.00 64.97  ? 520 LYS A NZ   1 
ATOM   3393 H H    . LYS A 1 224 ? -3.546  4.614  -4.838  1.00 46.02  ? 520 LYS A H    1 
ATOM   3394 H HA   . LYS A 1 224 ? -4.604  3.727  -2.628  1.00 47.78  ? 520 LYS A HA   1 
ATOM   3395 H HB2  . LYS A 1 224 ? -5.875  5.478  -4.437  1.00 47.99  ? 520 LYS A HB2  1 
ATOM   3396 H HB3  . LYS A 1 224 ? -6.199  5.354  -2.890  1.00 47.99  ? 520 LYS A HB3  1 
ATOM   3397 H HG2  . LYS A 1 224 ? -3.621  6.144  -3.397  1.00 51.32  ? 520 LYS A HG2  1 
ATOM   3398 H HG3  . LYS A 1 224 ? -4.717  7.197  -3.862  1.00 51.32  ? 520 LYS A HG3  1 
ATOM   3399 H HD2  . LYS A 1 224 ? -4.134  7.777  -1.743  1.00 59.02  ? 520 LYS A HD2  1 
ATOM   3400 H HD3  . LYS A 1 224 ? -5.584  7.132  -1.639  1.00 59.02  ? 520 LYS A HD3  1 
ATOM   3401 H HE2  . LYS A 1 224 ? -4.835  5.322  -0.615  1.00 68.82  ? 520 LYS A HE2  1 
ATOM   3402 H HE3  . LYS A 1 224 ? -3.367  5.487  -1.209  1.00 68.82  ? 520 LYS A HE3  1 
ATOM   3403 H HZ1  . LYS A 1 224 ? -3.392  6.009  1.006   1.00 77.97  ? 520 LYS A HZ1  1 
ATOM   3404 H HZ2  . LYS A 1 224 ? -3.043  7.199  0.258   1.00 77.97  ? 520 LYS A HZ2  1 
ATOM   3405 H HZ3  . LYS A 1 224 ? -4.378  7.050  0.799   1.00 77.97  ? 520 LYS A HZ3  1 
ATOM   3406 N N    . HIS A 1 225 ? -6.024  2.657  -5.277  1.00 36.73  ? 521 HIS A N    1 
ATOM   3407 C CA   . HIS A 1 225 ? -6.952  1.644  -5.769  1.00 36.06  ? 521 HIS A CA   1 
ATOM   3408 C C    . HIS A 1 225 ? -6.523  0.251  -5.331  1.00 38.00  ? 521 HIS A C    1 
ATOM   3409 O O    . HIS A 1 225 ? -7.319  -0.503 -4.758  1.00 39.20  ? 521 HIS A O    1 
ATOM   3410 C CB   . HIS A 1 225 ? -7.052  1.717  -7.290  1.00 39.30  ? 521 HIS A CB   1 
ATOM   3411 C CG   . HIS A 1 225 ? -7.872  0.620  -7.890  1.00 41.73  ? 521 HIS A CG   1 
ATOM   3412 N ND1  . HIS A 1 225 ? -9.195  0.416  -7.561  1.00 44.92  ? 521 HIS A ND1  1 
ATOM   3413 C CD2  . HIS A 1 225 ? -7.556  -0.339 -8.791  1.00 45.93  ? 521 HIS A CD2  1 
ATOM   3414 C CE1  . HIS A 1 225 ? -9.660  -0.619 -8.238  1.00 47.61  ? 521 HIS A CE1  1 
ATOM   3415 N NE2  . HIS A 1 225 ? -8.685  -1.095 -8.992  1.00 50.11  ? 521 HIS A NE2  1 
ATOM   3416 H H    . HIS A 1 225 ? -5.590  3.072  -5.893  1.00 44.08  ? 521 HIS A H    1 
ATOM   3417 H HA   . HIS A 1 225 ? -7.833  1.817  -5.401  1.00 43.27  ? 521 HIS A HA   1 
ATOM   3418 H HB2  . HIS A 1 225 ? -7.460  2.562  -7.537  1.00 47.16  ? 521 HIS A HB2  1 
ATOM   3419 H HB3  . HIS A 1 225 ? -6.159  1.660  -7.666  1.00 47.16  ? 521 HIS A HB3  1 
ATOM   3420 H HD2  . HIS A 1 225 ? -6.730  -0.462 -9.200  1.00 55.12  ? 521 HIS A HD2  1 
ATOM   3421 H HE1  . HIS A 1 225 ? -10.526 -0.955 -8.192  1.00 57.14  ? 521 HIS A HE1  1 
ATOM   3422 H HE2  . HIS A 1 225 ? -8.747  -1.769 -9.522  1.00 60.13  ? 521 HIS A HE2  1 
ATOM   3423 N N    . LEU A 1 226 ? -5.266  -0.116 -5.603  1.00 37.10  ? 522 LEU A N    1 
ATOM   3424 C CA   . LEU A 1 226 ? -4.747  -1.386 -5.110  1.00 40.22  ? 522 LEU A CA   1 
ATOM   3425 C C    . LEU A 1 226 ? -4.902  -1.490 -3.601  1.00 38.71  ? 522 LEU A C    1 
ATOM   3426 O O    . LEU A 1 226 ? -5.127  -2.585 -3.071  1.00 42.46  ? 522 LEU A O    1 
ATOM   3427 C CB   . LEU A 1 226 ? -3.276  -1.545 -5.500  1.00 42.59  ? 522 LEU A CB   1 
ATOM   3428 C CG   . LEU A 1 226 ? -2.975  -1.628 -6.998  1.00 45.87  ? 522 LEU A CG   1 
ATOM   3429 C CD1  . LEU A 1 226 ? -1.479  -1.734 -7.235  1.00 48.76  ? 522 LEU A CD1  1 
ATOM   3430 C CD2  . LEU A 1 226 ? -3.687  -2.809 -7.626  1.00 47.13  ? 522 LEU A CD2  1 
ATOM   3431 H H    . LEU A 1 226 ? -4.706  0.347  -6.064  1.00 44.52  ? 522 LEU A H    1 
ATOM   3432 H HA   . LEU A 1 226 ? -5.246  -2.112 -5.515  1.00 48.26  ? 522 LEU A HA   1 
ATOM   3433 H HB2  . LEU A 1 226 ? -2.785  -0.786 -5.150  1.00 51.11  ? 522 LEU A HB2  1 
ATOM   3434 H HB3  . LEU A 1 226 ? -2.941  -2.359 -5.094  1.00 51.11  ? 522 LEU A HB3  1 
ATOM   3435 H HG   . LEU A 1 226 ? -3.292  -0.819 -7.430  1.00 55.04  ? 522 LEU A HG   1 
ATOM   3436 H HD11 . LEU A 1 226 ? -1.313  -1.785 -8.189  1.00 58.51  ? 522 LEU A HD11 1 
ATOM   3437 H HD12 . LEU A 1 226 ? -1.044  -0.949 -6.865  1.00 58.51  ? 522 LEU A HD12 1 
ATOM   3438 H HD13 . LEU A 1 226 ? -1.146  -2.533 -6.798  1.00 58.51  ? 522 LEU A HD13 1 
ATOM   3439 H HD21 . LEU A 1 226 ? -3.478  -2.836 -8.573  1.00 56.56  ? 522 LEU A HD21 1 
ATOM   3440 H HD22 . LEU A 1 226 ? -3.384  -3.625 -7.197  1.00 56.56  ? 522 LEU A HD22 1 
ATOM   3441 H HD23 . LEU A 1 226 ? -4.643  -2.704 -7.501  1.00 56.56  ? 522 LEU A HD23 1 
ATOM   3442 N N    . ASN A 1 227 ? -4.788  -0.365 -2.898  1.00 46.67  ? 523 ASN A N    1 
ATOM   3443 C CA   . ASN A 1 227 ? -4.947  -0.337 -1.451  1.00 49.16  ? 523 ASN A CA   1 
ATOM   3444 C C    . ASN A 1 227 ? -6.404  -0.424 -1.017  1.00 50.42  ? 523 ASN A C    1 
ATOM   3445 O O    . ASN A 1 227 ? -6.668  -0.581 0.179   1.00 53.21  ? 523 ASN A O    1 
ATOM   3446 C CB   . ASN A 1 227 ? -4.318  0.944  -0.892  1.00 54.63  ? 523 ASN A CB   1 
ATOM   3447 C CG   . ASN A 1 227 ? -3.713  0.750  0.479   1.00 59.80  ? 523 ASN A CG   1 
ATOM   3448 O OD1  . ASN A 1 227 ? -3.241  -0.337 0.816   1.00 60.42  ? 523 ASN A OD1  1 
ATOM   3449 N ND2  . ASN A 1 227 ? -3.718  1.809  1.281   1.00 64.23  ? 523 ASN A ND2  1 
ATOM   3450 H H    . ASN A 1 227 ? -4.617  0.404  -3.243  1.00 56.00  ? 523 ASN A H    1 
ATOM   3451 H HA   . ASN A 1 227 ? -4.475  -1.093 -1.068  1.00 58.99  ? 523 ASN A HA   1 
ATOM   3452 H HB2  . ASN A 1 227 ? -3.615  1.238  -1.492  1.00 65.56  ? 523 ASN A HB2  1 
ATOM   3453 H HB3  . ASN A 1 227 ? -5.003  1.628  -0.824  1.00 65.56  ? 523 ASN A HB3  1 
ATOM   3454 H HD21 . ASN A 1 227 ? -3.385  1.751  2.072   1.00 77.07  ? 523 ASN A HD21 1 
ATOM   3455 H HD22 . ASN A 1 227 ? -4.054  2.552  1.009   1.00 77.07  ? 523 ASN A HD22 1 
ATOM   3456 N N    . GLY A 1 228 ? -7.348  -0.327 -1.951  1.00 47.33  ? 524 GLY A N    1 
ATOM   3457 C CA   . GLY A 1 228 ? -8.755  -0.400 -1.615  1.00 49.98  ? 524 GLY A CA   1 
ATOM   3458 C C    . GLY A 1 228 ? -9.378  0.910  -1.192  1.00 53.46  ? 524 GLY A C    1 
ATOM   3459 O O    . GLY A 1 228 ? -10.415 0.898  -0.521  1.00 56.67  ? 524 GLY A O    1 
ATOM   3460 H H    . GLY A 1 228 ? -7.193  -0.218 -2.790  1.00 56.80  ? 524 GLY A H    1 
ATOM   3461 H HA2  . GLY A 1 228 ? -9.246  -0.728 -2.385  1.00 59.98  ? 524 GLY A HA2  1 
ATOM   3462 H HA3  . GLY A 1 228 ? -8.873  -1.034 -0.891  1.00 59.98  ? 524 GLY A HA3  1 
ATOM   3463 N N    . ASP A 1 229 ? -8.784  2.044  -1.567  1.00 51.09  ? 525 ASP A N    1 
ATOM   3464 C CA   . ASP A 1 229 ? -9.259  3.351  -1.134  1.00 50.31  ? 525 ASP A CA   1 
ATOM   3465 C C    . ASP A 1 229 ? -10.016 4.113  -2.213  1.00 47.54  ? 525 ASP A C    1 
ATOM   3466 O O    . ASP A 1 229 ? -10.562 5.181  -1.925  1.00 48.30  ? 525 ASP A O    1 
ATOM   3467 C CB   . ASP A 1 229 ? -8.082  4.208  -0.658  1.00 50.70  ? 525 ASP A CB   1 
ATOM   3468 C CG   . ASP A 1 229 ? -7.382  3.620  0.549   1.00 54.44  ? 525 ASP A CG   1 
ATOM   3469 O OD1  . ASP A 1 229 ? -8.057  2.970  1.376   1.00 59.43  ? 525 ASP A OD1  1 
ATOM   3470 O OD2  . ASP A 1 229 ? -6.155  3.808  0.667   1.00 53.81  ? 525 ASP A OD2  1 
ATOM   3471 H H    . ASP A 1 229 ? -8.094  2.079  -2.079  1.00 61.31  ? 525 ASP A H    1 
ATOM   3472 H HA   . ASP A 1 229 ? -9.860  3.230  -0.382  1.00 60.38  ? 525 ASP A HA   1 
ATOM   3473 H HB2  . ASP A 1 229 ? -7.433  4.280  -1.375  1.00 60.84  ? 525 ASP A HB2  1 
ATOM   3474 H HB3  . ASP A 1 229 ? -8.409  5.089  -0.416  1.00 60.84  ? 525 ASP A HB3  1 
ATOM   3475 N N    . VAL A 1 230 ? -10.065 3.603  -3.443  1.00 44.46  ? 526 VAL A N    1 
ATOM   3476 C CA   . VAL A 1 230 ? -10.761 4.263  -4.537  1.00 44.83  ? 526 VAL A CA   1 
ATOM   3477 C C    . VAL A 1 230 ? -12.130 3.594  -4.685  1.00 50.52  ? 526 VAL A C    1 
ATOM   3478 O O    . VAL A 1 230 ? -12.189 2.427  -5.105  1.00 55.09  ? 526 VAL A O    1 
ATOM   3479 C CB   . VAL A 1 230 ? -9.962  4.188  -5.843  1.00 40.52  ? 526 VAL A CB   1 
ATOM   3480 C CG1  . VAL A 1 230 ? -10.690 4.916  -6.963  1.00 40.74  ? 526 VAL A CG1  1 
ATOM   3481 C CG2  . VAL A 1 230 ? -8.575  4.789  -5.642  1.00 41.56  ? 526 VAL A CG2  1 
ATOM   3482 H H    . VAL A 1 230 ? -9.694  2.861  -3.669  1.00 53.35  ? 526 VAL A H    1 
ATOM   3483 H HA   . VAL A 1 230 ? -10.899 5.197  -4.315  1.00 53.79  ? 526 VAL A HA   1 
ATOM   3484 H HB   . VAL A 1 230 ? -9.856  3.259  -6.102  1.00 48.63  ? 526 VAL A HB   1 
ATOM   3485 H HG11 . VAL A 1 230 ? -10.163 4.853  -7.775  1.00 48.89  ? 526 VAL A HG11 1 
ATOM   3486 H HG12 . VAL A 1 230 ? -11.557 4.502  -7.097  1.00 48.89  ? 526 VAL A HG12 1 
ATOM   3487 H HG13 . VAL A 1 230 ? -10.802 5.847  -6.713  1.00 48.89  ? 526 VAL A HG13 1 
ATOM   3488 H HG21 . VAL A 1 230 ? -8.084  4.733  -6.477  1.00 49.88  ? 526 VAL A HG21 1 
ATOM   3489 H HG22 . VAL A 1 230 ? -8.670  5.716  -5.375  1.00 49.88  ? 526 VAL A HG22 1 
ATOM   3490 H HG23 . VAL A 1 230 ? -8.112  4.290  -4.951  1.00 49.88  ? 526 VAL A HG23 1 
ATOM   3491 N N    . PRO A 1 231 ? -13.226 4.266  -4.341  1.00 49.42  ? 527 PRO A N    1 
ATOM   3492 C CA   . PRO A 1 231 ? -14.546 3.646  -4.497  1.00 52.14  ? 527 PRO A CA   1 
ATOM   3493 C C    . PRO A 1 231 ? -14.883 3.407  -5.959  1.00 51.41  ? 527 PRO A C    1 
ATOM   3494 O O    . PRO A 1 231 ? -14.170 3.810  -6.880  1.00 48.58  ? 527 PRO A O    1 
ATOM   3495 C CB   . PRO A 1 231 ? -15.504 4.661  -3.859  1.00 51.91  ? 527 PRO A CB   1 
ATOM   3496 C CG   . PRO A 1 231 ? -14.642 5.487  -2.964  1.00 53.07  ? 527 PRO A CG   1 
ATOM   3497 C CD   . PRO A 1 231 ? -13.321 5.570  -3.664  1.00 50.08  ? 527 PRO A CD   1 
ATOM   3498 H HA   . PRO A 1 231 ? -14.590 2.808  -4.011  1.00 62.57  ? 527 PRO A HA   1 
ATOM   3499 H HB2  . PRO A 1 231 ? -15.908 5.210  -4.550  1.00 62.29  ? 527 PRO A HB2  1 
ATOM   3500 H HB3  . PRO A 1 231 ? -16.183 4.195  -3.348  1.00 62.29  ? 527 PRO A HB3  1 
ATOM   3501 H HG2  . PRO A 1 231 ? -15.031 6.369  -2.859  1.00 63.68  ? 527 PRO A HG2  1 
ATOM   3502 H HG3  . PRO A 1 231 ? -14.548 5.048  -2.105  1.00 63.68  ? 527 PRO A HG3  1 
ATOM   3503 H HD2  . PRO A 1 231 ? -13.325 6.290  -4.314  1.00 60.09  ? 527 PRO A HD2  1 
ATOM   3504 H HD3  . PRO A 1 231 ? -12.602 5.671  -3.021  1.00 60.09  ? 527 PRO A HD3  1 
ATOM   3505 N N    . TYR A 1 232 ? -16.014 2.732  -6.150  1.00 58.99  ? 528 TYR A N    1 
ATOM   3506 C CA   . TYR A 1 232 ? -16.464 2.306  -7.468  1.00 63.94  ? 528 TYR A CA   1 
ATOM   3507 C C    . TYR A 1 232 ? -16.556 3.470  -8.449  1.00 58.92  ? 528 TYR A C    1 
ATOM   3508 O O    . TYR A 1 232 ? -17.412 4.349  -8.309  1.00 60.82  ? 528 TYR A O    1 
ATOM   3509 C CB   . TYR A 1 232 ? -17.814 1.594  -7.329  1.00 77.27  ? 528 TYR A CB   1 
ATOM   3510 C CG   . TYR A 1 232 ? -18.633 1.489  -8.597  1.00 85.97  ? 528 TYR A CG   1 
ATOM   3511 C CD1  . TYR A 1 232 ? -18.467 0.421  -9.470  1.00 89.11  ? 528 TYR A CD1  1 
ATOM   3512 C CD2  . TYR A 1 232 ? -19.593 2.443  -8.906  1.00 90.00  ? 528 TYR A CD2  1 
ATOM   3513 C CE1  . TYR A 1 232 ? -19.223 0.317  -10.625 1.00 91.67  ? 528 TYR A CE1  1 
ATOM   3514 C CE2  . TYR A 1 232 ? -20.352 2.349  -10.057 1.00 92.50  ? 528 TYR A CE2  1 
ATOM   3515 C CZ   . TYR A 1 232 ? -20.164 1.285  -10.912 1.00 93.74  ? 528 TYR A CZ   1 
ATOM   3516 O OH   . TYR A 1 232 ? -20.921 1.190  -12.058 1.00 95.15  ? 528 TYR A OH   1 
ATOM   3517 H H    . TYR A 1 232 ? -16.548 2.505  -5.516  1.00 70.78  ? 528 TYR A H    1 
ATOM   3518 H HA   . TYR A 1 232 ? -15.827 1.667  -7.825  1.00 76.73  ? 528 TYR A HA   1 
ATOM   3519 H HB2  . TYR A 1 232 ? -17.654 0.692  -7.011  1.00 92.73  ? 528 TYR A HB2  1 
ATOM   3520 H HB3  . TYR A 1 232 ? -18.348 2.076  -6.678  1.00 92.73  ? 528 TYR A HB3  1 
ATOM   3521 H HD1  . TYR A 1 232 ? -17.832 -0.232 -9.279  1.00 106.93 ? 528 TYR A HD1  1 
ATOM   3522 H HD2  . TYR A 1 232 ? -19.722 3.164  -8.332  1.00 108.00 ? 528 TYR A HD2  1 
ATOM   3523 H HE1  . TYR A 1 232 ? -19.098 -0.400 -11.204 1.00 110.00 ? 528 TYR A HE1  1 
ATOM   3524 H HE2  . TYR A 1 232 ? -20.987 3.000  -10.252 1.00 111.00 ? 528 TYR A HE2  1 
ATOM   3525 H HH   . TYR A 1 232 ? -21.450 1.841  -12.107 1.00 114.18 ? 528 TYR A HH   1 
ATOM   3526 N N    . ASN A 1 233 ? -15.663 3.482  -9.443  1.00 54.19  ? 529 ASN A N    1 
ATOM   3527 C CA   . ASN A 1 233 ? -15.663 4.486  -10.513 1.00 49.75  ? 529 ASN A CA   1 
ATOM   3528 C C    . ASN A 1 233 ? -15.092 3.795  -11.752 1.00 42.73  ? 529 ASN A C    1 
ATOM   3529 O O    . ASN A 1 233 ? -13.889 3.858  -12.011 1.00 43.24  ? 529 ASN A O    1 
ATOM   3530 C CB   . ASN A 1 233 ? -14.851 5.719  -10.142 1.00 48.12  ? 529 ASN A CB   1 
ATOM   3531 C CG   . ASN A 1 233 ? -15.517 6.563  -9.074  1.00 52.28  ? 529 ASN A CG   1 
ATOM   3532 O OD1  . ASN A 1 233 ? -16.454 7.312  -9.353  1.00 55.22  ? 529 ASN A OD1  1 
ATOM   3533 N ND2  . ASN A 1 233 ? -15.025 6.461  -7.845  1.00 52.48  ? 529 ASN A ND2  1 
ATOM   3534 H H    . ASN A 1 233 ? -15.032 2.903  -9.521  1.00 65.02  ? 529 ASN A H    1 
ATOM   3535 H HA   . ASN A 1 233 ? -16.573 4.760  -10.702 1.00 59.70  ? 529 ASN A HA   1 
ATOM   3536 H HB2  . ASN A 1 233 ? -13.986 5.438  -9.806  1.00 57.75  ? 529 ASN A HB2  1 
ATOM   3537 H HB3  . ASN A 1 233 ? -14.737 6.271  -10.932 1.00 57.75  ? 529 ASN A HB3  1 
ATOM   3538 H HD21 . ASN A 1 233 ? -15.369 6.920  -7.204  1.00 62.98  ? 529 ASN A HD21 1 
ATOM   3539 H HD22 . ASN A 1 233 ? -14.362 5.935  -7.690  1.00 62.98  ? 529 ASN A HD22 1 
ATOM   3540 N N    . ASN A 1 234 ? -15.975 3.151  -12.518 1.00 43.31  ? 530 ASN A N    1 
ATOM   3541 C CA   . ASN A 1 234 ? -15.520 2.225  -13.551 1.00 46.76  ? 530 ASN A CA   1 
ATOM   3542 C C    . ASN A 1 234 ? -14.646 2.917  -14.590 1.00 41.61  ? 530 ASN A C    1 
ATOM   3543 O O    . ASN A 1 234 ? -13.644 2.348  -15.038 1.00 41.34  ? 530 ASN A O    1 
ATOM   3544 C CB   . ASN A 1 234 ? -16.718 1.550  -14.218 1.00 53.12  ? 530 ASN A CB   1 
ATOM   3545 C CG   . ASN A 1 234 ? -17.318 0.455  -13.357 1.00 61.19  ? 530 ASN A CG   1 
ATOM   3546 O OD1  . ASN A 1 234 ? -16.687 -0.023 -12.415 1.00 64.90  ? 530 ASN A OD1  1 
ATOM   3547 N ND2  . ASN A 1 234 ? -18.538 0.046  -13.682 1.00 66.66  ? 530 ASN A ND2  1 
ATOM   3548 H H    . ASN A 1 234 ? -16.829 3.231  -12.460 1.00 51.97  ? 530 ASN A H    1 
ATOM   3549 H HA   . ASN A 1 234 ? -14.986 1.532  -13.133 1.00 56.11  ? 530 ASN A HA   1 
ATOM   3550 H HB2  . ASN A 1 234 ? -17.405 2.214  -14.383 1.00 63.74  ? 530 ASN A HB2  1 
ATOM   3551 H HB3  . ASN A 1 234 ? -16.432 1.151  -15.055 1.00 63.74  ? 530 ASN A HB3  1 
ATOM   3552 H HD21 . ASN A 1 234 ? -18.920 -0.573 -13.223 1.00 79.99  ? 530 ASN A HD21 1 
ATOM   3553 H HD22 . ASN A 1 234 ? -18.946 0.399  -14.351 1.00 79.99  ? 530 ASN A HD22 1 
ATOM   3554 N N    . LEU A 1 235 ? -14.999 4.140  -14.991 1.00 38.80  ? 531 LEU A N    1 
ATOM   3555 C CA   . LEU A 1 235 ? -14.221 4.804  -16.034 1.00 34.53  ? 531 LEU A CA   1 
ATOM   3556 C C    . LEU A 1 235 ? -12.847 5.210  -15.514 1.00 35.81  ? 531 LEU A C    1 
ATOM   3557 O O    . LEU A 1 235 ? -11.830 4.975  -16.176 1.00 35.48  ? 531 LEU A O    1 
ATOM   3558 C CB   . LEU A 1 235 ? -14.973 6.018  -16.579 1.00 34.34  ? 531 LEU A CB   1 
ATOM   3559 C CG   . LEU A 1 235 ? -14.270 6.768  -17.721 1.00 33.32  ? 531 LEU A CG   1 
ATOM   3560 C CD1  . LEU A 1 235 ? -13.859 5.823  -18.844 1.00 34.36  ? 531 LEU A CD1  1 
ATOM   3561 C CD2  . LEU A 1 235 ? -15.162 7.874  -18.276 1.00 35.43  ? 531 LEU A CD2  1 
ATOM   3562 H H    . LEU A 1 235 ? -15.664 4.593  -14.686 1.00 46.56  ? 531 LEU A H    1 
ATOM   3563 H HA   . LEU A 1 235 ? -14.089 4.183  -16.767 1.00 41.43  ? 531 LEU A HA   1 
ATOM   3564 H HB2  . LEU A 1 235 ? -15.835 5.722  -16.912 1.00 41.21  ? 531 LEU A HB2  1 
ATOM   3565 H HB3  . LEU A 1 235 ? -15.105 6.649  -15.854 1.00 41.21  ? 531 LEU A HB3  1 
ATOM   3566 H HG   . LEU A 1 235 ? -13.465 7.183  -17.373 1.00 39.99  ? 531 LEU A HG   1 
ATOM   3567 H HD11 . LEU A 1 235 ? -13.421 6.335  -19.542 1.00 41.23  ? 531 LEU A HD11 1 
ATOM   3568 H HD12 . LEU A 1 235 ? -13.250 5.157  -18.489 1.00 41.23  ? 531 LEU A HD12 1 
ATOM   3569 H HD13 . LEU A 1 235 ? -14.652 5.391  -19.198 1.00 41.23  ? 531 LEU A HD13 1 
ATOM   3570 H HD21 . LEU A 1 235 ? -14.692 8.327  -18.993 1.00 42.52  ? 531 LEU A HD21 1 
ATOM   3571 H HD22 . LEU A 1 235 ? -15.980 7.478  -18.615 1.00 42.52  ? 531 LEU A HD22 1 
ATOM   3572 H HD23 . LEU A 1 235 ? -15.366 8.501  -17.565 1.00 42.52  ? 531 LEU A HD23 1 
ATOM   3573 N N    . LEU A 1 236 ? -12.795 5.813  -14.325 1.00 37.97  ? 532 LEU A N    1 
ATOM   3574 C CA   . LEU A 1 236 ? -11.513 6.189  -13.741 1.00 33.73  ? 532 LEU A CA   1 
ATOM   3575 C C    . LEU A 1 236 ? -10.606 4.974  -13.588 1.00 36.98  ? 532 LEU A C    1 
ATOM   3576 O O    . LEU A 1 236 ? -9.425  5.012  -13.956 1.00 34.57  ? 532 LEU A O    1 
ATOM   3577 C CB   . LEU A 1 236 ? -11.737 6.868  -12.389 1.00 35.27  ? 532 LEU A CB   1 
ATOM   3578 C CG   . LEU A 1 236 ? -10.491 7.308  -11.620 1.00 34.61  ? 532 LEU A CG   1 
ATOM   3579 C CD1  . LEU A 1 236 ? -9.732  8.378  -12.386 1.00 35.86  ? 532 LEU A CD1  1 
ATOM   3580 C CD2  . LEU A 1 236 ? -10.865 7.809  -10.229 1.00 36.50  ? 532 LEU A CD2  1 
ATOM   3581 H H    . LEU A 1 236 ? -13.480 6.012  -13.844 1.00 45.56  ? 532 LEU A H    1 
ATOM   3582 H HA   . LEU A 1 236 ? -11.071 6.823  -14.327 1.00 40.47  ? 532 LEU A HA   1 
ATOM   3583 H HB2  . LEU A 1 236 ? -12.277 7.661  -12.535 1.00 42.32  ? 532 LEU A HB2  1 
ATOM   3584 H HB3  . LEU A 1 236 ? -12.222 6.252  -11.818 1.00 42.32  ? 532 LEU A HB3  1 
ATOM   3585 H HG   . LEU A 1 236 ? -9.902  6.545  -11.513 1.00 41.54  ? 532 LEU A HG   1 
ATOM   3586 H HD11 . LEU A 1 236 ? -8.949  8.637  -11.875 1.00 43.03  ? 532 LEU A HD11 1 
ATOM   3587 H HD12 . LEU A 1 236 ? -9.463  8.020  -13.246 1.00 43.03  ? 532 LEU A HD12 1 
ATOM   3588 H HD13 . LEU A 1 236 ? -10.312 9.145  -12.514 1.00 43.03  ? 532 LEU A HD13 1 
ATOM   3589 H HD21 . LEU A 1 236 ? -10.059 8.081  -9.764  1.00 43.80  ? 532 LEU A HD21 1 
ATOM   3590 H HD22 . LEU A 1 236 ? -11.467 8.564  -10.318 1.00 43.80  ? 532 LEU A HD22 1 
ATOM   3591 H HD23 . LEU A 1 236 ? -11.302 7.092  -9.743  1.00 43.80  ? 532 LEU A HD23 1 
ATOM   3592 N N    . ILE A 1 237 ? -11.145 3.878  -13.051 1.00 37.61  ? 533 ILE A N    1 
ATOM   3593 C CA   . ILE A 1 237 ? -10.332 2.689  -12.823 1.00 38.14  ? 533 ILE A CA   1 
ATOM   3594 C C    . ILE A 1 237 ? -9.896  2.080  -14.148 1.00 39.77  ? 533 ILE A C    1 
ATOM   3595 O O    . ILE A 1 237 ? -8.750  1.641  -14.298 1.00 39.75  ? 533 ILE A O    1 
ATOM   3596 C CB   . ILE A 1 237 ? -11.103 1.673  -11.959 1.00 41.16  ? 533 ILE A CB   1 
ATOM   3597 C CG1  . ILE A 1 237 ? -11.488 2.295  -10.613 1.00 44.25  ? 533 ILE A CG1  1 
ATOM   3598 C CG2  . ILE A 1 237 ? -10.280 0.401  -11.750 1.00 42.71  ? 533 ILE A CG2  1 
ATOM   3599 C CD1  . ILE A 1 237 ? -10.319 2.727  -9.762  1.00 46.98  ? 533 ILE A CD1  1 
ATOM   3600 H H    . ILE A 1 237 ? -11.968 3.801  -12.814 1.00 45.14  ? 533 ILE A H    1 
ATOM   3601 H HA   . ILE A 1 237 ? -9.532  2.945  -12.337 1.00 45.77  ? 533 ILE A HA   1 
ATOM   3602 H HB   . ILE A 1 237 ? -11.918 1.434  -12.427 1.00 49.39  ? 533 ILE A HB   1 
ATOM   3603 H HG12 . ILE A 1 237 ? -12.036 3.077  -10.778 1.00 53.10  ? 533 ILE A HG12 1 
ATOM   3604 H HG13 . ILE A 1 237 ? -11.996 1.642  -10.105 1.00 53.10  ? 533 ILE A HG13 1 
ATOM   3605 H HG21 . ILE A 1 237 ? -10.790 -0.218 -11.204 1.00 51.26  ? 533 ILE A HG21 1 
ATOM   3606 H HG22 . ILE A 1 237 ? -10.091 0.003  -12.614 1.00 51.26  ? 533 ILE A HG22 1 
ATOM   3607 H HG23 . ILE A 1 237 ? -9.451  0.632  -11.303 1.00 51.26  ? 533 ILE A HG23 1 
ATOM   3608 H HD11 . ILE A 1 237 ? -10.655 3.106  -8.935  1.00 56.38  ? 533 ILE A HD11 1 
ATOM   3609 H HD12 . ILE A 1 237 ? -9.765  1.954  -9.572  1.00 56.38  ? 533 ILE A HD12 1 
ATOM   3610 H HD13 . ILE A 1 237 ? -9.806  3.392  -10.247 1.00 56.38  ? 533 ILE A HD13 1 
ATOM   3611 N N    . GLU A 1 238 ? -10.801 2.035  -15.128 1.00 39.68  ? 534 GLU A N    1 
ATOM   3612 C CA   . GLU A 1 238 ? -10.444 1.480  -16.429 1.00 39.61  ? 534 GLU A CA   1 
ATOM   3613 C C    . GLU A 1 238 ? -9.295  2.258  -17.059 1.00 36.49  ? 534 GLU A C    1 
ATOM   3614 O O    . GLU A 1 238 ? -8.371  1.664  -17.629 1.00 37.89  ? 534 GLU A O    1 
ATOM   3615 C CB   . GLU A 1 238 ? -11.663 1.479  -17.352 1.00 39.86  ? 534 GLU A CB   1 
ATOM   3616 C CG   . GLU A 1 238 ? -11.367 1.006  -18.767 1.00 39.44  ? 534 GLU A CG   1 
ATOM   3617 C CD   . GLU A 1 238 ? -12.613 0.905  -19.620 1.00 44.19  ? 534 GLU A CD   1 
ATOM   3618 O OE1  . GLU A 1 238 ? -13.627 0.353  -19.138 1.00 49.09  ? 534 GLU A OE1  1 
ATOM   3619 O OE2  . GLU A 1 238 ? -12.578 1.385  -20.772 1.00 42.32  ? 534 GLU A OE2  1 
ATOM   3620 H H    . GLU A 1 238 ? -11.612 2.314  -15.066 1.00 47.61  ? 534 GLU A H    1 
ATOM   3621 H HA   . GLU A 1 238 ? -10.156 0.562  -16.312 1.00 47.54  ? 534 GLU A HA   1 
ATOM   3622 H HB2  . GLU A 1 238 ? -12.337 0.890  -16.977 1.00 47.83  ? 534 GLU A HB2  1 
ATOM   3623 H HB3  . GLU A 1 238 ? -12.012 2.382  -17.408 1.00 47.83  ? 534 GLU A HB3  1 
ATOM   3624 H HG2  . GLU A 1 238 ? -10.763 1.635  -19.191 1.00 47.33  ? 534 GLU A HG2  1 
ATOM   3625 H HG3  . GLU A 1 238 ? -10.958 0.127  -18.727 1.00 47.33  ? 534 GLU A HG3  1 
ATOM   3626 N N    . MET A 1 239 ? -9.329  3.588  -16.964 1.00 37.20  ? 535 MET A N    1 
ATOM   3627 C CA   . MET A 1 239 ? -8.245  4.386  -17.526 1.00 36.87  ? 535 MET A CA   1 
ATOM   3628 C C    . MET A 1 239 ? -6.941  4.170  -16.768 1.00 36.69  ? 535 MET A C    1 
ATOM   3629 O O    . MET A 1 239 ? -5.861  4.252  -17.364 1.00 39.05  ? 535 MET A O    1 
ATOM   3630 C CB   . MET A 1 239 ? -8.623  5.867  -17.521 1.00 35.42  ? 535 MET A CB   1 
ATOM   3631 C CG   . MET A 1 239 ? -9.881  6.193  -18.320 1.00 38.54  ? 535 MET A CG   1 
ATOM   3632 S SD   . MET A 1 239 ? -9.784  5.750  -20.068 1.00 43.75  ? 535 MET A SD   1 
ATOM   3633 C CE   . MET A 1 239 ? -8.764  7.069  -20.705 1.00 40.76  ? 535 MET A CE   1 
ATOM   3634 H H    . MET A 1 239 ? -9.955  4.042  -16.588 1.00 44.64  ? 535 MET A H    1 
ATOM   3635 H HA   . MET A 1 239 ? -8.113  4.121  -18.449 1.00 44.24  ? 535 MET A HA   1 
ATOM   3636 H HB2  . MET A 1 239 ? -8.774  6.147  -16.605 1.00 42.50  ? 535 MET A HB2  1 
ATOM   3637 H HB3  . MET A 1 239 ? -7.891  6.377  -17.902 1.00 42.50  ? 535 MET A HB3  1 
ATOM   3638 H HG2  . MET A 1 239 ? -10.628 5.710  -17.934 1.00 46.25  ? 535 MET A HG2  1 
ATOM   3639 H HG3  . MET A 1 239 ? -10.045 7.148  -18.266 1.00 46.25  ? 535 MET A HG3  1 
ATOM   3640 H HE1  . MET A 1 239 ? -8.638  6.937  -21.658 1.00 48.91  ? 535 MET A HE1  1 
ATOM   3641 H HE2  . MET A 1 239 ? -9.207  7.916  -20.543 1.00 48.91  ? 535 MET A HE2  1 
ATOM   3642 H HE3  . MET A 1 239 ? -7.906  7.051  -20.252 1.00 48.91  ? 535 MET A HE3  1 
ATOM   3643 N N    . LEU A 1 240 ? -7.014  3.893  -15.464 1.00 39.58  ? 536 LEU A N    1 
ATOM   3644 C CA   . LEU A 1 240 ? -5.806  3.585  -14.707 1.00 42.42  ? 536 LEU A CA   1 
ATOM   3645 C C    . LEU A 1 240 ? -5.179  2.272  -15.159 1.00 46.35  ? 536 LEU A C    1 
ATOM   3646 O O    . LEU A 1 240 ? -3.950  2.137  -15.141 1.00 50.06  ? 536 LEU A O    1 
ATOM   3647 C CB   . LEU A 1 240 ? -6.119  3.526  -13.210 1.00 44.94  ? 536 LEU A CB   1 
ATOM   3648 C CG   . LEU A 1 240 ? -6.290  4.859  -12.479 1.00 45.95  ? 536 LEU A CG   1 
ATOM   3649 C CD1  . LEU A 1 240 ? -6.834  4.627  -11.078 1.00 48.05  ? 536 LEU A CD1  1 
ATOM   3650 C CD2  . LEU A 1 240 ? -4.974  5.621  -12.414 1.00 46.34  ? 536 LEU A CD2  1 
ATOM   3651 H H    . LEU A 1 240 ? -7.740  3.878  -15.003 1.00 47.50  ? 536 LEU A H    1 
ATOM   3652 H HA   . LEU A 1 240 ? -5.156  4.291  -14.849 1.00 50.91  ? 536 LEU A HA   1 
ATOM   3653 H HB2  . LEU A 1 240 ? -6.944  3.029  -13.094 1.00 53.93  ? 536 LEU A HB2  1 
ATOM   3654 H HB3  . LEU A 1 240 ? -5.396  3.051  -12.770 1.00 53.93  ? 536 LEU A HB3  1 
ATOM   3655 H HG   . LEU A 1 240 ? -6.929  5.405  -12.963 1.00 55.14  ? 536 LEU A HG   1 
ATOM   3656 H HD11 . LEU A 1 240 ? -6.935  5.483  -10.633 1.00 57.66  ? 536 LEU A HD11 1 
ATOM   3657 H HD12 . LEU A 1 240 ? -7.695  4.184  -11.144 1.00 57.66  ? 536 LEU A HD12 1 
ATOM   3658 H HD13 . LEU A 1 240 ? -6.211  4.069  -10.586 1.00 57.66  ? 536 LEU A HD13 1 
ATOM   3659 H HD21 . LEU A 1 240 ? -5.117  6.459  -11.946 1.00 55.60  ? 536 LEU A HD21 1 
ATOM   3660 H HD22 . LEU A 1 240 ? -4.322  5.083  -11.938 1.00 55.60  ? 536 LEU A HD22 1 
ATOM   3661 H HD23 . LEU A 1 240 ? -4.665  5.795  -13.317 1.00 55.60  ? 536 LEU A HD23 1 
ATOM   3662 N N    . HIS A 1 241 ? -5.997  1.298  -15.558 1.00 46.42  ? 537 HIS A N    1 
ATOM   3663 C CA   . HIS A 1 241 ? -5.497  0.010  -16.026 1.00 53.57  ? 537 HIS A CA   1 
ATOM   3664 C C    . HIS A 1 241 ? -5.071  0.028  -17.488 1.00 56.42  ? 537 HIS A C    1 
ATOM   3665 O O    . HIS A 1 241 ? -4.546  -0.981 -17.972 1.00 59.16  ? 537 HIS A O    1 
ATOM   3666 C CB   . HIS A 1 241 ? -6.561  -1.073 -15.828 1.00 61.23  ? 537 HIS A CB   1 
ATOM   3667 C CG   . HIS A 1 241 ? -6.573  -1.667 -14.455 1.00 72.45  ? 537 HIS A CG   1 
ATOM   3668 N ND1  . HIS A 1 241 ? -7.121  -1.022 -13.368 1.00 77.94  ? 537 HIS A ND1  1 
ATOM   3669 C CD2  . HIS A 1 241 ? -6.100  -2.848 -13.993 1.00 78.00  ? 537 HIS A CD2  1 
ATOM   3670 C CE1  . HIS A 1 241 ? -6.987  -1.781 -12.295 1.00 81.67  ? 537 HIS A CE1  1 
ATOM   3671 N NE2  . HIS A 1 241 ? -6.370  -2.895 -12.647 1.00 82.25  ? 537 HIS A NE2  1 
ATOM   3672 H H    . HIS A 1 241 ? -6.855  1.361  -15.566 1.00 55.70  ? 537 HIS A H    1 
ATOM   3673 H HA   . HIS A 1 241 ? -4.723  -0.235 -15.496 1.00 64.28  ? 537 HIS A HA   1 
ATOM   3674 H HB2  . HIS A 1 241 ? -7.436  -0.686 -15.991 1.00 73.47  ? 537 HIS A HB2  1 
ATOM   3675 H HB3  . HIS A 1 241 ? -6.398  -1.791 -16.460 1.00 73.47  ? 537 HIS A HB3  1 
ATOM   3676 H HD2  . HIS A 1 241 ? -5.672  -3.506 -14.493 1.00 93.60  ? 537 HIS A HD2  1 
ATOM   3677 H HE1  . HIS A 1 241 ? -7.277  -1.567 -11.437 1.00 98.00  ? 537 HIS A HE1  1 
ATOM   3678 H HE2  . HIS A 1 241 ? -6.170  -3.544 -12.119 1.00 98.70  ? 537 HIS A HE2  1 
ATOM   3679 N N    . ALA A 1 242 ? -5.281  1.132  -18.200 1.00 56.09  ? 538 ALA A N    1 
ATOM   3680 C CA   . ALA A 1 242 ? -4.921  1.211  -19.612 1.00 57.32  ? 538 ALA A CA   1 
ATOM   3681 C C    . ALA A 1 242 ? -3.405  1.211  -19.792 1.00 54.68  ? 538 ALA A C    1 
ATOM   3682 O O    . ALA A 1 242 ? -2.680  1.876  -19.051 1.00 53.50  ? 538 ALA A O    1 
ATOM   3683 C CB   . ALA A 1 242 ? -5.530  2.455  -20.241 1.00 60.36  ? 538 ALA A CB   1 
ATOM   3684 H H    . ALA A 1 242 ? -5.632  1.851  -17.887 1.00 67.31  ? 538 ALA A H    1 
ATOM   3685 H HA   . ALA A 1 242 ? -5.278  0.436  -20.073 1.00 68.78  ? 538 ALA A HA   1 
ATOM   3686 H HB1  . ALA A 1 242 ? -5.279  2.490  -21.177 1.00 72.43  ? 538 ALA A HB1  1 
ATOM   3687 H HB2  . ALA A 1 242 ? -6.495  2.411  -20.158 1.00 72.43  ? 538 ALA A HB2  1 
ATOM   3688 H HB3  . ALA A 1 242 ? -5.193  3.239  -19.779 1.00 72.43  ? 538 ALA A HB3  1 
ATOM   3689 N N    . SER B 2 4   ? -15.157 -2.949 -22.492 1.00 48.42  ? 743 SER C N    1 
ATOM   3690 C CA   . SER B 2 4   ? -14.542 -1.656 -22.215 1.00 46.29  ? 743 SER C CA   1 
ATOM   3691 C C    . SER B 2 4   ? -15.584 -0.545 -22.218 1.00 46.40  ? 743 SER C C    1 
ATOM   3692 O O    . SER B 2 4   ? -16.307 -0.361 -23.197 1.00 47.13  ? 743 SER C O    1 
ATOM   3693 C CB   . SER B 2 4   ? -13.451 -1.353 -23.243 1.00 44.25  ? 743 SER C CB   1 
ATOM   3694 O OG   . SER B 2 4   ? -13.043 0.001  -23.173 1.00 42.21  ? 743 SER C OG   1 
ATOM   3695 H HA   . SER B 2 4   ? -14.131 -1.682 -21.337 1.00 55.55  ? 743 SER C HA   1 
ATOM   3696 H HB2  . SER B 2 4   ? -12.686 -1.922 -23.066 1.00 53.11  ? 743 SER C HB2  1 
ATOM   3697 H HB3  . SER B 2 4   ? -13.798 -1.532 -24.131 1.00 53.11  ? 743 SER C HB3  1 
ATOM   3698 H HG   . SER B 2 4   ? -12.739 0.171  -22.409 1.00 50.66  ? 743 SER C HG   1 
ATOM   3699 N N    . LEU B 2 5   ? -15.657 0.197  -21.112 1.00 41.41  ? 744 LEU C N    1 
ATOM   3700 C CA   . LEU B 2 5   ? -16.595 1.311  -21.035 1.00 39.81  ? 744 LEU C CA   1 
ATOM   3701 C C    . LEU B 2 5   ? -16.189 2.437  -21.975 1.00 39.07  ? 744 LEU C C    1 
ATOM   3702 O O    . LEU B 2 5   ? -17.047 3.069  -22.603 1.00 38.13  ? 744 LEU C O    1 
ATOM   3703 C CB   . LEU B 2 5   ? -16.686 1.820  -19.598 1.00 38.83  ? 744 LEU C CB   1 
ATOM   3704 C CG   . LEU B 2 5   ? -17.540 3.071  -19.384 1.00 39.86  ? 744 LEU C CG   1 
ATOM   3705 C CD1  . LEU B 2 5   ? -18.952 2.856  -19.898 1.00 41.66  ? 744 LEU C CD1  1 
ATOM   3706 C CD2  . LEU B 2 5   ? -17.554 3.456  -17.911 1.00 40.25  ? 744 LEU C CD2  1 
ATOM   3707 H H    . LEU B 2 5   ? -15.181 0.078  -20.406 1.00 49.69  ? 744 LEU C H    1 
ATOM   3708 H HA   . LEU B 2 5   ? -17.475 1.001  -21.300 1.00 47.78  ? 744 LEU C HA   1 
ATOM   3709 H HB2  . LEU B 2 5   ? -17.062 1.116  -19.048 1.00 46.59  ? 744 LEU C HB2  1 
ATOM   3710 H HB3  . LEU B 2 5   ? -15.790 2.026  -19.290 1.00 46.59  ? 744 LEU C HB3  1 
ATOM   3711 H HG   . LEU B 2 5   ? -17.151 3.807  -19.881 1.00 47.83  ? 744 LEU C HG   1 
ATOM   3712 H HD11 . LEU B 2 5   ? -19.469 3.663  -19.749 1.00 49.99  ? 744 LEU C HD11 1 
ATOM   3713 H HD12 . LEU B 2 5   ? -18.916 2.656  -20.847 1.00 49.99  ? 744 LEU C HD12 1 
ATOM   3714 H HD13 . LEU B 2 5   ? -19.353 2.114  -19.419 1.00 49.99  ? 744 LEU C HD13 1 
ATOM   3715 H HD21 . LEU B 2 5   ? -18.100 4.250  -17.797 1.00 48.30  ? 744 LEU C HD21 1 
ATOM   3716 H HD22 . LEU B 2 5   ? -17.926 2.722  -17.397 1.00 48.30  ? 744 LEU C HD22 1 
ATOM   3717 H HD23 . LEU B 2 5   ? -16.645 3.635  -17.623 1.00 48.30  ? 744 LEU C HD23 1 
ATOM   3718 N N    . LEU B 2 6   ? -14.887 2.704  -22.084 1.00 39.44  ? 745 LEU C N    1 
ATOM   3719 C CA   . LEU B 2 6   ? -14.418 3.743  -22.994 1.00 36.41  ? 745 LEU C CA   1 
ATOM   3720 C C    . LEU B 2 6   ? -14.822 3.427  -24.427 1.00 36.94  ? 745 LEU C C    1 
ATOM   3721 O O    . LEU B 2 6   ? -15.330 4.293  -25.148 1.00 36.02  ? 745 LEU C O    1 
ATOM   3722 C CB   . LEU B 2 6   ? -12.901 3.894  -22.878 1.00 33.58  ? 745 LEU C CB   1 
ATOM   3723 C CG   . LEU B 2 6   ? -12.215 4.852  -23.857 1.00 35.67  ? 745 LEU C CG   1 
ATOM   3724 C CD1  . LEU B 2 6   ? -12.780 6.260  -23.747 1.00 35.14  ? 745 LEU C CD1  1 
ATOM   3725 C CD2  . LEU B 2 6   ? -10.716 4.864  -23.616 1.00 37.14  ? 745 LEU C CD2  1 
ATOM   3726 H H    . LEU B 2 6   ? -14.264 2.302  -21.648 1.00 47.33  ? 745 LEU C H    1 
ATOM   3727 H HA   . LEU B 2 6   ? -14.825 4.589  -22.747 1.00 43.69  ? 745 LEU C HA   1 
ATOM   3728 H HB2  . LEU B 2 6   ? -12.698 4.208  -21.983 1.00 40.30  ? 745 LEU C HB2  1 
ATOM   3729 H HB3  . LEU B 2 6   ? -12.501 3.020  -23.007 1.00 40.30  ? 745 LEU C HB3  1 
ATOM   3730 H HG   . LEU B 2 6   ? -12.369 4.539  -24.763 1.00 42.81  ? 745 LEU C HG   1 
ATOM   3731 H HD11 . LEU B 2 6   ? -12.322 6.834  -24.380 1.00 42.17  ? 745 LEU C HD11 1 
ATOM   3732 H HD12 . LEU B 2 6   ? -13.729 6.235  -23.948 1.00 42.17  ? 745 LEU C HD12 1 
ATOM   3733 H HD13 . LEU B 2 6   ? -12.642 6.585  -22.844 1.00 42.17  ? 745 LEU C HD13 1 
ATOM   3734 H HD21 . LEU B 2 6   ? -10.300 5.475  -24.244 1.00 44.57  ? 745 LEU C HD21 1 
ATOM   3735 H HD22 . LEU B 2 6   ? -10.545 5.156  -22.707 1.00 44.57  ? 745 LEU C HD22 1 
ATOM   3736 H HD23 . LEU B 2 6   ? -10.368 3.967  -23.746 1.00 44.57  ? 745 LEU C HD23 1 
ATOM   3737 N N    . LYS B 2 7   ? -14.609 2.181  -24.856 1.00 36.14  ? 746 LYS C N    1 
ATOM   3738 C CA   . LYS B 2 7   ? -15.006 1.794  -26.204 1.00 42.05  ? 746 LYS C CA   1 
ATOM   3739 C C    . LYS B 2 7   ? -16.510 1.936  -26.386 1.00 41.57  ? 746 LYS C C    1 
ATOM   3740 O O    . LYS B 2 7   ? -16.981 2.329  -27.460 1.00 43.63  ? 746 LYS C O    1 
ATOM   3741 C CB   . LYS B 2 7   ? -14.555 0.361  -26.491 1.00 44.80  ? 746 LYS C CB   1 
ATOM   3742 C CG   . LYS B 2 7   ? -14.775 -0.077 -27.931 1.00 52.96  ? 746 LYS C CG   1 
ATOM   3743 C CD   . LYS B 2 7   ? -13.867 -1.236 -28.322 1.00 59.31  ? 746 LYS C CD   1 
ATOM   3744 C CE   . LYS B 2 7   ? -14.664 -2.481 -28.672 1.00 66.25  ? 746 LYS C CE   1 
ATOM   3745 N NZ   . LYS B 2 7   ? -13.793 -3.568 -29.201 1.00 69.98  ? 746 LYS C NZ   1 
ATOM   3746 H H    . LYS B 2 7   ? -14.244 1.555  -24.394 1.00 43.37  ? 746 LYS C H    1 
ATOM   3747 H HA   . LYS B 2 7   ? -14.570 2.379  -26.843 1.00 50.46  ? 746 LYS C HA   1 
ATOM   3748 H HB2  . LYS B 2 7   ? -13.607 0.288  -26.301 1.00 53.76  ? 746 LYS C HB2  1 
ATOM   3749 H HB3  . LYS B 2 7   ? -15.052 -0.243 -25.918 1.00 53.76  ? 746 LYS C HB3  1 
ATOM   3750 H HG2  . LYS B 2 7   ? -15.695 -0.365 -28.039 1.00 63.56  ? 746 LYS C HG2  1 
ATOM   3751 H HG3  . LYS B 2 7   ? -14.586 0.668  -28.523 1.00 63.56  ? 746 LYS C HG3  1 
ATOM   3752 H HD2  . LYS B 2 7   ? -13.343 -0.983 -29.098 1.00 71.17  ? 746 LYS C HD2  1 
ATOM   3753 H HD3  . LYS B 2 7   ? -13.283 -1.449 -27.577 1.00 71.17  ? 746 LYS C HD3  1 
ATOM   3754 H HE2  . LYS B 2 7   ? -15.108 -2.810 -27.875 1.00 79.50  ? 746 LYS C HE2  1 
ATOM   3755 H HE3  . LYS B 2 7   ? -15.318 -2.260 -29.353 1.00 79.50  ? 746 LYS C HE3  1 
ATOM   3756 H HZ1  . LYS B 2 7   ? -14.284 -4.283 -29.397 1.00 83.97  ? 746 LYS C HZ1  1 
ATOM   3757 H HZ2  . LYS B 2 7   ? -13.376 -3.293 -29.937 1.00 83.97  ? 746 LYS C HZ2  1 
ATOM   3758 H HZ3  . LYS B 2 7   ? -13.184 -3.794 -28.591 1.00 83.97  ? 746 LYS C HZ3  1 
ATOM   3759 N N    . LYS B 2 8   ? -17.280 1.636  -25.338 1.00 41.49  ? 747 LYS C N    1 
ATOM   3760 C CA   . LYS B 2 8   ? -18.727 1.805  -25.404 1.00 43.16  ? 747 LYS C CA   1 
ATOM   3761 C C    . LYS B 2 8   ? -19.097 3.269  -25.617 1.00 44.11  ? 747 LYS C C    1 
ATOM   3762 O O    . LYS B 2 8   ? -20.031 3.580  -26.367 1.00 45.10  ? 747 LYS C O    1 
ATOM   3763 C CB   . LYS B 2 8   ? -19.365 1.261  -24.125 1.00 47.18  ? 747 LYS C CB   1 
ATOM   3764 C CG   . LYS B 2 8   ? -20.882 1.300  -24.101 1.00 57.59  ? 747 LYS C CG   1 
ATOM   3765 C CD   . LYS B 2 8   ? -21.418 0.710  -22.805 1.00 63.12  ? 747 LYS C CD   1 
ATOM   3766 C CE   . LYS B 2 8   ? -22.939 0.753  -22.755 1.00 68.45  ? 747 LYS C CE   1 
ATOM   3767 N NZ   . LYS B 2 8   ? -23.472 0.183  -21.488 1.00 69.77  ? 747 LYS C NZ   1 
ATOM   3768 H H    . LYS B 2 8   ? -16.990 1.336  -24.586 1.00 49.79  ? 747 LYS C H    1 
ATOM   3769 H HA   . LYS B 2 8   ? -19.072 1.295  -26.154 1.00 51.79  ? 747 LYS C HA   1 
ATOM   3770 H HB2  . LYS B 2 8   ? -19.094 0.336  -24.014 1.00 56.62  ? 747 LYS C HB2  1 
ATOM   3771 H HB3  . LYS B 2 8   ? -19.047 1.786  -23.374 1.00 56.62  ? 747 LYS C HB3  1 
ATOM   3772 H HG2  . LYS B 2 8   ? -21.181 2.221  -24.165 1.00 69.11  ? 747 LYS C HG2  1 
ATOM   3773 H HG3  . LYS B 2 8   ? -21.229 0.779  -24.842 1.00 69.11  ? 747 LYS C HG3  1 
ATOM   3774 H HD2  . LYS B 2 8   ? -21.139 -0.216 -22.736 1.00 75.74  ? 747 LYS C HD2  1 
ATOM   3775 H HD3  . LYS B 2 8   ? -21.076 1.221  -22.055 1.00 75.74  ? 747 LYS C HD3  1 
ATOM   3776 H HE2  . LYS B 2 8   ? -23.233 1.675  -22.820 1.00 82.14  ? 747 LYS C HE2  1 
ATOM   3777 H HE3  . LYS B 2 8   ? -23.296 0.235  -23.494 1.00 82.14  ? 747 LYS C HE3  1 
ATOM   3778 H HZ1  . LYS B 2 8   ? -24.361 0.222  -21.487 1.00 83.72  ? 747 LYS C HZ1  1 
ATOM   3779 H HZ2  . LYS B 2 8   ? -23.219 -0.666 -21.406 1.00 83.72  ? 747 LYS C HZ2  1 
ATOM   3780 H HZ3  . LYS B 2 8   ? -23.162 0.645  -20.793 1.00 83.72  ? 747 LYS C HZ3  1 
ATOM   3781 N N    . LEU B 2 9   ? -18.366 4.184  -24.974 1.00 42.33  ? 748 LEU C N    1 
ATOM   3782 C CA   . LEU B 2 9   ? -18.636 5.610  -25.138 1.00 39.55  ? 748 LEU C CA   1 
ATOM   3783 C C    . LEU B 2 9   ? -18.293 6.083  -26.543 1.00 39.75  ? 748 LEU C C    1 
ATOM   3784 O O    . LEU B 2 9   ? -19.026 6.887  -27.131 1.00 38.99  ? 748 LEU C O    1 
ATOM   3785 C CB   . LEU B 2 9   ? -17.840 6.416  -24.111 1.00 35.52  ? 748 LEU C CB   1 
ATOM   3786 C CG   . LEU B 2 9   ? -18.234 6.254  -22.643 1.00 33.53  ? 748 LEU C CG   1 
ATOM   3787 C CD1  . LEU B 2 9   ? -17.204 6.928  -21.756 1.00 32.77  ? 748 LEU C CD1  1 
ATOM   3788 C CD2  . LEU B 2 9   ? -19.613 6.833  -22.390 1.00 35.27  ? 748 LEU C CD2  1 
ATOM   3789 H H    . LEU B 2 9   ? -17.714 4.005  -24.443 1.00 50.80  ? 748 LEU C H    1 
ATOM   3790 H HA   . LEU B 2 9   ? -19.579 5.775  -24.986 1.00 47.46  ? 748 LEU C HA   1 
ATOM   3791 H HB2  . LEU B 2 9   ? -16.907 6.162  -24.185 1.00 42.62  ? 748 LEU C HB2  1 
ATOM   3792 H HB3  . LEU B 2 9   ? -17.933 7.357  -24.328 1.00 42.62  ? 748 LEU C HB3  1 
ATOM   3793 H HG   . LEU B 2 9   ? -18.256 5.310  -22.420 1.00 40.24  ? 748 LEU C HG   1 
ATOM   3794 H HD11 . LEU B 2 9   ? -17.466 6.817  -20.829 1.00 39.32  ? 748 LEU C HD11 1 
ATOM   3795 H HD12 . LEU B 2 9   ? -16.339 6.515  -21.908 1.00 39.32  ? 748 LEU C HD12 1 
ATOM   3796 H HD13 . LEU B 2 9   ? -17.165 7.871  -21.979 1.00 39.32  ? 748 LEU C HD13 1 
ATOM   3797 H HD21 . LEU B 2 9   ? -19.837 6.717  -21.454 1.00 42.32  ? 748 LEU C HD21 1 
ATOM   3798 H HD22 . LEU B 2 9   ? -19.604 7.777  -22.614 1.00 42.32  ? 748 LEU C HD22 1 
ATOM   3799 H HD23 . LEU B 2 9   ? -20.258 6.367  -22.945 1.00 42.32  ? 748 LEU C HD23 1 
ATOM   3800 N N    . LEU B 2 10  ? -17.175 5.607  -27.093 1.00 38.10  ? 749 LEU C N    1 
ATOM   3801 C CA   . LEU B 2 10  ? -16.742 6.070  -28.406 1.00 40.78  ? 749 LEU C CA   1 
ATOM   3802 C C    . LEU B 2 10  ? -17.586 5.472  -29.525 1.00 41.91  ? 749 LEU C C    1 
ATOM   3803 O O    . LEU B 2 10  ? -17.689 6.066  -30.604 1.00 46.33  ? 749 LEU C O    1 
ATOM   3804 C CB   . LEU B 2 10  ? -15.263 5.735  -28.605 1.00 38.87  ? 749 LEU C CB   1 
ATOM   3805 C CG   . LEU B 2 10  ? -14.313 6.400  -27.604 1.00 35.40  ? 749 LEU C CG   1 
ATOM   3806 C CD1  . LEU B 2 10  ? -12.924 5.798  -27.711 1.00 37.28  ? 749 LEU C CD1  1 
ATOM   3807 C CD2  . LEU B 2 10  ? -14.258 7.907  -27.816 1.00 36.17  ? 749 LEU C CD2  1 
ATOM   3808 H H    . LEU B 2 10  ? -16.657 5.024  -26.730 1.00 45.73  ? 749 LEU C H    1 
ATOM   3809 H HA   . LEU B 2 10  ? -16.836 7.034  -28.445 1.00 48.94  ? 749 LEU C HA   1 
ATOM   3810 H HB2  . LEU B 2 10  ? -15.150 4.775  -28.523 1.00 46.64  ? 749 LEU C HB2  1 
ATOM   3811 H HB3  . LEU B 2 10  ? -14.999 6.020  -29.494 1.00 46.64  ? 749 LEU C HB3  1 
ATOM   3812 H HG   . LEU B 2 10  ? -14.639 6.236  -26.705 1.00 42.48  ? 749 LEU C HG   1 
ATOM   3813 H HD11 . LEU B 2 10  ? -12.342 6.234  -27.070 1.00 44.74  ? 749 LEU C HD11 1 
ATOM   3814 H HD12 . LEU B 2 10  ? -12.976 4.849  -27.520 1.00 44.74  ? 749 LEU C HD12 1 
ATOM   3815 H HD13 . LEU B 2 10  ? -12.589 5.937  -28.611 1.00 44.74  ? 749 LEU C HD13 1 
ATOM   3816 H HD21 . LEU B 2 10  ? -13.649 8.295  -27.168 1.00 43.41  ? 749 LEU C HD21 1 
ATOM   3817 H HD22 . LEU B 2 10  ? -13.944 8.089  -28.715 1.00 43.41  ? 749 LEU C HD22 1 
ATOM   3818 H HD23 . LEU B 2 10  ? -15.148 8.275  -27.695 1.00 43.41  ? 749 LEU C HD23 1 
ATOM   3819 N N    . LEU B 2 11  ? -18.198 4.308  -29.294 1.00 43.41  ? 750 LEU C N    1 
ATOM   3820 C CA   . LEU B 2 11  ? -19.039 3.683  -30.309 1.00 49.13  ? 750 LEU C CA   1 
ATOM   3821 C C    . LEU B 2 11  ? -20.452 4.251  -30.341 1.00 50.82  ? 750 LEU C C    1 
ATOM   3822 O O    . LEU B 2 11  ? -21.161 4.047  -31.332 1.00 55.26  ? 750 LEU C O    1 
ATOM   3823 C CB   . LEU B 2 11  ? -19.115 2.171  -30.076 1.00 54.26  ? 750 LEU C CB   1 
ATOM   3824 C CG   . LEU B 2 11  ? -17.913 1.327  -30.503 1.00 56.26  ? 750 LEU C CG   1 
ATOM   3825 C CD1  . LEU B 2 11  ? -18.073 -0.103 -30.006 1.00 57.07  ? 750 LEU C CD1  1 
ATOM   3826 C CD2  . LEU B 2 11  ? -17.756 1.345  -32.012 1.00 60.09  ? 750 LEU C CD2  1 
ATOM   3827 H H    . LEU B 2 11  ? -18.141 3.864  -28.559 1.00 52.09  ? 750 LEU C H    1 
ATOM   3828 H HA   . LEU B 2 11  ? -18.640 3.831  -31.180 1.00 58.96  ? 750 LEU C HA   1 
ATOM   3829 H HB2  . LEU B 2 11  ? -19.243 2.021  -29.126 1.00 65.11  ? 750 LEU C HB2  1 
ATOM   3830 H HB3  . LEU B 2 11  ? -19.885 1.832  -30.558 1.00 65.11  ? 750 LEU C HB3  1 
ATOM   3831 H HG   . LEU B 2 11  ? -17.107 1.696  -30.110 1.00 67.52  ? 750 LEU C HG   1 
ATOM   3832 H HD11 . LEU B 2 11  ? -17.303 -0.623 -30.286 1.00 68.48  ? 750 LEU C HD11 1 
ATOM   3833 H HD12 . LEU B 2 11  ? -18.133 -0.095 -29.038 1.00 68.48  ? 750 LEU C HD12 1 
ATOM   3834 H HD13 . LEU B 2 11  ? -18.882 -0.480 -30.385 1.00 68.48  ? 750 LEU C HD13 1 
ATOM   3835 H HD21 . LEU B 2 11  ? -16.989 0.803  -32.256 1.00 72.10  ? 750 LEU C HD21 1 
ATOM   3836 H HD22 . LEU B 2 11  ? -18.559 0.982  -32.417 1.00 72.10  ? 750 LEU C HD22 1 
ATOM   3837 H HD23 . LEU B 2 11  ? -17.621 2.260  -32.304 1.00 72.10  ? 750 LEU C HD23 1 
ATOM   3838 N N    . ALA B 2 12  ? -20.878 4.947  -29.293 1.00 51.60  ? 751 ALA C N    1 
ATOM   3839 C CA   . ALA B 2 12  ? -22.245 5.453  -29.219 1.00 55.98  ? 751 ALA C CA   1 
ATOM   3840 C C    . ALA B 2 12  ? -22.512 6.492  -30.304 1.00 61.97  ? 751 ALA C C    1 
ATOM   3841 O O    . ALA B 2 12  ? -21.615 7.233  -30.707 1.00 63.67  ? 751 ALA C O    1 
ATOM   3842 C CB   . ALA B 2 12  ? -22.512 6.041  -27.844 1.00 51.91  ? 751 ALA C CB   1 
ATOM   3843 H H    . ALA B 2 12  ? -20.394 5.142  -28.610 1.00 61.92  ? 751 ALA C H    1 
ATOM   3844 H HA   . ALA B 2 12  ? -22.860 4.715  -29.353 1.00 67.17  ? 751 ALA C HA   1 
ATOM   3845 H HB1  . ALA B 2 12  ? -23.424 6.371  -27.815 1.00 62.30  ? 751 ALA C HB1  1 
ATOM   3846 H HB2  . ALA B 2 12  ? -22.388 5.349  -27.176 1.00 62.30  ? 751 ALA C HB2  1 
ATOM   3847 H HB3  . ALA B 2 12  ? -21.891 6.769  -27.687 1.00 62.30  ? 751 ALA C HB3  1 
HETATM 3848 O O01  . RJW C 3 .   ? -10.463 16.187 -11.140 1.00 32.46  ? 601 RJW A O01  1 
HETATM 3849 C C02  . RJW C 3 .   ? -9.801  17.116 -10.328 1.00 30.39  ? 601 RJW A C02  1 
HETATM 3850 C C03  . RJW C 3 .   ? -8.678  17.731 -11.148 1.00 25.21  ? 601 RJW A C03  1 
HETATM 3851 C C04  . RJW C 3 .   ? -7.549  16.742 -10.983 1.00 27.92  ? 601 RJW A C04  1 
HETATM 3852 C C05  . RJW C 3 .   ? -7.614  16.170 -9.539  1.00 29.37  ? 601 RJW A C05  1 
HETATM 3853 C C06  . RJW C 3 .   ? -7.268  14.646 -9.429  1.00 31.66  ? 601 RJW A C06  1 
HETATM 3854 C C07  . RJW C 3 .   ? -7.763  13.688 -8.364  1.00 29.30  ? 601 RJW A C07  1 
HETATM 3855 C C08  . RJW C 3 .   ? -7.575  13.936 -6.993  1.00 31.52  ? 601 RJW A C08  1 
HETATM 3856 C C09  . RJW C 3 .   ? -8.041  13.058 -5.982  1.00 33.88  ? 601 RJW A C09  1 
HETATM 3857 C C10  . RJW C 3 .   ? -8.732  11.885 -6.326  1.00 33.35  ? 601 RJW A C10  1 
HETATM 3858 C C11  . RJW C 3 .   ? -8.939  11.617 -7.693  1.00 33.69  ? 601 RJW A C11  1 
HETATM 3859 C C12  . RJW C 3 .   ? -8.461  12.513 -8.683  1.00 31.35  ? 601 RJW A C12  1 
HETATM 3860 C C13  . RJW C 3 .   ? -6.414  14.164 -10.390 1.00 28.41  ? 601 RJW A C13  1 
HETATM 3861 C C14  . RJW C 3 .   ? -9.092  16.356 -9.161  1.00 30.18  ? 601 RJW A C14  1 
HETATM 3862 C C15  . RJW C 3 .   ? -9.097  17.118 -7.813  1.00 29.76  ? 601 RJW A C15  1 
HETATM 3863 C C16  . RJW C 3 .   ? -7.708  17.716 -7.676  1.00 28.34  ? 601 RJW A C16  1 
HETATM 3864 C C17  . RJW C 3 .   ? -7.346  18.567 -6.467  1.00 28.99  ? 601 RJW A C17  1 
HETATM 3865 C C18  . RJW C 3 .   ? -8.106  18.335 -5.111  1.00 32.43  ? 601 RJW A C18  1 
HETATM 3866 C C19  . RJW C 3 .   ? -7.621  17.087 -4.303  1.00 35.27  ? 601 RJW A C19  1 
HETATM 3867 C C20  . RJW C 3 .   ? -8.426  16.865 -2.995  1.00 37.36  ? 601 RJW A C20  1 
HETATM 3868 C C21  . RJW C 3 .   ? -8.333  15.423 -2.462  1.00 39.38  ? 601 RJW A C21  1 
HETATM 3869 C C22  . RJW C 3 .   ? -9.080  15.238 -1.134  1.00 39.72  ? 601 RJW A C22  1 
HETATM 3870 C C23  . RJW C 3 .   ? -6.811  17.070 -8.549  1.00 28.99  ? 601 RJW A C23  1 
HETATM 3871 C C24  . RJW C 3 .   ? -5.358  17.265 -8.664  1.00 29.85  ? 601 RJW A C24  1 
HETATM 3872 C C25  . RJW C 3 .   ? -4.818  18.505 -9.058  1.00 30.51  ? 601 RJW A C25  1 
HETATM 3873 C C26  . RJW C 3 .   ? -3.423  18.735 -9.180  1.00 29.80  ? 601 RJW A C26  1 
HETATM 3874 C C27  . RJW C 3 .   ? -2.508  17.701 -8.907  1.00 30.15  ? 601 RJW A C27  1 
HETATM 3875 C C28  . RJW C 3 .   ? -3.023  16.455 -8.512  1.00 30.60  ? 601 RJW A C28  1 
HETATM 3876 C C29  . RJW C 3 .   ? -4.426  16.254 -8.396  1.00 27.04  ? 601 RJW A C29  1 
HETATM 3877 H H011 . RJW C 3 .   ? -11.372 16.485 -11.133 1.00 38.95  ? 601 RJW A H011 1 
HETATM 3878 H H021 . RJW C 3 .   ? -10.472 17.875 -9.933  1.00 36.47  ? 601 RJW A H021 1 
HETATM 3879 H H031 . RJW C 3 .   ? -8.283  18.717 -10.837 1.00 30.25  ? 601 RJW A H031 1 
HETATM 3880 H H032 . RJW C 3 .   ? -8.911  17.874 -12.236 1.00 30.25  ? 601 RJW A H032 1 
HETATM 3881 H H042 . RJW C 3 .   ? -7.660  16.055 -11.831 1.00 33.51  ? 601 RJW A H042 1 
HETATM 3882 H H041 . RJW C 3 .   ? -6.668  17.378 -11.248 1.00 33.51  ? 601 RJW A H041 1 
HETATM 3883 H H081 . RJW C 3 .   ? -7.059  14.809 -6.653  1.00 37.82  ? 601 RJW A H081 1 
HETATM 3884 H H091 . RJW C 3 .   ? -7.880  13.265 -4.929  1.00 40.66  ? 601 RJW A H091 1 
HETATM 3885 H H101 . RJW C 3 .   ? -9.091  11.206 -5.571  1.00 40.03  ? 601 RJW A H101 1 
HETATM 3886 H H111 . RJW C 3 .   ? -9.471  10.710 -7.957  1.00 40.42  ? 601 RJW A H111 1 
HETATM 3887 H H121 . RJW C 3 .   ? -8.658  12.242 -9.698  1.00 37.62  ? 601 RJW A H121 1 
HETATM 3888 H H131 . RJW C 3 .   ? -5.991  14.728 -11.192 1.00 34.09  ? 601 RJW A H131 1 
HETATM 3889 H H132 . RJW C 3 .   ? -6.070  13.142 -10.463 1.00 34.09  ? 601 RJW A H132 1 
HETATM 3890 H H141 . RJW C 3 .   ? -9.527  15.354 -9.042  1.00 36.21  ? 601 RJW A H141 1 
HETATM 3891 H H151 . RJW C 3 .   ? -9.210  16.470 -6.914  1.00 35.71  ? 601 RJW A H151 1 
HETATM 3892 H H152 . RJW C 3 .   ? -9.958  17.772 -7.662  1.00 35.71  ? 601 RJW A H152 1 
HETATM 3893 H H172 . RJW C 3 .   ? -7.455  19.631 -6.678  1.00 34.79  ? 601 RJW A H172 1 
HETATM 3894 H H171 . RJW C 3 .   ? -6.279  18.506 -6.190  1.00 34.79  ? 601 RJW A H171 1 
HETATM 3895 H H181 . RJW C 3 .   ? -9.166  18.221 -5.290  1.00 38.91  ? 601 RJW A H181 1 
HETATM 3896 H H182 . RJW C 3 .   ? -7.941  19.179 -4.447  1.00 38.91  ? 601 RJW A H182 1 
HETATM 3897 H H192 . RJW C 3 .   ? -7.689  16.195 -4.925  1.00 42.33  ? 601 RJW A H192 1 
HETATM 3898 H H191 . RJW C 3 .   ? -6.562  17.183 -4.049  1.00 42.33  ? 601 RJW A H191 1 
HETATM 3899 H H202 . RJW C 3 .   ? -8.036  17.537 -2.223  1.00 44.83  ? 601 RJW A H202 1 
HETATM 3900 H H201 . RJW C 3 .   ? -9.463  17.144 -3.141  1.00 44.83  ? 601 RJW A H201 1 
HETATM 3901 H H212 . RJW C 3 .   ? -7.293  15.129 -2.307  1.00 47.25  ? 601 RJW A H212 1 
HETATM 3902 H H211 . RJW C 3 .   ? -8.748  14.727 -3.188  1.00 47.25  ? 601 RJW A H211 1 
HETATM 3903 H H223 . RJW C 3 .   ? -10.150 15.424 -1.209  1.00 47.66  ? 601 RJW A H223 1 
HETATM 3904 H H221 . RJW C 3 .   ? -8.693  15.868 -0.335  1.00 47.66  ? 601 RJW A H221 1 
HETATM 3905 H H222 . RJW C 3 .   ? -8.990  14.205 -0.759  1.00 47.66  ? 601 RJW A H222 1 
HETATM 3906 H H251 . RJW C 3 .   ? -5.446  19.342 -9.285  1.00 36.61  ? 601 RJW A H251 1 
HETATM 3907 H H261 . RJW C 3 .   ? -3.028  19.698 -9.486  1.00 35.76  ? 601 RJW A H261 1 
HETATM 3908 H H271 . RJW C 3 .   ? -1.447  17.862 -8.996  1.00 36.18  ? 601 RJW A H271 1 
HETATM 3909 H H281 . RJW C 3 .   ? -2.317  15.659 -8.300  1.00 36.72  ? 601 RJW A H281 1 
HETATM 3910 H H291 . RJW C 3 .   ? -4.729  15.276 -8.091  1.00 32.45  ? 601 RJW A H291 1 
HETATM 3911 O O    . HOH D 4 .   ? -25.651 8.345  -14.309 1.00 43.47  ? 701 HOH A O    1 
HETATM 3912 O O    . HOH D 4 .   ? -6.369  35.316 -8.730  1.00 57.76  ? 702 HOH A O    1 
HETATM 3913 O O    . HOH D 4 .   ? -3.605  23.187 -7.841  1.00 31.71  ? 703 HOH A O    1 
HETATM 3914 O O    . HOH D 4 .   ? 2.281   16.622 -23.257 1.00 41.54  ? 704 HOH A O    1 
HETATM 3915 O O    . HOH D 4 .   ? -24.769 11.408 -16.596 1.00 46.97  ? 705 HOH A O    1 
HETATM 3916 O O    . HOH D 4 .   ? -9.914  12.735 -43.129 1.00 36.93  ? 706 HOH A O    1 
HETATM 3917 O O    . HOH D 4 .   ? -19.143 10.513 -24.863 1.00 38.33  ? 707 HOH A O    1 
HETATM 3918 O O    . HOH D 4 .   ? 6.383   19.012 -13.415 1.00 43.25  ? 708 HOH A O    1 
HETATM 3919 O O    . HOH D 4 .   ? -6.369  28.696 5.871   1.00 34.80  ? 709 HOH A O    1 
HETATM 3920 O O    . HOH D 4 .   ? 9.259   21.470 -19.683 1.00 44.83  ? 710 HOH A O    1 
HETATM 3921 O O    . HOH D 4 .   ? 3.638   23.560 -37.696 1.00 43.86  ? 711 HOH A O    1 
HETATM 3922 O O    . HOH D 4 .   ? -1.979  12.662 -0.205  1.00 35.89  ? 712 HOH A O    1 
HETATM 3923 O O    . HOH D 4 .   ? -4.251  34.493 -17.983 1.00 40.42  ? 713 HOH A O    1 
HETATM 3924 O O    . HOH D 4 .   ? 1.282   34.822 -11.443 1.00 45.33  ? 714 HOH A O    1 
HETATM 3925 O O    . HOH D 4 .   ? -12.003 22.552 -27.480 1.00 43.63  ? 715 HOH A O    1 
HETATM 3926 O O    . HOH D 4 .   ? -5.662  28.521 2.169   1.00 44.70  ? 716 HOH A O    1 
HETATM 3927 O O    . HOH D 4 .   ? -0.321  13.804 -24.571 1.00 39.27  ? 717 HOH A O    1 
HETATM 3928 O O    . HOH D 4 .   ? -6.695  28.525 -7.429  1.00 32.18  ? 718 HOH A O    1 
HETATM 3929 O O    . HOH D 4 .   ? -12.104 17.780 -12.410 1.00 28.82  ? 719 HOH A O    1 
HETATM 3930 O O    . HOH D 4 .   ? -10.781 24.514 -17.305 1.00 45.46  ? 720 HOH A O    1 
HETATM 3931 O O    . HOH D 4 .   ? -2.393  25.889 -38.873 1.00 32.84  ? 721 HOH A O    1 
HETATM 3932 O O    . HOH D 4 .   ? 7.247   14.973 -18.628 1.00 41.98  ? 722 HOH A O    1 
HETATM 3933 O O    . HOH D 4 .   ? -10.338 22.086 -10.518 1.00 34.62  ? 723 HOH A O    1 
HETATM 3934 O O    . HOH D 4 .   ? -12.141 30.456 -20.549 1.00 44.63  ? 724 HOH A O    1 
HETATM 3935 O O    . HOH D 4 .   ? -8.319  5.930  -37.503 1.00 57.72  ? 725 HOH A O    1 
HETATM 3936 O O    . HOH D 4 .   ? -10.202 18.869 -14.356 1.00 27.65  ? 726 HOH A O    1 
HETATM 3937 O O    . HOH D 4 .   ? -7.117  31.585 -40.264 1.00 42.16  ? 727 HOH A O    1 
HETATM 3938 O O    . HOH D 4 .   ? -1.940  11.406 -19.286 1.00 37.74  ? 728 HOH A O    1 
HETATM 3939 O O    . HOH D 4 .   ? 4.552   36.063 -28.662 1.00 34.77  ? 729 HOH A O    1 
HETATM 3940 O O    . HOH D 4 .   ? -12.331 19.967 -10.480 1.00 33.30  ? 730 HOH A O    1 
HETATM 3941 O O    . HOH D 4 .   ? 4.993   33.460 -29.340 1.00 36.97  ? 731 HOH A O    1 
HETATM 3942 O O    . HOH D 4 .   ? 3.965   20.778 -29.838 1.00 42.93  ? 732 HOH A O    1 
HETATM 3943 O O    . HOH D 4 .   ? -3.354  5.473  -17.881 1.00 44.22  ? 733 HOH A O    1 
HETATM 3944 O O    . HOH D 4 .   ? -2.093  42.024 -26.461 1.00 37.79  ? 734 HOH A O    1 
HETATM 3945 O O    . HOH D 4 .   ? -17.671 5.341  -14.182 1.00 55.39  ? 735 HOH A O    1 
HETATM 3946 O O    . HOH D 4 .   ? -2.731  11.294 -26.424 1.00 29.78  ? 736 HOH A O    1 
HETATM 3947 O O    . HOH D 4 .   ? 1.748   16.504 -26.897 1.00 48.99  ? 737 HOH A O    1 
HETATM 3948 O O    . HOH D 4 .   ? 3.830   14.932 -29.392 1.00 51.91  ? 738 HOH A O    1 
HETATM 3949 O O    . HOH D 4 .   ? -30.055 23.302 -17.608 1.00 43.12  ? 739 HOH A O    1 
HETATM 3950 O O    . HOH D 4 .   ? -28.706 15.630 -7.520  1.00 42.39  ? 740 HOH A O    1 
HETATM 3951 O O    . HOH D 4 .   ? -1.655  4.126  -14.514 1.00 42.28  ? 741 HOH A O    1 
HETATM 3952 O O    . HOH D 4 .   ? 6.853   16.493 -11.391 1.00 47.69  ? 742 HOH A O    1 
HETATM 3953 O O    . HOH D 4 .   ? -5.533  11.123 -0.452  1.00 39.63  ? 743 HOH A O    1 
HETATM 3954 O O    . HOH D 4 .   ? -9.942  0.730  -4.205  1.00 43.15  ? 744 HOH A O    1 
HETATM 3955 O O    . HOH D 4 .   ? 2.845   18.163 -43.975 1.00 39.86  ? 745 HOH A O    1 
HETATM 3956 O O    . HOH D 4 .   ? 6.717   12.252 -13.288 1.00 48.24  ? 746 HOH A O    1 
HETATM 3957 O O    . HOH D 4 .   ? 6.947   34.798 -22.420 1.00 46.00  ? 747 HOH A O    1 
HETATM 3958 O O    . HOH D 4 .   ? 1.690   41.575 -23.789 1.00 43.57  ? 748 HOH A O    1 
HETATM 3959 O O    . HOH D 4 .   ? -9.272  34.151 -22.467 1.00 40.45  ? 749 HOH A O    1 
HETATM 3960 O O    . HOH D 4 .   ? -14.521 3.013  -35.659 1.00 48.83  ? 750 HOH A O    1 
HETATM 3961 O O    . HOH D 4 .   ? -4.952  36.816 -21.199 1.00 52.93  ? 751 HOH A O    1 
HETATM 3962 O O    . HOH D 4 .   ? -4.615  30.254 -8.068  1.00 44.75  ? 752 HOH A O    1 
HETATM 3963 O O    . HOH D 4 .   ? -18.887 4.319  -12.015 1.00 50.27  ? 753 HOH A O    1 
HETATM 3964 O O    . HOH D 4 .   ? -12.448 27.119 -16.980 1.00 52.98  ? 754 HOH A O    1 
HETATM 3965 O O    . HOH D 4 .   ? -10.841 -1.842 -15.279 1.00 57.79  ? 755 HOH A O    1 
HETATM 3966 O O    . HOH D 4 .   ? -15.888 22.399 -17.884 1.00 49.74  ? 756 HOH A O    1 
HETATM 3967 O O    . HOH E 4 .   ? -16.281 8.110  -31.466 1.00 46.94  ? 801 HOH C O    1 
HETATM 3968 O O    . HOH E 4 .   ? -20.847 8.607  -25.921 1.00 40.47  ? 802 HOH C O    1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . SER A 4   ? 1.0333 0.8794 1.1113 0.0327  0.0948  0.0632  300 SER A N   
2    C CA  . SER A 4   ? 1.0065 0.8836 1.0828 0.0492  0.0842  0.0654  300 SER A CA  
3    C C   . SER A 4   ? 0.9341 0.8460 1.0179 0.0375  0.0682  0.0525  300 SER A C   
4    O O   . SER A 4   ? 0.9652 0.8787 1.0574 0.0202  0.0664  0.0436  300 SER A O   
5    C CB  . SER A 4   ? 1.0262 0.9166 1.0941 0.0670  0.0854  0.0862  300 SER A CB  
6    O OG  . SER A 4   ? 1.0208 0.9414 1.0876 0.0815  0.0755  0.0916  300 SER A OG  
11   N N   . ILE A 5   ? 0.7774 0.7179 0.8582 0.0467  0.0575  0.0534  301 ILE A N   
12   C CA  . ILE A 5   ? 0.6033 0.5704 0.6863 0.0372  0.0443  0.0414  301 ILE A CA  
13   C C   . ILE A 5   ? 0.5676 0.5525 0.6382 0.0379  0.0393  0.0489  301 ILE A C   
14   O O   . ILE A 5   ? 0.5422 0.5374 0.6019 0.0481  0.0367  0.0614  301 ILE A O   
15   C CB  . ILE A 5   ? 0.5257 0.5085 0.6107 0.0428  0.0367  0.0353  301 ILE A CB  
16   C CG1 . ILE A 5   ? 0.5607 0.5174 0.6498 0.0433  0.0450  0.0273  301 ILE A CG1 
17   C CG2 . ILE A 5   ? 0.4656 0.4707 0.5502 0.0319  0.0247  0.0235  301 ILE A CG2 
18   C CD1 . ILE A 5   ? 0.5737 0.5432 0.6643 0.0522  0.0419  0.0235  301 ILE A CD1 
30   N N   . PRO A 6   ? 0.4779 0.4665 0.5470 0.0279  0.0388  0.0430  302 PRO A N   
31   C CA  . PRO A 6   ? 0.4921 0.4882 0.5397 0.0283  0.0367  0.0480  302 PRO A CA  
32   C C   . PRO A 6   ? 0.4215 0.4364 0.4545 0.0287  0.0236  0.0460  302 PRO A C   
33   O O   . PRO A 6   ? 0.4213 0.4476 0.4635 0.0259  0.0162  0.0368  302 PRO A O   
34   C CB  . PRO A 6   ? 0.4856 0.4812 0.5369 0.0203  0.0409  0.0405  302 PRO A CB  
35   C CG  . PRO A 6   ? 0.5092 0.4999 0.5870 0.0145  0.0461  0.0383  302 PRO A CG  
36   C CD  . PRO A 6   ? 0.5002 0.4859 0.5850 0.0161  0.0414  0.0338  302 PRO A CD  
44   N N   . HIS A 7   ? 0.4543 0.4735 0.4624 0.0300  0.0204  0.0556  303 HIS A N   
45   C CA  . HIS A 7   ? 0.4183 0.4595 0.4106 0.0250  0.0059  0.0558  303 HIS A CA  
46   C C   . HIS A 7   ? 0.3588 0.3995 0.3415 0.0125  0.0011  0.0401  303 HIS A C   
47   O O   . HIS A 7   ? 0.3799 0.4401 0.3627 0.0065  -0.0103 0.0364  303 HIS A O   
48   C CB  . HIS A 7   ? 0.4771 0.5209 0.4374 0.0234  0.0023  0.0682  303 HIS A CB  
49   C CG  . HIS A 7   ? 0.5684 0.6198 0.5367 0.0376  0.0045  0.0876  303 HIS A CG  
50   N ND1 . HIS A 7   ? 0.6371 0.6889 0.5782 0.0388  0.0034  0.1020  303 HIS A ND1 
51   C CD2 . HIS A 7   ? 0.5995 0.6544 0.5961 0.0522  0.0096  0.0960  303 HIS A CD2 
52   C CE1 . HIS A 7   ? 0.6652 0.7240 0.6209 0.0549  0.0071  0.1201  303 HIS A CE1 
53   N NE2 . HIS A 7   ? 0.6439 0.7020 0.6325 0.0639  0.0123  0.1167  303 HIS A NE2 
61   N N   . LEU A 8   ? 0.3613 0.3808 0.3363 0.0096  0.0113  0.0329  304 LEU A N   
62   C CA  . LEU A 8   ? 0.3896 0.4037 0.3545 0.0012  0.0102  0.0201  304 LEU A CA  
63   C C   . LEU A 8   ? 0.3268 0.3562 0.3201 0.0008  0.0040  0.0119  304 LEU A C   
64   O O   . LEU A 8   ? 0.3515 0.3878 0.3363 -0.0070 -0.0036 0.0045  304 LEU A O   
65   C CB  . LEU A 8   ? 0.4219 0.4141 0.3811 0.0043  0.0260  0.0187  304 LEU A CB  
66   C CG  . LEU A 8   ? 0.4704 0.4538 0.4216 0.0009  0.0296  0.0087  304 LEU A CG  
67   C CD1 . LEU A 8   ? 0.5145 0.4871 0.4258 -0.0109 0.0227  0.0018  304 LEU A CD1 
68   C CD2 . LEU A 8   ? 0.5584 0.5242 0.5056 0.0090  0.0485  0.0133  304 LEU A CD2 
80   N N   . ILE A 9   ? 0.3662 0.3977 0.3895 0.0073  0.0079  0.0129  305 ILE A N   
81   C CA  . ILE A 9   ? 0.3139 0.3550 0.3580 0.0063  0.0033  0.0043  305 ILE A CA  
82   C C   . ILE A 9   ? 0.3252 0.3845 0.3717 0.0088  -0.0055 0.0070  305 ILE A C   
83   O O   . ILE A 9   ? 0.3503 0.4204 0.4022 0.0056  -0.0109 -0.0004 305 ILE A O   
84   C CB  . ILE A 9   ? 0.3347 0.3674 0.4020 0.0085  0.0100  0.0038  305 ILE A CB  
85   C CG1 . ILE A 9   ? 0.3250 0.3523 0.3966 0.0047  0.0173  0.0039  305 ILE A CG1 
86   C CG2 . ILE A 9   ? 0.3385 0.3758 0.4193 0.0067  0.0056  -0.0056 305 ILE A CG2 
87   C CD1 . ILE A 9   ? 0.3174 0.3412 0.4115 0.0004  0.0220  0.0048  305 ILE A CD1 
99   N N   . LEU A 10  ? 0.3548 0.4210 0.3985 0.0157  -0.0063 0.0199  306 LEU A N   
100  C CA  . LEU A 10  ? 0.3609 0.4537 0.4108 0.0202  -0.0141 0.0277  306 LEU A CA  
101  C C   . LEU A 10  ? 0.3372 0.4492 0.3715 0.0063  -0.0261 0.0239  306 LEU A C   
102  O O   . LEU A 10  ? 0.3907 0.5266 0.4361 0.0054  -0.0321 0.0244  306 LEU A O   
103  C CB  . LEU A 10  ? 0.4144 0.5157 0.4631 0.0314  -0.0131 0.0465  306 LEU A CB  
104  C CG  . LEU A 10  ? 0.4425 0.5218 0.5052 0.0462  0.0007  0.0528  306 LEU A CG  
105  C CD1 . LEU A 10  ? 0.4670 0.5552 0.5252 0.0587  0.0022  0.0743  306 LEU A CD1 
106  C CD2 . LEU A 10  ? 0.4545 0.5298 0.5359 0.0548  0.0067  0.0481  306 LEU A CD2 
118  N N   . GLU A 11  ? 0.3389 0.4375 0.3444 -0.0056 -0.0278 0.0203  307 GLU A N   
119  C CA  . GLU A 11  ? 0.3797 0.4859 0.3624 -0.0232 -0.0374 0.0145  307 GLU A CA  
120  C C   . GLU A 11  ? 0.3787 0.4765 0.3677 -0.0275 -0.0349 0.0003  307 GLU A C   
121  O O   . GLU A 11  ? 0.4172 0.5302 0.4018 -0.0390 -0.0429 -0.0028 307 GLU A O   
122  C CB  . GLU A 11  ? 0.4870 0.5688 0.4277 -0.0345 -0.0360 0.0131  307 GLU A CB  
123  C CG  . GLU A 11  ? 0.6089 0.7061 0.5184 -0.0548 -0.0504 0.0168  307 GLU A CG  
124  C CD  . GLU A 11  ? 0.6249 0.7685 0.5531 -0.0513 -0.0633 0.0353  307 GLU A CD  
125  O OE1 . GLU A 11  ? 0.5836 0.7319 0.5287 -0.0331 -0.0582 0.0474  307 GLU A OE1 
126  O OE2 . GLU A 11  ? 0.6827 0.8594 0.6095 -0.0664 -0.0776 0.0397  307 GLU A OE2 
133  N N   . LEU A 12  ? 0.4183 0.4956 0.4186 -0.0196 -0.0245 -0.0067 308 LEU A N   
134  C CA  . LEU A 12  ? 0.3720 0.4452 0.3796 -0.0219 -0.0229 -0.0176 308 LEU A CA  
135  C C   . LEU A 12  ? 0.3968 0.4926 0.4288 -0.0178 -0.0276 -0.0180 308 LEU A C   
136  O O   . LEU A 12  ? 0.4048 0.5071 0.4358 -0.0241 -0.0307 -0.0243 308 LEU A O   
137  C CB  . LEU A 12  ? 0.3732 0.4286 0.3905 -0.0150 -0.0127 -0.0209 308 LEU A CB  
138  C CG  . LEU A 12  ? 0.4101 0.4434 0.4075 -0.0140 -0.0029 -0.0179 308 LEU A CG  
139  C CD1 . LEU A 12  ? 0.3830 0.4114 0.3980 -0.0076 0.0061  -0.0182 308 LEU A CD1 
140  C CD2 . LEU A 12  ? 0.4374 0.4530 0.3962 -0.0239 -0.0019 -0.0217 308 LEU A CD2 
152  N N   . LEU A 13  ? 0.3457 0.4498 0.3969 -0.0062 -0.0256 -0.0108 309 LEU A N   
153  C CA  . LEU A 13  ? 0.3282 0.4475 0.3985 0.0012  -0.0253 -0.0104 309 LEU A CA  
154  C C   . LEU A 13  ? 0.3321 0.4841 0.4032 -0.0035 -0.0337 -0.0030 309 LEU A C   
155  O O   . LEU A 13  ? 0.3594 0.5250 0.4417 -0.0017 -0.0332 -0.0052 309 LEU A O   
156  C CB  . LEU A 13  ? 0.3056 0.4176 0.3897 0.0163  -0.0172 -0.0028 309 LEU A CB  
157  C CG  . LEU A 13  ? 0.3244 0.4063 0.4112 0.0168  -0.0092 -0.0111 309 LEU A CG  
158  C CD1 . LEU A 13  ? 0.3303 0.3969 0.4223 0.0280  -0.0001 -0.0020 309 LEU A CD1 
159  C CD2 . LEU A 13  ? 0.3552 0.4301 0.4467 0.0146  -0.0075 -0.0234 309 LEU A CD2 
171  N N   . LYS A 14  ? 0.3930 0.5597 0.4513 -0.0112 -0.0416 0.0065  310 LYS A N   
172  C CA  . LYS A 14  ? 0.4289 0.6335 0.4882 -0.0214 -0.0524 0.0154  310 LYS A CA  
173  C C   . LYS A 14  ? 0.4582 0.6600 0.5059 -0.0386 -0.0559 0.0035  310 LYS A C   
174  O O   . LYS A 14  ? 0.4694 0.7041 0.5273 -0.0455 -0.0618 0.0093  310 LYS A O   
175  C CB  . LYS A 14  ? 0.5218 0.7391 0.5612 -0.0326 -0.0625 0.0262  310 LYS A CB  
176  C CG  . LYS A 14  ? 0.5896 0.8203 0.6420 -0.0149 -0.0606 0.0436  310 LYS A CG  
177  C CD  . LYS A 14  ? 0.6886 0.9227 0.7130 -0.0274 -0.0701 0.0517  310 LYS A CD  
178  C CE  . LYS A 14  ? 0.7436 0.9934 0.7810 -0.0081 -0.0680 0.0721  310 LYS A CE  
179  N NZ  . LYS A 14  ? 0.8066 1.0599 0.8126 -0.0208 -0.0779 0.0806  310 LYS A NZ  
193  N N   . CYS A 15  ? 0.4557 0.6204 0.4826 -0.0452 -0.0511 -0.0106 311 CYS A N   
194  C CA  . CYS A 15  ? 0.5048 0.6596 0.5163 -0.0600 -0.0518 -0.0207 311 CYS A CA  
195  C C   . CYS A 15  ? 0.4472 0.6062 0.4794 -0.0510 -0.0467 -0.0263 311 CYS A C   
196  O O   . CYS A 15  ? 0.4880 0.6428 0.5104 -0.0616 -0.0467 -0.0325 311 CYS A O   
197  C CB  . CYS A 15  ? 0.6145 0.7263 0.5949 -0.0655 -0.0451 -0.0305 311 CYS A CB  
198  S SG  . CYS A 15  ? 0.7496 0.8459 0.6935 -0.0775 -0.0482 -0.0262 311 CYS A SG  
204  N N   . GLU A 16  ? 0.3659 0.5288 0.4216 -0.0330 -0.0412 -0.0245 312 GLU A N   
205  C CA  . GLU A 16  ? 0.3567 0.5171 0.4240 -0.0259 -0.0356 -0.0315 312 GLU A CA  
206  C C   . GLU A 16  ? 0.3076 0.4990 0.3846 -0.0296 -0.0379 -0.0260 312 GLU A C   
207  O O   . GLU A 16  ? 0.3322 0.5558 0.4220 -0.0278 -0.0415 -0.0125 312 GLU A O   
208  C CB  . GLU A 16  ? 0.3132 0.4643 0.3956 -0.0090 -0.0281 -0.0314 312 GLU A CB  
209  C CG  . GLU A 16  ? 0.3517 0.4739 0.4282 -0.0084 -0.0252 -0.0386 312 GLU A CG  
210  C CD  . GLU A 16  ? 0.3930 0.5031 0.4618 -0.0146 -0.0251 -0.0490 312 GLU A CD  
211  O OE1 . GLU A 16  ? 0.4176 0.5232 0.4909 -0.0114 -0.0226 -0.0551 312 GLU A OE1 
212  O OE2 . GLU A 16  ? 0.3671 0.4705 0.4223 -0.0222 -0.0267 -0.0500 312 GLU A OE2 
219  N N   . PRO A 17  ? 0.4296 0.6161 0.5023 -0.0343 -0.0355 -0.0338 313 PRO A N   
220  C CA  . PRO A 17  ? 0.4285 0.6462 0.5122 -0.0378 -0.0356 -0.0273 313 PRO A CA  
221  C C   . PRO A 17  ? 0.3953 0.6310 0.5024 -0.0174 -0.0271 -0.0196 313 PRO A C   
222  O O   . PRO A 17  ? 0.3519 0.5642 0.4599 -0.0027 -0.0195 -0.0248 313 PRO A O   
223  C CB  . PRO A 17  ? 0.4469 0.6459 0.5168 -0.0448 -0.0324 -0.0383 313 PRO A CB  
224  C CG  . PRO A 17  ? 0.4802 0.6435 0.5301 -0.0480 -0.0328 -0.0475 313 PRO A CG  
225  C CD  . PRO A 17  ? 0.4645 0.6208 0.5223 -0.0368 -0.0324 -0.0460 313 PRO A CD  
233  N N   . ASP A 18  ? 0.3333 0.6102 0.4579 -0.0173 -0.0270 -0.0058 314 ASP A N   
234  C CA  . ASP A 18  ? 0.3285 0.6221 0.4739 0.0055  -0.0141 0.0040  314 ASP A CA  
235  C C   . ASP A 18  ? 0.3135 0.5807 0.4489 0.0115  -0.0031 -0.0096 314 ASP A C   
236  O O   . ASP A 18  ? 0.3266 0.6039 0.4587 0.0006  -0.0038 -0.0118 314 ASP A O   
237  C CB  . ASP A 18  ? 0.3220 0.6751 0.4925 0.0040  -0.0165 0.0258  314 ASP A CB  
238  C CG  . ASP A 18  ? 0.3157 0.6883 0.5094 0.0328  0.0010  0.0404  314 ASP A CG  
239  O OD1 . ASP A 18  ? 0.3202 0.6919 0.5154 0.0391  0.0129  0.0376  314 ASP A OD1 
240  O OD2 . ASP A 18  ? 0.3347 0.7215 0.5431 0.0506  0.0049  0.0560  314 ASP A OD2 
245  N N   . GLU A 19  ? 0.3721 0.6033 0.4989 0.0265  0.0069  -0.0186 315 GLU A N   
246  C CA  . GLU A 19  ? 0.4205 0.6220 0.5299 0.0282  0.0147  -0.0334 315 GLU A CA  
247  C C   . GLU A 19  ? 0.4539 0.6752 0.5702 0.0376  0.0273  -0.0268 315 GLU A C   
248  O O   . GLU A 19  ? 0.4294 0.6470 0.5341 0.0283  0.0267  -0.0344 315 GLU A O   
249  C CB  . GLU A 19  ? 0.5819 0.7409 0.6775 0.0382  0.0224  -0.0436 315 GLU A CB  
250  C CG  . GLU A 19  ? 0.6999 0.8259 0.7711 0.0341  0.0260  -0.0605 315 GLU A CG  
251  C CD  . GLU A 19  ? 0.8248 0.9085 0.8790 0.0369  0.0313  -0.0709 315 GLU A CD  
252  O OE1 . GLU A 19  ? 0.8326 0.9081 0.8891 0.0291  0.0222  -0.0728 315 GLU A OE1 
253  O OE2 . GLU A 19  ? 0.9060 0.9623 0.9421 0.0459  0.0457  -0.0771 315 GLU A OE2 
260  N N   . PRO A 20  ? 0.4547 0.6980 0.5895 0.0574  0.0405  -0.0107 316 PRO A N   
261  C CA  . PRO A 20  ? 0.4678 0.7319 0.6102 0.0682  0.0555  -0.0025 316 PRO A CA  
262  C C   . PRO A 20  ? 0.3944 0.7015 0.5498 0.0489  0.0453  0.0049  316 PRO A C   
263  O O   . PRO A 20  ? 0.3579 0.6667 0.5074 0.0481  0.0536  0.0025  316 PRO A O   
264  C CB  . PRO A 20  ? 0.4811 0.7683 0.6468 0.0953  0.0714  0.0191  316 PRO A CB  
265  C CG  . PRO A 20  ? 0.5095 0.7652 0.6674 0.1011  0.0689  0.0151  316 PRO A CG  
266  C CD  . PRO A 20  ? 0.4786 0.7294 0.6285 0.0739  0.0450  0.0032  316 PRO A CD  
274  N N   . GLN A 21  ? 0.3749 0.7131 0.5436 0.0313  0.0279  0.0135  317 GLN A N   
275  C CA  . GLN A 21  ? 0.3382 0.7130 0.5147 0.0082  0.0185  0.0204  317 GLN A CA  
276  C C   . GLN A 21  ? 0.3481 0.6857 0.4950 -0.0113 0.0122  0.0009  317 GLN A C   
277  O O   . GLN A 21  ? 0.3456 0.6962 0.4908 -0.0240 0.0137  0.0026  317 GLN A O   
278  C CB  . GLN A 21  ? 0.3418 0.7560 0.5335 -0.0084 0.0015  0.0345  317 GLN A CB  
279  C CG  . GLN A 21  ? 0.3700 0.8302 0.5725 -0.0347 -0.0075 0.0461  317 GLN A CG  
280  C CD  . GLN A 21  ? 0.3910 0.8989 0.6233 -0.0218 0.0069  0.0650  317 GLN A CD  
281  O OE1 . GLN A 21  ? 0.4455 1.0073 0.7115 -0.0085 0.0099  0.0894  317 GLN A OE1 
282  N NE2 . GLN A 21  ? 0.3481 0.8382 0.5687 -0.0239 0.0173  0.0559  317 GLN A NE2 
291  N N   . VAL A 22  ? 0.3010 0.5943 0.4257 -0.0132 0.0063  -0.0154 318 VAL A N   
292  C CA  . VAL A 22  ? 0.3225 0.5822 0.4209 -0.0259 0.0029  -0.0304 318 VAL A CA  
293  C C   . VAL A 22  ? 0.2955 0.5410 0.3838 -0.0152 0.0154  -0.0366 318 VAL A C   
294  O O   . VAL A 22  ? 0.3217 0.5634 0.3979 -0.0253 0.0165  -0.0393 318 VAL A O   
295  C CB  . VAL A 22  ? 0.3724 0.5959 0.4548 -0.0269 -0.0046 -0.0422 318 VAL A CB  
296  C CG1 . VAL A 22  ? 0.3845 0.5781 0.4431 -0.0349 -0.0062 -0.0534 318 VAL A CG1 
297  C CG2 . VAL A 22  ? 0.4179 0.6509 0.5033 -0.0387 -0.0155 -0.0365 318 VAL A CG2 
307  N N   . GLN A 23  ? 0.3288 0.5619 0.4173 0.0050  0.0264  -0.0391 319 GLN A N   
308  C CA  . GLN A 23  ? 0.3859 0.5998 0.4569 0.0144  0.0394  -0.0464 319 GLN A CA  
309  C C   . GLN A 23  ? 0.3770 0.6234 0.4598 0.0150  0.0497  -0.0344 319 GLN A C   
310  O O   . GLN A 23  ? 0.3737 0.6108 0.4396 0.0092  0.0531  -0.0393 319 GLN A O   
311  C CB  . GLN A 23  ? 0.5181 0.7066 0.5815 0.0344  0.0522  -0.0510 319 GLN A CB  
312  C CG  . GLN A 23  ? 0.6318 0.7851 0.6805 0.0307  0.0430  -0.0640 319 GLN A CG  
313  C CD  . GLN A 23  ? 0.7563 0.8744 0.7888 0.0458  0.0573  -0.0707 319 GLN A CD  
314  O OE1 . GLN A 23  ? 0.7928 0.9067 0.8202 0.0620  0.0764  -0.0669 319 GLN A OE1 
315  N NE2 . GLN A 23  ? 0.8108 0.9004 0.8327 0.0404  0.0500  -0.0803 319 GLN A NE2 
324  N N   . ALA A 24  ? 0.3534 0.6422 0.4667 0.0222  0.0551  -0.0160 320 ALA A N   
325  C CA  . ALA A 24  ? 0.3152 0.6442 0.4462 0.0228  0.0659  -0.0007 320 ALA A CA  
326  C C   . ALA A 24  ? 0.2805 0.6213 0.4073 -0.0053 0.0544  -0.0008 320 ALA A C   
327  O O   . ALA A 24  ? 0.2785 0.6289 0.4027 -0.0086 0.0639  0.0031  320 ALA A O   
328  C CB  . ALA A 24  ? 0.3439 0.7269 0.5142 0.0339  0.0705  0.0234  320 ALA A CB  
334  N N   . LYS A 25  ? 0.2742 0.6095 0.3966 -0.0256 0.0362  -0.0050 321 LYS A N   
335  C CA  . LYS A 25  ? 0.3119 0.6494 0.4242 -0.0535 0.0276  -0.0051 321 LYS A CA  
336  C C   . LYS A 25  ? 0.2905 0.5839 0.3702 -0.0553 0.0314  -0.0194 321 LYS A C   
337  O O   . LYS A 25  ? 0.2925 0.5903 0.3656 -0.0662 0.0371  -0.0158 321 LYS A O   
338  C CB  . LYS A 25  ? 0.3693 0.7032 0.4775 -0.0728 0.0103  -0.0067 321 LYS A CB  
339  C CG  . LYS A 25  ? 0.4424 0.7599 0.5279 -0.1023 0.0036  -0.0104 321 LYS A CG  
340  C CD  . LYS A 25  ? 0.5257 0.7907 0.5807 -0.1043 -0.0023 -0.0257 321 LYS A CD  
341  C CE  . LYS A 25  ? 0.5774 0.8115 0.6020 -0.1270 -0.0021 -0.0301 321 LYS A CE  
342  N NZ  . LYS A 25  ? 0.6216 0.8061 0.6182 -0.1237 -0.0040 -0.0415 321 LYS A NZ  
356  N N   . ILE A 26  ? 0.2989 0.5525 0.3587 -0.0455 0.0281  -0.0337 322 ILE A N   
357  C CA  . ILE A 26  ? 0.3059 0.5244 0.3365 -0.0461 0.0298  -0.0439 322 ILE A CA  
358  C C   . ILE A 26  ? 0.3393 0.5586 0.3630 -0.0331 0.0442  -0.0438 322 ILE A C   
359  O O   . ILE A 26  ? 0.3698 0.5769 0.3745 -0.0377 0.0487  -0.0448 322 ILE A O   
360  C CB  . ILE A 26  ? 0.3662 0.5525 0.3824 -0.0400 0.0213  -0.0557 322 ILE A CB  
361  C CG1 . ILE A 26  ? 0.3395 0.5225 0.3593 -0.0518 0.0103  -0.0548 322 ILE A CG1 
362  C CG2 . ILE A 26  ? 0.3897 0.5488 0.3789 -0.0393 0.0218  -0.0620 322 ILE A CG2 
363  C CD1 . ILE A 26  ? 0.3743 0.5317 0.3851 -0.0457 0.0033  -0.0631 322 ILE A CD1 
375  N N   . MET A 27  ? 0.3452 0.5753 0.3808 -0.0154 0.0539  -0.0418 323 MET A N   
376  C CA  . MET A 27  ? 0.4005 0.6284 0.4258 -0.0016 0.0716  -0.0410 323 MET A CA  
377  C C   . MET A 27  ? 0.3797 0.6383 0.4162 -0.0106 0.0802  -0.0274 323 MET A C   
378  O O   . MET A 27  ? 0.3932 0.6391 0.4087 -0.0094 0.0897  -0.0293 323 MET A O   
379  C CB  . MET A 27  ? 0.5158 0.7489 0.5528 0.0204  0.0848  -0.0378 323 MET A CB  
380  C CG  . MET A 27  ? 0.6794 0.8873 0.6900 0.0379  0.1047  -0.0437 323 MET A CG  
381  S SD  . MET A 27  ? 0.7988 1.0083 0.8217 0.0672  0.1275  -0.0359 323 MET A SD  
382  C CE  . MET A 27  ? 0.7803 0.9704 0.8076 0.0650  0.1108  -0.0443 323 MET A CE  
392  N N   . ALA A 28  ? 0.3144 0.6151 0.3829 -0.0218 0.0763  -0.0127 324 ALA A N   
393  C CA  . ALA A 28  ? 0.3156 0.6504 0.3977 -0.0359 0.0830  0.0019  324 ALA A CA  
394  C C   . ALA A 28  ? 0.3256 0.6318 0.3798 -0.0567 0.0773  -0.0048 324 ALA A C   
395  O O   . ALA A 28  ? 0.3421 0.6518 0.3887 -0.0608 0.0888  0.0008  324 ALA A O   
396  C CB  . ALA A 28  ? 0.3383 0.7262 0.4582 -0.0500 0.0749  0.0191  324 ALA A CB  
402  N N   . TYR A 29  ? 0.3563 0.6323 0.3940 -0.0680 0.0621  -0.0152 325 TYR A N   
403  C CA  . TYR A 29  ? 0.4353 0.6789 0.4444 -0.0841 0.0597  -0.0195 325 TYR A CA  
404  C C   . TYR A 29  ? 0.4611 0.6768 0.4428 -0.0699 0.0690  -0.0253 325 TYR A C   
405  O O   . TYR A 29  ? 0.5178 0.7250 0.4839 -0.0785 0.0770  -0.0205 325 TYR A O   
406  C CB  . TYR A 29  ? 0.4204 0.6337 0.4156 -0.0917 0.0457  -0.0284 325 TYR A CB  
407  C CG  . TYR A 29  ? 0.4819 0.7007 0.4787 -0.1194 0.0388  -0.0232 325 TYR A CG  
408  C CD1 . TYR A 29  ? 0.5023 0.7014 0.4774 -0.1407 0.0437  -0.0203 325 TYR A CD1 
409  C CD2 . TYR A 29  ? 0.4810 0.7211 0.4963 -0.1261 0.0277  -0.0214 325 TYR A CD2 
410  C CE1 . TYR A 29  ? 0.5231 0.7198 0.4914 -0.1708 0.0377  -0.0175 325 TYR A CE1 
411  C CE2 . TYR A 29  ? 0.5460 0.7890 0.5558 -0.1553 0.0200  -0.0177 325 TYR A CE2 
412  C CZ  . TYR A 29  ? 0.5588 0.7782 0.5434 -0.1790 0.0250  -0.0168 325 TYR A CZ  
413  O OH  . TYR A 29  ? 0.5645 0.7797 0.5359 -0.2126 0.0176  -0.0150 325 TYR A OH  
423  N N   . LEU A 30  ? 0.4874 0.6874 0.4598 -0.0503 0.0678  -0.0353 326 LEU A N   
424  C CA  . LEU A 30  ? 0.5430 0.7176 0.4846 -0.0399 0.0733  -0.0411 326 LEU A CA  
425  C C   . LEU A 30  ? 0.5607 0.7498 0.5004 -0.0326 0.0917  -0.0345 326 LEU A C   
426  O O   . LEU A 30  ? 0.5936 0.7679 0.5080 -0.0326 0.0986  -0.0332 326 LEU A O   
427  C CB  . LEU A 30  ? 0.5738 0.7290 0.5035 -0.0264 0.0658  -0.0538 326 LEU A CB  
428  C CG  . LEU A 30  ? 0.6074 0.7515 0.5419 -0.0308 0.0494  -0.0591 326 LEU A CG  
429  C CD1 . LEU A 30  ? 0.6599 0.7860 0.5787 -0.0212 0.0427  -0.0701 326 LEU A CD1 
430  C CD2 . LEU A 30  ? 0.5922 0.7217 0.5154 -0.0417 0.0443  -0.0547 326 LEU A CD2 
442  N N   . GLN A 31  ? 0.5514 0.7704 0.5174 -0.0244 0.1014  -0.0281 327 GLN A N   
443  C CA  . GLN A 31  ? 0.5697 0.8062 0.5373 -0.0149 0.1226  -0.0188 327 GLN A CA  
444  C C   . GLN A 31  ? 0.5360 0.7941 0.5129 -0.0336 0.1279  -0.0047 327 GLN A C   
445  O O   . GLN A 31  ? 0.5526 0.8126 0.5176 -0.0292 0.1445  0.0015  327 GLN A O   
446  C CB  . GLN A 31  ? 0.6321 0.8994 0.6302 0.0013  0.1341  -0.0107 327 GLN A CB  
447  C CG  . GLN A 31  ? 0.7488 0.9840 0.7261 0.0232  0.1392  -0.0242 327 GLN A CG  
448  C CD  . GLN A 31  ? 0.8615 1.0661 0.7982 0.0362  0.1569  -0.0312 327 GLN A CD  
449  O OE1 . GLN A 31  ? 0.9043 1.1266 0.8441 0.0430  0.1771  -0.0195 327 GLN A OE1 
450  N NE2 . GLN A 31  ? 0.8993 1.0590 0.7963 0.0381  0.1490  -0.0496 327 GLN A NE2 
459  N N   . GLN A 32  ? 0.5323 0.8033 0.5262 -0.0561 0.1150  0.0001  328 GLN A N   
460  C CA  . GLN A 32  ? 0.5936 0.8760 0.5897 -0.0803 0.1185  0.0116  328 GLN A CA  
461  C C   . GLN A 32  ? 0.6239 0.8632 0.5789 -0.0811 0.1232  0.0066  328 GLN A C   
462  O O   . GLN A 32  ? 0.6106 0.8552 0.5585 -0.0847 0.1380  0.0159  328 GLN A O   
463  C CB  . GLN A 32  ? 0.6287 0.9171 0.6367 -0.1069 0.1022  0.0130  328 GLN A CB  
464  C CG  . GLN A 32  ? 0.6744 0.9690 0.6801 -0.1386 0.1051  0.0236  328 GLN A CG  
465  C CD  . GLN A 32  ? 0.7298 0.9979 0.7209 -0.1647 0.0903  0.0178  328 GLN A CD  
466  O OE1 . GLN A 32  ? 0.7347 0.9610 0.7029 -0.1560 0.0822  0.0048  328 GLN A OE1 
467  N NE2 . GLN A 32  ? 0.7713 1.0634 0.7737 -0.1981 0.0873  0.0279  328 GLN A NE2 
476  N N   . LEU A 43  ? 0.8503 0.8819 0.5254 -0.0083 0.1062  0.0101  339 LEU A N   
477  C CA  . LEU A 43  ? 0.8164 0.8530 0.5157 -0.0088 0.0902  0.0033  339 LEU A CA  
478  C C   . LEU A 43  ? 0.7949 0.8443 0.4858 -0.0025 0.0722  -0.0060 339 LEU A C   
479  O O   . LEU A 43  ? 0.7914 0.8470 0.4778 -0.0038 0.0722  -0.0191 339 LEU A O   
480  C CB  . LEU A 43  ? 0.8352 0.8811 0.5691 -0.0200 0.0933  -0.0062 339 LEU A CB  
481  C CG  . LEU A 43  ? 0.8333 0.8776 0.5909 -0.0232 0.0817  -0.0098 339 LEU A CG  
482  C CD1 . LEU A 43  ? 0.8583 0.8778 0.6111 -0.0289 0.0897  0.0016  339 LEU A CD1 
483  C CD2 . LEU A 43  ? 0.8273 0.8893 0.6160 -0.0310 0.0797  -0.0210 339 LEU A CD2 
494  N N   . SER A 44  ? 0.7492 0.8016 0.4367 0.0040  0.0581  0.0021  340 SER A N   
495  C CA  . SER A 44  ? 0.7159 0.7846 0.3967 0.0050  0.0383  -0.0048 340 SER A CA  
496  C C   . SER A 44  ? 0.6461 0.7210 0.3548 -0.0018 0.0305  -0.0216 340 SER A C   
497  O O   . SER A 44  ? 0.5903 0.6612 0.3268 -0.0048 0.0371  -0.0243 340 SER A O   
498  C CB  . SER A 44  ? 0.7455 0.8254 0.4247 0.0139  0.0255  0.0128  340 SER A CB  
499  O OG  . SER A 44  ? 0.6916 0.7637 0.3972 0.0182  0.0302  0.0204  340 SER A OG  
505  N N   . THR A 45  ? 0.5191 0.7797 0.3194 -0.1078 -0.0020 0.0205  341 THR A N   
506  C CA  . THR A 45  ? 0.5272 0.7705 0.3477 -0.0829 -0.0060 0.0044  341 THR A CA  
507  C C   . THR A 45  ? 0.4409 0.6532 0.2887 -0.0806 -0.0158 0.0206  341 THR A C   
508  O O   . THR A 45  ? 0.4324 0.6422 0.3044 -0.0665 -0.0135 0.0131  341 THR A O   
509  C CB  . THR A 45  ? 0.5380 0.7569 0.3316 -0.0747 -0.0153 -0.0094 341 THR A CB  
510  O OG1 . THR A 45  ? 0.5952 0.8394 0.3560 -0.0733 -0.0045 -0.0261 341 THR A OG1 
511  C CG2 . THR A 45  ? 0.5670 0.7580 0.3704 -0.0517 -0.0199 -0.0260 341 THR A CG2 
519  N N   . PHE A 46  ? 0.4725 0.6641 0.3150 -0.0912 -0.0267 0.0431  342 PHE A N   
520  C CA  . PHE A 46  ? 0.4856 0.6534 0.3504 -0.0846 -0.0330 0.0595  342 PHE A CA  
521  C C   . PHE A 46  ? 0.4937 0.6612 0.3686 -0.0873 -0.0230 0.0614  342 PHE A C   
522  O O   . PHE A 46  ? 0.4673 0.6220 0.3639 -0.0753 -0.0231 0.0597  342 PHE A O   
523  C CB  . PHE A 46  ? 0.5321 0.6859 0.3848 -0.0902 -0.0444 0.0850  342 PHE A CB  
524  C CG  . PHE A 46  ? 0.5105 0.6408 0.3783 -0.0777 -0.0478 0.1027  342 PHE A CG  
525  C CD1 . PHE A 46  ? 0.5048 0.6346 0.3984 -0.0620 -0.0543 0.1045  342 PHE A CD1 
526  C CD2 . PHE A 46  ? 0.5521 0.6573 0.4018 -0.0824 -0.0444 0.1177  342 PHE A CD2 
527  C CE1 . PHE A 46  ? 0.5288 0.6413 0.4337 -0.0456 -0.0550 0.1194  342 PHE A CE1 
528  C CE2 . PHE A 46  ? 0.5585 0.6323 0.4124 -0.0655 -0.0468 0.1316  342 PHE A CE2 
529  C CZ  . PHE A 46  ? 0.5304 0.6119 0.4138 -0.0444 -0.0510 0.1318  342 PHE A CZ  
539  N N   . GLY A 47  ? 0.5227 0.7047 0.3779 -0.1072 -0.0150 0.0655  343 GLY A N   
540  C CA  . GLY A 47  ? 0.5438 0.7280 0.4025 -0.1189 -0.0073 0.0675  343 GLY A CA  
541  C C   . GLY A 47  ? 0.4735 0.6922 0.3596 -0.1072 0.0003  0.0462  343 GLY A C   
542  O O   . GLY A 47  ? 0.4452 0.6556 0.3450 -0.1068 0.0010  0.0466  343 GLY A O   
546  N N   . LEU A 48  ? 0.4872 0.7419 0.3768 -0.0950 0.0055  0.0270  344 LEU A N   
547  C CA  . LEU A 48  ? 0.4125 0.6978 0.3246 -0.0749 0.0113  0.0069  344 LEU A CA  
548  C C   . LEU A 48  ? 0.3911 0.6370 0.3217 -0.0538 0.0020  0.0046  344 LEU A C   
549  O O   . LEU A 48  ? 0.3456 0.6023 0.2960 -0.0432 0.0038  -0.0024 344 LEU A O   
550  C CB  . LEU A 48  ? 0.4484 0.7667 0.3488 -0.0582 0.0182  -0.0138 344 LEU A CB  
551  C CG  . LEU A 48  ? 0.5065 0.8639 0.4238 -0.0305 0.0257  -0.0349 344 LEU A CG  
552  C CD1 . LEU A 48  ? 0.5117 0.9400 0.4456 -0.0463 0.0374  -0.0319 344 LEU A CD1 
553  C CD2 . LEU A 48  ? 0.5745 0.9386 0.4675 -0.0041 0.0302  -0.0569 344 LEU A CD2 
565  N N   . MET A 49  ? 0.4076 0.6137 0.3317 -0.0497 -0.0086 0.0119  345 MET A N   
566  C CA  . MET A 49  ? 0.3997 0.5743 0.3396 -0.0348 -0.0169 0.0128  345 MET A CA  
567  C C   . MET A 49  ? 0.3706 0.5280 0.3235 -0.0388 -0.0172 0.0276  345 MET A C   
568  O O   . MET A 49  ? 0.4179 0.5629 0.3866 -0.0265 -0.0191 0.0247  345 MET A O   
569  C CB  . MET A 49  ? 0.4332 0.5835 0.3628 -0.0355 -0.0285 0.0192  345 MET A CB  
570  C CG  . MET A 49  ? 0.5228 0.6723 0.4283 -0.0320 -0.0308 0.0020  345 MET A CG  
571  S SD  . MET A 49  ? 0.5317 0.6662 0.4336 -0.0063 -0.0300 -0.0230 345 MET A SD  
572  C CE  . MET A 49  ? 0.6292 0.8151 0.5281 0.0051  -0.0130 -0.0400 345 MET A CE  
582  N N   . CYS A 50  ? 0.4170 0.5661 0.3561 -0.0552 -0.0159 0.0435  346 CYS A N   
583  C CA  . CYS A 50  ? 0.3893 0.5107 0.3272 -0.0583 -0.0156 0.0546  346 CYS A CA  
584  C C   . CYS A 50  ? 0.3678 0.5097 0.3156 -0.0637 -0.0096 0.0430  346 CYS A C   
585  O O   . CYS A 50  ? 0.4422 0.5643 0.3977 -0.0568 -0.0110 0.0432  346 CYS A O   
586  C CB  . CYS A 50  ? 0.4654 0.5617 0.3727 -0.0757 -0.0164 0.0730  346 CYS A CB  
587  S SG  . CYS A 50  ? 0.4753 0.5481 0.3721 -0.0630 -0.0262 0.0924  346 CYS A SG  
593  N N   . LYS A 51  ? 0.4325 0.6213 0.3802 -0.0756 -0.0029 0.0333  347 LYS A N   
594  C CA  . LYS A 51  ? 0.4087 0.6370 0.3710 -0.0796 0.0018  0.0229  347 LYS A CA  
595  C C   . LYS A 51  ? 0.3950 0.6291 0.3812 -0.0495 -0.0008 0.0085  347 LYS A C   
596  O O   . LYS A 51  ? 0.3601 0.5966 0.3577 -0.0472 -0.0025 0.0063  347 LYS A O   
597  C CB  . LYS A 51  ? 0.4908 0.7848 0.4511 -0.0941 0.0110  0.0163  347 LYS A CB  
598  C CG  . LYS A 51  ? 0.6388 0.9976 0.6199 -0.0960 0.0160  0.0062  347 LYS A CG  
599  C CD  . LYS A 51  ? 0.7946 1.1349 0.7719 -0.1203 0.0111  0.0160  347 LYS A CD  
600  C CE  . LYS A 51  ? 0.9297 1.2410 0.8712 -0.1635 0.0106  0.0340  347 LYS A CE  
601  N NZ  . LYS A 51  ? 0.9926 1.2484 0.9145 -0.1819 0.0029  0.0430  347 LYS A NZ  
615  N N   . MET A 52  ? 0.3903 0.6203 0.3776 -0.0283 -0.0027 -0.0008 348 MET A N   
616  C CA  . MET A 52  ? 0.3856 0.6067 0.3843 -0.0009 -0.0071 -0.0131 348 MET A CA  
617  C C   . MET A 52  ? 0.3666 0.5437 0.3718 0.0020  -0.0140 -0.0033 348 MET A C   
618  O O   . MET A 52  ? 0.3733 0.5492 0.3891 0.0147  -0.0163 -0.0087 348 MET A O   
619  C CB  . MET A 52  ? 0.3990 0.6055 0.3825 0.0144  -0.0101 -0.0234 348 MET A CB  
620  C CG  . MET A 52  ? 0.4453 0.6350 0.4264 0.0431  -0.0149 -0.0383 348 MET A CG  
621  S SD  . MET A 52  ? 0.4758 0.6234 0.4212 0.0535  -0.0218 -0.0495 348 MET A SD  
622  C CE  . MET A 52  ? 0.4826 0.5903 0.4289 0.0286  -0.0326 -0.0281 348 MET A CE  
632  N N   . ALA A 53  ? 0.4144 0.5595 0.4121 -0.0070 -0.0171 0.0117  349 ALA A N   
633  C CA  . ALA A 53  ? 0.3024 0.4147 0.3055 -0.0012 -0.0210 0.0217  349 ALA A CA  
634  C C   . ALA A 53  ? 0.3491 0.4554 0.3511 -0.0081 -0.0178 0.0246  349 ALA A C   
635  O O   . ALA A 53  ? 0.2961 0.3880 0.3042 0.0015  -0.0196 0.0237  349 ALA A O   
636  C CB  . ALA A 53  ? 0.4078 0.5007 0.4039 -0.0043 -0.0241 0.0381  349 ALA A CB  
642  N N   . ASP A 54  ? 0.3837 0.4971 0.3719 -0.0283 -0.0141 0.0285  350 ASP A N   
643  C CA  . ASP A 54  ? 0.3327 0.4353 0.3100 -0.0430 -0.0133 0.0305  350 ASP A CA  
644  C C   . ASP A 54  ? 0.3873 0.5249 0.3839 -0.0369 -0.0145 0.0175  350 ASP A C   
645  O O   . ASP A 54  ? 0.3048 0.4226 0.2986 -0.0353 -0.0172 0.0177  350 ASP A O   
646  C CB  . ASP A 54  ? 0.4283 0.5375 0.3827 -0.0738 -0.0107 0.0369  350 ASP A CB  
647  C CG  . ASP A 54  ? 0.4900 0.5704 0.4185 -0.0975 -0.0126 0.0416  350 ASP A CG  
648  O OD1 . ASP A 54  ? 0.5270 0.5423 0.4284 -0.0928 -0.0148 0.0504  350 ASP A OD1 
649  O OD2 . ASP A 54  ? 0.5421 0.6660 0.4734 -0.1213 -0.0122 0.0367  350 ASP A OD2 
654  N N   . GLN A 55  ? 0.3585 0.5482 0.3715 -0.0298 -0.0125 0.0061  351 GLN A N   
655  C CA  . GLN A 55  ? 0.3033 0.5315 0.3343 -0.0162 -0.0146 -0.0053 351 GLN A CA  
656  C C   . GLN A 55  ? 0.3623 0.5564 0.3988 0.0103  -0.0205 -0.0083 351 GLN A C   
657  O O   . GLN A 55  ? 0.2647 0.4660 0.3078 0.0174  -0.0248 -0.0115 351 GLN A O   
658  C CB  . GLN A 55  ? 0.3464 0.6375 0.3891 -0.0053 -0.0099 -0.0172 351 GLN A CB  
659  C CG  . GLN A 55  ? 0.3905 0.7396 0.4325 -0.0351 -0.0036 -0.0142 351 GLN A CG  
660  C CD  . GLN A 55  ? 0.4329 0.8132 0.4805 -0.0567 -0.0072 -0.0110 351 GLN A CD  
661  O OE1 . GLN A 55  ? 0.4693 0.8611 0.5311 -0.0382 -0.0130 -0.0167 351 GLN A OE1 
662  N NE2 . GLN A 55  ? 0.4892 0.8786 0.5200 -0.0993 -0.0056 -0.0006 351 GLN A NE2 
671  N N   . THR A 56  ? 0.2889 0.4485 0.3207 0.0217  -0.0219 -0.0059 352 THR A N   
672  C CA  . THR A 56  ? 0.2928 0.4189 0.3249 0.0390  -0.0279 -0.0056 352 THR A CA  
673  C C   . THR A 56  ? 0.3373 0.4363 0.3665 0.0328  -0.0281 0.0043  352 THR A C   
674  O O   . THR A 56  ? 0.3484 0.4364 0.3788 0.0433  -0.0321 0.0028  352 THR A O   
675  C CB  . THR A 56  ? 0.3353 0.4354 0.3597 0.0423  -0.0305 -0.0022 352 THR A CB  
676  O OG1 . THR A 56  ? 0.3452 0.4626 0.3630 0.0483  -0.0300 -0.0136 352 THR A OG1 
677  C CG2 . THR A 56  ? 0.3451 0.4129 0.3654 0.0532  -0.0376 -0.0004 352 THR A CG2 
685  N N   . LEU A 57  ? 0.3500 0.4331 0.3690 0.0180  -0.0239 0.0142  353 LEU A N   
686  C CA  . LEU A 57  ? 0.3243 0.3742 0.3309 0.0168  -0.0227 0.0215  353 LEU A CA  
687  C C   . LEU A 57  ? 0.3091 0.3679 0.3115 0.0093  -0.0253 0.0148  353 LEU A C   
688  O O   . LEU A 57  ? 0.3299 0.3666 0.3250 0.0158  -0.0267 0.0158  353 LEU A O   
689  C CB  . LEU A 57  ? 0.3258 0.3476 0.3116 0.0070  -0.0186 0.0324  353 LEU A CB  
690  C CG  . LEU A 57  ? 0.3925 0.4065 0.3815 0.0176  -0.0174 0.0432  353 LEU A CG  
691  C CD1 . LEU A 57  ? 0.4357 0.4183 0.3980 0.0131  -0.0146 0.0545  353 LEU A CD1 
692  C CD2 . LEU A 57  ? 0.4430 0.4509 0.4416 0.0353  -0.0172 0.0486  353 LEU A CD2 
704  N N   . PHE A 58  ? 0.3189 0.4165 0.3253 -0.0061 -0.0263 0.0088  354 PHE A N   
705  C CA  . PHE A 58  ? 0.3382 0.4606 0.3450 -0.0155 -0.0312 0.0034  354 PHE A CA  
706  C C   . PHE A 58  ? 0.3196 0.4541 0.3421 0.0100  -0.0367 -0.0027 354 PHE A C   
707  O O   . PHE A 58  ? 0.3293 0.4525 0.3441 0.0099  -0.0416 -0.0027 354 PHE A O   
708  C CB  . PHE A 58  ? 0.3989 0.5830 0.4145 -0.0357 -0.0309 -0.0005 354 PHE A CB  
709  C CG  . PHE A 58  ? 0.4094 0.5760 0.3970 -0.0736 -0.0295 0.0071  354 PHE A CG  
710  C CD1 . PHE A 58  ? 0.4356 0.5780 0.3967 -0.0985 -0.0352 0.0094  354 PHE A CD1 
711  C CD2 . PHE A 58  ? 0.3889 0.5558 0.3685 -0.0867 -0.0240 0.0124  354 PHE A CD2 
712  C CE1 . PHE A 58  ? 0.4934 0.6040 0.4160 -0.1370 -0.0359 0.0168  354 PHE A CE1 
713  C CE2 . PHE A 58  ? 0.4461 0.5860 0.3907 -0.1238 -0.0243 0.0213  354 PHE A CE2 
714  C CZ  . PHE A 58  ? 0.5048 0.6123 0.4184 -0.1496 -0.0306 0.0235  354 PHE A CZ  
724  N N   . SER A 59  ? 0.3280 0.4781 0.3652 0.0318  -0.0372 -0.0079 355 SER A N   
725  C CA  . SER A 59  ? 0.3235 0.4698 0.3651 0.0573  -0.0441 -0.0123 355 SER A CA  
726  C C   . SER A 59  ? 0.3453 0.4388 0.3742 0.0607  -0.0451 -0.0042 355 SER A C   
727  O O   . SER A 59  ? 0.3401 0.4249 0.3645 0.0709  -0.0513 -0.0043 355 SER A O   
728  C CB  . SER A 59  ? 0.3552 0.5084 0.4001 0.0792  -0.0449 -0.0199 355 SER A CB  
729  O OG  . SER A 59  ? 0.4584 0.6713 0.5152 0.0826  -0.0422 -0.0286 355 SER A OG  
735  N N   . ILE A 60  ? 0.3259 0.3902 0.3489 0.0532  -0.0390 0.0041  356 ILE A N   
736  C CA  . ILE A 60  ? 0.3520 0.3814 0.3659 0.0573  -0.0375 0.0133  356 ILE A CA  
737  C C   . ILE A 60  ? 0.3590 0.3743 0.3584 0.0516  -0.0360 0.0148  356 ILE A C   
738  O O   . ILE A 60  ? 0.3898 0.3899 0.3811 0.0588  -0.0379 0.0173  356 ILE A O   
739  C CB  . ILE A 60  ? 0.3632 0.3806 0.3776 0.0538  -0.0314 0.0231  356 ILE A CB  
740  C CG1 . ILE A 60  ? 0.3644 0.3869 0.3854 0.0568  -0.0358 0.0221  356 ILE A CG1 
741  C CG2 . ILE A 60  ? 0.3887 0.3858 0.3953 0.0586  -0.0264 0.0341  356 ILE A CG2 
742  C CD1 . ILE A 60  ? 0.3892 0.4128 0.4131 0.0503  -0.0326 0.0319  356 ILE A CD1 
754  N N   . VAL A 61  ? 0.3720 0.3858 0.3604 0.0361  -0.0331 0.0136  357 VAL A N   
755  C CA  . VAL A 61  ? 0.3926 0.3816 0.3552 0.0270  -0.0332 0.0130  357 VAL A CA  
756  C C   . VAL A 61  ? 0.3826 0.3945 0.3487 0.0272  -0.0428 0.0068  357 VAL A C   
757  O O   . VAL A 61  ? 0.4161 0.4052 0.3636 0.0296  -0.0443 0.0075  357 VAL A O   
758  C CB  . VAL A 61  ? 0.3973 0.3725 0.3379 0.0037  -0.0317 0.0128  357 VAL A CB  
759  C CG1 . VAL A 61  ? 0.4569 0.3999 0.3609 -0.0116 -0.0352 0.0098  357 VAL A CG1 
760  C CG2 . VAL A 61  ? 0.4169 0.3588 0.3458 0.0097  -0.0233 0.0212  357 VAL A CG2 
770  N N   . GLU A 62  ? 0.3727 0.4335 0.3609 0.0275  -0.0494 0.0010  358 GLU A N   
771  C CA  . GLU A 62  ? 0.4191 0.5102 0.4124 0.0334  -0.0601 -0.0034 358 GLU A CA  
772  C C   . GLU A 62  ? 0.4204 0.4893 0.4126 0.0580  -0.0637 -0.0006 358 GLU A C   
773  O O   . GLU A 62  ? 0.4026 0.4668 0.3830 0.0611  -0.0709 0.0002  358 GLU A O   
774  C CB  . GLU A 62  ? 0.4181 0.5763 0.4363 0.0358  -0.0649 -0.0096 358 GLU A CB  
775  C CG  . GLU A 62  ? 0.4572 0.6580 0.4831 0.0474  -0.0773 -0.0126 358 GLU A CG  
776  C CD  . GLU A 62  ? 0.4926 0.6991 0.5011 0.0194  -0.0842 -0.0111 358 GLU A CD  
777  O OE1 . GLU A 62  ? 0.5458 0.7386 0.5377 -0.0132 -0.0800 -0.0100 358 GLU A OE1 
778  O OE2 . GLU A 62  ? 0.4753 0.6929 0.4798 0.0288  -0.0950 -0.0106 358 GLU A OE2 
785  N N   . TRP A 63  ? 0.3711 0.4242 0.3704 0.0718  -0.0603 0.0018  359 TRP A N   
786  C CA  . TRP A 63  ? 0.3842 0.4069 0.3739 0.0869  -0.0643 0.0072  359 TRP A CA  
787  C C   . TRP A 63  ? 0.4549 0.4475 0.4255 0.0801  -0.0599 0.0148  359 TRP A C   
788  O O   . TRP A 63  ? 0.5013 0.4837 0.4582 0.0861  -0.0667 0.0172  359 TRP A O   
789  C CB  . TRP A 63  ? 0.3949 0.3997 0.3879 0.0911  -0.0612 0.0103  359 TRP A CB  
790  C CG  . TRP A 63  ? 0.4246 0.3931 0.4020 0.0924  -0.0627 0.0205  359 TRP A CG  
791  C CD1 . TRP A 63  ? 0.5113 0.4553 0.4713 0.1035  -0.0734 0.0225  359 TRP A CD1 
792  C CD2 . TRP A 63  ? 0.4131 0.3694 0.3883 0.0812  -0.0535 0.0320  359 TRP A CD2 
793  N NE1 . TRP A 63  ? 0.5085 0.4246 0.4541 0.0930  -0.0715 0.0353  359 TRP A NE1 
794  C CE2 . TRP A 63  ? 0.4670 0.3985 0.4255 0.0803  -0.0586 0.0413  359 TRP A CE2 
795  C CE3 . TRP A 63  ? 0.3823 0.3479 0.3654 0.0738  -0.0418 0.0366  359 TRP A CE3 
796  C CZ2 . TRP A 63  ? 0.4620 0.3920 0.4178 0.0688  -0.0511 0.0553  359 TRP A CZ2 
797  C CZ3 . TRP A 63  ? 0.3995 0.3628 0.3805 0.0703  -0.0345 0.0495  359 TRP A CZ3 
798  C CH2 . TRP A 63  ? 0.4439 0.3965 0.4144 0.0662  -0.0385 0.0590  359 TRP A CH2 
809  N N   . ALA A 64  ? 0.4115 0.3896 0.3772 0.0706  -0.0483 0.0190  360 ALA A N   
810  C CA  . ALA A 64  ? 0.4135 0.3657 0.3574 0.0701  -0.0412 0.0248  360 ALA A CA  
811  C C   . ALA A 64  ? 0.4398 0.3870 0.3623 0.0629  -0.0465 0.0185  360 ALA A C   
812  O O   . ALA A 64  ? 0.4784 0.4100 0.3812 0.0664  -0.0475 0.0213  360 ALA A O   
813  C CB  . ALA A 64  ? 0.4108 0.3500 0.3504 0.0692  -0.0279 0.0293  360 ALA A CB  
819  N N   . ARG A 65  ? 0.4702 0.4323 0.3933 0.0487  -0.0508 0.0109  361 ARG A N   
820  C CA  . ARG A 65  ? 0.4985 0.4618 0.3997 0.0344  -0.0594 0.0054  361 ARG A CA  
821  C C   . ARG A 65  ? 0.5667 0.5538 0.4742 0.0447  -0.0723 0.0059  361 ARG A C   
822  O O   . ARG A 65  ? 0.6238 0.5964 0.5055 0.0408  -0.0773 0.0058  361 ARG A O   
823  C CB  . ARG A 65  ? 0.5505 0.5411 0.4565 0.0113  -0.0642 -0.0002 361 ARG A CB  
824  C CG  . ARG A 65  ? 0.6570 0.6095 0.5199 -0.0149 -0.0642 -0.0034 361 ARG A CG  
825  C CD  . ARG A 65  ? 0.6884 0.6758 0.5557 -0.0458 -0.0711 -0.0062 361 ARG A CD  
826  N NE  . ARG A 65  ? 0.7053 0.7544 0.5869 -0.0578 -0.0863 -0.0088 361 ARG A NE  
827  C CZ  . ARG A 65  ? 0.7974 0.8384 0.6462 -0.0822 -0.0972 -0.0112 361 ARG A CZ  
828  N NH1 . ARG A 65  ? 0.8727 0.8349 0.6659 -0.0958 -0.0936 -0.0134 361 ARG A NH1 
829  N NH2 . ARG A 65  ? 0.8048 0.9169 0.6731 -0.0909 -0.1125 -0.0115 361 ARG A NH2 
843  N N   . SER A 66  ? 0.4736 0.7682 0.6228 0.1009  -0.0831 0.1220  362 SER A N   
844  C CA  . SER A 66  ? 0.5579 0.8361 0.6996 0.1368  -0.0817 0.1415  362 SER A CA  
845  C C   . SER A 66  ? 0.5304 0.7238 0.6035 0.1329  -0.0806 0.1304  362 SER A C   
846  O O   . SER A 66  ? 0.4966 0.6746 0.5562 0.1537  -0.0916 0.1528  362 SER A O   
847  C CB  . SER A 66  ? 0.6599 0.9335 0.8168 0.1768  -0.0400 0.1428  362 SER A CB  
848  O OG  . SER A 66  ? 0.7162 0.8960 0.8087 0.1786  -0.0103 0.1165  362 SER A OG  
854  N N   . SER A 67  ? 0.4689 0.6146 0.5042 0.1059  -0.0683 0.1027  363 SER A N   
855  C CA  . SER A 67  ? 0.5373 0.6030 0.5145 0.1056  -0.0507 0.0920  363 SER A CA  
856  C C   . SER A 67  ? 0.5310 0.5695 0.4669 0.0959  -0.0711 0.1002  363 SER A C   
857  O O   . SER A 67  ? 0.4655 0.5214 0.3980 0.0717  -0.0906 0.0952  363 SER A O   
858  C CB  . SER A 67  ? 0.6194 0.6604 0.5841 0.0773  -0.0314 0.0675  363 SER A CB  
859  O OG  . SER A 67  ? 0.7426 0.7210 0.6604 0.0664  -0.0203 0.0618  363 SER A OG  
865  N N   . ILE A 68  ? 0.5755 0.5626 0.4717 0.1139  -0.0645 0.1131  364 ILE A N   
866  C CA  . ILE A 68  ? 0.6556 0.5971 0.4902 0.0985  -0.0718 0.1161  364 ILE A CA  
867  C C   . ILE A 68  ? 0.5822 0.5024 0.3998 0.0670  -0.0535 0.0885  364 ILE A C   
868  O O   . ILE A 68  ? 0.5965 0.5167 0.4394 0.0596  -0.0321 0.0735  364 ILE A O   
869  C CB  . ILE A 68  ? 0.7729 0.6512 0.5693 0.1198  -0.0567 0.1332  364 ILE A CB  
870  C CG1 . ILE A 68  ? 0.8568 0.6937 0.5830 0.1045  -0.0660 0.1444  364 ILE A CG1 
871  C CG2 . ILE A 68  ? 0.7986 0.6277 0.5901 0.1157  -0.0198 0.1123  364 ILE A CG2 
872  C CD1 . ILE A 68  ? 0.9702 0.7526 0.6627 0.1271  -0.0607 0.1740  364 ILE A CD1 
884  N N   . PHE A 69  ? 0.5464 0.4496 0.3206 0.0479  -0.0614 0.0840  365 PHE A N   
885  C CA  . PHE A 69  ? 0.5437 0.4254 0.3065 0.0256  -0.0369 0.0623  365 PHE A CA  
886  C C   . PHE A 69  ? 0.4759 0.4002 0.2916 0.0142  -0.0429 0.0485  365 PHE A C   
887  O O   . PHE A 69  ? 0.5740 0.4836 0.3691 -0.0011 -0.0429 0.0359  365 PHE A O   
888  C CB  . PHE A 69  ? 0.5519 0.4073 0.3219 0.0232  -0.0031 0.0595  365 PHE A CB  
889  C CG  . PHE A 69  ? 0.6038 0.4096 0.3267 0.0326  0.0045  0.0754  365 PHE A CG  
890  C CD1 . PHE A 69  ? 0.6928 0.4641 0.3491 0.0330  -0.0022 0.0880  365 PHE A CD1 
891  C CD2 . PHE A 69  ? 0.6555 0.4411 0.3920 0.0375  0.0177  0.0784  365 PHE A CD2 
892  C CE1 . PHE A 69  ? 0.7679 0.4911 0.3823 0.0416  0.0038  0.1092  365 PHE A CE1 
893  C CE2 . PHE A 69  ? 0.7221 0.4493 0.4146 0.0456  0.0261  0.0945  365 PHE A CE2 
894  C CZ  . PHE A 69  ? 0.8020 0.5008 0.4386 0.0497  0.0189  0.1129  365 PHE A CZ  
904  N N   . PHE A 70  ? 0.4455 0.4145 0.3224 0.0202  -0.0453 0.0507  366 PHE A N   
905  C CA  . PHE A 70  ? 0.4030 0.4135 0.3323 0.0077  -0.0513 0.0442  366 PHE A CA  
906  C C   . PHE A 70  ? 0.4774 0.5076 0.4043 -0.0005 -0.0827 0.0464  366 PHE A C   
907  O O   . PHE A 70  ? 0.5171 0.5430 0.4538 -0.0178 -0.0844 0.0362  366 PHE A O   
908  C CB  . PHE A 70  ? 0.3783 0.4333 0.3586 0.0126  -0.0496 0.0492  366 PHE A CB  
909  C CG  . PHE A 70  ? 0.3303 0.4262 0.3640 -0.0035 -0.0521 0.0486  366 PHE A CG  
910  C CD1 . PHE A 70  ? 0.3629 0.4549 0.4181 -0.0166 -0.0342 0.0477  366 PHE A CD1 
911  C CD2 . PHE A 70  ? 0.3321 0.4764 0.4017 -0.0064 -0.0736 0.0559  366 PHE A CD2 
912  C CE1 . PHE A 70  ? 0.3129 0.4444 0.4227 -0.0295 -0.0389 0.0557  366 PHE A CE1 
913  C CE2 . PHE A 70  ? 0.2855 0.4634 0.4030 -0.0224 -0.0764 0.0606  366 PHE A CE2 
914  C CZ  . PHE A 70  ? 0.2776 0.4469 0.4141 -0.0324 -0.0596 0.0613  366 PHE A CZ  
924  N N   . ARG A 71  ? 0.5080 0.5586 0.4247 0.0099  -0.1086 0.0633  367 ARG A N   
925  C CA  . ARG A 71  ? 0.5750 0.6592 0.4980 -0.0059 -0.1466 0.0724  367 ARG A CA  
926  C C   . ARG A 71  ? 0.6413 0.6683 0.4881 -0.0327 -0.1571 0.0579  367 ARG A C   
927  O O   . ARG A 71  ? 0.7357 0.7769 0.5729 -0.0582 -0.1918 0.0611  367 ARG A O   
928  C CB  . ARG A 71  ? 0.6743 0.8094 0.6204 0.0141  -0.1725 0.1043  367 ARG A CB  
929  C CG  . ARG A 71  ? 0.8861 0.9832 0.7763 0.0295  -0.1756 0.1192  367 ARG A CG  
930  C CD  . ARG A 71  ? 1.0332 1.1883 0.9708 0.0599  -0.1949 0.1589  367 ARG A CD  
931  N NE  . ARG A 71  ? 1.2196 1.3321 1.1159 0.0839  -0.1893 0.1781  367 ARG A NE  
932  C CZ  . ARG A 71  ? 1.3255 1.4226 1.2450 0.1233  -0.1609 0.1888  367 ARG A CZ  
933  N NH1 . ARG A 71  ? 1.3083 1.4291 1.2838 0.1429  -0.1332 0.1787  367 ARG A NH1 
934  N NH2 . ARG A 71  ? 1.4290 1.4783 1.3070 0.1414  -0.1586 0.2099  367 ARG A NH2 
948  N N   . GLU A 72  ? 0.6603 0.6211 0.4480 -0.0316 -0.1262 0.0418  368 GLU A N   
949  C CA  . GLU A 72  ? 0.7473 0.6408 0.4485 -0.0563 -0.1233 0.0216  368 GLU A CA  
950  C C   . GLU A 72  ? 0.7506 0.6094 0.4644 -0.0675 -0.0943 -0.0055 368 GLU A C   
951  O O   . GLU A 72  ? 0.8390 0.6403 0.4876 -0.0923 -0.0958 -0.0267 368 GLU A O   
952  C CB  . GLU A 72  ? 0.8099 0.6495 0.4388 -0.0480 -0.0969 0.0210  368 GLU A CB  
953  C CG  . GLU A 72  ? 0.8327 0.6935 0.4446 -0.0347 -0.1245 0.0531  368 GLU A CG  
954  C CD  . GLU A 72  ? 0.9206 0.7202 0.4280 -0.0434 -0.1171 0.0564  368 GLU A CD  
955  O OE1 . GLU A 72  ? 0.9040 0.7037 0.4054 -0.0243 -0.1183 0.0832  368 GLU A OE1 
956  O OE2 . GLU A 72  ? 0.9949 0.7393 0.4205 -0.0697 -0.1071 0.0326  368 GLU A OE2 
963  N N   . LEU A 73  ? 0.6566 0.5437 0.4486 -0.0512 -0.0677 -0.0035 369 LEU A N   
964  C CA  . LEU A 73  ? 0.6346 0.4984 0.4583 -0.0559 -0.0415 -0.0182 369 LEU A CA  
965  C C   . LEU A 73  ? 0.6330 0.5081 0.4757 -0.0783 -0.0745 -0.0202 369 LEU A C   
966  O O   . LEU A 73  ? 0.6185 0.5547 0.4926 -0.0847 -0.1141 -0.0021 369 LEU A O   
967  C CB  . LEU A 73  ? 0.5930 0.5029 0.5042 -0.0386 -0.0182 -0.0040 369 LEU A CB  
968  C CG  . LEU A 73  ? 0.5968 0.4962 0.5009 -0.0248 0.0162  0.0004  369 LEU A CG  
969  C CD1 . LEU A 73  ? 0.5385 0.4975 0.5219 -0.0200 0.0190  0.0195  369 LEU A CD1 
970  C CD2 . LEU A 73  ? 0.6643 0.5063 0.5436 -0.0213 0.0625  -0.0133 369 LEU A CD2 
982  N N   . LYS A 74  ? 0.6861 0.4990 0.5118 -0.0898 -0.0544 -0.0406 370 LYS A N   
983  C CA  . LYS A 74  ? 0.7079 0.5210 0.5570 -0.1148 -0.0819 -0.0414 370 LYS A CA  
984  C C   . LYS A 74  ? 0.5885 0.4736 0.5502 -0.1026 -0.0819 -0.0163 370 LYS A C   
985  O O   . LYS A 74  ? 0.5438 0.4595 0.5567 -0.0781 -0.0548 -0.0043 370 LYS A O   
986  C CB  . LYS A 74  ? 0.8619 0.5646 0.6480 -0.1303 -0.0548 -0.0738 370 LYS A CB  
987  C CG  . LYS A 74  ? 1.0722 0.6923 0.7254 -0.1467 -0.0483 -0.1025 370 LYS A CG  
988  C CD  . LYS A 74  ? 1.3427 0.8492 0.9072 -0.1819 -0.0439 -0.1385 370 LYS A CD  
989  C CE  . LYS A 74  ? 1.4953 1.0221 1.0368 -0.2325 -0.1142 -0.1320 370 LYS A CE  
990  N NZ  . LYS A 74  ? 1.5832 1.1578 1.0682 -0.2516 -0.1635 -0.1166 370 LYS A NZ  
1004 N N   . VAL A 75  ? 0.6858 0.4694 0.4575 -0.0877 -0.0491 0.0068  371 VAL A N   
1005 C CA  . VAL A 75  ? 0.6474 0.4697 0.4693 -0.0764 -0.0555 0.0216  371 VAL A CA  
1006 C C   . VAL A 75  ? 0.6251 0.4403 0.4782 -0.0618 -0.0365 0.0157  371 VAL A C   
1007 O O   . VAL A 75  ? 0.5466 0.3941 0.4345 -0.0479 -0.0344 0.0251  371 VAL A O   
1008 C CB  . VAL A 75  ? 0.6555 0.4844 0.4833 -0.0914 -0.0754 0.0313  371 VAL A CB  
1009 C CG1 . VAL A 75  ? 0.6251 0.4864 0.4983 -0.0843 -0.0796 0.0456  371 VAL A CG1 
1010 C CG2 . VAL A 75  ? 0.6647 0.5168 0.4754 -0.1025 -0.0965 0.0393  371 VAL A CG2 
1020 N N   . ASP A 76  ? 0.7108 0.4842 0.5533 -0.0643 -0.0231 -0.0006 372 ASP A N   
1021 C CA  . ASP A 76  ? 0.7358 0.5036 0.6146 -0.0479 -0.0072 -0.0070 372 ASP A CA  
1022 C C   . ASP A 76  ? 0.6599 0.4524 0.5552 -0.0331 0.0087  -0.0096 372 ASP A C   
1023 O O   . ASP A 76  ? 0.5976 0.4170 0.5345 -0.0191 0.0092  -0.0006 372 ASP A O   
1024 C CB  . ASP A 76  ? 0.8910 0.6080 0.7537 -0.0511 0.0078  -0.0292 372 ASP A CB  
1025 C CG  . ASP A 76  ? 1.0229 0.7114 0.8768 -0.0643 -0.0080 -0.0257 372 ASP A CG  
1026 O OD1 . ASP A 76  ? 1.0411 0.7471 0.9234 -0.0629 -0.0246 -0.0070 372 ASP A OD1 
1027 O OD2 . ASP A 76  ? 1.1278 0.7746 0.9425 -0.0788 -0.0038 -0.0416 372 ASP A OD2 
1032 N N   . ASP A 77  ? 0.6260 0.4087 0.4856 -0.0387 0.0204  -0.0210 373 ASP A N   
1033 C CA  . ASP A 77  ? 0.5728 0.3769 0.4425 -0.0289 0.0351  -0.0231 373 ASP A CA  
1034 C C   . ASP A 77  ? 0.5322 0.3779 0.4209 -0.0225 0.0193  -0.0022 373 ASP A C   
1035 O O   . ASP A 77  ? 0.5149 0.3862 0.4337 -0.0108 0.0267  0.0015  373 ASP A O   
1036 C CB  . ASP A 77  ? 0.6220 0.4017 0.4403 -0.0412 0.0485  -0.0374 373 ASP A CB  
1037 C CG  . ASP A 77  ? 0.6758 0.4208 0.4806 -0.0456 0.0737  -0.0633 373 ASP A CG  
1038 O OD1 . ASP A 77  ? 0.6653 0.4083 0.5094 -0.0337 0.0824  -0.0711 373 ASP A OD1 
1039 O OD2 . ASP A 77  ? 0.7466 0.4653 0.5006 -0.0611 0.0848  -0.0764 373 ASP A OD2 
1044 N N   . GLN A 78  ? 0.5484 0.4029 0.4208 -0.0306 -0.0020 0.0103  374 GLN A N   
1045 C CA  . GLN A 78  ? 0.5127 0.4076 0.4051 -0.0238 -0.0155 0.0272  374 GLN A CA  
1046 C C   . GLN A 78  ? 0.4676 0.3897 0.4069 -0.0150 -0.0178 0.0374  374 GLN A C   
1047 O O   . GLN A 78  ? 0.4259 0.3780 0.3866 -0.0061 -0.0168 0.0451  374 GLN A O   
1048 C CB  . GLN A 78  ? 0.5239 0.4279 0.3993 -0.0333 -0.0380 0.0366  374 GLN A CB  
1049 C CG  . GLN A 78  ? 0.5335 0.4155 0.3623 -0.0411 -0.0423 0.0316  374 GLN A CG  
1050 C CD  . GLN A 78  ? 0.5753 0.4750 0.3971 -0.0473 -0.0679 0.0422  374 GLN A CD  
1051 O OE1 . GLN A 78  ? 0.5488 0.4693 0.3930 -0.0520 -0.0798 0.0494  374 GLN A OE1 
1052 N NE2 . GLN A 78  ? 0.6474 0.5393 0.4389 -0.0481 -0.0773 0.0437  374 GLN A NE2 
1061 N N   . MET A 79  ? 0.4918 0.4001 0.4439 -0.0188 -0.0220 0.0382  375 MET A N   
1062 C CA  . MET A 79  ? 0.4992 0.4271 0.4906 -0.0129 -0.0274 0.0503  375 MET A CA  
1063 C C   . MET A 79  ? 0.4920 0.4252 0.5111 0.0018  -0.0123 0.0455  375 MET A C   
1064 O O   . MET A 79  ? 0.4600 0.4237 0.5060 0.0078  -0.0164 0.0573  375 MET A O   
1065 C CB  . MET A 79  ? 0.5870 0.4889 0.5807 -0.0213 -0.0365 0.0522  375 MET A CB  
1066 C CG  . MET A 79  ? 0.6475 0.5559 0.6239 -0.0388 -0.0547 0.0614  375 MET A CG  
1067 S SD  . MET A 79  ? 0.6705 0.5461 0.6488 -0.0521 -0.0666 0.0664  375 MET A SD  
1068 C CE  . MET A 79  ? 0.6111 0.5120 0.6301 -0.0450 -0.0732 0.0854  375 MET A CE  
1078 N N   . LYS A 80  ? 0.4853 0.3914 0.4989 0.0063  0.0055  0.0273  376 LYS A N   
1079 C CA  . LYS A 80  ? 0.4994 0.4159 0.5459 0.0201  0.0202  0.0210  376 LYS A CA  
1080 C C   . LYS A 80  ? 0.4349 0.3844 0.4839 0.0229  0.0245  0.0261  376 LYS A C   
1081 O O   . LYS A 80  ? 0.4466 0.4230 0.5291 0.0309  0.0229  0.0345  376 LYS A O   
1082 C CB  . LYS A 80  ? 0.5841 0.4710 0.6225 0.0227  0.0427  -0.0034 376 LYS A CB  
1083 C CG  . LYS A 80  ? 0.7204 0.5649 0.7402 0.0165  0.0422  -0.0143 376 LYS A CG  
1084 C CD  . LYS A 80  ? 0.8183 0.6548 0.8641 0.0198  0.0237  -0.0011 376 LYS A CD  
1085 C CE  . LYS A 80  ? 0.9271 0.7149 0.9514 0.0127  0.0246  -0.0143 376 LYS A CE  
1086 N NZ  . LYS A 80  ? 0.9572 0.7354 0.9705 -0.0004 0.0003  0.0031  376 LYS A NZ  
1100 N N   . LEU A 81  ? 0.4403 0.3848 0.4514 0.0155  0.0286  0.0213  377 LEU A N   
1101 C CA  . LEU A 81  ? 0.4115 0.3787 0.4194 0.0174  0.0329  0.0248  377 LEU A CA  
1102 C C   . LEU A 81  ? 0.3684 0.3692 0.3969 0.0204  0.0169  0.0431  377 LEU A C   
1103 O O   . LEU A 81  ? 0.4012 0.4260 0.4510 0.0255  0.0203  0.0475  377 LEU A O   
1104 C CB  . LEU A 81  ? 0.4366 0.3849 0.3958 0.0084  0.0347  0.0194  377 LEU A CB  
1105 C CG  . LEU A 81  ? 0.4943 0.4087 0.4222 0.0006  0.0534  0.0003  377 LEU A CG  
1106 C CD1 . LEU A 81  ? 0.5465 0.4409 0.4216 -0.0102 0.0493  0.0002  377 LEU A CD1 
1107 C CD2 . LEU A 81  ? 0.4717 0.3947 0.4216 0.0049  0.0768  -0.0121 377 LEU A CD2 
1119 N N   . LEU A 82  ? 0.4005 0.4052 0.4224 0.0152  -0.0001 0.0531  378 LEU A N   
1120 C CA  . LEU A 82  ? 0.3372 0.3760 0.3757 0.0155  -0.0126 0.0680  378 LEU A CA  
1121 C C   . LEU A 82  ? 0.3871 0.4406 0.4610 0.0180  -0.0161 0.0774  378 LEU A C   
1122 O O   . LEU A 82  ? 0.3616 0.4432 0.4506 0.0193  -0.0188 0.0861  378 LEU A O   
1123 C CB  . LEU A 82  ? 0.3819 0.4259 0.4080 0.0073  -0.0282 0.0744  378 LEU A CB  
1124 C CG  . LEU A 82  ? 0.3884 0.4312 0.3865 0.0071  -0.0318 0.0707  378 LEU A CG  
1125 C CD1 . LEU A 82  ? 0.4132 0.4616 0.4042 -0.0017 -0.0479 0.0752  378 LEU A CD1 
1126 C CD2 . LEU A 82  ? 0.3749 0.4445 0.3793 0.0144  -0.0310 0.0743  378 LEU A CD2 
1138 N N   . GLN A 83  ? 0.4130 0.4449 0.4987 0.0183  -0.0175 0.0759  379 GLN A N   
1139 C CA  . GLN A 83  ? 0.4009 0.4411 0.5201 0.0221  -0.0242 0.0863  379 GLN A CA  
1140 C C   . GLN A 83  ? 0.3687 0.4241 0.5115 0.0323  -0.0135 0.0823  379 GLN A C   
1141 O O   . GLN A 83  ? 0.3666 0.4414 0.5357 0.0343  -0.0220 0.0945  379 GLN A O   
1142 C CB  . GLN A 83  ? 0.4447 0.4508 0.5712 0.0230  -0.0281 0.0834  379 GLN A CB  
1143 C CG  . GLN A 83  ? 0.5051 0.4985 0.6127 0.0090  -0.0426 0.0914  379 GLN A CG  
1144 C CD  . GLN A 83  ? 0.5902 0.5404 0.6973 0.0088  -0.0446 0.0852  379 GLN A CD  
1145 O OE1 . GLN A 83  ? 0.6197 0.5473 0.7353 0.0203  -0.0312 0.0695  379 GLN A OE1 
1146 N NE2 . GLN A 83  ? 0.6426 0.5808 0.7395 -0.0053 -0.0603 0.0961  379 GLN A NE2 
1155 N N   . ASN A 84  ? 0.4103 0.4581 0.5424 0.0363  0.0043  0.0661  380 ASN A N   
1156 C CA  . ASN A 84  ? 0.3744 0.4383 0.5301 0.0435  0.0166  0.0600  380 ASN A CA  
1157 C C   . ASN A 84  ? 0.3973 0.4894 0.5466 0.0397  0.0167  0.0664  380 ASN A C   
1158 O O   . ASN A 84  ? 0.4176 0.5306 0.5917 0.0428  0.0206  0.0672  380 ASN A O   
1159 C CB  . ASN A 84  ? 0.4001 0.4438 0.5440 0.0453  0.0384  0.0383  380 ASN A CB  
1160 C CG  . ASN A 84  ? 0.4423 0.5076 0.6085 0.0492  0.0537  0.0300  380 ASN A CG  
1161 O OD1 . ASN A 84  ? 0.4543 0.5332 0.6640 0.0588  0.0550  0.0285  380 ASN A OD1 
1162 N ND2 . ASN A 84  ? 0.4614 0.5296 0.5984 0.0412  0.0643  0.0249  380 ASN A ND2 
1169 N N   . CYS A 85  ? 0.3734 0.4666 0.4919 0.0333  0.0119  0.0701  381 CYS A N   
1170 C CA  . CYS A 85  ? 0.3762 0.4870 0.4827 0.0308  0.0150  0.0715  381 CYS A CA  
1171 C C   . CYS A 85  ? 0.3460 0.4758 0.4460 0.0269  0.0018  0.0833  381 CYS A C   
1172 O O   . CYS A 85  ? 0.3435 0.4842 0.4312 0.0258  0.0043  0.0827  381 CYS A O   
1173 C CB  . CYS A 85  ? 0.3623 0.4510 0.4331 0.0288  0.0271  0.0589  381 CYS A CB  
1174 S SG  . CYS A 85  ? 0.4495 0.5198 0.4840 0.0263  0.0162  0.0599  381 CYS A SG  
1180 N N   . TRP A 86  ? 0.3503 0.4840 0.4575 0.0235  -0.0110 0.0927  382 TRP A N   
1181 C CA  . TRP A 86  ? 0.3053 0.4604 0.4053 0.0178  -0.0203 0.1006  382 TRP A CA  
1182 C C   . TRP A 86  ? 0.2564 0.4386 0.3645 0.0150  -0.0201 0.1063  382 TRP A C   
1183 O O   . TRP A 86  ? 0.3177 0.5133 0.4128 0.0145  -0.0184 0.1037  382 TRP A O   
1184 C CB  . TRP A 86  ? 0.3059 0.4629 0.4136 0.0101  -0.0332 0.1106  382 TRP A CB  
1185 C CG  . TRP A 86  ? 0.3118 0.4717 0.4425 0.0067  -0.0408 0.1225  382 TRP A CG  
1186 C CD1 . TRP A 86  ? 0.3579 0.4950 0.5045 0.0120  -0.0420 0.1222  382 TRP A CD1 
1187 C CD2 . TRP A 86  ? 0.3307 0.5158 0.4701 -0.0028 -0.0498 0.1365  382 TRP A CD2 
1188 N NE1 . TRP A 86  ? 0.3445 0.4898 0.5115 0.0083  -0.0540 0.1370  382 TRP A NE1 
1189 C CE2 . TRP A 86  ? 0.3166 0.4906 0.4763 -0.0028 -0.0594 0.1468  382 TRP A CE2 
1190 C CE3 . TRP A 86  ? 0.2958 0.5106 0.4266 -0.0117 -0.0506 0.1404  382 TRP A CE3 
1191 C CZ2 . TRP A 86  ? 0.3405 0.5303 0.5082 -0.0134 -0.0723 0.1637  382 TRP A CZ2 
1192 C CZ3 . TRP A 86  ? 0.2902 0.5223 0.4272 -0.0239 -0.0598 0.1548  382 TRP A CZ3 
1193 C CH2 . TRP A 86  ? 0.3182 0.5369 0.4715 -0.0256 -0.0719 0.1676  382 TRP A CH2 
1204 N N   . SER A 87  ? 0.3458 0.5356 0.4754 0.0135  -0.0225 0.1134  383 SER A N   
1205 C CA  . SER A 87  ? 0.2694 0.4841 0.4031 0.0075  -0.0240 0.1194  383 SER A CA  
1206 C C   . SER A 87  ? 0.2999 0.5133 0.4223 0.0109  -0.0113 0.1084  383 SER A C   
1207 O O   . SER A 87  ? 0.2759 0.5040 0.3871 0.0061  -0.0097 0.1081  383 SER A O   
1208 C CB  . SER A 87  ? 0.3427 0.5654 0.5028 0.0041  -0.0343 0.1322  383 SER A CB  
1209 O OG  . SER A 87  ? 0.3334 0.5441 0.5139 0.0139  -0.0288 0.1260  383 SER A OG  
1215 N N   . GLU A 88  ? 0.2749 0.4692 0.3970 0.0174  -0.0011 0.0984  384 GLU A N   
1216 C CA  . GLU A 88  ? 0.2620 0.4505 0.3676 0.0171  0.0112  0.0883  384 GLU A CA  
1217 C C   . GLU A 88  ? 0.3209 0.4977 0.3943 0.0187  0.0126  0.0828  384 GLU A C   
1218 O O   . GLU A 88  ? 0.3207 0.4994 0.3790 0.0163  0.0165  0.0794  384 GLU A O   
1219 C CB  . GLU A 88  ? 0.3296 0.5004 0.4389 0.0204  0.0235  0.0778  384 GLU A CB  
1220 C CG  . GLU A 88  ? 0.4133 0.5822 0.5106 0.0151  0.0365  0.0692  384 GLU A CG  
1221 C CD  . GLU A 88  ? 0.4798 0.6394 0.5860 0.0153  0.0512  0.0578  384 GLU A CD  
1222 O OE1 . GLU A 88  ? 0.5158 0.6697 0.6398 0.0216  0.0515  0.0555  384 GLU A OE1 
1223 O OE2 . GLU A 88  ? 0.4412 0.5987 0.5357 0.0077  0.0636  0.0499  384 GLU A OE2 
1230 N N   . LEU A 89  ? 0.2929 0.4570 0.3564 0.0231  0.0079  0.0817  385 LEU A N   
1231 C CA  . LEU A 89  ? 0.3497 0.5067 0.3897 0.0274  0.0055  0.0775  385 LEU A CA  
1232 C C   . LEU A 89  ? 0.3003 0.4855 0.3467 0.0257  0.0006  0.0813  385 LEU A C   
1233 O O   . LEU A 89  ? 0.3080 0.4909 0.3392 0.0301  0.0026  0.0752  385 LEU A O   
1234 C CB  . LEU A 89  ? 0.2985 0.4420 0.3313 0.0308  -0.0014 0.0768  385 LEU A CB  
1235 C CG  . LEU A 89  ? 0.3567 0.4666 0.3716 0.0310  0.0043  0.0699  385 LEU A CG  
1236 C CD1 . LEU A 89  ? 0.3129 0.4127 0.3203 0.0313  -0.0053 0.0705  385 LEU A CD1 
1237 C CD2 . LEU A 89  ? 0.3343 0.4194 0.3180 0.0319  0.0111  0.0626  385 LEU A CD2 
1249 N N   . LEU A 90  ? 0.3193 0.5289 0.3862 0.0186  -0.0054 0.0908  386 LEU A N   
1250 C CA  . LEU A 90  ? 0.2784 0.5167 0.3483 0.0128  -0.0077 0.0935  386 LEU A CA  
1251 C C   . LEU A 90  ? 0.3221 0.5644 0.3835 0.0093  -0.0007 0.0898  386 LEU A C   
1252 O O   . LEU A 90  ? 0.3030 0.5534 0.3534 0.0106  0.0030  0.0826  386 LEU A O   
1253 C CB  . LEU A 90  ? 0.3457 0.6033 0.4331 0.0014  -0.0165 0.1066  386 LEU A CB  
1254 C CG  . LEU A 90  ? 0.4026 0.6908 0.4911 -0.0090 -0.0197 0.1103  386 LEU A CG  
1255 C CD1 . LEU A 90  ? 0.3721 0.6677 0.4598 -0.0035 -0.0206 0.1036  386 LEU A CD1 
1256 C CD2 . LEU A 90  ? 0.4397 0.7368 0.5393 -0.0237 -0.0300 0.1264  386 LEU A CD2 
1268 N N   . ILE A 91  ? 0.2560 0.4929 0.3237 0.0049  0.0014  0.0930  387 ILE A N   
1269 C CA  . ILE A 91  ? 0.3097 0.5510 0.3691 -0.0019 0.0068  0.0901  387 ILE A CA  
1270 C C   . ILE A 91  ? 0.3023 0.5171 0.3365 0.0046  0.0161  0.0775  387 ILE A C   
1271 O O   . ILE A 91  ? 0.3191 0.5330 0.3367 0.0017  0.0204  0.0712  387 ILE A O   
1272 C CB  . ILE A 91  ? 0.2963 0.5447 0.3758 -0.0087 0.0045  0.0976  387 ILE A CB  
1273 C CG1 . ILE A 91  ? 0.3301 0.5982 0.4321 -0.0147 -0.0086 0.1126  387 ILE A CG1 
1274 C CG2 . ILE A 91  ? 0.3130 0.5677 0.3833 -0.0187 0.0090  0.0947  387 ILE A CG2 
1275 C CD1 . ILE A 91  ? 0.3780 0.6681 0.4710 -0.0273 -0.0142 0.1188  387 ILE A CD1 
1287 N N   . LEU A 92  ? 0.3124 0.5016 0.3397 0.0119  0.0190  0.0734  388 LEU A N   
1288 C CA  . LEU A 92  ? 0.3254 0.4829 0.3228 0.0161  0.0252  0.0637  388 LEU A CA  
1289 C C   . LEU A 92  ? 0.3504 0.5037 0.3339 0.0258  0.0213  0.0584  388 LEU A C   
1290 O O   . LEU A 92  ? 0.3471 0.4838 0.3094 0.0271  0.0250  0.0511  388 LEU A O   
1291 C CB  . LEU A 92  ? 0.3221 0.4524 0.3099 0.0195  0.0279  0.0613  388 LEU A CB  
1292 C CG  . LEU A 92  ? 0.3335 0.4238 0.2837 0.0217  0.0314  0.0539  388 LEU A CG  
1293 C CD1 . LEU A 92  ? 0.3807 0.4608 0.3144 0.0114  0.0402  0.0496  388 LEU A CD1 
1294 C CD2 . LEU A 92  ? 0.3408 0.4068 0.2790 0.0205  0.0346  0.0520  388 LEU A CD2 
1306 N N   . ASP A 93  ? 0.3432 0.5117 0.3403 0.0328  0.0138  0.0610  389 ASP A N   
1307 C CA  . ASP A 93  ? 0.3503 0.5248 0.3443 0.0434  0.0102  0.0546  389 ASP A CA  
1308 C C   . ASP A 93  ? 0.2969 0.4924 0.2922 0.0385  0.0159  0.0497  389 ASP A C   
1309 O O   . ASP A 93  ? 0.3740 0.5580 0.3561 0.0473  0.0185  0.0391  389 ASP A O   
1310 C CB  . ASP A 93  ? 0.3750 0.5723 0.3892 0.0469  0.0017  0.0590  389 ASP A CB  
1311 C CG  . ASP A 93  ? 0.4414 0.6544 0.4616 0.0587  -0.0018 0.0510  389 ASP A CG  
1312 O OD1 . ASP A 93  ? 0.4599 0.6473 0.4656 0.0727  -0.0053 0.0442  389 ASP A OD1 
1313 O OD2 . ASP A 93  ? 0.4553 0.7067 0.4954 0.0537  -0.0014 0.0515  389 ASP A OD2 
1318 N N   . HIS A 94  ? 0.3292 0.5525 0.3383 0.0241  0.0171  0.0571  390 HIS A N   
1319 C CA  . HIS A 94  ? 0.2785 0.5209 0.2832 0.0144  0.0227  0.0529  390 HIS A CA  
1320 C C   . HIS A 94  ? 0.3476 0.5630 0.3280 0.0122  0.0295  0.0450  390 HIS A C   
1321 O O   . HIS A 94  ? 0.3140 0.5259 0.2803 0.0143  0.0354  0.0333  390 HIS A O   
1322 C CB  . HIS A 94  ? 0.2859 0.5562 0.3049 -0.0034 0.0187  0.0660  390 HIS A CB  
1323 C CG  . HIS A 94  ? 0.2449 0.5299 0.2527 -0.0188 0.0232  0.0640  390 HIS A CG  
1324 N ND1 . HIS A 94  ? 0.3099 0.6166 0.3120 -0.0234 0.0287  0.0559  390 HIS A ND1 
1325 C CD2 . HIS A 94  ? 0.2669 0.5494 0.2673 -0.0323 0.0230  0.0681  390 HIS A CD2 
1326 C CE1 . HIS A 94  ? 0.2677 0.5809 0.2547 -0.0402 0.0320  0.0551  390 HIS A CE1 
1327 N NE2 . HIS A 94  ? 0.3161 0.6153 0.3024 -0.0459 0.0272  0.0634  390 HIS A NE2 
1335 N N   . ILE A 95  ? 0.3086 0.5047 0.2840 0.0070  0.0299  0.0499  391 ILE A N   
1336 C CA  . ILE A 95  ? 0.3736 0.5450 0.3250 -0.0000 0.0364  0.0435  391 ILE A CA  
1337 C C   . ILE A 95  ? 0.3497 0.4827 0.2746 0.0137  0.0385  0.0319  391 ILE A C   
1338 O O   . ILE A 95  ? 0.3865 0.5041 0.2906 0.0119  0.0434  0.0221  391 ILE A O   
1339 C CB  . ILE A 95  ? 0.3285 0.4927 0.2847 -0.0090 0.0377  0.0501  391 ILE A CB  
1340 C CG1 . ILE A 95  ? 0.3247 0.5252 0.3066 -0.0229 0.0337  0.0606  391 ILE A CG1 
1341 C CG2 . ILE A 95  ? 0.4126 0.5438 0.3392 -0.0163 0.0451  0.0426  391 ILE A CG2 
1342 C CD1 . ILE A 95  ? 0.3086 0.5125 0.3095 -0.0277 0.0342  0.0664  391 ILE A CD1 
1354 N N   . TYR A 96  ? 0.3976 0.5113 0.3212 0.0274  0.0333  0.0330  392 TYR A N   
1355 C CA  . TYR A 96  ? 0.4133 0.4867 0.3113 0.0415  0.0309  0.0245  392 TYR A CA  
1356 C C   . TYR A 96  ? 0.3848 0.4705 0.2896 0.0551  0.0302  0.0139  392 TYR A C   
1357 O O   . TYR A 96  ? 0.4272 0.4802 0.3101 0.0642  0.0308  0.0037  392 TYR A O   
1358 C CB  . TYR A 96  ? 0.3893 0.4420 0.2836 0.0517  0.0224  0.0293  392 TYR A CB  
1359 C CG  . TYR A 96  ? 0.4667 0.4742 0.3333 0.0665  0.0151  0.0235  392 TYR A CG  
1360 C CD1 . TYR A 96  ? 0.4994 0.4594 0.3279 0.0597  0.0182  0.0206  392 TYR A CD1 
1361 C CD2 . TYR A 96  ? 0.4573 0.4689 0.3361 0.0866  0.0034  0.0217  392 TYR A CD2 
1362 C CE1 . TYR A 96  ? 0.5250 0.4367 0.3250 0.0733  0.0084  0.0172  392 TYR A CE1 
1363 C CE2 . TYR A 96  ? 0.4781 0.4468 0.3340 0.1022  -0.0071 0.0178  392 TYR A CE2 
1364 C CZ  . TYR A 96  ? 0.5415 0.4572 0.3563 0.0959  -0.0052 0.0162  392 TYR A CZ  
1365 O OH  . TYR A 96  ? 0.6318 0.4979 0.4207 0.1115  -0.0186 0.0142  392 TYR A OH  
1375 N N   . ARG A 97  ? 0.4462 0.5778 0.3807 0.0562  0.0297  0.0153  393 ARG A N   
1376 C CA  . ARG A 97  ? 0.3633 0.5153 0.3084 0.0671  0.0328  0.0026  393 ARG A CA  
1377 C C   . ARG A 97  ? 0.4161 0.5612 0.3421 0.0578  0.0437  -0.0086 393 ARG A C   
1378 O O   . ARG A 97  ? 0.3771 0.5104 0.2969 0.0713  0.0477  -0.0243 393 ARG A O   
1379 C CB  . ARG A 97  ? 0.4389 0.6442 0.4158 0.0623  0.0323  0.0071  393 ARG A CB  
1380 C CG  . ARG A 97  ? 0.4421 0.6784 0.4345 0.0710  0.0387  -0.0079 393 ARG A CG  
1381 C CD  . ARG A 97  ? 0.4015 0.6888 0.4239 0.0647  0.0371  -0.0024 393 ARG A CD  
1382 N NE  . ARG A 97  ? 0.4126 0.6966 0.4492 0.0746  0.0241  0.0069  393 ARG A NE  
1383 C CZ  . ARG A 97  ? 0.4168 0.7038 0.4578 0.0629  0.0173  0.0228  393 ARG A CZ  
1384 N NH1 . ARG A 97  ? 0.3719 0.6672 0.4091 0.0428  0.0202  0.0331  393 ARG A NH1 
1385 N NH2 . ARG A 97  ? 0.4475 0.7279 0.4971 0.0719  0.0061  0.0282  393 ARG A NH2 
1399 N N   . GLN A 98  ? 0.4127 0.5646 0.3301 0.0351  0.0480  -0.0014 394 GLN A N   
1400 C CA  . GLN A 98  ? 0.4227 0.5651 0.3170 0.0222  0.0571  -0.0113 394 GLN A CA  
1401 C C   . GLN A 98  ? 0.4691 0.5548 0.3305 0.0275  0.0579  -0.0188 394 GLN A C   
1402 O O   . GLN A 98  ? 0.4835 0.5482 0.3241 0.0291  0.0645  -0.0339 394 GLN A O   
1403 C CB  . GLN A 98  ? 0.4014 0.5670 0.2966 -0.0044 0.0576  0.0004  394 GLN A CB  
1404 C CG  . GLN A 98  ? 0.3386 0.5510 0.2624 -0.0120 0.0528  0.0131  394 GLN A CG  
1405 C CD  . GLN A 98  ? 0.3640 0.6059 0.2991 -0.0061 0.0574  0.0039  394 GLN A CD  
1406 O OE1 . GLN A 98  ? 0.3361 0.5806 0.2570 -0.0091 0.0673  -0.0113 394 GLN A OE1 
1407 N NE2 . GLN A 98  ? 0.3572 0.6226 0.3179 0.0011  0.0515  0.0117  394 GLN A NE2 
1416 N N   . VAL A 99  ? 0.4498 0.5075 0.3028 0.0282  0.0517  -0.0091 395 VAL A N   
1417 C CA  . VAL A 99  ? 0.5206 0.5204 0.3366 0.0285  0.0516  -0.0138 395 VAL A CA  
1418 C C   . VAL A 99  ? 0.5688 0.5359 0.3741 0.0532  0.0480  -0.0271 395 VAL A C   
1419 O O   . VAL A 99  ? 0.6141 0.5413 0.3898 0.0532  0.0515  -0.0385 395 VAL A O   
1420 C CB  . VAL A 99  ? 0.5139 0.4929 0.3227 0.0242  0.0466  -0.0015 395 VAL A CB  
1421 C CG1 . VAL A 99  ? 0.5575 0.4716 0.3226 0.0237  0.0450  -0.0052 395 VAL A CG1 
1422 C CG2 . VAL A 99  ? 0.4764 0.4858 0.2984 0.0010  0.0516  0.0082  395 VAL A CG2 
1432 N N   . VAL A 100 ? 0.5583 0.5415 0.3890 0.0750  0.0399  -0.0261 396 VAL A N   
1433 C CA  . VAL A 100 ? 0.5964 0.5538 0.4264 0.1027  0.0330  -0.0378 396 VAL A CA  
1434 C C   . VAL A 100 ? 0.6822 0.6674 0.5280 0.1101  0.0438  -0.0564 396 VAL A C   
1435 O O   . VAL A 100 ? 0.7095 0.6594 0.5319 0.1140  0.0491  -0.0711 396 VAL A O   
1436 C CB  . VAL A 100 ? 0.5492 0.5204 0.4045 0.1216  0.0190  -0.0300 396 VAL A CB  
1437 C CG1 . VAL A 100 ? 0.6367 0.5928 0.5025 0.1530  0.0098  -0.0426 396 VAL A CG1 
1438 C CG2 . VAL A 100 ? 0.5514 0.4860 0.3823 0.1137  0.0095  -0.0146 396 VAL A CG2 
1448 N N   . HIS A 101 ? 0.7580 0.8047 0.6411 0.1104  0.0479  -0.0570 397 HIS A N   
1449 C CA  . HIS A 101 ? 0.8321 0.9131 0.7339 0.1174  0.0598  -0.0762 397 HIS A CA  
1450 C C   . HIS A 101 ? 0.8926 0.9922 0.7789 0.0900  0.0752  -0.0812 397 HIS A C   
1451 O O   . HIS A 101 ? 0.9138 1.0372 0.8069 0.0914  0.0882  -0.0996 397 HIS A O   
1452 C CB  . HIS A 101 ? 0.8203 0.9614 0.7670 0.1259  0.0578  -0.0745 397 HIS A CB  
1453 C CG  . HIS A 101 ? 0.8586 0.9902 0.8227 0.1480  0.0401  -0.0663 397 HIS A CG  
1454 N ND1 . HIS A 101 ? 0.8922 1.0064 0.8687 0.1789  0.0320  -0.0788 397 HIS A ND1 
1455 C CD2 . HIS A 101 ? 0.8488 0.9852 0.8195 0.1433  0.0279  -0.0473 397 HIS A CD2 
1456 C CE1 . HIS A 101 ? 0.8955 1.0051 0.8837 0.1906  0.0138  -0.0660 397 HIS A CE1 
1457 N NE2 . HIS A 101 ? 0.8697 0.9918 0.8526 0.1684  0.0123  -0.0477 397 HIS A NE2 
1465 N N   . GLY A 102 ? 0.8922 0.8691 0.9121 -0.0134 -0.0933 -0.0025 398 GLY A N   
1466 C CA  . GLY A 102 ? 0.9016 0.8708 0.9099 -0.0285 -0.0910 -0.0070 398 GLY A CA  
1467 C C   . GLY A 102 ? 0.9698 0.8772 0.9529 -0.0384 -0.1154 -0.0080 398 GLY A C   
1468 O O   . GLY A 102 ? 1.0184 0.8879 0.9941 -0.0432 -0.1371 0.0057  398 GLY A O   
1472 N N   . LYS A 103 ? 0.9918 0.8846 0.9573 -0.0422 -0.1135 -0.0246 399 LYS A N   
1473 C CA  . LYS A 103 ? 1.0062 0.8371 0.9410 -0.0538 -0.1384 -0.0293 399 LYS A CA  
1474 C C   . LYS A 103 ? 0.9889 0.8330 0.9163 -0.0792 -0.1396 -0.0202 399 LYS A C   
1475 O O   . LYS A 103 ? 0.8912 0.7882 0.8347 -0.0814 -0.1188 -0.0154 399 LYS A O   
1476 C CB  . LYS A 103 ? 1.0085 0.7984 0.9181 -0.0254 -0.1385 -0.0667 399 LYS A CB  
1477 C CG  . LYS A 103 ? 0.9999 0.7690 0.9164 0.0025  -0.1443 -0.0766 399 LYS A CG  
1478 C CD  . LYS A 103 ? 1.0359 0.7712 0.9295 0.0353  -0.1425 -0.1154 399 LYS A CD  
1479 C CE  . LYS A 103 ? 1.0584 0.7746 0.9628 0.0670  -0.1511 -0.1250 399 LYS A CE  
1480 N NZ  . LYS A 103 ? 1.1028 0.7944 0.9888 0.1053  -0.1469 -0.1646 399 LYS A NZ  
1494 N N   . GLU A 104 ? 1.0700 0.8614 0.9718 -0.0983 -0.1676 -0.0176 400 GLU A N   
1495 C CA  . GLU A 104 ? 1.0556 0.8556 0.9488 -0.1230 -0.1749 -0.0095 400 GLU A CA  
1496 C C   . GLU A 104 ? 0.9535 0.7638 0.8256 -0.1067 -0.1553 -0.0373 400 GLU A C   
1497 O O   . GLU A 104 ? 0.9916 0.7647 0.8333 -0.0847 -0.1530 -0.0684 400 GLU A O   
1498 C CB  . GLU A 104 ? 1.2094 0.9421 1.0752 -0.1474 -0.2140 -0.0048 400 GLU A CB  
1499 C CG  . GLU A 104 ? 1.2651 1.0106 1.1579 -0.1832 -0.2343 0.0371  400 GLU A CG  
1500 C CD  . GLU A 104 ? 1.3207 1.0384 1.2205 -0.1809 -0.2445 0.0506  400 GLU A CD  
1501 O OE1 . GLU A 104 ? 1.3886 1.0773 1.2904 -0.2125 -0.2735 0.0782  400 GLU A OE1 
1502 O OE2 . GLU A 104 ? 1.3008 1.0255 1.2043 -0.1492 -0.2254 0.0357  400 GLU A OE2 
1509 N N   . GLY A 105 ? 0.8204 0.6822 0.7074 -0.1161 -0.1408 -0.0252 401 GLY A N   
1510 C CA  . GLY A 105 ? 0.7528 0.6230 0.6164 -0.1071 -0.1248 -0.0445 401 GLY A CA  
1511 C C   . GLY A 105 ? 0.6022 0.5007 0.4737 -0.0802 -0.0926 -0.0630 401 GLY A C   
1512 O O   . GLY A 105 ? 0.5676 0.4658 0.4135 -0.0711 -0.0785 -0.0818 401 GLY A O   
1516 N N   . SER A 106 ? 0.5579 0.4827 0.4632 -0.0690 -0.0814 -0.0570 402 SER A N   
1517 C CA  . SER A 106 ? 0.5094 0.4672 0.4301 -0.0478 -0.0541 -0.0713 402 SER A CA  
1518 C C   . SER A 106 ? 0.4622 0.4679 0.4197 -0.0510 -0.0431 -0.0514 402 SER A C   
1519 O O   . SER A 106 ? 0.4677 0.4821 0.4397 -0.0637 -0.0545 -0.0283 402 SER A O   
1520 C CB  . SER A 106 ? 0.5641 0.5015 0.4862 -0.0235 -0.0541 -0.0914 402 SER A CB  
1521 O OG  . SER A 106 ? 0.6867 0.5725 0.5706 -0.0155 -0.0666 -0.1127 402 SER A OG  
1527 N N   . ILE A 107 ? 0.4305 0.4680 0.4018 -0.0396 -0.0209 -0.0606 403 ILE A N   
1528 C CA  . ILE A 107 ? 0.4266 0.5016 0.4280 -0.0374 -0.0116 -0.0490 403 ILE A CA  
1529 C C   . ILE A 107 ? 0.4203 0.5088 0.4397 -0.0190 -0.0012 -0.0650 403 ILE A C   
1530 O O   . ILE A 107 ? 0.4274 0.5204 0.4429 -0.0107 0.0117  -0.0833 403 ILE A O   
1531 C CB  . ILE A 107 ? 0.4706 0.5692 0.4726 -0.0455 0.0002  -0.0419 403 ILE A CB  
1532 C CG1 . ILE A 107 ? 0.5067 0.6011 0.4990 -0.0611 -0.0127 -0.0231 403 ILE A CG1 
1533 C CG2 . ILE A 107 ? 0.4347 0.5631 0.4620 -0.0389 0.0093  -0.0374 403 ILE A CG2 
1534 C CD1 . ILE A 107 ? 0.4749 0.5847 0.4870 -0.0649 -0.0231 -0.0021 403 ILE A CD1 
1546 N N   . PHE A 108 ? 0.3379 0.4371 0.3771 -0.0126 -0.0068 -0.0572 404 PHE A N   
1547 C CA  . PHE A 108 ? 0.3527 0.4688 0.4132 0.0042  -0.0016 -0.0700 404 PHE A CA  
1548 C C   . PHE A 108 ? 0.2883 0.4381 0.3673 0.0020  0.0078  -0.0656 404 PHE A C   
1549 O O   . PHE A 108 ? 0.3600 0.5157 0.4380 -0.0035 0.0035  -0.0500 404 PHE A O   
1550 C CB  . PHE A 108 ? 0.4184 0.5163 0.4821 0.0143  -0.0188 -0.0652 404 PHE A CB  
1551 C CG  . PHE A 108 ? 0.6068 0.6639 0.6535 0.0226  -0.0303 -0.0763 404 PHE A CG  
1552 C CD1 . PHE A 108 ? 0.7055 0.7270 0.7259 0.0083  -0.0415 -0.0698 404 PHE A CD1 
1553 C CD2 . PHE A 108 ? 0.6617 0.7147 0.7186 0.0462  -0.0323 -0.0944 404 PHE A CD2 
1554 C CE1 . PHE A 108 ? 0.7684 0.7420 0.7668 0.0167  -0.0558 -0.0828 404 PHE A CE1 
1555 C CE2 . PHE A 108 ? 0.7384 0.7470 0.7754 0.0589  -0.0445 -0.1076 404 PHE A CE2 
1556 C CZ  . PHE A 108 ? 0.7751 0.7396 0.7799 0.0438  -0.0568 -0.1027 404 PHE A CZ  
1566 N N   . LEU A 109 ? 0.2746 0.4467 0.3697 0.0063  0.0201  -0.0795 405 LEU A N   
1567 C CA  . LEU A 109 ? 0.2958 0.4918 0.4062 0.0012  0.0260  -0.0777 405 LEU A CA  
1568 C C   . LEU A 109 ? 0.2844 0.4975 0.4185 0.0131  0.0183  -0.0834 405 LEU A C   
1569 O O   . LEU A 109 ? 0.3140 0.5278 0.4585 0.0268  0.0126  -0.0915 405 LEU A O   
1570 C CB  . LEU A 109 ? 0.3087 0.5196 0.4231 -0.0085 0.0423  -0.0850 405 LEU A CB  
1571 C CG  . LEU A 109 ? 0.3687 0.5620 0.4544 -0.0195 0.0491  -0.0802 405 LEU A CG  
1572 C CD1 . LEU A 109 ? 0.3483 0.5588 0.4351 -0.0300 0.0666  -0.0845 405 LEU A CD1 
1573 C CD2 . LEU A 109 ? 0.3302 0.5087 0.4007 -0.0277 0.0408  -0.0634 405 LEU A CD2 
1585 N N   . VAL A 110 ? 0.3029 0.5266 0.4429 0.0093  0.0156  -0.0801 406 VAL A N   
1586 C CA  . VAL A 110 ? 0.3216 0.5601 0.4792 0.0188  0.0046  -0.0854 406 VAL A CA  
1587 C C   . VAL A 110 ? 0.3487 0.6141 0.5388 0.0230  0.0078  -0.0997 406 VAL A C   
1588 O O   . VAL A 110 ? 0.3701 0.6490 0.5783 0.0348  -0.0045 -0.1049 406 VAL A O   
1589 C CB  . VAL A 110 ? 0.3191 0.5581 0.4712 0.0131  0.0006  -0.0833 406 VAL A CB  
1590 C CG1 . VAL A 110 ? 0.3016 0.5466 0.4637 -0.0030 0.0100  -0.0879 406 VAL A CG1 
1591 C CG2 . VAL A 110 ? 0.3475 0.5961 0.5081 0.0235  -0.0152 -0.0887 406 VAL A CG2 
1601 N N   . THR A 111 ? 0.3690 0.6471 0.5672 0.0141  0.0242  -0.1052 407 THR A N   
1602 C CA  . THR A 111 ? 0.3886 0.7034 0.6209 0.0195  0.0320  -0.1178 407 THR A CA  
1603 C C   . THR A 111 ? 0.4042 0.7149 0.6375 0.0425  0.0304  -0.1268 407 THR A C   
1604 O O   . THR A 111 ? 0.3761 0.7217 0.6402 0.0543  0.0368  -0.1390 407 THR A O   
1605 C CB  . THR A 111 ? 0.4154 0.7480 0.6507 0.0021  0.0533  -0.1180 407 THR A CB  
1606 O OG1 . THR A 111 ? 0.3977 0.6993 0.5950 -0.0012 0.0616  -0.1132 407 THR A OG1 
1607 C CG2 . THR A 111 ? 0.4186 0.7557 0.6609 -0.0205 0.0512  -0.1104 407 THR A CG2 
1615 N N   . GLY A 112 ? 0.4186 0.6881 0.6206 0.0491  0.0211  -0.1208 408 GLY A N   
1616 C CA  . GLY A 112 ? 0.4167 0.6671 0.6121 0.0696  0.0157  -0.1294 408 GLY A CA  
1617 C C   . GLY A 112 ? 0.4217 0.6562 0.5938 0.0696  0.0296  -0.1377 408 GLY A C   
1618 O O   . GLY A 112 ? 0.4803 0.6875 0.6387 0.0876  0.0227  -0.1472 408 GLY A O   
1622 N N   . GLN A 113 ? 0.4039 0.6493 0.5664 0.0506  0.0466  -0.1347 409 GLN A N   
1623 C CA  . GLN A 113 ? 0.4678 0.6992 0.6017 0.0500  0.0598  -0.1426 409 GLN A CA  
1624 C C   . GLN A 113 ? 0.4290 0.6074 0.5226 0.0429  0.0453  -0.1336 409 GLN A C   
1625 O O   . GLN A 113 ? 0.4063 0.5721 0.4948 0.0288  0.0346  -0.1159 409 GLN A O   
1626 C CB  . GLN A 113 ? 0.5972 0.8556 0.7300 0.0297  0.0808  -0.1381 409 GLN A CB  
1627 C CG  . GLN A 113 ? 0.7087 1.0204 0.8847 0.0237  0.0918  -0.1384 409 GLN A CG  
1628 C CD  . GLN A 113 ? 0.7854 1.1091 0.9545 -0.0034 0.1062  -0.1265 409 GLN A CD  
1629 O OE1 . GLN A 113 ? 0.7771 1.1146 0.9674 -0.0192 0.1023  -0.1170 409 GLN A OE1 
1630 N NE2 . GLN A 113 ? 0.8367 1.1494 0.9714 -0.0089 0.1203  -0.1267 409 GLN A NE2 
1639 N N   . GLN A 114 ? 0.4424 0.5920 0.5075 0.0530  0.0449  -0.1466 410 GLN A N   
1640 C CA  . GLN A 114 ? 0.4812 0.5802 0.5072 0.0428  0.0292  -0.1396 410 GLN A CA  
1641 C C   . GLN A 114 ? 0.4745 0.5716 0.4690 0.0315  0.0432  -0.1438 410 GLN A C   
1642 O O   . GLN A 114 ? 0.5119 0.6168 0.4936 0.0456  0.0582  -0.1634 410 GLN A O   
1643 C CB  . GLN A 114 ? 0.5465 0.5996 0.5561 0.0621  0.0104  -0.1519 410 GLN A CB  
1644 C CG  . GLN A 114 ? 0.6652 0.6619 0.6328 0.0489  -0.0088 -0.1472 410 GLN A CG  
1645 C CD  . GLN A 114 ? 0.8156 0.7562 0.7663 0.0653  -0.0330 -0.1571 410 GLN A CD  
1646 O OE1 . GLN A 114 ? 0.8689 0.8128 0.8373 0.0916  -0.0339 -0.1698 410 GLN A OE1 
1647 N NE2 . GLN A 114 ? 0.8958 0.7827 0.8128 0.0494  -0.0556 -0.1504 410 GLN A NE2 
1656 N N   . VAL A 115 ? 0.4821 0.5717 0.4631 0.0084  0.0385  -0.1252 411 VAL A N   
1657 C CA  . VAL A 115 ? 0.5462 0.6312 0.4941 -0.0044 0.0476  -0.1247 411 VAL A CA  
1658 C C   . VAL A 115 ? 0.5366 0.5775 0.4520 -0.0167 0.0245  -0.1164 411 VAL A C   
1659 O O   . VAL A 115 ? 0.5135 0.5441 0.4425 -0.0249 0.0063  -0.1003 411 VAL A O   
1660 C CB  . VAL A 115 ? 0.5734 0.6910 0.5358 -0.0212 0.0609  -0.1086 411 VAL A CB  
1661 C CG1 . VAL A 115 ? 0.6012 0.7623 0.5948 -0.0147 0.0821  -0.1162 411 VAL A CG1 
1662 C CG2 . VAL A 115 ? 0.5493 0.6666 0.5311 -0.0309 0.0464  -0.0882 411 VAL A CG2 
1672 N N   . ASP A 116 ? 0.5480 0.5658 0.4200 -0.0190 0.0248  -0.1267 412 ASP A N   
1673 C CA  . ASP A 116 ? 0.5891 0.5671 0.4297 -0.0346 -0.0002 -0.1185 412 ASP A CA  
1674 C C   . ASP A 116 ? 0.5286 0.5269 0.3839 -0.0559 -0.0049 -0.0911 412 ASP A C   
1675 O O   . ASP A 116 ? 0.5208 0.5483 0.3826 -0.0599 0.0124  -0.0841 412 ASP A O   
1676 C CB  . ASP A 116 ? 0.6890 0.6393 0.4740 -0.0314 0.0014  -0.1373 412 ASP A CB  
1677 C CG  . ASP A 116 ? 0.8105 0.7230 0.5618 -0.0516 -0.0269 -0.1278 412 ASP A CG  
1678 O OD1 . ASP A 116 ? 0.8733 0.7417 0.6125 -0.0534 -0.0536 -0.1325 412 ASP A OD1 
1679 O OD2 . ASP A 116 ? 0.8273 0.7525 0.5644 -0.0666 -0.0249 -0.1144 412 ASP A OD2 
1684 N N   . TYR A 117 ? 0.5118 0.4951 0.3736 -0.0694 -0.0293 -0.0744 413 TYR A N   
1685 C CA  . TYR A 117 ? 0.4992 0.5092 0.3819 -0.0839 -0.0337 -0.0486 413 TYR A CA  
1686 C C   . TYR A 117 ? 0.4788 0.4889 0.3328 -0.0936 -0.0325 -0.0443 413 TYR A C   
1687 O O   . TYR A 117 ? 0.4551 0.4914 0.3226 -0.0956 -0.0226 -0.0314 413 TYR A O   
1688 C CB  . TYR A 117 ? 0.5210 0.5231 0.4178 -0.0978 -0.0592 -0.0301 413 TYR A CB  
1689 C CG  . TYR A 117 ? 0.5160 0.5557 0.4397 -0.1075 -0.0615 -0.0041 413 TYR A CG  
1690 C CD1 . TYR A 117 ? 0.5148 0.5572 0.4248 -0.1200 -0.0727 0.0065  413 TYR A CD1 
1691 C CD2 . TYR A 117 ? 0.5118 0.5851 0.4724 -0.1009 -0.0531 0.0086  413 TYR A CD2 
1692 C CE1 . TYR A 117 ? 0.5237 0.6036 0.4611 -0.1234 -0.0750 0.0291  413 TYR A CE1 
1693 C CE2 . TYR A 117 ? 0.4927 0.6022 0.4762 -0.1037 -0.0535 0.0294  413 TYR A CE2 
1694 C CZ  . TYR A 117 ? 0.5273 0.6413 0.5016 -0.1138 -0.0642 0.0395  413 TYR A CZ  
1695 O OH  . TYR A 117 ? 0.5402 0.6931 0.5400 -0.1115 -0.0649 0.0592  413 TYR A OH  
1705 N N   . SER A 118 ? 0.5178 0.4935 0.3279 -0.0991 -0.0453 -0.0551 414 SER A N   
1706 C CA  . SER A 118 ? 0.5808 0.5533 0.3575 -0.1094 -0.0487 -0.0488 414 SER A CA  
1707 C C   . SER A 118 ? 0.5891 0.5802 0.3541 -0.1024 -0.0198 -0.0536 414 SER A C   
1708 O O   . SER A 118 ? 0.6069 0.6072 0.3620 -0.1109 -0.0189 -0.0384 414 SER A O   
1709 C CB  . SER A 118 ? 0.6551 0.5823 0.3791 -0.1154 -0.0697 -0.0632 414 SER A CB  
1710 O OG  . SER A 118 ? 0.7370 0.6408 0.4323 -0.0980 -0.0568 -0.0923 414 SER A OG  
1716 N N   . ILE A 119 ? 0.5754 0.5735 0.3431 -0.0877 0.0028  -0.0726 415 ILE A N   
1717 C CA  . ILE A 119 ? 0.5576 0.5805 0.3204 -0.0854 0.0312  -0.0740 415 ILE A CA  
1718 C C   . ILE A 119 ? 0.5404 0.5923 0.3466 -0.0905 0.0379  -0.0546 415 ILE A C   
1719 O O   . ILE A 119 ? 0.5644 0.6222 0.3607 -0.1004 0.0434  -0.0401 415 ILE A O   
1720 C CB  . ILE A 119 ? 0.6102 0.6434 0.3729 -0.0674 0.0533  -0.0988 415 ILE A CB  
1721 C CG1 . ILE A 119 ? 0.6869 0.6864 0.3930 -0.0587 0.0487  -0.1211 415 ILE A CG1 
1722 C CG2 . ILE A 119 ? 0.5948 0.6670 0.3690 -0.0694 0.0837  -0.0950 415 ILE A CG2 
1723 C CD1 . ILE A 119 ? 0.7498 0.7569 0.4555 -0.0335 0.0673  -0.1491 415 ILE A CD1 
1735 N N   . ILE A 120 ? 0.4692 0.5344 0.3195 -0.0830 0.0356  -0.0543 416 ILE A N   
1736 C CA  . ILE A 120 ? 0.4845 0.5725 0.3706 -0.0845 0.0408  -0.0406 416 ILE A CA  
1737 C C   . ILE A 120 ? 0.4771 0.5607 0.3640 -0.0919 0.0237  -0.0197 416 ILE A C   
1738 O O   . ILE A 120 ? 0.4812 0.5724 0.3783 -0.0937 0.0270  -0.0080 416 ILE A O   
1739 C CB  . ILE A 120 ? 0.4966 0.5996 0.4228 -0.0727 0.0418  -0.0472 416 ILE A CB  
1740 C CG1 . ILE A 120 ? 0.5163 0.6389 0.4720 -0.0729 0.0477  -0.0382 416 ILE A CG1 
1741 C CG2 . ILE A 120 ? 0.4839 0.5753 0.4179 -0.0710 0.0212  -0.0417 416 ILE A CG2 
1742 C CD1 . ILE A 120 ? 0.5240 0.6649 0.5127 -0.0622 0.0534  -0.0486 416 ILE A CD1 
1754 N N   . ALA A 121 ? 0.4743 0.5455 0.3520 -0.0958 0.0035  -0.0146 417 ALA A N   
1755 C CA  . ALA A 121 ? 0.4948 0.5709 0.3771 -0.1015 -0.0133 0.0060  417 ALA A CA  
1756 C C   . ALA A 121 ? 0.5256 0.5902 0.3746 -0.1088 -0.0131 0.0139  417 ALA A C   
1757 O O   . ALA A 121 ? 0.5448 0.6160 0.4029 -0.1074 -0.0182 0.0300  417 ALA A O   
1758 C CB  . ALA A 121 ? 0.5134 0.5830 0.3952 -0.1091 -0.0367 0.0112  417 ALA A CB  
1764 N N   . SER A 122 ? 0.5610 0.6064 0.3674 -0.1145 -0.0078 0.0029  418 SER A N   
1765 C CA  . SER A 122 ? 0.5694 0.6035 0.3378 -0.1226 -0.0048 0.0121  418 SER A CA  
1766 C C   . SER A 122 ? 0.5662 0.6106 0.3509 -0.1222 0.0131  0.0199  418 SER A C   
1767 O O   . SER A 122 ? 0.6410 0.6782 0.4213 -0.1254 0.0053  0.0381  418 SER A O   
1768 C CB  . SER A 122 ? 0.5610 0.5779 0.2778 -0.1261 0.0041  -0.0039 418 SER A CB  
1769 O OG  . SER A 122 ? 0.6057 0.6014 0.2985 -0.1284 -0.0185 -0.0115 418 SER A OG  
1775 N N   . GLN A 123 ? 0.5196 0.5786 0.3240 -0.1183 0.0342  0.0067  419 GLN A N   
1776 C CA  . GLN A 123 ? 0.5238 0.5911 0.3448 -0.1226 0.0486  0.0135  419 GLN A CA  
1777 C C   . GLN A 123 ? 0.5172 0.5836 0.3704 -0.1158 0.0358  0.0248  419 GLN A C   
1778 O O   . GLN A 123 ? 0.5479 0.6054 0.4036 -0.1210 0.0382  0.0349  419 GLN A O   
1779 C CB  . GLN A 123 ? 0.5161 0.6070 0.3606 -0.1192 0.0701  -0.0036 419 GLN A CB  
1780 C CG  . GLN A 123 ? 0.5112 0.6091 0.3244 -0.1206 0.0878  -0.0171 419 GLN A CG  
1781 C CD  . GLN A 123 ? 0.5342 0.6603 0.3777 -0.1095 0.1047  -0.0370 419 GLN A CD  
1782 O OE1 . GLN A 123 ? 0.5611 0.6927 0.4404 -0.0983 0.0965  -0.0443 419 GLN A OE1 
1783 N NE2 . GLN A 123 ? 0.5747 0.7224 0.4039 -0.1112 0.1287  -0.0449 419 GLN A NE2 
1792 N N   . ALA A 124 ? 0.4914 0.5658 0.3671 -0.1044 0.0220  0.0236  420 ALA A N   
1793 C CA  . ALA A 124 ? 0.4769 0.5567 0.3812 -0.0928 0.0127  0.0317  420 ALA A CA  
1794 C C   . ALA A 124 ? 0.4892 0.5572 0.3809 -0.0904 -0.0042 0.0500  420 ALA A C   
1795 O O   . ALA A 124 ? 0.4918 0.5579 0.3994 -0.0780 -0.0100 0.0563  420 ALA A O   
1796 C CB  . ALA A 124 ? 0.4665 0.5675 0.3999 -0.0819 0.0075  0.0263  420 ALA A CB  
1802 N N   . GLY A 125 ? 0.5142 0.5727 0.3759 -0.0994 -0.0139 0.0575  421 GLY A N   
1803 C CA  . GLY A 125 ? 0.5423 0.5935 0.3948 -0.0956 -0.0337 0.0758  421 GLY A CA  
1804 C C   . GLY A 125 ? 0.4686 0.5482 0.3502 -0.0860 -0.0501 0.0814  421 GLY A C   
1805 O O   . GLY A 125 ? 0.4818 0.5839 0.3914 -0.0824 -0.0457 0.0734  421 GLY A O   
1809 N N   . ALA A 126 ? 0.5977 0.6821 0.4167 -0.0815 -0.0995 0.1127  422 ALA A N   
1810 C CA  . ALA A 126 ? 0.5791 0.6822 0.4423 -0.0735 -0.1244 0.1233  422 ALA A CA  
1811 C C   . ALA A 126 ? 0.5576 0.6833 0.4938 -0.0538 -0.1093 0.1176  422 ALA A C   
1812 O O   . ALA A 126 ? 0.5096 0.6547 0.4713 -0.0487 -0.1097 0.1042  422 ALA A O   
1813 C CB  . ALA A 126 ? 0.6401 0.7331 0.5037 -0.0783 -0.1599 0.1583  422 ALA A CB  
1819 N N   . THR A 127 ? 0.5397 0.6607 0.5079 -0.0446 -0.0944 0.1268  423 THR A N   
1820 C CA  . THR A 127 ? 0.4936 0.6350 0.5311 -0.0291 -0.0786 0.1212  423 THR A CA  
1821 C C   . THR A 127 ? 0.4219 0.5804 0.4593 -0.0275 -0.0544 0.0904  423 THR A C   
1822 O O   . THR A 127 ? 0.4137 0.5919 0.4870 -0.0219 -0.0568 0.0829  423 THR A O   
1823 C CB  . THR A 127 ? 0.5218 0.6511 0.5848 -0.0226 -0.0597 0.1309  423 THR A CB  
1824 O OG1 . THR A 127 ? 0.5372 0.6491 0.6068 -0.0214 -0.0849 0.1630  423 THR A OG1 
1825 C CG2 . THR A 127 ? 0.4945 0.6448 0.6278 -0.0100 -0.0398 0.1219  423 THR A CG2 
1833 N N   . LEU A 128 ? 0.4365 0.5881 0.4346 -0.0328 -0.0310 0.0726  424 LEU A N   
1834 C CA  . LEU A 128 ? 0.3853 0.5545 0.3864 -0.0298 -0.0095 0.0454  424 LEU A CA  
1835 C C   . LEU A 128 ? 0.4063 0.5823 0.3921 -0.0317 -0.0251 0.0355  424 LEU A C   
1836 O O   . LEU A 128 ? 0.4026 0.5949 0.4130 -0.0257 -0.0185 0.0225  424 LEU A O   
1837 C CB  . LEU A 128 ? 0.4599 0.6233 0.4223 -0.0357 0.0158  0.0280  424 LEU A CB  
1838 C CG  . LEU A 128 ? 0.4769 0.6476 0.4643 -0.0323 0.0459  0.0203  424 LEU A CG  
1839 C CD1 . LEU A 128 ? 0.4553 0.6248 0.4007 -0.0403 0.0683  -0.0002 424 LEU A CD1 
1840 C CD2 . LEU A 128 ? 0.4101 0.6058 0.4464 -0.0237 0.0567  0.0099  424 LEU A CD2 
1852 N N   . ASN A 129 ? 0.4362 0.5976 0.3786 -0.0420 -0.0450 0.0412  425 ASN A N   
1853 C CA  . ASN A 129 ? 0.4931 0.6576 0.4204 -0.0455 -0.0588 0.0314  425 ASN A CA  
1854 C C   . ASN A 129 ? 0.4256 0.6056 0.4026 -0.0385 -0.0721 0.0386  425 ASN A C   
1855 O O   . ASN A 129 ? 0.4043 0.5918 0.3867 -0.0364 -0.0705 0.0244  425 ASN A O   
1856 C CB  . ASN A 129 ? 0.5948 0.7412 0.4708 -0.0612 -0.0799 0.0394  425 ASN A CB  
1857 C CG  . ASN A 129 ? 0.6499 0.7970 0.5092 -0.0670 -0.0926 0.0280  425 ASN A CG  
1858 O OD1 . ASN A 129 ? 0.6408 0.7937 0.5036 -0.0612 -0.0784 0.0069  425 ASN A OD1 
1859 N ND2 . ASN A 129 ? 0.7195 0.8600 0.5607 -0.0792 -0.1198 0.0426  425 ASN A ND2 
1866 N N   . ASN A 130 ? 0.4404 0.6245 0.4555 -0.0350 -0.0847 0.0603  426 ASN A N   
1867 C CA  . ASN A 130 ? 0.4544 0.6562 0.5225 -0.0295 -0.0951 0.0655  426 ASN A CA  
1868 C C   . ASN A 130 ? 0.3814 0.5976 0.4832 -0.0218 -0.0703 0.0484  426 ASN A C   
1869 O O   . ASN A 130 ? 0.3105 0.5366 0.4284 -0.0221 -0.0735 0.0401  426 ASN A O   
1870 C CB  . ASN A 130 ? 0.5941 0.7994 0.7048 -0.0251 -0.1100 0.0907  426 ASN A CB  
1871 C CG  . ASN A 130 ? 0.7193 0.9466 0.8937 -0.0194 -0.1161 0.0931  426 ASN A CG  
1872 O OD1 . ASN A 130 ? 0.7844 1.0205 0.9584 -0.0243 -0.1267 0.0853  426 ASN A OD1 
1873 N ND2 . ASN A 130 ? 0.7447 0.9800 0.9750 -0.0100 -0.1070 0.1020  426 ASN A ND2 
1880 N N   . LEU A 131 ? 0.3528 0.5696 0.4630 -0.0171 -0.0454 0.0432  427 LEU A N   
1881 C CA  . LEU A 131 ? 0.3115 0.5428 0.4479 -0.0131 -0.0219 0.0270  427 LEU A CA  
1882 C C   . LEU A 131 ? 0.3504 0.5817 0.4520 -0.0145 -0.0168 0.0076  427 LEU A C   
1883 O O   . LEU A 131 ? 0.3009 0.5421 0.4196 -0.0135 -0.0121 -0.0017 427 LEU A O   
1884 C CB  . LEU A 131 ? 0.2894 0.5215 0.4384 -0.0105 0.0039  0.0248  427 LEU A CB  
1885 C CG  . LEU A 131 ? 0.3086 0.5366 0.4961 -0.0071 0.0028  0.0435  427 LEU A CG  
1886 C CD1 . LEU A 131 ? 0.3099 0.5354 0.5035 -0.0068 0.0326  0.0375  427 LEU A CD1 
1887 C CD2 . LEU A 131 ? 0.3151 0.5582 0.5623 -0.0038 -0.0036 0.0490  427 LEU A CD2 
1899 N N   . MET A 132 ? 0.3648 0.5839 0.4182 -0.0174 -0.0171 0.0013  428 MET A N   
1900 C CA  . MET A 132 ? 0.3752 0.5932 0.3999 -0.0168 -0.0132 -0.0171 428 MET A CA  
1901 C C   . MET A 132 ? 0.3562 0.5699 0.3801 -0.0190 -0.0324 -0.0168 428 MET A C   
1902 O O   . MET A 132 ? 0.3423 0.5582 0.3665 -0.0159 -0.0283 -0.0287 428 MET A O   
1903 C CB  . MET A 132 ? 0.4118 0.6172 0.3883 -0.0212 -0.0096 -0.0251 428 MET A CB  
1904 C CG  . MET A 132 ? 0.4031 0.6118 0.3745 -0.0212 0.0122  -0.0292 428 MET A CG  
1905 S SD  . MET A 132 ? 0.5315 0.7218 0.4445 -0.0321 0.0144  -0.0352 428 MET A SD  
1906 C CE  . MET A 132 ? 0.5053 0.6960 0.3942 -0.0303 0.0150  -0.0590 428 MET A CE  
1916 N N   . SER A 133 ? 0.3578 0.5651 0.3798 -0.0254 -0.0541 -0.0025 429 SER A N   
1917 C CA  . SER A 133 ? 0.3729 0.5770 0.3934 -0.0304 -0.0721 -0.0027 429 SER A CA  
1918 C C   . SER A 133 ? 0.3572 0.5750 0.4231 -0.0275 -0.0697 -0.0023 429 SER A C   
1919 O O   . SER A 133 ? 0.3602 0.5742 0.4217 -0.0294 -0.0719 -0.0114 429 SER A O   
1920 C CB  . SER A 133 ? 0.4448 0.6435 0.4545 -0.0399 -0.0970 0.0135  429 SER A CB  
1921 O OG  . SER A 133 ? 0.5075 0.7037 0.5118 -0.0475 -0.1136 0.0111  429 SER A OG  
1927 N N   . HIS A 134 ? 0.3661 0.5978 0.4755 -0.0243 -0.0640 0.0075  430 HIS A N   
1928 C CA  . HIS A 134 ? 0.3424 0.5879 0.4953 -0.0240 -0.0561 0.0045  430 HIS A CA  
1929 C C   . HIS A 134 ? 0.3289 0.5741 0.4703 -0.0220 -0.0377 -0.0115 430 HIS A C   
1930 O O   . HIS A 134 ? 0.3462 0.5913 0.4937 -0.0259 -0.0386 -0.0174 430 HIS A O   
1931 C CB  . HIS A 134 ? 0.3757 0.6347 0.5770 -0.0207 -0.0471 0.0143  430 HIS A CB  
1932 C CG  . HIS A 134 ? 0.4224 0.6969 0.6738 -0.0237 -0.0402 0.0115  430 HIS A CG  
1933 N ND1 . HIS A 134 ? 0.4476 0.7228 0.6967 -0.0305 -0.0423 0.0021  430 HIS A ND1 
1934 C CD2 . HIS A 134 ? 0.4258 0.7143 0.7312 -0.0224 -0.0293 0.0157  430 HIS A CD2 
1935 C CE1 . HIS A 134 ? 0.4247 0.7148 0.7217 -0.0349 -0.0328 -0.0001 430 HIS A CE1 
1936 N NE2 . HIS A 134 ? 0.4255 0.7249 0.7596 -0.0298 -0.0241 0.0072  430 HIS A NE2 
1944 N N   . ALA A 135 ? 0.3108 0.5557 0.4341 -0.0169 -0.0218 -0.0182 431 ALA A N   
1945 C CA  . ALA A 135 ? 0.2616 0.5092 0.3743 -0.0143 -0.0075 -0.0318 431 ALA A CA  
1946 C C   . ALA A 135 ? 0.3090 0.5416 0.3905 -0.0135 -0.0187 -0.0393 431 ALA A C   
1947 O O   . ALA A 135 ? 0.2966 0.5280 0.3794 -0.0137 -0.0159 -0.0452 431 ALA A O   
1948 C CB  . ALA A 135 ? 0.2962 0.5492 0.3952 -0.0096 0.0097  -0.0385 431 ALA A CB  
1954 N N   . GLN A 136 ? 0.3086 0.5272 0.3602 -0.0141 -0.0311 -0.0391 432 GLN A N   
1955 C CA  . GLN A 136 ? 0.3620 0.5633 0.3854 -0.0141 -0.0396 -0.0479 432 GLN A CA  
1956 C C   . GLN A 136 ? 0.3608 0.5565 0.3975 -0.0210 -0.0509 -0.0443 432 GLN A C   
1957 O O   . GLN A 136 ? 0.3699 0.5518 0.3929 -0.0201 -0.0521 -0.0518 432 GLN A O   
1958 C CB  . GLN A 136 ? 0.4058 0.5931 0.3941 -0.0179 -0.0489 -0.0498 432 GLN A CB  
1959 C CG  . GLN A 136 ? 0.4766 0.6651 0.4435 -0.0131 -0.0354 -0.0587 432 GLN A CG  
1960 C CD  . GLN A 136 ? 0.4713 0.6610 0.4339 -0.0028 -0.0224 -0.0742 432 GLN A CD  
1961 O OE1 . GLN A 136 ? 0.3984 0.6041 0.3731 0.0033  -0.0078 -0.0778 432 GLN A OE1 
1962 N NE2 . GLN A 136 ? 0.5317 0.7044 0.4780 -0.0009 -0.0280 -0.0832 432 GLN A NE2 
1971 N N   . GLU A 137 ? 0.3956 0.6017 0.4606 -0.0279 -0.0589 -0.0332 433 GLU A N   
1972 C CA  . GLU A 137 ? 0.4194 0.6247 0.5023 -0.0364 -0.0667 -0.0318 433 GLU A CA  
1973 C C   . GLU A 137 ? 0.4053 0.6132 0.5014 -0.0361 -0.0524 -0.0375 433 GLU A C   
1974 O O   . GLU A 137 ? 0.4242 0.6183 0.5101 -0.0413 -0.0557 -0.0419 433 GLU A O   
1975 C CB  . GLU A 137 ? 0.4435 0.6658 0.5643 -0.0424 -0.0760 -0.0199 433 GLU A CB  
1976 C CG  . GLU A 137 ? 0.5333 0.7533 0.6393 -0.0455 -0.0951 -0.0108 433 GLU A CG  
1977 C CD  . GLU A 137 ? 0.5915 0.8312 0.7417 -0.0485 -0.1066 0.0035  433 GLU A CD  
1978 O OE1 . GLU A 137 ? 0.5793 0.8331 0.7718 -0.0511 -0.1015 0.0028  433 GLU A OE1 
1979 O OE2 . GLU A 137 ? 0.6514 0.8924 0.7950 -0.0487 -0.1209 0.0155  433 GLU A OE2 
1986 N N   . LEU A 138 ? 0.3398 0.5637 0.4555 -0.0320 -0.0363 -0.0373 434 LEU A N   
1987 C CA  . LEU A 138 ? 0.3272 0.5550 0.4507 -0.0348 -0.0228 -0.0424 434 LEU A CA  
1988 C C   . LEU A 138 ? 0.3519 0.5637 0.4403 -0.0280 -0.0232 -0.0493 434 LEU A C   
1989 O O   . LEU A 138 ? 0.3538 0.5566 0.4366 -0.0327 -0.0224 -0.0511 434 LEU A O   
1990 C CB  . LEU A 138 ? 0.3790 0.6276 0.5275 -0.0338 -0.0042 -0.0423 434 LEU A CB  
1991 C CG  . LEU A 138 ? 0.4515 0.7158 0.6461 -0.0427 0.0027  -0.0383 434 LEU A CG  
1992 C CD1 . LEU A 138 ? 0.4980 0.7641 0.7096 -0.0405 -0.0119 -0.0287 434 LEU A CD1 
1993 C CD2 . LEU A 138 ? 0.4552 0.7360 0.6707 -0.0434 0.0253  -0.0414 434 LEU A CD2 
2005 N N   . VAL A 139 ? 0.3317 0.5391 0.3972 -0.0173 -0.0243 -0.0533 435 VAL A N   
2006 C CA  . VAL A 139 ? 0.3221 0.5147 0.3605 -0.0083 -0.0256 -0.0609 435 VAL A CA  
2007 C C   . VAL A 139 ? 0.3488 0.5150 0.3714 -0.0125 -0.0381 -0.0614 435 VAL A C   
2008 O O   . VAL A 139 ? 0.3782 0.5311 0.3913 -0.0103 -0.0387 -0.0628 435 VAL A O   
2009 C CB  . VAL A 139 ? 0.3101 0.5022 0.3294 0.0014  -0.0239 -0.0678 435 VAL A CB  
2010 C CG1 . VAL A 139 ? 0.3197 0.4958 0.3174 0.0121  -0.0257 -0.0775 435 VAL A CG1 
2011 C CG2 . VAL A 139 ? 0.2939 0.5100 0.3254 0.0046  -0.0092 -0.0689 435 VAL A CG2 
2021 N N   . ALA A 140 ? 0.3944 0.5516 0.4124 -0.0196 -0.0489 -0.0596 436 ALA A N   
2022 C CA  . ALA A 140 ? 0.4307 0.5616 0.4312 -0.0260 -0.0593 -0.0619 436 ALA A CA  
2023 C C   . ALA A 140 ? 0.4365 0.5640 0.4503 -0.0366 -0.0587 -0.0579 436 ALA A C   
2024 O O   . ALA A 140 ? 0.4683 0.5703 0.4639 -0.0384 -0.0618 -0.0602 436 ALA A O   
2025 C CB  . ALA A 140 ? 0.4623 0.5901 0.4564 -0.0351 -0.0712 -0.0607 436 ALA A CB  
2031 N N   . LYS A 141 ? 0.4115 0.5625 0.4569 -0.0449 -0.0534 -0.0526 437 LYS A N   
2032 C CA  . LYS A 141 ? 0.4216 0.5711 0.4800 -0.0585 -0.0495 -0.0513 437 LYS A CA  
2033 C C   . LYS A 141 ? 0.3517 0.4942 0.3974 -0.0556 -0.0411 -0.0517 437 LYS A C   
2034 O O   . LYS A 141 ? 0.3878 0.5095 0.4191 -0.0644 -0.0430 -0.0512 437 LYS A O   
2035 C CB  . LYS A 141 ? 0.4664 0.6447 0.5670 -0.0676 -0.0427 -0.0482 437 LYS A CB  
2036 C CG  . LYS A 141 ? 0.5834 0.7708 0.7012 -0.0713 -0.0549 -0.0449 437 LYS A CG  
2037 C CD  . LYS A 141 ? 0.6295 0.8455 0.7973 -0.0778 -0.0483 -0.0416 437 LYS A CD  
2038 C CE  . LYS A 141 ? 0.6604 0.8881 0.8480 -0.0792 -0.0645 -0.0354 437 LYS A CE  
2039 N NZ  . LYS A 141 ? 0.6860 0.8991 0.8557 -0.0902 -0.0794 -0.0383 437 LYS A NZ  
2053 N N   . LEU A 142 ? 0.2996 0.4590 0.3488 -0.0447 -0.0326 -0.0521 438 LEU A N   
2054 C CA  . LEU A 142 ? 0.3081 0.4657 0.3459 -0.0426 -0.0271 -0.0513 438 LEU A CA  
2055 C C   . LEU A 142 ? 0.3438 0.4713 0.3509 -0.0318 -0.0379 -0.0516 438 LEU A C   
2056 O O   . LEU A 142 ? 0.3985 0.5115 0.3917 -0.0351 -0.0400 -0.0474 438 LEU A O   
2057 C CB  . LEU A 142 ? 0.3036 0.4892 0.3530 -0.0342 -0.0157 -0.0532 438 LEU A CB  
2058 C CG  . LEU A 142 ? 0.3440 0.5562 0.4250 -0.0460 -0.0010 -0.0531 438 LEU A CG  
2059 C CD1 . LEU A 142 ? 0.2524 0.4879 0.3417 -0.0372 0.0104  -0.0562 438 LEU A CD1 
2060 C CD2 . LEU A 142 ? 0.3096 0.5235 0.3943 -0.0639 0.0074  -0.0523 438 LEU A CD2 
2072 N N   . ARG A 143 ? 0.3736 0.4898 0.3693 -0.0196 -0.0444 -0.0565 439 ARG A N   
2073 C CA  . ARG A 143 ? 0.4406 0.5249 0.4116 -0.0091 -0.0528 -0.0588 439 ARG A CA  
2074 C C   . ARG A 143 ? 0.4810 0.5332 0.4376 -0.0223 -0.0596 -0.0550 439 ARG A C   
2075 O O   . ARG A 143 ? 0.5147 0.5417 0.4546 -0.0188 -0.0641 -0.0510 439 ARG A O   
2076 C CB  . ARG A 143 ? 0.5096 0.5870 0.4714 0.0011  -0.0552 -0.0678 439 ARG A CB  
2077 C CG  . ARG A 143 ? 0.5640 0.6640 0.5317 0.0161  -0.0481 -0.0739 439 ARG A CG  
2078 C CD  . ARG A 143 ? 0.6672 0.7583 0.6218 0.0204  -0.0488 -0.0842 439 ARG A CD  
2079 N NE  . ARG A 143 ? 0.8328 0.9149 0.7797 0.0377  -0.0460 -0.0946 439 ARG A NE  
2080 C CZ  . ARG A 143 ? 0.9708 1.0676 0.9177 0.0458  -0.0381 -0.1054 439 ARG A CZ  
2081 N NH1 . ARG A 143 ? 0.9857 1.1032 0.9346 0.0380  -0.0330 -0.1054 439 ARG A NH1 
2082 N NH2 . ARG A 143 ? 1.0441 1.1333 0.9898 0.0618  -0.0348 -0.1165 439 ARG A NH2 
2096 N N   . SER A 144 ? 0.5289 0.5813 0.4921 -0.0381 -0.0610 -0.0559 440 SER A N   
2097 C CA  . SER A 144 ? 0.5558 0.5787 0.5051 -0.0536 -0.0659 -0.0546 440 SER A CA  
2098 C C   . SER A 144 ? 0.5827 0.6033 0.5317 -0.0661 -0.0613 -0.0478 440 SER A C   
2099 O O   . SER A 144 ? 0.6257 0.6133 0.5533 -0.0761 -0.0649 -0.0451 440 SER A O   
2100 C CB  . SER A 144 ? 0.5913 0.6236 0.5537 -0.0690 -0.0686 -0.0579 440 SER A CB  
2101 O OG  . SER A 144 ? 0.5816 0.6484 0.5768 -0.0787 -0.0617 -0.0551 440 SER A OG  
2107 N N   . LEU A 145 ? 0.4588 0.5098 0.4863 -0.0677 0.0074  0.0151  441 LEU A N   
2108 C CA  . LEU A 145 ? 0.4426 0.4841 0.4814 -0.0581 0.0227  0.0183  441 LEU A CA  
2109 C C   . LEU A 145 ? 0.4445 0.4536 0.4496 -0.0398 0.0323  0.0158  441 LEU A C   
2110 O O   . LEU A 145 ? 0.4919 0.4811 0.4905 -0.0330 0.0428  0.0189  441 LEU A O   
2111 C CB  . LEU A 145 ? 0.4066 0.4795 0.4829 -0.0506 0.0191  0.0276  441 LEU A CB  
2112 C CG  . LEU A 145 ? 0.4081 0.5152 0.5331 -0.0624 0.0075  0.0300  441 LEU A CG  
2113 C CD1 . LEU A 145 ? 0.4176 0.5481 0.5760 -0.0493 0.0033  0.0384  441 LEU A CD1 
2114 C CD2 . LEU A 145 ? 0.4210 0.5264 0.5691 -0.0777 0.0224  0.0223  441 LEU A CD2 
2126 N N   . GLN A 146 ? 0.4516 0.4545 0.4357 -0.0320 0.0287  0.0088  442 GLN A N   
2127 C CA  . GLN A 146 ? 0.4728 0.4530 0.4382 -0.0107 0.0327  0.0039  442 GLN A CA  
2128 C C   . GLN A 146 ? 0.4492 0.4480 0.4298 0.0043  0.0304  0.0110  442 GLN A C   
2129 O O   . GLN A 146 ? 0.4454 0.4217 0.4135 0.0194  0.0307  0.0121  442 GLN A O   
2130 C CB  . GLN A 146 ? 0.6131 0.5423 0.5504 -0.0081 0.0396  0.0020  442 GLN A CB  
2131 C CG  . GLN A 146 ? 0.6832 0.5871 0.6021 -0.0247 0.0433  -0.0070 442 GLN A CG  
2132 C CD  . GLN A 146 ? 0.7751 0.6170 0.6580 -0.0226 0.0505  -0.0079 442 GLN A CD  
2133 O OE1 . GLN A 146 ? 0.8268 0.6330 0.6865 -0.0060 0.0486  -0.0158 442 GLN A OE1 
2134 N NE2 . GLN A 146 ? 0.7963 0.6224 0.6745 -0.0397 0.0600  -0.0009 442 GLN A NE2 
2143 N N   . PHE A 147 ? 0.3978 0.4324 0.4004 -0.0012 0.0256  0.0163  443 PHE A N   
2144 C CA  . PHE A 147 ? 0.3664 0.4189 0.3823 0.0096  0.0237  0.0210  443 PHE A CA  
2145 C C   . PHE A 147 ? 0.3574 0.4086 0.3675 0.0262  0.0228  0.0112  443 PHE A C   
2146 O O   . PHE A 147 ? 0.3836 0.4430 0.3924 0.0256  0.0248  0.0002  443 PHE A O   
2147 C CB  . PHE A 147 ? 0.3504 0.4321 0.3821 -0.0010 0.0175  0.0270  443 PHE A CB  
2148 C CG  . PHE A 147 ? 0.3769 0.4730 0.4223 0.0053  0.0164  0.0329  443 PHE A CG  
2149 C CD1 . PHE A 147 ? 0.3697 0.4575 0.4216 0.0133  0.0206  0.0367  443 PHE A CD1 
2150 C CD2 . PHE A 147 ? 0.3525 0.4649 0.3979 -0.0004 0.0130  0.0340  443 PHE A CD2 
2151 C CE1 . PHE A 147 ? 0.3523 0.4495 0.4137 0.0172  0.0200  0.0403  443 PHE A CE1 
2152 C CE2 . PHE A 147 ? 0.3599 0.4805 0.4153 0.0026  0.0126  0.0388  443 PHE A CE2 
2153 C CZ  . PHE A 147 ? 0.3310 0.4449 0.3962 0.0122  0.0154  0.0415  443 PHE A CZ  
2163 N N   . ASP A 148 ? 0.3469 0.3882 0.3549 0.0405  0.0196  0.0130  444 ASP A N   
2164 C CA  . ASP A 148 ? 0.3512 0.3954 0.3636 0.0591  0.0128  0.0024  444 ASP A CA  
2165 C C   . ASP A 148 ? 0.3558 0.4232 0.3841 0.0633  0.0074  0.0041  444 ASP A C   
2166 O O   . ASP A 148 ? 0.3597 0.4349 0.3910 0.0528  0.0107  0.0136  444 ASP A O   
2167 C CB  . ASP A 148 ? 0.3599 0.3595 0.3472 0.0749  0.0056  0.0012  444 ASP A CB  
2168 C CG  . ASP A 148 ? 0.4140 0.3817 0.3746 0.0762  0.0017  0.0133  444 ASP A CG  
2169 O OD1 . ASP A 148 ? 0.4389 0.4244 0.4078 0.0720  0.0019  0.0183  444 ASP A OD1 
2170 O OD2 . ASP A 148 ? 0.4772 0.3949 0.4020 0.0801  -0.0004 0.0170  444 ASP A OD2 
2175 N N   . GLN A 149 ? 0.3708 0.4492 0.4131 0.0795  -0.0021 -0.0073 445 GLN A N   
2176 C CA  . GLN A 149 ? 0.3091 0.4169 0.3725 0.0800  -0.0073 -0.0105 445 GLN A CA  
2177 C C   . GLN A 149 ? 0.3183 0.4021 0.3595 0.0815  -0.0154 0.0008  445 GLN A C   
2178 O O   . GLN A 149 ? 0.3022 0.4019 0.3513 0.0727  -0.0137 0.0031  445 GLN A O   
2179 C CB  . GLN A 149 ? 0.3069 0.4394 0.4017 0.0969  -0.0172 -0.0291 445 GLN A CB  
2180 C CG  . GLN A 149 ? 0.2978 0.4693 0.4226 0.0921  -0.0206 -0.0366 445 GLN A CG  
2181 C CD  . GLN A 149 ? 0.3766 0.5797 0.5450 0.1103  -0.0333 -0.0580 445 GLN A CD  
2182 O OE1 . GLN A 149 ? 0.4587 0.6436 0.6289 0.1337  -0.0488 -0.0631 445 GLN A OE1 
2183 N NE2 . GLN A 149 ? 0.3677 0.6175 0.5747 0.0993  -0.0273 -0.0714 445 GLN A NE2 
2192 N N   . ARG A 150 ? 0.3845 0.4238 0.3916 0.0905  -0.0226 0.0069  446 ARG A N   
2193 C CA  . ARG A 150 ? 0.3645 0.3723 0.3383 0.0875  -0.0255 0.0163  446 ARG A CA  
2194 C C   . ARG A 150 ? 0.3663 0.3787 0.3421 0.0687  -0.0052 0.0243  446 ARG A C   
2195 O O   . ARG A 150 ? 0.3766 0.3905 0.3498 0.0631  -0.0026 0.0261  446 ARG A O   
2196 C CB  . ARG A 150 ? 0.3987 0.3472 0.3234 0.0953  -0.0326 0.0224  446 ARG A CB  
2197 C CG  . ARG A 150 ? 0.4689 0.3988 0.3823 0.1186  -0.0623 0.0175  446 ARG A CG  
2198 C CD  . ARG A 150 ? 0.5047 0.4667 0.4628 0.1349  -0.0696 0.0037  446 ARG A CD  
2199 N NE  . ARG A 150 ? 0.5663 0.5058 0.5138 0.1320  -0.0557 0.0047  446 ARG A NE  
2200 C CZ  . ARG A 150 ? 0.6283 0.5856 0.6060 0.1426  -0.0546 -0.0085 446 ARG A CZ  
2201 N NH1 . ARG A 150 ? 0.6377 0.6407 0.6647 0.1571  -0.0640 -0.0251 446 ARG A NH1 
2202 N NH2 . ARG A 150 ? 0.6236 0.5536 0.5838 0.1368  -0.0418 -0.0079 446 ARG A NH2 
2216 N N   . GLU A 151 ? 0.3949 0.4099 0.3787 0.0595  0.0076  0.0276  447 GLU A N   
2217 C CA  . GLU A 151 ? 0.2875 0.3132 0.2864 0.0452  0.0222  0.0337  447 GLU A CA  
2218 C C   . GLU A 151 ? 0.3049 0.3667 0.3335 0.0412  0.0203  0.0334  447 GLU A C   
2219 O O   . GLU A 151 ? 0.2874 0.3520 0.3260 0.0355  0.0268  0.0376  447 GLU A O   
2220 C CB  . GLU A 151 ? 0.3449 0.3689 0.3499 0.0361  0.0299  0.0356  447 GLU A CB  
2221 C CG  . GLU A 151 ? 0.3539 0.3345 0.3252 0.0340  0.0370  0.0367  447 GLU A CG  
2222 C CD  . GLU A 151 ? 0.3934 0.3677 0.3641 0.0276  0.0389  0.0344  447 GLU A CD  
2223 O OE1 . GLU A 151 ? 0.3663 0.3696 0.3593 0.0257  0.0334  0.0312  447 GLU A OE1 
2224 O OE2 . GLU A 151 ? 0.4552 0.3897 0.3964 0.0217  0.0470  0.0353  447 GLU A OE2 
2231 N N   . PHE A 152 ? 0.3241 0.4095 0.3652 0.0431  0.0136  0.0271  448 PHE A N   
2232 C CA  . PHE A 152 ? 0.2888 0.4005 0.3480 0.0344  0.0143  0.0270  448 PHE A CA  
2233 C C   . PHE A 152 ? 0.3066 0.4184 0.3667 0.0349  0.0124  0.0259  448 PHE A C   
2234 O O   . PHE A 152 ? 0.2785 0.3904 0.3446 0.0269  0.0166  0.0319  448 PHE A O   
2235 C CB  . PHE A 152 ? 0.2782 0.4123 0.3463 0.0333  0.0137  0.0161  448 PHE A CB  
2236 C CG  . PHE A 152 ? 0.2847 0.4407 0.3633 0.0204  0.0178  0.0134  448 PHE A CG  
2237 C CD1 . PHE A 152 ? 0.2816 0.4332 0.3533 0.0060  0.0204  0.0247  448 PHE A CD1 
2238 C CD2 . PHE A 152 ? 0.2958 0.4752 0.3915 0.0217  0.0178  -0.0009 448 PHE A CD2 
2239 C CE1 . PHE A 152 ? 0.3309 0.4909 0.4005 -0.0092 0.0251  0.0239  448 PHE A CE1 
2240 C CE2 . PHE A 152 ? 0.3149 0.5117 0.4174 0.0044  0.0262  -0.0048 448 PHE A CE2 
2241 C CZ  . PHE A 152 ? 0.3355 0.5177 0.4189 -0.0122 0.0309  0.0087  448 PHE A CZ  
2251 N N   . VAL A 153 ? 0.3338 0.4427 0.3873 0.0445  0.0032  0.0178  449 VAL A N   
2252 C CA  . VAL A 153 ? 0.2736 0.3819 0.3246 0.0422  -0.0012 0.0147  449 VAL A CA  
2253 C C   . VAL A 153 ? 0.2704 0.3480 0.3011 0.0388  0.0077  0.0225  449 VAL A C   
2254 O O   . VAL A 153 ? 0.3550 0.4301 0.3870 0.0317  0.0116  0.0221  449 VAL A O   
2255 C CB  . VAL A 153 ? 0.3593 0.4704 0.4077 0.0542  -0.0196 0.0040  449 VAL A CB  
2256 C CG1 . VAL A 153 ? 0.3244 0.4757 0.4089 0.0575  -0.0236 -0.0092 449 VAL A CG1 
2257 C CG2 . VAL A 153 ? 0.4056 0.4777 0.4194 0.0670  -0.0281 0.0086  449 VAL A CG2 
2267 N N   . CYS A 154 ? 0.3169 0.3693 0.3297 0.0419  0.0143  0.0277  450 CYS A N   
2268 C CA  . CYS A 154 ? 0.3157 0.3435 0.3168 0.0365  0.0300  0.0311  450 CYS A CA  
2269 C C   . CYS A 154 ? 0.3426 0.3876 0.3775 0.0308  0.0393  0.0354  450 CYS A C   
2270 O O   . CYS A 154 ? 0.4889 0.5231 0.5261 0.0281  0.0483  0.0339  450 CYS A O   
2271 C CB  . CYS A 154 ? 0.4075 0.4088 0.3880 0.0361  0.0400  0.0339  450 CYS A CB  
2272 S SG  . CYS A 154 ? 0.3433 0.2967 0.2622 0.0414  0.0296  0.0325  450 CYS A SG  
2278 N N   . LEU A 155 ? 0.2985 0.3653 0.3566 0.0294  0.0355  0.0404  451 LEU A N   
2279 C CA  . LEU A 155 ? 0.3050 0.3818 0.3906 0.0258  0.0368  0.0469  451 LEU A CA  
2280 C C   . LEU A 155 ? 0.2518 0.3303 0.3373 0.0217  0.0322  0.0473  451 LEU A C   
2281 O O   . LEU A 155 ? 0.2420 0.3110 0.3405 0.0216  0.0353  0.0511  451 LEU A O   
2282 C CB  . LEU A 155 ? 0.2628 0.3563 0.3613 0.0226  0.0288  0.0527  451 LEU A CB  
2283 C CG  . LEU A 155 ? 0.3092 0.4014 0.4132 0.0225  0.0335  0.0521  451 LEU A CG  
2284 C CD1 . LEU A 155 ? 0.2952 0.4030 0.4117 0.0165  0.0219  0.0574  451 LEU A CD1 
2285 C CD2 . LEU A 155 ? 0.3675 0.4517 0.4905 0.0234  0.0482  0.0500  451 LEU A CD2 
2297 N N   . LYS A 156 ? 0.2364 0.3261 0.3106 0.0181  0.0258  0.0417  452 LYS A N   
2298 C CA  . LYS A 156 ? 0.2819 0.3730 0.3551 0.0089  0.0245  0.0396  452 LYS A CA  
2299 C C   . LYS A 156 ? 0.2759 0.3445 0.3413 0.0096  0.0301  0.0358  452 LYS A C   
2300 O O   . LYS A 156 ? 0.3429 0.3979 0.4109 0.0038  0.0331  0.0387  452 LYS A O   
2301 C CB  . LYS A 156 ? 0.3117 0.4263 0.3846 0.0044  0.0195  0.0285  452 LYS A CB  
2302 C CG  . LYS A 156 ? 0.3895 0.5243 0.4681 -0.0018 0.0200  0.0283  452 LYS A CG  
2303 C CD  . LYS A 156 ? 0.4489 0.6127 0.5399 -0.0051 0.0193  0.0119  452 LYS A CD  
2304 C CE  . LYS A 156 ? 0.5352 0.7063 0.6307 -0.0225 0.0239  0.0058  452 LYS A CE  
2305 N NZ  . LYS A 156 ? 0.5362 0.7456 0.6581 -0.0260 0.0238  -0.0147 452 LYS A NZ  
2319 N N   . PHE A 157 ? 0.3004 0.3575 0.3489 0.0155  0.0315  0.0290  453 PHE A N   
2320 C CA  . PHE A 157 ? 0.3190 0.3490 0.3498 0.0133  0.0387  0.0229  453 PHE A CA  
2321 C C   . PHE A 157 ? 0.3202 0.3308 0.3628 0.0170  0.0556  0.0261  453 PHE A C   
2322 O O   . PHE A 157 ? 0.3277 0.3172 0.3677 0.0143  0.0644  0.0217  453 PHE A O   
2323 C CB  . PHE A 157 ? 0.3169 0.3319 0.3139 0.0162  0.0330  0.0155  453 PHE A CB  
2324 C CG  . PHE A 157 ? 0.3403 0.3698 0.3313 0.0127  0.0140  0.0068  453 PHE A CG  
2325 C CD1 . PHE A 157 ? 0.3116 0.3751 0.3239 0.0168  0.0005  0.0049  453 PHE A CD1 
2326 C CD2 . PHE A 157 ? 0.4219 0.4331 0.3904 0.0045  0.0102  -0.0022 453 PHE A CD2 
2327 C CE1 . PHE A 157 ? 0.3092 0.3952 0.3307 0.0145  -0.0168 -0.0067 453 PHE A CE1 
2328 C CE2 . PHE A 157 ? 0.4424 0.4737 0.4143 0.0002  -0.0106 -0.0124 453 PHE A CE2 
2329 C CZ  . PHE A 157 ? 0.3918 0.4641 0.3955 0.0060  -0.0242 -0.0151 453 PHE A CZ  
2339 N N   . LEU A 158 ? 0.3372 0.3558 0.3977 0.0231  0.0608  0.0315  454 LEU A N   
2340 C CA  . LEU A 158 ? 0.3362 0.3477 0.4256 0.0279  0.0757  0.0317  454 LEU A CA  
2341 C C   . LEU A 158 ? 0.3191 0.3332 0.4364 0.0304  0.0674  0.0392  454 LEU A C   
2342 O O   . LEU A 158 ? 0.3363 0.3340 0.4730 0.0359  0.0775  0.0357  454 LEU A O   
2343 C CB  . LEU A 158 ? 0.3210 0.3477 0.4311 0.0308  0.0801  0.0344  454 LEU A CB  
2344 C CG  . LEU A 158 ? 0.3807 0.3914 0.4600 0.0267  0.0936  0.0279  454 LEU A CG  
2345 C CD1 . LEU A 158 ? 0.3823 0.4091 0.4856 0.0256  0.0977  0.0305  454 LEU A CD1 
2346 C CD2 . LEU A 158 ? 0.4523 0.4327 0.5145 0.0230  0.1187  0.0162  454 LEU A CD2 
2358 N N   . VAL A 159 ? 0.3361 0.3651 0.4521 0.0260  0.0499  0.0489  455 VAL A N   
2359 C CA  . VAL A 159 ? 0.3410 0.3602 0.4666 0.0248  0.0395  0.0588  455 VAL A CA  
2360 C C   . VAL A 159 ? 0.3560 0.3492 0.4620 0.0177  0.0447  0.0533  455 VAL A C   
2361 O O   . VAL A 159 ? 0.3312 0.2986 0.4472 0.0219  0.0451  0.0568  455 VAL A O   
2362 C CB  . VAL A 159 ? 0.4036 0.4382 0.5179 0.0159  0.0239  0.0687  455 VAL A CB  
2363 C CG1 . VAL A 159 ? 0.4349 0.4467 0.5379 0.0083  0.0136  0.0800  455 VAL A CG1 
2364 C CG2 . VAL A 159 ? 0.3853 0.4389 0.5193 0.0218  0.0165  0.0742  455 VAL A CG2 
2374 N N   . LEU A 160 ? 0.3055 0.3039 0.3853 0.0074  0.0466  0.0439  456 LEU A N   
2375 C CA  . LEU A 160 ? 0.3319 0.3085 0.3928 -0.0035 0.0502  0.0363  456 LEU A CA  
2376 C C   . LEU A 160 ? 0.3861 0.3318 0.4444 0.0029  0.0653  0.0268  456 LEU A C   
2377 O O   . LEU A 160 ? 0.4447 0.3596 0.5015 0.0006  0.0701  0.0255  456 LEU A O   
2378 C CB  . LEU A 160 ? 0.3430 0.3406 0.3862 -0.0149 0.0444  0.0258  456 LEU A CB  
2379 C CG  . LEU A 160 ? 0.3760 0.3588 0.4019 -0.0307 0.0451  0.0146  456 LEU A CG  
2380 C CD1 . LEU A 160 ? 0.4328 0.4005 0.4585 -0.0451 0.0462  0.0214  456 LEU A CD1 
2381 C CD2 . LEU A 160 ? 0.3814 0.3951 0.4032 -0.0380 0.0339  0.0022  456 LEU A CD2 
2393 N N   . PHE A 161 ? 0.2958 0.2435 0.3490 0.0095  0.0753  0.0191  457 PHE A N   
2394 C CA  . PHE A 161 ? 0.4251 0.3410 0.4676 0.0116  0.0958  0.0061  457 PHE A CA  
2395 C C   . PHE A 161 ? 0.4516 0.3668 0.5373 0.0266  0.1102  0.0072  457 PHE A C   
2396 O O   . PHE A 161 ? 0.5050 0.4223 0.5967 0.0304  0.1277  -0.0002 457 PHE A O   
2397 C CB  . PHE A 161 ? 0.4252 0.3346 0.4274 0.0061  0.1004  -0.0036 457 PHE A CB  
2398 C CG  . PHE A 161 ? 0.4600 0.3644 0.4248 -0.0068 0.0849  -0.0100 457 PHE A CG  
2399 C CD1 . PHE A 161 ? 0.4337 0.3715 0.4032 -0.0094 0.0625  -0.0049 457 PHE A CD1 
2400 C CD2 . PHE A 161 ? 0.5296 0.3978 0.4583 -0.0169 0.0928  -0.0238 457 PHE A CD2 
2401 C CE1 . PHE A 161 ? 0.4143 0.3565 0.3631 -0.0204 0.0462  -0.0138 457 PHE A CE1 
2402 C CE2 . PHE A 161 ? 0.5167 0.3846 0.4160 -0.0301 0.0740  -0.0312 457 PHE A CE2 
2403 C CZ  . PHE A 161 ? 0.4473 0.3558 0.3617 -0.0312 0.0496  -0.0264 457 PHE A CZ  
2413 N N   . SER A 162 ? 0.5234 0.4337 0.6401 0.0342  0.1020  0.0160  458 SER A N   
2414 C CA  . SER A 162 ? 0.5872 0.5026 0.7582 0.0520  0.1078  0.0170  458 SER A CA  
2415 C C   . SER A 162 ? 0.6355 0.5218 0.8187 0.0586  0.1363  -0.0021 458 SER A C   
2416 O O   . SER A 162 ? 0.6742 0.5246 0.8240 0.0509  0.1447  -0.0111 458 SER A O   
2417 C CB  . SER A 162 ? 0.6532 0.5640 0.8463 0.0594  0.0832  0.0344  458 SER A CB  
2418 O OG  . SER A 162 ? 0.7139 0.6223 0.9640 0.0802  0.0848  0.0328  458 SER A OG  
2423 N N   . LEU A 163 ? 0.6705 0.5735 0.9044 0.0712  0.1534  -0.0109 459 LEU A N   
2424 C CA  . LEU A 163 ? 0.7968 0.6773 1.0572 0.0798  0.1854  -0.0326 459 LEU A CA  
2425 C C   . LEU A 163 ? 0.8523 0.7233 1.1736 0.1030  0.1751  -0.0301 459 LEU A C   
2426 O O   . LEU A 163 ? 0.9094 0.7598 1.2410 0.1068  0.1937  -0.0469 459 LEU A O   
2427 C CB  . LEU A 163 ? 0.8161 0.7213 1.1054 0.0787  0.2152  -0.0483 459 LEU A CB  
2428 C CG  . LEU A 163 ? 0.8485 0.7515 1.0740 0.0574  0.2274  -0.0508 459 LEU A CG  
2429 C CD1 . LEU A 163 ? 0.8684 0.7847 1.1111 0.0486  0.2547  -0.0649 459 LEU A CD1 
2430 C CD2 . LEU A 163 ? 0.9096 0.7666 1.0537 0.0414  0.2343  -0.0581 459 LEU A CD2 
2442 N N   . ASP A 164 ? 0.8445 0.7312 1.1902 0.1127  0.1382  -0.0076 460 ASP A N   
2443 C CA  . ASP A 164 ? 0.8824 0.7552 1.2670 0.1317  0.1162  -0.0006 460 ASP A CA  
2444 C C   . ASP A 164 ? 0.8462 0.6585 1.1898 0.1301  0.1084  0.0071  460 ASP A C   
2445 O O   . ASP A 164 ? 0.8438 0.6338 1.2024 0.1440  0.0859  0.0158  460 ASP A O   
2446 C CB  . ASP A 164 ? 0.9427 0.8483 1.3584 0.1402  0.0771  0.0204  460 ASP A CB  
2447 C CG  . ASP A 164 ? 0.9901 0.8941 1.3589 0.1260  0.0551  0.0434  460 ASP A CG  
2448 O OD1 . ASP A 164 ? 1.0364 0.9058 1.3437 0.1102  0.0541  0.0490  460 ASP A OD1 
2449 O OD2 . ASP A 164 ? 0.9739 0.9160 1.3564 0.1238  0.0382  0.0531  460 ASP A OD2 
2454 N N   . VAL A 165 ? 0.8190 0.6109 1.0942 0.1060  0.1198  0.0036  461 VAL A N   
2455 C CA  . VAL A 165 ? 0.8433 0.5803 1.0727 0.0959  0.1165  0.0056  461 VAL A CA  
2456 C C   . VAL A 165 ? 0.8733 0.5712 1.1111 0.1034  0.1488  -0.0202 461 VAL A C   
2457 O O   . VAL A 165 ? 0.8728 0.5765 1.0929 0.0933  0.1787  -0.0414 461 VAL A O   
2458 C CB  . VAL A 165 ? 0.8237 0.5636 0.9836 0.0645  0.1126  0.0091  461 VAL A CB  
2459 C CG1 . VAL A 165 ? 0.8728 0.5575 0.9884 0.0490  0.1152  0.0052  461 VAL A CG1 
2460 C CG2 . VAL A 165 ? 0.7916 0.5636 0.9437 0.0570  0.0844  0.0321  461 VAL A CG2 
2470 N N   . LEU A 168 ? 0.9294 0.4327 0.9399 0.0223  0.2255  -0.0984 464 LEU A N   
2471 C CA  . LEU A 168 ? 0.9294 0.4504 0.8851 -0.0057 0.2207  -0.1015 464 LEU A CA  
2472 C C   . LEU A 168 ? 0.9981 0.4807 0.8949 -0.0259 0.2440  -0.1295 464 LEU A C   
2473 O O   . LEU A 168 ? 1.0388 0.5237 0.9426 -0.0175 0.2686  -0.1434 464 LEU A O   
2474 C CB  . LEU A 168 ? 0.8898 0.4730 0.8677 0.0025  0.2160  -0.0922 464 LEU A CB  
2475 C CG  . LEU A 168 ? 0.8567 0.4872 0.8784 0.0152  0.1878  -0.0642 464 LEU A CG  
2476 C CD1 . LEU A 168 ? 0.8159 0.4991 0.8493 0.0190  0.1875  -0.0601 464 LEU A CD1 
2477 C CD2 . LEU A 168 ? 0.8575 0.4916 0.8513 -0.0047 0.1600  -0.0485 464 LEU A CD2 
2488 N N   . GLU A 169 ? 1.0357 0.5013 0.8767 -0.0556 0.2295  -0.1335 465 GLU A N   
2489 C CA  . GLU A 169 ? 1.1333 0.5681 0.9113 -0.0777 0.2422  -0.1568 465 GLU A CA  
2490 C C   . GLU A 169 ? 1.1528 0.6081 0.8980 -0.0827 0.2484  -0.1637 465 GLU A C   
2491 O O   . GLU A 169 ? 1.2938 0.7287 0.9967 -0.0926 0.2655  -0.1785 465 GLU A O   
2492 C CB  . GLU A 169 ? 1.2006 0.6170 0.9332 -0.1102 0.2203  -0.1608 465 GLU A CB  
2493 C CG  . GLU A 169 ? 1.3333 0.7206 1.0029 -0.1333 0.2262  -0.1818 465 GLU A CG  
2494 C CD  . GLU A 169 ? 1.3942 0.7991 1.0130 -0.1485 0.2141  -0.1885 465 GLU A CD  
2495 O OE1 . GLU A 169 ? 1.3538 0.7992 0.9855 -0.1450 0.1946  -0.1768 465 GLU A OE1 
2496 O OE2 . GLU A 169 ? 1.4664 0.8459 1.0319 -0.1627 0.2211  -0.2023 465 GLU A OE2 
2503 N N   . ASN A 170 ? 0.9626 0.4709 0.7288 -0.0756 0.2289  -0.1455 466 ASN A N   
2504 C CA  . ASN A 170 ? 0.9113 0.4369 0.6420 -0.0801 0.2291  -0.1472 466 ASN A CA  
2505 C C   . ASN A 170 ? 0.7988 0.3708 0.5871 -0.0562 0.2338  -0.1312 466 ASN A C   
2506 O O   . ASN A 170 ? 0.7434 0.3596 0.5378 -0.0545 0.2095  -0.1143 466 ASN A O   
2507 C CB  . ASN A 170 ? 0.9091 0.4577 0.5986 -0.0998 0.1903  -0.1409 466 ASN A CB  
2508 C CG  . ASN A 170 ? 0.9382 0.4780 0.5664 -0.1080 0.1880  -0.1459 466 ASN A CG  
2509 O OD1 . ASN A 170 ? 0.9223 0.4473 0.5426 -0.1001 0.2173  -0.1503 466 ASN A OD1 
2510 N ND2 . ASN A 170 ? 0.9595 0.5069 0.5445 -0.1246 0.1522  -0.1456 466 ASN A ND2 
2517 N N   . PHE A 171 ? 0.8356 0.4099 0.5687 0.0392  0.1502  -0.1536 467 PHE A N   
2518 C CA  . PHE A 171 ? 0.8108 0.4372 0.6077 0.0617  0.1572  -0.1483 467 PHE A CA  
2519 C C   . PHE A 171 ? 0.8100 0.4732 0.5966 0.0501  0.1766  -0.1504 467 PHE A C   
2520 O O   . PHE A 171 ? 0.7645 0.4768 0.5942 0.0584  0.1745  -0.1385 467 PHE A O   
2521 C CB  . PHE A 171 ? 0.8827 0.4945 0.7329 0.0941  0.1736  -0.1684 467 PHE A CB  
2522 C CG  . PHE A 171 ? 0.9011 0.5683 0.8276 0.1164  0.1788  -0.1657 467 PHE A CG  
2523 C CD1 . PHE A 171 ? 0.8879 0.5758 0.8562 0.1301  0.1465  -0.1439 467 PHE A CD1 
2524 C CD2 . PHE A 171 ? 0.9210 0.6237 0.8743 0.1181  0.2101  -0.1816 467 PHE A CD2 
2525 C CE1 . PHE A 171 ? 0.8720 0.6087 0.9105 0.1485  0.1464  -0.1419 467 PHE A CE1 
2526 C CE2 . PHE A 171 ? 0.8689 0.6276 0.8960 0.1338  0.2103  -0.1774 467 PHE A CE2 
2527 C CZ  . PHE A 171 ? 0.8494 0.6222 0.9227 0.1513  0.1802  -0.1603 467 PHE A CZ  
2537 N N   . GLN A 172 ? 0.8825 0.5157 0.6054 0.0288  0.1933  -0.1645 468 GLN A N   
2538 C CA  . GLN A 172 ? 0.8740 0.5279 0.5701 0.0134  0.2089  -0.1640 468 GLN A CA  
2539 C C   . GLN A 172 ? 0.7745 0.4672 0.4719 0.0008  0.1773  -0.1354 468 GLN A C   
2540 O O   . GLN A 172 ? 0.6994 0.4288 0.4168 0.0021  0.1827  -0.1267 468 GLN A O   
2541 C CB  . GLN A 172 ? 0.9789 0.5861 0.5956 -0.0116 0.2208  -0.1782 468 GLN A CB  
2542 C CG  . GLN A 172 ? 1.0839 0.6684 0.7129 -0.0009 0.2448  -0.2001 468 GLN A CG  
2543 C CD  . GLN A 172 ? 1.1103 0.7341 0.7991 0.0155  0.2763  -0.2095 468 GLN A CD  
2544 O OE1 . GLN A 172 ? 1.0765 0.7439 0.8400 0.0379  0.2748  -0.2040 468 GLN A OE1 
2545 N NE2 . GLN A 172 ? 1.1895 0.7964 0.8450 0.0020  0.3042  -0.2237 468 GLN A NE2 
2554 N N   . LEU A 173 ? 0.7766 0.4609 0.4565 -0.0121 0.1458  -0.1223 469 LEU A N   
2555 C CA  . LEU A 173 ? 0.7410 0.4650 0.4352 -0.0213 0.1180  -0.0989 469 LEU A CA  
2556 C C   . LEU A 173 ? 0.6647 0.4339 0.4248 -0.0000 0.1150  -0.0861 469 LEU A C   
2557 O O   . LEU A 173 ? 0.6197 0.4256 0.3989 0.0007  0.1104  -0.0744 469 LEU A O   
2558 C CB  . LEU A 173 ? 0.7909 0.5006 0.4671 -0.0398 0.0905  -0.0919 469 LEU A CB  
2559 C CG  . LEU A 173 ? 0.8228 0.5746 0.5232 -0.0502 0.0635  -0.0723 469 LEU A CG  
2560 C CD1 . LEU A 173 ? 0.8585 0.6190 0.5335 -0.0616 0.0537  -0.0675 469 LEU A CD1 
2561 C CD2 . LEU A 173 ? 0.8835 0.6237 0.5791 -0.0696 0.0431  -0.0698 469 LEU A CD2 
2573 N N   . VAL A 174 ? 0.6661 0.4260 0.4561 0.0166  0.1144  -0.0878 470 VAL A N   
2574 C CA  . VAL A 174 ? 0.6004 0.3928 0.4420 0.0344  0.1060  -0.0753 470 VAL A CA  
2575 C C   . VAL A 174 ? 0.6067 0.4302 0.4840 0.0484  0.1229  -0.0799 470 VAL A C   
2576 O O   . VAL A 174 ? 0.5491 0.4093 0.4513 0.0505  0.1150  -0.0674 470 VAL A O   
2577 C CB  . VAL A 174 ? 0.6017 0.3635 0.4574 0.0488  0.0978  -0.0761 470 VAL A CB  
2578 C CG1 . VAL A 174 ? 0.5747 0.3606 0.4737 0.0660  0.0844  -0.0633 470 VAL A CG1 
2579 C CG2 . VAL A 174 ? 0.6076 0.3382 0.4262 0.0291  0.0828  -0.0694 470 VAL A CG2 
2589 N N   . GLU A 175 ? 0.6424 0.4509 0.5247 0.0567  0.1491  -0.1001 471 GLU A N   
2590 C CA  . GLU A 175 ? 0.6755 0.5160 0.5984 0.0662  0.1711  -0.1072 471 GLU A CA  
2591 C C   . GLU A 175 ? 0.6492 0.5084 0.5420 0.0463  0.1747  -0.0978 471 GLU A C   
2592 O O   . GLU A 175 ? 0.6056 0.5005 0.5342 0.0503  0.1754  -0.0901 471 GLU A O   
2593 C CB  . GLU A 175 ? 0.8117 0.6311 0.7434 0.0746  0.2067  -0.1352 471 GLU A CB  
2594 C CG  . GLU A 175 ? 0.8811 0.7365 0.8620 0.0805  0.2369  -0.1463 471 GLU A CG  
2595 C CD  . GLU A 175 ? 0.9629 0.8083 0.9492 0.0801  0.2633  -0.1676 471 GLU A CD  
2596 O OE1 . GLU A 175 ? 0.9831 0.7872 0.9391 0.0818  0.2643  -0.1792 471 GLU A OE1 
2597 O OE2 . GLU A 175 ? 1.0218 0.8980 1.0414 0.0766  0.2844  -0.1733 471 GLU A OE2 
2604 N N   . GLY A 176 ? 0.6435 0.4741 0.4690 0.0241  0.1728  -0.0976 472 GLY A N   
2605 C CA  . GLY A 176 ? 0.6374 0.4749 0.4281 0.0054  0.1692  -0.0867 472 GLY A CA  
2606 C C   . GLY A 176 ? 0.5675 0.4388 0.3841 0.0072  0.1383  -0.0644 472 GLY A C   
2607 O O   . GLY A 176 ? 0.5544 0.4455 0.3785 0.0041  0.1376  -0.0550 472 GLY A O   
2611 N N   . VAL A 177 ? 0.5821 0.4568 0.4109 0.0105  0.1152  -0.0569 473 VAL A N   
2612 C CA  . VAL A 177 ? 0.5094 0.4162 0.3668 0.0129  0.0930  -0.0403 473 VAL A CA  
2613 C C   . VAL A 177 ? 0.4794 0.4147 0.3850 0.0298  0.0984  -0.0372 473 VAL A C   
2614 O O   . VAL A 177 ? 0.4628 0.4210 0.3828 0.0297  0.0914  -0.0276 473 VAL A O   
2615 C CB  . VAL A 177 ? 0.5021 0.4048 0.3628 0.0098  0.0761  -0.0362 473 VAL A CB  
2616 C CG1 . VAL A 177 ? 0.4543 0.3891 0.3483 0.0140  0.0629  -0.0238 473 VAL A CG1 
2617 C CG2 . VAL A 177 ? 0.5290 0.4115 0.3510 -0.0105 0.0640  -0.0376 473 VAL A CG2 
2627 N N   . GLN A 178 ? 0.5114 0.4426 0.4443 0.0450  0.1077  -0.0458 474 GLN A N   
2628 C CA  . GLN A 178 ? 0.4851 0.4421 0.4680 0.0605  0.1066  -0.0435 474 GLN A CA  
2629 C C   . GLN A 178 ? 0.4969 0.4743 0.4924 0.0560  0.1228  -0.0454 474 GLN A C   
2630 O O   . GLN A 178 ? 0.4713 0.4726 0.4921 0.0584  0.1137  -0.0366 474 GLN A O   
2631 C CB  . GLN A 178 ? 0.5768 0.5223 0.5921 0.0785  0.1101  -0.0541 474 GLN A CB  
2632 C CG  . GLN A 178 ? 0.6655 0.6375 0.7417 0.0953  0.1038  -0.0538 474 GLN A CG  
2633 C CD  . GLN A 178 ? 0.7625 0.7340 0.8416 0.1002  0.0730  -0.0385 474 GLN A CD  
2634 O OE1 . GLN A 178 ? 0.8074 0.7558 0.8486 0.0935  0.0608  -0.0304 474 GLN A OE1 
2635 N NE2 . GLN A 178 ? 0.7935 0.7881 0.9149 0.1089  0.0617  -0.0355 474 GLN A NE2 
2644 N N   . GLU A 179 ? 0.5293 0.4920 0.5010 0.0466  0.1486  -0.0574 475 GLU A N   
2645 C CA  . GLU A 179 ? 0.5879 0.5637 0.5659 0.0377  0.1699  -0.0598 475 GLU A CA  
2646 C C   . GLU A 179 ? 0.5115 0.4859 0.4538 0.0223  0.1542  -0.0428 475 GLU A C   
2647 O O   . GLU A 179 ? 0.4684 0.4603 0.4306 0.0192  0.1565  -0.0367 475 GLU A O   
2648 C CB  . GLU A 179 ? 0.7057 0.6578 0.6557 0.0278  0.2074  -0.0791 475 GLU A CB  
2649 C CG  . GLU A 179 ? 0.8336 0.7471 0.6970 0.0023  0.2107  -0.0755 475 GLU A CG  
2650 C CD  . GLU A 179 ? 0.9441 0.8224 0.7655 -0.0086 0.2489  -0.0979 475 GLU A CD  
2651 O OE1 . GLU A 179 ? 0.9373 0.8315 0.8131 0.0047  0.2725  -0.1153 475 GLU A OE1 
2652 O OE2 . GLU A 179 ? 1.0078 0.8427 0.7457 -0.0306 0.2477  -0.0967 475 GLU A OE2 
2659 N N   . GLN A 180 ? 0.4954 0.4484 0.3904 0.0128  0.1353  -0.0352 476 GLN A N   
2660 C CA  . GLN A 180 ? 0.4591 0.4082 0.3275 0.0014  0.1150  -0.0196 476 GLN A CA  
2661 C C   . GLN A 180 ? 0.4002 0.3785 0.3116 0.0136  0.0925  -0.0087 476 GLN A C   
2662 O O   . GLN A 180 ? 0.4190 0.4015 0.3316 0.0102  0.0831  0.0012  476 GLN A O   
2663 C CB  . GLN A 180 ? 0.5091 0.4286 0.3238 -0.0121 0.0972  -0.0166 476 GLN A CB  
2664 C CG  . GLN A 180 ? 0.5556 0.4332 0.3060 -0.0297 0.1178  -0.0271 476 GLN A CG  
2665 C CD  . GLN A 180 ? 0.5985 0.4558 0.3088 -0.0464 0.1319  -0.0223 476 GLN A CD  
2666 O OE1 . GLN A 180 ? 0.6317 0.4961 0.3480 -0.0480 0.1132  -0.0065 476 GLN A OE1 
2667 N NE2 . GLN A 180 ? 0.6517 0.4789 0.3180 -0.0604 0.1676  -0.0370 476 GLN A NE2 
2676 N N   . VAL A 181 ? 0.3342 0.3259 0.2744 0.0261  0.0845  -0.0108 477 VAL A N   
2677 C CA  . VAL A 181 ? 0.3794 0.3926 0.3513 0.0354  0.0691  -0.0035 477 VAL A CA  
2678 C C   . VAL A 181 ? 0.3241 0.3529 0.3283 0.0422  0.0752  -0.0038 477 VAL A C   
2679 O O   . VAL A 181 ? 0.3438 0.3819 0.3591 0.0429  0.0654  0.0028  477 VAL A O   
2680 C CB  . VAL A 181 ? 0.3850 0.3981 0.3650 0.0416  0.0624  -0.0055 477 VAL A CB  
2681 C CG1 . VAL A 181 ? 0.3257 0.3533 0.3281 0.0489  0.0526  -0.0009 477 VAL A CG1 
2682 C CG2 . VAL A 181 ? 0.3934 0.3972 0.3510 0.0311  0.0541  -0.0047 477 VAL A CG2 
2692 N N   . ASN A 182 ? 0.3649 0.3970 0.3902 0.0475  0.0906  -0.0129 478 ASN A N   
2693 C CA  . ASN A 182 ? 0.3623 0.4141 0.4289 0.0515  0.0952  -0.0147 478 ASN A CA  
2694 C C   . ASN A 182 ? 0.3795 0.4306 0.4333 0.0370  0.1038  -0.0096 478 ASN A C   
2695 O O   . ASN A 182 ? 0.3870 0.4490 0.4610 0.0366  0.0947  -0.0041 478 ASN A O   
2696 C CB  . ASN A 182 ? 0.3868 0.4460 0.4899 0.0596  0.1126  -0.0285 478 ASN A CB  
2697 C CG  . ASN A 182 ? 0.4014 0.4659 0.5407 0.0773  0.0926  -0.0294 478 ASN A CG  
2698 O OD1 . ASN A 182 ? 0.3954 0.4660 0.5445 0.0807  0.0707  -0.0214 478 ASN A OD1 
2699 N ND2 . ASN A 182 ? 0.4548 0.5096 0.6079 0.0880  0.0984  -0.0395 478 ASN A ND2 
2706 N N   . ALA A 183 ? 0.3659 0.3962 0.3776 0.0228  0.1198  -0.0108 479 ALA A N   
2707 C CA  . ALA A 183 ? 0.4495 0.4665 0.4347 0.0051  0.1273  -0.0036 479 ALA A CA  
2708 C C   . ALA A 183 ? 0.3327 0.3414 0.3026 0.0051  0.0980  0.0115  479 ALA A C   
2709 O O   . ALA A 183 ? 0.3574 0.3628 0.3304 -0.0018 0.0951  0.0188  479 ALA A O   
2710 C CB  . ALA A 183 ? 0.4239 0.4077 0.3491 -0.0131 0.1478  -0.0074 479 ALA A CB  
2716 N N   . ALA A 184 ? 0.3773 0.3824 0.3356 0.0125  0.0772  0.0149  480 ALA A N   
2717 C CA  . ALA A 184 ? 0.3748 0.3771 0.3334 0.0162  0.0513  0.0251  480 ALA A CA  
2718 C C   . ALA A 184 ? 0.3251 0.3482 0.3255 0.0283  0.0452  0.0239  480 ALA A C   
2719 O O   . ALA A 184 ? 0.3152 0.3320 0.3195 0.0290  0.0326  0.0302  480 ALA A O   
2720 C CB  . ALA A 184 ? 0.3822 0.3841 0.3334 0.0202  0.0347  0.0252  480 ALA A CB  
2726 N N   . LEU A 185 ? 0.3159 0.3571 0.3430 0.0375  0.0513  0.0159  481 LEU A N   
2727 C CA  . LEU A 185 ? 0.2914 0.3437 0.3458 0.0457  0.0429  0.0144  481 LEU A CA  
2728 C C   . LEU A 185 ? 0.2869 0.3413 0.3580 0.0390  0.0471  0.0156  481 LEU A C   
2729 O O   . LEU A 185 ? 0.3299 0.3807 0.4083 0.0398  0.0360  0.0179  481 LEU A O   
2730 C CB  . LEU A 185 ? 0.2746 0.3349 0.3428 0.0546  0.0425  0.0081  481 LEU A CB  
2731 C CG  . LEU A 185 ? 0.2979 0.3602 0.3809 0.0605  0.0299  0.0065  481 LEU A CG  
2732 C CD1 . LEU A 185 ? 0.2914 0.3460 0.3599 0.0619  0.0227  0.0069  481 LEU A CD1 
2733 C CD2 . LEU A 185 ? 0.2961 0.3554 0.3830 0.0675  0.0242  0.0034  481 LEU A CD2 
2745 N N   . LEU A 186 ? 0.2499 0.3097 0.3295 0.0308  0.0657  0.0122  482 LEU A N   
2746 C CA  . LEU A 186 ? 0.3004 0.3651 0.4009 0.0192  0.0745  0.0126  482 LEU A CA  
2747 C C   . LEU A 186 ? 0.3382 0.3761 0.4043 0.0064  0.0697  0.0238  482 LEU A C   
2748 O O   . LEU A 186 ? 0.3114 0.3449 0.3894 0.0022  0.0609  0.0272  482 LEU A O   
2749 C CB  . LEU A 186 ? 0.2749 0.3519 0.3937 0.0108  0.1035  0.0036  482 LEU A CB  
2750 C CG  . LEU A 186 ? 0.3263 0.4102 0.4680 -0.0079 0.1219  0.0025  482 LEU A CG  
2751 C CD1 . LEU A 186 ? 0.3449 0.4496 0.5383 -0.0036 0.1030  0.0013  482 LEU A CD1 
2752 C CD2 . LEU A 186 ? 0.3262 0.4260 0.4924 -0.0155 0.1584  -0.0114 482 LEU A CD2 
2764 N N   . ASP A 187 ? 0.3878 0.4016 0.4076 -0.0003 0.0713  0.0302  483 ASP A N   
2765 C CA  . ASP A 187 ? 0.4259 0.4051 0.4082 -0.0111 0.0588  0.0435  483 ASP A CA  
2766 C C   . ASP A 187 ? 0.3512 0.3283 0.3503 0.0035  0.0321  0.0466  483 ASP A C   
2767 O O   . ASP A 187 ? 0.3931 0.3493 0.3880 -0.0024 0.0232  0.0534  483 ASP A O   
2768 C CB  . ASP A 187 ? 0.5189 0.4695 0.4473 -0.0183 0.0543  0.0501  483 ASP A CB  
2769 C CG  . ASP A 187 ? 0.7089 0.6121 0.5875 -0.0341 0.0403  0.0663  483 ASP A CG  
2770 O OD1 . ASP A 187 ? 0.7625 0.6516 0.6417 -0.0231 0.0089  0.0746  483 ASP A OD1 
2771 O OD2 . ASP A 187 ? 0.8382 0.7156 0.6774 -0.0580 0.0615  0.0702  483 ASP A OD2 
2776 N N   . TYR A 188 ? 0.3619 0.3570 0.3787 0.0212  0.0222  0.0402  484 TYR A N   
2777 C CA  . TYR A 188 ? 0.3483 0.3413 0.3812 0.0348  0.0040  0.0388  484 TYR A CA  
2778 C C   . TYR A 188 ? 0.3433 0.3398 0.3979 0.0359  0.0043  0.0332  484 TYR A C   
2779 O O   . TYR A 188 ? 0.3633 0.3400 0.4187 0.0376  -0.0074 0.0350  484 TYR A O   
2780 C CB  . TYR A 188 ? 0.3591 0.3716 0.4051 0.0483  0.0016  0.0309  484 TYR A CB  
2781 C CG  . TYR A 188 ? 0.3359 0.3500 0.4031 0.0615  -0.0073 0.0238  484 TYR A CG  
2782 C CD1 . TYR A 188 ? 0.3525 0.3572 0.4297 0.0693  -0.0228 0.0260  484 TYR A CD1 
2783 C CD2 . TYR A 188 ? 0.3536 0.3751 0.4304 0.0660  -0.0008 0.0137  484 TYR A CD2 
2784 C CE1 . TYR A 188 ? 0.3301 0.3379 0.4346 0.0828  -0.0251 0.0150  484 TYR A CE1 
2785 C CE2 . TYR A 188 ? 0.3616 0.3792 0.4500 0.0758  -0.0024 0.0037  484 TYR A CE2 
2786 C CZ  . TYR A 188 ? 0.3939 0.4073 0.5004 0.0849  -0.0112 0.0027  484 TYR A CZ  
2787 O OH  . TYR A 188 ? 0.3971 0.4084 0.5230 0.0962  -0.0071 -0.0116 484 TYR A OH  
2797 N N   . THR A 189 ? 0.3374 0.3551 0.4101 0.0353  0.0137  0.0261  485 THR A N   
2798 C CA  . THR A 189 ? 0.3363 0.3550 0.4275 0.0348  0.0071  0.0206  485 THR A CA  
2799 C C   . THR A 189 ? 0.3457 0.3514 0.4411 0.0186  0.0084  0.0262  485 THR A C   
2800 O O   . THR A 189 ? 0.3831 0.3723 0.4811 0.0169  -0.0031 0.0246  485 THR A O   
2801 C CB  . THR A 189 ? 0.3769 0.4179 0.4891 0.0378  0.0087  0.0137  485 THR A CB  
2802 O OG1 . THR A 189 ? 0.3668 0.4247 0.4970 0.0298  0.0240  0.0144  485 THR A OG1 
2803 C CG2 . THR A 189 ? 0.3733 0.4175 0.4722 0.0500  0.0073  0.0096  485 THR A CG2 
2811 N N   . MET A 190 ? 0.3781 0.3866 0.4700 0.0040  0.0250  0.0317  486 MET A N   
2812 C CA  . MET A 190 ? 0.4085 0.4019 0.5004 -0.0172 0.0319  0.0374  486 MET A CA  
2813 C C   . MET A 190 ? 0.4689 0.4181 0.5249 -0.0203 0.0169  0.0486  486 MET A C   
2814 O O   . MET A 190 ? 0.5199 0.4482 0.5780 -0.0316 0.0107  0.0514  486 MET A O   
2815 C CB  . MET A 190 ? 0.4706 0.4719 0.5580 -0.0349 0.0604  0.0388  486 MET A CB  
2816 C CG  . MET A 190 ? 0.5430 0.5873 0.6871 -0.0365 0.0766  0.0260  486 MET A CG  
2817 S SD  . MET A 190 ? 0.6377 0.6892 0.7891 -0.0651 0.1199  0.0229  486 MET A SD  
2818 C CE  . MET A 190 ? 0.6969 0.7208 0.8408 -0.0931 0.1183  0.0329  486 MET A CE  
2828 N N   . CYS A 191 ? 0.4666 0.3989 0.4930 -0.0103 0.0077  0.0548  487 CYS A N   
2829 C CA  . CYS A 191 ? 0.5054 0.3927 0.5030 -0.0105 -0.0122 0.0664  487 CYS A CA  
2830 C C   . CYS A 191 ? 0.4928 0.3744 0.5125 0.0101  -0.0316 0.0584  487 CYS A C   
2831 O O   . CYS A 191 ? 0.5258 0.3684 0.5354 0.0094  -0.0473 0.0642  487 CYS A O   
2832 C CB  . CYS A 191 ? 0.5948 0.4651 0.5575 -0.0083 -0.0210 0.0762  487 CYS A CB  
2833 S SG  . CYS A 191 ? 0.7396 0.5879 0.6476 -0.0393 0.0016  0.0872  487 CYS A SG  
2839 N N   . ASN A 192 ? 0.4523 0.3663 0.4978 0.0272  -0.0288 0.0442  488 ASN A N   
2840 C CA  . ASN A 192 ? 0.4698 0.3768 0.5307 0.0457  -0.0396 0.0328  488 ASN A CA  
2841 C C   . ASN A 192 ? 0.4650 0.3735 0.5353 0.0433  -0.0372 0.0204  488 ASN A C   
2842 O O   . ASN A 192 ? 0.4647 0.3541 0.5377 0.0541  -0.0437 0.0096  488 ASN A O   
2843 C CB  . ASN A 192 ? 0.4329 0.3663 0.5076 0.0629  -0.0364 0.0242  488 ASN A CB  
2844 C CG  . ASN A 192 ? 0.4694 0.3947 0.5428 0.0692  -0.0497 0.0336  488 ASN A CG  
2845 O OD1 . ASN A 192 ? 0.5035 0.4127 0.5940 0.0834  -0.0650 0.0312  488 ASN A OD1 
2846 N ND2 . ASN A 192 ? 0.4593 0.3926 0.5134 0.0589  -0.0464 0.0434  488 ASN A ND2 
2853 N N   . TYR A 193 ? 0.4474 0.3760 0.5244 0.0299  -0.0295 0.0203  489 TYR A N   
2854 C CA  . TYR A 193 ? 0.4437 0.3704 0.5290 0.0243  -0.0355 0.0105  489 TYR A CA  
2855 C C   . TYR A 193 ? 0.4239 0.3601 0.5272 0.0023  -0.0325 0.0168  489 TYR A C   
2856 O O   . TYR A 193 ? 0.4156 0.3790 0.5431 -0.0023 -0.0327 0.0119  489 TYR A O   
2857 C CB  . TYR A 193 ? 0.3961 0.3436 0.4817 0.0339  -0.0345 -0.0002 489 TYR A CB  
2858 C CG  . TYR A 193 ? 0.4234 0.3645 0.4945 0.0509  -0.0298 -0.0091 489 TYR A CG  
2859 C CD1 . TYR A 193 ? 0.3954 0.3565 0.4699 0.0593  -0.0203 -0.0054 489 TYR A CD1 
2860 C CD2 . TYR A 193 ? 0.4844 0.3994 0.5405 0.0565  -0.0325 -0.0233 489 TYR A CD2 
2861 C CE1 . TYR A 193 ? 0.3762 0.3381 0.4492 0.0722  -0.0132 -0.0152 489 TYR A CE1 
2862 C CE2 . TYR A 193 ? 0.4613 0.3749 0.5122 0.0704  -0.0208 -0.0350 489 TYR A CE2 
2863 C CZ  . TYR A 193 ? 0.4158 0.3564 0.4802 0.0779  -0.0110 -0.0306 489 TYR A CZ  
2864 O OH  . TYR A 193 ? 0.4067 0.3523 0.4775 0.0892  0.0032  -0.0437 489 TYR A OH  
2874 N N   . PRO A 194 ? 0.4507 0.3630 0.5451 -0.0127 -0.0301 0.0276  490 PRO A N   
2875 C CA  . PRO A 194 ? 0.4920 0.4169 0.6074 -0.0382 -0.0188 0.0323  490 PRO A CA  
2876 C C   . PRO A 194 ? 0.4731 0.4020 0.6176 -0.0497 -0.0312 0.0235  490 PRO A C   
2877 O O   . PRO A 194 ? 0.4437 0.4037 0.6287 -0.0663 -0.0228 0.0217  490 PRO A O   
2878 C CB  . PRO A 194 ? 0.5294 0.4124 0.6113 -0.0541 -0.0147 0.0474  490 PRO A CB  
2879 C CG  . PRO A 194 ? 0.5348 0.3776 0.5923 -0.0360 -0.0357 0.0475  490 PRO A CG  
2880 C CD  . PRO A 194 ? 0.4965 0.3655 0.5630 -0.0087 -0.0388 0.0358  490 PRO A CD  
2888 N N   . GLN A 195 ? 0.5123 0.4103 0.6403 -0.0421 -0.0509 0.0160  491 GLN A N   
2889 C CA  . GLN A 195 ? 0.5550 0.4508 0.7027 -0.0545 -0.0680 0.0065  491 GLN A CA  
2890 C C   . GLN A 195 ? 0.5337 0.4631 0.7019 -0.0453 -0.0788 -0.0031 491 GLN A C   
2891 O O   . GLN A 195 ? 0.5567 0.4972 0.7552 -0.0586 -0.0960 -0.0086 491 GLN A O   
2892 C CB  . GLN A 195 ? 0.5947 0.4370 0.7082 -0.0503 -0.0845 -0.0009 491 GLN A CB  
2893 C CG  . GLN A 195 ? 0.6261 0.4244 0.7237 -0.0639 -0.0833 0.0091  491 GLN A CG  
2894 C CD  . GLN A 195 ? 0.6982 0.5013 0.8235 -0.0980 -0.0817 0.0151  491 GLN A CD  
2895 O OE1 . GLN A 195 ? 0.7276 0.5476 0.8823 -0.1105 -0.0946 0.0056  491 GLN A OE1 
2896 N NE2 . GLN A 195 ? 0.7236 0.5100 0.8386 -0.1156 -0.0667 0.0309  491 GLN A NE2 
2905 N N   . GLN A 196 ? 0.5524 0.4948 0.7047 -0.0245 -0.0726 -0.0044 492 GLN A N   
2906 C CA  . GLN A 196 ? 0.5810 0.5471 0.7445 -0.0161 -0.0839 -0.0101 492 GLN A CA  
2907 C C   . GLN A 196 ? 0.5209 0.5341 0.7367 -0.0203 -0.0720 -0.0052 492 GLN A C   
2908 O O   . GLN A 196 ? 0.4714 0.5014 0.6846 -0.0102 -0.0530 -0.0011 492 GLN A O   
2909 C CB  . GLN A 196 ? 0.6675 0.6223 0.7892 0.0040  -0.0786 -0.0136 492 GLN A CB  
2910 C CG  . GLN A 196 ? 0.8058 0.7666 0.9197 0.0101  -0.0942 -0.0180 492 GLN A CG  
2911 C CD  . GLN A 196 ? 0.9637 0.8824 1.0311 0.0072  -0.1145 -0.0286 492 GLN A CD  
2912 O OE1 . GLN A 196 ? 1.0185 0.9047 1.0491 0.0099  -0.1056 -0.0365 492 GLN A OE1 
2913 N NE2 . GLN A 196 ? 1.0342 0.9497 1.1022 0.0016  -0.1432 -0.0300 492 GLN A NE2 
2922 N N   . THR A 197 ? 0.5145 0.5494 0.7825 -0.0361 -0.0825 -0.0078 493 THR A N   
2923 C CA  . THR A 197 ? 0.4690 0.5518 0.8007 -0.0417 -0.0651 -0.0075 493 THR A CA  
2924 C C   . THR A 197 ? 0.4036 0.5089 0.7466 -0.0207 -0.0682 -0.0098 493 THR A C   
2925 O O   . THR A 197 ? 0.3749 0.4690 0.7051 -0.0098 -0.0980 -0.0127 493 THR A O   
2926 C CB  . THR A 197 ? 0.5086 0.6166 0.9096 -0.0614 -0.0801 -0.0132 493 THR A CB  
2927 O OG1 . THR A 197 ? 0.5759 0.6497 0.9543 -0.0810 -0.0872 -0.0116 493 THR A OG1 
2928 C CG2 . THR A 197 ? 0.4428 0.5997 0.9145 -0.0730 -0.0477 -0.0155 493 THR A CG2 
2936 N N   . GLU A 198 ? 0.3418 0.4709 0.7007 -0.0169 -0.0376 -0.0086 494 GLU A N   
2937 C CA  . GLU A 198 ? 0.3794 0.5302 0.7596 0.0015  -0.0379 -0.0121 494 GLU A CA  
2938 C C   . GLU A 198 ? 0.3465 0.4662 0.6630 0.0192  -0.0530 -0.0087 494 GLU A C   
2939 O O   . GLU A 198 ? 0.3436 0.4662 0.6676 0.0329  -0.0696 -0.0103 494 GLU A O   
2940 C CB  . GLU A 198 ? 0.5032 0.6871 0.9628 0.0032  -0.0622 -0.0199 494 GLU A CB  
2941 C CG  . GLU A 198 ? 0.6144 0.8265 1.1197 0.0211  -0.0570 -0.0256 494 GLU A CG  
2942 C CD  . GLU A 198 ? 0.6715 0.9160 1.2185 0.0141  -0.0093 -0.0326 494 GLU A CD  
2943 O OE1 . GLU A 198 ? 0.6946 0.9343 1.2223 -0.0067 0.0191  -0.0300 494 GLU A OE1 
2944 O OE2 . GLU A 198 ? 0.6870 0.9560 1.2811 0.0285  0.0002  -0.0413 494 GLU A OE2 
2951 N N   . LYS A 199 ? 0.3119 0.4078 0.3329 -0.0308 0.0472  0.0387  495 LYS A N   
2952 C CA  . LYS A 199 ? 0.3561 0.4395 0.3716 -0.0239 0.0448  0.0297  495 LYS A CA  
2953 C C   . LYS A 199 ? 0.2972 0.3922 0.3268 -0.0069 0.0461  0.0285  495 LYS A C   
2954 O O   . LYS A 199 ? 0.3134 0.4148 0.3504 -0.0039 0.0424  0.0269  495 LYS A O   
2955 C CB  . LYS A 199 ? 0.3479 0.3984 0.3450 -0.0199 0.0501  0.0228  495 LYS A CB  
2956 C CG  . LYS A 199 ? 0.3750 0.4154 0.3742 -0.0116 0.0521  0.0186  495 LYS A CG  
2957 C CD  . LYS A 199 ? 0.3971 0.4075 0.3896 -0.0045 0.0640  0.0196  495 LYS A CD  
2958 C CE  . LYS A 199 ? 0.3882 0.3935 0.3914 0.0055  0.0703  0.0203  495 LYS A CE  
2959 N NZ  . LYS A 199 ? 0.4011 0.3818 0.4117 0.0180  0.0882  0.0290  495 LYS A NZ  
2973 N N   . PHE A 200 ? 0.3480 0.4378 0.3729 0.0016  0.0522  0.0291  496 PHE A N   
2974 C CA  . PHE A 200 ? 0.3397 0.4242 0.3606 0.0128  0.0562  0.0272  496 PHE A CA  
2975 C C   . PHE A 200 ? 0.3832 0.4894 0.4267 0.0180  0.0618  0.0339  496 PHE A C   
2976 O O   . PHE A 200 ? 0.3466 0.4511 0.3917 0.0233  0.0587  0.0306  496 PHE A O   
2977 C CB  . PHE A 200 ? 0.3826 0.4466 0.3803 0.0154  0.0663  0.0279  496 PHE A CB  
2978 C CG  . PHE A 200 ? 0.3767 0.4165 0.3511 0.0226  0.0761  0.0252  496 PHE A CG  
2979 C CD1 . PHE A 200 ? 0.4382 0.4583 0.3921 0.0195  0.0633  0.0197  496 PHE A CD1 
2980 C CD2 . PHE A 200 ? 0.3513 0.3823 0.3207 0.0313  0.1009  0.0305  496 PHE A CD2 
2981 C CE1 . PHE A 200 ? 0.4590 0.4434 0.3764 0.0205  0.0720  0.0162  496 PHE A CE1 
2982 C CE2 . PHE A 200 ? 0.4469 0.4380 0.3805 0.0376  0.1170  0.0265  496 PHE A CE2 
2983 C CZ  . PHE A 200 ? 0.4706 0.4341 0.3718 0.0298  0.1010  0.0176  496 PHE A CZ  
2993 N N   . GLY A 201 ? 0.2990 0.4291 0.3656 0.0162  0.0695  0.0476  497 GLY A N   
2994 C CA  . GLY A 201 ? 0.3213 0.4797 0.4218 0.0223  0.0750  0.0631  497 GLY A CA  
2995 C C   . GLY A 201 ? 0.2762 0.4513 0.3876 0.0109  0.0560  0.0648  497 GLY A C   
2996 O O   . GLY A 201 ? 0.2907 0.4771 0.4190 0.0185  0.0568  0.0710  497 GLY A O   
3000 N N   . GLN A 202 ? 0.3191 0.4881 0.4141 -0.0082 0.0415  0.0594  498 GLN A N   
3001 C CA  . GLN A 202 ? 0.3465 0.5166 0.4353 -0.0231 0.0267  0.0593  498 GLN A CA  
3002 C C   . GLN A 202 ? 0.3418 0.4927 0.4179 -0.0113 0.0279  0.0444  498 GLN A C   
3003 O O   . GLN A 202 ? 0.3353 0.4920 0.4140 -0.0165 0.0203  0.0473  498 GLN A O   
3004 C CB  . GLN A 202 ? 0.3947 0.5420 0.4513 -0.0470 0.0186  0.0544  498 GLN A CB  
3005 C CG  . GLN A 202 ? 0.4165 0.5856 0.4834 -0.0697 0.0092  0.0740  498 GLN A CG  
3006 C CD  . GLN A 202 ? 0.4766 0.6799 0.5666 -0.0886 -0.0089 0.0982  498 GLN A CD  
3007 O OE1 . GLN A 202 ? 0.4706 0.6650 0.5473 -0.0938 -0.0169 0.0946  498 GLN A OE1 
3008 N NE2 . GLN A 202 ? 0.4757 0.7213 0.6045 -0.0998 -0.0160 0.1274  498 GLN A NE2 
3017 N N   . LEU A 203 ? 0.3630 0.4924 0.4261 0.0015  0.0350  0.0320  499 LEU A N   
3018 C CA  . LEU A 203 ? 0.2928 0.4102 0.3509 0.0102  0.0338  0.0238  499 LEU A CA  
3019 C C   . LEU A 203 ? 0.2912 0.4167 0.3605 0.0213  0.0373  0.0276  499 LEU A C   
3020 O O   . LEU A 203 ? 0.3533 0.4814 0.4270 0.0225  0.0331  0.0271  499 LEU A O   
3021 C CB  . LEU A 203 ? 0.3194 0.4169 0.3654 0.0153  0.0349  0.0178  499 LEU A CB  
3022 C CG  . LEU A 203 ? 0.3712 0.4542 0.4097 0.0103  0.0373  0.0164  499 LEU A CG  
3023 C CD1 . LEU A 203 ? 0.4011 0.4746 0.4405 0.0164  0.0358  0.0198  499 LEU A CD1 
3024 C CD2 . LEU A 203 ? 0.3362 0.4091 0.3711 0.0069  0.0408  0.0140  499 LEU A CD2 
3036 N N   . LEU A 204 ? 0.3135 0.4364 0.3834 0.0300  0.0491  0.0319  500 LEU A N   
3037 C CA  . LEU A 204 ? 0.3231 0.4392 0.3953 0.0430  0.0611  0.0358  500 LEU A CA  
3038 C C   . LEU A 204 ? 0.3687 0.5165 0.4764 0.0452  0.0604  0.0518  500 LEU A C   
3039 O O   . LEU A 204 ? 0.3932 0.5352 0.5044 0.0548  0.0660  0.0542  500 LEU A O   
3040 C CB  . LEU A 204 ? 0.3566 0.4530 0.4157 0.0526  0.0828  0.0389  500 LEU A CB  
3041 C CG  . LEU A 204 ? 0.3483 0.4064 0.3628 0.0467  0.0812  0.0262  500 LEU A CG  
3042 C CD1 . LEU A 204 ? 0.4229 0.4518 0.4137 0.0545  0.1074  0.0291  500 LEU A CD1 
3043 C CD2 . LEU A 204 ? 0.3906 0.4206 0.3755 0.0412  0.0691  0.0166  500 LEU A CD2 
3055 N N   . LEU A 205 ? 0.3569 0.5366 0.4888 0.0333  0.0515  0.0656  501 LEU A N   
3056 C CA  . LEU A 205 ? 0.3743 0.5889 0.5416 0.0286  0.0436  0.0878  501 LEU A CA  
3057 C C   . LEU A 205 ? 0.3768 0.5838 0.5316 0.0230  0.0304  0.0799  501 LEU A C   
3058 O O   . LEU A 205 ? 0.3927 0.6202 0.5729 0.0254  0.0271  0.0971  501 LEU A O   
3059 C CB  . LEU A 205 ? 0.4307 0.6739 0.6123 0.0050  0.0274  0.1043  501 LEU A CB  
3060 C CG  . LEU A 205 ? 0.4666 0.7406 0.6871 0.0091  0.0384  0.1292  501 LEU A CG  
3061 C CD1 . LEU A 205 ? 0.4912 0.7831 0.7104 -0.0228 0.0162  0.1409  501 LEU A CD1 
3062 C CD2 . LEU A 205 ? 0.4978 0.8083 0.7753 0.0256  0.0500  0.1621  501 LEU A CD2 
3074 N N   . ARG A 206 ? 0.3556 0.5349 0.4760 0.0165  0.0245  0.0579  502 ARG A N   
3075 C CA  . ARG A 206 ? 0.3506 0.5211 0.4585 0.0102  0.0154  0.0517  502 ARG A CA  
3076 C C   . ARG A 206 ? 0.3671 0.5271 0.4768 0.0265  0.0223  0.0473  502 ARG A C   
3077 O O   . ARG A 206 ? 0.3397 0.4999 0.4486 0.0234  0.0160  0.0481  502 ARG A O   
3078 C CB  . ARG A 206 ? 0.3913 0.5353 0.4689 0.0011  0.0142  0.0351  502 ARG A CB  
3079 C CG  . ARG A 206 ? 0.4637 0.6001 0.5267 -0.0121 0.0140  0.0341  502 ARG A CG  
3080 C CD  . ARG A 206 ? 0.4931 0.6232 0.5343 -0.0385 0.0033  0.0403  502 ARG A CD  
3081 N NE  . ARG A 206 ? 0.4515 0.6175 0.5180 -0.0502 -0.0112 0.0634  502 ARG A NE  
3082 C CZ  . ARG A 206 ? 0.5117 0.6971 0.5894 -0.0644 -0.0188 0.0791  502 ARG A CZ  
3083 N NH1 . ARG A 206 ? 0.5632 0.7296 0.6214 -0.0691 -0.0128 0.0698  502 ARG A NH1 
3084 N NH2 . ARG A 206 ? 0.5390 0.7662 0.6533 -0.0743 -0.0329 0.1087  502 ARG A NH2 
3098 N N   . LEU A 207 ? 0.3559 0.4997 0.4600 0.0406  0.0356  0.0428  503 LEU A N   
3099 C CA  . LEU A 207 ? 0.3615 0.4818 0.4525 0.0503  0.0417  0.0375  503 LEU A CA  
3100 C C   . LEU A 207 ? 0.3249 0.4577 0.4394 0.0601  0.0486  0.0533  503 LEU A C   
3101 O O   . LEU A 207 ? 0.3512 0.4763 0.4607 0.0599  0.0436  0.0509  503 LEU A O   
3102 C CB  . LEU A 207 ? 0.3744 0.4598 0.4362 0.0562  0.0542  0.0295  503 LEU A CB  
3103 C CG  . LEU A 207 ? 0.3702 0.4420 0.4096 0.0453  0.0432  0.0187  503 LEU A CG  
3104 C CD1 . LEU A 207 ? 0.4139 0.4433 0.4125 0.0449  0.0521  0.0137  503 LEU A CD1 
3105 C CD2 . LEU A 207 ? 0.3611 0.4354 0.4015 0.0368  0.0276  0.0148  503 LEU A CD2 
3117 N N   . PRO A 208 ? 0.3248 0.4794 0.4709 0.0696  0.0607  0.0736  504 PRO A N   
3118 C CA  . PRO A 208 ? 0.3296 0.5050 0.5110 0.0794  0.0654  0.0970  504 PRO A CA  
3119 C C   . PRO A 208 ? 0.3246 0.5274 0.5172 0.0611  0.0388  0.1044  504 PRO A C   
3120 O O   . PRO A 208 ? 0.3109 0.5163 0.5146 0.0661  0.0377  0.1143  504 PRO A O   
3121 C CB  . PRO A 208 ? 0.3262 0.5322 0.5523 0.0903  0.0813  0.1251  504 PRO A CB  
3122 C CG  . PRO A 208 ? 0.3345 0.5131 0.5320 0.0937  0.0962  0.1089  504 PRO A CG  
3123 C CD  . PRO A 208 ? 0.3015 0.4626 0.4572 0.0744  0.0739  0.0806  504 PRO A CD  
3131 N N   . GLU A 209 ? 0.3483 0.5630 0.5302 0.0386  0.0195  0.0996  505 GLU A N   
3132 C CA  . GLU A 209 ? 0.3639 0.5879 0.5372 0.0161  -0.0028 0.1042  505 GLU A CA  
3133 C C   . GLU A 209 ? 0.2982 0.4918 0.4404 0.0170  -0.0027 0.0831  505 GLU A C   
3134 O O   . GLU A 209 ? 0.2853 0.4824 0.4284 0.0115  -0.0113 0.0910  505 GLU A O   
3135 C CB  . GLU A 209 ? 0.4089 0.6326 0.5599 -0.0099 -0.0169 0.1007  505 GLU A CB  
3136 C CG  . GLU A 209 ? 0.4371 0.6950 0.6198 -0.0177 -0.0222 0.1256  505 GLU A CG  
3137 C CD  . GLU A 209 ? 0.4868 0.7313 0.6349 -0.0459 -0.0344 0.1181  505 GLU A CD  
3138 O OE1 . GLU A 209 ? 0.5138 0.7175 0.6146 -0.0521 -0.0308 0.0918  505 GLU A OE1 
3139 O OE2 . GLU A 209 ? 0.5100 0.7829 0.6792 -0.0616 -0.0453 0.1414  505 GLU A OE2 
3146 N N   . ILE A 210 ? 0.2929 0.4597 0.4112 0.0223  0.0057  0.0601  506 ILE A N   
3147 C CA  . ILE A 210 ? 0.3264 0.4713 0.4257 0.0230  0.0061  0.0461  506 ILE A CA  
3148 C C   . ILE A 210 ? 0.3255 0.4646 0.4329 0.0360  0.0112  0.0512  506 ILE A C   
3149 O O   . ILE A 210 ? 0.3536 0.4868 0.4550 0.0324  0.0066  0.0504  506 ILE A O   
3150 C CB  . ILE A 210 ? 0.3363 0.4628 0.4211 0.0254  0.0114  0.0306  506 ILE A CB  
3151 C CG1 . ILE A 210 ? 0.3722 0.4968 0.4468 0.0144  0.0110  0.0265  506 ILE A CG1 
3152 C CG2 . ILE A 210 ? 0.3408 0.4532 0.4185 0.0257  0.0107  0.0244  506 ILE A CG2 
3153 C CD1 . ILE A 210 ? 0.3711 0.4842 0.4421 0.0190  0.0165  0.0186  506 ILE A CD1 
3165 N N   . ARG A 211 ? 0.3494 0.4830 0.4654 0.0514  0.0247  0.0566  507 ARG A N   
3166 C CA  . ARG A 211 ? 0.3474 0.4599 0.4603 0.0646  0.0362  0.0603  507 ARG A CA  
3167 C C   . ARG A 211 ? 0.3821 0.5186 0.5238 0.0668  0.0317  0.0816  507 ARG A C   
3168 O O   . ARG A 211 ? 0.2913 0.4121 0.4253 0.0697  0.0325  0.0815  507 ARG A O   
3169 C CB  . ARG A 211 ? 0.3994 0.4872 0.5055 0.0813  0.0603  0.0624  507 ARG A CB  
3170 C CG  . ARG A 211 ? 0.5507 0.5946 0.6347 0.0937  0.0789  0.0623  507 ARG A CG  
3171 C CD  . ARG A 211 ? 0.7317 0.7275 0.7836 0.1057  0.1076  0.0579  507 ARG A CD  
3172 N NE  . ARG A 211 ? 0.9582 0.8943 0.9733 0.1153  0.1304  0.0563  507 ARG A NE  
3173 C CZ  . ARG A 211 ? 1.1244 1.0083 1.0810 0.0992  0.1231  0.0383  507 ARG A CZ  
3174 N NH1 . ARG A 211 ? 1.1597 1.0531 1.1000 0.0753  0.0935  0.0246  507 ARG A NH1 
3175 N NH2 . ARG A 211 ? 1.2249 1.0454 1.1402 0.1061  0.1464  0.0376  507 ARG A NH2 
3188 N N   . ALA A 212 ? 0.2358 0.4111 0.4110 0.0626  0.0244  0.1035  508 ALA A N   
3189 C CA  . ALA A 212 ? 0.2970 0.5010 0.5022 0.0586  0.0130  0.1308  508 ALA A CA  
3190 C C   . ALA A 212 ? 0.3246 0.5202 0.5009 0.0379  -0.0065 0.1199  508 ALA A C   
3191 O O   . ALA A 212 ? 0.3127 0.5073 0.4939 0.0395  -0.0099 0.1301  508 ALA A O   
3192 C CB  . ALA A 212 ? 0.2695 0.5202 0.5145 0.0486  0.0011  0.1610  508 ALA A CB  
3198 N N   . ILE A 213 ? 0.3062 0.4909 0.4506 0.0199  -0.0150 0.1002  509 ILE A N   
3199 C CA  . ILE A 213 ? 0.2836 0.4504 0.3953 0.0029  -0.0239 0.0890  509 ILE A CA  
3200 C C   . ILE A 213 ? 0.3054 0.4496 0.4088 0.0153  -0.0141 0.0762  509 ILE A C   
3201 O O   . ILE A 213 ? 0.3178 0.4559 0.4121 0.0089  -0.0194 0.0796  509 ILE A O   
3202 C CB  . ILE A 213 ? 0.3321 0.4816 0.4114 -0.0125 -0.0235 0.0714  509 ILE A CB  
3203 C CG1 . ILE A 213 ? 0.3556 0.5201 0.4321 -0.0327 -0.0370 0.0854  509 ILE A CG1 
3204 C CG2 . ILE A 213 ? 0.3786 0.5001 0.4223 -0.0251 -0.0214 0.0601  509 ILE A CG2 
3205 C CD1 . ILE A 213 ? 0.3859 0.5247 0.4267 -0.0456 -0.0315 0.0684  509 ILE A CD1 
3217 N N   . SER A 214 ? 0.2870 0.4156 0.3883 0.0292  -0.0019 0.0629  510 SER A N   
3218 C CA  . SER A 214 ? 0.3039 0.4083 0.3919 0.0336  0.0027  0.0533  510 SER A CA  
3219 C C   . SER A 214 ? 0.3378 0.4341 0.4333 0.0446  0.0076  0.0655  510 SER A C   
3220 O O   . SER A 214 ? 0.3352 0.4159 0.4191 0.0415  0.0059  0.0627  510 SER A O   
3221 C CB  . SER A 214 ? 0.3425 0.4278 0.4181 0.0377  0.0089  0.0405  510 SER A CB  
3222 O OG  . SER A 214 ? 0.4005 0.4741 0.4758 0.0506  0.0207  0.0440  510 SER A OG  
3228 N N   . MET A 215 ? 0.3135 0.4197 0.4317 0.0586  0.0166  0.0820  511 MET A N   
3229 C CA  . MET A 215 ? 0.3736 0.4714 0.5054 0.0730  0.0266  0.0993  511 MET A CA  
3230 C C   . MET A 215 ? 0.3680 0.4892 0.5128 0.0615  0.0089  0.1151  511 MET A C   
3231 O O   . MET A 215 ? 0.4209 0.5249 0.5597 0.0651  0.0112  0.1188  511 MET A O   
3232 C CB  . MET A 215 ? 0.4343 0.5432 0.5999 0.0940  0.0456  0.1214  511 MET A CB  
3233 C CG  . MET A 215 ? 0.5954 0.6629 0.7356 0.1077  0.0713  0.1072  511 MET A CG  
3234 S SD  . MET A 215 ? 0.7390 0.8047 0.9183 0.1406  0.1090  0.1382  511 MET A SD  
3235 C CE  . MET A 215 ? 0.7289 0.8792 0.9793 0.1331  0.0869  0.1719  511 MET A CE  
3245 N N   . GLN A 216 ? 0.3376 0.4917 0.4928 0.0441  -0.0095 0.1253  512 GLN A N   
3246 C CA  . GLN A 216 ? 0.3662 0.5330 0.5177 0.0253  -0.0291 0.1397  512 GLN A CA  
3247 C C   . GLN A 216 ? 0.3411 0.4784 0.4524 0.0138  -0.0301 0.1164  512 GLN A C   
3248 O O   . GLN A 216 ? 0.3390 0.4707 0.4433 0.0078  -0.0365 0.1246  512 GLN A O   
3249 C CB  . GLN A 216 ? 0.3602 0.5537 0.5119 0.0006  -0.0499 0.1533  512 GLN A CB  
3250 C CG  . GLN A 216 ? 0.3688 0.6048 0.5735 0.0070  -0.0546 0.1889  512 GLN A CG  
3251 C CD  . GLN A 216 ? 0.4519 0.7112 0.6495 -0.0260 -0.0808 0.2039  512 GLN A CD  
3252 O OE1 . GLN A 216 ? 0.5125 0.7579 0.6811 -0.0368 -0.0794 0.1823  512 GLN A OE1 
3253 N NE2 . GLN A 216 ? 0.4751 0.7672 0.6966 -0.0450 -0.1061 0.2438  512 GLN A NE2 
3262 N N   . ALA A 217 ? 0.3439 0.4648 0.4336 0.0113  -0.0228 0.0914  513 ALA A N   
3263 C CA  . ALA A 217 ? 0.3975 0.4967 0.4620 0.0033  -0.0194 0.0757  513 ALA A CA  
3264 C C   . ALA A 217 ? 0.3733 0.4557 0.4398 0.0138  -0.0138 0.0746  513 ALA A C   
3265 O O   . ALA A 217 ? 0.3524 0.4248 0.4071 0.0062  -0.0157 0.0752  513 ALA A O   
3266 C CB  . ALA A 217 ? 0.3509 0.4430 0.4066 0.0020  -0.0111 0.0579  513 ALA A CB  
3272 N N   . GLU A 218 ? 0.3472 0.4185 0.4207 0.0291  -0.0050 0.0729  514 GLU A N   
3273 C CA  . GLU A 218 ? 0.3814 0.4225 0.4427 0.0349  0.0015  0.0712  514 GLU A CA  
3274 C C   . GLU A 218 ? 0.3959 0.4370 0.4663 0.0400  0.0008  0.0893  514 GLU A C   
3275 O O   . GLU A 218 ? 0.4209 0.4426 0.4771 0.0353  -0.0001 0.0881  514 GLU A O   
3276 C CB  . GLU A 218 ? 0.4421 0.4550 0.4927 0.0475  0.0154  0.0663  514 GLU A CB  
3277 C CG  . GLU A 218 ? 0.4601 0.4609 0.4917 0.0378  0.0126  0.0502  514 GLU A CG  
3278 C CD  . GLU A 218 ? 0.5002 0.4520 0.4980 0.0424  0.0254  0.0443  514 GLU A CD  
3279 O OE1 . GLU A 218 ? 0.5292 0.4404 0.5029 0.0453  0.0349  0.0465  514 GLU A OE1 
3280 O OE2 . GLU A 218 ? 0.4895 0.4358 0.4774 0.0416  0.0279  0.0375  514 GLU A OE2 
3287 N N   . GLU A 219 ? 0.3619 0.4272 0.4606 0.0491  0.0004  0.1105  515 GLU A N   
3288 C CA  . GLU A 219 ? 0.4381 0.5104 0.5552 0.0545  -0.0023 0.1359  515 GLU A CA  
3289 C C   . GLU A 219 ? 0.4130 0.4924 0.5137 0.0321  -0.0208 0.1368  515 GLU A C   
3290 O O   . GLU A 219 ? 0.4250 0.4925 0.5225 0.0326  -0.0220 0.1468  515 GLU A O   
3291 C CB  . GLU A 219 ? 0.4696 0.5796 0.6323 0.0646  -0.0038 0.1673  515 GLU A CB  
3292 C CG  . GLU A 219 ? 0.5767 0.6726 0.7597 0.0933  0.0246  0.1743  515 GLU A CG  
3293 C CD  . GLU A 219 ? 0.7448 0.8184 0.9449 0.1170  0.0457  0.1970  515 GLU A CD  
3294 O OE1 . GLU A 219 ? 0.8140 0.9251 1.0617 0.1221  0.0381  0.2354  515 GLU A OE1 
3295 O OE2 . GLU A 219 ? 0.8065 0.8217 0.9698 0.1284  0.0695  0.1791  515 GLU A OE2 
3302 N N   . TYR A 220 ? 0.4491 0.5404 0.5334 0.0123  -0.0318 0.1266  516 TYR A N   
3303 C CA  . TYR A 220 ? 0.4211 0.5055 0.4766 -0.0101 -0.0423 0.1255  516 TYR A CA  
3304 C C   . TYR A 220 ? 0.4318 0.4894 0.4681 -0.0101 -0.0316 0.1079  516 TYR A C   
3305 O O   . TYR A 220 ? 0.4221 0.4687 0.4455 -0.0178 -0.0349 0.1144  516 TYR A O   
3306 C CB  . TYR A 220 ? 0.4170 0.5039 0.4479 -0.0305 -0.0480 0.1173  516 TYR A CB  
3307 C CG  . TYR A 220 ? 0.4674 0.5319 0.4535 -0.0555 -0.0520 0.1153  516 TYR A CG  
3308 C CD1 . TYR A 220 ? 0.5046 0.5722 0.4759 -0.0758 -0.0724 0.1386  516 TYR A CD1 
3309 C CD2 . TYR A 220 ? 0.4579 0.4960 0.4165 -0.0595 -0.0338 0.0941  516 TYR A CD2 
3310 C CE1 . TYR A 220 ? 0.5887 0.6241 0.5050 -0.1021 -0.0741 0.1359  516 TYR A CE1 
3311 C CE2 . TYR A 220 ? 0.5318 0.5392 0.4429 -0.0807 -0.0291 0.0924  516 TYR A CE2 
3312 C CZ  . TYR A 220 ? 0.5880 0.5892 0.4709 -0.1033 -0.0492 0.1109  516 TYR A CZ  
3313 O OH  . TYR A 220 ? 0.6860 0.6454 0.5077 -0.1280 -0.0430 0.1083  516 TYR A OH  
3323 N N   . LEU A 221 ? 0.4430 0.4922 0.4793 -0.0040 -0.0210 0.0894  517 LEU A N   
3324 C CA  . LEU A 221 ? 0.4405 0.4722 0.4675 -0.0077 -0.0147 0.0798  517 LEU A CA  
3325 C C   . LEU A 221 ? 0.4258 0.4369 0.4513 -0.0006 -0.0142 0.0860  517 LEU A C   
3326 O O   . LEU A 221 ? 0.4396 0.4375 0.4548 -0.0089 -0.0142 0.0867  517 LEU A O   
3327 C CB  . LEU A 221 ? 0.3812 0.4142 0.4145 -0.0063 -0.0092 0.0669  517 LEU A CB  
3328 C CG  . LEU A 221 ? 0.3639 0.4100 0.3985 -0.0110 -0.0037 0.0608  517 LEU A CG  
3329 C CD1 . LEU A 221 ? 0.3921 0.4434 0.4411 -0.0076 -0.0008 0.0544  517 LEU A CD1 
3330 C CD2 . LEU A 221 ? 0.3878 0.4264 0.4081 -0.0222 0.0057  0.0618  517 LEU A CD2 
3342 N N   . TYR A 222 ? 0.4455 0.4481 0.4788 0.0152  -0.0096 0.0916  518 TYR A N   
3343 C CA  . TYR A 222 ? 0.4770 0.4471 0.5014 0.0242  -0.0023 0.0987  518 TYR A CA  
3344 C C   . TYR A 222 ? 0.4757 0.4534 0.5069 0.0225  -0.0086 0.1174  518 TYR A C   
3345 O O   . TYR A 222 ? 0.5020 0.4540 0.5182 0.0194  -0.0068 0.1193  518 TYR A O   
3346 C CB  . TYR A 222 ? 0.5273 0.4803 0.5577 0.0455  0.0134  0.1041  518 TYR A CB  
3347 C CG  . TYR A 222 ? 0.6346 0.5297 0.6365 0.0541  0.0304  0.1037  518 TYR A CG  
3348 C CD1 . TYR A 222 ? 0.7359 0.5855 0.6953 0.0430  0.0344  0.0851  518 TYR A CD1 
3349 C CD2 . TYR A 222 ? 0.7058 0.5866 0.7190 0.0708  0.0423  0.1247  518 TYR A CD2 
3350 C CE1 . TYR A 222 ? 0.8217 0.6026 0.7376 0.0450  0.0508  0.0832  518 TYR A CE1 
3351 C CE2 . TYR A 222 ? 0.7879 0.6024 0.7658 0.0792  0.0637  0.1234  518 TYR A CE2 
3352 C CZ  . TYR A 222 ? 0.8524 0.6120 0.7753 0.0647  0.0683  0.1006  518 TYR A CZ  
3353 O OH  . TYR A 222 ? 0.9589 0.6375 0.8299 0.0674  0.0903  0.0980  518 TYR A OH  
3363 N N   . TYR A 223 ? 0.4718 0.4832 0.5223 0.0204  -0.0190 0.1335  519 TYR A N   
3364 C CA  . TYR A 223 ? 0.4530 0.4730 0.5052 0.0119  -0.0311 0.1548  519 TYR A CA  
3365 C C   . TYR A 223 ? 0.4525 0.4580 0.4727 -0.0084 -0.0347 0.1421  519 TYR A C   
3366 O O   . TYR A 223 ? 0.4576 0.4467 0.4689 -0.0110 -0.0356 0.1505  519 TYR A O   
3367 C CB  . TYR A 223 ? 0.4159 0.4731 0.4847 0.0022  -0.0484 0.1756  519 TYR A CB  
3368 C CG  . TYR A 223 ? 0.4534 0.5194 0.5179 -0.0141 -0.0674 0.2021  519 TYR A CG  
3369 C CD1 . TYR A 223 ? 0.4563 0.5313 0.5549 0.0007  -0.0693 0.2351  519 TYR A CD1 
3370 C CD2 . TYR A 223 ? 0.5258 0.5853 0.5481 -0.0448 -0.0809 0.1963  519 TYR A CD2 
3371 C CE1 . TYR A 223 ? 0.5468 0.6322 0.6427 -0.0169 -0.0907 0.2639  519 TYR A CE1 
3372 C CE2 . TYR A 223 ? 0.5558 0.6164 0.5627 -0.0653 -0.1008 0.2213  519 TYR A CE2 
3373 C CZ  . TYR A 223 ? 0.5939 0.6716 0.6404 -0.0523 -0.1089 0.2562  519 TYR A CZ  
3374 O OH  . TYR A 223 ? 0.6888 0.7702 0.7219 -0.0750 -0.1326 0.2856  519 TYR A OH  
3384 N N   . LYS A 224 ? 0.4810 0.4903 0.4858 -0.0213 -0.0328 0.1241  520 LYS A N   
3385 C CA  . LYS A 224 ? 0.5126 0.5080 0.4923 -0.0375 -0.0283 0.1158  520 LYS A CA  
3386 C C   . LYS A 224 ? 0.4772 0.4543 0.4587 -0.0341 -0.0210 0.1104  520 LYS A C   
3387 O O   . LYS A 224 ? 0.5225 0.4872 0.4900 -0.0444 -0.0193 0.1141  520 LYS A O   
3388 C CB  . LYS A 224 ? 0.5170 0.5160 0.4866 -0.0455 -0.0187 0.1009  520 LYS A CB  
3389 C CG  . LYS A 224 ? 0.5530 0.5612 0.5108 -0.0535 -0.0260 0.1036  520 LYS A CG  
3390 C CD  . LYS A 224 ? 0.6576 0.6434 0.5677 -0.0778 -0.0254 0.1060  520 LYS A CD  
3391 C CE  . LYS A 224 ? 0.7676 0.7481 0.6633 -0.0895 -0.0421 0.1259  520 LYS A CE  
3392 N NZ  . LYS A 224 ? 0.8904 0.8482 0.7300 -0.1208 -0.0521 0.1336  520 LYS A NZ  
3406 N N   . HIS A 225 ? 0.4776 0.4480 0.4700 -0.0237 -0.0174 0.1028  521 HIS A N   
3407 C CA  . HIS A 225 ? 0.4801 0.4257 0.4642 -0.0280 -0.0152 0.0996  521 HIS A CA  
3408 C C   . HIS A 225 ? 0.5174 0.4366 0.4898 -0.0237 -0.0155 0.1114  521 HIS A C   
3409 O O   . HIS A 225 ? 0.5412 0.4462 0.5019 -0.0352 -0.0164 0.1144  521 HIS A O   
3410 C CB  . HIS A 225 ? 0.5263 0.4583 0.5085 -0.0239 -0.0138 0.0900  521 HIS A CB  
3411 C CG  . HIS A 225 ? 0.5770 0.4720 0.5367 -0.0354 -0.0157 0.0887  521 HIS A CG  
3412 N ND1 . HIS A 225 ? 0.6144 0.5151 0.5771 -0.0552 -0.0218 0.0922  521 HIS A ND1 
3413 C CD2 . HIS A 225 ? 0.6569 0.5026 0.5857 -0.0328 -0.0110 0.0863  521 HIS A CD2 
3414 C CE1 . HIS A 225 ? 0.6715 0.5317 0.6059 -0.0684 -0.0268 0.0925  521 HIS A CE1 
3415 N NE2 . HIS A 225 ? 0.7261 0.5455 0.6324 -0.0557 -0.0191 0.0868  521 HIS A NE2 
3423 N N   . LEU A 226 ? 0.5056 0.4186 0.4855 -0.0057 -0.0124 0.1216  522 LEU A N   
3424 C CA  . LEU A 226 ? 0.5538 0.4440 0.5302 0.0027  -0.0093 0.1389  522 LEU A CA  
3425 C C   . LEU A 226 ? 0.5298 0.4365 0.5045 -0.0110 -0.0208 0.1512  522 LEU A C   
3426 O O   . LEU A 226 ? 0.5889 0.4724 0.5519 -0.0133 -0.0202 0.1604  522 LEU A O   
3427 C CB  . LEU A 226 ? 0.5743 0.4683 0.5755 0.0276  -0.0008 0.1570  522 LEU A CB  
3428 C CG  . LEU A 226 ? 0.6291 0.4914 0.6224 0.0440  0.0186  0.1468  522 LEU A CG  
3429 C CD1 . LEU A 226 ? 0.6501 0.5231 0.6793 0.0721  0.0328  0.1715  522 LEU A CD1 
3430 C CD2 . LEU A 226 ? 0.6822 0.4775 0.6312 0.0405  0.0317  0.1362  522 LEU A CD2 
3442 N N   . ASN A 227 ? 0.6551 0.6128 0.5053 -0.1588 -0.0943 0.2731  523 ASN A N   
3443 C CA  . ASN A 227 ? 0.6962 0.6610 0.5107 -0.1758 -0.0911 0.2851  523 ASN A CA  
3444 C C   . ASN A 227 ? 0.7059 0.6955 0.5143 -0.1882 -0.0711 0.2760  523 ASN A C   
3445 O O   . ASN A 227 ? 0.7495 0.7450 0.5273 -0.2036 -0.0647 0.2877  523 ASN A O   
3446 C CB  . ASN A 227 ? 0.7738 0.7409 0.5611 -0.1680 -0.0986 0.2765  523 ASN A CB  
3447 C CG  . ASN A 227 ? 0.8501 0.8087 0.6132 -0.1751 -0.1032 0.2844  523 ASN A CG  
3448 O OD1 . ASN A 227 ? 0.8574 0.8049 0.6335 -0.1795 -0.1067 0.2963  523 ASN A OD1 
3449 N ND2 . ASN A 227 ? 0.9181 0.8790 0.6432 -0.1758 -0.1043 0.2769  523 ASN A ND2 
3456 N N   . GLY A 228 ? 0.6523 0.6568 0.4894 -0.1821 -0.0613 0.2569  524 GLY A N   
3457 C CA  . GLY A 228 ? 0.6753 0.7083 0.5156 -0.1931 -0.0422 0.2502  524 GLY A CA  
3458 C C   . GLY A 228 ? 0.7168 0.7763 0.5380 -0.1858 -0.0291 0.2294  524 GLY A C   
3459 O O   . GLY A 228 ? 0.7512 0.8366 0.5654 -0.1955 -0.0104 0.2291  524 GLY A O   
3463 N N   . ASP A 229 ? 0.6916 0.7452 0.5045 -0.1683 -0.0379 0.2128  525 ASP A N   
3464 C CA  . ASP A 229 ? 0.6837 0.7554 0.4726 -0.1593 -0.0283 0.1924  525 ASP A CA  
3465 C C   . ASP A 229 ? 0.6325 0.7220 0.4518 -0.1443 -0.0231 0.1653  525 ASP A C   
3466 O O   . ASP A 229 ? 0.6418 0.7479 0.4454 -0.1353 -0.0137 0.1467  525 ASP A O   
3467 C CB  . ASP A 229 ? 0.7082 0.7582 0.4600 -0.1521 -0.0450 0.1934  525 ASP A CB  
3468 C CG  . ASP A 229 ? 0.7736 0.8056 0.4891 -0.1675 -0.0515 0.2195  525 ASP A CG  
3469 O OD1 . ASP A 229 ? 0.8379 0.8804 0.5395 -0.1825 -0.0365 0.2306  525 ASP A OD1 
3470 O OD2 . ASP A 229 ? 0.7781 0.7861 0.4802 -0.1654 -0.0723 0.2305  525 ASP A OD2 
3475 N N   . VAL A 230 ? 0.5820 0.6655 0.4416 -0.1407 -0.0297 0.1624  526 VAL A N   
3476 C CA  . VAL A 230 ? 0.5726 0.6693 0.4614 -0.1278 -0.0277 0.1381  526 VAL A CA  
3477 C C   . VAL A 230 ? 0.6263 0.7478 0.5453 -0.1389 -0.0128 0.1386  526 VAL A C   
3478 O O   . VAL A 230 ? 0.6812 0.7908 0.6214 -0.1497 -0.0174 0.1528  526 VAL A O   
3479 C CB  . VAL A 230 ? 0.5196 0.5908 0.4293 -0.1163 -0.0450 0.1341  526 VAL A CB  
3480 C CG1 . VAL A 230 ? 0.5100 0.5922 0.4457 -0.1040 -0.0445 0.1089  526 VAL A CG1 
3481 C CG2 . VAL A 230 ? 0.5476 0.5987 0.4330 -0.1073 -0.0599 0.1389  526 VAL A CG2 
3491 N N   . PRO A 231 ? 0.6002 0.7551 0.5227 -0.1367 0.0041  0.1253  527 PRO A N   
3492 C CA  . PRO A 231 ? 0.6132 0.7964 0.5714 -0.1481 0.0176  0.1289  527 PRO A CA  
3493 C C   . PRO A 231 ? 0.5927 0.7678 0.5929 -0.1446 0.0054  0.1192  527 PRO A C   
3494 O O   . PRO A 231 ? 0.5650 0.7151 0.5656 -0.1313 -0.0103 0.1072  527 PRO A O   
3495 C CB  . PRO A 231 ? 0.5998 0.8208 0.5518 -0.1405 0.0386  0.1145  527 PRO A CB  
3496 C CG  . PRO A 231 ? 0.6370 0.8434 0.5359 -0.1314 0.0378  0.1105  527 PRO A CG  
3497 C CD  . PRO A 231 ? 0.6144 0.7824 0.5060 -0.1245 0.0126  0.1093  527 PRO A CD  
3505 N N   . TYR A 232 ? 0.6699 0.8664 0.7049 -0.1578 0.0126  0.1261  528 TYR A N   
3506 C CA  . TYR A 232 ? 0.7238 0.9089 0.7967 -0.1593 -0.0007 0.1207  528 TYR A CA  
3507 C C   . TYR A 232 ? 0.6565 0.8418 0.7404 -0.1395 -0.0076 0.0932  528 TYR A C   
3508 O O   . TYR A 232 ? 0.6646 0.8843 0.7621 -0.1327 0.0041  0.0794  528 TYR A O   
3509 C CB  . TYR A 232 ? 0.8700 1.0864 0.9797 -0.1780 0.0090  0.1334  528 TYR A CB  
3510 C CG  . TYR A 232 ? 0.9662 1.1818 1.1185 -0.1792 -0.0031 0.1242  528 TYR A CG  
3511 C CD1 . TYR A 232 ? 1.0153 1.1923 1.1780 -0.1892 -0.0230 0.1333  528 TYR A CD1 
3512 C CD2 . TYR A 232 ? 0.9962 1.2468 1.1766 -0.1702 0.0044  0.1070  528 TYR A CD2 
3513 C CE1 . TYR A 232 ? 1.0386 1.2093 1.2351 -0.1916 -0.0368 0.1253  528 TYR A CE1 
3514 C CE2 . TYR A 232 ? 1.0155 1.2640 1.2350 -0.1728 -0.0093 0.0999  528 TYR A CE2 
3515 C CZ  . TYR A 232 ? 1.0428 1.2501 1.2686 -0.1843 -0.0306 0.1092  528 TYR A CZ  
3516 O OH  . TYR A 232 ? 1.0519 1.2516 1.3116 -0.1880 -0.0468 0.1025  528 TYR A OH  
3526 N N   . ASN A 233 ? 0.6116 0.7581 0.6891 -0.1294 -0.0260 0.0860  529 ASN A N   
3527 C CA  . ASN A 233 ? 0.5545 0.6948 0.6411 -0.1121 -0.0356 0.0617  529 ASN A CA  
3528 C C   . ASN A 233 ? 0.4788 0.5749 0.5697 -0.1102 -0.0543 0.0629  529 ASN A C   
3529 O O   . ASN A 233 ? 0.5026 0.5691 0.5710 -0.0998 -0.0626 0.0638  529 ASN A O   
3530 C CB  . ASN A 233 ? 0.5438 0.6842 0.6005 -0.0951 -0.0351 0.0488  529 ASN A CB  
3531 C CG  . ASN A 233 ? 0.5866 0.7650 0.6347 -0.0926 -0.0173 0.0421  529 ASN A CG  
3532 O OD1 . ASN A 233 ? 0.6085 0.8121 0.6776 -0.0855 -0.0117 0.0256  529 ASN A OD1 
3533 N ND2 . ASN A 233 ? 0.5995 0.7800 0.6145 -0.0973 -0.0084 0.0549  529 ASN A ND2 
3540 N N   . ASN A 234 ? 0.4784 0.5695 0.5976 -0.1199 -0.0610 0.0636  530 ASN A N   
3541 C CA  . ASN A 234 ? 0.5391 0.5821 0.6556 -0.1209 -0.0776 0.0684  530 ASN A CA  
3542 C C   . ASN A 234 ? 0.4889 0.5018 0.5904 -0.1002 -0.0883 0.0517  530 ASN A C   
3543 O O   . ASN A 234 ? 0.5049 0.4782 0.5876 -0.0938 -0.0957 0.0585  530 ASN A O   
3544 C CB  . ASN A 234 ? 0.6100 0.6508 0.7575 -0.1356 -0.0861 0.0704  530 ASN A CB  
3545 C CG  . ASN A 234 ? 0.7032 0.7590 0.8629 -0.1587 -0.0800 0.0943  530 ASN A CG  
3546 O OD1 . ASN A 234 ? 0.7571 0.8122 0.8966 -0.1636 -0.0721 0.1103  530 ASN A OD1 
3547 N ND2 . ASN A 234 ? 0.7567 0.8257 0.9504 -0.1743 -0.0852 0.0985  530 ASN A ND2 
3554 N N   . LEU A 235 ? 0.4444 0.4757 0.5543 -0.0889 -0.0888 0.0309  531 LEU A N   
3555 C CA  . LEU A 235 ? 0.4040 0.4073 0.5007 -0.0708 -0.0996 0.0163  531 LEU A CA  
3556 C C   . LEU A 235 ? 0.4313 0.4288 0.5006 -0.0593 -0.0965 0.0218  531 LEU A C   
3557 O O   . LEU A 235 ? 0.4432 0.4069 0.4980 -0.0491 -0.1034 0.0252  531 LEU A O   
3558 C CB  . LEU A 235 ? 0.3893 0.4130 0.5026 -0.0629 -0.1030 -0.0065 531 LEU A CB  
3559 C CG  . LEU A 235 ? 0.3900 0.3858 0.4903 -0.0456 -0.1151 -0.0218 531 LEU A CG  
3560 C CD1 . LEU A 235 ? 0.4231 0.3689 0.5135 -0.0444 -0.1263 -0.0173 531 LEU A CD1 
3561 C CD2 . LEU A 235 ? 0.4041 0.4185 0.5235 -0.0403 -0.1207 -0.0434 531 LEU A CD2 
3573 N N   . LEU A 236 ? 0.4506 0.4798 0.5120 -0.0607 -0.0862 0.0240  532 LEU A N   
3574 C CA  . LEU A 236 ? 0.4075 0.4307 0.4432 -0.0527 -0.0864 0.0319  532 LEU A CA  
3575 C C   . LEU A 236 ? 0.4612 0.4571 0.4866 -0.0572 -0.0881 0.0547  532 LEU A C   
3576 O O   . LEU A 236 ? 0.4420 0.4156 0.4561 -0.0460 -0.0943 0.0606  532 LEU A O   
3577 C CB  . LEU A 236 ? 0.4203 0.4763 0.4434 -0.0564 -0.0760 0.0320  532 LEU A CB  
3578 C CG  . LEU A 236 ? 0.4238 0.4736 0.4177 -0.0514 -0.0790 0.0416  532 LEU A CG  
3579 C CD1 . LEU A 236 ? 0.4453 0.4833 0.4339 -0.0352 -0.0914 0.0292  532 LEU A CD1 
3580 C CD2 . LEU A 236 ? 0.4454 0.5213 0.4201 -0.0570 -0.0683 0.0421  532 LEU A CD2 
3592 N N   . ILE A 237 ? 0.4666 0.4646 0.4979 -0.0733 -0.0826 0.0690  533 ILE A N   
3593 C CA  . ILE A 237 ? 0.4856 0.4567 0.5069 -0.0779 -0.0849 0.0913  533 ILE A CA  
3594 C C   . ILE A 237 ? 0.5197 0.4485 0.5428 -0.0679 -0.0945 0.0899  533 ILE A C   
3595 O O   . ILE A 237 ? 0.5319 0.4349 0.5435 -0.0587 -0.0976 0.1022  533 ILE A O   
3596 C CB  . ILE A 237 ? 0.5181 0.5006 0.5451 -0.0991 -0.0781 0.1071  533 ILE A CB  
3597 C CG1 . ILE A 237 ? 0.5467 0.5691 0.5655 -0.1070 -0.0655 0.1090  533 ILE A CG1 
3598 C CG2 . ILE A 237 ? 0.5519 0.5027 0.5683 -0.1040 -0.0825 0.1303  533 ILE A CG2 
3599 C CD1 . ILE A 237 ? 0.5910 0.6117 0.5824 -0.1016 -0.0660 0.1180  533 ILE A CD1 
3611 N N   . GLU A 238 ? 0.5170 0.4367 0.5538 -0.0687 -0.0996 0.0755  534 GLU A N   
3612 C CA  . GLU A 238 ? 0.5335 0.4070 0.5645 -0.0583 -0.1090 0.0722  534 GLU A CA  
3613 C C   . GLU A 238 ? 0.5022 0.3634 0.5209 -0.0364 -0.1104 0.0660  534 GLU A C   
3614 O O   . GLU A 238 ? 0.5358 0.3615 0.5423 -0.0245 -0.1123 0.0744  534 GLU A O   
3615 C CB  . GLU A 238 ? 0.5342 0.4005 0.5797 -0.0641 -0.1169 0.0567  534 GLU A CB  
3616 C CG  . GLU A 238 ? 0.5512 0.3641 0.5832 -0.0527 -0.1278 0.0503  534 GLU A CG  
3617 C CD  . GLU A 238 ? 0.6111 0.4124 0.6556 -0.0620 -0.1394 0.0375  534 GLU A CD  
3618 O OE1 . GLU A 238 ? 0.6618 0.4786 0.7250 -0.0821 -0.1414 0.0447  534 GLU A OE1 
3619 O OE2 . GLU A 238 ? 0.5982 0.3753 0.6344 -0.0499 -0.1474 0.0217  534 GLU A OE2 
3626 N N   . MET A 239 ? 0.5005 0.3905 0.5226 -0.0304 -0.1095 0.0523  535 MET A N   
3627 C CA  . MET A 239 ? 0.5021 0.3839 0.5150 -0.0117 -0.1121 0.0487  535 MET A CA  
3628 C C   . MET A 239 ? 0.5026 0.3851 0.5065 -0.0074 -0.1089 0.0702  535 MET A C   
3629 O O   . MET A 239 ? 0.5401 0.4048 0.5389 0.0082  -0.1102 0.0763  535 MET A O   
3630 C CB  . MET A 239 ? 0.4723 0.3833 0.4901 -0.0081 -0.1144 0.0299  535 MET A CB  
3631 C CG  . MET A 239 ? 0.5071 0.4194 0.5378 -0.0110 -0.1192 0.0089  535 MET A CG  
3632 S SD  . MET A 239 ? 0.5920 0.4547 0.6157 -0.0001 -0.1284 0.0006  535 MET A SD  
3633 C CE  . MET A 239 ? 0.5572 0.4200 0.5713 0.0193  -0.1318 -0.0077 535 MET A CE  
3643 N N   . LEU A 240 ? 0.5329 0.4359 0.5351 -0.0209 -0.1047 0.0832  536 LEU A N   
3644 C CA  . LEU A 240 ? 0.5721 0.4732 0.5665 -0.0191 -0.1043 0.1060  536 LEU A CA  
3645 C C   . LEU A 240 ? 0.6341 0.4994 0.6276 -0.0137 -0.1040 0.1225  536 LEU A C   
3646 O O   . LEU A 240 ? 0.6847 0.5406 0.6768 -0.0026 -0.1048 0.1388  536 LEU A O   
3647 C CB  . LEU A 240 ? 0.5977 0.5243 0.5855 -0.0362 -0.1006 0.1160  536 LEU A CB  
3648 C CG  . LEU A 240 ? 0.6031 0.5605 0.5824 -0.0378 -0.1010 0.1055  536 LEU A CG  
3649 C CD1 . LEU A 240 ? 0.6267 0.6043 0.5948 -0.0550 -0.0942 0.1137  536 LEU A CD1 
3650 C CD2 . LEU A 240 ? 0.6110 0.5667 0.5828 -0.0268 -0.1095 0.1137  536 LEU A CD2 
3662 N N   . HIS A 241 ? 0.6415 0.4857 0.6363 -0.0210 -0.1037 0.1196  537 HIS A N   
3663 C CA  . HIS A 241 ? 0.7477 0.5508 0.7369 -0.0150 -0.1046 0.1331  537 HIS A CA  
3664 C C   . HIS A 241 ? 0.7975 0.5657 0.7804 0.0063  -0.1056 0.1233  537 HIS A C   
3665 O O   . HIS A 241 ? 0.8483 0.5774 0.8222 0.0163  -0.1050 0.1333  537 HIS A O   
3666 C CB  . HIS A 241 ? 0.8488 0.6387 0.8388 -0.0336 -0.1069 0.1354  537 HIS A CB  
3667 C CG  . HIS A 241 ? 0.9852 0.7920 0.9755 -0.0514 -0.1047 0.1554  537 HIS A CG  
3668 N ND1 . HIS A 241 ? 1.0392 0.8888 1.0333 -0.0663 -0.1001 0.1546  537 HIS A ND1 
3669 C CD2 . HIS A 241 ? 1.0648 0.8492 1.0495 -0.0562 -0.1065 0.1769  537 HIS A CD2 
3670 C CE1 . HIS A 241 ? 1.0870 0.9399 1.0763 -0.0805 -0.0988 0.1752  537 HIS A CE1 
3671 N NE2 . HIS A 241 ? 1.1085 0.9229 1.0938 -0.0754 -0.1036 0.1894  537 HIS A NE2 
3679 N N   . ALA A 242 ? 0.7893 0.5679 0.7740 0.0143  -0.1068 0.1042  538 ALA A N   
3680 C CA  . ALA A 242 ? 0.8193 0.5644 0.7942 0.0341  -0.1071 0.0944  538 ALA A CA  
3681 C C   . ALA A 242 ? 0.7857 0.5324 0.7595 0.0536  -0.0961 0.1077  538 ALA A C   
3682 O O   . ALA A 242 ? 0.7571 0.5352 0.7406 0.0539  -0.0950 0.1183  538 ALA A O   
3683 C CB  . ALA A 242 ? 0.8513 0.6125 0.8295 0.0357  -0.1113 0.0713  538 ALA A CB  
3689 N N   . SER B 4   ? 0.6740 0.5452 0.6206 -0.1525 -0.0912 -0.1142 743 SER C N   
3690 C CA  . SER B 4   ? 0.6458 0.5160 0.5970 -0.1465 -0.0715 -0.1123 743 SER C CA  
3691 C C   . SER B 4   ? 0.6437 0.5380 0.5814 -0.1611 -0.0710 -0.0946 743 SER C C   
3692 O O   . SER B 4   ? 0.6637 0.5601 0.5671 -0.1750 -0.0804 -0.0894 743 SER C O   
3693 C CB  . SER B 4   ? 0.6383 0.4786 0.5646 -0.1409 -0.0522 -0.1311 743 SER C CB  
3694 O OG  . SER B 4   ? 0.6095 0.4529 0.5415 -0.1404 -0.0275 -0.1283 743 SER C OG  
3699 N N   . LEU B 5   ? 0.5642 0.4780 0.5311 -0.1575 -0.0637 -0.0860 744 LEU C N   
3700 C CA  . LEU B 5   ? 0.5297 0.4784 0.5046 -0.1606 -0.0605 -0.0693 744 LEU C CA  
3701 C C   . LEU B 5   ? 0.5228 0.4687 0.4931 -0.1456 -0.0429 -0.0669 744 LEU C C   
3702 O O   . LEU B 5   ? 0.5042 0.4729 0.4716 -0.1454 -0.0474 -0.0495 744 LEU C O   
3703 C CB  . LEU B 5   ? 0.4999 0.4695 0.5058 -0.1526 -0.0535 -0.0657 744 LEU C CB  
3704 C CG  . LEU B 5   ? 0.4914 0.5017 0.5215 -0.1389 -0.0442 -0.0515 744 LEU C CG  
3705 C CD1 . LEU B 5   ? 0.5017 0.5471 0.5341 -0.1512 -0.0580 -0.0310 744 LEU C CD1 
3706 C CD2 . LEU B 5   ? 0.4850 0.5105 0.5338 -0.1290 -0.0359 -0.0556 744 LEU C CD2 
3718 N N   . LEU B 6   ? 0.5345 0.4539 0.5101 -0.1343 -0.0247 -0.0807 745 LEU C N   
3719 C CA  . LEU B 6   ? 0.4969 0.4151 0.4713 -0.1229 -0.0067 -0.0731 745 LEU C CA  
3720 C C   . LEU B 6   ? 0.5224 0.4360 0.4453 -0.1325 -0.0107 -0.0677 745 LEU C C   
3721 O O   . LEU B 6   ? 0.5085 0.4374 0.4228 -0.1310 -0.0111 -0.0474 745 LEU C O   
3722 C CB  . LEU B 6   ? 0.4625 0.3548 0.4587 -0.1120 0.0138  -0.0871 745 LEU C CB  
3723 C CG  . LEU B 6   ? 0.4884 0.3795 0.4876 -0.1028 0.0366  -0.0758 745 LEU C CG  
3724 C CD1 . LEU B 6   ? 0.4643 0.3791 0.4918 -0.0944 0.0331  -0.0523 745 LEU C CD1 
3725 C CD2 . LEU B 6   ? 0.5020 0.3716 0.5378 -0.0935 0.0560  -0.0884 745 LEU C CD2 
3737 N N   . LYS B 7   ? 0.5328 0.4215 0.4190 -0.1424 -0.0176 -0.0865 746 LYS C N   
3738 C CA  . LYS B 7   ? 0.6317 0.5091 0.4568 -0.1511 -0.0255 -0.0867 746 LYS C CA  
3739 C C   . LYS B 7   ? 0.6204 0.5213 0.4375 -0.1632 -0.0553 -0.0639 746 LYS C C   
3740 O O   . LYS B 7   ? 0.6595 0.5610 0.4374 -0.1674 -0.0627 -0.0500 746 LYS C O   
3741 C CB  . LYS B 7   ? 0.6889 0.5315 0.4818 -0.1574 -0.0327 -0.1170 746 LYS C CB  
3742 C CG  . LYS B 7   ? 0.8246 0.6460 0.5418 -0.1629 -0.0391 -0.1259 746 LYS C CG  
3743 C CD  . LYS B 7   ? 0.9270 0.7099 0.6166 -0.1590 -0.0315 -0.1646 746 LYS C CD  
3744 C CE  . LYS B 7   ? 1.0305 0.7950 0.6916 -0.1684 -0.0713 -0.1760 746 LYS C CE  
3745 N NZ  . LYS B 7   ? 1.0896 0.8283 0.7408 -0.1517 -0.0639 -0.2102 746 LYS C NZ  
3759 N N   . LYS B 8   ? 0.5993 0.5216 0.4557 -0.1697 -0.0729 -0.0573 747 LYS C N   
3760 C CA  . LYS B 8   ? 0.6065 0.5592 0.4742 -0.1802 -0.0987 -0.0331 747 LYS C CA  
3761 C C   . LYS B 8   ? 0.6013 0.5812 0.4934 -0.1688 -0.0903 -0.0102 747 LYS C C   
3762 O O   . LYS B 8   ? 0.6130 0.6049 0.4957 -0.1762 -0.1111 0.0101  747 LYS C O   
3763 C CB  . LYS B 8   ? 0.6343 0.6120 0.5464 -0.1878 -0.1097 -0.0285 747 LYS C CB  
3764 C CG  . LYS B 8   ? 0.7445 0.7606 0.6831 -0.1995 -0.1341 -0.0022 747 LYS C CG  
3765 C CD  . LYS B 8   ? 0.7906 0.8361 0.7715 -0.2080 -0.1378 0.0048  747 LYS C CD  
3766 C CE  . LYS B 8   ? 0.8292 0.9213 0.8502 -0.2193 -0.1577 0.0339  747 LYS C CE  
3767 N NZ  . LYS B 8   ? 0.8216 0.9473 0.8819 -0.2251 -0.1529 0.0448  747 LYS C NZ  
3781 N N   . LEU B 9   ? 0.5649 0.5512 0.4924 -0.1511 -0.0649 -0.0126 748 LEU C N   
3782 C CA  . LEU B 9   ? 0.5120 0.5194 0.4712 -0.1388 -0.0602 0.0078  748 LEU C CA  
3783 C C   . LEU B 9   ? 0.5350 0.5242 0.4512 -0.1414 -0.0585 0.0204  748 LEU C C   
3784 O O   . LEU B 9   ? 0.5177 0.5220 0.4416 -0.1428 -0.0733 0.0456  748 LEU C O   
3785 C CB  . LEU B 9   ? 0.4445 0.4545 0.4505 -0.1193 -0.0385 -0.0012 748 LEU C CB  
3786 C CG  . LEU B 9   ? 0.3997 0.4310 0.4435 -0.1136 -0.0382 -0.0107 748 LEU C CG  
3787 C CD1 . LEU B 9   ? 0.3848 0.4028 0.4576 -0.0954 -0.0212 -0.0250 748 LEU C CD1 
3788 C CD2 . LEU B 9   ? 0.3945 0.4690 0.4765 -0.1101 -0.0495 0.0064  748 LEU C CD2 
3800 N N   . LEU B 10  ? 0.5391 0.4973 0.4114 -0.1421 -0.0397 0.0046  749 LEU C N   
3801 C CA  . LEU B 10  ? 0.5938 0.5378 0.4179 -0.1444 -0.0303 0.0177  749 LEU C CA  
3802 C C   . LEU B 10  ? 0.6351 0.5678 0.3894 -0.1614 -0.0572 0.0242  749 LEU C C   
3803 O O   . LEU B 10  ? 0.7064 0.6345 0.4196 -0.1664 -0.0608 0.0459  749 LEU C O   
3804 C CB  . LEU B 10  ? 0.5838 0.5041 0.3889 -0.1376 0.0041  -0.0027 749 LEU C CB  
3805 C CG  . LEU B 10  ? 0.5145 0.4401 0.3903 -0.1219 0.0260  -0.0062 749 LEU C CG  
3806 C CD1 . LEU B 10  ? 0.5483 0.4516 0.4166 -0.1168 0.0558  -0.0292 749 LEU C CD1 
3807 C CD2 . LEU B 10  ? 0.5068 0.4478 0.4199 -0.1148 0.0302  0.0249  749 LEU C CD2 
3819 N N   . LEU B 11  ? 0.6614 0.5871 0.4008 -0.1720 -0.0802 0.0080  750 LEU C N   
3820 C CA  . LEU B 11  ? 0.7605 0.6698 0.4366 -0.1889 -0.1141 0.0122  750 LEU C CA  
3821 C C   . LEU B 11  ? 0.7609 0.6981 0.4717 -0.1976 -0.1500 0.0446  750 LEU C C   
3822 O O   . LEU B 11  ? 0.8388 0.7617 0.4992 -0.2119 -0.1829 0.0566  750 LEU C O   
3823 C CB  . LEU B 11  ? 0.8402 0.7266 0.4949 -0.1980 -0.1305 -0.0172 750 LEU C CB  
3824 C CG  . LEU B 11  ? 0.8967 0.7443 0.4968 -0.1926 -0.1075 -0.0536 750 LEU C CG  
3825 C CD1 . LEU B 11  ? 0.9119 0.7395 0.5169 -0.2010 -0.1305 -0.0799 750 LEU C CD1 
3826 C CD2 . LEU B 11  ? 0.9866 0.8062 0.4902 -0.1959 -0.1074 -0.0563 750 LEU C CD2 
3838 N N   . ALA B 12  ? 0.7297 0.7051 0.5256 -0.1883 -0.1460 0.0574  751 ALA C N   
3839 C CA  . ALA B 12  ? 0.7575 0.7658 0.6036 -0.1935 -0.1770 0.0857  751 ALA C CA  
3840 C C   . ALA B 12  ? 0.8409 0.8456 0.6681 -0.1959 -0.1922 0.1155  751 ALA C C   
3841 O O   . ALA B 12  ? 0.8736 0.8659 0.6798 -0.1877 -0.1688 0.1199  751 ALA C O   
3842 C CB  . ALA B 12  ? 0.6615 0.7118 0.5991 -0.1780 -0.1611 0.0871  751 ALA C CB  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   297 ?   ?   ?   A . n 
A 1 2   ASN 2   298 ?   ?   ?   A . n 
A 1 3   ALA 3   299 ?   ?   ?   A . n 
A 1 4   SER 4   300 300 SER SER A . n 
A 1 5   ILE 5   301 301 ILE ILE A . n 
A 1 6   PRO 6   302 302 PRO PRO A . n 
A 1 7   HIS 7   303 303 HIS HIS A . n 
A 1 8   LEU 8   304 304 LEU LEU A . n 
A 1 9   ILE 9   305 305 ILE ILE A . n 
A 1 10  LEU 10  306 306 LEU LEU A . n 
A 1 11  GLU 11  307 307 GLU GLU A . n 
A 1 12  LEU 12  308 308 LEU LEU A . n 
A 1 13  LEU 13  309 309 LEU LEU A . n 
A 1 14  LYS 14  310 310 LYS LYS A . n 
A 1 15  CYS 15  311 311 CYS CYS A . n 
A 1 16  GLU 16  312 312 GLU GLU A . n 
A 1 17  PRO 17  313 313 PRO PRO A . n 
A 1 18  ASP 18  314 314 ASP ASP A . n 
A 1 19  GLU 19  315 315 GLU GLU A . n 
A 1 20  PRO 20  316 316 PRO PRO A . n 
A 1 21  GLN 21  317 317 GLN GLN A . n 
A 1 22  VAL 22  318 318 VAL VAL A . n 
A 1 23  GLN 23  319 319 GLN GLN A . n 
A 1 24  ALA 24  320 320 ALA ALA A . n 
A 1 25  LYS 25  321 321 LYS LYS A . n 
A 1 26  ILE 26  322 322 ILE ILE A . n 
A 1 27  MET 27  323 323 MET MET A . n 
A 1 28  ALA 28  324 324 ALA ALA A . n 
A 1 29  TYR 29  325 325 TYR TYR A . n 
A 1 30  LEU 30  326 326 LEU LEU A . n 
A 1 31  GLN 31  327 327 GLN GLN A . n 
A 1 32  GLN 32  328 328 GLN GLN A . n 
A 1 33  GLU 33  329 ?   ?   ?   A . n 
A 1 34  GLN 34  330 ?   ?   ?   A . n 
A 1 35  ALA 35  331 ?   ?   ?   A . n 
A 1 36  ASN 36  332 ?   ?   ?   A . n 
A 1 37  ARG 37  333 ?   ?   ?   A . n 
A 1 38  SER 38  334 ?   ?   ?   A . n 
A 1 39  LYS 39  335 ?   ?   ?   A . n 
A 1 40  HIS 40  336 ?   ?   ?   A . n 
A 1 41  GLU 41  337 ?   ?   ?   A . n 
A 1 42  LYS 42  338 ?   ?   ?   A . n 
A 1 43  LEU 43  339 339 LEU LEU A . n 
A 1 44  SER 44  340 340 SER SER A . n 
A 1 45  THR 45  341 341 THR THR A . n 
A 1 46  PHE 46  342 342 PHE PHE A . n 
A 1 47  GLY 47  343 343 GLY GLY A . n 
A 1 48  LEU 48  344 344 LEU LEU A . n 
A 1 49  MET 49  345 345 MET MET A . n 
A 1 50  CYS 50  346 346 CYS CYS A . n 
A 1 51  LYS 51  347 347 LYS LYS A . n 
A 1 52  MET 52  348 348 MET MET A . n 
A 1 53  ALA 53  349 349 ALA ALA A . n 
A 1 54  ASP 54  350 350 ASP ASP A . n 
A 1 55  GLN 55  351 351 GLN GLN A . n 
A 1 56  THR 56  352 352 THR THR A . n 
A 1 57  LEU 57  353 353 LEU LEU A . n 
A 1 58  PHE 58  354 354 PHE PHE A . n 
A 1 59  SER 59  355 355 SER SER A . n 
A 1 60  ILE 60  356 356 ILE ILE A . n 
A 1 61  VAL 61  357 357 VAL VAL A . n 
A 1 62  GLU 62  358 358 GLU GLU A . n 
A 1 63  TRP 63  359 359 TRP TRP A . n 
A 1 64  ALA 64  360 360 ALA ALA A . n 
A 1 65  ARG 65  361 361 ARG ARG A . n 
A 1 66  SER 66  362 362 SER SER A . n 
A 1 67  SER 67  363 363 SER SER A . n 
A 1 68  ILE 68  364 364 ILE ILE A . n 
A 1 69  PHE 69  365 365 PHE PHE A . n 
A 1 70  PHE 70  366 366 PHE PHE A . n 
A 1 71  ARG 71  367 367 ARG ARG A . n 
A 1 72  GLU 72  368 368 GLU GLU A . n 
A 1 73  LEU 73  369 369 LEU LEU A . n 
A 1 74  LYS 74  370 370 LYS LYS A . n 
A 1 75  VAL 75  371 371 VAL VAL A . n 
A 1 76  ASP 76  372 372 ASP ASP A . n 
A 1 77  ASP 77  373 373 ASP ASP A . n 
A 1 78  GLN 78  374 374 GLN GLN A . n 
A 1 79  MET 79  375 375 MET MET A . n 
A 1 80  LYS 80  376 376 LYS LYS A . n 
A 1 81  LEU 81  377 377 LEU LEU A . n 
A 1 82  LEU 82  378 378 LEU LEU A . n 
A 1 83  GLN 83  379 379 GLN GLN A . n 
A 1 84  ASN 84  380 380 ASN ASN A . n 
A 1 85  CYS 85  381 381 CYS CYS A . n 
A 1 86  TRP 86  382 382 TRP TRP A . n 
A 1 87  SER 87  383 383 SER SER A . n 
A 1 88  GLU 88  384 384 GLU GLU A . n 
A 1 89  LEU 89  385 385 LEU LEU A . n 
A 1 90  LEU 90  386 386 LEU LEU A . n 
A 1 91  ILE 91  387 387 ILE ILE A . n 
A 1 92  LEU 92  388 388 LEU LEU A . n 
A 1 93  ASP 93  389 389 ASP ASP A . n 
A 1 94  HIS 94  390 390 HIS HIS A . n 
A 1 95  ILE 95  391 391 ILE ILE A . n 
A 1 96  TYR 96  392 392 TYR TYR A . n 
A 1 97  ARG 97  393 393 ARG ARG A . n 
A 1 98  GLN 98  394 394 GLN GLN A . n 
A 1 99  VAL 99  395 395 VAL VAL A . n 
A 1 100 VAL 100 396 396 VAL VAL A . n 
A 1 101 HIS 101 397 397 HIS HIS A . n 
A 1 102 GLY 102 398 398 GLY GLY A . n 
A 1 103 LYS 103 399 399 LYS LYS A . n 
A 1 104 GLU 104 400 400 GLU GLU A . n 
A 1 105 GLY 105 401 401 GLY GLY A . n 
A 1 106 SER 106 402 402 SER SER A . n 
A 1 107 ILE 107 403 403 ILE ILE A . n 
A 1 108 PHE 108 404 404 PHE PHE A . n 
A 1 109 LEU 109 405 405 LEU LEU A . n 
A 1 110 VAL 110 406 406 VAL VAL A . n 
A 1 111 THR 111 407 407 THR THR A . n 
A 1 112 GLY 112 408 408 GLY GLY A . n 
A 1 113 GLN 113 409 409 GLN GLN A . n 
A 1 114 GLN 114 410 410 GLN GLN A . n 
A 1 115 VAL 115 411 411 VAL VAL A . n 
A 1 116 ASP 116 412 412 ASP ASP A . n 
A 1 117 TYR 117 413 413 TYR TYR A . n 
A 1 118 SER 118 414 414 SER SER A . n 
A 1 119 ILE 119 415 415 ILE ILE A . n 
A 1 120 ILE 120 416 416 ILE ILE A . n 
A 1 121 ALA 121 417 417 ALA ALA A . n 
A 1 122 SER 122 418 418 SER SER A . n 
A 1 123 GLN 123 419 419 GLN GLN A . n 
A 1 124 ALA 124 420 420 ALA ALA A . n 
A 1 125 GLY 125 421 421 GLY GLY A . n 
A 1 126 ALA 126 422 422 ALA ALA A . n 
A 1 127 THR 127 423 423 THR THR A . n 
A 1 128 LEU 128 424 424 LEU LEU A . n 
A 1 129 ASN 129 425 425 ASN ASN A . n 
A 1 130 ASN 130 426 426 ASN ASN A . n 
A 1 131 LEU 131 427 427 LEU LEU A . n 
A 1 132 MET 132 428 428 MET MET A . n 
A 1 133 SER 133 429 429 SER SER A . n 
A 1 134 HIS 134 430 430 HIS HIS A . n 
A 1 135 ALA 135 431 431 ALA ALA A . n 
A 1 136 GLN 136 432 432 GLN GLN A . n 
A 1 137 GLU 137 433 433 GLU GLU A . n 
A 1 138 LEU 138 434 434 LEU LEU A . n 
A 1 139 VAL 139 435 435 VAL VAL A . n 
A 1 140 ALA 140 436 436 ALA ALA A . n 
A 1 141 LYS 141 437 437 LYS LYS A . n 
A 1 142 LEU 142 438 438 LEU LEU A . n 
A 1 143 ARG 143 439 439 ARG ARG A . n 
A 1 144 SER 144 440 440 SER SER A . n 
A 1 145 LEU 145 441 441 LEU LEU A . n 
A 1 146 GLN 146 442 442 GLN GLN A . n 
A 1 147 PHE 147 443 443 PHE PHE A . n 
A 1 148 ASP 148 444 444 ASP ASP A . n 
A 1 149 GLN 149 445 445 GLN GLN A . n 
A 1 150 ARG 150 446 446 ARG ARG A . n 
A 1 151 GLU 151 447 447 GLU GLU A . n 
A 1 152 PHE 152 448 448 PHE PHE A . n 
A 1 153 VAL 153 449 449 VAL VAL A . n 
A 1 154 CYS 154 450 450 CYS CYS A . n 
A 1 155 LEU 155 451 451 LEU LEU A . n 
A 1 156 LYS 156 452 452 LYS LYS A . n 
A 1 157 PHE 157 453 453 PHE PHE A . n 
A 1 158 LEU 158 454 454 LEU LEU A . n 
A 1 159 VAL 159 455 455 VAL VAL A . n 
A 1 160 LEU 160 456 456 LEU LEU A . n 
A 1 161 PHE 161 457 457 PHE PHE A . n 
A 1 162 SER 162 458 458 SER SER A . n 
A 1 163 LEU 163 459 459 LEU LEU A . n 
A 1 164 ASP 164 460 460 ASP ASP A . n 
A 1 165 VAL 165 461 461 VAL VAL A . n 
A 1 166 LYS 166 462 ?   ?   ?   A . n 
A 1 167 ASN 167 463 ?   ?   ?   A . n 
A 1 168 LEU 168 464 464 LEU LEU A . n 
A 1 169 GLU 169 465 465 GLU GLU A . n 
A 1 170 ASN 170 466 466 ASN ASN A . n 
A 1 171 PHE 171 467 467 PHE PHE A . n 
A 1 172 GLN 172 468 468 GLN GLN A . n 
A 1 173 LEU 173 469 469 LEU LEU A . n 
A 1 174 VAL 174 470 470 VAL VAL A . n 
A 1 175 GLU 175 471 471 GLU GLU A . n 
A 1 176 GLY 176 472 472 GLY GLY A . n 
A 1 177 VAL 177 473 473 VAL VAL A . n 
A 1 178 GLN 178 474 474 GLN GLN A . n 
A 1 179 GLU 179 475 475 GLU GLU A . n 
A 1 180 GLN 180 476 476 GLN GLN A . n 
A 1 181 VAL 181 477 477 VAL VAL A . n 
A 1 182 ASN 182 478 478 ASN ASN A . n 
A 1 183 ALA 183 479 479 ALA ALA A . n 
A 1 184 ALA 184 480 480 ALA ALA A . n 
A 1 185 LEU 185 481 481 LEU LEU A . n 
A 1 186 LEU 186 482 482 LEU LEU A . n 
A 1 187 ASP 187 483 483 ASP ASP A . n 
A 1 188 TYR 188 484 484 TYR TYR A . n 
A 1 189 THR 189 485 485 THR THR A . n 
A 1 190 MET 190 486 486 MET MET A . n 
A 1 191 CYS 191 487 487 CYS CYS A . n 
A 1 192 ASN 192 488 488 ASN ASN A . n 
A 1 193 TYR 193 489 489 TYR TYR A . n 
A 1 194 PRO 194 490 490 PRO PRO A . n 
A 1 195 GLN 195 491 491 GLN GLN A . n 
A 1 196 GLN 196 492 492 GLN GLN A . n 
A 1 197 THR 197 493 493 THR THR A . n 
A 1 198 GLU 198 494 494 GLU GLU A . n 
A 1 199 LYS 199 495 495 LYS LYS A . n 
A 1 200 PHE 200 496 496 PHE PHE A . n 
A 1 201 GLY 201 497 497 GLY GLY A . n 
A 1 202 GLN 202 498 498 GLN GLN A . n 
A 1 203 LEU 203 499 499 LEU LEU A . n 
A 1 204 LEU 204 500 500 LEU LEU A . n 
A 1 205 LEU 205 501 501 LEU LEU A . n 
A 1 206 ARG 206 502 502 ARG ARG A . n 
A 1 207 LEU 207 503 503 LEU LEU A . n 
A 1 208 PRO 208 504 504 PRO PRO A . n 
A 1 209 GLU 209 505 505 GLU GLU A . n 
A 1 210 ILE 210 506 506 ILE ILE A . n 
A 1 211 ARG 211 507 507 ARG ARG A . n 
A 1 212 ALA 212 508 508 ALA ALA A . n 
A 1 213 ILE 213 509 509 ILE ILE A . n 
A 1 214 SER 214 510 510 SER SER A . n 
A 1 215 MET 215 511 511 MET MET A . n 
A 1 216 GLN 216 512 512 GLN GLN A . n 
A 1 217 ALA 217 513 513 ALA ALA A . n 
A 1 218 GLU 218 514 514 GLU GLU A . n 
A 1 219 GLU 219 515 515 GLU GLU A . n 
A 1 220 TYR 220 516 516 TYR TYR A . n 
A 1 221 LEU 221 517 517 LEU LEU A . n 
A 1 222 TYR 222 518 518 TYR TYR A . n 
A 1 223 TYR 223 519 519 TYR TYR A . n 
A 1 224 LYS 224 520 520 LYS LYS A . n 
A 1 225 HIS 225 521 521 HIS HIS A . n 
A 1 226 LEU 226 522 522 LEU LEU A . n 
A 1 227 ASN 227 523 523 ASN ASN A . n 
A 1 228 GLY 228 524 524 GLY GLY A . n 
A 1 229 ASP 229 525 525 ASP ASP A . n 
A 1 230 VAL 230 526 526 VAL VAL A . n 
A 1 231 PRO 231 527 527 PRO PRO A . n 
A 1 232 TYR 232 528 528 TYR TYR A . n 
A 1 233 ASN 233 529 529 ASN ASN A . n 
A 1 234 ASN 234 530 530 ASN ASN A . n 
A 1 235 LEU 235 531 531 LEU LEU A . n 
A 1 236 LEU 236 532 532 LEU LEU A . n 
A 1 237 ILE 237 533 533 ILE ILE A . n 
A 1 238 GLU 238 534 534 GLU GLU A . n 
A 1 239 MET 239 535 535 MET MET A . n 
A 1 240 LEU 240 536 536 LEU LEU A . n 
A 1 241 HIS 241 537 537 HIS HIS A . n 
A 1 242 ALA 242 538 538 ALA ALA A . n 
A 1 243 LYS 243 539 ?   ?   ?   A . n 
A 1 244 ARG 244 540 ?   ?   ?   A . n 
A 1 245 ALA 245 541 ?   ?   ?   A . n 
B 2 1   GLU 1   740 ?   ?   ?   C . n 
B 2 2   GLU 2   741 ?   ?   ?   C . n 
B 2 3   PRO 3   742 ?   ?   ?   C . n 
B 2 4   SER 4   743 743 SER SER C . n 
B 2 5   LEU 5   744 744 LEU LEU C . n 
B 2 6   LEU 6   745 745 LEU LEU C . n 
B 2 7   LYS 7   746 746 LYS LYS C . n 
B 2 8   LYS 8   747 747 LYS LYS C . n 
B 2 9   LEU 9   748 748 LEU LEU C . n 
B 2 10  LEU 10  749 749 LEU LEU C . n 
B 2 11  LEU 11  750 750 LEU LEU C . n 
B 2 12  ALA 12  751 751 ALA ALA C . n 
B 2 13  PRO 13  752 ?   ?   ?   C . n 
B 2 14  ALA 14  753 ?   ?   ?   C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 RJW 1  601 1  RJW RJW A . 
D 4 HOH 1  701 58 HOH HOH A . 
D 4 HOH 2  702 69 HOH HOH A . 
D 4 HOH 3  703 50 HOH HOH A . 
D 4 HOH 4  704 5  HOH HOH A . 
D 4 HOH 5  705 81 HOH HOH A . 
D 4 HOH 6  706 8  HOH HOH A . 
D 4 HOH 7  707 49 HOH HOH A . 
D 4 HOH 8  708 87 HOH HOH A . 
D 4 HOH 9  709 19 HOH HOH A . 
D 4 HOH 10 710 76 HOH HOH A . 
D 4 HOH 11 711 57 HOH HOH A . 
D 4 HOH 12 712 10 HOH HOH A . 
D 4 HOH 13 713 33 HOH HOH A . 
D 4 HOH 14 714 73 HOH HOH A . 
D 4 HOH 15 715 30 HOH HOH A . 
D 4 HOH 16 716 61 HOH HOH A . 
D 4 HOH 17 717 13 HOH HOH A . 
D 4 HOH 18 718 2  HOH HOH A . 
D 4 HOH 19 719 3  HOH HOH A . 
D 4 HOH 20 720 39 HOH HOH A . 
D 4 HOH 21 721 25 HOH HOH A . 
D 4 HOH 22 722 77 HOH HOH A . 
D 4 HOH 23 723 7  HOH HOH A . 
D 4 HOH 24 724 64 HOH HOH A . 
D 4 HOH 25 725 28 HOH HOH A . 
D 4 HOH 26 726 6  HOH HOH A . 
D 4 HOH 27 727 71 HOH HOH A . 
D 4 HOH 28 728 51 HOH HOH A . 
D 4 HOH 29 729 23 HOH HOH A . 
D 4 HOH 30 730 4  HOH HOH A . 
D 4 HOH 31 731 24 HOH HOH A . 
D 4 HOH 32 732 56 HOH HOH A . 
D 4 HOH 33 733 31 HOH HOH A . 
D 4 HOH 34 734 22 HOH HOH A . 
D 4 HOH 35 735 68 HOH HOH A . 
D 4 HOH 36 736 12 HOH HOH A . 
D 4 HOH 37 737 54 HOH HOH A . 
D 4 HOH 38 738 53 HOH HOH A . 
D 4 HOH 39 739 55 HOH HOH A . 
D 4 HOH 40 740 85 HOH HOH A . 
D 4 HOH 41 741 11 HOH HOH A . 
D 4 HOH 42 742 88 HOH HOH A . 
D 4 HOH 43 743 9  HOH HOH A . 
D 4 HOH 44 744 32 HOH HOH A . 
D 4 HOH 45 745 44 HOH HOH A . 
D 4 HOH 46 746 89 HOH HOH A . 
D 4 HOH 47 747 86 HOH HOH A . 
D 4 HOH 48 748 91 HOH HOH A . 
D 4 HOH 49 749 35 HOH HOH A . 
D 4 HOH 50 750 84 HOH HOH A . 
D 4 HOH 51 751 34 HOH HOH A . 
D 4 HOH 52 752 82 HOH HOH A . 
D 4 HOH 53 753 79 HOH HOH A . 
D 4 HOH 54 754 70 HOH HOH A . 
D 4 HOH 55 755 42 HOH HOH A . 
D 4 HOH 56 756 37 HOH HOH A . 
E 4 HOH 1  801 90 HOH HOH C . 
E 4 HOH 2  802 48 HOH HOH C . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 970   ? 
1 MORE         -10   ? 
1 'SSA (A^2)'  11410 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-04-19 
2 'Structure model' 1 1 2017-06-07 
3 'Structure model' 1 2 2017-09-20 
4 'Structure model' 1 3 2019-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Author supporting evidence' 
3 3 'Structure model' 'Refinement description'     
4 4 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' pdbx_audit_support 
2 3 'Structure model' software           
3 4 'Structure model' pdbx_audit_support 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_pdbx_audit_support.funding_organization' 
2 4 'Structure model' '_pdbx_audit_support.funding_organization' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1  ? refined -17.5547 22.4518 -20.8260 0.2181 0.4073 0.3003 -0.0216 -0.0204 -0.0443 1.8671 2.7871 4.8427 
0.4240  -1.6492 -2.0332 0.0036  0.2222  -0.2333 0.1004  0.2691  0.2847  0.0485  -0.0071 -0.6831 
'X-RAY DIFFRACTION' 2  ? refined -14.8321 12.8906 -14.9247 0.2716 0.3954 0.2923 0.0063  -0.0207 0.0081  2.1176 2.2878 9.1041 
0.4204  0.9035  -1.0223 0.0443  -0.2174 -0.0810 -0.3860 0.0095  0.1197  0.0469  0.2494  -0.8371 
'X-RAY DIFFRACTION' 3  ? refined -12.3905 13.4427 -35.1051 0.4367 0.4392 0.3063 0.0090  -0.0937 0.0566  6.6338 8.4928 8.2826 
2.8659  -1.4552 -4.4988 0.0114  0.3500  0.0287  0.5197  -0.0440 0.3376  -1.4431 -0.2061 -0.8991 
'X-RAY DIFFRACTION' 4  ? refined -7.1191  15.7091 -20.4682 0.2247 0.3753 0.2642 0.0297  -0.0029 0.0791  2.2974 3.2867 3.6382 
1.8649  0.6154  0.5785  0.1085  -0.0258 0.0396  -0.2395 -0.2683 -0.1001 -0.3866 -0.1099 -0.1521 
'X-RAY DIFFRACTION' 5  ? refined -9.8928  24.8850 -2.9031  0.3617 0.4395 0.3273 -0.0399 0.0148  -0.0721 3.6845 3.9231 5.5518 
-0.4328 2.0588  -0.8083 -0.1218 -0.3121 -0.0015 -0.3640 0.3625  0.1952  0.6598  -0.5975 -0.2688 
'X-RAY DIFFRACTION' 6  ? refined 0.9395   23.9937 -8.5749  0.2566 0.4807 0.3324 -0.0191 -0.0397 -0.0273 2.4025 2.8424 2.3397 
2.0494  -0.7578 0.7900  -0.0893 -0.1740 0.2622  -0.3198 -0.1873 -0.5457 0.5396  -0.2549 0.0749  
'X-RAY DIFFRACTION' 7  ? refined -3.6025  21.0230 -27.6423 0.1963 0.2411 0.2571 0.0243  0.0462  0.0365  2.4921 6.9889 4.5323 
1.8386  0.0035  1.9181  -0.0251 -0.0679 0.0190  0.0005  -0.3095 -0.3645 -0.4868 0.1238  -0.1359 
'X-RAY DIFFRACTION' 8  ? refined 1.0721   27.3352 -33.1167 0.2513 0.3104 0.3176 0.0375  0.0765  0.0044  2.7867 8.4342 3.9370 
2.0616  0.8201  1.1914  -0.2597 0.2621  -0.0534 0.3038  0.0128  -0.6932 -0.5670 -0.0438 0.2922  
'X-RAY DIFFRACTION' 9  ? refined 1.5568   14.7462 -14.8316 0.2324 0.3655 0.3453 0.0389  0.0051  0.0664  1.6255 6.8864 4.7023 
2.4064  -1.6757 -4.4444 0.0979  -0.4506 0.2335  -0.2517 -0.3260 -0.5384 -0.0326 0.2297  0.4759  
'X-RAY DIFFRACTION' 10 ? refined -10.8224 2.8958  -11.0003 0.4349 0.4481 0.4465 -0.0940 -0.0708 0.1015  1.0373 3.2306 2.1806 
-0.0126 1.1303  -1.5350 0.1651  -0.2675 -0.0109 -0.7539 -0.5045 0.3818  0.2979  0.4063  -0.4867 
'X-RAY DIFFRACTION' 11 ? refined -17.2039 3.0498  -25.6322 0.4787 0.4183 0.3496 -0.1569 -0.0563 -0.0396 5.8623 6.9582 2.0787 
0.2908  2.8744  -1.1984 0.1190  0.3286  -0.0525 0.7621  0.1500  0.1276  -1.0994 0.4306  -0.5236 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1  1  A 300 A 340 
;chain 'A' and (resid 300 through 340 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 2  2  A 341 A 361 
;chain 'A' and (resid 341 through 361 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 3  3  A 362 A 370 
;chain 'A' and (resid 362 through 370 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 4  4  A 371 A 397 
;chain 'A' and (resid 371 through 397 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 5  5  A 398 A 421 
;chain 'A' and (resid 398 through 421 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 6  6  A 422 A 440 
;chain 'A' and (resid 422 through 440 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 7  7  A 441 A 466 
;chain 'A' and (resid 441 through 466 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 8  8  A 467 A 494 
;chain 'A' and (resid 467 through 494 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 9  9  A 495 A 522 
;chain 'A' and (resid 495 through 522 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 10 10 A 523 A 538 
;chain 'A' and (resid 523 through 538 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 11 11 C 743 C 751 
;chain 'C' and (resid 743 through 751 )
;
? ? ? ? ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .           1 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.10.1_2155 2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22        3 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.10.1_2155 4 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? DENZO       ? ? ? .           5 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? SCALEPACK   ? ? ? .           6 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OH 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   TYR 
_pdbx_validate_close_contact.auth_seq_id_1    325 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    701 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.01 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    OE2 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    GLU 
_pdbx_validate_symm_contact.auth_seq_id_1     515 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    OH 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    TYR 
_pdbx_validate_symm_contact.auth_seq_id_2     518 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_555 
_pdbx_validate_symm_contact.dist              2.06 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PHE A 365 ? ? 78.68  -56.85 
2 1 VAL A 396 ? ? -76.92 -71.17 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 297 ? A SER 1   
2  1 Y 1 A ASN 298 ? A ASN 2   
3  1 Y 1 A ALA 299 ? A ALA 3   
4  1 Y 1 A GLU 329 ? A GLU 33  
5  1 Y 1 A GLN 330 ? A GLN 34  
6  1 Y 1 A ALA 331 ? A ALA 35  
7  1 Y 1 A ASN 332 ? A ASN 36  
8  1 Y 1 A ARG 333 ? A ARG 37  
9  1 Y 1 A SER 334 ? A SER 38  
10 1 Y 1 A LYS 335 ? A LYS 39  
11 1 Y 1 A HIS 336 ? A HIS 40  
12 1 Y 1 A GLU 337 ? A GLU 41  
13 1 Y 1 A LYS 338 ? A LYS 42  
14 1 Y 1 A LYS 462 ? A LYS 166 
15 1 Y 1 A ASN 463 ? A ASN 167 
16 1 Y 1 A LYS 539 ? A LYS 243 
17 1 Y 1 A ARG 540 ? A ARG 244 
18 1 Y 1 A ALA 541 ? A ALA 245 
19 1 Y 1 C GLU 740 ? B GLU 1   
20 1 Y 1 C GLU 741 ? B GLU 2   
21 1 Y 1 C PRO 742 ? B PRO 3   
22 1 Y 1 C PRO 752 ? B PRO 13  
23 1 Y 1 C ALA 753 ? B ALA 14  
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Institute of Diabetes and Digestive and Kidney Disease (NIH/NIDDK)' 'United States' 
R01DK095750       1 
'National Institutes of Health/National Institute of Diabetes and Digestive and Kidney Disease (NIH/NIDDK)' 'United States' 
F31DK111171       2 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)'                  'United States' 
T32GM008602       3 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)'                  'United States' 
'NIH K12GM000680' 4 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 '(1R,3aR,6aR)-5-hexyl-4-phenyl-3a-(1-phenylethenyl)-1,2,3,3a,6,6a-hexahydropentalen-1-ol' RJW 
4 water                                                                                     HOH 
#