data_5UQ9
# 
_entry.id   5UQ9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.303 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5UQ9         
WWPDB D_1000225951 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB '4GWG contains the same protein but without any bound ligand'                      4GWG unspecified 
PDB '4GWK contains the same protein with 3-phosphoglycerate bound in the active site.' 4GWK unspecified 
PDB '2JKV contains the same protein with NADPH bound.'                                 2JKV unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5UQ9 
_pdbx_database_status.recvd_initial_deposition_date   2017-02-07 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name               'Leonard, P.G.' 
_audit_author.pdbx_ordinal       1 
_audit_author.identifier_ORCID   ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Cell Rep' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2211-1247 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            26 
_citation.language                  ? 
_citation.page_first                469 
_citation.page_last                 482.e5 
_citation.title                     
'Functional Genomics Reveals Synthetic Lethality between Phosphogluconate Dehydrogenase and Oxidative Phosphorylation.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.celrep.2018.12.043 
_citation.pdbx_database_id_PubMed   30625329 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Sun, Y.'         1  ? 
primary 'Bandi, M.'       2  ? 
primary 'Lofton, T.'      3  ? 
primary 'Smith, M.'       4  ? 
primary 'Bristow, C.A.'   5  ? 
primary 'Carugo, A.'      6  ? 
primary 'Rogers, N.'      7  ? 
primary 'Leonard, P.'     8  ? 
primary 'Chang, Q.'       9  ? 
primary 'Mullinax, R.'    10 ? 
primary 'Han, J.'         11 ? 
primary 'Shi, X.'         12 ? 
primary 'Seth, S.'        13 ? 
primary 'Meyers, B.A.'    14 ? 
primary 'Miller, M.'      15 ? 
primary 'Miao, L.'        16 ? 
primary 'Ma, X.'          17 ? 
primary 'Feng, N.'        18 ? 
primary 'Giuliani, V.'    19 ? 
primary 'Geck Do, M.'     20 ? 
primary 'Czako, B.'       21 ? 
primary 'Palmer, W.S.'    22 ? 
primary 'Mseeh, F.'       23 ? 
primary 'Asara, J.M.'     24 ? 
primary 'Jiang, Y.'       25 ? 
primary 'Morlacchi, P.'   26 ? 
primary 'Zhao, S.'        27 ? 
primary 'Peoples, M.'     28 ? 
primary 'Tieu, T.N.'      29 ? 
primary 'Warmoes, M.O.'   30 ? 
primary 'Lorenzi, P.L.'   31 ? 
primary 'Muller, F.L.'    32 ? 
primary 'DePinho, R.A.'   33 ? 
primary 'Draetta, G.F.'   34 ? 
primary 'Toniatti, C.'    35 ? 
primary 'Jones, P.'       36 ? 
primary 'Heffernan, T.P.' 37 ? 
primary 'Marszalek, J.R.' 38 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   91.430 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5UQ9 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     87.311 
_cell.length_a_esd                 ? 
_cell.length_b                     164.930 
_cell.length_b_esd                 ? 
_cell.length_c                     133.199 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        16 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5UQ9 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man '6-phosphogluconate dehydrogenase, decarboxylating'                                        53763.504 8 1.1.1.44 
? ? ? 
2 non-polymer syn '[(4R,5R)-5-(hydroxycarbamoyl)-2,2-dimethyl-1,3-dioxolan-4-yl]methyl dihydrogen phosphate' 271.162   1 ?        
? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GAMADIMAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILL
VKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIK
TIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIE
ITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQKFQFDG
DKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDF
FKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGG
TVSSSSYNA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GAMADIMAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILL
VKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIK
TIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIE
ITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQKFQFDG
DKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDF
FKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGG
TVSSSSYNA
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MET n 
1 4   ALA n 
1 5   ASP n 
1 6   ILE n 
1 7   MET n 
1 8   ALA n 
1 9   GLN n 
1 10  ALA n 
1 11  ASP n 
1 12  ILE n 
1 13  ALA n 
1 14  LEU n 
1 15  ILE n 
1 16  GLY n 
1 17  LEU n 
1 18  ALA n 
1 19  VAL n 
1 20  MET n 
1 21  GLY n 
1 22  GLN n 
1 23  ASN n 
1 24  LEU n 
1 25  ILE n 
1 26  LEU n 
1 27  ASN n 
1 28  MET n 
1 29  ASN n 
1 30  ASP n 
1 31  HIS n 
1 32  GLY n 
1 33  PHE n 
1 34  VAL n 
1 35  VAL n 
1 36  CYS n 
1 37  ALA n 
1 38  PHE n 
1 39  ASN n 
1 40  ARG n 
1 41  THR n 
1 42  VAL n 
1 43  SER n 
1 44  LYS n 
1 45  VAL n 
1 46  ASP n 
1 47  ASP n 
1 48  PHE n 
1 49  LEU n 
1 50  ALA n 
1 51  ASN n 
1 52  GLU n 
1 53  ALA n 
1 54  LYS n 
1 55  GLY n 
1 56  THR n 
1 57  LYS n 
1 58  VAL n 
1 59  VAL n 
1 60  GLY n 
1 61  ALA n 
1 62  GLN n 
1 63  SER n 
1 64  LEU n 
1 65  LYS n 
1 66  GLU n 
1 67  MET n 
1 68  VAL n 
1 69  SER n 
1 70  LYS n 
1 71  LEU n 
1 72  LYS n 
1 73  LYS n 
1 74  PRO n 
1 75  ARG n 
1 76  ARG n 
1 77  ILE n 
1 78  ILE n 
1 79  LEU n 
1 80  LEU n 
1 81  VAL n 
1 82  LYS n 
1 83  ALA n 
1 84  GLY n 
1 85  GLN n 
1 86  ALA n 
1 87  VAL n 
1 88  ASP n 
1 89  ASP n 
1 90  PHE n 
1 91  ILE n 
1 92  GLU n 
1 93  LYS n 
1 94  LEU n 
1 95  VAL n 
1 96  PRO n 
1 97  LEU n 
1 98  LEU n 
1 99  ASP n 
1 100 THR n 
1 101 GLY n 
1 102 ASP n 
1 103 ILE n 
1 104 ILE n 
1 105 ILE n 
1 106 ASP n 
1 107 GLY n 
1 108 GLY n 
1 109 ASN n 
1 110 SER n 
1 111 GLU n 
1 112 TYR n 
1 113 ARG n 
1 114 ASP n 
1 115 THR n 
1 116 THR n 
1 117 ARG n 
1 118 ARG n 
1 119 CYS n 
1 120 ARG n 
1 121 ASP n 
1 122 LEU n 
1 123 LYS n 
1 124 ALA n 
1 125 LYS n 
1 126 GLY n 
1 127 ILE n 
1 128 LEU n 
1 129 PHE n 
1 130 VAL n 
1 131 GLY n 
1 132 SER n 
1 133 GLY n 
1 134 VAL n 
1 135 SER n 
1 136 GLY n 
1 137 GLY n 
1 138 GLU n 
1 139 GLU n 
1 140 GLY n 
1 141 ALA n 
1 142 ARG n 
1 143 TYR n 
1 144 GLY n 
1 145 PRO n 
1 146 SER n 
1 147 LEU n 
1 148 MET n 
1 149 PRO n 
1 150 GLY n 
1 151 GLY n 
1 152 ASN n 
1 153 LYS n 
1 154 GLU n 
1 155 ALA n 
1 156 TRP n 
1 157 PRO n 
1 158 HIS n 
1 159 ILE n 
1 160 LYS n 
1 161 THR n 
1 162 ILE n 
1 163 PHE n 
1 164 GLN n 
1 165 GLY n 
1 166 ILE n 
1 167 ALA n 
1 168 ALA n 
1 169 LYS n 
1 170 VAL n 
1 171 GLY n 
1 172 THR n 
1 173 GLY n 
1 174 GLU n 
1 175 PRO n 
1 176 CYS n 
1 177 CYS n 
1 178 ASP n 
1 179 TRP n 
1 180 VAL n 
1 181 GLY n 
1 182 ASP n 
1 183 GLU n 
1 184 GLY n 
1 185 ALA n 
1 186 GLY n 
1 187 HIS n 
1 188 PHE n 
1 189 VAL n 
1 190 LYS n 
1 191 MET n 
1 192 VAL n 
1 193 HIS n 
1 194 ASN n 
1 195 GLY n 
1 196 ILE n 
1 197 GLU n 
1 198 TYR n 
1 199 GLY n 
1 200 ASP n 
1 201 MET n 
1 202 GLN n 
1 203 LEU n 
1 204 ILE n 
1 205 CYS n 
1 206 GLU n 
1 207 ALA n 
1 208 TYR n 
1 209 HIS n 
1 210 LEU n 
1 211 MET n 
1 212 LYS n 
1 213 ASP n 
1 214 VAL n 
1 215 LEU n 
1 216 GLY n 
1 217 MET n 
1 218 ALA n 
1 219 GLN n 
1 220 ASP n 
1 221 GLU n 
1 222 MET n 
1 223 ALA n 
1 224 GLN n 
1 225 ALA n 
1 226 PHE n 
1 227 GLU n 
1 228 ASP n 
1 229 TRP n 
1 230 ASN n 
1 231 LYS n 
1 232 THR n 
1 233 GLU n 
1 234 LEU n 
1 235 ASP n 
1 236 SER n 
1 237 PHE n 
1 238 LEU n 
1 239 ILE n 
1 240 GLU n 
1 241 ILE n 
1 242 THR n 
1 243 ALA n 
1 244 ASN n 
1 245 ILE n 
1 246 LEU n 
1 247 LYS n 
1 248 PHE n 
1 249 GLN n 
1 250 ASP n 
1 251 THR n 
1 252 ASP n 
1 253 GLY n 
1 254 LYS n 
1 255 HIS n 
1 256 LEU n 
1 257 LEU n 
1 258 PRO n 
1 259 LYS n 
1 260 ILE n 
1 261 ARG n 
1 262 ASP n 
1 263 SER n 
1 264 ALA n 
1 265 GLY n 
1 266 GLN n 
1 267 LYS n 
1 268 GLY n 
1 269 THR n 
1 270 GLY n 
1 271 LYS n 
1 272 TRP n 
1 273 THR n 
1 274 ALA n 
1 275 ILE n 
1 276 SER n 
1 277 ALA n 
1 278 LEU n 
1 279 GLU n 
1 280 TYR n 
1 281 GLY n 
1 282 VAL n 
1 283 PRO n 
1 284 VAL n 
1 285 THR n 
1 286 LEU n 
1 287 ILE n 
1 288 GLY n 
1 289 GLU n 
1 290 ALA n 
1 291 VAL n 
1 292 PHE n 
1 293 ALA n 
1 294 ARG n 
1 295 CYS n 
1 296 LEU n 
1 297 SER n 
1 298 SER n 
1 299 LEU n 
1 300 LYS n 
1 301 ASP n 
1 302 GLU n 
1 303 ARG n 
1 304 ILE n 
1 305 GLN n 
1 306 ALA n 
1 307 SER n 
1 308 LYS n 
1 309 LYS n 
1 310 LEU n 
1 311 LYS n 
1 312 GLY n 
1 313 PRO n 
1 314 GLN n 
1 315 LYS n 
1 316 PHE n 
1 317 GLN n 
1 318 PHE n 
1 319 ASP n 
1 320 GLY n 
1 321 ASP n 
1 322 LYS n 
1 323 LYS n 
1 324 SER n 
1 325 PHE n 
1 326 LEU n 
1 327 GLU n 
1 328 ASP n 
1 329 ILE n 
1 330 ARG n 
1 331 LYS n 
1 332 ALA n 
1 333 LEU n 
1 334 TYR n 
1 335 ALA n 
1 336 SER n 
1 337 LYS n 
1 338 ILE n 
1 339 ILE n 
1 340 SER n 
1 341 TYR n 
1 342 ALA n 
1 343 GLN n 
1 344 GLY n 
1 345 PHE n 
1 346 MET n 
1 347 LEU n 
1 348 LEU n 
1 349 ARG n 
1 350 GLN n 
1 351 ALA n 
1 352 ALA n 
1 353 THR n 
1 354 GLU n 
1 355 PHE n 
1 356 GLY n 
1 357 TRP n 
1 358 THR n 
1 359 LEU n 
1 360 ASN n 
1 361 TYR n 
1 362 GLY n 
1 363 GLY n 
1 364 ILE n 
1 365 ALA n 
1 366 LEU n 
1 367 MET n 
1 368 TRP n 
1 369 ARG n 
1 370 GLY n 
1 371 GLY n 
1 372 CYS n 
1 373 ILE n 
1 374 ILE n 
1 375 ARG n 
1 376 SER n 
1 377 VAL n 
1 378 PHE n 
1 379 LEU n 
1 380 GLY n 
1 381 LYS n 
1 382 ILE n 
1 383 LYS n 
1 384 ASP n 
1 385 ALA n 
1 386 PHE n 
1 387 ASP n 
1 388 ARG n 
1 389 ASN n 
1 390 PRO n 
1 391 GLU n 
1 392 LEU n 
1 393 GLN n 
1 394 ASN n 
1 395 LEU n 
1 396 LEU n 
1 397 LEU n 
1 398 ASP n 
1 399 ASP n 
1 400 PHE n 
1 401 PHE n 
1 402 LYS n 
1 403 SER n 
1 404 ALA n 
1 405 VAL n 
1 406 GLU n 
1 407 ASN n 
1 408 CYS n 
1 409 GLN n 
1 410 ASP n 
1 411 SER n 
1 412 TRP n 
1 413 ARG n 
1 414 ARG n 
1 415 ALA n 
1 416 VAL n 
1 417 SER n 
1 418 THR n 
1 419 GLY n 
1 420 VAL n 
1 421 GLN n 
1 422 ALA n 
1 423 GLY n 
1 424 ILE n 
1 425 PRO n 
1 426 MET n 
1 427 PRO n 
1 428 CYS n 
1 429 PHE n 
1 430 THR n 
1 431 THR n 
1 432 ALA n 
1 433 LEU n 
1 434 SER n 
1 435 PHE n 
1 436 TYR n 
1 437 ASP n 
1 438 GLY n 
1 439 TYR n 
1 440 ARG n 
1 441 HIS n 
1 442 GLU n 
1 443 MET n 
1 444 LEU n 
1 445 PRO n 
1 446 ALA n 
1 447 SER n 
1 448 LEU n 
1 449 ILE n 
1 450 GLN n 
1 451 ALA n 
1 452 GLN n 
1 453 ARG n 
1 454 ASP n 
1 455 TYR n 
1 456 PHE n 
1 457 GLY n 
1 458 ALA n 
1 459 HIS n 
1 460 THR n 
1 461 TYR n 
1 462 GLU n 
1 463 LEU n 
1 464 LEU n 
1 465 ALA n 
1 466 LYS n 
1 467 PRO n 
1 468 GLY n 
1 469 GLN n 
1 470 PHE n 
1 471 ILE n 
1 472 HIS n 
1 473 THR n 
1 474 ASN n 
1 475 TRP n 
1 476 THR n 
1 477 GLY n 
1 478 HIS n 
1 479 GLY n 
1 480 GLY n 
1 481 THR n 
1 482 VAL n 
1 483 SER n 
1 484 SER n 
1 485 SER n 
1 486 SER n 
1 487 TYR n 
1 488 ASN n 
1 489 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   489 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PGD, PGDH' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    6PGD_HUMAN 
_struct_ref.pdbx_db_accession          P52209 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQA
VDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGI
AAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANIL
KFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQKFQFDGDKKSFL
EDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVE
NCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSS
YNA
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5UQ9 A 7 ? 489 ? P52209 1 ? 483 ? 1 483 
2 1 5UQ9 B 7 ? 489 ? P52209 1 ? 483 ? 1 483 
3 1 5UQ9 C 7 ? 489 ? P52209 1 ? 483 ? 1 483 
4 1 5UQ9 D 7 ? 489 ? P52209 1 ? 483 ? 1 483 
5 1 5UQ9 E 7 ? 489 ? P52209 1 ? 483 ? 1 483 
6 1 5UQ9 F 7 ? 489 ? P52209 1 ? 483 ? 1 483 
7 1 5UQ9 G 7 ? 489 ? P52209 1 ? 483 ? 1 483 
8 1 5UQ9 H 7 ? 489 ? P52209 1 ? 483 ? 1 483 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5UQ9 GLY A 1 ? UNP P52209 ? ? 'expression tag' -5 1  
1 5UQ9 ALA A 2 ? UNP P52209 ? ? 'expression tag' -4 2  
1 5UQ9 MET A 3 ? UNP P52209 ? ? 'expression tag' -3 3  
1 5UQ9 ALA A 4 ? UNP P52209 ? ? 'expression tag' -2 4  
1 5UQ9 ASP A 5 ? UNP P52209 ? ? 'expression tag' -1 5  
1 5UQ9 ILE A 6 ? UNP P52209 ? ? 'expression tag' 0  6  
2 5UQ9 GLY B 1 ? UNP P52209 ? ? 'expression tag' -5 7  
2 5UQ9 ALA B 2 ? UNP P52209 ? ? 'expression tag' -4 8  
2 5UQ9 MET B 3 ? UNP P52209 ? ? 'expression tag' -3 9  
2 5UQ9 ALA B 4 ? UNP P52209 ? ? 'expression tag' -2 10 
2 5UQ9 ASP B 5 ? UNP P52209 ? ? 'expression tag' -1 11 
2 5UQ9 ILE B 6 ? UNP P52209 ? ? 'expression tag' 0  12 
3 5UQ9 GLY C 1 ? UNP P52209 ? ? 'expression tag' -5 13 
3 5UQ9 ALA C 2 ? UNP P52209 ? ? 'expression tag' -4 14 
3 5UQ9 MET C 3 ? UNP P52209 ? ? 'expression tag' -3 15 
3 5UQ9 ALA C 4 ? UNP P52209 ? ? 'expression tag' -2 16 
3 5UQ9 ASP C 5 ? UNP P52209 ? ? 'expression tag' -1 17 
3 5UQ9 ILE C 6 ? UNP P52209 ? ? 'expression tag' 0  18 
4 5UQ9 GLY D 1 ? UNP P52209 ? ? 'expression tag' -5 19 
4 5UQ9 ALA D 2 ? UNP P52209 ? ? 'expression tag' -4 20 
4 5UQ9 MET D 3 ? UNP P52209 ? ? 'expression tag' -3 21 
4 5UQ9 ALA D 4 ? UNP P52209 ? ? 'expression tag' -2 22 
4 5UQ9 ASP D 5 ? UNP P52209 ? ? 'expression tag' -1 23 
4 5UQ9 ILE D 6 ? UNP P52209 ? ? 'expression tag' 0  24 
5 5UQ9 GLY E 1 ? UNP P52209 ? ? 'expression tag' -5 25 
5 5UQ9 ALA E 2 ? UNP P52209 ? ? 'expression tag' -4 26 
5 5UQ9 MET E 3 ? UNP P52209 ? ? 'expression tag' -3 27 
5 5UQ9 ALA E 4 ? UNP P52209 ? ? 'expression tag' -2 28 
5 5UQ9 ASP E 5 ? UNP P52209 ? ? 'expression tag' -1 29 
5 5UQ9 ILE E 6 ? UNP P52209 ? ? 'expression tag' 0  30 
6 5UQ9 GLY F 1 ? UNP P52209 ? ? 'expression tag' -5 31 
6 5UQ9 ALA F 2 ? UNP P52209 ? ? 'expression tag' -4 32 
6 5UQ9 MET F 3 ? UNP P52209 ? ? 'expression tag' -3 33 
6 5UQ9 ALA F 4 ? UNP P52209 ? ? 'expression tag' -2 34 
6 5UQ9 ASP F 5 ? UNP P52209 ? ? 'expression tag' -1 35 
6 5UQ9 ILE F 6 ? UNP P52209 ? ? 'expression tag' 0  36 
7 5UQ9 GLY G 1 ? UNP P52209 ? ? 'expression tag' -5 37 
7 5UQ9 ALA G 2 ? UNP P52209 ? ? 'expression tag' -4 38 
7 5UQ9 MET G 3 ? UNP P52209 ? ? 'expression tag' -3 39 
7 5UQ9 ALA G 4 ? UNP P52209 ? ? 'expression tag' -2 40 
7 5UQ9 ASP G 5 ? UNP P52209 ? ? 'expression tag' -1 41 
7 5UQ9 ILE G 6 ? UNP P52209 ? ? 'expression tag' 0  42 
8 5UQ9 GLY H 1 ? UNP P52209 ? ? 'expression tag' -5 43 
8 5UQ9 ALA H 2 ? UNP P52209 ? ? 'expression tag' -4 44 
8 5UQ9 MET H 3 ? UNP P52209 ? ? 'expression tag' -3 45 
8 5UQ9 ALA H 4 ? UNP P52209 ? ? 'expression tag' -2 46 
8 5UQ9 ASP H 5 ? UNP P52209 ? ? 'expression tag' -1 47 
8 5UQ9 ILE H 6 ? UNP P52209 ? ? 'expression tag' 0  48 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
8HS non-polymer         . '[(4R,5R)-5-(hydroxycarbamoyl)-2,2-dimethyl-1,3-dioxolan-4-yl]methyl dihydrogen phosphate' ? 
'C7 H14 N O8 P'  271.162 
ALA 'L-peptide linking' y ALANINE                                                                                    ? 
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                                                   ? 
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                 ? 
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                            ? 
'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                   ? 
'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                                  ? 
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                            ? 
'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                                                    ? 
'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                  ? 
'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                                                 ? 
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                    ? 
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                                                     ? 
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                                                 ? 
'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                              ? 
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                                                    ? 
'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                                                     ? 
'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                                                  ? 
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                 ? 
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                   ? 
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                                                     ? 
'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5UQ9 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.23 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         44.82 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    'Room temp' 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '13% (w/v) PEG 3350, 10.0% (v/v) ethylene glycol' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-01-28 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.11587 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ALS BEAMLINE 8.3.1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.11587 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   8.3.1 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.B_iso_Wilson_estimate            60.050 
_reflns.entry_id                         5UQ9 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.000 
_reflns.d_resolution_low                 87.283 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       75282 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.900 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.500 
_reflns.pdbx_Rmerge_I_obs                0.122 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            8.700 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.144 
_reflns.pdbx_Rpim_I_all                  0.076 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.993 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
3.000  3.060  ? ? ? ? ? ? ? 99.900 ? ? ? ? 0.886 ? ? ? ? ? ? ? ? 3.600 ? ? ? ? 1.045 0.549 ? 1 1 0.502 ? 
15.000 87.280 ? ? ? ? ? ? ? 97.400 ? ? ? ? 0.045 ? ? ? ? ? ? ? ? 3.600 ? ? ? ? 0.053 0.028 ? 2 1 0.994 ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                129.420 
_refine.B_iso_mean                               59.6840 
_refine.B_iso_min                                16.590 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5UQ9 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.0000 
_refine.ls_d_res_low                             87.2830 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     75244 
_refine.ls_number_reflns_R_free                  3909 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.8400 
_refine.ls_percent_reflns_R_free                 5.2000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2198 
_refine.ls_R_factor_R_free                       0.2717 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2169 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.360 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2JKV 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 30.1300 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.4600 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       3.0000 
_refine_hist.d_res_low                        87.2830 
_refine_hist.pdbx_number_atoms_ligand         17 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               29092 
_refine_hist.pdbx_number_residues_total       3746 
_refine_hist.pdbx_B_iso_mean_ligand           76.82 
_refine_hist.pdbx_number_atoms_protein        29075 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.002  ? 29680 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.419  ? 40005 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.037  ? 4344  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003  ? 5167  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 11.443 ? 17644 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.0001 3.0366  2694 . 141 2553 100.0000 . . . 0.3941 0.0000 0.3304 . . . . . . 28 . . . 
'X-RAY DIFFRACTION' 3.0366 3.0751  2629 . 131 2498 100.0000 . . . 0.3619 0.0000 0.3155 . . . . . . 28 . . . 
'X-RAY DIFFRACTION' 3.0751 3.1155  2713 . 141 2572 100.0000 . . . 0.3453 0.0000 0.3024 . . . . . . 28 . . . 
'X-RAY DIFFRACTION' 3.1155 3.1582  2660 . 136 2524 100.0000 . . . 0.3759 0.0000 0.2968 . . . . . . 28 . . . 
'X-RAY DIFFRACTION' 3.1582 3.2034  2661 . 161 2500 100.0000 . . . 0.3903 0.0000 0.2878 . . . . . . 28 . . . 
'X-RAY DIFFRACTION' 3.2034 3.2512  2674 . 130 2544 100.0000 . . . 0.3125 0.0000 0.2758 . . . . . . 28 . . . 
'X-RAY DIFFRACTION' 3.2512 3.3020  2674 . 116 2558 100.0000 . . . 0.3338 0.0000 0.2706 . . . . . . 28 . . . 
'X-RAY DIFFRACTION' 3.3020 3.3561  2719 . 133 2586 100.0000 . . . 0.3065 0.0000 0.2569 . . . . . . 28 . . . 
'X-RAY DIFFRACTION' 3.3561 3.4140  2656 . 137 2519 100.0000 . . . 0.3488 0.0000 0.2533 . . . . . . 28 . . . 
'X-RAY DIFFRACTION' 3.4140 3.4761  2678 . 146 2532 100.0000 . . . 0.3205 0.0000 0.2491 . . . . . . 28 . . . 
'X-RAY DIFFRACTION' 3.4761 3.5429  2672 . 137 2535 100.0000 . . . 0.3323 0.0000 0.2510 . . . . . . 28 . . . 
'X-RAY DIFFRACTION' 3.5429 3.6152  2693 . 136 2557 100.0000 . . . 0.2755 0.0000 0.2382 . . . . . . 28 . . . 
'X-RAY DIFFRACTION' 3.6152 3.6939  2676 . 112 2564 100.0000 . . . 0.2838 0.0000 0.2367 . . . . . . 28 . . . 
'X-RAY DIFFRACTION' 3.6939 3.7798  2694 . 98  2596 100.0000 . . . 0.3519 0.0000 0.2273 . . . . . . 28 . . . 
'X-RAY DIFFRACTION' 3.7798 3.8743  2666 . 121 2545 100.0000 . . . 0.2938 0.0000 0.2214 . . . . . . 28 . . . 
'X-RAY DIFFRACTION' 3.8743 3.9791  2709 . 152 2557 100.0000 . . . 0.2899 0.0000 0.2099 . . . . . . 28 . . . 
'X-RAY DIFFRACTION' 3.9791 4.0961  2658 . 129 2529 100.0000 . . . 0.2374 0.0000 0.2000 . . . . . . 28 . . . 
'X-RAY DIFFRACTION' 4.0961 4.2284  2714 . 145 2569 100.0000 . . . 0.2743 0.0000 0.1978 . . . . . . 28 . . . 
'X-RAY DIFFRACTION' 4.2284 4.3795  2683 . 142 2541 100.0000 . . . 0.2239 0.0000 0.1927 . . . . . . 28 . . . 
'X-RAY DIFFRACTION' 4.3795 4.5548  2689 . 160 2529 100.0000 . . . 0.2487 0.0000 0.1856 . . . . . . 28 . . . 
'X-RAY DIFFRACTION' 4.5548 4.7621  2680 . 171 2509 100.0000 . . . 0.2542 0.0000 0.1833 . . . . . . 28 . . . 
'X-RAY DIFFRACTION' 4.7621 5.0131  2688 . 112 2576 100.0000 . . . 0.2504 0.0000 0.1854 . . . . . . 28 . . . 
'X-RAY DIFFRACTION' 5.0131 5.3272  2713 . 164 2549 100.0000 . . . 0.2270 0.0000 0.1960 . . . . . . 28 . . . 
'X-RAY DIFFRACTION' 5.3272 5.7384  2684 . 147 2537 100.0000 . . . 0.2420 0.0000 0.2058 . . . . . . 28 . . . 
'X-RAY DIFFRACTION' 5.7384 6.3158  2712 . 139 2573 100.0000 . . . 0.2539 0.0000 0.1974 . . . . . . 28 . . . 
'X-RAY DIFFRACTION' 6.3158 7.2293  2701 . 140 2561 100.0000 . . . 0.2623 0.0000 0.2053 . . . . . . 28 . . . 
'X-RAY DIFFRACTION' 7.2293 9.1066  2703 . 167 2536 100.0000 . . . 0.2289 0.0000 0.1810 . . . . . . 28 . . . 
'X-RAY DIFFRACTION' 9.1066 87.3203 2751 . 165 2586 99.0000  . . . 0.2233 0.0000 0.1812 . . . . . . 28 . . . 
# 
_struct.entry_id                     5UQ9 
_struct.title                        
;Crystal structure of 6-phosphogluconate dehydrogenase with ((4R,5R)-5-(hydroxycarbamoyl)-2,2-dimethyl-1,3-dioxolan-4-yl)methyl dihydrogen phosphate
;
_struct.pdbx_descriptor              '6-phosphogluconate dehydrogenase, decarboxylating (E.C.1.1.1.44)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5UQ9 
_struct_keywords.text            'Rossmann fold, Pentose phosphate pathway, Dehydrogenase, OXIDOREDUCTASE' 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 1 ? 
H N N 1 ? 
I N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 ALA A 18  ? ASP A 30  ? ALA A 12  ASP A 24  1 ? 13 
HELX_P HELX_P2   AA2 VAL A 42  ? ASN A 51  ? VAL A 36  ASN A 45  1 ? 10 
HELX_P HELX_P3   AA3 SER A 63  ? SER A 69  ? SER A 57  SER A 63  1 ? 7  
HELX_P HELX_P4   AA4 GLY A 84  ? VAL A 95  ? GLY A 78  VAL A 89  1 ? 12 
HELX_P HELX_P5   AA5 PRO A 96  ? LEU A 98  ? PRO A 90  LEU A 92  5 ? 3  
HELX_P HELX_P6   AA6 GLU A 111 ? LYS A 125 ? GLU A 105 LYS A 119 1 ? 15 
HELX_P HELX_P7   AA7 GLU A 139 ? GLY A 144 ? GLU A 133 GLY A 138 1 ? 6  
HELX_P HELX_P8   AA8 ALA A 155 ? ALA A 167 ? ALA A 149 ALA A 161 1 ? 13 
HELX_P HELX_P9   AA9 GLY A 184 ? VAL A 214 ? GLY A 178 VAL A 208 1 ? 31 
HELX_P HELX_P10  AB1 ALA A 218 ? ASN A 230 ? ALA A 212 ASN A 224 1 ? 13 
HELX_P HELX_P11  AB2 SER A 236 ? PHE A 248 ? SER A 230 PHE A 242 1 ? 13 
HELX_P HELX_P12  AB3 LEU A 256 ? ILE A 260 ? LEU A 250 ILE A 254 5 ? 5  
HELX_P HELX_P13  AB4 GLY A 268 ? GLY A 281 ? GLY A 262 GLY A 275 1 ? 14 
HELX_P HELX_P14  AB5 VAL A 284 ? LEU A 299 ? VAL A 278 LEU A 293 1 ? 16 
HELX_P HELX_P15  AB6 LEU A 299 ? LEU A 310 ? LEU A 293 LEU A 304 1 ? 12 
HELX_P HELX_P16  AB7 ASP A 321 ? GLY A 356 ? ASP A 315 GLY A 350 1 ? 36 
HELX_P HELX_P17  AB8 ASN A 360 ? TRP A 368 ? ASN A 354 TRP A 362 1 ? 9  
HELX_P HELX_P18  AB9 SER A 376 ? ASN A 389 ? SER A 370 ASN A 383 1 ? 14 
HELX_P HELX_P19  AC1 ASN A 394 ? LEU A 397 ? ASN A 388 LEU A 391 5 ? 4  
HELX_P HELX_P20  AC2 ASP A 398 ? GLY A 423 ? ASP A 392 GLY A 417 1 ? 26 
HELX_P HELX_P21  AC3 MET A 426 ? ARG A 440 ? MET A 420 ARG A 434 1 ? 15 
HELX_P HELX_P22  AC4 PRO A 445 ? GLY A 457 ? PRO A 439 GLY A 451 1 ? 13 
HELX_P HELX_P23  AC5 ALA B 18  ? HIS B 31  ? ALA B 12  HIS B 25  1 ? 14 
HELX_P HELX_P24  AC6 VAL B 42  ? ALA B 50  ? VAL B 36  ALA B 44  1 ? 9  
HELX_P HELX_P25  AC7 SER B 63  ? LYS B 70  ? SER B 57  LYS B 64  1 ? 8  
HELX_P HELX_P26  AC8 GLY B 84  ? VAL B 95  ? GLY B 78  VAL B 89  1 ? 12 
HELX_P HELX_P27  AC9 PRO B 96  ? LEU B 98  ? PRO B 90  LEU B 92  5 ? 3  
HELX_P HELX_P28  AD1 GLU B 111 ? LYS B 125 ? GLU B 105 LYS B 119 1 ? 15 
HELX_P HELX_P29  AD2 GLY B 136 ? GLY B 144 ? GLY B 130 GLY B 138 1 ? 9  
HELX_P HELX_P30  AD3 ALA B 155 ? ALA B 167 ? ALA B 149 ALA B 161 1 ? 13 
HELX_P HELX_P31  AD4 GLY B 184 ? VAL B 214 ? GLY B 178 VAL B 208 1 ? 31 
HELX_P HELX_P32  AD5 ALA B 218 ? ASN B 230 ? ALA B 212 ASN B 224 1 ? 13 
HELX_P HELX_P33  AD6 SER B 236 ? PHE B 248 ? SER B 230 PHE B 242 1 ? 13 
HELX_P HELX_P34  AD7 LEU B 256 ? ILE B 260 ? LEU B 250 ILE B 254 5 ? 5  
HELX_P HELX_P35  AD8 GLY B 270 ? GLY B 281 ? GLY B 264 GLY B 275 1 ? 12 
HELX_P HELX_P36  AD9 VAL B 284 ? SER B 298 ? VAL B 278 SER B 292 1 ? 15 
HELX_P HELX_P37  AE1 LEU B 299 ? LEU B 310 ? LEU B 293 LEU B 304 1 ? 12 
HELX_P HELX_P38  AE2 ASP B 321 ? GLY B 356 ? ASP B 315 GLY B 350 1 ? 36 
HELX_P HELX_P39  AE3 ASN B 360 ? ARG B 369 ? ASN B 354 ARG B 363 1 ? 10 
HELX_P HELX_P40  AE4 SER B 376 ? ASN B 389 ? SER B 370 ASN B 383 1 ? 14 
HELX_P HELX_P41  AE5 ASN B 394 ? LEU B 397 ? ASN B 388 LEU B 391 5 ? 4  
HELX_P HELX_P42  AE6 ASP B 398 ? GLY B 423 ? ASP B 392 GLY B 417 1 ? 26 
HELX_P HELX_P43  AE7 MET B 426 ? ARG B 440 ? MET B 420 ARG B 434 1 ? 15 
HELX_P HELX_P44  AE8 PRO B 445 ? ALA B 458 ? PRO B 439 ALA B 452 1 ? 14 
HELX_P HELX_P45  AE9 ALA C 18  ? ASP C 30  ? ALA C 12  ASP C 24  1 ? 13 
HELX_P HELX_P46  AF1 THR C 41  ? SER C 43  ? THR C 35  SER C 37  5 ? 3  
HELX_P HELX_P47  AF2 LYS C 44  ? ASN C 51  ? LYS C 38  ASN C 45  1 ? 8  
HELX_P HELX_P48  AF3 SER C 63  ? SER C 69  ? SER C 57  SER C 63  1 ? 7  
HELX_P HELX_P49  AF4 GLY C 84  ? VAL C 95  ? GLY C 78  VAL C 89  1 ? 12 
HELX_P HELX_P50  AF5 GLU C 111 ? ALA C 124 ? GLU C 105 ALA C 118 1 ? 14 
HELX_P HELX_P51  AF6 ALA C 155 ? ALA C 167 ? ALA C 149 ALA C 161 1 ? 13 
HELX_P HELX_P52  AF7 GLY C 184 ? VAL C 214 ? GLY C 178 VAL C 208 1 ? 31 
HELX_P HELX_P53  AF8 ALA C 218 ? ASN C 230 ? ALA C 212 ASN C 224 1 ? 13 
HELX_P HELX_P54  AF9 SER C 236 ? LYS C 247 ? SER C 230 LYS C 241 1 ? 12 
HELX_P HELX_P55  AG1 LEU C 256 ? ILE C 260 ? LEU C 250 ILE C 254 5 ? 5  
HELX_P HELX_P56  AG2 LYS C 267 ? GLY C 281 ? LYS C 261 GLY C 275 1 ? 15 
HELX_P HELX_P57  AG3 VAL C 284 ? LEU C 299 ? VAL C 278 LEU C 293 1 ? 16 
HELX_P HELX_P58  AG4 LEU C 299 ? LEU C 310 ? LEU C 293 LEU C 304 1 ? 12 
HELX_P HELX_P59  AG5 ASP C 321 ? GLY C 356 ? ASP C 315 GLY C 350 1 ? 36 
HELX_P HELX_P60  AG6 ASN C 360 ? ARG C 369 ? ASN C 354 ARG C 363 1 ? 10 
HELX_P HELX_P61  AG7 SER C 376 ? ASN C 389 ? SER C 370 ASN C 383 1 ? 14 
HELX_P HELX_P62  AG8 ASN C 394 ? LEU C 397 ? ASN C 388 LEU C 391 5 ? 4  
HELX_P HELX_P63  AG9 ASP C 398 ? GLY C 423 ? ASP C 392 GLY C 417 1 ? 26 
HELX_P HELX_P64  AH1 MET C 426 ? ARG C 440 ? MET C 420 ARG C 434 1 ? 15 
HELX_P HELX_P65  AH2 PRO C 445 ? GLY C 457 ? PRO C 439 GLY C 451 1 ? 13 
HELX_P HELX_P66  AH3 ALA D 18  ? HIS D 31  ? ALA D 12  HIS D 25  1 ? 14 
HELX_P HELX_P67  AH4 VAL D 42  ? ALA D 50  ? VAL D 36  ALA D 44  1 ? 9  
HELX_P HELX_P68  AH5 SER D 63  ? LEU D 71  ? SER D 57  LEU D 65  1 ? 9  
HELX_P HELX_P69  AH6 GLY D 84  ? VAL D 95  ? GLY D 78  VAL D 89  1 ? 12 
HELX_P HELX_P70  AH7 PRO D 96  ? LEU D 98  ? PRO D 90  LEU D 92  5 ? 3  
HELX_P HELX_P71  AH8 GLU D 111 ? LYS D 125 ? GLU D 105 LYS D 119 1 ? 15 
HELX_P HELX_P72  AH9 GLY D 136 ? GLY D 144 ? GLY D 130 GLY D 138 1 ? 9  
HELX_P HELX_P73  AI1 ASN D 152 ? GLU D 154 ? ASN D 146 GLU D 148 5 ? 3  
HELX_P HELX_P74  AI2 ALA D 155 ? ALA D 167 ? ALA D 149 ALA D 161 1 ? 13 
HELX_P HELX_P75  AI3 GLY D 184 ? VAL D 214 ? GLY D 178 VAL D 208 1 ? 31 
HELX_P HELX_P76  AI4 ALA D 218 ? ASN D 230 ? ALA D 212 ASN D 224 1 ? 13 
HELX_P HELX_P77  AI5 SER D 236 ? LYS D 247 ? SER D 230 LYS D 241 1 ? 12 
HELX_P HELX_P78  AI6 LEU D 256 ? ILE D 260 ? LEU D 250 ILE D 254 5 ? 5  
HELX_P HELX_P79  AI7 GLY D 270 ? GLY D 281 ? GLY D 264 GLY D 275 1 ? 12 
HELX_P HELX_P80  AI8 VAL D 284 ? SER D 298 ? VAL D 278 SER D 292 1 ? 15 
HELX_P HELX_P81  AI9 LEU D 299 ? LEU D 310 ? LEU D 293 LEU D 304 1 ? 12 
HELX_P HELX_P82  AJ1 ASP D 321 ? GLY D 356 ? ASP D 315 GLY D 350 1 ? 36 
HELX_P HELX_P83  AJ2 ASN D 360 ? TRP D 368 ? ASN D 354 TRP D 362 1 ? 9  
HELX_P HELX_P84  AJ3 SER D 376 ? ASN D 389 ? SER D 370 ASN D 383 1 ? 14 
HELX_P HELX_P85  AJ4 ASN D 394 ? LEU D 397 ? ASN D 388 LEU D 391 5 ? 4  
HELX_P HELX_P86  AJ5 ASP D 398 ? ASN D 407 ? ASP D 392 ASN D 401 1 ? 10 
HELX_P HELX_P87  AJ6 CYS D 408 ? GLY D 423 ? CYS D 402 GLY D 417 1 ? 16 
HELX_P HELX_P88  AJ7 MET D 426 ? ARG D 440 ? MET D 420 ARG D 434 1 ? 15 
HELX_P HELX_P89  AJ8 PRO D 445 ? PHE D 456 ? PRO D 439 PHE D 450 1 ? 12 
HELX_P HELX_P90  AJ9 ALA E 18  ? HIS E 31  ? ALA E 12  HIS E 25  1 ? 14 
HELX_P HELX_P91  AK1 VAL E 42  ? ALA E 50  ? VAL E 36  ALA E 44  1 ? 9  
HELX_P HELX_P92  AK2 SER E 63  ? LYS E 70  ? SER E 57  LYS E 64  1 ? 8  
HELX_P HELX_P93  AK3 GLY E 84  ? VAL E 95  ? GLY E 78  VAL E 89  1 ? 12 
HELX_P HELX_P94  AK4 PRO E 96  ? LEU E 98  ? PRO E 90  LEU E 92  5 ? 3  
HELX_P HELX_P95  AK5 GLU E 111 ? LYS E 125 ? GLU E 105 LYS E 119 1 ? 15 
HELX_P HELX_P96  AK6 GLY E 136 ? GLY E 144 ? GLY E 130 GLY E 138 1 ? 9  
HELX_P HELX_P97  AK7 ASN E 152 ? GLU E 154 ? ASN E 146 GLU E 148 5 ? 3  
HELX_P HELX_P98  AK8 ALA E 155 ? ALA E 167 ? ALA E 149 ALA E 161 1 ? 13 
HELX_P HELX_P99  AK9 GLY E 184 ? VAL E 214 ? GLY E 178 VAL E 208 1 ? 31 
HELX_P HELX_P100 AL1 ALA E 218 ? ASN E 230 ? ALA E 212 ASN E 224 1 ? 13 
HELX_P HELX_P101 AL2 SER E 236 ? LYS E 247 ? SER E 230 LYS E 241 1 ? 12 
HELX_P HELX_P102 AL3 LEU E 256 ? ILE E 260 ? LEU E 250 ILE E 254 5 ? 5  
HELX_P HELX_P103 AL4 THR E 269 ? GLY E 281 ? THR E 263 GLY E 275 1 ? 13 
HELX_P HELX_P104 AL5 VAL E 284 ? LEU E 299 ? VAL E 278 LEU E 293 1 ? 16 
HELX_P HELX_P105 AL6 LEU E 299 ? LEU E 310 ? LEU E 293 LEU E 304 1 ? 12 
HELX_P HELX_P106 AL7 ASP E 321 ? GLY E 356 ? ASP E 315 GLY E 350 1 ? 36 
HELX_P HELX_P107 AL8 ASN E 360 ? GLY E 370 ? ASN E 354 GLY E 364 1 ? 11 
HELX_P HELX_P108 AL9 SER E 376 ? ARG E 388 ? SER E 370 ARG E 382 1 ? 13 
HELX_P HELX_P109 AM1 ASN E 394 ? LEU E 397 ? ASN E 388 LEU E 391 5 ? 4  
HELX_P HELX_P110 AM2 ASP E 398 ? GLY E 423 ? ASP E 392 GLY E 417 1 ? 26 
HELX_P HELX_P111 AM3 MET E 426 ? ARG E 440 ? MET E 420 ARG E 434 1 ? 15 
HELX_P HELX_P112 AM4 PRO E 445 ? GLY E 457 ? PRO E 439 GLY E 451 1 ? 13 
HELX_P HELX_P113 AM5 ALA F 18  ? HIS F 31  ? ALA F 12  HIS F 25  1 ? 14 
HELX_P HELX_P114 AM6 VAL F 42  ? ALA F 50  ? VAL F 36  ALA F 44  1 ? 9  
HELX_P HELX_P115 AM7 SER F 63  ? LYS F 70  ? SER F 57  LYS F 64  1 ? 8  
HELX_P HELX_P116 AM8 GLY F 84  ? VAL F 95  ? GLY F 78  VAL F 89  1 ? 12 
HELX_P HELX_P117 AM9 PRO F 96  ? LEU F 98  ? PRO F 90  LEU F 92  5 ? 3  
HELX_P HELX_P118 AN1 GLU F 111 ? LYS F 125 ? GLU F 105 LYS F 119 1 ? 15 
HELX_P HELX_P119 AN2 GLY F 136 ? GLY F 144 ? GLY F 130 GLY F 138 1 ? 9  
HELX_P HELX_P120 AN3 ASN F 152 ? GLU F 154 ? ASN F 146 GLU F 148 5 ? 3  
HELX_P HELX_P121 AN4 ALA F 155 ? ALA F 167 ? ALA F 149 ALA F 161 1 ? 13 
HELX_P HELX_P122 AN5 GLY F 184 ? VAL F 214 ? GLY F 178 VAL F 208 1 ? 31 
HELX_P HELX_P123 AN6 ALA F 218 ? ASN F 230 ? ALA F 212 ASN F 224 1 ? 13 
HELX_P HELX_P124 AN7 SER F 236 ? PHE F 248 ? SER F 230 PHE F 242 1 ? 13 
HELX_P HELX_P125 AN8 LEU F 256 ? ILE F 260 ? LEU F 250 ILE F 254 5 ? 5  
HELX_P HELX_P126 AN9 THR F 269 ? GLY F 281 ? THR F 263 GLY F 275 1 ? 13 
HELX_P HELX_P127 AO1 VAL F 284 ? SER F 298 ? VAL F 278 SER F 292 1 ? 15 
HELX_P HELX_P128 AO2 LEU F 299 ? LYS F 308 ? LEU F 293 LYS F 302 1 ? 10 
HELX_P HELX_P129 AO3 ASP F 321 ? GLY F 356 ? ASP F 315 GLY F 350 1 ? 36 
HELX_P HELX_P130 AO4 ASN F 360 ? ARG F 369 ? ASN F 354 ARG F 363 1 ? 10 
HELX_P HELX_P131 AO5 SER F 376 ? ASN F 389 ? SER F 370 ASN F 383 1 ? 14 
HELX_P HELX_P132 AO6 ASN F 394 ? LEU F 397 ? ASN F 388 LEU F 391 5 ? 4  
HELX_P HELX_P133 AO7 ASP F 398 ? GLY F 423 ? ASP F 392 GLY F 417 1 ? 26 
HELX_P HELX_P134 AO8 MET F 426 ? ARG F 440 ? MET F 420 ARG F 434 1 ? 15 
HELX_P HELX_P135 AO9 PRO F 445 ? ALA F 458 ? PRO F 439 ALA F 452 1 ? 14 
HELX_P HELX_P136 AP1 VAL G 19  ? ASN G 27  ? VAL G 13  ASN G 21  1 ? 9  
HELX_P HELX_P137 AP2 THR G 41  ? LEU G 49  ? THR G 35  LEU G 43  1 ? 9  
HELX_P HELX_P138 AP3 SER G 63  ? SER G 69  ? SER G 57  SER G 63  1 ? 7  
HELX_P HELX_P139 AP4 ALA G 83  ? VAL G 95  ? ALA G 77  VAL G 89  1 ? 13 
HELX_P HELX_P140 AP5 PRO G 96  ? LEU G 98  ? PRO G 90  LEU G 92  5 ? 3  
HELX_P HELX_P141 AP6 GLU G 111 ? ALA G 124 ? GLU G 105 ALA G 118 1 ? 14 
HELX_P HELX_P142 AP7 GLU G 139 ? TYR G 143 ? GLU G 133 TYR G 137 5 ? 5  
HELX_P HELX_P143 AP8 ASN G 152 ? GLU G 154 ? ASN G 146 GLU G 148 5 ? 3  
HELX_P HELX_P144 AP9 ALA G 155 ? ALA G 167 ? ALA G 149 ALA G 161 1 ? 13 
HELX_P HELX_P145 AQ1 GLY G 184 ? VAL G 214 ? GLY G 178 VAL G 208 1 ? 31 
HELX_P HELX_P146 AQ2 ALA G 218 ? ASN G 230 ? ALA G 212 ASN G 224 1 ? 13 
HELX_P HELX_P147 AQ3 SER G 236 ? PHE G 248 ? SER G 230 PHE G 242 1 ? 13 
HELX_P HELX_P148 AQ4 LEU G 256 ? ILE G 260 ? LEU G 250 ILE G 254 5 ? 5  
HELX_P HELX_P149 AQ5 THR G 269 ? GLY G 281 ? THR G 263 GLY G 275 1 ? 13 
HELX_P HELX_P150 AQ6 VAL G 284 ? LEU G 299 ? VAL G 278 LEU G 293 1 ? 16 
HELX_P HELX_P151 AQ7 LEU G 299 ? LEU G 310 ? LEU G 293 LEU G 304 1 ? 12 
HELX_P HELX_P152 AQ8 ASP G 321 ? PHE G 355 ? ASP G 315 PHE G 349 1 ? 35 
HELX_P HELX_P153 AQ9 TYR G 361 ? GLY G 370 ? TYR G 355 GLY G 364 1 ? 10 
HELX_P HELX_P154 AR1 VAL G 377 ? ASN G 389 ? VAL G 371 ASN G 383 1 ? 13 
HELX_P HELX_P155 AR2 ASN G 394 ? LEU G 397 ? ASN G 388 LEU G 391 5 ? 4  
HELX_P HELX_P156 AR3 ASP G 398 ? CYS G 408 ? ASP G 392 CYS G 402 1 ? 11 
HELX_P HELX_P157 AR4 CYS G 408 ? GLY G 423 ? CYS G 402 GLY G 417 1 ? 16 
HELX_P HELX_P158 AR5 MET G 426 ? TYR G 439 ? MET G 420 TYR G 433 1 ? 14 
HELX_P HELX_P159 AR6 PRO G 445 ? PHE G 456 ? PRO G 439 PHE G 450 1 ? 12 
HELX_P HELX_P160 AR7 ALA H 18  ? HIS H 31  ? ALA H 12  HIS H 25  1 ? 14 
HELX_P HELX_P161 AR8 SER H 43  ? ALA H 50  ? SER H 37  ALA H 44  1 ? 8  
HELX_P HELX_P162 AR9 SER H 63  ? LYS H 70  ? SER H 57  LYS H 64  1 ? 8  
HELX_P HELX_P163 AS1 GLY H 84  ? VAL H 95  ? GLY H 78  VAL H 89  1 ? 12 
HELX_P HELX_P164 AS2 PRO H 96  ? LEU H 98  ? PRO H 90  LEU H 92  5 ? 3  
HELX_P HELX_P165 AS3 GLU H 111 ? ALA H 124 ? GLU H 105 ALA H 118 1 ? 14 
HELX_P HELX_P166 AS4 GLU H 138 ? TYR H 143 ? GLU H 132 TYR H 137 1 ? 6  
HELX_P HELX_P167 AS5 ASN H 152 ? GLU H 154 ? ASN H 146 GLU H 148 5 ? 3  
HELX_P HELX_P168 AS6 ALA H 155 ? ALA H 167 ? ALA H 149 ALA H 161 1 ? 13 
HELX_P HELX_P169 AS7 GLY H 184 ? VAL H 214 ? GLY H 178 VAL H 208 1 ? 31 
HELX_P HELX_P170 AS8 ALA H 218 ? THR H 232 ? ALA H 212 THR H 226 1 ? 15 
HELX_P HELX_P171 AS9 PHE H 237 ? LYS H 247 ? PHE H 231 LYS H 241 1 ? 11 
HELX_P HELX_P172 AT1 LEU H 256 ? ILE H 260 ? LEU H 250 ILE H 254 5 ? 5  
HELX_P HELX_P173 AT2 THR H 269 ? GLY H 281 ? THR H 263 GLY H 275 1 ? 13 
HELX_P HELX_P174 AT3 VAL H 284 ? SER H 298 ? VAL H 278 SER H 292 1 ? 15 
HELX_P HELX_P175 AT4 LEU H 299 ? LYS H 308 ? LEU H 293 LYS H 302 1 ? 10 
HELX_P HELX_P176 AT5 ASP H 321 ? GLY H 356 ? ASP H 315 GLY H 350 1 ? 36 
HELX_P HELX_P177 AT6 ASN H 360 ? ARG H 369 ? ASN H 354 ARG H 363 1 ? 10 
HELX_P HELX_P178 AT7 SER H 376 ? ASN H 389 ? SER H 370 ASN H 383 1 ? 14 
HELX_P HELX_P179 AT8 PHE H 400 ? GLY H 423 ? PHE H 394 GLY H 417 1 ? 24 
HELX_P HELX_P180 AT9 MET H 426 ? ARG H 440 ? MET H 420 ARG H 434 1 ? 15 
HELX_P HELX_P181 AU1 PRO H 445 ? GLY H 457 ? PRO H 439 GLY H 451 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 73 A . ? LYS 67 A PRO 74 A ? PRO 68 A 1 2.00  
2 LYS 73 B . ? LYS 67 B PRO 74 B ? PRO 68 B 1 -2.59 
3 LYS 73 C . ? LYS 67 C PRO 74 C ? PRO 68 C 1 -0.17 
4 LYS 73 D . ? LYS 67 D PRO 74 D ? PRO 68 D 1 0.81  
5 LYS 73 E . ? LYS 67 E PRO 74 E ? PRO 68 E 1 -1.17 
6 LYS 73 F . ? LYS 67 F PRO 74 F ? PRO 68 F 1 -1.49 
7 LYS 73 G . ? LYS 67 G PRO 74 G ? PRO 68 G 1 -0.10 
8 LYS 73 H . ? LYS 67 H PRO 74 H ? PRO 68 H 1 0.44  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 8 ? 
AA2 ? 2 ? 
AA3 ? 7 ? 
AA4 ? 2 ? 
AA5 ? 8 ? 
AA6 ? 6 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 6 ? 
AB1 ? 2 ? 
AB2 ? 2 ? 
AB3 ? 6 ? 
AB4 ? 2 ? 
AB5 ? 2 ? 
AB6 ? 7 ? 
AB7 ? 2 ? 
AB8 ? 6 ? 
AB9 ? 2 ? 
AC1 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA1 6 7 ? anti-parallel 
AA1 7 8 ? parallel      
AA2 1 2 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? parallel      
AA3 3 4 ? parallel      
AA3 4 5 ? parallel      
AA3 5 6 ? parallel      
AA3 6 7 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? parallel      
AA5 2 3 ? parallel      
AA5 3 4 ? parallel      
AA5 4 5 ? parallel      
AA5 5 6 ? parallel      
AA5 6 7 ? anti-parallel 
AA5 7 8 ? parallel      
AA6 1 2 ? parallel      
AA6 2 3 ? parallel      
AA6 3 4 ? parallel      
AA6 4 5 ? parallel      
AA6 5 6 ? parallel      
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? parallel      
AA9 2 3 ? parallel      
AA9 3 4 ? parallel      
AA9 4 5 ? parallel      
AA9 5 6 ? parallel      
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? parallel      
AB3 2 3 ? parallel      
AB3 3 4 ? parallel      
AB3 4 5 ? parallel      
AB3 5 6 ? parallel      
AB4 1 2 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB6 1 2 ? parallel      
AB6 2 3 ? parallel      
AB6 3 4 ? parallel      
AB6 4 5 ? parallel      
AB6 5 6 ? anti-parallel 
AB6 6 7 ? parallel      
AB7 1 2 ? anti-parallel 
AB8 1 2 ? parallel      
AB8 2 3 ? parallel      
AB8 3 4 ? parallel      
AB8 4 5 ? parallel      
AB8 5 6 ? parallel      
AB9 1 2 ? anti-parallel 
AC1 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 59  ? GLY A 60  ? VAL A 53  GLY A 54  
AA1 2 VAL A 35  ? PHE A 38  ? VAL A 29  PHE A 32  
AA1 3 ILE A 12  ? ILE A 15  ? ILE A 6   ILE A 9   
AA1 4 ARG A 76  ? LEU A 79  ? ARG A 70  LEU A 73  
AA1 5 ILE A 103 ? ASP A 106 ? ILE A 97  ASP A 100 
AA1 6 LEU A 128 ? SER A 135 ? LEU A 122 SER A 129 
AA1 7 SER A 146 ? GLY A 151 ? SER A 140 GLY A 145 
AA1 8 GLY A 181 ? ASP A 182 ? GLY A 175 ASP A 176 
AA2 1 TYR A 461 ? LEU A 463 ? TYR A 455 LEU A 457 
AA2 2 LYS A 466 ? ILE A 471 ? LYS A 460 ILE A 465 
AA3 1 VAL B 59  ? GLY B 60  ? VAL B 53  GLY B 54  
AA3 2 VAL B 35  ? PHE B 38  ? VAL B 29  PHE B 32  
AA3 3 ILE B 12  ? ILE B 15  ? ILE B 6   ILE B 9   
AA3 4 ARG B 76  ? LEU B 79  ? ARG B 70  LEU B 73  
AA3 5 ILE B 103 ? ASP B 106 ? ILE B 97  ASP B 100 
AA3 6 LEU B 128 ? SER B 135 ? LEU B 122 SER B 129 
AA3 7 SER B 146 ? GLY B 151 ? SER B 140 GLY B 145 
AA4 1 TYR B 461 ? LEU B 463 ? TYR B 455 LEU B 457 
AA4 2 LYS B 466 ? ILE B 471 ? LYS B 460 ILE B 465 
AA5 1 VAL C 59  ? GLY C 60  ? VAL C 53  GLY C 54  
AA5 2 VAL C 35  ? PHE C 38  ? VAL C 29  PHE C 32  
AA5 3 ILE C 12  ? ILE C 15  ? ILE C 6   ILE C 9   
AA5 4 ARG C 76  ? LEU C 79  ? ARG C 70  LEU C 73  
AA5 5 ILE C 103 ? ASP C 106 ? ILE C 97  ASP C 100 
AA5 6 LEU C 128 ? SER C 135 ? LEU C 122 SER C 129 
AA5 7 SER C 146 ? GLY C 151 ? SER C 140 GLY C 145 
AA5 8 GLY C 181 ? ASP C 182 ? GLY C 175 ASP C 176 
AA6 1 VAL D 59  ? GLY D 60  ? VAL D 53  GLY D 54  
AA6 2 VAL D 35  ? PHE D 38  ? VAL D 29  PHE D 32  
AA6 3 ILE D 12  ? ILE D 15  ? ILE D 6   ILE D 9   
AA6 4 ARG D 76  ? LEU D 79  ? ARG D 70  LEU D 73  
AA6 5 ILE D 103 ? ASP D 106 ? ILE D 97  ASP D 100 
AA6 6 LEU D 128 ? GLY D 131 ? LEU D 122 GLY D 125 
AA7 1 GLY D 133 ? SER D 135 ? GLY D 127 SER D 129 
AA7 2 SER D 146 ? MET D 148 ? SER D 140 MET D 142 
AA8 1 TYR D 461 ? LEU D 463 ? TYR D 455 LEU D 457 
AA8 2 LYS D 466 ? ILE D 471 ? LYS D 460 ILE D 465 
AA9 1 VAL E 59  ? GLY E 60  ? VAL E 53  GLY E 54  
AA9 2 VAL E 35  ? PHE E 38  ? VAL E 29  PHE E 32  
AA9 3 ILE E 12  ? ILE E 15  ? ILE E 6   ILE E 9   
AA9 4 ARG E 76  ? LEU E 79  ? ARG E 70  LEU E 73  
AA9 5 ILE E 103 ? ASP E 106 ? ILE E 97  ASP E 100 
AA9 6 LEU E 128 ? GLY E 131 ? LEU E 122 GLY E 125 
AB1 1 GLY E 133 ? SER E 135 ? GLY E 127 SER E 129 
AB1 2 SER E 146 ? MET E 148 ? SER E 140 MET E 142 
AB2 1 TYR E 461 ? LEU E 463 ? TYR E 455 LEU E 457 
AB2 2 LYS E 466 ? ILE E 471 ? LYS E 460 ILE E 465 
AB3 1 VAL F 59  ? GLY F 60  ? VAL F 53  GLY F 54  
AB3 2 VAL F 35  ? PHE F 38  ? VAL F 29  PHE F 32  
AB3 3 ILE F 12  ? ILE F 15  ? ILE F 6   ILE F 9   
AB3 4 ARG F 76  ? LEU F 79  ? ARG F 70  LEU F 73  
AB3 5 ILE F 103 ? ASP F 106 ? ILE F 97  ASP F 100 
AB3 6 LEU F 128 ? GLY F 131 ? LEU F 122 GLY F 125 
AB4 1 GLY F 133 ? SER F 135 ? GLY F 127 SER F 129 
AB4 2 SER F 146 ? MET F 148 ? SER F 140 MET F 142 
AB5 1 TYR F 461 ? LEU F 463 ? TYR F 455 LEU F 457 
AB5 2 LYS F 466 ? ILE F 471 ? LYS F 460 ILE F 465 
AB6 1 VAL G 35  ? ALA G 37  ? VAL G 29  ALA G 31  
AB6 2 ILE G 12  ? LEU G 14  ? ILE G 6   LEU G 8   
AB6 3 ARG G 76  ? LEU G 79  ? ARG G 70  LEU G 73  
AB6 4 ILE G 103 ? ASP G 106 ? ILE G 97  ASP G 100 
AB6 5 LEU G 128 ? SER G 135 ? LEU G 122 SER G 129 
AB6 6 SER G 146 ? GLY G 151 ? SER G 140 GLY G 145 
AB6 7 GLY G 181 ? ASP G 182 ? GLY G 175 ASP G 176 
AB7 1 TYR G 461 ? LEU G 463 ? TYR G 455 LEU G 457 
AB7 2 LYS G 466 ? ILE G 471 ? LYS G 460 ILE G 465 
AB8 1 VAL H 59  ? GLY H 60  ? VAL H 53  GLY H 54  
AB8 2 VAL H 35  ? PHE H 38  ? VAL H 29  PHE H 32  
AB8 3 ILE H 12  ? ILE H 15  ? ILE H 6   ILE H 9   
AB8 4 ARG H 76  ? LEU H 79  ? ARG H 70  LEU H 73  
AB8 5 ILE H 103 ? ASP H 106 ? ILE H 97  ASP H 100 
AB8 6 LEU H 128 ? GLY H 131 ? LEU H 122 GLY H 125 
AB9 1 GLY H 133 ? SER H 135 ? GLY H 127 SER H 129 
AB9 2 SER H 146 ? MET H 148 ? SER H 140 MET H 142 
AC1 1 TYR H 461 ? LEU H 463 ? TYR H 455 LEU H 457 
AC1 2 LYS H 466 ? ILE H 471 ? LYS H 460 ILE H 465 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O VAL A 59  ? O VAL A 53  N VAL A 35  ? N VAL A 29  
AA1 2 3 O CYS A 36  ? O CYS A 30  N ILE A 12  ? N ILE A 6   
AA1 3 4 N ALA A 13  ? N ALA A 7   O ILE A 78  ? O ILE A 72  
AA1 4 5 N LEU A 79  ? N LEU A 73  O ILE A 105 ? O ILE A 99  
AA1 5 6 N ILE A 104 ? N ILE A 98  O VAL A 130 ? O VAL A 124 
AA1 6 7 N GLY A 131 ? N GLY A 125 O GLY A 150 ? O GLY A 144 
AA1 7 8 N GLY A 151 ? N GLY A 145 O GLY A 181 ? O GLY A 175 
AA2 1 2 N TYR A 461 ? N TYR A 455 O ILE A 471 ? O ILE A 465 
AA3 1 2 O VAL B 59  ? O VAL B 53  N ALA B 37  ? N ALA B 31  
AA3 2 3 O CYS B 36  ? O CYS B 30  N ILE B 12  ? N ILE B 6   
AA3 3 4 N ILE B 15  ? N ILE B 9   O ILE B 78  ? O ILE B 72  
AA3 4 5 N LEU B 79  ? N LEU B 73  O ILE B 105 ? O ILE B 99  
AA3 5 6 N ASP B 106 ? N ASP B 100 O VAL B 130 ? O VAL B 124 
AA3 6 7 N GLY B 131 ? N GLY B 125 O GLY B 150 ? O GLY B 144 
AA4 1 2 N TYR B 461 ? N TYR B 455 O ILE B 471 ? O ILE B 465 
AA5 1 2 O VAL C 59  ? O VAL C 53  N ALA C 37  ? N ALA C 31  
AA5 2 3 O CYS C 36  ? O CYS C 30  N ILE C 12  ? N ILE C 6   
AA5 3 4 N ALA C 13  ? N ALA C 7   O ILE C 78  ? O ILE C 72  
AA5 4 5 N ILE C 77  ? N ILE C 71  O ILE C 105 ? O ILE C 99  
AA5 5 6 N ASP C 106 ? N ASP C 100 O VAL C 130 ? O VAL C 124 
AA5 6 7 N GLY C 131 ? N GLY C 125 O GLY C 150 ? O GLY C 144 
AA5 7 8 N GLY C 151 ? N GLY C 145 O GLY C 181 ? O GLY C 175 
AA6 1 2 O VAL D 59  ? O VAL D 53  N ALA D 37  ? N ALA D 31  
AA6 2 3 O CYS D 36  ? O CYS D 30  N ILE D 12  ? N ILE D 6   
AA6 3 4 N ALA D 13  ? N ALA D 7   O ILE D 78  ? O ILE D 72  
AA6 4 5 N LEU D 79  ? N LEU D 73  O ILE D 105 ? O ILE D 99  
AA6 5 6 N ASP D 106 ? N ASP D 100 O VAL D 130 ? O VAL D 124 
AA7 1 2 N SER D 135 ? N SER D 129 O SER D 146 ? O SER D 140 
AA8 1 2 N TYR D 461 ? N TYR D 455 O ILE D 471 ? O ILE D 465 
AA9 1 2 O VAL E 59  ? O VAL E 53  N ALA E 37  ? N ALA E 31  
AA9 2 3 O CYS E 36  ? O CYS E 30  N ILE E 12  ? N ILE E 6   
AA9 3 4 N ALA E 13  ? N ALA E 7   O ILE E 78  ? O ILE E 72  
AA9 4 5 N LEU E 79  ? N LEU E 73  O ILE E 105 ? O ILE E 99  
AA9 5 6 N ILE E 104 ? N ILE E 98  O VAL E 130 ? O VAL E 124 
AB1 1 2 N SER E 135 ? N SER E 129 O SER E 146 ? O SER E 140 
AB2 1 2 N TYR E 461 ? N TYR E 455 O ILE E 471 ? O ILE E 465 
AB3 1 2 O VAL F 59  ? O VAL F 53  N ALA F 37  ? N ALA F 31  
AB3 2 3 O CYS F 36  ? O CYS F 30  N ILE F 12  ? N ILE F 6   
AB3 3 4 N ALA F 13  ? N ALA F 7   O ILE F 78  ? O ILE F 72  
AB3 4 5 N ILE F 77  ? N ILE F 71  O ILE F 105 ? O ILE F 99  
AB3 5 6 N ASP F 106 ? N ASP F 100 O VAL F 130 ? O VAL F 124 
AB4 1 2 N SER F 135 ? N SER F 129 O SER F 146 ? O SER F 140 
AB5 1 2 N TYR F 461 ? N TYR F 455 O ILE F 471 ? O ILE F 465 
AB6 1 2 O CYS G 36  ? O CYS G 30  N ILE G 12  ? N ILE G 6   
AB6 2 3 N ALA G 13  ? N ALA G 7   O ILE G 78  ? O ILE G 72  
AB6 3 4 N LEU G 79  ? N LEU G 73  O ILE G 105 ? O ILE G 99  
AB6 4 5 N ASP G 106 ? N ASP G 100 O VAL G 130 ? O VAL G 124 
AB6 5 6 N GLY G 131 ? N GLY G 125 O GLY G 150 ? O GLY G 144 
AB6 6 7 N GLY G 151 ? N GLY G 145 O GLY G 181 ? O GLY G 175 
AB7 1 2 N TYR G 461 ? N TYR G 455 O ILE G 471 ? O ILE G 465 
AB8 1 2 O VAL H 59  ? O VAL H 53  N VAL H 35  ? N VAL H 29  
AB8 2 3 O CYS H 36  ? O CYS H 30  N LEU H 14  ? N LEU H 8   
AB8 3 4 N ILE H 15  ? N ILE H 9   O ILE H 78  ? O ILE H 72  
AB8 4 5 N LEU H 79  ? N LEU H 73  O ILE H 105 ? O ILE H 99  
AB8 5 6 N ILE H 104 ? N ILE H 98  O VAL H 130 ? O VAL H 124 
AB9 1 2 N GLY H 133 ? N GLY H 127 O MET H 148 ? O MET H 142 
AC1 1 2 N TYR H 461 ? N TYR H 455 O ILE H 471 ? O ILE H 465 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    F 
_struct_site.pdbx_auth_comp_id    8HS 
_struct_site.pdbx_auth_seq_id     501 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    8 
_struct_site.details              'binding site for residue 8HS F 501' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 8 ASN E 109 ? ASN E 103 . ? 1_555 ? 
2 AC1 8 TYR E 198 ? TYR E 192 . ? 1_555 ? 
3 AC1 8 LYS E 267 ? LYS E 261 . ? 1_555 ? 
4 AC1 8 ARG E 294 ? ARG E 288 . ? 1_555 ? 
5 AC1 8 ARG F 453 ? ARG F 447 . ? 1_555 ? 
6 AC1 8 PHE F 456 ? PHE F 450 . ? 1_555 ? 
7 AC1 8 GLY F 457 ? GLY F 451 . ? 1_555 ? 
8 AC1 8 HIS F 459 ? HIS F 453 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5UQ9 
_atom_sites.fract_transf_matrix[1][1]   0.011453 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000286 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006063 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007510 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . ALA A 1 8   ? 180.019 -42.823 282.073 1.00 77.08  ?  2   ALA A N   1 
ATOM   2     C CA  . ALA A 1 8   ? 180.699 -43.615 283.092 1.00 82.21  ?  2   ALA A CA  1 
ATOM   3     C C   . ALA A 1 8   ? 182.212 -43.467 282.977 1.00 83.12  ?  2   ALA A C   1 
ATOM   4     O O   . ALA A 1 8   ? 182.968 -44.314 283.453 1.00 83.87  ?  2   ALA A O   1 
ATOM   5     C CB  . ALA A 1 8   ? 180.298 -45.077 282.980 1.00 80.14  ?  2   ALA A CB  1 
ATOM   6     N N   . GLN A 1 9   ? 182.648 -42.379 282.342 1.00 84.47  ?  3   GLN A N   1 
ATOM   7     C CA  . GLN A 1 9   ? 184.063 -42.111 282.131 1.00 79.84  ?  3   GLN A CA  1 
ATOM   8     C C   . GLN A 1 9   ? 184.573 -40.898 282.891 1.00 78.15  ?  3   GLN A C   1 
ATOM   9     O O   . GLN A 1 9   ? 185.753 -40.860 283.245 1.00 74.21  ?  3   GLN A O   1 
ATOM   10    C CB  . GLN A 1 9   ? 184.347 -41.912 280.636 1.00 82.34  ?  3   GLN A CB  1 
ATOM   11    C CG  . GLN A 1 9   ? 185.713 -42.401 280.179 1.00 96.01  ?  3   GLN A CG  1 
ATOM   12    C CD  . GLN A 1 9   ? 185.624 -43.642 279.308 1.00 98.69  ?  3   GLN A CD  1 
ATOM   13    O OE1 . GLN A 1 9   ? 184.660 -44.405 279.389 1.00 95.31  ?  3   GLN A OE1 1 
ATOM   14    N NE2 . GLN A 1 9   ? 186.627 -43.844 278.460 1.00 82.76  ?  3   GLN A NE2 1 
ATOM   15    N N   . ALA A 1 10  ? 183.717 -39.913 283.153 1.00 79.47  ?  4   ALA A N   1 
ATOM   16    C CA  . ALA A 1 10  ? 184.102 -38.690 283.842 1.00 73.42  ?  4   ALA A CA  1 
ATOM   17    C C   . ALA A 1 10  ? 183.512 -38.669 285.245 1.00 75.04  ?  4   ALA A C   1 
ATOM   18    O O   . ALA A 1 10  ? 182.397 -39.152 285.469 1.00 72.82  ?  4   ALA A O   1 
ATOM   19    C CB  . ALA A 1 10  ? 183.643 -37.453 283.065 1.00 70.35  ?  4   ALA A CB  1 
ATOM   20    N N   . ASP A 1 11  ? 184.267 -38.102 286.188 1.00 72.23  ?  5   ASP A N   1 
ATOM   21    C CA  . ASP A 1 11  ? 183.813 -38.025 287.572 1.00 71.64  ?  5   ASP A CA  1 
ATOM   22    C C   . ASP A 1 11  ? 182.932 -36.802 287.801 1.00 69.01  ?  5   ASP A C   1 
ATOM   23    O O   . ASP A 1 11  ? 181.867 -36.901 288.420 1.00 64.81  ?  5   ASP A O   1 
ATOM   24    C CB  . ASP A 1 11  ? 185.016 -37.992 288.517 1.00 76.24  ?  5   ASP A CB  1 
ATOM   25    C CG  . ASP A 1 11  ? 185.918 -39.199 288.358 1.00 79.66  ?  5   ASP A CG  1 
ATOM   26    O OD1 . ASP A 1 11  ? 185.403 -40.335 288.393 1.00 78.13  ?  5   ASP A OD1 1 
ATOM   27    O OD2 . ASP A 1 11  ? 187.142 -39.008 288.194 1.00 81.52  -1 5   ASP A OD2 1 
ATOM   28    N N   . ILE A 1 12  ? 183.362 -35.643 287.307 1.00 72.22  ?  6   ILE A N   1 
ATOM   29    C CA  . ILE A 1 12  ? 182.706 -34.371 287.574 1.00 64.25  ?  6   ILE A CA  1 
ATOM   30    C C   . ILE A 1 12  ? 182.560 -33.609 286.264 1.00 65.81  ?  6   ILE A C   1 
ATOM   31    O O   . ILE A 1 12  ? 183.334 -33.802 285.321 1.00 70.06  ?  6   ILE A O   1 
ATOM   32    C CB  . ILE A 1 12  ? 183.499 -33.542 288.615 1.00 59.20  ?  6   ILE A CB  1 
ATOM   33    C CG1 . ILE A 1 12  ? 182.700 -32.326 289.089 1.00 52.05  ?  6   ILE A CG1 1 
ATOM   34    C CG2 . ILE A 1 12  ? 184.844 -33.116 288.053 1.00 60.97  ?  6   ILE A CG2 1 
ATOM   35    C CD1 . ILE A 1 12  ? 181.857 -32.590 290.309 1.00 52.97  ?  6   ILE A CD1 1 
ATOM   36    N N   . ALA A 1 13  ? 181.544 -32.751 286.202 1.00 62.40  ?  7   ALA A N   1 
ATOM   37    C CA  . ALA A 1 13  ? 181.327 -31.858 285.074 1.00 59.98  ?  7   ALA A CA  1 
ATOM   38    C C   . ALA A 1 13  ? 181.326 -30.417 285.564 1.00 56.26  ?  7   ALA A C   1 
ATOM   39    O O   . ALA A 1 13  ? 180.775 -30.113 286.626 1.00 48.44  ?  7   ALA A O   1 
ATOM   40    C CB  . ALA A 1 13  ? 180.009 -32.168 284.359 1.00 61.01  ?  7   ALA A CB  1 
ATOM   41    N N   . LEU A 1 14  ? 181.948 -29.532 284.787 1.00 59.29  ?  8   LEU A N   1 
ATOM   42    C CA  . LEU A 1 14  ? 182.042 -28.119 285.131 1.00 54.69  ?  8   LEU A CA  1 
ATOM   43    C C   . LEU A 1 14  ? 181.644 -27.295 283.916 1.00 56.70  ?  8   LEU A C   1 
ATOM   44    O O   . LEU A 1 14  ? 182.283 -27.390 282.863 1.00 54.98  ?  8   LEU A O   1 
ATOM   45    C CB  . LEU A 1 14  ? 183.456 -27.755 285.598 1.00 54.92  ?  8   LEU A CB  1 
ATOM   46    C CG  . LEU A 1 14  ? 183.666 -26.377 286.233 1.00 53.70  ?  8   LEU A CG  1 
ATOM   47    C CD1 . LEU A 1 14  ? 184.730 -26.454 287.315 1.00 61.13  ?  8   LEU A CD1 1 
ATOM   48    C CD2 . LEU A 1 14  ? 184.051 -25.336 285.190 1.00 55.47  ?  8   LEU A CD2 1 
ATOM   49    N N   . ILE A 1 15  ? 180.595 -26.491 284.065 1.00 51.50  ?  9   ILE A N   1 
ATOM   50    C CA  . ILE A 1 15  ? 180.108 -25.618 283.003 1.00 54.89  ?  9   ILE A CA  1 
ATOM   51    C C   . ILE A 1 15  ? 180.617 -24.208 283.265 1.00 56.15  ?  9   ILE A C   1 
ATOM   52    O O   . ILE A 1 15  ? 180.479 -23.686 284.378 1.00 55.05  ?  9   ILE A O   1 
ATOM   53    C CB  . ILE A 1 15  ? 178.573 -25.643 282.917 1.00 46.81  ?  9   ILE A CB  1 
ATOM   54    C CG1 . ILE A 1 15  ? 178.071 -27.078 282.750 1.00 46.97  ?  9   ILE A CG1 1 
ATOM   55    C CG2 . ILE A 1 15  ? 178.095 -24.779 281.764 1.00 48.80  ?  9   ILE A CG2 1 
ATOM   56    C CD1 . ILE A 1 15  ? 176.568 -27.186 282.604 1.00 46.63  ?  9   ILE A CD1 1 
ATOM   57    N N   . GLY A 1 16  ? 181.201 -23.591 282.241 1.00 53.54  ?  10  GLY A N   1 
ATOM   58    C CA  . GLY A 1 16  ? 181.776 -22.268 282.380 1.00 55.26  ?  10  GLY A CA  1 
ATOM   59    C C   . GLY A 1 16  ? 183.278 -22.284 282.192 1.00 65.11  ?  10  GLY A C   1 
ATOM   60    O O   . GLY A 1 16  ? 184.031 -22.412 283.162 1.00 69.29  ?  10  GLY A O   1 
ATOM   61    N N   . LEU A 1 17  ? 183.727 -22.155 280.944 1.00 68.87  ?  11  LEU A N   1 
ATOM   62    C CA  . LEU A 1 17  ? 185.147 -22.287 280.616 1.00 62.40  ?  11  LEU A CA  1 
ATOM   63    C C   . LEU A 1 17  ? 185.814 -20.912 280.602 1.00 60.75  ?  11  LEU A C   1 
ATOM   64    O O   . LEU A 1 17  ? 186.283 -20.409 279.579 1.00 63.13  ?  11  LEU A O   1 
ATOM   65    C CB  . LEU A 1 17  ? 185.319 -23.012 279.288 1.00 72.74  ?  11  LEU A CB  1 
ATOM   66    C CG  . LEU A 1 17  ? 184.828 -24.459 279.288 1.00 70.88  ?  11  LEU A CG  1 
ATOM   67    C CD1 . LEU A 1 17  ? 185.262 -25.164 278.023 1.00 78.98  ?  11  LEU A CD1 1 
ATOM   68    C CD2 . LEU A 1 17  ? 185.342 -25.192 280.512 1.00 62.54  ?  11  LEU A CD2 1 
ATOM   69    N N   . ALA A 1 18  ? 185.846 -20.304 281.781 1.00 60.58  ?  12  ALA A N   1 
ATOM   70    C CA  . ALA A 1 18  ? 186.626 -19.103 282.025 1.00 54.31  ?  12  ALA A CA  1 
ATOM   71    C C   . ALA A 1 18  ? 187.900 -19.472 282.776 1.00 58.09  ?  12  ALA A C   1 
ATOM   72    O O   . ALA A 1 18  ? 188.092 -20.616 283.193 1.00 66.49  ?  12  ALA A O   1 
ATOM   73    C CB  . ALA A 1 18  ? 185.810 -18.075 282.814 1.00 57.27  ?  12  ALA A CB  1 
ATOM   74    N N   . VAL A 1 19  ? 188.778 -18.480 282.947 1.00 61.60  ?  13  VAL A N   1 
ATOM   75    C CA  . VAL A 1 19  ? 190.022 -18.711 283.677 1.00 59.61  ?  13  VAL A CA  1 
ATOM   76    C C   . VAL A 1 19  ? 189.741 -19.260 285.069 1.00 60.57  ?  13  VAL A C   1 
ATOM   77    O O   . VAL A 1 19  ? 190.530 -20.045 285.607 1.00 62.64  ?  13  VAL A O   1 
ATOM   78    C CB  . VAL A 1 19  ? 190.854 -17.416 283.738 1.00 59.69  ?  13  VAL A CB  1 
ATOM   79    C CG1 . VAL A 1 19  ? 191.594 -17.203 282.427 1.00 51.19  ?  13  VAL A CG1 1 
ATOM   80    C CG2 . VAL A 1 19  ? 189.956 -16.229 284.040 1.00 65.47  ?  13  VAL A CG2 1 
ATOM   81    N N   . MET A 1 20  ? 188.613 -18.874 285.668 1.00 64.37  ?  14  MET A N   1 
ATOM   82    C CA  . MET A 1 20  ? 188.222 -19.449 286.950 1.00 64.24  ?  14  MET A CA  1 
ATOM   83    C C   . MET A 1 20  ? 187.843 -20.917 286.795 1.00 66.40  ?  14  MET A C   1 
ATOM   84    O O   . MET A 1 20  ? 188.321 -21.777 287.545 1.00 61.35  ?  14  MET A O   1 
ATOM   85    C CB  . MET A 1 20  ? 187.060 -18.653 287.545 1.00 67.48  ?  14  MET A CB  1 
ATOM   86    C CG  . MET A 1 20  ? 186.766 -18.972 289.000 1.00 64.31  ?  14  MET A CG  1 
ATOM   87    S SD  . MET A 1 20  ? 188.100 -18.434 290.084 1.00 78.59  ?  14  MET A SD  1 
ATOM   88    C CE  . MET A 1 20  ? 188.142 -16.681 289.716 1.00 65.41  ?  14  MET A CE  1 
ATOM   89    N N   . GLY A 1 21  ? 186.986 -21.222 285.819 1.00 65.39  ?  15  GLY A N   1 
ATOM   90    C CA  . GLY A 1 21  ? 186.557 -22.598 285.627 1.00 60.21  ?  15  GLY A CA  1 
ATOM   91    C C   . GLY A 1 21  ? 187.646 -23.483 285.053 1.00 69.75  ?  15  GLY A C   1 
ATOM   92    O O   . GLY A 1 21  ? 187.779 -24.647 285.443 1.00 75.48  ?  15  GLY A O   1 
ATOM   93    N N   . GLN A 1 22  ? 188.436 -22.950 284.116 1.00 69.60  ?  16  GLN A N   1 
ATOM   94    C CA  . GLN A 1 22  ? 189.514 -23.735 283.522 1.00 61.84  ?  16  GLN A CA  1 
ATOM   95    C C   . GLN A 1 22  ? 190.530 -24.162 284.573 1.00 63.83  ?  16  GLN A C   1 
ATOM   96    O O   . GLN A 1 22  ? 190.972 -25.317 284.588 1.00 68.37  ?  16  GLN A O   1 
ATOM   97    C CB  . GLN A 1 22  ? 190.204 -22.936 282.416 1.00 59.82  ?  16  GLN A CB  1 
ATOM   98    C CG  . GLN A 1 22  ? 189.353 -22.695 281.182 1.00 60.98  ?  16  GLN A CG  1 
ATOM   99    C CD  . GLN A 1 22  ? 190.076 -21.867 280.138 1.00 67.38  ?  16  GLN A CD  1 
ATOM   100   O OE1 . GLN A 1 22  ? 191.142 -21.311 280.399 1.00 74.23  ?  16  GLN A OE1 1 
ATOM   101   N NE2 . GLN A 1 22  ? 189.498 -21.784 278.946 1.00 72.33  ?  16  GLN A NE2 1 
ATOM   102   N N   . ASN A 1 23  ? 190.911 -23.242 285.462 1.00 64.92  ?  17  ASN A N   1 
ATOM   103   C CA  . ASN A 1 23  ? 191.881 -23.576 286.498 1.00 62.74  ?  17  ASN A CA  1 
ATOM   104   C C   . ASN A 1 23  ? 191.335 -24.614 287.471 1.00 62.19  ?  17  ASN A C   1 
ATOM   105   O O   . ASN A 1 23  ? 192.103 -25.426 287.997 1.00 60.89  ?  17  ASN A O   1 
ATOM   106   C CB  . ASN A 1 23  ? 192.311 -22.312 287.243 1.00 60.30  ?  17  ASN A CB  1 
ATOM   107   C CG  . ASN A 1 23  ? 193.255 -21.447 286.426 1.00 58.42  ?  17  ASN A CG  1 
ATOM   108   O OD1 . ASN A 1 23  ? 194.472 -21.624 286.471 1.00 72.29  ?  17  ASN A OD1 1 
ATOM   109   N ND2 . ASN A 1 23  ? 192.698 -20.508 285.672 1.00 56.36  ?  17  ASN A ND2 1 
ATOM   110   N N   . LEU A 1 24  ? 190.023 -24.611 287.718 1.00 64.92  ?  18  LEU A N   1 
ATOM   111   C CA  . LEU A 1 24  ? 189.436 -25.632 288.582 1.00 64.63  ?  18  LEU A CA  1 
ATOM   112   C C   . LEU A 1 24  ? 189.415 -26.992 287.895 1.00 64.46  ?  18  LEU A C   1 
ATOM   113   O O   . LEU A 1 24  ? 189.611 -28.025 288.546 1.00 63.74  ?  18  LEU A O   1 
ATOM   114   C CB  . LEU A 1 24  ? 188.024 -25.226 289.003 1.00 61.16  ?  18  LEU A CB  1 
ATOM   115   C CG  . LEU A 1 24  ? 187.904 -24.351 290.251 1.00 60.62  ?  18  LEU A CG  1 
ATOM   116   C CD1 . LEU A 1 24  ? 186.443 -24.098 290.582 1.00 59.46  ?  18  LEU A CD1 1 
ATOM   117   C CD2 . LEU A 1 24  ? 188.613 -25.001 291.427 1.00 58.16  ?  18  LEU A CD2 1 
ATOM   118   N N   . ILE A 1 25  ? 189.170 -27.013 286.583 1.00 67.86  ?  19  ILE A N   1 
ATOM   119   C CA  . ILE A 1 25  ? 189.178 -28.273 285.843 1.00 68.23  ?  19  ILE A CA  1 
ATOM   120   C C   . ILE A 1 25  ? 190.572 -28.884 285.857 1.00 65.28  ?  19  ILE A C   1 
ATOM   121   O O   . ILE A 1 25  ? 190.749 -30.071 286.154 1.00 68.76  ?  19  ILE A O   1 
ATOM   122   C CB  . ILE A 1 25  ? 188.672 -28.053 284.407 1.00 65.44  ?  19  ILE A CB  1 
ATOM   123   C CG1 . ILE A 1 25  ? 187.196 -27.658 284.423 1.00 64.15  ?  19  ILE A CG1 1 
ATOM   124   C CG2 . ILE A 1 25  ? 188.895 -29.299 283.563 1.00 66.63  ?  19  ILE A CG2 1 
ATOM   125   C CD1 . ILE A 1 25  ? 186.640 -27.346 283.063 1.00 66.30  ?  19  ILE A CD1 1 
ATOM   126   N N   . LEU A 1 26  ? 191.585 -28.076 285.536 1.00 64.82  ?  20  LEU A N   1 
ATOM   127   C CA  . LEU A 1 26  ? 192.962 -28.552 285.604 1.00 66.87  ?  20  LEU A CA  1 
ATOM   128   C C   . LEU A 1 26  ? 193.363 -28.889 287.033 1.00 69.47  ?  20  LEU A C   1 
ATOM   129   O O   . LEU A 1 26  ? 194.174 -29.796 287.252 1.00 70.48  ?  20  LEU A O   1 
ATOM   130   C CB  . LEU A 1 26  ? 193.902 -27.501 285.014 1.00 68.71  ?  20  LEU A CB  1 
ATOM   131   C CG  . LEU A 1 26  ? 193.601 -27.066 283.578 1.00 70.41  ?  20  LEU A CG  1 
ATOM   132   C CD1 . LEU A 1 26  ? 194.054 -25.634 283.347 1.00 70.99  ?  20  LEU A CD1 1 
ATOM   133   C CD2 . LEU A 1 26  ? 194.264 -28.004 282.581 1.00 66.30  ?  20  LEU A CD2 1 
ATOM   134   N N   . ASN A 1 27  ? 192.809 -28.172 288.015 1.00 74.70  ?  21  ASN A N   1 
ATOM   135   C CA  . ASN A 1 27  ? 193.043 -28.513 289.415 1.00 64.22  ?  21  ASN A CA  1 
ATOM   136   C C   . ASN A 1 27  ? 192.552 -29.923 289.714 1.00 67.68  ?  21  ASN A C   1 
ATOM   137   O O   . ASN A 1 27  ? 193.279 -30.739 290.293 1.00 75.17  ?  21  ASN A O   1 
ATOM   138   C CB  . ASN A 1 27  ? 192.343 -27.498 290.323 1.00 68.28  ?  21  ASN A CB  1 
ATOM   139   C CG  . ASN A 1 27  ? 192.950 -27.427 291.714 1.00 66.07  ?  21  ASN A CG  1 
ATOM   140   O OD1 . ASN A 1 27  ? 192.928 -26.378 292.356 1.00 65.19  ?  21  ASN A OD1 1 
ATOM   141   N ND2 . ASN A 1 27  ? 193.499 -28.539 292.184 1.00 69.36  ?  21  ASN A ND2 1 
ATOM   142   N N   . MET A 1 28  ? 191.313 -30.227 289.324 1.00 63.27  ?  22  MET A N   1 
ATOM   143   C CA  . MET A 1 28  ? 190.781 -31.568 289.533 1.00 64.33  ?  22  MET A CA  1 
ATOM   144   C C   . MET A 1 28  ? 191.464 -32.588 288.631 1.00 66.58  ?  22  MET A C   1 
ATOM   145   O O   . MET A 1 28  ? 191.558 -33.766 288.992 1.00 66.05  ?  22  MET A O   1 
ATOM   146   C CB  . MET A 1 28  ? 189.271 -31.574 289.301 1.00 65.64  ?  22  MET A CB  1 
ATOM   147   C CG  . MET A 1 28  ? 188.495 -30.679 290.255 1.00 65.98  ?  22  MET A CG  1 
ATOM   148   S SD  . MET A 1 28  ? 186.734 -30.577 289.879 1.00 63.16  ?  22  MET A SD  1 
ATOM   149   C CE  . MET A 1 28  ? 186.764 -29.672 288.334 1.00 56.36  ?  22  MET A CE  1 
ATOM   150   N N   . ASN A 1 29  ? 191.949 -32.160 287.464 1.00 65.51  ?  23  ASN A N   1 
ATOM   151   C CA  . ASN A 1 29  ? 192.628 -33.089 286.569 1.00 67.74  ?  23  ASN A CA  1 
ATOM   152   C C   . ASN A 1 29  ? 194.041 -33.393 287.049 1.00 71.43  ?  23  ASN A C   1 
ATOM   153   O O   . ASN A 1 29  ? 194.526 -34.520 286.890 1.00 67.33  ?  23  ASN A O   1 
ATOM   154   C CB  . ASN A 1 29  ? 192.653 -32.530 285.148 1.00 69.82  ?  23  ASN A CB  1 
ATOM   155   C CG  . ASN A 1 29  ? 193.353 -33.451 284.174 1.00 76.36  ?  23  ASN A CG  1 
ATOM   156   O OD1 . ASN A 1 29  ? 194.547 -33.304 283.915 1.00 74.22  ?  23  ASN A OD1 1 
ATOM   157   N ND2 . ASN A 1 29  ? 192.614 -34.409 283.625 1.00 81.37  ?  23  ASN A ND2 1 
ATOM   158   N N   . ASP A 1 30  ? 194.712 -32.411 287.645 1.00 74.64  ?  24  ASP A N   1 
ATOM   159   C CA  . ASP A 1 30  ? 196.025 -32.652 288.236 1.00 72.85  ?  24  ASP A CA  1 
ATOM   160   C C   . ASP A 1 30  ? 195.946 -33.421 289.545 1.00 68.69  ?  24  ASP A C   1 
ATOM   161   O O   . ASP A 1 30  ? 196.955 -33.511 290.257 1.00 76.84  ?  24  ASP A O   1 
ATOM   162   C CB  . ASP A 1 30  ? 196.759 -31.327 288.453 1.00 69.68  ?  24  ASP A CB  1 
ATOM   163   C CG  . ASP A 1 30  ? 197.089 -30.620 287.149 1.00 78.42  ?  24  ASP A CG  1 
ATOM   164   O OD1 . ASP A 1 30  ? 197.157 -31.293 286.099 1.00 75.31  ?  24  ASP A OD1 1 
ATOM   165   O OD2 . ASP A 1 30  ? 197.286 -29.387 287.179 1.00 84.52  -1 24  ASP A OD2 1 
ATOM   166   N N   . HIS A 1 31  ? 194.772 -33.962 289.873 1.00 65.56  ?  25  HIS A N   1 
ATOM   167   C CA  . HIS A 1 31  ? 194.576 -34.763 291.074 1.00 69.93  ?  25  HIS A CA  1 
ATOM   168   C C   . HIS A 1 31  ? 194.007 -36.141 290.762 1.00 75.41  ?  25  HIS A C   1 
ATOM   169   O O   . HIS A 1 31  ? 193.620 -36.865 291.688 1.00 79.02  ?  25  HIS A O   1 
ATOM   170   C CB  . HIS A 1 31  ? 193.667 -34.026 292.064 1.00 75.81  ?  25  HIS A CB  1 
ATOM   171   C CG  . HIS A 1 31  ? 194.310 -32.834 292.704 1.00 72.40  ?  25  HIS A CG  1 
ATOM   172   N ND1 . HIS A 1 31  ? 194.851 -31.797 291.975 1.00 68.60  ?  25  HIS A ND1 1 
ATOM   173   C CD2 . HIS A 1 31  ? 194.499 -32.516 294.007 1.00 63.42  ?  25  HIS A CD2 1 
ATOM   174   C CE1 . HIS A 1 31  ? 195.347 -30.893 292.801 1.00 67.80  ?  25  HIS A CE1 1 
ATOM   175   N NE2 . HIS A 1 31  ? 195.145 -31.304 294.040 1.00 68.05  ?  25  HIS A NE2 1 
ATOM   176   N N   . GLY A 1 32  ? 193.939 -36.519 289.488 1.00 75.91  ?  26  GLY A N   1 
ATOM   177   C CA  . GLY A 1 32  ? 193.493 -37.840 289.101 1.00 81.06  ?  26  GLY A CA  1 
ATOM   178   C C   . GLY A 1 32  ? 192.019 -37.974 288.792 1.00 76.22  ?  26  GLY A C   1 
ATOM   179   O O   . GLY A 1 32  ? 191.524 -39.104 288.711 1.00 81.69  ?  26  GLY A O   1 
ATOM   180   N N   . PHE A 1 33  ? 191.302 -36.869 288.613 1.00 78.66  ?  27  PHE A N   1 
ATOM   181   C CA  . PHE A 1 33  ? 189.876 -36.896 288.323 1.00 78.29  ?  27  PHE A CA  1 
ATOM   182   C C   . PHE A 1 33  ? 189.632 -36.551 286.861 1.00 72.33  ?  27  PHE A C   1 
ATOM   183   O O   . PHE A 1 33  ? 190.235 -35.616 286.324 1.00 64.70  ?  27  PHE A O   1 
ATOM   184   C CB  . PHE A 1 33  ? 189.110 -35.921 289.221 1.00 69.33  ?  27  PHE A CB  1 
ATOM   185   C CG  . PHE A 1 33  ? 189.246 -36.211 290.688 1.00 69.09  ?  27  PHE A CG  1 
ATOM   186   C CD1 . PHE A 1 33  ? 188.475 -37.192 291.288 1.00 67.54  ?  27  PHE A CD1 1 
ATOM   187   C CD2 . PHE A 1 33  ? 190.142 -35.499 291.468 1.00 65.03  ?  27  PHE A CD2 1 
ATOM   188   C CE1 . PHE A 1 33  ? 188.597 -37.461 292.637 1.00 71.52  ?  27  PHE A CE1 1 
ATOM   189   C CE2 . PHE A 1 33  ? 190.269 -35.763 292.819 1.00 67.16  ?  27  PHE A CE2 1 
ATOM   190   C CZ  . PHE A 1 33  ? 189.495 -36.745 293.404 1.00 70.88  ?  27  PHE A CZ  1 
ATOM   191   N N   . VAL A 1 34  ? 188.747 -37.309 286.222 1.00 77.38  ?  28  VAL A N   1 
ATOM   192   C CA  . VAL A 1 34  ? 188.362 -37.063 284.837 1.00 84.38  ?  28  VAL A CA  1 
ATOM   193   C C   . VAL A 1 34  ? 187.221 -36.051 284.848 1.00 78.60  ?  28  VAL A C   1 
ATOM   194   O O   . VAL A 1 34  ? 186.105 -36.363 285.272 1.00 73.41  ?  28  VAL A O   1 
ATOM   195   C CB  . VAL A 1 34  ? 187.955 -38.357 284.124 1.00 82.69  ?  28  VAL A CB  1 
ATOM   196   C CG1 . VAL A 1 34  ? 187.587 -38.071 282.676 1.00 73.03  ?  28  VAL A CG1 1 
ATOM   197   C CG2 . VAL A 1 34  ? 189.079 -39.379 284.201 1.00 85.63  ?  28  VAL A CG2 1 
ATOM   198   N N   . VAL A 1 35  ? 187.502 -34.837 284.383 1.00 74.05  ?  29  VAL A N   1 
ATOM   199   C CA  . VAL A 1 35  ? 186.545 -33.736 284.408 1.00 70.20  ?  29  VAL A CA  1 
ATOM   200   C C   . VAL A 1 35  ? 185.964 -33.549 283.015 1.00 70.57  ?  29  VAL A C   1 
ATOM   201   O O   . VAL A 1 35  ? 186.690 -33.588 282.014 1.00 67.09  ?  29  VAL A O   1 
ATOM   202   C CB  . VAL A 1 35  ? 187.209 -32.438 284.905 1.00 71.25  ?  29  VAL A CB  1 
ATOM   203   C CG1 . VAL A 1 35  ? 186.168 -31.345 285.096 1.00 68.00  ?  29  VAL A CG1 1 
ATOM   204   C CG2 . VAL A 1 35  ? 187.971 -32.696 286.191 1.00 62.86  ?  29  VAL A CG2 1 
ATOM   205   N N   . CYS A 1 36  ? 184.650 -33.341 282.950 1.00 74.03  ?  30  CYS A N   1 
ATOM   206   C CA  . CYS A 1 36  ? 183.950 -33.095 281.695 1.00 76.44  ?  30  CYS A CA  1 
ATOM   207   C C   . CYS A 1 36  ? 183.737 -31.592 281.548 1.00 72.83  ?  30  CYS A C   1 
ATOM   208   O O   . CYS A 1 36  ? 182.893 -31.008 282.234 1.00 66.84  ?  30  CYS A O   1 
ATOM   209   C CB  . CYS A 1 36  ? 182.621 -33.844 281.654 1.00 73.84  ?  30  CYS A CB  1 
ATOM   210   S SG  . CYS A 1 36  ? 181.730 -33.690 280.088 1.00 84.46  ?  30  CYS A SG  1 
ATOM   211   N N   . ALA A 1 37  ? 184.503 -30.971 280.655 1.00 67.19  ?  31  ALA A N   1 
ATOM   212   C CA  . ALA A 1 37  ? 184.390 -29.537 280.428 1.00 64.74  ?  31  ALA A CA  1 
ATOM   213   C C   . ALA A 1 37  ? 183.284 -29.242 279.425 1.00 67.01  ?  31  ALA A C   1 
ATOM   214   O O   . ALA A 1 37  ? 183.118 -29.957 278.432 1.00 68.47  ?  31  ALA A O   1 
ATOM   215   C CB  . ALA A 1 37  ? 185.718 -28.968 279.926 1.00 61.29  ?  31  ALA A CB  1 
ATOM   216   N N   . PHE A 1 38  ? 182.523 -28.182 279.691 1.00 69.05  ?  32  PHE A N   1 
ATOM   217   C CA  . PHE A 1 38  ? 181.427 -27.796 278.816 1.00 67.51  ?  32  PHE A CA  1 
ATOM   218   C C   . PHE A 1 38  ? 181.188 -26.299 278.940 1.00 67.80  ?  32  PHE A C   1 
ATOM   219   O O   . PHE A 1 38  ? 181.514 -25.677 279.954 1.00 67.85  ?  32  PHE A O   1 
ATOM   220   C CB  . PHE A 1 38  ? 180.148 -28.579 279.139 1.00 59.79  ?  32  PHE A CB  1 
ATOM   221   C CG  . PHE A 1 38  ? 178.997 -28.261 278.229 1.00 61.58  ?  32  PHE A CG  1 
ATOM   222   C CD1 . PHE A 1 38  ? 179.008 -28.673 276.908 1.00 64.15  ?  32  PHE A CD1 1 
ATOM   223   C CD2 . PHE A 1 38  ? 177.904 -27.547 278.694 1.00 65.83  ?  32  PHE A CD2 1 
ATOM   224   C CE1 . PHE A 1 38  ? 177.953 -28.380 276.067 1.00 68.15  ?  32  PHE A CE1 1 
ATOM   225   C CE2 . PHE A 1 38  ? 176.844 -27.252 277.857 1.00 67.11  ?  32  PHE A CE2 1 
ATOM   226   C CZ  . PHE A 1 38  ? 176.869 -27.670 276.542 1.00 65.50  ?  32  PHE A CZ  1 
ATOM   227   N N   . ASN A 1 39  ? 180.615 -25.725 277.884 1.00 67.38  ?  33  ASN A N   1 
ATOM   228   C CA  . ASN A 1 39  ? 180.294 -24.307 277.849 1.00 65.53  ?  33  ASN A CA  1 
ATOM   229   C C   . ASN A 1 39  ? 179.117 -24.102 276.907 1.00 67.84  ?  33  ASN A C   1 
ATOM   230   O O   . ASN A 1 39  ? 178.865 -24.914 276.013 1.00 72.92  ?  33  ASN A O   1 
ATOM   231   C CB  . ASN A 1 39  ? 181.503 -23.471 277.404 1.00 70.18  ?  33  ASN A CB  1 
ATOM   232   C CG  . ASN A 1 39  ? 181.336 -21.991 277.700 1.00 71.78  ?  33  ASN A CG  1 
ATOM   233   O OD1 . ASN A 1 39  ? 180.219 -21.485 277.802 1.00 75.43  ?  33  ASN A OD1 1 
ATOM   234   N ND2 . ASN A 1 39  ? 182.454 -21.289 277.838 1.00 67.50  ?  33  ASN A ND2 1 
ATOM   235   N N   . ARG A 1 40  ? 178.388 -23.004 277.124 1.00 67.91  ?  34  ARG A N   1 
ATOM   236   C CA  . ARG A 1 40  ? 177.268 -22.683 276.244 1.00 63.44  ?  34  ARG A CA  1 
ATOM   237   C C   . ARG A 1 40  ? 177.753 -22.396 274.829 1.00 69.76  ?  34  ARG A C   1 
ATOM   238   O O   . ARG A 1 40  ? 177.128 -22.823 273.851 1.00 73.13  ?  34  ARG A O   1 
ATOM   239   C CB  . ARG A 1 40  ? 176.482 -21.495 276.800 1.00 61.41  ?  34  ARG A CB  1 
ATOM   240   C CG  . ARG A 1 40  ? 175.187 -21.205 276.056 1.00 64.18  ?  34  ARG A CG  1 
ATOM   241   C CD  . ARG A 1 40  ? 174.295 -20.264 276.851 1.00 67.34  ?  34  ARG A CD  1 
ATOM   242   N NE  . ARG A 1 40  ? 172.989 -20.083 276.222 1.00 65.49  ?  34  ARG A NE  1 
ATOM   243   C CZ  . ARG A 1 40  ? 172.658 -19.037 275.472 1.00 71.12  ?  34  ARG A CZ  1 
ATOM   244   N NH1 . ARG A 1 40  ? 173.537 -18.068 275.256 1.00 69.31  1  34  ARG A NH1 1 
ATOM   245   N NH2 . ARG A 1 40  ? 171.446 -18.958 274.940 1.00 73.12  ?  34  ARG A NH2 1 
ATOM   246   N N   . THR A 1 41  ? 178.866 -21.677 274.701 1.00 68.90  ?  35  THR A N   1 
ATOM   247   C CA  . THR A 1 41  ? 179.536 -21.492 273.415 1.00 75.33  ?  35  THR A CA  1 
ATOM   248   C C   . THR A 1 41  ? 180.565 -22.608 273.278 1.00 80.59  ?  35  THR A C   1 
ATOM   249   O O   . THR A 1 41  ? 181.691 -22.497 273.772 1.00 77.58  ?  35  THR A O   1 
ATOM   250   C CB  . THR A 1 41  ? 180.184 -20.115 273.327 1.00 77.29  ?  35  THR A CB  1 
ATOM   251   O OG1 . THR A 1 41  ? 181.256 -20.030 274.274 1.00 84.50  ?  35  THR A OG1 1 
ATOM   252   C CG2 . THR A 1 41  ? 179.164 -19.025 273.630 1.00 68.56  ?  35  THR A CG2 1 
ATOM   253   N N   . VAL A 1 42  ? 180.174 -23.693 272.604 1.00 82.78  ?  36  VAL A N   1 
ATOM   254   C CA  . VAL A 1 42  ? 181.007 -24.889 272.526 1.00 75.68  ?  36  VAL A CA  1 
ATOM   255   C C   . VAL A 1 42  ? 182.302 -24.664 271.761 1.00 76.87  ?  36  VAL A C   1 
ATOM   256   O O   . VAL A 1 42  ? 183.192 -25.522 271.803 1.00 77.15  ?  36  VAL A O   1 
ATOM   257   C CB  . VAL A 1 42  ? 180.204 -26.043 271.890 1.00 74.68  ?  36  VAL A CB  1 
ATOM   258   C CG1 . VAL A 1 42  ? 180.790 -27.390 272.288 1.00 75.19  ?  36  VAL A CG1 1 
ATOM   259   C CG2 . VAL A 1 42  ? 178.741 -25.957 272.295 1.00 63.86  ?  36  VAL A CG2 1 
ATOM   260   N N   . SER A 1 43  ? 182.435 -23.534 271.062 1.00 79.18  ?  37  SER A N   1 
ATOM   261   C CA  . SER A 1 43  ? 183.687 -23.234 270.374 1.00 82.64  ?  37  SER A CA  1 
ATOM   262   C C   . SER A 1 43  ? 184.853 -23.175 271.353 1.00 81.40  ?  37  SER A C   1 
ATOM   263   O O   . SER A 1 43  ? 185.948 -23.668 271.057 1.00 77.16  ?  37  SER A O   1 
ATOM   264   C CB  . SER A 1 43  ? 183.562 -21.916 269.610 1.00 89.97  ?  37  SER A CB  1 
ATOM   265   O OG  . SER A 1 43  ? 184.801 -21.543 269.033 1.00 89.91  ?  37  SER A OG  1 
ATOM   266   N N   . LYS A 1 44  ? 184.633 -22.586 272.531 1.00 84.73  ?  38  LYS A N   1 
ATOM   267   C CA  . LYS A 1 44  ? 185.692 -22.495 273.529 1.00 84.44  ?  38  LYS A CA  1 
ATOM   268   C C   . LYS A 1 44  ? 185.985 -23.838 274.187 1.00 81.53  ?  38  LYS A C   1 
ATOM   269   O O   . LYS A 1 44  ? 187.030 -23.981 274.831 1.00 75.50  ?  38  LYS A O   1 
ATOM   270   C CB  . LYS A 1 44  ? 185.324 -21.461 274.594 1.00 82.67  ?  38  LYS A CB  1 
ATOM   271   C CG  . LYS A 1 44  ? 184.814 -20.141 274.031 1.00 85.19  ?  38  LYS A CG  1 
ATOM   272   C CD  . LYS A 1 44  ? 185.831 -19.493 273.103 1.00 76.51  ?  38  LYS A CD  1 
ATOM   273   C CE  . LYS A 1 44  ? 187.085 -19.074 273.852 1.00 81.30  ?  38  LYS A CE  1 
ATOM   274   N NZ  . LYS A 1 44  ? 188.070 -18.411 272.953 1.00 69.67  1  38  LYS A NZ  1 
ATOM   275   N N   . VAL A 1 45  ? 185.091 -24.818 274.044 1.00 82.14  ?  39  VAL A N   1 
ATOM   276   C CA  . VAL A 1 45  ? 185.340 -26.141 274.611 1.00 74.88  ?  39  VAL A CA  1 
ATOM   277   C C   . VAL A 1 45  ? 186.483 -26.826 273.875 1.00 76.59  ?  39  VAL A C   1 
ATOM   278   O O   . VAL A 1 45  ? 187.459 -27.273 274.488 1.00 70.51  ?  39  VAL A O   1 
ATOM   279   C CB  . VAL A 1 45  ? 184.058 -26.992 274.581 1.00 73.74  ?  39  VAL A CB  1 
ATOM   280   C CG1 . VAL A 1 45  ? 184.336 -28.383 275.133 1.00 70.34  ?  39  VAL A CG1 1 
ATOM   281   C CG2 . VAL A 1 45  ? 182.949 -26.312 275.368 1.00 71.56  ?  39  VAL A CG2 1 
ATOM   282   N N   . ASP A 1 46  ? 186.378 -26.917 272.547 1.00 80.58  ?  40  ASP A N   1 
ATOM   283   C CA  . ASP A 1 46  ? 187.458 -27.505 271.761 1.00 80.15  ?  40  ASP A CA  1 
ATOM   284   C C   . ASP A 1 46  ? 188.731 -26.675 271.863 1.00 80.30  ?  40  ASP A C   1 
ATOM   285   O O   . ASP A 1 46  ? 189.837 -27.220 271.776 1.00 78.18  ?  40  ASP A O   1 
ATOM   286   C CB  . ASP A 1 46  ? 187.020 -27.651 270.303 1.00 78.65  ?  40  ASP A CB  1 
ATOM   287   C CG  . ASP A 1 46  ? 187.781 -28.739 269.567 1.00 90.43  ?  40  ASP A CG  1 
ATOM   288   O OD1 . ASP A 1 46  ? 189.029 -28.742 269.617 1.00 94.00  ?  40  ASP A OD1 1 
ATOM   289   O OD2 . ASP A 1 46  ? 187.127 -29.599 268.942 1.00 96.95  -1 40  ASP A OD2 1 
ATOM   290   N N   . ASP A 1 47  ? 188.597 -25.359 272.054 1.00 85.02  ?  41  ASP A N   1 
ATOM   291   C CA  . ASP A 1 47  ? 189.771 -24.521 272.276 1.00 79.40  ?  41  ASP A CA  1 
ATOM   292   C C   . ASP A 1 47  ? 190.452 -24.869 273.594 1.00 82.32  ?  41  ASP A C   1 
ATOM   293   O O   . ASP A 1 47  ? 191.686 -24.905 273.672 1.00 88.98  ?  41  ASP A O   1 
ATOM   294   C CB  . ASP A 1 47  ? 189.376 -23.044 272.255 1.00 79.76  ?  41  ASP A CB  1 
ATOM   295   C CG  . ASP A 1 47  ? 188.810 -22.609 270.917 1.00 80.39  ?  41  ASP A CG  1 
ATOM   296   O OD1 . ASP A 1 47  ? 188.818 -23.423 269.970 1.00 77.61  ?  41  ASP A OD1 1 
ATOM   297   O OD2 . ASP A 1 47  ? 188.354 -21.450 270.814 1.00 75.48  -1 41  ASP A OD2 1 
ATOM   298   N N   . PHE A 1 48  ? 189.663 -25.128 274.640 1.00 81.76  ?  42  PHE A N   1 
ATOM   299   C CA  . PHE A 1 48  ? 190.237 -25.471 275.937 1.00 80.11  ?  42  PHE A CA  1 
ATOM   300   C C   . PHE A 1 48  ? 190.929 -26.828 275.908 1.00 78.93  ?  42  PHE A C   1 
ATOM   301   O O   . PHE A 1 48  ? 191.892 -27.045 276.652 1.00 82.75  ?  42  PHE A O   1 
ATOM   302   C CB  . PHE A 1 48  ? 189.149 -25.443 277.012 1.00 78.61  ?  42  PHE A CB  1 
ATOM   303   C CG  . PHE A 1 48  ? 189.599 -25.958 278.349 1.00 73.62  ?  42  PHE A CG  1 
ATOM   304   C CD1 . PHE A 1 48  ? 190.538 -25.265 279.093 1.00 77.70  ?  42  PHE A CD1 1 
ATOM   305   C CD2 . PHE A 1 48  ? 189.074 -27.131 278.866 1.00 71.35  ?  42  PHE A CD2 1 
ATOM   306   C CE1 . PHE A 1 48  ? 190.953 -25.737 280.325 1.00 79.01  ?  42  PHE A CE1 1 
ATOM   307   C CE2 . PHE A 1 48  ? 189.483 -27.607 280.097 1.00 71.40  ?  42  PHE A CE2 1 
ATOM   308   C CZ  . PHE A 1 48  ? 190.423 -26.909 280.828 1.00 74.18  ?  42  PHE A CZ  1 
ATOM   309   N N   . LEU A 1 49  ? 190.463 -27.746 275.061 1.00 79.23  ?  43  LEU A N   1 
ATOM   310   C CA  . LEU A 1 49  ? 191.082 -29.061 274.950 1.00 83.71  ?  43  LEU A CA  1 
ATOM   311   C C   . LEU A 1 49  ? 192.335 -29.058 274.086 1.00 87.43  ?  43  LEU A C   1 
ATOM   312   O O   . LEU A 1 49  ? 193.051 -30.065 274.060 1.00 89.46  ?  43  LEU A O   1 
ATOM   313   C CB  . LEU A 1 49  ? 190.079 -30.073 274.386 1.00 69.59  ?  43  LEU A CB  1 
ATOM   314   C CG  . LEU A 1 49  ? 189.192 -30.846 275.369 1.00 67.22  ?  43  LEU A CG  1 
ATOM   315   C CD1 . LEU A 1 49  ? 188.256 -29.925 276.138 1.00 71.57  ?  43  LEU A CD1 1 
ATOM   316   C CD2 . LEU A 1 49  ? 188.403 -31.928 274.643 1.00 67.55  ?  43  LEU A CD2 1 
ATOM   317   N N   . ALA A 1 50  ? 192.621 -27.962 273.386 1.00 84.44  ?  44  ALA A N   1 
ATOM   318   C CA  . ALA A 1 50  ? 193.749 -27.896 272.471 1.00 87.41  ?  44  ALA A CA  1 
ATOM   319   C C   . ALA A 1 50  ? 194.843 -26.944 272.932 1.00 94.39  ?  44  ALA A C   1 
ATOM   320   O O   . ALA A 1 50  ? 195.897 -26.879 272.291 1.00 98.30  ?  44  ALA A O   1 
ATOM   321   C CB  . ALA A 1 50  ? 193.270 -27.496 271.072 1.00 83.30  ?  44  ALA A CB  1 
ATOM   322   N N   . ASN A 1 51  ? 194.631 -26.211 274.024 1.00 91.86  ?  45  ASN A N   1 
ATOM   323   C CA  . ASN A 1 51  ? 195.639 -25.274 274.506 1.00 95.23  ?  45  ASN A CA  1 
ATOM   324   C C   . ASN A 1 51  ? 195.845 -25.418 276.009 1.00 96.93  ?  45  ASN A C   1 
ATOM   325   O O   . ASN A 1 51  ? 196.874 -25.940 276.452 1.00 95.63  ?  45  ASN A O   1 
ATOM   326   C CB  . ASN A 1 51  ? 195.242 -23.838 274.155 1.00 91.45  ?  45  ASN A CB  1 
ATOM   327   C CG  . ASN A 1 51  ? 196.383 -22.852 274.336 1.00 98.37  ?  45  ASN A CG  1 
ATOM   328   O OD1 . ASN A 1 51  ? 197.141 -22.924 275.304 1.00 96.59  ?  45  ASN A OD1 1 
ATOM   329   N ND2 . ASN A 1 51  ? 196.511 -21.923 273.396 1.00 102.93 ?  45  ASN A ND2 1 
ATOM   330   N N   . GLU A 1 52  ? 194.876 -24.951 276.800 1.00 96.24  ?  46  GLU A N   1 
ATOM   331   C CA  . GLU A 1 52  ? 195.026 -24.977 278.252 1.00 94.00  ?  46  GLU A CA  1 
ATOM   332   C C   . GLU A 1 52  ? 195.071 -26.401 278.792 1.00 92.45  ?  46  GLU A C   1 
ATOM   333   O O   . GLU A 1 52  ? 195.705 -26.651 279.823 1.00 90.98  ?  46  GLU A O   1 
ATOM   334   C CB  . GLU A 1 52  ? 193.891 -24.192 278.910 1.00 92.28  ?  46  GLU A CB  1 
ATOM   335   C CG  . GLU A 1 52  ? 193.737 -22.765 278.397 1.00 91.99  ?  46  GLU A CG  1 
ATOM   336   C CD  . GLU A 1 52  ? 194.898 -21.867 278.787 1.00 96.82  ?  46  GLU A CD  1 
ATOM   337   O OE1 . GLU A 1 52  ? 195.623 -22.205 279.747 1.00 94.24  ?  46  GLU A OE1 1 
ATOM   338   O OE2 . GLU A 1 52  ? 195.084 -20.819 278.132 1.00 90.35  -1 46  GLU A OE2 1 
ATOM   339   N N   . ALA A 1 53  ? 194.410 -27.341 278.117 1.00 88.52  ?  47  ALA A N   1 
ATOM   340   C CA  . ALA A 1 53  ? 194.451 -28.741 278.521 1.00 83.51  ?  47  ALA A CA  1 
ATOM   341   C C   . ALA A 1 53  ? 195.111 -29.584 277.438 1.00 90.84  ?  47  ALA A C   1 
ATOM   342   O O   . ALA A 1 53  ? 194.576 -30.622 277.036 1.00 87.84  ?  47  ALA A O   1 
ATOM   343   C CB  . ALA A 1 53  ? 193.044 -29.259 278.822 1.00 79.92  ?  47  ALA A CB  1 
ATOM   344   N N   . LYS A 1 54  ? 196.273 -29.144 276.960 1.00 95.62  ?  48  LYS A N   1 
ATOM   345   C CA  . LYS A 1 54  ? 196.987 -29.836 275.892 1.00 92.93  ?  48  LYS A CA  1 
ATOM   346   C C   . LYS A 1 54  ? 197.759 -31.010 276.483 1.00 93.04  ?  48  LYS A C   1 
ATOM   347   O O   . LYS A 1 54  ? 198.783 -30.819 277.147 1.00 96.97  ?  48  LYS A O   1 
ATOM   348   C CB  . LYS A 1 54  ? 197.924 -28.874 275.167 1.00 88.49  ?  48  LYS A CB  1 
ATOM   349   C CG  . LYS A 1 54  ? 198.671 -29.499 274.000 1.00 87.06  ?  48  LYS A CG  1 
ATOM   350   C CD  . LYS A 1 54  ? 199.876 -28.663 273.603 1.00 82.25  ?  48  LYS A CD  1 
ATOM   351   C CE  . LYS A 1 54  ? 200.908 -28.623 274.719 1.00 80.48  ?  48  LYS A CE  1 
ATOM   352   N NZ  . LYS A 1 54  ? 201.374 -29.988 275.091 1.00 80.18  1  48  LYS A NZ  1 
ATOM   353   N N   . GLY A 1 55  ? 197.272 -32.224 276.242 1.00 93.20  ?  49  GLY A N   1 
ATOM   354   C CA  . GLY A 1 55  ? 197.955 -33.416 276.705 1.00 91.46  ?  49  GLY A CA  1 
ATOM   355   C C   . GLY A 1 55  ? 197.616 -33.799 278.130 1.00 88.86  ?  49  GLY A C   1 
ATOM   356   O O   . GLY A 1 55  ? 198.462 -33.700 279.023 1.00 84.04  ?  49  GLY A O   1 
ATOM   357   N N   . THR A 1 56  ? 196.382 -34.243 278.351 1.00 80.37  ?  50  THR A N   1 
ATOM   358   C CA  . THR A 1 56  ? 195.927 -34.658 279.672 1.00 84.60  ?  50  THR A CA  1 
ATOM   359   C C   . THR A 1 56  ? 194.644 -35.462 279.503 1.00 82.91  ?  50  THR A C   1 
ATOM   360   O O   . THR A 1 56  ? 194.155 -35.663 278.387 1.00 80.10  ?  50  THR A O   1 
ATOM   361   C CB  . THR A 1 56  ? 195.716 -33.453 280.593 1.00 89.29  ?  50  THR A CB  1 
ATOM   362   O OG1 . THR A 1 56  ? 195.191 -33.896 281.849 1.00 94.91  ?  50  THR A OG1 1 
ATOM   363   C CG2 . THR A 1 56  ? 194.753 -32.461 279.959 1.00 84.15  ?  50  THR A CG2 1 
ATOM   364   N N   . LYS A 1 57  ? 194.098 -35.925 280.627 1.00 85.27  ?  51  LYS A N   1 
ATOM   365   C CA  . LYS A 1 57  ? 192.888 -36.734 280.633 1.00 87.70  ?  51  LYS A CA  1 
ATOM   366   C C   . LYS A 1 57  ? 191.616 -35.890 280.663 1.00 82.35  ?  51  LYS A C   1 
ATOM   367   O O   . LYS A 1 57  ? 190.530 -36.429 280.903 1.00 82.45  ?  51  LYS A O   1 
ATOM   368   C CB  . LYS A 1 57  ? 192.914 -37.704 281.822 1.00 86.91  ?  51  LYS A CB  1 
ATOM   369   C CG  . LYS A 1 57  ? 192.033 -38.939 281.651 1.00 94.55  ?  51  LYS A CG  1 
ATOM   370   C CD  . LYS A 1 57  ? 192.332 -39.656 280.344 1.00 93.11  ?  51  LYS A CD  1 
ATOM   371   C CE  . LYS A 1 57  ? 191.187 -40.574 279.942 1.00 90.15  ?  51  LYS A CE  1 
ATOM   372   N NZ  . LYS A 1 57  ? 189.940 -39.809 279.656 1.00 89.34  1  51  LYS A NZ  1 
ATOM   373   N N   . VAL A 1 58  ? 191.721 -34.584 280.419 1.00 76.20  ?  52  VAL A N   1 
ATOM   374   C CA  . VAL A 1 58  ? 190.534 -33.740 280.359 1.00 87.11  ?  52  VAL A CA  1 
ATOM   375   C C   . VAL A 1 58  ? 189.721 -34.103 279.125 1.00 79.88  ?  52  VAL A C   1 
ATOM   376   O O   . VAL A 1 58  ? 190.242 -34.137 278.002 1.00 72.55  ?  52  VAL A O   1 
ATOM   377   C CB  . VAL A 1 58  ? 190.923 -32.255 280.354 1.00 84.59  ?  52  VAL A CB  1 
ATOM   378   C CG1 . VAL A 1 58  ? 189.697 -31.387 280.117 1.00 80.20  ?  52  VAL A CG1 1 
ATOM   379   C CG2 . VAL A 1 58  ? 191.589 -31.878 281.665 1.00 75.31  ?  52  VAL A CG2 1 
ATOM   380   N N   . VAL A 1 59  ? 188.435 -34.384 279.329 1.00 72.90  ?  53  VAL A N   1 
ATOM   381   C CA  . VAL A 1 59  ? 187.529 -34.734 278.242 1.00 74.94  ?  53  VAL A CA  1 
ATOM   382   C C   . VAL A 1 59  ? 186.682 -33.505 277.924 1.00 82.25  ?  53  VAL A C   1 
ATOM   383   O O   . VAL A 1 59  ? 186.944 -32.413 278.441 1.00 84.13  ?  53  VAL A O   1 
ATOM   384   C CB  . VAL A 1 59  ? 186.675 -35.964 278.620 1.00 68.56  ?  53  VAL A CB  1 
ATOM   385   C CG1 . VAL A 1 59  ? 185.550 -35.585 279.578 1.00 68.99  ?  53  VAL A CG1 1 
ATOM   386   C CG2 . VAL A 1 59  ? 186.153 -36.694 277.378 1.00 76.18  ?  53  VAL A CG2 1 
ATOM   387   N N   . GLY A 1 60  ? 185.681 -33.658 277.059 1.00 82.80  ?  54  GLY A N   1 
ATOM   388   C CA  . GLY A 1 60  ? 184.801 -32.554 276.726 1.00 73.75  ?  54  GLY A CA  1 
ATOM   389   C C   . GLY A 1 60  ? 183.489 -33.060 276.172 1.00 74.04  ?  54  GLY A C   1 
ATOM   390   O O   . GLY A 1 60  ? 183.342 -34.235 275.828 1.00 81.09  ?  54  GLY A O   1 
ATOM   391   N N   . ALA A 1 61  ? 182.526 -32.144 276.089 1.00 62.29  ?  55  ALA A N   1 
ATOM   392   C CA  . ALA A 1 61  ? 181.204 -32.451 275.566 1.00 64.07  ?  55  ALA A CA  1 
ATOM   393   C C   . ALA A 1 61  ? 180.748 -31.325 274.652 1.00 66.52  ?  55  ALA A C   1 
ATOM   394   O O   . ALA A 1 61  ? 181.066 -30.154 274.877 1.00 67.68  ?  55  ALA A O   1 
ATOM   395   C CB  . ALA A 1 61  ? 180.181 -32.661 276.690 1.00 67.61  ?  55  ALA A CB  1 
ATOM   396   N N   . GLN A 1 62  ? 179.997 -31.692 273.616 1.00 62.87  ?  56  GLN A N   1 
ATOM   397   C CA  . GLN A 1 62  ? 179.479 -30.737 272.647 1.00 64.74  ?  56  GLN A CA  1 
ATOM   398   C C   . GLN A 1 62  ? 178.032 -30.345 272.915 1.00 61.91  ?  56  GLN A C   1 
ATOM   399   O O   . GLN A 1 62  ? 177.501 -29.476 272.217 1.00 54.35  ?  56  GLN A O   1 
ATOM   400   C CB  . GLN A 1 62  ? 179.609 -31.303 271.229 1.00 64.58  ?  56  GLN A CB  1 
ATOM   401   C CG  . GLN A 1 62  ? 181.039 -31.617 270.811 1.00 59.62  ?  56  GLN A CG  1 
ATOM   402   C CD  . GLN A 1 62  ? 181.848 -30.372 270.501 1.00 72.77  ?  56  GLN A CD  1 
ATOM   403   O OE1 . GLN A 1 62  ? 181.361 -29.448 269.850 1.00 79.99  ?  56  GLN A OE1 1 
ATOM   404   N NE2 . GLN A 1 62  ? 183.092 -30.342 270.967 1.00 75.67  ?  56  GLN A NE2 1 
ATOM   405   N N   . SER A 1 63  ? 177.388 -30.958 273.904 1.00 61.25  ?  57  SER A N   1 
ATOM   406   C CA  . SER A 1 63  ? 176.000 -30.660 274.232 1.00 63.87  ?  57  SER A CA  1 
ATOM   407   C C   . SER A 1 63  ? 175.748 -31.085 275.673 1.00 69.00  ?  57  SER A C   1 
ATOM   408   O O   . SER A 1 63  ? 176.629 -31.633 276.343 1.00 71.45  ?  57  SER A O   1 
ATOM   409   C CB  . SER A 1 63  ? 175.040 -31.359 273.265 1.00 70.04  ?  57  SER A CB  1 
ATOM   410   O OG  . SER A 1 63  ? 175.177 -32.767 273.342 1.00 71.00  ?  57  SER A OG  1 
ATOM   411   N N   . LEU A 1 64  ? 174.528 -30.826 276.150 1.00 71.63  ?  58  LEU A N   1 
ATOM   412   C CA  . LEU A 1 64  ? 174.162 -31.248 277.499 1.00 75.47  ?  58  LEU A CA  1 
ATOM   413   C C   . LEU A 1 64  ? 173.908 -32.750 277.559 1.00 78.24  ?  58  LEU A C   1 
ATOM   414   O O   . LEU A 1 64  ? 174.238 -33.400 278.558 1.00 79.64  ?  58  LEU A O   1 
ATOM   415   C CB  . LEU A 1 64  ? 172.933 -30.478 277.982 1.00 77.05  ?  58  LEU A CB  1 
ATOM   416   C CG  . LEU A 1 64  ? 173.156 -29.040 278.456 1.00 74.51  ?  58  LEU A CG  1 
ATOM   417   C CD1 . LEU A 1 64  ? 171.853 -28.434 278.957 1.00 68.58  ?  58  LEU A CD1 1 
ATOM   418   C CD2 . LEU A 1 64  ? 174.221 -28.993 279.540 1.00 65.72  ?  58  LEU A CD2 1 
ATOM   419   N N   . LYS A 1 65  ? 173.318 -33.316 276.503 1.00 74.28  ?  59  LYS A N   1 
ATOM   420   C CA  . LYS A 1 65  ? 173.086 -34.757 276.468 1.00 70.95  ?  59  LYS A CA  1 
ATOM   421   C C   . LYS A 1 65  ? 174.402 -35.522 276.516 1.00 74.60  ?  59  LYS A C   1 
ATOM   422   O O   . LYS A 1 65  ? 174.545 -36.490 277.272 1.00 78.29  ?  59  LYS A O   1 
ATOM   423   C CB  . LYS A 1 65  ? 172.293 -35.134 275.216 1.00 77.36  ?  59  LYS A CB  1 
ATOM   424   C CG  . LYS A 1 65  ? 172.149 -36.637 275.014 1.00 75.19  ?  59  LYS A CG  1 
ATOM   425   C CD  . LYS A 1 65  ? 171.690 -36.978 273.605 1.00 76.38  ?  59  LYS A CD  1 
ATOM   426   C CE  . LYS A 1 65  ? 170.292 -36.455 273.331 1.00 78.67  ?  59  LYS A CE  1 
ATOM   427   N NZ  . LYS A 1 65  ? 169.821 -36.799 271.961 1.00 58.39  1  59  LYS A NZ  1 
ATOM   428   N N   . GLU A 1 66  ? 175.378 -35.100 275.709 1.00 76.85  ?  60  GLU A N   1 
ATOM   429   C CA  . GLU A 1 66  ? 176.681 -35.756 275.713 1.00 76.29  ?  60  GLU A CA  1 
ATOM   430   C C   . GLU A 1 66  ? 177.399 -35.569 277.043 1.00 81.08  ?  60  GLU A C   1 
ATOM   431   O O   . GLU A 1 66  ? 178.160 -36.448 277.465 1.00 83.54  ?  60  GLU A O   1 
ATOM   432   C CB  . GLU A 1 66  ? 177.538 -35.223 274.563 1.00 71.01  ?  60  GLU A CB  1 
ATOM   433   C CG  . GLU A 1 66  ? 178.904 -35.880 274.440 1.00 77.43  ?  60  GLU A CG  1 
ATOM   434   C CD  . GLU A 1 66  ? 179.741 -35.278 273.328 1.00 79.69  ?  60  GLU A CD  1 
ATOM   435   O OE1 . GLU A 1 66  ? 179.194 -34.485 272.534 1.00 76.03  ?  60  GLU A OE1 1 
ATOM   436   O OE2 . GLU A 1 66  ? 180.947 -35.596 273.252 1.00 77.37  -1 60  GLU A OE2 1 
ATOM   437   N N   . MET A 1 67  ? 177.166 -34.442 277.720 1.00 77.51  ?  61  MET A N   1 
ATOM   438   C CA  . MET A 1 67  ? 177.809 -34.208 279.008 1.00 71.85  ?  61  MET A CA  1 
ATOM   439   C C   . MET A 1 67  ? 177.256 -35.145 280.075 1.00 73.69  ?  61  MET A C   1 
ATOM   440   O O   . MET A 1 67  ? 178.017 -35.841 280.756 1.00 81.09  ?  61  MET A O   1 
ATOM   441   C CB  . MET A 1 67  ? 177.627 -32.749 279.429 1.00 71.29  ?  61  MET A CB  1 
ATOM   442   C CG  . MET A 1 67  ? 178.369 -32.383 280.703 1.00 70.79  ?  61  MET A CG  1 
ATOM   443   S SD  . MET A 1 67  ? 177.848 -30.799 281.387 1.00 60.59  ?  61  MET A SD  1 
ATOM   444   C CE  . MET A 1 67  ? 176.149 -31.165 281.821 1.00 46.88  ?  61  MET A CE  1 
ATOM   445   N N   . VAL A 1 68  ? 175.929 -35.177 280.229 1.00 62.67  ?  62  VAL A N   1 
ATOM   446   C CA  . VAL A 1 68  ? 175.300 -36.022 281.241 1.00 65.60  ?  62  VAL A CA  1 
ATOM   447   C C   . VAL A 1 68  ? 175.648 -37.490 281.027 1.00 78.55  ?  62  VAL A C   1 
ATOM   448   O O   . VAL A 1 68  ? 175.797 -38.250 281.994 1.00 83.29  ?  62  VAL A O   1 
ATOM   449   C CB  . VAL A 1 68  ? 173.774 -35.782 281.240 1.00 65.12  ?  62  VAL A CB  1 
ATOM   450   C CG1 . VAL A 1 68  ? 173.012 -37.047 281.613 1.00 63.24  ?  62  VAL A CG1 1 
ATOM   451   C CG2 . VAL A 1 68  ? 173.419 -34.648 282.191 1.00 55.70  ?  62  VAL A CG2 1 
ATOM   452   N N   . SER A 1 69  ? 175.818 -37.909 279.772 1.00 78.05  ?  63  SER A N   1 
ATOM   453   C CA  . SER A 1 69  ? 176.108 -39.305 279.467 1.00 75.92  ?  63  SER A CA  1 
ATOM   454   C C   . SER A 1 69  ? 177.491 -39.750 279.929 1.00 78.59  ?  63  SER A C   1 
ATOM   455   O O   . SER A 1 69  ? 177.756 -40.956 279.943 1.00 94.50  ?  63  SER A O   1 
ATOM   456   C CB  . SER A 1 69  ? 175.974 -39.549 277.963 1.00 78.34  ?  63  SER A CB  1 
ATOM   457   O OG  . SER A 1 69  ? 176.944 -38.812 277.239 1.00 72.18  ?  63  SER A OG  1 
ATOM   458   N N   . LYS A 1 70  ? 178.373 -38.823 280.303 1.00 74.88  ?  64  LYS A N   1 
ATOM   459   C CA  . LYS A 1 70  ? 179.737 -39.160 280.690 1.00 78.98  ?  64  LYS A CA  1 
ATOM   460   C C   . LYS A 1 70  ? 179.962 -39.128 282.196 1.00 79.10  ?  64  LYS A C   1 
ATOM   461   O O   . LYS A 1 70  ? 181.073 -39.424 282.647 1.00 75.04  ?  64  LYS A O   1 
ATOM   462   C CB  . LYS A 1 70  ? 180.729 -38.211 280.010 1.00 71.19  ?  64  LYS A CB  1 
ATOM   463   C CG  . LYS A 1 70  ? 180.743 -38.297 278.494 1.00 74.72  ?  64  LYS A CG  1 
ATOM   464   C CD  . LYS A 1 70  ? 181.844 -37.427 277.909 1.00 80.38  ?  64  LYS A CD  1 
ATOM   465   C CE  . LYS A 1 70  ? 181.912 -37.558 276.397 1.00 83.95  ?  64  LYS A CE  1 
ATOM   466   N NZ  . LYS A 1 70  ? 183.047 -36.781 275.826 1.00 80.87  1  64  LYS A NZ  1 
ATOM   467   N N   . LEU A 1 71  ? 178.947 -38.785 282.982 1.00 75.06  ?  65  LEU A N   1 
ATOM   468   C CA  . LEU A 1 71  ? 179.108 -38.613 284.420 1.00 79.48  ?  65  LEU A CA  1 
ATOM   469   C C   . LEU A 1 71  ? 178.806 -39.914 285.152 1.00 76.96  ?  65  LEU A C   1 
ATOM   470   O O   . LEU A 1 71  ? 177.742 -40.513 284.958 1.00 73.50  ?  65  LEU A O   1 
ATOM   471   C CB  . LEU A 1 71  ? 178.195 -37.498 284.932 1.00 78.96  ?  65  LEU A CB  1 
ATOM   472   C CG  . LEU A 1 71  ? 178.748 -36.072 284.990 1.00 73.40  ?  65  LEU A CG  1 
ATOM   473   C CD1 . LEU A 1 71  ? 179.859 -35.982 286.017 1.00 74.72  ?  65  LEU A CD1 1 
ATOM   474   C CD2 . LEU A 1 71  ? 179.242 -35.617 283.631 1.00 71.88  ?  65  LEU A CD2 1 
ATOM   475   N N   . LYS A 1 72  ? 179.744 -40.346 285.993 1.00 78.38  ?  66  LYS A N   1 
ATOM   476   C CA  . LYS A 1 72  ? 179.506 -41.494 286.855 1.00 78.63  ?  66  LYS A CA  1 
ATOM   477   C C   . LYS A 1 72  ? 178.407 -41.173 287.860 1.00 74.03  ?  66  LYS A C   1 
ATOM   478   O O   . LYS A 1 72  ? 178.392 -40.098 288.464 1.00 77.23  ?  66  LYS A O   1 
ATOM   479   C CB  . LYS A 1 72  ? 180.786 -41.887 287.591 1.00 71.01  ?  66  LYS A CB  1 
ATOM   480   C CG  . LYS A 1 72  ? 181.956 -42.241 286.688 1.00 69.85  ?  66  LYS A CG  1 
ATOM   481   C CD  . LYS A 1 72  ? 183.198 -42.554 287.508 1.00 63.29  ?  66  LYS A CD  1 
ATOM   482   C CE  . LYS A 1 72  ? 184.398 -42.838 286.619 1.00 76.46  ?  66  LYS A CE  1 
ATOM   483   N NZ  . LYS A 1 72  ? 185.645 -43.015 287.415 1.00 70.41  1  66  LYS A NZ  1 
ATOM   484   N N   . LYS A 1 73  ? 177.484 -42.112 288.037 1.00 68.25  ?  67  LYS A N   1 
ATOM   485   C CA  . LYS A 1 73  ? 176.376 -41.862 288.948 1.00 73.08  ?  67  LYS A CA  1 
ATOM   486   C C   . LYS A 1 73  ? 176.836 -42.013 290.399 1.00 74.64  ?  67  LYS A C   1 
ATOM   487   O O   . LYS A 1 73  ? 177.559 -42.959 290.725 1.00 76.08  ?  67  LYS A O   1 
ATOM   488   C CB  . LYS A 1 73  ? 175.218 -42.814 288.660 1.00 63.98  ?  67  LYS A CB  1 
ATOM   489   C CG  . LYS A 1 73  ? 174.527 -42.542 287.332 1.00 67.80  ?  67  LYS A CG  1 
ATOM   490   C CD  . LYS A 1 73  ? 173.068 -42.155 287.527 1.00 69.49  ?  67  LYS A CD  1 
ATOM   491   C CE  . LYS A 1 73  ? 172.178 -43.382 287.651 1.00 76.84  ?  67  LYS A CE  1 
ATOM   492   N NZ  . LYS A 1 73  ? 172.608 -44.291 288.749 1.00 73.78  1  67  LYS A NZ  1 
ATOM   493   N N   . PRO A 1 74  ? 176.433 -41.094 291.293 1.00 71.84  ?  68  PRO A N   1 
ATOM   494   C CA  . PRO A 1 74  ? 175.543 -39.960 291.011 1.00 72.61  ?  68  PRO A CA  1 
ATOM   495   C C   . PRO A 1 74  ? 176.216 -38.842 290.216 1.00 70.60  ?  68  PRO A C   1 
ATOM   496   O O   . PRO A 1 74  ? 177.338 -38.441 290.531 1.00 67.31  ?  68  PRO A O   1 
ATOM   497   C CB  . PRO A 1 74  ? 175.155 -39.470 292.408 1.00 66.96  ?  68  PRO A CB  1 
ATOM   498   C CG  . PRO A 1 74  ? 176.322 -39.826 293.253 1.00 67.68  ?  68  PRO A CG  1 
ATOM   499   C CD  . PRO A 1 74  ? 176.842 -41.130 292.709 1.00 65.30  ?  68  PRO A CD  1 
ATOM   500   N N   . ARG A 1 75  ? 175.524 -38.356 289.189 1.00 74.60  ?  69  ARG A N   1 
ATOM   501   C CA  . ARG A 1 75  ? 176.082 -37.327 288.324 1.00 74.55  ?  69  ARG A CA  1 
ATOM   502   C C   . ARG A 1 75  ? 176.248 -36.017 289.085 1.00 63.39  ?  69  ARG A C   1 
ATOM   503   O O   . ARG A 1 75  ? 175.373 -35.609 289.853 1.00 57.62  ?  69  ARG A O   1 
ATOM   504   C CB  . ARG A 1 75  ? 175.188 -37.125 287.101 1.00 71.59  ?  69  ARG A CB  1 
ATOM   505   C CG  . ARG A 1 75  ? 175.057 -38.368 286.232 1.00 76.42  ?  69  ARG A CG  1 
ATOM   506   C CD  . ARG A 1 75  ? 174.277 -38.086 284.961 1.00 78.93  ?  69  ARG A CD  1 
ATOM   507   N NE  . ARG A 1 75  ? 172.838 -38.065 285.200 1.00 78.92  ?  69  ARG A NE  1 
ATOM   508   C CZ  . ARG A 1 75  ? 172.055 -39.135 285.115 1.00 73.98  ?  69  ARG A CZ  1 
ATOM   509   N NH1 . ARG A 1 75  ? 172.574 -40.313 284.798 1.00 73.54  1  69  ARG A NH1 1 
ATOM   510   N NH2 . ARG A 1 75  ? 170.755 -39.028 285.348 1.00 69.90  ?  69  ARG A NH2 1 
ATOM   511   N N   . ARG A 1 76  ? 177.385 -35.360 288.867 1.00 61.60  ?  70  ARG A N   1 
ATOM   512   C CA  . ARG A 1 76  ? 177.744 -34.146 289.591 1.00 62.29  ?  70  ARG A CA  1 
ATOM   513   C C   . ARG A 1 76  ? 178.172 -33.084 288.590 1.00 55.64  ?  70  ARG A C   1 
ATOM   514   O O   . ARG A 1 76  ? 179.121 -33.293 287.827 1.00 49.09  ?  70  ARG A O   1 
ATOM   515   C CB  . ARG A 1 76  ? 178.861 -34.425 290.600 1.00 65.49  ?  70  ARG A CB  1 
ATOM   516   C CG  . ARG A 1 76  ? 178.459 -35.369 291.723 1.00 62.82  ?  70  ARG A CG  1 
ATOM   517   C CD  . ARG A 1 76  ? 179.664 -35.820 292.534 1.00 64.38  ?  70  ARG A CD  1 
ATOM   518   N NE  . ARG A 1 76  ? 180.463 -36.816 291.824 1.00 68.03  ?  70  ARG A NE  1 
ATOM   519   C CZ  . ARG A 1 76  ? 180.274 -38.128 291.919 1.00 66.33  ?  70  ARG A CZ  1 
ATOM   520   N NH1 . ARG A 1 76  ? 179.310 -38.606 292.695 1.00 65.27  1  70  ARG A NH1 1 
ATOM   521   N NH2 . ARG A 1 76  ? 181.047 -38.963 291.239 1.00 65.95  ?  70  ARG A NH2 1 
ATOM   522   N N   . ILE A 1 77  ? 177.477 -31.949 288.598 1.00 54.88  ?  71  ILE A N   1 
ATOM   523   C CA  . ILE A 1 77  ? 177.719 -30.855 287.665 1.00 49.89  ?  71  ILE A CA  1 
ATOM   524   C C   . ILE A 1 77  ? 178.049 -29.603 288.464 1.00 44.91  ?  71  ILE A C   1 
ATOM   525   O O   . ILE A 1 77  ? 177.280 -29.204 289.347 1.00 51.96  ?  71  ILE A O   1 
ATOM   526   C CB  . ILE A 1 77  ? 176.504 -30.611 286.751 1.00 50.80  ?  71  ILE A CB  1 
ATOM   527   C CG1 . ILE A 1 77  ? 176.058 -31.919 286.094 1.00 46.23  ?  71  ILE A CG1 1 
ATOM   528   C CG2 . ILE A 1 77  ? 176.830 -29.564 285.697 1.00 44.77  ?  71  ILE A CG2 1 
ATOM   529   C CD1 . ILE A 1 77  ? 174.811 -31.781 285.251 1.00 51.22  ?  71  ILE A CD1 1 
ATOM   530   N N   . ILE A 1 78  ? 179.185 -28.985 288.153 1.00 45.97  ?  72  ILE A N   1 
ATOM   531   C CA  . ILE A 1 78  ? 179.615 -27.745 288.792 1.00 46.59  ?  72  ILE A CA  1 
ATOM   532   C C   . ILE A 1 78  ? 179.280 -26.584 287.867 1.00 47.79  ?  72  ILE A C   1 
ATOM   533   O O   . ILE A 1 78  ? 179.646 -26.596 286.686 1.00 53.09  ?  72  ILE A O   1 
ATOM   534   C CB  . ILE A 1 78  ? 181.119 -27.776 289.116 1.00 45.95  ?  72  ILE A CB  1 
ATOM   535   C CG1 . ILE A 1 78  ? 181.427 -28.888 290.119 1.00 39.06  ?  72  ILE A CG1 1 
ATOM   536   C CG2 . ILE A 1 78  ? 181.578 -26.428 289.650 1.00 42.43  ?  72  ILE A CG2 1 
ATOM   537   C CD1 . ILE A 1 78  ? 182.878 -28.939 290.544 1.00 36.91  ?  72  ILE A CD1 1 
ATOM   538   N N   . LEU A 1 79  ? 178.586 -25.583 288.400 1.00 45.59  ?  73  LEU A N   1 
ATOM   539   C CA  . LEU A 1 79  ? 178.161 -24.419 287.632 1.00 43.60  ?  73  LEU A CA  1 
ATOM   540   C C   . LEU A 1 79  ? 179.014 -23.218 288.019 1.00 50.12  ?  73  LEU A C   1 
ATOM   541   O O   . LEU A 1 79  ? 179.045 -22.826 289.190 1.00 54.72  ?  73  LEU A O   1 
ATOM   542   C CB  . LEU A 1 79  ? 176.680 -24.121 287.861 1.00 42.38  ?  73  LEU A CB  1 
ATOM   543   C CG  . LEU A 1 79  ? 175.696 -25.133 287.276 1.00 45.70  ?  73  LEU A CG  1 
ATOM   544   C CD1 . LEU A 1 79  ? 174.262 -24.692 287.524 1.00 47.53  ?  73  LEU A CD1 1 
ATOM   545   C CD2 . LEU A 1 79  ? 175.954 -25.321 285.790 1.00 50.59  ?  73  LEU A CD2 1 
ATOM   546   N N   . LEU A 1 80  ? 179.700 -22.640 287.033 1.00 47.21  ?  74  LEU A N   1 
ATOM   547   C CA  . LEU A 1 80  ? 180.489 -21.423 287.214 1.00 52.98  ?  74  LEU A CA  1 
ATOM   548   C C   . LEU A 1 80  ? 180.103 -20.410 286.135 1.00 50.41  ?  74  LEU A C   1 
ATOM   549   O O   . LEU A 1 80  ? 180.926 -19.954 285.343 1.00 54.42  ?  74  LEU A O   1 
ATOM   550   C CB  . LEU A 1 80  ? 181.988 -21.716 287.178 1.00 47.18  ?  74  LEU A CB  1 
ATOM   551   C CG  . LEU A 1 80  ? 182.624 -22.162 288.495 1.00 43.63  ?  74  LEU A CG  1 
ATOM   552   C CD1 . LEU A 1 80  ? 184.088 -22.503 288.291 1.00 45.96  ?  74  LEU A CD1 1 
ATOM   553   C CD2 . LEU A 1 80  ? 182.472 -21.077 289.547 1.00 48.29  ?  74  LEU A CD2 1 
ATOM   554   N N   . VAL A 1 81  ? 178.819 -20.058 286.110 1.00 39.46  ?  75  VAL A N   1 
ATOM   555   C CA  . VAL A 1 81  ? 178.298 -19.115 285.128 1.00 46.41  ?  75  VAL A CA  1 
ATOM   556   C C   . VAL A 1 81  ? 178.074 -17.764 285.793 1.00 49.11  ?  75  VAL A C   1 
ATOM   557   O O   . VAL A 1 81  ? 178.338 -17.596 286.989 1.00 54.86  ?  75  VAL A O   1 
ATOM   558   C CB  . VAL A 1 81  ? 176.999 -19.639 284.489 1.00 47.21  ?  75  VAL A CB  1 
ATOM   559   C CG1 . VAL A 1 81  ? 177.289 -20.857 283.627 1.00 42.78  ?  75  VAL A CG1 1 
ATOM   560   C CG2 . VAL A 1 81  ? 175.977 -19.974 285.565 1.00 41.46  ?  75  VAL A CG2 1 
ATOM   561   N N   . LYS A 1 82  ? 177.593 -16.794 285.020 1.00 47.37  ?  76  LYS A N   1 
ATOM   562   C CA  . LYS A 1 82  ? 177.324 -15.469 285.559 1.00 47.57  ?  76  LYS A CA  1 
ATOM   563   C C   . LYS A 1 82  ? 176.196 -15.532 286.581 1.00 44.18  ?  76  LYS A C   1 
ATOM   564   O O   . LYS A 1 82  ? 175.177 -16.193 286.365 1.00 41.68  ?  76  LYS A O   1 
ATOM   565   C CB  . LYS A 1 82  ? 176.964 -14.503 284.430 1.00 54.25  ?  76  LYS A CB  1 
ATOM   566   C CG  . LYS A 1 82  ? 176.789 -13.058 284.867 1.00 57.48  ?  76  LYS A CG  1 
ATOM   567   C CD  . LYS A 1 82  ? 176.483 -12.161 283.677 1.00 61.18  ?  76  LYS A CD  1 
ATOM   568   C CE  . LYS A 1 82  ? 176.344 -10.706 284.096 1.00 52.52  ?  76  LYS A CE  1 
ATOM   569   N NZ  . LYS A 1 82  ? 176.041 -9.823  282.936 1.00 53.45  1  76  LYS A NZ  1 
ATOM   570   N N   . ALA A 1 83  ? 176.388 -14.843 287.703 1.00 46.76  ?  77  ALA A N   1 
ATOM   571   C CA  . ALA A 1 83  ? 175.390 -14.854 288.764 1.00 41.96  ?  77  ALA A CA  1 
ATOM   572   C C   . ALA A 1 83  ? 174.098 -14.201 288.290 1.00 42.39  ?  77  ALA A C   1 
ATOM   573   O O   . ALA A 1 83  ? 174.114 -13.191 287.582 1.00 52.63  ?  77  ALA A O   1 
ATOM   574   C CB  . ALA A 1 83  ? 175.923 -14.133 290.002 1.00 44.64  ?  77  ALA A CB  1 
ATOM   575   N N   . GLY A 1 84  ? 172.972 -14.790 288.685 1.00 39.65  ?  78  GLY A N   1 
ATOM   576   C CA  . GLY A 1 84  ? 171.673 -14.274 288.303 1.00 41.22  ?  78  GLY A CA  1 
ATOM   577   C C   . GLY A 1 84  ? 170.839 -15.274 287.530 1.00 47.80  ?  78  GLY A C   1 
ATOM   578   O O   . GLY A 1 84  ? 170.730 -16.439 287.922 1.00 48.71  ?  78  GLY A O   1 
ATOM   579   N N   . GLN A 1 85  ? 170.249 -14.828 286.418 1.00 48.34  ?  79  GLN A N   1 
ATOM   580   C CA  . GLN A 1 85  ? 169.379 -15.696 285.634 1.00 47.79  ?  79  GLN A CA  1 
ATOM   581   C C   . GLN A 1 85  ? 170.152 -16.781 284.895 1.00 46.20  ?  79  GLN A C   1 
ATOM   582   O O   . GLN A 1 85  ? 169.573 -17.824 284.573 1.00 50.60  ?  79  GLN A O   1 
ATOM   583   C CB  . GLN A 1 85  ? 168.565 -14.862 284.641 1.00 50.23  ?  79  GLN A CB  1 
ATOM   584   C CG  . GLN A 1 85  ? 167.451 -15.628 283.939 1.00 43.18  ?  79  GLN A CG  1 
ATOM   585   C CD  . GLN A 1 85  ? 166.407 -16.159 284.904 1.00 52.11  ?  79  GLN A CD  1 
ATOM   586   O OE1 . GLN A 1 85  ? 166.132 -15.549 285.938 1.00 46.52  ?  79  GLN A OE1 1 
ATOM   587   N NE2 . GLN A 1 85  ? 165.822 -17.304 284.571 1.00 54.44  ?  79  GLN A NE2 1 
ATOM   588   N N   . ALA A 1 86  ? 171.443 -16.565 284.625 1.00 39.69  ?  80  ALA A N   1 
ATOM   589   C CA  . ALA A 1 86  ? 172.222 -17.562 283.898 1.00 46.83  ?  80  ALA A CA  1 
ATOM   590   C C   . ALA A 1 86  ? 172.311 -18.876 284.662 1.00 47.60  ?  80  ALA A C   1 
ATOM   591   O O   . ALA A 1 86  ? 172.349 -19.949 284.048 1.00 42.45  ?  80  ALA A O   1 
ATOM   592   C CB  . ALA A 1 86  ? 173.623 -17.024 283.603 1.00 55.22  ?  80  ALA A CB  1 
ATOM   593   N N   . VAL A 1 87  ? 172.341 -18.816 285.994 1.00 51.95  ?  81  VAL A N   1 
ATOM   594   C CA  . VAL A 1 87  ? 172.376 -20.041 286.786 1.00 47.60  ?  81  VAL A CA  1 
ATOM   595   C C   . VAL A 1 87  ? 171.024 -20.740 286.740 1.00 45.93  ?  81  VAL A C   1 
ATOM   596   O O   . VAL A 1 87  ? 170.947 -21.961 286.561 1.00 54.59  ?  81  VAL A O   1 
ATOM   597   C CB  . VAL A 1 87  ? 172.805 -19.732 288.232 1.00 41.76  ?  81  VAL A CB  1 
ATOM   598   C CG1 . VAL A 1 87  ? 173.544 -20.918 288.833 1.00 38.76  ?  81  VAL A CG1 1 
ATOM   599   C CG2 . VAL A 1 87  ? 173.659 -18.475 288.279 1.00 43.99  ?  81  VAL A CG2 1 
ATOM   600   N N   . ASP A 1 88  ? 169.938 -19.978 286.891 1.00 45.79  ?  82  ASP A N   1 
ATOM   601   C CA  . ASP A 1 88  ? 168.603 -20.570 286.875 1.00 46.65  ?  82  ASP A CA  1 
ATOM   602   C C   . ASP A 1 88  ? 168.253 -21.122 285.499 1.00 46.46  ?  82  ASP A C   1 
ATOM   603   O O   . ASP A 1 88  ? 167.567 -22.145 285.393 1.00 53.54  ?  82  ASP A O   1 
ATOM   604   C CB  . ASP A 1 88  ? 167.568 -19.537 287.316 1.00 52.06  ?  82  ASP A CB  1 
ATOM   605   C CG  . ASP A 1 88  ? 167.717 -19.150 288.772 1.00 52.32  ?  82  ASP A CG  1 
ATOM   606   O OD1 . ASP A 1 88  ? 167.810 -20.059 289.623 1.00 56.89  ?  82  ASP A OD1 1 
ATOM   607   O OD2 . ASP A 1 88  ? 167.748 -17.936 289.066 1.00 56.87  -1 82  ASP A OD2 1 
ATOM   608   N N   . ASP A 1 89  ? 168.707 -20.457 284.433 1.00 45.74  ?  83  ASP A N   1 
ATOM   609   C CA  . ASP A 1 89  ? 168.429 -20.947 283.086 1.00 46.42  ?  83  ASP A CA  1 
ATOM   610   C C   . ASP A 1 89  ? 169.049 -22.319 282.860 1.00 51.44  ?  83  ASP A C   1 
ATOM   611   O O   . ASP A 1 89  ? 168.400 -23.218 282.312 1.00 62.75  ?  83  ASP A O   1 
ATOM   612   C CB  . ASP A 1 89  ? 168.939 -19.949 282.046 1.00 48.03  ?  83  ASP A CB  1 
ATOM   613   C CG  . ASP A 1 89  ? 168.050 -18.727 281.924 1.00 54.96  ?  83  ASP A CG  1 
ATOM   614   O OD1 . ASP A 1 89  ? 166.994 -18.688 282.591 1.00 55.03  ?  83  ASP A OD1 1 
ATOM   615   O OD2 . ASP A 1 89  ? 168.406 -17.807 281.157 1.00 50.99  -1 83  ASP A OD2 1 
ATOM   616   N N   . PHE A 1 90  ? 170.302 -22.502 283.282 1.00 53.47  ?  84  PHE A N   1 
ATOM   617   C CA  . PHE A 1 90  ? 170.940 -23.807 283.148 1.00 53.89  ?  84  PHE A CA  1 
ATOM   618   C C   . PHE A 1 90  ? 170.289 -24.848 284.048 1.00 53.87  ?  84  PHE A C   1 
ATOM   619   O O   . PHE A 1 90  ? 170.265 -26.034 283.700 1.00 60.55  ?  84  PHE A O   1 
ATOM   620   C CB  . PHE A 1 90  ? 172.434 -23.700 283.455 1.00 54.29  ?  84  PHE A CB  1 
ATOM   621   C CG  . PHE A 1 90  ? 173.299 -23.619 282.231 1.00 51.07  ?  84  PHE A CG  1 
ATOM   622   C CD1 . PHE A 1 90  ? 174.475 -22.891 282.244 1.00 47.85  ?  84  PHE A CD1 1 
ATOM   623   C CD2 . PHE A 1 90  ? 172.937 -24.278 281.068 1.00 57.87  ?  84  PHE A CD2 1 
ATOM   624   C CE1 . PHE A 1 90  ? 175.271 -22.815 281.117 1.00 52.71  ?  84  PHE A CE1 1 
ATOM   625   C CE2 . PHE A 1 90  ? 173.730 -24.208 279.940 1.00 56.97  ?  84  PHE A CE2 1 
ATOM   626   C CZ  . PHE A 1 90  ? 174.899 -23.476 279.965 1.00 51.88  ?  84  PHE A CZ  1 
ATOM   627   N N   . ILE A 1 91  ? 169.763 -24.431 285.202 1.00 49.19  ?  85  ILE A N   1 
ATOM   628   C CA  . ILE A 1 91  ? 169.086 -25.370 286.093 1.00 50.22  ?  85  ILE A CA  1 
ATOM   629   C C   . ILE A 1 91  ? 167.854 -25.949 285.411 1.00 55.51  ?  85  ILE A C   1 
ATOM   630   O O   . ILE A 1 91  ? 167.645 -27.167 285.396 1.00 61.66  ?  85  ILE A O   1 
ATOM   631   C CB  . ILE A 1 91  ? 168.728 -24.686 287.425 1.00 45.63  ?  85  ILE A CB  1 
ATOM   632   C CG1 . ILE A 1 91  ? 169.989 -24.448 288.256 1.00 45.31  ?  85  ILE A CG1 1 
ATOM   633   C CG2 . ILE A 1 91  ? 167.724 -25.522 288.205 1.00 48.19  ?  85  ILE A CG2 1 
ATOM   634   C CD1 . ILE A 1 91  ? 169.738 -23.701 289.547 1.00 49.39  ?  85  ILE A CD1 1 
ATOM   635   N N   . GLU A 1 92  ? 167.023 -25.082 284.826 1.00 55.86  ?  86  GLU A N   1 
ATOM   636   C CA  . GLU A 1 92  ? 165.855 -25.560 284.094 1.00 57.89  ?  86  GLU A CA  1 
ATOM   637   C C   . GLU A 1 92  ? 166.255 -26.393 282.883 1.00 59.47  ?  86  GLU A C   1 
ATOM   638   O O   . GLU A 1 92  ? 165.513 -27.295 282.478 1.00 60.32  ?  86  GLU A O   1 
ATOM   639   C CB  . GLU A 1 92  ? 164.982 -24.380 283.665 1.00 53.13  ?  86  GLU A CB  1 
ATOM   640   C CG  . GLU A 1 92  ? 164.277 -23.680 284.815 1.00 56.83  ?  86  GLU A CG  1 
ATOM   641   C CD  . GLU A 1 92  ? 163.352 -22.572 284.347 1.00 73.50  ?  86  GLU A CD  1 
ATOM   642   O OE1 . GLU A 1 92  ? 163.677 -21.908 283.340 1.00 74.94  ?  86  GLU A OE1 1 
ATOM   643   O OE2 . GLU A 1 92  ? 162.296 -22.369 284.984 1.00 80.20  -1 86  GLU A OE2 1 
ATOM   644   N N   . LYS A 1 93  ? 167.418 -26.110 282.293 1.00 54.05  ?  87  LYS A N   1 
ATOM   645   C CA  . LYS A 1 93  ? 167.906 -26.903 281.172 1.00 53.73  ?  87  LYS A CA  1 
ATOM   646   C C   . LYS A 1 93  ? 168.522 -28.223 281.613 1.00 63.07  ?  87  LYS A C   1 
ATOM   647   O O   . LYS A 1 93  ? 168.740 -29.101 280.770 1.00 63.25  ?  87  LYS A O   1 
ATOM   648   C CB  . LYS A 1 93  ? 168.938 -26.107 280.367 1.00 56.52  ?  87  LYS A CB  1 
ATOM   649   C CG  . LYS A 1 93  ? 168.362 -24.930 279.594 1.00 63.51  ?  87  LYS A CG  1 
ATOM   650   C CD  . LYS A 1 93  ? 169.467 -24.063 279.000 1.00 65.90  ?  87  LYS A CD  1 
ATOM   651   C CE  . LYS A 1 93  ? 170.398 -24.872 278.108 1.00 66.45  ?  87  LYS A CE  1 
ATOM   652   N NZ  . LYS A 1 93  ? 171.522 -24.049 277.576 1.00 52.74  1  87  LYS A NZ  1 
ATOM   653   N N   . LEU A 1 94  ? 168.805 -28.384 282.904 1.00 63.33  ?  88  LEU A N   1 
ATOM   654   C CA  . LEU A 1 94  ? 169.462 -29.582 283.411 1.00 59.78  ?  88  LEU A CA  1 
ATOM   655   C C   . LEU A 1 94  ? 168.543 -30.512 284.185 1.00 58.47  ?  88  LEU A C   1 
ATOM   656   O O   . LEU A 1 94  ? 168.788 -31.720 284.199 1.00 60.35  ?  88  LEU A O   1 
ATOM   657   C CB  . LEU A 1 94  ? 170.646 -29.201 284.310 1.00 50.25  ?  88  LEU A CB  1 
ATOM   658   C CG  . LEU A 1 94  ? 171.956 -28.833 283.612 1.00 58.95  ?  88  LEU A CG  1 
ATOM   659   C CD1 . LEU A 1 94  ? 172.998 -28.399 284.631 1.00 59.02  ?  88  LEU A CD1 1 
ATOM   660   C CD2 . LEU A 1 94  ? 172.467 -30.004 282.788 1.00 66.52  ?  88  LEU A CD2 1 
ATOM   661   N N   . VAL A 1 95  ? 167.490 -29.988 284.823 1.00 52.08  ?  89  VAL A N   1 
ATOM   662   C CA  . VAL A 1 95  ? 166.633 -30.840 285.653 1.00 55.19  ?  89  VAL A CA  1 
ATOM   663   C C   . VAL A 1 95  ? 165.941 -31.944 284.862 1.00 64.00  ?  89  VAL A C   1 
ATOM   664   O O   . VAL A 1 95  ? 165.821 -33.061 285.389 1.00 62.52  ?  89  VAL A O   1 
ATOM   665   C CB  . VAL A 1 95  ? 165.670 -29.977 286.483 1.00 57.73  ?  89  VAL A CB  1 
ATOM   666   C CG1 . VAL A 1 95  ? 164.993 -28.896 285.650 1.00 62.49  ?  89  VAL A CG1 1 
ATOM   667   C CG2 . VAL A 1 95  ? 164.633 -30.843 287.194 1.00 59.79  ?  89  VAL A CG2 1 
ATOM   668   N N   . PRO A 1 96  ? 165.489 -31.746 283.611 1.00 66.76  ?  90  PRO A N   1 
ATOM   669   C CA  . PRO A 1 96  ? 164.871 -32.879 282.901 1.00 66.97  ?  90  PRO A CA  1 
ATOM   670   C C   . PRO A 1 96  ? 165.862 -33.956 282.494 1.00 64.12  ?  90  PRO A C   1 
ATOM   671   O O   . PRO A 1 96  ? 165.447 -35.100 282.273 1.00 67.63  ?  90  PRO A O   1 
ATOM   672   C CB  . PRO A 1 96  ? 164.228 -32.223 281.667 1.00 64.98  ?  90  PRO A CB  1 
ATOM   673   C CG  . PRO A 1 96  ? 164.217 -30.762 281.953 1.00 67.73  ?  90  PRO A CG  1 
ATOM   674   C CD  . PRO A 1 96  ? 165.439 -30.537 282.770 1.00 63.83  ?  90  PRO A CD  1 
ATOM   675   N N   . LEU A 1 97  ? 167.149 -33.634 282.391 1.00 62.31  ?  91  LEU A N   1 
ATOM   676   C CA  . LEU A 1 97  ? 168.160 -34.596 281.974 1.00 66.66  ?  91  LEU A CA  1 
ATOM   677   C C   . LEU A 1 97  ? 168.777 -35.360 283.138 1.00 68.66  ?  91  LEU A C   1 
ATOM   678   O O   . LEU A 1 97  ? 169.615 -36.238 282.907 1.00 63.90  ?  91  LEU A O   1 
ATOM   679   C CB  . LEU A 1 97  ? 169.269 -33.889 281.187 1.00 63.94  ?  91  LEU A CB  1 
ATOM   680   C CG  . LEU A 1 97  ? 168.858 -33.180 279.896 1.00 70.05  ?  91  LEU A CG  1 
ATOM   681   C CD1 . LEU A 1 97  ? 170.069 -32.548 279.228 1.00 65.86  ?  91  LEU A CD1 1 
ATOM   682   C CD2 . LEU A 1 97  ? 168.163 -34.146 278.950 1.00 79.83  ?  91  LEU A CD2 1 
ATOM   683   N N   . LEU A 1 98  ? 168.390 -35.056 284.373 1.00 71.28  ?  92  LEU A N   1 
ATOM   684   C CA  . LEU A 1 98  ? 168.970 -35.681 285.551 1.00 74.64  ?  92  LEU A CA  1 
ATOM   685   C C   . LEU A 1 98  ? 167.985 -36.652 286.188 1.00 79.31  ?  92  LEU A C   1 
ATOM   686   O O   . LEU A 1 98  ? 166.777 -36.607 285.940 1.00 77.24  ?  92  LEU A O   1 
ATOM   687   C CB  . LEU A 1 98  ? 169.396 -34.627 286.580 1.00 68.16  ?  92  LEU A CB  1 
ATOM   688   C CG  . LEU A 1 98  ? 170.499 -33.652 286.162 1.00 56.59  ?  92  LEU A CG  1 
ATOM   689   C CD1 . LEU A 1 98  ? 170.861 -32.731 287.317 1.00 48.44  ?  92  LEU A CD1 1 
ATOM   690   C CD2 . LEU A 1 98  ? 171.725 -34.400 285.661 1.00 54.33  ?  92  LEU A CD2 1 
ATOM   691   N N   . ASP A 1 99  ? 168.526 -37.537 287.019 1.00 78.94  ?  93  ASP A N   1 
ATOM   692   C CA  . ASP A 1 99  ? 167.748 -38.487 287.797 1.00 81.76  ?  93  ASP A CA  1 
ATOM   693   C C   . ASP A 1 99  ? 167.768 -38.087 289.268 1.00 74.98  ?  93  ASP A C   1 
ATOM   694   O O   . ASP A 1 99  ? 168.600 -37.288 289.706 1.00 70.78  ?  93  ASP A O   1 
ATOM   695   C CB  . ASP A 1 99  ? 168.292 -39.910 287.629 1.00 83.91  ?  93  ASP A CB  1 
ATOM   696   C CG  . ASP A 1 99  ? 168.101 -40.445 286.223 1.00 87.41  ?  93  ASP A CG  1 
ATOM   697   O OD1 . ASP A 1 99  ? 166.970 -40.354 285.700 1.00 83.13  ?  93  ASP A OD1 1 
ATOM   698   O OD2 . ASP A 1 99  ? 169.084 -40.948 285.638 1.00 88.01  -1 93  ASP A OD2 1 
ATOM   699   N N   . THR A 1 100 ? 166.832 -38.654 290.027 1.00 69.78  ?  94  THR A N   1 
ATOM   700   C CA  . THR A 1 100 ? 166.738 -38.360 291.452 1.00 65.45  ?  94  THR A CA  1 
ATOM   701   C C   . THR A 1 100 ? 167.996 -38.824 292.174 1.00 67.27  ?  94  THR A C   1 
ATOM   702   O O   . THR A 1 100 ? 168.335 -40.011 292.152 1.00 68.21  ?  94  THR A O   1 
ATOM   703   C CB  . THR A 1 100 ? 165.501 -39.031 292.049 1.00 49.71  ?  94  THR A CB  1 
ATOM   704   O OG1 . THR A 1 100 ? 165.409 -40.379 291.573 1.00 65.46  ?  94  THR A OG1 1 
ATOM   705   C CG2 . THR A 1 100 ? 164.240 -38.271 291.664 1.00 50.64  ?  94  THR A CG2 1 
ATOM   706   N N   . GLY A 1 101 ? 168.688 -37.884 292.811 1.00 55.09  ?  95  GLY A N   1 
ATOM   707   C CA  . GLY A 1 101 ? 169.939 -38.160 293.494 1.00 57.11  ?  95  GLY A CA  1 
ATOM   708   C C   . GLY A 1 101 ? 171.153 -37.477 292.898 1.00 65.66  ?  95  GLY A C   1 
ATOM   709   O O   . GLY A 1 101 ? 172.234 -37.538 293.502 1.00 66.03  ?  95  GLY A O   1 
ATOM   710   N N   . ASP A 1 102 ? 171.033 -36.829 291.741 1.00 64.51  ?  96  ASP A N   1 
ATOM   711   C CA  . ASP A 1 102 ? 172.165 -36.143 291.138 1.00 59.12  ?  96  ASP A CA  1 
ATOM   712   C C   . ASP A 1 102 ? 172.416 -34.805 291.829 1.00 59.14  ?  96  ASP A C   1 
ATOM   713   O O   . ASP A 1 102 ? 171.564 -34.274 292.548 1.00 54.98  ?  96  ASP A O   1 
ATOM   714   C CB  . ASP A 1 102 ? 171.938 -35.936 289.641 1.00 64.52  ?  96  ASP A CB  1 
ATOM   715   C CG  . ASP A 1 102 ? 172.016 -37.230 288.858 1.00 74.47  ?  96  ASP A CG  1 
ATOM   716   O OD1 . ASP A 1 102 ? 172.702 -38.163 289.327 1.00 75.53  ?  96  ASP A OD1 1 
ATOM   717   O OD2 . ASP A 1 102 ? 171.396 -37.316 287.777 1.00 77.79  -1 96  ASP A OD2 1 
ATOM   718   N N   . ILE A 1 103 ? 173.605 -34.256 291.592 1.00 61.45  ?  97  ILE A N   1 
ATOM   719   C CA  . ILE A 1 103 ? 174.109 -33.105 292.330 1.00 55.31  ?  97  ILE A CA  1 
ATOM   720   C C   . ILE A 1 103 ? 174.395 -31.972 291.354 1.00 57.01  ?  97  ILE A C   1 
ATOM   721   O O   . ILE A 1 103 ? 175.024 -32.187 290.312 1.00 57.26  ?  97  ILE A O   1 
ATOM   722   C CB  . ILE A 1 103 ? 175.374 -33.465 293.130 1.00 57.10  ?  97  ILE A CB  1 
ATOM   723   C CG1 . ILE A 1 103 ? 175.117 -34.706 293.986 1.00 56.88  ?  97  ILE A CG1 1 
ATOM   724   C CG2 . ILE A 1 103 ? 175.813 -32.296 293.999 1.00 49.02  ?  97  ILE A CG2 1 
ATOM   725   C CD1 . ILE A 1 103 ? 176.340 -35.217 294.698 1.00 54.34  ?  97  ILE A CD1 1 
ATOM   726   N N   . ILE A 1 104 ? 173.934 -30.772 291.696 1.00 51.81  ?  98  ILE A N   1 
ATOM   727   C CA  . ILE A 1 104 ? 174.238 -29.553 290.955 1.00 43.41  ?  98  ILE A CA  1 
ATOM   728   C C   . ILE A 1 104 ? 174.932 -28.596 291.914 1.00 41.22  ?  98  ILE A C   1 
ATOM   729   O O   . ILE A 1 104 ? 174.373 -28.247 292.962 1.00 39.77  ?  98  ILE A O   1 
ATOM   730   C CB  . ILE A 1 104 ? 172.977 -28.913 290.355 1.00 44.11  ?  98  ILE A CB  1 
ATOM   731   C CG1 . ILE A 1 104 ? 172.376 -29.821 289.279 1.00 52.48  ?  98  ILE A CG1 1 
ATOM   732   C CG2 . ILE A 1 104 ? 173.297 -27.540 289.784 1.00 46.06  ?  98  ILE A CG2 1 
ATOM   733   C CD1 . ILE A 1 104 ? 171.173 -29.224 288.579 1.00 43.77  ?  98  ILE A CD1 1 
ATOM   734   N N   . ILE A 1 105 ? 176.144 -28.176 291.561 1.00 40.45  ?  99  ILE A N   1 
ATOM   735   C CA  . ILE A 1 105 ? 176.966 -27.321 292.410 1.00 44.84  ?  99  ILE A CA  1 
ATOM   736   C C   . ILE A 1 105 ? 177.079 -25.950 291.760 1.00 43.56  ?  99  ILE A C   1 
ATOM   737   O O   . ILE A 1 105 ? 177.482 -25.838 290.595 1.00 44.65  ?  99  ILE A O   1 
ATOM   738   C CB  . ILE A 1 105 ? 178.359 -27.927 292.653 1.00 42.10  ?  99  ILE A CB  1 
ATOM   739   C CG1 . ILE A 1 105 ? 178.245 -29.339 293.232 1.00 37.67  ?  99  ILE A CG1 1 
ATOM   740   C CG2 . ILE A 1 105 ? 179.166 -27.040 293.587 1.00 37.40  ?  99  ILE A CG2 1 
ATOM   741   C CD1 . ILE A 1 105 ? 178.400 -30.441 292.204 1.00 45.77  ?  99  ILE A CD1 1 
ATOM   742   N N   . ASP A 1 106 ? 176.729 -24.910 292.514 1.00 43.95  ?  100 ASP A N   1 
ATOM   743   C CA  . ASP A 1 106 ? 176.835 -23.527 292.062 1.00 42.28  ?  100 ASP A CA  1 
ATOM   744   C C   . ASP A 1 106 ? 178.041 -22.892 292.747 1.00 44.24  ?  100 ASP A C   1 
ATOM   745   O O   . ASP A 1 106 ? 177.988 -22.568 293.938 1.00 41.98  ?  100 ASP A O   1 
ATOM   746   C CB  . ASP A 1 106 ? 175.554 -22.755 292.371 1.00 44.10  ?  100 ASP A CB  1 
ATOM   747   C CG  . ASP A 1 106 ? 175.609 -21.313 291.900 1.00 47.62  ?  100 ASP A CG  1 
ATOM   748   O OD1 . ASP A 1 106 ? 176.511 -20.972 291.105 1.00 43.42  ?  100 ASP A OD1 1 
ATOM   749   O OD2 . ASP A 1 106 ? 174.747 -20.518 292.331 1.00 51.59  -1 100 ASP A OD2 1 
ATOM   750   N N   . GLY A 1 107 ? 179.122 -22.715 291.994 1.00 42.81  ?  101 GLY A N   1 
ATOM   751   C CA  . GLY A 1 107 ? 180.356 -22.163 292.510 1.00 35.62  ?  101 GLY A CA  1 
ATOM   752   C C   . GLY A 1 107 ? 180.509 -20.664 292.373 1.00 47.25  ?  101 GLY A C   1 
ATOM   753   O O   . GLY A 1 107 ? 181.574 -20.134 292.707 1.00 55.05  ?  101 GLY A O   1 
ATOM   754   N N   . GLY A 1 108 ? 179.481 -19.959 291.894 1.00 38.91  ?  102 GLY A N   1 
ATOM   755   C CA  . GLY A 1 108 ? 179.570 -18.525 291.722 1.00 43.36  ?  102 GLY A CA  1 
ATOM   756   C C   . GLY A 1 108 ? 179.150 -17.752 292.962 1.00 48.69  ?  102 GLY A C   1 
ATOM   757   O O   . GLY A 1 108 ? 178.672 -18.311 293.947 1.00 48.60  ?  102 GLY A O   1 
ATOM   758   N N   . ASN A 1 109 ? 179.339 -16.432 292.895 1.00 40.01  ?  103 ASN A N   1 
ATOM   759   C CA  . ASN A 1 109 ? 178.984 -15.535 293.996 1.00 31.64  ?  103 ASN A CA  1 
ATOM   760   C C   . ASN A 1 109 ? 177.496 -15.192 293.916 1.00 35.31  ?  103 ASN A C   1 
ATOM   761   O O   . ASN A 1 109 ? 177.088 -14.055 293.670 1.00 41.20  ?  103 ASN A O   1 
ATOM   762   C CB  . ASN A 1 109 ? 179.848 -14.282 293.964 1.00 34.74  ?  103 ASN A CB  1 
ATOM   763   C CG  . ASN A 1 109 ? 181.299 -14.568 294.282 1.00 42.49  ?  103 ASN A CG  1 
ATOM   764   O OD1 . ASN A 1 109 ? 182.066 -14.989 293.416 1.00 50.62  ?  103 ASN A OD1 1 
ATOM   765   N ND2 . ASN A 1 109 ? 181.687 -14.337 295.531 1.00 33.63  ?  103 ASN A ND2 1 
ATOM   766   N N   . SER A 1 110 ? 176.677 -16.214 294.133 1.00 34.87  ?  104 SER A N   1 
ATOM   767   C CA  . SER A 1 110 ? 175.232 -16.055 294.131 1.00 37.02  ?  104 SER A CA  1 
ATOM   768   C C   . SER A 1 110 ? 174.746 -15.612 295.505 1.00 38.59  ?  104 SER A C   1 
ATOM   769   O O   . SER A 1 110 ? 175.311 -15.986 296.537 1.00 46.62  ?  104 SER A O   1 
ATOM   770   C CB  . SER A 1 110 ? 174.542 -17.360 293.731 1.00 41.21  ?  104 SER A CB  1 
ATOM   771   O OG  . SER A 1 110 ? 174.921 -17.756 292.425 1.00 52.22  ?  104 SER A OG  1 
ATOM   772   N N   . GLU A 1 111 ? 173.691 -14.803 295.508 1.00 33.10  ?  105 GLU A N   1 
ATOM   773   C CA  . GLU A 1 111 ? 173.107 -14.347 296.760 1.00 33.95  ?  105 GLU A CA  1 
ATOM   774   C C   . GLU A 1 111 ? 172.466 -15.520 297.491 1.00 39.29  ?  105 GLU A C   1 
ATOM   775   O O   . GLU A 1 111 ? 171.868 -16.405 296.873 1.00 42.44  ?  105 GLU A O   1 
ATOM   776   C CB  . GLU A 1 111 ? 172.082 -13.247 296.491 1.00 39.39  ?  105 GLU A CB  1 
ATOM   777   C CG  . GLU A 1 111 ? 172.559 -12.226 295.467 1.00 41.33  ?  105 GLU A CG  1 
ATOM   778   C CD  . GLU A 1 111 ? 171.700 -10.978 295.428 1.00 51.21  ?  105 GLU A CD  1 
ATOM   779   O OE1 . GLU A 1 111 ? 171.005 -10.701 296.428 1.00 56.79  ?  105 GLU A OE1 1 
ATOM   780   O OE2 . GLU A 1 111 ? 171.725 -10.274 294.397 1.00 50.14  -1 105 GLU A OE2 1 
ATOM   781   N N   . TYR A 1 112 ? 172.601 -15.527 298.821 1.00 36.64  ?  106 TYR A N   1 
ATOM   782   C CA  . TYR A 1 112 ? 172.211 -16.706 299.589 1.00 35.59  ?  106 TYR A CA  1 
ATOM   783   C C   . TYR A 1 112 ? 170.708 -16.952 299.541 1.00 36.22  ?  106 TYR A C   1 
ATOM   784   O O   . TYR A 1 112 ? 170.273 -18.107 299.598 1.00 42.22  ?  106 TYR A O   1 
ATOM   785   C CB  . TYR A 1 112 ? 172.689 -16.578 301.038 1.00 36.47  ?  106 TYR A CB  1 
ATOM   786   C CG  . TYR A 1 112 ? 172.013 -15.487 301.839 1.00 34.88  ?  106 TYR A CG  1 
ATOM   787   C CD1 . TYR A 1 112 ? 172.526 -14.197 301.863 1.00 39.98  ?  106 TYR A CD1 1 
ATOM   788   C CD2 . TYR A 1 112 ? 170.871 -15.751 302.584 1.00 34.70  ?  106 TYR A CD2 1 
ATOM   789   C CE1 . TYR A 1 112 ? 171.915 -13.199 302.598 1.00 41.14  ?  106 TYR A CE1 1 
ATOM   790   C CE2 . TYR A 1 112 ? 170.253 -14.760 303.319 1.00 37.07  ?  106 TYR A CE2 1 
ATOM   791   C CZ  . TYR A 1 112 ? 170.779 -13.486 303.324 1.00 43.94  ?  106 TYR A CZ  1 
ATOM   792   O OH  . TYR A 1 112 ? 170.166 -12.497 304.058 1.00 46.80  ?  106 TYR A OH  1 
ATOM   793   N N   . ARG A 1 113 ? 169.900 -15.893 299.438 1.00 39.55  ?  107 ARG A N   1 
ATOM   794   C CA  . ARG A 1 113 ? 168.457 -16.088 299.332 1.00 36.37  ?  107 ARG A CA  1 
ATOM   795   C C   . ARG A 1 113 ? 168.096 -16.813 298.043 1.00 37.10  ?  107 ARG A C   1 
ATOM   796   O O   . ARG A 1 113 ? 167.177 -17.640 298.024 1.00 38.69  ?  107 ARG A O   1 
ATOM   797   C CB  . ARG A 1 113 ? 167.728 -14.748 299.417 1.00 29.97  ?  107 ARG A CB  1 
ATOM   798   C CG  . ARG A 1 113 ? 167.793 -14.090 300.782 1.00 32.28  ?  107 ARG A CG  1 
ATOM   799   C CD  . ARG A 1 113 ? 166.762 -12.981 300.900 1.00 37.46  ?  107 ARG A CD  1 
ATOM   800   N NE  . ARG A 1 113 ? 166.976 -12.160 302.087 1.00 42.05  ?  107 ARG A NE  1 
ATOM   801   C CZ  . ARG A 1 113 ? 167.738 -11.071 302.109 1.00 46.84  ?  107 ARG A CZ  1 
ATOM   802   N NH1 . ARG A 1 113 ? 168.360 -10.674 301.007 1.00 40.35  1  107 ARG A NH1 1 
ATOM   803   N NH2 . ARG A 1 113 ? 167.880 -10.380 303.231 1.00 50.98  ?  107 ARG A NH2 1 
ATOM   804   N N   . ASP A 1 114 ? 168.807 -16.513 296.954 1.00 36.21  ?  108 ASP A N   1 
ATOM   805   C CA  . ASP A 1 114 ? 168.608 -17.261 295.717 1.00 38.28  ?  108 ASP A CA  1 
ATOM   806   C C   . ASP A 1 114 ? 168.992 -18.722 295.902 1.00 38.54  ?  108 ASP A C   1 
ATOM   807   O O   . ASP A 1 114 ? 168.201 -19.625 295.608 1.00 43.59  ?  108 ASP A O   1 
ATOM   808   C CB  . ASP A 1 114 ? 169.414 -16.629 294.582 1.00 42.72  ?  108 ASP A CB  1 
ATOM   809   C CG  . ASP A 1 114 ? 168.760 -15.380 294.025 1.00 51.07  ?  108 ASP A CG  1 
ATOM   810   O OD1 . ASP A 1 114 ? 167.640 -15.046 294.466 1.00 51.39  ?  108 ASP A OD1 1 
ATOM   811   O OD2 . ASP A 1 114 ? 169.365 -14.733 293.145 1.00 56.50  -1 108 ASP A OD2 1 
ATOM   812   N N   . THR A 1 115 ? 170.204 -18.972 296.408 1.00 43.04  ?  109 THR A N   1 
ATOM   813   C CA  . THR A 1 115 ? 170.667 -20.343 296.608 1.00 44.80  ?  109 THR A CA  1 
ATOM   814   C C   . THR A 1 115 ? 169.719 -21.123 297.511 1.00 44.87  ?  109 THR A C   1 
ATOM   815   O O   . THR A 1 115 ? 169.505 -22.325 297.310 1.00 44.02  ?  109 THR A O   1 
ATOM   816   C CB  . THR A 1 115 ? 172.081 -20.335 297.188 1.00 34.17  ?  109 THR A CB  1 
ATOM   817   O OG1 . THR A 1 115 ? 172.932 -19.533 296.359 1.00 43.66  ?  109 THR A OG1 1 
ATOM   818   C CG2 . THR A 1 115 ? 172.641 -21.743 297.249 1.00 35.71  ?  109 THR A CG2 1 
ATOM   819   N N   . THR A 1 116 ? 169.139 -20.456 298.511 1.00 39.49  ?  110 THR A N   1 
ATOM   820   C CA  . THR A 1 116 ? 168.099 -21.089 299.316 1.00 38.28  ?  110 THR A CA  1 
ATOM   821   C C   . THR A 1 116 ? 166.900 -21.469 298.457 1.00 50.04  ?  110 THR A C   1 
ATOM   822   O O   . THR A 1 116 ? 166.336 -22.559 298.609 1.00 54.90  ?  110 THR A O   1 
ATOM   823   C CB  . THR A 1 116 ? 167.676 -20.155 300.451 1.00 38.61  ?  110 THR A CB  1 
ATOM   824   O OG1 . THR A 1 116 ? 168.763 -19.991 301.370 1.00 34.28  ?  110 THR A OG1 1 
ATOM   825   C CG2 . THR A 1 116 ? 166.469 -20.716 301.191 1.00 42.50  ?  110 THR A CG2 1 
ATOM   826   N N   . ARG A 1 117 ? 166.506 -20.586 297.535 1.00 49.46  ?  111 ARG A N   1 
ATOM   827   C CA  . ARG A 1 117 ? 165.373 -20.874 296.662 1.00 42.05  ?  111 ARG A CA  1 
ATOM   828   C C   . ARG A 1 117 ? 165.667 -22.047 295.733 1.00 44.07  ?  111 ARG A C   1 
ATOM   829   O O   . ARG A 1 117 ? 164.808 -22.912 295.529 1.00 41.48  ?  111 ARG A O   1 
ATOM   830   C CB  . ARG A 1 117 ? 165.008 -19.626 295.858 1.00 36.01  ?  111 ARG A CB  1 
ATOM   831   C CG  . ARG A 1 117 ? 163.905 -19.837 294.840 1.00 39.81  ?  111 ARG A CG  1 
ATOM   832   C CD  . ARG A 1 117 ? 163.748 -18.618 293.949 1.00 44.27  ?  111 ARG A CD  1 
ATOM   833   N NE  . ARG A 1 117 ? 165.006 -18.256 293.302 1.00 38.75  ?  111 ARG A NE  1 
ATOM   834   C CZ  . ARG A 1 117 ? 165.462 -18.820 292.189 1.00 43.82  ?  111 ARG A CZ  1 
ATOM   835   N NH1 . ARG A 1 117 ? 164.765 -19.778 291.594 1.00 54.86  1  111 ARG A NH1 1 
ATOM   836   N NH2 . ARG A 1 117 ? 166.618 -18.429 291.670 1.00 47.07  ?  111 ARG A NH2 1 
ATOM   837   N N   . ARG A 1 118 ? 166.873 -22.095 295.158 1.00 42.78  ?  112 ARG A N   1 
ATOM   838   C CA  . ARG A 1 118 ? 167.228 -23.217 294.293 1.00 46.58  ?  112 ARG A CA  1 
ATOM   839   C C   . ARG A 1 118 ? 167.292 -24.520 295.079 1.00 51.78  ?  112 ARG A C   1 
ATOM   840   O O   . ARG A 1 118 ? 166.914 -25.580 294.567 1.00 51.11  ?  112 ARG A O   1 
ATOM   841   C CB  . ARG A 1 118 ? 168.564 -22.958 293.596 1.00 40.68  ?  112 ARG A CB  1 
ATOM   842   C CG  . ARG A 1 118 ? 168.549 -21.836 292.571 1.00 44.55  ?  112 ARG A CG  1 
ATOM   843   C CD  . ARG A 1 118 ? 169.414 -20.679 293.034 1.00 49.11  ?  112 ARG A CD  1 
ATOM   844   N NE  . ARG A 1 118 ? 169.536 -19.625 292.033 1.00 49.15  ?  112 ARG A NE  1 
ATOM   845   C CZ  . ARG A 1 118 ? 170.662 -19.339 291.390 1.00 44.78  ?  112 ARG A CZ  1 
ATOM   846   N NH1 . ARG A 1 118 ? 171.767 -20.025 291.650 1.00 51.27  1  112 ARG A NH1 1 
ATOM   847   N NH2 . ARG A 1 118 ? 170.687 -18.363 290.493 1.00 45.30  ?  112 ARG A NH2 1 
ATOM   848   N N   . CYS A 1 119 ? 167.771 -24.461 296.324 1.00 52.98  ?  113 CYS A N   1 
ATOM   849   C CA  . CYS A 1 119 ? 167.889 -25.673 297.128 1.00 52.25  ?  113 CYS A CA  1 
ATOM   850   C C   . CYS A 1 119 ? 166.520 -26.262 297.445 1.00 45.99  ?  113 CYS A C   1 
ATOM   851   O O   . CYS A 1 119 ? 166.328 -27.480 297.355 1.00 40.87  ?  113 CYS A O   1 
ATOM   852   C CB  . CYS A 1 119 ? 168.659 -25.374 298.415 1.00 49.93  ?  113 CYS A CB  1 
ATOM   853   S SG  . CYS A 1 119 ? 168.986 -26.823 299.447 1.00 60.90  ?  113 CYS A SG  1 
ATOM   854   N N   . ARG A 1 120 ? 165.554 -25.415 297.807 1.00 42.39  ?  114 ARG A N   1 
ATOM   855   C CA  . ARG A 1 120 ? 164.228 -25.915 298.153 1.00 44.13  ?  114 ARG A CA  1 
ATOM   856   C C   . ARG A 1 120 ? 163.469 -26.385 296.918 1.00 51.67  ?  114 ARG A C   1 
ATOM   857   O O   . ARG A 1 120 ? 162.814 -27.434 296.949 1.00 61.56  ?  114 ARG A O   1 
ATOM   858   C CB  . ARG A 1 120 ? 163.435 -24.836 298.889 1.00 39.22  ?  114 ARG A CB  1 
ATOM   859   C CG  . ARG A 1 120 ? 164.086 -24.345 300.168 1.00 38.08  ?  114 ARG A CG  1 
ATOM   860   C CD  . ARG A 1 120 ? 163.220 -23.302 300.853 1.00 48.05  ?  114 ARG A CD  1 
ATOM   861   N NE  . ARG A 1 120 ? 163.879 -22.721 302.018 1.00 50.30  ?  114 ARG A NE  1 
ATOM   862   C CZ  . ARG A 1 120 ? 163.332 -21.796 302.800 1.00 55.03  ?  114 ARG A CZ  1 
ATOM   863   N NH1 . ARG A 1 120 ? 162.112 -21.346 302.544 1.00 63.22  1  114 ARG A NH1 1 
ATOM   864   N NH2 . ARG A 1 120 ? 164.005 -21.321 303.840 1.00 56.21  ?  114 ARG A NH2 1 
ATOM   865   N N   . ASP A 1 121 ? 163.539 -25.622 295.824 1.00 49.62  ?  115 ASP A N   1 
ATOM   866   C CA  . ASP A 1 121 ? 162.803 -25.995 294.619 1.00 52.39  ?  115 ASP A CA  1 
ATOM   867   C C   . ASP A 1 121 ? 163.341 -27.288 294.017 1.00 55.38  ?  115 ASP A C   1 
ATOM   868   O O   . ASP A 1 121 ? 162.566 -28.121 293.533 1.00 59.94  ?  115 ASP A O   1 
ATOM   869   C CB  . ASP A 1 121 ? 162.856 -24.858 293.598 1.00 53.28  ?  115 ASP A CB  1 
ATOM   870   C CG  . ASP A 1 121 ? 162.113 -23.619 294.066 1.00 61.36  ?  115 ASP A CG  1 
ATOM   871   O OD1 . ASP A 1 121 ? 161.604 -23.625 295.208 1.00 50.17  ?  115 ASP A OD1 1 
ATOM   872   O OD2 . ASP A 1 121 ? 162.036 -22.641 293.293 1.00 59.05  -1 115 ASP A OD2 1 
ATOM   873   N N   . LEU A 1 122 ? 164.662 -27.476 294.039 1.00 51.07  ?  116 LEU A N   1 
ATOM   874   C CA  . LEU A 1 122 ? 165.245 -28.723 293.561 1.00 49.59  ?  116 LEU A CA  1 
ATOM   875   C C   . LEU A 1 122 ? 165.120 -29.851 294.575 1.00 54.92  ?  116 LEU A C   1 
ATOM   876   O O   . LEU A 1 122 ? 165.184 -31.023 294.187 1.00 51.46  ?  116 LEU A O   1 
ATOM   877   C CB  . LEU A 1 122 ? 166.715 -28.515 293.193 1.00 48.36  ?  116 LEU A CB  1 
ATOM   878   C CG  . LEU A 1 122 ? 166.971 -27.681 291.936 1.00 53.18  ?  116 LEU A CG  1 
ATOM   879   C CD1 . LEU A 1 122 ? 168.462 -27.552 291.669 1.00 51.11  ?  116 LEU A CD1 1 
ATOM   880   C CD2 . LEU A 1 122 ? 166.259 -28.289 290.736 1.00 47.21  ?  116 LEU A CD2 1 
ATOM   881   N N   . LYS A 1 123 ? 164.949 -29.526 295.860 1.00 61.20  ?  117 LYS A N   1 
ATOM   882   C CA  . LYS A 1 123 ? 164.671 -30.558 296.855 1.00 61.52  ?  117 LYS A CA  1 
ATOM   883   C C   . LYS A 1 123 ? 163.362 -31.272 296.546 1.00 56.54  ?  117 LYS A C   1 
ATOM   884   O O   . LYS A 1 123 ? 163.240 -32.484 296.758 1.00 56.78  ?  117 LYS A O   1 
ATOM   885   C CB  . LYS A 1 123 ? 164.627 -29.939 298.253 1.00 57.90  ?  117 LYS A CB  1 
ATOM   886   C CG  . LYS A 1 123 ? 164.281 -30.908 299.373 1.00 49.36  ?  117 LYS A CG  1 
ATOM   887   C CD  . LYS A 1 123 ? 165.457 -31.803 299.723 1.00 50.44  ?  117 LYS A CD  1 
ATOM   888   C CE  . LYS A 1 123 ? 165.119 -32.720 300.889 1.00 57.58  ?  117 LYS A CE  1 
ATOM   889   N NZ  . LYS A 1 123 ? 164.671 -31.957 302.088 1.00 49.75  1  117 LYS A NZ  1 
ATOM   890   N N   . ALA A 1 124 ? 162.371 -30.535 296.038 1.00 55.31  ?  118 ALA A N   1 
ATOM   891   C CA  . ALA A 1 124 ? 161.091 -31.144 295.698 1.00 51.17  ?  118 ALA A CA  1 
ATOM   892   C C   . ALA A 1 124 ? 161.184 -31.987 294.434 1.00 48.74  ?  118 ALA A C   1 
ATOM   893   O O   . ALA A 1 124 ? 160.409 -32.935 294.265 1.00 60.47  ?  118 ALA A O   1 
ATOM   894   C CB  . ALA A 1 124 ? 160.021 -30.064 295.537 1.00 53.81  ?  118 ALA A CB  1 
ATOM   895   N N   . LYS A 1 125 ? 162.116 -31.663 293.540 1.00 46.80  ?  119 LYS A N   1 
ATOM   896   C CA  . LYS A 1 125 ? 162.295 -32.402 292.299 1.00 53.41  ?  119 LYS A CA  1 
ATOM   897   C C   . LYS A 1 125 ? 163.331 -33.513 292.419 1.00 52.66  ?  119 LYS A C   1 
ATOM   898   O O   . LYS A 1 125 ? 163.775 -34.044 291.395 1.00 47.71  ?  119 LYS A O   1 
ATOM   899   C CB  . LYS A 1 125 ? 162.685 -31.445 291.169 1.00 58.03  ?  119 LYS A CB  1 
ATOM   900   C CG  . LYS A 1 125 ? 161.717 -30.288 290.979 1.00 56.30  ?  119 LYS A CG  1 
ATOM   901   C CD  . LYS A 1 125 ? 162.112 -29.417 289.797 1.00 48.13  ?  119 LYS A CD  1 
ATOM   902   C CE  . LYS A 1 125 ? 161.221 -28.189 289.701 1.00 55.19  ?  119 LYS A CE  1 
ATOM   903   N NZ  . LYS A 1 125 ? 159.780 -28.554 289.621 1.00 60.03  1  119 LYS A NZ  1 
ATOM   904   N N   . GLY A 1 126 ? 163.725 -33.874 293.639 1.00 54.92  ?  120 GLY A N   1 
ATOM   905   C CA  . GLY A 1 126 ? 164.683 -34.944 293.830 1.00 51.23  ?  120 GLY A CA  1 
ATOM   906   C C   . GLY A 1 126 ? 166.093 -34.628 293.390 1.00 48.21  ?  120 GLY A C   1 
ATOM   907   O O   . GLY A 1 126 ? 166.874 -35.551 293.145 1.00 53.01  ?  120 GLY A O   1 
ATOM   908   N N   . ILE A 1 127 ? 166.446 -33.350 293.285 1.00 54.27  ?  121 ILE A N   1 
ATOM   909   C CA  . ILE A 1 127 ? 167.773 -32.921 292.858 1.00 58.32  ?  121 ILE A CA  1 
ATOM   910   C C   . ILE A 1 127 ? 168.496 -32.329 294.060 1.00 50.90  ?  121 ILE A C   1 
ATOM   911   O O   . ILE A 1 127 ? 167.925 -31.518 294.799 1.00 51.84  ?  121 ILE A O   1 
ATOM   912   C CB  . ILE A 1 127 ? 167.695 -31.907 291.704 1.00 55.13  ?  121 ILE A CB  1 
ATOM   913   C CG1 . ILE A 1 127 ? 166.971 -32.520 290.503 1.00 51.51  ?  121 ILE A CG1 1 
ATOM   914   C CG2 . ILE A 1 127 ? 169.087 -31.442 291.303 1.00 47.78  ?  121 ILE A CG2 1 
ATOM   915   C CD1 . ILE A 1 127 ? 167.674 -33.726 289.919 1.00 56.33  ?  121 ILE A CD1 1 
ATOM   916   N N   . LEU A 1 128 ? 169.748 -32.735 294.255 1.00 45.69  ?  122 LEU A N   1 
ATOM   917   C CA  . LEU A 1 128 ? 170.563 -32.250 295.363 1.00 47.81  ?  122 LEU A CA  1 
ATOM   918   C C   . LEU A 1 128 ? 171.340 -31.023 294.899 1.00 47.03  ?  122 LEU A C   1 
ATOM   919   O O   . LEU A 1 128 ? 172.242 -31.130 294.062 1.00 46.21  ?  122 LEU A O   1 
ATOM   920   C CB  . LEU A 1 128 ? 171.506 -33.344 295.855 1.00 51.41  ?  122 LEU A CB  1 
ATOM   921   C CG  . LEU A 1 128 ? 170.839 -34.651 296.286 1.00 51.52  ?  122 LEU A CG  1 
ATOM   922   C CD1 . LEU A 1 128 ? 171.872 -35.636 296.808 1.00 50.44  ?  122 LEU A CD1 1 
ATOM   923   C CD2 . LEU A 1 128 ? 169.769 -34.381 297.330 1.00 41.72  ?  122 LEU A CD2 1 
ATOM   924   N N   . PHE A 1 129 ? 170.993 -29.861 295.442 1.00 42.65  ?  123 PHE A N   1 
ATOM   925   C CA  . PHE A 1 129 ? 171.640 -28.609 295.081 1.00 41.15  ?  123 PHE A CA  1 
ATOM   926   C C   . PHE A 1 129 ? 172.665 -28.226 296.140 1.00 45.80  ?  123 PHE A C   1 
ATOM   927   O O   . PHE A 1 129 ? 172.398 -28.321 297.342 1.00 43.37  ?  123 PHE A O   1 
ATOM   928   C CB  . PHE A 1 129 ? 170.611 -27.490 294.915 1.00 43.20  ?  123 PHE A CB  1 
ATOM   929   C CG  . PHE A 1 129 ? 171.189 -26.210 294.388 1.00 46.39  ?  123 PHE A CG  1 
ATOM   930   C CD1 . PHE A 1 129 ? 171.663 -26.133 293.089 1.00 46.75  ?  123 PHE A CD1 1 
ATOM   931   C CD2 . PHE A 1 129 ? 171.254 -25.082 295.187 1.00 42.25  ?  123 PHE A CD2 1 
ATOM   932   C CE1 . PHE A 1 129 ? 172.195 -24.958 292.598 1.00 39.85  ?  123 PHE A CE1 1 
ATOM   933   C CE2 . PHE A 1 129 ? 171.784 -23.905 294.701 1.00 43.94  ?  123 PHE A CE2 1 
ATOM   934   C CZ  . PHE A 1 129 ? 172.255 -23.842 293.406 1.00 45.03  ?  123 PHE A CZ  1 
ATOM   935   N N   . VAL A 1 130 ? 173.840 -27.794 295.686 1.00 45.41  ?  124 VAL A N   1 
ATOM   936   C CA  . VAL A 1 130 ? 174.946 -27.430 296.565 1.00 40.14  ?  124 VAL A CA  1 
ATOM   937   C C   . VAL A 1 130 ? 175.430 -26.044 296.165 1.00 41.86  ?  124 VAL A C   1 
ATOM   938   O O   . VAL A 1 130 ? 176.028 -25.876 295.094 1.00 41.39  ?  124 VAL A O   1 
ATOM   939   C CB  . VAL A 1 130 ? 176.096 -28.444 296.504 1.00 35.89  ?  124 VAL A CB  1 
ATOM   940   C CG1 . VAL A 1 130 ? 177.264 -27.969 297.356 1.00 42.45  ?  124 VAL A CG1 1 
ATOM   941   C CG2 . VAL A 1 130 ? 175.623 -29.810 296.962 1.00 39.87  ?  124 VAL A CG2 1 
ATOM   942   N N   . GLY A 1 131 ? 175.179 -25.055 297.018 1.00 38.35  ?  125 GLY A N   1 
ATOM   943   C CA  . GLY A 1 131 ? 175.714 -23.724 296.809 1.00 39.26  ?  125 GLY A CA  1 
ATOM   944   C C   . GLY A 1 131 ? 177.023 -23.531 297.544 1.00 37.88  ?  125 GLY A C   1 
ATOM   945   O O   . GLY A 1 131 ? 177.036 -23.364 298.767 1.00 39.07  ?  125 GLY A O   1 
ATOM   946   N N   . SER A 1 132 ? 178.133 -23.553 296.811 1.00 31.99  ?  126 SER A N   1 
ATOM   947   C CA  . SER A 1 132 ? 179.463 -23.523 297.399 1.00 34.31  ?  126 SER A CA  1 
ATOM   948   C C   . SER A 1 132 ? 180.179 -22.229 297.041 1.00 39.91  ?  126 SER A C   1 
ATOM   949   O O   . SER A 1 132 ? 180.057 -21.728 295.919 1.00 39.89  ?  126 SER A O   1 
ATOM   950   C CB  . SER A 1 132 ? 180.294 -24.721 296.930 1.00 35.10  ?  126 SER A CB  1 
ATOM   951   O OG  . SER A 1 132 ? 181.571 -24.727 297.543 1.00 41.54  ?  126 SER A OG  1 
ATOM   952   N N   . GLY A 1 133 ? 180.927 -21.693 298.003 1.00 34.46  ?  127 GLY A N   1 
ATOM   953   C CA  . GLY A 1 133 ? 181.750 -20.523 297.763 1.00 38.03  ?  127 GLY A CA  1 
ATOM   954   C C   . GLY A 1 133 ? 183.163 -20.925 297.370 1.00 37.75  ?  127 GLY A C   1 
ATOM   955   O O   . GLY A 1 133 ? 183.732 -21.865 297.919 1.00 39.96  ?  127 GLY A O   1 
ATOM   956   N N   . VAL A 1 134 ? 183.716 -20.203 296.398 1.00 36.08  ?  128 VAL A N   1 
ATOM   957   C CA  . VAL A 1 134 ? 185.045 -20.481 295.862 1.00 40.52  ?  128 VAL A CA  1 
ATOM   958   C C   . VAL A 1 134 ? 185.851 -19.191 295.935 1.00 46.20  ?  128 VAL A C   1 
ATOM   959   O O   . VAL A 1 134 ? 185.618 -18.264 295.149 1.00 47.53  ?  128 VAL A O   1 
ATOM   960   C CB  . VAL A 1 134 ? 184.994 -21.008 294.421 1.00 39.47  ?  128 VAL A CB  1 
ATOM   961   C CG1 . VAL A 1 134 ? 186.353 -21.557 294.010 1.00 38.87  ?  128 VAL A CG1 1 
ATOM   962   C CG2 . VAL A 1 134 ? 183.914 -22.069 294.273 1.00 35.71  ?  128 VAL A CG2 1 
ATOM   963   N N   . SER A 1 135 ? 186.796 -19.130 296.868 1.00 48.61  ?  129 SER A N   1 
ATOM   964   C CA  . SER A 1 135 ? 187.662 -17.973 297.033 1.00 47.94  ?  129 SER A CA  1 
ATOM   965   C C   . SER A 1 135 ? 189.112 -18.375 296.805 1.00 47.05  ?  129 SER A C   1 
ATOM   966   O O   . SER A 1 135 ? 189.498 -19.528 297.024 1.00 42.23  ?  129 SER A O   1 
ATOM   967   C CB  . SER A 1 135 ? 187.504 -17.352 298.426 1.00 36.23  ?  129 SER A CB  1 
ATOM   968   O OG  . SER A 1 135 ? 187.685 -18.325 299.438 1.00 46.63  ?  129 SER A OG  1 
ATOM   969   N N   . GLY A 1 136 ? 189.912 -17.409 296.362 1.00 52.46  ?  130 GLY A N   1 
ATOM   970   C CA  . GLY A 1 136 ? 191.316 -17.652 296.096 1.00 50.93  ?  130 GLY A CA  1 
ATOM   971   C C   . GLY A 1 136 ? 191.779 -17.066 294.780 1.00 60.62  ?  130 GLY A C   1 
ATOM   972   O O   . GLY A 1 136 ? 192.920 -17.284 294.361 1.00 62.88  ?  130 GLY A O   1 
ATOM   973   N N   . GLY A 1 137 ? 190.900 -16.314 294.121 1.00 57.30  ?  131 GLY A N   1 
ATOM   974   C CA  . GLY A 1 137 ? 191.248 -15.755 292.832 1.00 62.49  ?  131 GLY A CA  1 
ATOM   975   C C   . GLY A 1 137 ? 191.416 -16.840 291.782 1.00 63.54  ?  131 GLY A C   1 
ATOM   976   O O   . GLY A 1 137 ? 190.763 -17.887 291.814 1.00 67.29  ?  131 GLY A O   1 
ATOM   977   N N   . GLU A 1 138 ? 192.316 -16.583 290.837 1.00 63.60  ?  132 GLU A N   1 
ATOM   978   C CA  . GLU A 1 138 ? 192.608 -17.521 289.760 1.00 63.96  ?  132 GLU A CA  1 
ATOM   979   C C   . GLU A 1 138 ? 193.845 -18.366 290.031 1.00 61.67  ?  132 GLU A C   1 
ATOM   980   O O   . GLU A 1 138 ? 193.858 -19.556 289.701 1.00 62.74  ?  132 GLU A O   1 
ATOM   981   C CB  . GLU A 1 138 ? 192.781 -16.765 288.440 1.00 70.01  ?  132 GLU A CB  1 
ATOM   982   C CG  . GLU A 1 138 ? 191.539 -16.004 288.006 1.00 73.08  ?  132 GLU A CG  1 
ATOM   983   C CD  . GLU A 1 138 ? 191.816 -15.025 286.884 1.00 87.06  ?  132 GLU A CD  1 
ATOM   984   O OE1 . GLU A 1 138 ? 193.004 -14.792 286.576 1.00 82.69  ?  132 GLU A OE1 1 
ATOM   985   O OE2 . GLU A 1 138 ? 190.845 -14.486 286.312 1.00 89.25  -1 132 GLU A OE2 1 
ATOM   986   N N   . GLU A 1 139 ? 194.887 -17.777 290.623 1.00 66.84  ?  133 GLU A N   1 
ATOM   987   C CA  . GLU A 1 139 ? 196.069 -18.556 290.976 1.00 66.86  ?  133 GLU A CA  1 
ATOM   988   C C   . GLU A 1 139 ? 195.739 -19.600 292.035 1.00 63.79  ?  133 GLU A C   1 
ATOM   989   O O   . GLU A 1 139 ? 196.253 -20.724 291.993 1.00 69.98  ?  133 GLU A O   1 
ATOM   990   C CB  . GLU A 1 139 ? 197.184 -17.627 291.458 1.00 66.11  ?  133 GLU A CB  1 
ATOM   991   C CG  . GLU A 1 139 ? 198.428 -18.343 291.972 1.00 76.31  ?  133 GLU A CG  1 
ATOM   992   C CD  . GLU A 1 139 ? 199.195 -19.067 290.879 1.00 87.52  ?  133 GLU A CD  1 
ATOM   993   O OE1 . GLU A 1 139 ? 198.951 -18.790 289.685 1.00 80.81  ?  133 GLU A OE1 1 
ATOM   994   O OE2 . GLU A 1 139 ? 200.047 -19.917 291.218 1.00 86.81  -1 133 GLU A OE2 1 
ATOM   995   N N   . GLY A 1 140 ? 194.877 -19.248 292.991 1.00 59.62  ?  134 GLY A N   1 
ATOM   996   C CA  . GLY A 1 140 ? 194.441 -20.213 293.984 1.00 64.95  ?  134 GLY A CA  1 
ATOM   997   C C   . GLY A 1 140 ? 193.443 -21.227 293.472 1.00 61.62  ?  134 GLY A C   1 
ATOM   998   O O   . GLY A 1 140 ? 193.311 -22.302 294.064 1.00 59.99  ?  134 GLY A O   1 
ATOM   999   N N   . ALA A 1 141 ? 192.742 -20.913 292.381 1.00 65.84  ?  135 ALA A N   1 
ATOM   1000  C CA  . ALA A 1 141 ? 191.751 -21.829 291.829 1.00 64.76  ?  135 ALA A CA  1 
ATOM   1001  C C   . ALA A 1 141 ? 192.375 -23.022 291.117 1.00 65.37  ?  135 ALA A C   1 
ATOM   1002  O O   . ALA A 1 141 ? 191.655 -23.977 290.807 1.00 62.72  ?  135 ALA A O   1 
ATOM   1003  C CB  . ALA A 1 141 ? 190.825 -21.083 290.867 1.00 58.41  ?  135 ALA A CB  1 
ATOM   1004  N N   . ARG A 1 142 ? 193.684 -22.997 290.852 1.00 67.44  ?  136 ARG A N   1 
ATOM   1005  C CA  . ARG A 1 142 ? 194.347 -24.094 290.162 1.00 62.60  ?  136 ARG A CA  1 
ATOM   1006  C C   . ARG A 1 142 ? 195.217 -24.955 291.063 1.00 64.64  ?  136 ARG A C   1 
ATOM   1007  O O   . ARG A 1 142 ? 195.558 -26.075 290.672 1.00 72.93  ?  136 ARG A O   1 
ATOM   1008  C CB  . ARG A 1 142 ? 195.218 -23.562 289.015 1.00 59.14  ?  136 ARG A CB  1 
ATOM   1009  C CG  . ARG A 1 142 ? 195.230 -24.465 287.793 1.00 68.41  ?  136 ARG A CG  1 
ATOM   1010  C CD  . ARG A 1 142 ? 196.465 -24.250 286.939 1.00 71.85  ?  136 ARG A CD  1 
ATOM   1011  N NE  . ARG A 1 142 ? 197.521 -25.198 287.281 1.00 78.88  ?  136 ARG A NE  1 
ATOM   1012  C CZ  . ARG A 1 142 ? 197.586 -26.438 286.809 1.00 71.43  ?  136 ARG A CZ  1 
ATOM   1013  N NH1 . ARG A 1 142 ? 196.655 -26.880 285.976 1.00 67.66  1  136 ARG A NH1 1 
ATOM   1014  N NH2 . ARG A 1 142 ? 198.579 -27.239 287.170 1.00 74.07  ?  136 ARG A NH2 1 
ATOM   1015  N N   . TYR A 1 143 ? 195.583 -24.470 292.251 1.00 61.46  ?  137 TYR A N   1 
ATOM   1016  C CA  . TYR A 1 143 ? 196.458 -25.206 293.150 1.00 66.60  ?  137 TYR A CA  1 
ATOM   1017  C C   . TYR A 1 143 ? 195.847 -25.506 294.510 1.00 62.43  ?  137 TYR A C   1 
ATOM   1018  O O   . TYR A 1 143 ? 196.344 -26.401 295.201 1.00 56.46  ?  137 TYR A O   1 
ATOM   1019  C CB  . TYR A 1 143 ? 197.775 -24.440 293.361 1.00 73.05  ?  137 TYR A CB  1 
ATOM   1020  C CG  . TYR A 1 143 ? 198.602 -24.292 292.103 1.00 79.02  ?  137 TYR A CG  1 
ATOM   1021  C CD1 . TYR A 1 143 ? 199.346 -23.143 291.868 1.00 85.98  ?  137 TYR A CD1 1 
ATOM   1022  C CD2 . TYR A 1 143 ? 198.643 -25.304 291.153 1.00 77.58  ?  137 TYR A CD2 1 
ATOM   1023  C CE1 . TYR A 1 143 ? 200.103 -23.005 290.719 1.00 86.54  ?  137 TYR A CE1 1 
ATOM   1024  C CE2 . TYR A 1 143 ? 199.397 -25.176 290.003 1.00 77.96  ?  137 TYR A CE2 1 
ATOM   1025  C CZ  . TYR A 1 143 ? 200.125 -24.025 289.790 1.00 83.66  ?  137 TYR A CZ  1 
ATOM   1026  O OH  . TYR A 1 143 ? 200.878 -23.894 288.646 1.00 87.15  ?  137 TYR A OH  1 
ATOM   1027  N N   . GLY A 1 144 ? 194.797 -24.796 294.914 1.00 62.06  ?  138 GLY A N   1 
ATOM   1028  C CA  . GLY A 1 144 ? 194.170 -25.032 296.192 1.00 57.22  ?  138 GLY A CA  1 
ATOM   1029  C C   . GLY A 1 144 ? 193.320 -23.864 296.649 1.00 53.50  ?  138 GLY A C   1 
ATOM   1030  O O   . GLY A 1 144 ? 193.779 -22.977 297.376 1.00 52.23  ?  138 GLY A O   1 
ATOM   1031  N N   . PRO A 1 145 ? 192.063 -23.835 296.220 1.00 52.45  ?  139 PRO A N   1 
ATOM   1032  C CA  . PRO A 1 145 ? 191.150 -22.774 296.643 1.00 50.66  ?  139 PRO A CA  1 
ATOM   1033  C C   . PRO A 1 145 ? 190.406 -23.152 297.920 1.00 49.97  ?  139 PRO A C   1 
ATOM   1034  O O   . PRO A 1 145 ? 190.496 -24.276 298.420 1.00 52.68  ?  139 PRO A O   1 
ATOM   1035  C CB  . PRO A 1 145 ? 190.183 -22.670 295.458 1.00 52.86  ?  139 PRO A CB  1 
ATOM   1036  C CG  . PRO A 1 145 ? 190.100 -24.073 294.954 1.00 53.76  ?  139 PRO A CG  1 
ATOM   1037  C CD  . PRO A 1 145 ? 191.459 -24.702 295.193 1.00 56.12  ?  139 PRO A CD  1 
ATOM   1038  N N   . SER A 1 146 ? 189.665 -22.180 298.443 1.00 46.38  ?  140 SER A N   1 
ATOM   1039  C CA  . SER A 1 146 ? 188.808 -22.383 299.603 1.00 44.89  ?  140 SER A CA  1 
ATOM   1040  C C   . SER A 1 146 ? 187.391 -22.653 299.117 1.00 43.28  ?  140 SER A C   1 
ATOM   1041  O O   . SER A 1 146 ? 186.785 -21.803 298.455 1.00 45.01  ?  140 SER A O   1 
ATOM   1042  C CB  . SER A 1 146 ? 188.841 -21.169 300.530 1.00 40.82  ?  140 SER A CB  1 
ATOM   1043  O OG  . SER A 1 146 ? 190.152 -20.924 301.006 1.00 53.96  ?  140 SER A OG  1 
ATOM   1044  N N   . LEU A 1 147 ? 186.870 -23.834 299.436 1.00 41.12  ?  141 LEU A N   1 
ATOM   1045  C CA  . LEU A 1 147 ? 185.539 -24.250 299.016 1.00 42.81  ?  141 LEU A CA  1 
ATOM   1046  C C   . LEU A 1 147 ? 184.624 -24.306 300.230 1.00 42.28  ?  141 LEU A C   1 
ATOM   1047  O O   . LEU A 1 147 ? 184.985 -24.892 301.257 1.00 48.45  ?  141 LEU A O   1 
ATOM   1048  C CB  . LEU A 1 147 ? 185.589 -25.608 298.315 1.00 42.28  ?  141 LEU A CB  1 
ATOM   1049  C CG  . LEU A 1 147 ? 186.420 -25.646 297.031 1.00 40.88  ?  141 LEU A CG  1 
ATOM   1050  C CD1 . LEU A 1 147 ? 186.578 -27.070 296.531 1.00 47.04  ?  141 LEU A CD1 1 
ATOM   1051  C CD2 . LEU A 1 147 ? 185.788 -24.768 295.963 1.00 39.97  ?  141 LEU A CD2 1 
ATOM   1052  N N   . MET A 1 148 ? 183.440 -23.698 300.110 1.00 40.56  ?  142 MET A N   1 
ATOM   1053  C CA  . MET A 1 148 ? 182.483 -23.575 301.209 1.00 39.16  ?  142 MET A CA  1 
ATOM   1054  C C   . MET A 1 148 ? 181.162 -24.211 300.788 1.00 41.74  ?  142 MET A C   1 
ATOM   1055  O O   . MET A 1 148 ? 180.186 -23.505 300.496 1.00 43.37  ?  142 MET A O   1 
ATOM   1056  C CB  . MET A 1 148 ? 182.296 -22.111 301.606 1.00 38.63  ?  142 MET A CB  1 
ATOM   1057  C CG  . MET A 1 148 ? 183.606 -21.343 301.713 1.00 39.62  ?  142 MET A CG  1 
ATOM   1058  S SD  . MET A 1 148 ? 183.391 -19.575 301.984 1.00 44.81  ?  142 MET A SD  1 
ATOM   1059  C CE  . MET A 1 148 ? 185.027 -18.975 301.568 1.00 30.43  ?  142 MET A CE  1 
ATOM   1060  N N   . PRO A 1 149 ? 181.088 -25.544 300.767 1.00 40.74  ?  143 PRO A N   1 
ATOM   1061  C CA  . PRO A 1 149 ? 179.891 -26.216 300.240 1.00 42.46  ?  143 PRO A CA  1 
ATOM   1062  C C   . PRO A 1 149 ? 178.727 -26.137 301.220 1.00 37.64  ?  143 PRO A C   1 
ATOM   1063  O O   . PRO A 1 149 ? 178.866 -26.466 302.400 1.00 40.29  ?  143 PRO A O   1 
ATOM   1064  C CB  . PRO A 1 149 ? 180.352 -27.667 300.042 1.00 44.83  ?  143 PRO A CB  1 
ATOM   1065  C CG  . PRO A 1 149 ? 181.855 -27.650 300.227 1.00 44.42  ?  143 PRO A CG  1 
ATOM   1066  C CD  . PRO A 1 149 ? 182.131 -26.508 301.145 1.00 44.52  ?  143 PRO A CD  1 
ATOM   1067  N N   . GLY A 1 150 ? 177.572 -25.710 300.715 1.00 43.06  ?  144 GLY A N   1 
ATOM   1068  C CA  . GLY A 1 150 ? 176.365 -25.658 301.518 1.00 41.63  ?  144 GLY A CA  1 
ATOM   1069  C C   . GLY A 1 150 ? 175.153 -25.966 300.666 1.00 38.88  ?  144 GLY A C   1 
ATOM   1070  O O   . GLY A 1 150 ? 175.206 -25.923 299.433 1.00 39.23  ?  144 GLY A O   1 
ATOM   1071  N N   . GLY A 1 151 ? 174.052 -26.283 301.343 1.00 43.62  ?  145 GLY A N   1 
ATOM   1072  C CA  . GLY A 1 151 ? 172.812 -26.591 300.657 1.00 43.26  ?  145 GLY A CA  1 
ATOM   1073  C C   . GLY A 1 151 ? 172.135 -27.845 301.170 1.00 44.31  ?  145 GLY A C   1 
ATOM   1074  O O   . GLY A 1 151 ? 171.527 -27.836 302.244 1.00 45.45  ?  145 GLY A O   1 
ATOM   1075  N N   . ASN A 1 152 ? 172.229 -28.930 300.408 1.00 49.45  ?  146 ASN A N   1 
ATOM   1076  C CA  . ASN A 1 152 ? 171.645 -30.213 300.779 1.00 52.35  ?  146 ASN A CA  1 
ATOM   1077  C C   . ASN A 1 152 ? 172.770 -31.156 301.184 1.00 46.58  ?  146 ASN A C   1 
ATOM   1078  O O   . ASN A 1 152 ? 173.616 -31.509 300.356 1.00 45.98  ?  146 ASN A O   1 
ATOM   1079  C CB  . ASN A 1 152 ? 170.832 -30.800 299.624 1.00 52.91  ?  146 ASN A CB  1 
ATOM   1080  C CG  . ASN A 1 152 ? 169.898 -31.910 300.070 1.00 55.33  ?  146 ASN A CG  1 
ATOM   1081  O OD1 . ASN A 1 152 ? 170.206 -32.670 300.989 1.00 51.38  ?  146 ASN A OD1 1 
ATOM   1082  N ND2 . ASN A 1 152 ? 168.745 -32.007 299.419 1.00 59.53  ?  146 ASN A ND2 1 
ATOM   1083  N N   . LYS A 1 153 ? 172.773 -31.565 302.456 1.00 42.86  ?  147 LYS A N   1 
ATOM   1084  C CA  . LYS A 1 153 ? 173.844 -32.417 302.960 1.00 52.06  ?  147 LYS A CA  1 
ATOM   1085  C C   . LYS A 1 153 ? 173.813 -33.813 302.350 1.00 49.40  ?  147 LYS A C   1 
ATOM   1086  O O   . LYS A 1 153 ? 174.816 -34.530 302.427 1.00 48.90  ?  147 LYS A O   1 
ATOM   1087  C CB  . LYS A 1 153 ? 173.771 -32.508 304.487 1.00 52.14  ?  147 LYS A CB  1 
ATOM   1088  C CG  . LYS A 1 153 ? 175.059 -32.995 305.139 1.00 56.36  ?  147 LYS A CG  1 
ATOM   1089  C CD  . LYS A 1 153 ? 174.957 -33.010 306.654 1.00 61.51  ?  147 LYS A CD  1 
ATOM   1090  C CE  . LYS A 1 153 ? 176.258 -33.483 307.284 1.00 58.70  ?  147 LYS A CE  1 
ATOM   1091  N NZ  . LYS A 1 153 ? 176.189 -33.495 308.770 1.00 68.73  1  147 LYS A NZ  1 
ATOM   1092  N N   . GLU A 1 154 ? 172.693 -34.212 301.741 1.00 48.01  ?  148 GLU A N   1 
ATOM   1093  C CA  . GLU A 1 154 ? 172.631 -35.508 301.076 1.00 50.41  ?  148 GLU A CA  1 
ATOM   1094  C C   . GLU A 1 154 ? 173.641 -35.615 299.942 1.00 50.41  ?  148 GLU A C   1 
ATOM   1095  O O   . GLU A 1 154 ? 174.028 -36.729 299.570 1.00 53.69  ?  148 GLU A O   1 
ATOM   1096  C CB  . GLU A 1 154 ? 171.217 -35.761 300.546 1.00 49.32  ?  148 GLU A CB  1 
ATOM   1097  C CG  . GLU A 1 154 ? 170.915 -37.221 300.241 1.00 58.43  ?  148 GLU A CG  1 
ATOM   1098  C CD  . GLU A 1 154 ? 169.514 -37.430 299.693 1.00 63.45  ?  148 GLU A CD  1 
ATOM   1099  O OE1 . GLU A 1 154 ? 169.337 -37.354 298.458 1.00 59.16  ?  148 GLU A OE1 1 
ATOM   1100  O OE2 . GLU A 1 154 ? 168.589 -37.664 300.498 1.00 58.96  -1 148 GLU A OE2 1 
ATOM   1101  N N   . ALA A 1 155 ? 174.080 -34.485 299.392 1.00 49.14  ?  149 ALA A N   1 
ATOM   1102  C CA  . ALA A 1 155 ? 175.079 -34.467 298.334 1.00 45.95  ?  149 ALA A CA  1 
ATOM   1103  C C   . ALA A 1 155 ? 176.502 -34.353 298.860 1.00 51.12  ?  149 ALA A C   1 
ATOM   1104  O O   . ALA A 1 155 ? 177.446 -34.468 298.071 1.00 56.97  ?  149 ALA A O   1 
ATOM   1105  C CB  . ALA A 1 155 ? 174.802 -33.310 297.372 1.00 47.11  ?  149 ALA A CB  1 
ATOM   1106  N N   . TRP A 1 156 ? 176.677 -34.130 300.162 1.00 49.50  ?  150 TRP A N   1 
ATOM   1107  C CA  . TRP A 1 156 ? 178.024 -33.998 300.716 1.00 45.45  ?  150 TRP A CA  1 
ATOM   1108  C C   . TRP A 1 156 ? 178.846 -35.277 300.602 1.00 50.97  ?  150 TRP A C   1 
ATOM   1109  O O   . TRP A 1 156 ? 180.007 -35.191 300.167 1.00 52.12  ?  150 TRP A O   1 
ATOM   1110  C CB  . TRP A 1 156 ? 177.938 -33.508 302.166 1.00 45.53  ?  150 TRP A CB  1 
ATOM   1111  C CG  . TRP A 1 156 ? 179.266 -33.439 302.870 1.00 53.65  ?  150 TRP A CG  1 
ATOM   1112  C CD1 . TRP A 1 156 ? 179.626 -34.105 304.006 1.00 57.01  ?  150 TRP A CD1 1 
ATOM   1113  C CD2 . TRP A 1 156 ? 180.410 -32.666 302.480 1.00 50.68  ?  150 TRP A CD2 1 
ATOM   1114  N NE1 . TRP A 1 156 ? 180.919 -33.792 304.350 1.00 60.36  ?  150 TRP A NE1 1 
ATOM   1115  C CE2 . TRP A 1 156 ? 181.423 -32.912 303.429 1.00 54.12  ?  150 TRP A CE2 1 
ATOM   1116  C CE3 . TRP A 1 156 ? 180.676 -31.791 301.422 1.00 50.60  ?  150 TRP A CE3 1 
ATOM   1117  C CZ2 . TRP A 1 156 ? 182.680 -32.314 303.353 1.00 54.91  ?  150 TRP A CZ2 1 
ATOM   1118  C CZ3 . TRP A 1 156 ? 181.925 -31.199 301.348 1.00 57.20  ?  150 TRP A CZ3 1 
ATOM   1119  C CH2 . TRP A 1 156 ? 182.911 -31.463 302.307 1.00 55.11  ?  150 TRP A CH2 1 
ATOM   1120  N N   . PRO A 1 157 ? 178.341 -36.468 300.955 1.00 53.00  ?  151 PRO A N   1 
ATOM   1121  C CA  . PRO A 1 157 ? 179.198 -37.666 300.865 1.00 51.31  ?  151 PRO A CA  1 
ATOM   1122  C C   . PRO A 1 157 ? 179.734 -37.941 299.470 1.00 55.47  ?  151 PRO A C   1 
ATOM   1123  O O   . PRO A 1 157 ? 180.793 -38.568 299.340 1.00 56.34  ?  151 PRO A O   1 
ATOM   1124  C CB  . PRO A 1 157 ? 178.273 -38.794 301.341 1.00 46.22  ?  151 PRO A CB  1 
ATOM   1125  C CG  . PRO A 1 157 ? 177.271 -38.121 302.199 1.00 46.27  ?  151 PRO A CG  1 
ATOM   1126  C CD  . PRO A 1 157 ? 177.032 -36.793 301.552 1.00 48.46  ?  151 PRO A CD  1 
ATOM   1127  N N   . HIS A 1 158 ? 179.043 -37.492 298.423 1.00 49.87  ?  152 HIS A N   1 
ATOM   1128  C CA  . HIS A 1 158 ? 179.494 -37.742 297.060 1.00 49.41  ?  152 HIS A CA  1 
ATOM   1129  C C   . HIS A 1 158 ? 180.458 -36.678 296.551 1.00 52.35  ?  152 HIS A C   1 
ATOM   1130  O O   . HIS A 1 158 ? 181.313 -36.981 295.710 1.00 47.03  ?  152 HIS A O   1 
ATOM   1131  C CB  . HIS A 1 158 ? 178.293 -37.839 296.117 1.00 55.52  ?  152 HIS A CB  1 
ATOM   1132  C CG  . HIS A 1 158 ? 177.242 -38.804 296.575 1.00 64.02  ?  152 HIS A CG  1 
ATOM   1133  N ND1 . HIS A 1 158 ? 177.346 -40.165 296.381 1.00 58.43  ?  152 HIS A ND1 1 
ATOM   1134  C CD2 . HIS A 1 158 ? 176.067 -38.603 297.216 1.00 56.09  ?  152 HIS A CD2 1 
ATOM   1135  C CE1 . HIS A 1 158 ? 176.279 -40.761 296.884 1.00 55.88  ?  152 HIS A CE1 1 
ATOM   1136  N NE2 . HIS A 1 158 ? 175.488 -39.836 297.396 1.00 51.29  ?  152 HIS A NE2 1 
ATOM   1137  N N   . ILE A 1 159 ? 180.342 -35.440 297.037 1.00 55.91  ?  153 ILE A N   1 
ATOM   1138  C CA  . ILE A 1 159 ? 181.258 -34.369 296.658 1.00 56.57  ?  153 ILE A CA  1 
ATOM   1139  C C   . ILE A 1 159 ? 182.347 -34.142 297.695 1.00 57.59  ?  153 ILE A C   1 
ATOM   1140  O O   . ILE A 1 159 ? 183.234 -33.305 297.477 1.00 60.14  ?  153 ILE A O   1 
ATOM   1141  C CB  . ILE A 1 159 ? 180.499 -33.052 296.400 1.00 53.90  ?  153 ILE A CB  1 
ATOM   1142  C CG1 . ILE A 1 159 ? 179.941 -32.495 297.712 1.00 50.50  ?  153 ILE A CG1 1 
ATOM   1143  C CG2 . ILE A 1 159 ? 179.384 -33.265 295.389 1.00 51.13  ?  153 ILE A CG2 1 
ATOM   1144  C CD1 . ILE A 1 159 ? 179.203 -31.186 297.555 1.00 47.78  ?  153 ILE A CD1 1 
ATOM   1145  N N   . LYS A 1 160 ? 182.308 -34.865 298.818 1.00 52.78  ?  154 LYS A N   1 
ATOM   1146  C CA  . LYS A 1 160 ? 183.284 -34.655 299.884 1.00 53.34  ?  154 LYS A CA  1 
ATOM   1147  C C   . LYS A 1 160 ? 184.697 -34.988 299.422 1.00 56.24  ?  154 LYS A C   1 
ATOM   1148  O O   . LYS A 1 160 ? 185.640 -34.234 299.690 1.00 56.12  ?  154 LYS A O   1 
ATOM   1149  C CB  . LYS A 1 160 ? 182.904 -35.499 301.101 1.00 59.02  ?  154 LYS A CB  1 
ATOM   1150  C CG  . LYS A 1 160 ? 183.884 -35.451 302.258 1.00 62.62  ?  154 LYS A CG  1 
ATOM   1151  C CD  . LYS A 1 160 ? 183.389 -36.323 303.404 1.00 53.42  ?  154 LYS A CD  1 
ATOM   1152  C CE  . LYS A 1 160 ? 184.375 -36.352 304.558 1.00 61.29  ?  154 LYS A CE  1 
ATOM   1153  N NZ  . LYS A 1 160 ? 184.570 -35.003 305.155 1.00 67.43  1  154 LYS A NZ  1 
ATOM   1154  N N   . THR A 1 161 ? 184.862 -36.110 298.720 1.00 61.35  ?  155 THR A N   1 
ATOM   1155  C CA  . THR A 1 161 ? 186.197 -36.555 298.331 1.00 61.14  ?  155 THR A CA  1 
ATOM   1156  C C   . THR A 1 161 ? 186.817 -35.623 297.295 1.00 57.43  ?  155 THR A C   1 
ATOM   1157  O O   . THR A 1 161 ? 188.025 -35.359 297.335 1.00 57.40  ?  155 THR A O   1 
ATOM   1158  C CB  . THR A 1 161 ? 186.134 -37.987 297.797 1.00 61.50  ?  155 THR A CB  1 
ATOM   1159  O OG1 . THR A 1 161 ? 185.567 -38.846 298.795 1.00 63.28  ?  155 THR A OG1 1 
ATOM   1160  C CG2 . THR A 1 161 ? 187.524 -38.493 297.434 1.00 50.10  ?  155 THR A CG2 1 
ATOM   1161  N N   . ILE A 1 162 ? 186.009 -35.108 296.369 1.00 58.94  ?  156 ILE A N   1 
ATOM   1162  C CA  . ILE A 1 162 ? 186.553 -34.313 295.273 1.00 60.56  ?  156 ILE A CA  1 
ATOM   1163  C C   . ILE A 1 162 ? 186.907 -32.905 295.739 1.00 60.29  ?  156 ILE A C   1 
ATOM   1164  O O   . ILE A 1 162 ? 187.973 -32.380 295.400 1.00 62.24  ?  156 ILE A O   1 
ATOM   1165  C CB  . ILE A 1 162 ? 185.567 -34.287 294.090 1.00 58.30  ?  156 ILE A CB  1 
ATOM   1166  C CG1 . ILE A 1 162 ? 185.381 -35.692 293.506 1.00 56.12  ?  156 ILE A CG1 1 
ATOM   1167  C CG2 . ILE A 1 162 ? 186.048 -33.327 293.013 1.00 43.30  ?  156 ILE A CG2 1 
ATOM   1168  C CD1 . ILE A 1 162 ? 184.227 -36.473 294.107 1.00 59.80  ?  156 ILE A CD1 1 
ATOM   1169  N N   . PHE A 1 163 ? 186.027 -32.274 296.520 1.00 53.91  ?  157 PHE A N   1 
ATOM   1170  C CA  . PHE A 1 163 ? 186.266 -30.896 296.942 1.00 52.10  ?  157 PHE A CA  1 
ATOM   1171  C C   . PHE A 1 163 ? 187.501 -30.793 297.829 1.00 51.33  ?  157 PHE A C   1 
ATOM   1172  O O   . PHE A 1 163 ? 188.378 -29.954 297.595 1.00 55.21  ?  157 PHE A O   1 
ATOM   1173  C CB  . PHE A 1 163 ? 185.036 -30.345 297.664 1.00 50.48  ?  157 PHE A CB  1 
ATOM   1174  C CG  . PHE A 1 163 ? 184.022 -29.722 296.747 1.00 54.11  ?  157 PHE A CG  1 
ATOM   1175  C CD1 . PHE A 1 163 ? 184.295 -29.553 295.399 1.00 52.06  ?  157 PHE A CD1 1 
ATOM   1176  C CD2 . PHE A 1 163 ? 182.800 -29.293 297.235 1.00 51.20  ?  157 PHE A CD2 1 
ATOM   1177  C CE1 . PHE A 1 163 ? 183.365 -28.977 294.555 1.00 38.42  ?  157 PHE A CE1 1 
ATOM   1178  C CE2 . PHE A 1 163 ? 181.867 -28.715 296.396 1.00 50.71  ?  157 PHE A CE2 1 
ATOM   1179  C CZ  . PHE A 1 163 ? 182.150 -28.557 295.055 1.00 41.28  ?  157 PHE A CZ  1 
ATOM   1180  N N   . GLN A 1 164 ? 187.588 -31.642 298.856 1.00 51.47  ?  158 GLN A N   1 
ATOM   1181  C CA  . GLN A 1 164 ? 188.738 -31.605 299.751 1.00 48.93  ?  158 GLN A CA  1 
ATOM   1182  C C   . GLN A 1 164 ? 190.031 -32.008 299.055 1.00 51.34  ?  158 GLN A C   1 
ATOM   1183  O O   . GLN A 1 164 ? 191.112 -31.632 299.521 1.00 61.64  ?  158 GLN A O   1 
ATOM   1184  C CB  . GLN A 1 164 ? 188.497 -32.508 300.960 1.00 41.61  ?  158 GLN A CB  1 
ATOM   1185  C CG  . GLN A 1 164 ? 187.412 -32.008 301.897 1.00 52.97  ?  158 GLN A CG  1 
ATOM   1186  C CD  . GLN A 1 164 ? 187.248 -32.889 303.118 1.00 62.20  ?  158 GLN A CD  1 
ATOM   1187  O OE1 . GLN A 1 164 ? 187.668 -34.046 303.124 1.00 73.45  ?  158 GLN A OE1 1 
ATOM   1188  N NE2 . GLN A 1 164 ? 186.640 -32.343 304.165 1.00 62.56  ?  158 GLN A NE2 1 
ATOM   1189  N N   . GLY A 1 165 ? 189.947 -32.760 297.957 1.00 47.63  ?  159 GLY A N   1 
ATOM   1190  C CA  . GLY A 1 165 ? 191.156 -33.153 297.253 1.00 54.77  ?  159 GLY A CA  1 
ATOM   1191  C C   . GLY A 1 165 ? 191.859 -31.981 296.598 1.00 61.65  ?  159 GLY A C   1 
ATOM   1192  O O   . GLY A 1 165 ? 193.086 -31.862 296.668 1.00 60.35  ?  159 GLY A O   1 
ATOM   1193  N N   . ILE A 1 166 ? 191.096 -31.095 295.957 1.00 65.87  ?  160 ILE A N   1 
ATOM   1194  C CA  . ILE A 1 166 ? 191.687 -29.940 295.291 1.00 61.68  ?  160 ILE A CA  1 
ATOM   1195  C C   . ILE A 1 166 ? 191.799 -28.724 296.201 1.00 56.40  ?  160 ILE A C   1 
ATOM   1196  O O   . ILE A 1 166 ? 192.526 -27.779 295.865 1.00 59.69  ?  160 ILE A O   1 
ATOM   1197  C CB  . ILE A 1 166 ? 190.881 -29.559 294.038 1.00 61.40  ?  160 ILE A CB  1 
ATOM   1198  C CG1 . ILE A 1 166 ? 189.447 -29.197 294.425 1.00 58.82  ?  160 ILE A CG1 1 
ATOM   1199  C CG2 . ILE A 1 166 ? 190.903 -30.696 293.034 1.00 64.80  ?  160 ILE A CG2 1 
ATOM   1200  C CD1 . ILE A 1 166 ? 188.618 -28.674 293.280 1.00 67.22  ?  160 ILE A CD1 1 
ATOM   1201  N N   . ALA A 1 167 ? 191.105 -28.717 297.336 1.00 53.78  ?  161 ALA A N   1 
ATOM   1202  C CA  . ALA A 1 167 ? 191.141 -27.569 298.226 1.00 52.62  ?  161 ALA A CA  1 
ATOM   1203  C C   . ALA A 1 167 ? 192.524 -27.413 298.851 1.00 54.08  ?  161 ALA A C   1 
ATOM   1204  O O   . ALA A 1 167 ? 193.317 -28.356 298.923 1.00 64.58  ?  161 ALA A O   1 
ATOM   1205  C CB  . ALA A 1 167 ? 190.085 -27.704 299.322 1.00 47.25  ?  161 ALA A CB  1 
ATOM   1206  N N   . ALA A 1 168 ? 192.810 -26.194 299.300 1.00 59.00  ?  162 ALA A N   1 
ATOM   1207  C CA  . ALA A 1 168 ? 194.075 -25.922 299.963 1.00 60.77  ?  162 ALA A CA  1 
ATOM   1208  C C   . ALA A 1 168 ? 194.147 -26.657 301.296 1.00 61.01  ?  162 ALA A C   1 
ATOM   1209  O O   . ALA A 1 168 ? 193.134 -26.891 301.961 1.00 48.49  ?  162 ALA A O   1 
ATOM   1210  C CB  . ALA A 1 168 ? 194.255 -24.421 300.182 1.00 52.62  ?  162 ALA A CB  1 
ATOM   1211  N N   . LYS A 1 169 ? 195.364 -27.028 301.682 1.00 67.52  ?  163 LYS A N   1 
ATOM   1212  C CA  . LYS A 1 169 ? 195.616 -27.718 302.937 1.00 74.50  ?  163 LYS A CA  1 
ATOM   1213  C C   . LYS A 1 169 ? 196.596 -26.912 303.776 1.00 72.63  ?  163 LYS A C   1 
ATOM   1214  O O   . LYS A 1 169 ? 197.547 -26.327 303.248 1.00 70.58  ?  163 LYS A O   1 
ATOM   1215  C CB  . LYS A 1 169 ? 196.157 -29.131 302.691 1.00 71.71  ?  163 LYS A CB  1 
ATOM   1216  C CG  . LYS A 1 169 ? 195.065 -30.170 302.484 1.00 76.69  ?  163 LYS A CG  1 
ATOM   1217  C CD  . LYS A 1 169 ? 195.600 -31.426 301.819 1.00 86.90  ?  163 LYS A CD  1 
ATOM   1218  C CE  . LYS A 1 169 ? 195.899 -31.182 300.349 1.00 81.76  ?  163 LYS A CE  1 
ATOM   1219  N NZ  . LYS A 1 169 ? 194.668 -30.808 299.597 1.00 69.68  1  163 LYS A NZ  1 
ATOM   1220  N N   . VAL A 1 170 ? 196.352 -26.881 305.084 1.00 71.26  ?  164 VAL A N   1 
ATOM   1221  C CA  . VAL A 1 170 ? 197.166 -26.098 306.006 1.00 82.98  ?  164 VAL A CA  1 
ATOM   1222  C C   . VAL A 1 170 ? 198.275 -26.969 306.582 1.00 88.35  ?  164 VAL A C   1 
ATOM   1223  O O   . VAL A 1 170 ? 198.390 -28.153 306.244 1.00 92.87  ?  164 VAL A O   1 
ATOM   1224  C CB  . VAL A 1 170 ? 196.301 -25.484 307.121 1.00 81.49  ?  164 VAL A CB  1 
ATOM   1225  C CG1 . VAL A 1 170 ? 195.497 -24.312 306.579 1.00 58.68  ?  164 VAL A CG1 1 
ATOM   1226  C CG2 . VAL A 1 170 ? 195.374 -26.535 307.710 1.00 78.97  ?  164 VAL A CG2 1 
ATOM   1227  N N   . GLY A 1 171 ? 199.094 -26.388 307.461 1.00 88.49  ?  165 GLY A N   1 
ATOM   1228  C CA  . GLY A 1 171 ? 200.253 -27.075 308.010 1.00 90.81  ?  165 GLY A CA  1 
ATOM   1229  C C   . GLY A 1 171 ? 199.931 -28.288 308.860 1.00 91.12  ?  165 GLY A C   1 
ATOM   1230  O O   . GLY A 1 171 ? 200.842 -29.066 309.164 1.00 95.90  ?  165 GLY A O   1 
ATOM   1231  N N   . THR A 1 172 ? 198.671 -28.467 309.253 1.00 93.06  ?  166 THR A N   1 
ATOM   1232  C CA  . THR A 1 172 ? 198.265 -29.626 310.036 1.00 90.28  ?  166 THR A CA  1 
ATOM   1233  C C   . THR A 1 172 ? 197.753 -30.772 309.171 1.00 90.75  ?  166 THR A C   1 
ATOM   1234  O O   . THR A 1 172 ? 197.564 -31.881 309.683 1.00 91.00  ?  166 THR A O   1 
ATOM   1235  C CB  . THR A 1 172 ? 197.188 -29.222 311.052 1.00 95.00  ?  166 THR A CB  1 
ATOM   1236  O OG1 . THR A 1 172 ? 197.468 -27.904 311.542 1.00 91.76  ?  166 THR A OG1 1 
ATOM   1237  C CG2 . THR A 1 172 ? 197.168 -30.185 312.233 1.00 87.99  ?  166 THR A CG2 1 
ATOM   1238  N N   . GLY A 1 173 ? 197.536 -30.538 307.877 1.00 87.89  ?  167 GLY A N   1 
ATOM   1239  C CA  . GLY A 1 173 ? 197.055 -31.558 306.972 1.00 88.34  ?  167 GLY A CA  1 
ATOM   1240  C C   . GLY A 1 173 ? 195.561 -31.543 306.735 1.00 81.35  ?  167 GLY A C   1 
ATOM   1241  O O   . GLY A 1 173 ? 195.092 -32.203 305.799 1.00 77.69  ?  167 GLY A O   1 
ATOM   1242  N N   . GLU A 1 174 ? 194.804 -30.814 307.550 1.00 83.56  ?  168 GLU A N   1 
ATOM   1243  C CA  . GLU A 1 174 ? 193.361 -30.735 307.379 1.00 71.84  ?  168 GLU A CA  1 
ATOM   1244  C C   . GLU A 1 174 ? 193.015 -29.856 306.178 1.00 69.54  ?  168 GLU A C   1 
ATOM   1245  O O   . GLU A 1 174 ? 193.687 -28.851 305.927 1.00 66.26  ?  168 GLU A O   1 
ATOM   1246  C CB  . GLU A 1 174 ? 192.704 -30.183 308.643 1.00 63.56  ?  168 GLU A CB  1 
ATOM   1247  C CG  . GLU A 1 174 ? 193.617 -29.294 309.473 1.00 78.53  ?  168 GLU A CG  1 
ATOM   1248  C CD  . GLU A 1 174 ? 193.238 -29.270 310.941 1.00 81.89  ?  168 GLU A CD  1 
ATOM   1249  O OE1 . GLU A 1 174 ? 192.076 -29.597 311.265 1.00 68.72  ?  168 GLU A OE1 1 
ATOM   1250  O OE2 . GLU A 1 174 ? 194.106 -28.933 311.774 1.00 86.00  -1 168 GLU A OE2 1 
ATOM   1251  N N   . PRO A 1 175 ? 191.983 -30.214 305.420 1.00 73.05  ?  169 PRO A N   1 
ATOM   1252  C CA  . PRO A 1 175 ? 191.626 -29.434 304.233 1.00 69.14  ?  169 PRO A CA  1 
ATOM   1253  C C   . PRO A 1 175 ? 190.828 -28.187 304.578 1.00 56.22  ?  169 PRO A C   1 
ATOM   1254  O O   . PRO A 1 175 ? 190.062 -28.150 305.544 1.00 44.91  ?  169 PRO A O   1 
ATOM   1255  C CB  . PRO A 1 175 ? 190.777 -30.415 303.418 1.00 66.76  ?  169 PRO A CB  1 
ATOM   1256  C CG  . PRO A 1 175 ? 190.122 -31.268 304.462 1.00 71.97  ?  169 PRO A CG  1 
ATOM   1257  C CD  . PRO A 1 175 ? 191.117 -31.395 305.592 1.00 72.00  ?  169 PRO A CD  1 
ATOM   1258  N N   . CYS A 1 176 ? 191.015 -27.158 303.755 1.00 54.79  ?  170 CYS A N   1 
ATOM   1259  C CA  . CYS A 1 176 ? 190.271 -25.903 303.868 1.00 53.31  ?  170 CYS A CA  1 
ATOM   1260  C C   . CYS A 1 176 ? 188.922 -25.993 303.160 1.00 48.16  ?  170 CYS A C   1 
ATOM   1261  O O   . CYS A 1 176 ? 188.549 -25.127 302.368 1.00 49.15  ?  170 CYS A O   1 
ATOM   1262  C CB  . CYS A 1 176 ? 191.106 -24.753 303.316 1.00 47.42  ?  170 CYS A CB  1 
ATOM   1263  S SG  . CYS A 1 176 ? 192.692 -24.524 304.166 1.00 67.35  ?  170 CYS A SG  1 
ATOM   1264  N N   . CYS A 1 177 ? 188.174 -27.056 303.452 1.00 50.89  ?  171 CYS A N   1 
ATOM   1265  C CA  . CYS A 1 177 ? 186.884 -27.287 302.805 1.00 53.86  ?  171 CYS A CA  1 
ATOM   1266  C C   . CYS A 1 177 ? 186.102 -28.303 303.622 1.00 57.52  ?  171 CYS A C   1 
ATOM   1267  O O   . CYS A 1 177 ? 186.533 -29.453 303.758 1.00 60.73  ?  171 CYS A O   1 
ATOM   1268  C CB  . CYS A 1 177 ? 187.072 -27.780 301.372 1.00 46.56  ?  171 CYS A CB  1 
ATOM   1269  S SG  . CYS A 1 177 ? 185.552 -28.364 300.590 1.00 58.37  ?  171 CYS A SG  1 
ATOM   1270  N N   . ASP A 1 178 ? 184.957 -27.885 304.156 1.00 46.80  ?  172 ASP A N   1 
ATOM   1271  C CA  . ASP A 1 178 ? 184.089 -28.776 304.908 1.00 52.71  ?  172 ASP A CA  1 
ATOM   1272  C C   . ASP A 1 178 ? 182.670 -28.232 304.841 1.00 57.68  ?  172 ASP A C   1 
ATOM   1273  O O   . ASP A 1 178 ? 182.453 -27.050 304.562 1.00 64.28  ?  172 ASP A O   1 
ATOM   1274  C CB  . ASP A 1 178 ? 184.562 -28.926 306.361 1.00 54.76  ?  172 ASP A CB  1 
ATOM   1275  C CG  . ASP A 1 178 ? 183.853 -30.050 307.096 1.00 64.33  ?  172 ASP A CG  1 
ATOM   1276  O OD1 . ASP A 1 178 ? 182.628 -29.944 307.316 1.00 64.64  ?  172 ASP A OD1 1 
ATOM   1277  O OD2 . ASP A 1 178 ? 184.522 -31.046 307.444 1.00 68.13  -1 172 ASP A OD2 1 
ATOM   1278  N N   . TRP A 1 179 ? 181.703 -29.113 305.088 1.00 50.91  ?  173 TRP A N   1 
ATOM   1279  C CA  . TRP A 1 179 ? 180.301 -28.720 305.023 1.00 48.29  ?  173 TRP A CA  1 
ATOM   1280  C C   . TRP A 1 179 ? 180.004 -27.651 306.067 1.00 50.47  ?  173 TRP A C   1 
ATOM   1281  O O   . TRP A 1 179 ? 180.363 -27.794 307.240 1.00 54.27  ?  173 TRP A O   1 
ATOM   1282  C CB  . TRP A 1 179 ? 179.403 -29.937 305.233 1.00 45.41  ?  173 TRP A CB  1 
ATOM   1283  C CG  . TRP A 1 179 ? 177.985 -29.689 304.849 1.00 41.41  ?  173 TRP A CG  1 
ATOM   1284  C CD1 . TRP A 1 179 ? 176.929 -29.493 305.688 1.00 39.50  ?  173 TRP A CD1 1 
ATOM   1285  C CD2 . TRP A 1 179 ? 177.465 -29.594 303.518 1.00 41.62  ?  173 TRP A CD2 1 
ATOM   1286  N NE1 . TRP A 1 179 ? 175.780 -29.289 304.963 1.00 41.60  ?  173 TRP A NE1 1 
ATOM   1287  C CE2 . TRP A 1 179 ? 176.083 -29.345 303.628 1.00 41.06  ?  173 TRP A CE2 1 
ATOM   1288  C CE3 . TRP A 1 179 ? 178.033 -29.697 302.245 1.00 42.82  ?  173 TRP A CE3 1 
ATOM   1289  C CZ2 . TRP A 1 179 ? 175.261 -29.198 302.513 1.00 40.95  ?  173 TRP A CZ2 1 
ATOM   1290  C CZ3 . TRP A 1 179 ? 177.215 -29.552 301.139 1.00 41.51  ?  173 TRP A CZ3 1 
ATOM   1291  C CH2 . TRP A 1 179 ? 175.845 -29.306 301.281 1.00 39.03  ?  173 TRP A CH2 1 
ATOM   1292  N N   . VAL A 1 180 ? 179.347 -26.574 305.640 1.00 43.97  ?  174 VAL A N   1 
ATOM   1293  C CA  . VAL A 1 180 ? 179.134 -25.408 306.483 1.00 47.11  ?  174 VAL A CA  1 
ATOM   1294  C C   . VAL A 1 180 ? 177.694 -25.315 306.978 1.00 43.85  ?  174 VAL A C   1 
ATOM   1295  O O   . VAL A 1 180 ? 177.462 -24.917 308.121 1.00 48.87  ?  174 VAL A O   1 
ATOM   1296  C CB  . VAL A 1 180 ? 179.564 -24.109 305.758 1.00 43.31  ?  174 VAL A CB  1 
ATOM   1297  C CG1 . VAL A 1 180 ? 180.222 -24.427 304.420 1.00 34.45  ?  174 VAL A CG1 1 
ATOM   1298  C CG2 . VAL A 1 180 ? 178.398 -23.136 305.586 1.00 33.85  ?  174 VAL A CG2 1 
ATOM   1299  N N   . GLY A 1 181 ? 176.717 -25.692 306.160 1.00 40.03  ?  175 GLY A N   1 
ATOM   1300  C CA  . GLY A 1 181 ? 175.339 -25.580 306.593 1.00 42.33  ?  175 GLY A CA  1 
ATOM   1301  C C   . GLY A 1 181 ? 174.363 -25.845 305.463 1.00 37.43  ?  175 GLY A C   1 
ATOM   1302  O O   . GLY A 1 181 ? 174.735 -26.303 304.381 1.00 44.38  ?  175 GLY A O   1 
ATOM   1303  N N   . ASP A 1 182 ? 173.102 -25.528 305.747 1.00 37.42  ?  176 ASP A N   1 
ATOM   1304  C CA  . ASP A 1 182 ? 171.967 -25.865 304.902 1.00 44.38  ?  176 ASP A CA  1 
ATOM   1305  C C   . ASP A 1 182 ? 171.472 -24.643 304.134 1.00 46.95  ?  176 ASP A C   1 
ATOM   1306  O O   . ASP A 1 182 ? 171.616 -23.503 304.584 1.00 49.11  ?  176 ASP A O   1 
ATOM   1307  C CB  . ASP A 1 182 ? 170.824 -26.430 305.753 1.00 55.76  ?  176 ASP A CB  1 
ATOM   1308  C CG  . ASP A 1 182 ? 169.651 -26.919 304.921 1.00 55.47  ?  176 ASP A CG  1 
ATOM   1309  O OD1 . ASP A 1 182 ? 168.768 -27.600 305.485 1.00 55.08  ?  176 ASP A OD1 1 
ATOM   1310  O OD2 . ASP A 1 182 ? 169.617 -26.639 303.705 1.00 61.65  -1 176 ASP A OD2 1 
ATOM   1311  N N   . GLU A 1 183 ? 170.882 -24.903 302.964 1.00 44.79  ?  177 GLU A N   1 
ATOM   1312  C CA  . GLU A 1 183 ? 170.174 -23.897 302.169 1.00 42.67  ?  177 GLU A CA  1 
ATOM   1313  C C   . GLU A 1 183 ? 171.070 -22.699 301.849 1.00 44.34  ?  177 GLU A C   1 
ATOM   1314  O O   . GLU A 1 183 ? 170.788 -21.557 302.218 1.00 47.55  ?  177 GLU A O   1 
ATOM   1315  C CB  . GLU A 1 183 ? 168.891 -23.448 302.876 1.00 44.06  ?  177 GLU A CB  1 
ATOM   1316  C CG  . GLU A 1 183 ? 167.762 -24.460 302.827 1.00 43.03  ?  177 GLU A CG  1 
ATOM   1317  C CD  . GLU A 1 183 ? 166.511 -23.963 303.522 1.00 49.45  ?  177 GLU A CD  1 
ATOM   1318  O OE1 . GLU A 1 183 ? 166.631 -23.097 304.414 1.00 55.48  ?  177 GLU A OE1 1 
ATOM   1319  O OE2 . GLU A 1 183 ? 165.408 -24.432 303.172 1.00 48.70  -1 177 GLU A OE2 1 
ATOM   1320  N N   . GLY A 1 184 ? 172.158 -22.980 301.138 1.00 40.28  ?  178 GLY A N   1 
ATOM   1321  C CA  . GLY A 1 184 ? 173.074 -21.924 300.748 1.00 44.32  ?  178 GLY A CA  1 
ATOM   1322  C C   . GLY A 1 184 ? 173.708 -21.195 301.908 1.00 51.37  ?  178 GLY A C   1 
ATOM   1323  O O   . GLY A 1 184 ? 173.975 -19.992 301.806 1.00 44.51  ?  178 GLY A O   1 
ATOM   1324  N N   . ALA A 1 185 ? 173.946 -21.889 303.023 1.00 50.04  ?  179 ALA A N   1 
ATOM   1325  C CA  . ALA A 1 185 ? 174.660 -21.271 304.133 1.00 37.44  ?  179 ALA A CA  1 
ATOM   1326  C C   . ALA A 1 185 ? 176.098 -20.949 303.754 1.00 39.13  ?  179 ALA A C   1 
ATOM   1327  O O   . ALA A 1 185 ? 176.692 -20.020 304.313 1.00 42.00  ?  179 ALA A O   1 
ATOM   1328  C CB  . ALA A 1 185 ? 174.623 -22.184 305.357 1.00 39.77  ?  179 ALA A CB  1 
ATOM   1329  N N   . GLY A 1 186 ? 176.669 -21.696 302.806 1.00 40.16  ?  180 GLY A N   1 
ATOM   1330  C CA  . GLY A 1 186 ? 178.025 -21.411 302.369 1.00 39.73  ?  180 GLY A CA  1 
ATOM   1331  C C   . GLY A 1 186 ? 178.129 -20.111 301.594 1.00 38.44  ?  180 GLY A C   1 
ATOM   1332  O O   . GLY A 1 186 ? 179.120 -19.386 301.712 1.00 42.05  ?  180 GLY A O   1 
ATOM   1333  N N   . HIS A 1 187 ? 177.110 -19.799 300.788 1.00 37.77  ?  181 HIS A N   1 
ATOM   1334  C CA  . HIS A 1 187 ? 177.113 -18.534 300.063 1.00 37.87  ?  181 HIS A CA  1 
ATOM   1335  C C   . HIS A 1 187 ? 176.992 -17.348 301.009 1.00 36.44  ?  181 HIS A C   1 
ATOM   1336  O O   . HIS A 1 187 ? 177.553 -16.280 300.736 1.00 30.94  ?  181 HIS A O   1 
ATOM   1337  C CB  . HIS A 1 187 ? 175.989 -18.518 299.028 1.00 36.55  ?  181 HIS A CB  1 
ATOM   1338  C CG  . HIS A 1 187 ? 176.325 -19.251 297.766 1.00 35.25  ?  181 HIS A CG  1 
ATOM   1339  N ND1 . HIS A 1 187 ? 175.363 -19.779 296.933 1.00 38.95  ?  181 HIS A ND1 1 
ATOM   1340  C CD2 . HIS A 1 187 ? 177.518 -19.537 297.193 1.00 37.47  ?  181 HIS A CD2 1 
ATOM   1341  C CE1 . HIS A 1 187 ? 175.949 -20.364 295.903 1.00 41.09  ?  181 HIS A CE1 1 
ATOM   1342  N NE2 . HIS A 1 187 ? 177.256 -20.231 296.037 1.00 38.89  ?  181 HIS A NE2 1 
ATOM   1343  N N   . PHE A 1 188 ? 176.269 -17.510 302.120 1.00 39.03  ?  182 PHE A N   1 
ATOM   1344  C CA  . PHE A 1 188 ? 176.285 -16.484 303.156 1.00 41.00  ?  182 PHE A CA  1 
ATOM   1345  C C   . PHE A 1 188 ? 177.668 -16.374 303.784 1.00 41.41  ?  182 PHE A C   1 
ATOM   1346  O O   . PHE A 1 188 ? 178.131 -15.271 304.096 1.00 42.85  ?  182 PHE A O   1 
ATOM   1347  C CB  . PHE A 1 188 ? 175.230 -16.789 304.222 1.00 37.77  ?  182 PHE A CB  1 
ATOM   1348  C CG  . PHE A 1 188 ? 175.020 -15.670 305.206 1.00 37.91  ?  182 PHE A CG  1 
ATOM   1349  C CD1 . PHE A 1 188 ? 175.839 -15.539 306.317 1.00 37.69  ?  182 PHE A CD1 1 
ATOM   1350  C CD2 . PHE A 1 188 ? 173.999 -14.753 305.023 1.00 38.33  ?  182 PHE A CD2 1 
ATOM   1351  C CE1 . PHE A 1 188 ? 175.649 -14.512 307.220 1.00 33.20  ?  182 PHE A CE1 1 
ATOM   1352  C CE2 . PHE A 1 188 ? 173.802 -13.724 305.926 1.00 38.86  ?  182 PHE A CE2 1 
ATOM   1353  C CZ  . PHE A 1 188 ? 174.630 -13.602 307.024 1.00 38.02  ?  182 PHE A CZ  1 
ATOM   1354  N N   . VAL A 1 189 ? 178.342 -17.511 303.976 1.00 36.72  ?  183 VAL A N   1 
ATOM   1355  C CA  . VAL A 1 189 ? 179.707 -17.492 304.488 1.00 37.43  ?  183 VAL A CA  1 
ATOM   1356  C C   . VAL A 1 189 ? 180.641 -16.819 303.490 1.00 37.48  ?  183 VAL A C   1 
ATOM   1357  O O   . VAL A 1 189 ? 181.531 -16.050 303.873 1.00 40.57  ?  183 VAL A O   1 
ATOM   1358  C CB  . VAL A 1 189 ? 180.165 -18.922 304.829 1.00 32.83  ?  183 VAL A CB  1 
ATOM   1359  C CG1 . VAL A 1 189 ? 181.649 -18.948 305.147 1.00 38.95  ?  183 VAL A CG1 1 
ATOM   1360  C CG2 . VAL A 1 189 ? 179.365 -19.466 306.001 1.00 34.29  ?  183 VAL A CG2 1 
ATOM   1361  N N   . LYS A 1 190 ? 180.449 -17.085 302.195 1.00 34.18  ?  184 LYS A N   1 
ATOM   1362  C CA  . LYS A 1 190 ? 181.261 -16.422 301.179 1.00 35.47  ?  184 LYS A CA  1 
ATOM   1363  C C   . LYS A 1 190 ? 180.972 -14.927 301.138 1.00 38.64  ?  184 LYS A C   1 
ATOM   1364  O O   . LYS A 1 190 ? 181.885 -14.117 300.936 1.00 37.04  ?  184 LYS A O   1 
ATOM   1365  C CB  . LYS A 1 190 ? 181.014 -17.061 299.811 1.00 31.27  ?  184 LYS A CB  1 
ATOM   1366  C CG  . LYS A 1 190 ? 182.255 -17.174 298.930 1.00 30.58  ?  184 LYS A CG  1 
ATOM   1367  C CD  . LYS A 1 190 ? 182.717 -15.824 298.408 1.00 34.98  ?  184 LYS A CD  1 
ATOM   1368  C CE  . LYS A 1 190 ? 184.008 -15.948 297.618 1.00 34.75  ?  184 LYS A CE  1 
ATOM   1369  N NZ  . LYS A 1 190 ? 183.838 -16.805 296.413 1.00 39.63  1  184 LYS A NZ  1 
ATOM   1370  N N   . MET A 1 191 ? 179.708 -14.542 301.329 1.00 39.12  ?  185 MET A N   1 
ATOM   1371  C CA  . MET A 1 191 ? 179.363 -13.124 301.359 1.00 37.16  ?  185 MET A CA  1 
ATOM   1372  C C   . MET A 1 191 ? 180.045 -12.424 302.527 1.00 37.24  ?  185 MET A C   1 
ATOM   1373  O O   . MET A 1 191 ? 180.627 -11.344 302.366 1.00 42.30  ?  185 MET A O   1 
ATOM   1374  C CB  . MET A 1 191 ? 177.847 -12.955 301.443 1.00 35.26  ?  185 MET A CB  1 
ATOM   1375  C CG  . MET A 1 191 ? 177.393 -11.508 301.431 1.00 35.43  ?  185 MET A CG  1 
ATOM   1376  S SD  . MET A 1 191 ? 175.694 -11.322 301.994 1.00 33.72  ?  185 MET A SD  1 
ATOM   1377  C CE  . MET A 1 191 ? 175.835 -11.942 303.667 1.00 34.59  ?  185 MET A CE  1 
ATOM   1378  N N   . VAL A 1 192 ? 179.984 -13.028 303.715 1.00 36.81  ?  186 VAL A N   1 
ATOM   1379  C CA  . VAL A 1 192 ? 180.667 -12.462 304.875 1.00 35.66  ?  186 VAL A CA  1 
ATOM   1380  C C   . VAL A 1 192 ? 182.176 -12.483 304.667 1.00 32.03  ?  186 VAL A C   1 
ATOM   1381  O O   . VAL A 1 192 ? 182.886 -11.561 305.086 1.00 26.53  ?  186 VAL A O   1 
ATOM   1382  C CB  . VAL A 1 192 ? 180.255 -13.216 306.152 1.00 32.78  ?  186 VAL A CB  1 
ATOM   1383  C CG1 . VAL A 1 192 ? 181.064 -12.735 307.346 1.00 29.32  ?  186 VAL A CG1 1 
ATOM   1384  C CG2 . VAL A 1 192 ? 178.769 -13.037 306.410 1.00 33.43  ?  186 VAL A CG2 1 
ATOM   1385  N N   . HIS A 1 193 ? 182.688 -13.528 304.011 1.00 35.49  ?  187 HIS A N   1 
ATOM   1386  C CA  . HIS A 1 193 ? 184.118 -13.603 303.725 1.00 29.76  ?  187 HIS A CA  1 
ATOM   1387  C C   . HIS A 1 193 ? 184.579 -12.402 302.909 1.00 31.41  ?  187 HIS A C   1 
ATOM   1388  O O   . HIS A 1 193 ? 185.618 -11.799 303.201 1.00 34.12  ?  187 HIS A O   1 
ATOM   1389  C CB  . HIS A 1 193 ? 184.441 -14.902 302.988 1.00 31.73  ?  187 HIS A CB  1 
ATOM   1390  C CG  . HIS A 1 193 ? 185.748 -14.870 302.259 1.00 38.95  ?  187 HIS A CG  1 
ATOM   1391  N ND1 . HIS A 1 193 ? 185.862 -14.438 300.955 1.00 41.97  ?  187 HIS A ND1 1 
ATOM   1392  C CD2 . HIS A 1 193 ? 186.998 -15.211 302.652 1.00 40.52  ?  187 HIS A CD2 1 
ATOM   1393  C CE1 . HIS A 1 193 ? 187.125 -14.515 300.576 1.00 46.92  ?  187 HIS A CE1 1 
ATOM   1394  N NE2 . HIS A 1 193 ? 187.836 -14.981 301.588 1.00 39.13  ?  187 HIS A NE2 1 
ATOM   1395  N N   . ASN A 1 194 ? 183.817 -12.043 301.874 1.00 34.99  ?  188 ASN A N   1 
ATOM   1396  C CA  . ASN A 1 194 ? 184.187 -10.892 301.058 1.00 35.13  ?  188 ASN A CA  1 
ATOM   1397  C C   . ASN A 1 194 ? 184.027 -9.592  301.836 1.00 31.56  ?  188 ASN A C   1 
ATOM   1398  O O   . ASN A 1 194 ? 184.831 -8.666  301.676 1.00 28.85  ?  188 ASN A O   1 
ATOM   1399  C CB  . ASN A 1 194 ? 183.356 -10.867 299.776 1.00 40.16  ?  188 ASN A CB  1 
ATOM   1400  C CG  . ASN A 1 194 ? 183.614 -12.074 298.892 1.00 46.46  ?  188 ASN A CG  1 
ATOM   1401  O OD1 . ASN A 1 194 ? 184.628 -12.758 299.037 1.00 42.93  ?  188 ASN A OD1 1 
ATOM   1402  N ND2 . ASN A 1 194 ? 182.699 -12.337 297.967 1.00 41.14  ?  188 ASN A ND2 1 
ATOM   1403  N N   . GLY A 1 195 ? 183.003 -9.504  302.687 1.00 31.12  ?  189 GLY A N   1 
ATOM   1404  C CA  . GLY A 1 195 ? 182.848 -8.321  303.518 1.00 29.47  ?  189 GLY A CA  1 
ATOM   1405  C C   . GLY A 1 195 ? 184.038 -8.092  304.430 1.00 29.19  ?  189 GLY A C   1 
ATOM   1406  O O   . GLY A 1 195 ? 184.508 -6.962  304.582 1.00 25.72  ?  189 GLY A O   1 
ATOM   1407  N N   . ILE A 1 196 ? 184.545 -9.164  305.043 1.00 31.39  ?  190 ILE A N   1 
ATOM   1408  C CA  . ILE A 1 196 ? 185.763 -9.059  305.842 1.00 34.45  ?  190 ILE A CA  1 
ATOM   1409  C C   . ILE A 1 196 ? 186.941 -8.664  304.960 1.00 28.94  ?  190 ILE A C   1 
ATOM   1410  O O   . ILE A 1 196 ? 187.821 -7.899  305.376 1.00 25.45  ?  190 ILE A O   1 
ATOM   1411  C CB  . ILE A 1 196 ? 186.023 -10.380 306.590 1.00 29.32  ?  190 ILE A CB  1 
ATOM   1412  C CG1 . ILE A 1 196 ? 184.988 -10.573 307.702 1.00 30.52  ?  190 ILE A CG1 1 
ATOM   1413  C CG2 . ILE A 1 196 ? 187.432 -10.417 307.156 1.00 31.16  ?  190 ILE A CG2 1 
ATOM   1414  C CD1 . ILE A 1 196 ? 185.195 -11.828 308.521 1.00 30.28  ?  190 ILE A CD1 1 
ATOM   1415  N N   . GLU A 1 197 ? 186.969 -9.167  303.723 1.00 27.51  ?  191 GLU A N   1 
ATOM   1416  C CA  . GLU A 1 197 ? 188.016 -8.775  302.785 1.00 27.13  ?  191 GLU A CA  1 
ATOM   1417  C C   . GLU A 1 197 ? 187.981 -7.276  302.514 1.00 30.75  ?  191 GLU A C   1 
ATOM   1418  O O   . GLU A 1 197 ? 189.032 -6.632  302.417 1.00 27.63  ?  191 GLU A O   1 
ATOM   1419  C CB  . GLU A 1 197 ? 187.874 -9.567  301.485 1.00 29.22  ?  191 GLU A CB  1 
ATOM   1420  C CG  . GLU A 1 197 ? 188.778 -9.100  300.359 1.00 30.90  ?  191 GLU A CG  1 
ATOM   1421  C CD  . GLU A 1 197 ? 188.624 -9.941  299.109 1.00 44.62  ?  191 GLU A CD  1 
ATOM   1422  O OE1 . GLU A 1 197 ? 188.619 -11.185 299.225 1.00 38.43  ?  191 GLU A OE1 1 
ATOM   1423  O OE2 . GLU A 1 197 ? 188.497 -9.359  298.011 1.00 64.18  -1 191 GLU A OE2 1 
ATOM   1424  N N   . TYR A 1 198 ? 186.780 -6.702  302.393 1.00 30.39  ?  192 TYR A N   1 
ATOM   1425  C CA  . TYR A 1 198 ? 186.659 -5.251  302.278 1.00 25.83  ?  192 TYR A CA  1 
ATOM   1426  C C   . TYR A 1 198 ? 187.299 -4.552  303.470 1.00 28.01  ?  192 TYR A C   1 
ATOM   1427  O O   . TYR A 1 198 ? 187.950 -3.512  303.316 1.00 32.07  ?  192 TYR A O   1 
ATOM   1428  C CB  . TYR A 1 198 ? 185.187 -4.849  302.163 1.00 27.21  ?  192 TYR A CB  1 
ATOM   1429  C CG  . TYR A 1 198 ? 184.596 -4.970  300.775 1.00 31.85  ?  192 TYR A CG  1 
ATOM   1430  C CD1 . TYR A 1 198 ? 184.656 -6.164  300.072 1.00 32.99  ?  192 TYR A CD1 1 
ATOM   1431  C CD2 . TYR A 1 198 ? 183.954 -3.893  300.177 1.00 30.41  ?  192 TYR A CD2 1 
ATOM   1432  C CE1 . TYR A 1 198 ? 184.109 -6.282  298.812 1.00 28.31  ?  192 TYR A CE1 1 
ATOM   1433  C CE2 . TYR A 1 198 ? 183.403 -4.001  298.914 1.00 28.89  ?  192 TYR A CE2 1 
ATOM   1434  C CZ  . TYR A 1 198 ? 183.485 -5.199  298.237 1.00 30.07  ?  192 TYR A CZ  1 
ATOM   1435  O OH  . TYR A 1 198 ? 182.940 -5.322  296.981 1.00 39.15  ?  192 TYR A OH  1 
ATOM   1436  N N   . GLY A 1 199 ? 187.129 -5.114  304.668 1.00 31.60  ?  193 GLY A N   1 
ATOM   1437  C CA  . GLY A 1 199 ? 187.688 -4.485  305.854 1.00 29.80  ?  193 GLY A CA  1 
ATOM   1438  C C   . GLY A 1 199 ? 189.202 -4.564  305.899 1.00 26.13  ?  193 GLY A C   1 
ATOM   1439  O O   . GLY A 1 199 ? 189.879 -3.560  306.134 1.00 32.11  ?  193 GLY A O   1 
ATOM   1440  N N   . ASP A 1 200 ? 189.753 -5.759  305.670 1.00 27.40  ?  194 ASP A N   1 
ATOM   1441  C CA  . ASP A 1 200 ? 191.203 -5.928  305.720 1.00 28.17  ?  194 ASP A CA  1 
ATOM   1442  C C   . ASP A 1 200 ? 191.901 -5.053  304.688 1.00 26.01  ?  194 ASP A C   1 
ATOM   1443  O O   . ASP A 1 200 ? 192.982 -4.513  304.950 1.00 28.88  ?  194 ASP A O   1 
ATOM   1444  C CB  . ASP A 1 200 ? 191.572 -7.397  305.508 1.00 23.34  ?  194 ASP A CB  1 
ATOM   1445  C CG  . ASP A 1 200 ? 191.154 -8.277  306.666 1.00 26.61  ?  194 ASP A CG  1 
ATOM   1446  O OD1 . ASP A 1 200 ? 190.497 -7.769  307.599 1.00 38.06  ?  194 ASP A OD1 1 
ATOM   1447  O OD2 . ASP A 1 200 ? 191.489 -9.480  306.644 1.00 31.65  -1 194 ASP A OD2 1 
ATOM   1448  N N   . MET A 1 201 ? 191.299 -4.900  303.507 1.00 25.30  ?  195 MET A N   1 
ATOM   1449  C CA  . MET A 1 201 ? 191.897 -4.054  302.480 1.00 28.19  ?  195 MET A CA  1 
ATOM   1450  C C   . MET A 1 201 ? 191.828 -2.581  302.865 1.00 30.60  ?  195 MET A C   1 
ATOM   1451  O O   . MET A 1 201 ? 192.798 -1.838  302.675 1.00 30.73  ?  195 MET A O   1 
ATOM   1452  C CB  . MET A 1 201 ? 191.207 -4.297  301.138 1.00 30.06  ?  195 MET A CB  1 
ATOM   1453  C CG  . MET A 1 201 ? 191.396 -5.704  300.593 1.00 31.52  ?  195 MET A CG  1 
ATOM   1454  S SD  . MET A 1 201 ? 190.382 -6.031  299.138 1.00 35.61  ?  195 MET A SD  1 
ATOM   1455  C CE  . MET A 1 201 ? 190.919 -4.710  298.059 1.00 37.30  ?  195 MET A CE  1 
ATOM   1456  N N   . GLN A 1 202 ? 190.692 -2.139  303.411 1.00 28.68  ?  196 GLN A N   1 
ATOM   1457  C CA  . GLN A 1 202 ? 190.565 -0.745  303.824 1.00 30.61  ?  196 GLN A CA  1 
ATOM   1458  C C   . GLN A 1 202 ? 191.414 -0.442  305.053 1.00 34.97  ?  196 GLN A C   1 
ATOM   1459  O O   . GLN A 1 202 ? 191.948 0.667   305.176 1.00 37.65  ?  196 GLN A O   1 
ATOM   1460  C CB  . GLN A 1 202 ? 189.098 -0.406  304.089 1.00 27.34  ?  196 GLN A CB  1 
ATOM   1461  C CG  . GLN A 1 202 ? 188.865 1.004   304.613 1.00 24.21  ?  196 GLN A CG  1 
ATOM   1462  C CD  . GLN A 1 202 ? 189.385 2.076   303.675 1.00 34.41  ?  196 GLN A CD  1 
ATOM   1463  O OE1 . GLN A 1 202 ? 189.979 3.063   304.112 1.00 36.80  ?  196 GLN A OE1 1 
ATOM   1464  N NE2 . GLN A 1 202 ? 189.157 1.894   302.379 1.00 30.94  ?  196 GLN A NE2 1 
ATOM   1465  N N   . LEU A 1 203 ? 191.552 -1.407  305.966 1.00 30.29  ?  197 LEU A N   1 
ATOM   1466  C CA  . LEU A 1 203 ? 192.413 -1.208  307.128 1.00 31.37  ?  197 LEU A CA  1 
ATOM   1467  C C   . LEU A 1 203 ? 193.858 -0.973  306.708 1.00 39.07  ?  197 LEU A C   1 
ATOM   1468  O O   . LEU A 1 203 ? 194.553 -0.130  307.288 1.00 39.26  ?  197 LEU A O   1 
ATOM   1469  C CB  . LEU A 1 203 ? 192.320 -2.413  308.064 1.00 28.07  ?  197 LEU A CB  1 
ATOM   1470  C CG  . LEU A 1 203 ? 191.058 -2.588  308.910 1.00 34.90  ?  197 LEU A CG  1 
ATOM   1471  C CD1 . LEU A 1 203 ? 191.121 -3.891  309.692 1.00 34.19  ?  197 LEU A CD1 1 
ATOM   1472  C CD2 . LEU A 1 203 ? 190.875 -1.412  309.848 1.00 36.52  ?  197 LEU A CD2 1 
ATOM   1473  N N   . ILE A 1 204 ? 194.328 -1.711  305.700 1.00 37.32  ?  198 ILE A N   1 
ATOM   1474  C CA  . ILE A 1 204 ? 195.690 -1.525  305.208 1.00 33.58  ?  198 ILE A CA  1 
ATOM   1475  C C   . ILE A 1 204 ? 195.849 -0.142  304.588 1.00 36.11  ?  198 ILE A C   1 
ATOM   1476  O O   . ILE A 1 204 ? 196.889 0.509   304.743 1.00 37.34  ?  198 ILE A O   1 
ATOM   1477  C CB  . ILE A 1 204 ? 196.049 -2.644  304.213 1.00 31.97  ?  198 ILE A CB  1 
ATOM   1478  C CG1 . ILE A 1 204 ? 196.135 -3.991  304.932 1.00 25.11  ?  198 ILE A CG1 1 
ATOM   1479  C CG2 . ILE A 1 204 ? 197.357 -2.340  303.501 1.00 39.78  ?  198 ILE A CG2 1 
ATOM   1480  C CD1 . ILE A 1 204 ? 196.341 -5.165  304.002 1.00 34.54  ?  198 ILE A CD1 1 
ATOM   1481  N N   . CYS A 1 205 ? 194.815 0.334   303.889 1.00 38.99  ?  199 CYS A N   1 
ATOM   1482  C CA  . CYS A 1 205 ? 194.897 1.641   303.245 1.00 36.90  ?  199 CYS A CA  1 
ATOM   1483  C C   . CYS A 1 205 ? 194.941 2.768   304.269 1.00 36.24  ?  199 CYS A C   1 
ATOM   1484  O O   . CYS A 1 205 ? 195.616 3.781   304.055 1.00 36.81  ?  199 CYS A O   1 
ATOM   1485  C CB  . CYS A 1 205 ? 193.721 1.828   302.290 1.00 29.15  ?  199 CYS A CB  1 
ATOM   1486  S SG  . CYS A 1 205 ? 193.800 0.773   300.834 1.00 36.88  ?  199 CYS A SG  1 
ATOM   1487  N N   . GLU A 1 206 ? 194.224 2.616   305.384 1.00 32.65  ?  200 GLU A N   1 
ATOM   1488  C CA  . GLU A 1 206 ? 194.296 3.623   306.437 1.00 37.70  ?  200 GLU A CA  1 
ATOM   1489  C C   . GLU A 1 206 ? 195.674 3.636   307.086 1.00 42.52  ?  200 GLU A C   1 
ATOM   1490  O O   . GLU A 1 206 ? 196.176 4.699   307.470 1.00 44.72  ?  200 GLU A O   1 
ATOM   1491  C CB  . GLU A 1 206 ? 193.206 3.374   307.480 1.00 41.40  ?  200 GLU A CB  1 
ATOM   1492  C CG  . GLU A 1 206 ? 191.791 3.500   306.934 1.00 45.40  ?  200 GLU A CG  1 
ATOM   1493  C CD  . GLU A 1 206 ? 190.730 3.199   307.976 1.00 47.46  ?  200 GLU A CD  1 
ATOM   1494  O OE1 . GLU A 1 206 ? 191.094 2.946   309.144 1.00 50.08  ?  200 GLU A OE1 1 
ATOM   1495  O OE2 . GLU A 1 206 ? 189.532 3.213   307.625 1.00 41.47  -1 200 GLU A OE2 1 
ATOM   1496  N N   . ALA A 1 207 ? 196.302 2.465   307.210 1.00 42.53  ?  201 ALA A N   1 
ATOM   1497  C CA  . ALA A 1 207 ? 197.672 2.413   307.709 1.00 42.29  ?  201 ALA A CA  1 
ATOM   1498  C C   . ALA A 1 207 ? 198.653 2.948   306.674 1.00 44.41  ?  201 ALA A C   1 
ATOM   1499  O O   . ALA A 1 207 ? 199.608 3.653   307.022 1.00 47.38  ?  201 ALA A O   1 
ATOM   1500  C CB  . ALA A 1 207 ? 198.033 0.982   308.105 1.00 40.89  ?  201 ALA A CB  1 
ATOM   1501  N N   . TYR A 1 208 ? 198.435 2.621   305.397 1.00 42.46  ?  202 TYR A N   1 
ATOM   1502  C CA  . TYR A 1 208 ? 199.281 3.152   304.333 1.00 35.78  ?  202 TYR A CA  1 
ATOM   1503  C C   . TYR A 1 208 ? 199.189 4.671   304.262 1.00 43.13  ?  202 TYR A C   1 
ATOM   1504  O O   . TYR A 1 208 ? 200.182 5.349   303.974 1.00 48.23  ?  202 TYR A O   1 
ATOM   1505  C CB  . TYR A 1 208 ? 198.890 2.523   302.995 1.00 40.43  ?  202 TYR A CB  1 
ATOM   1506  C CG  . TYR A 1 208 ? 199.387 3.269   301.775 1.00 43.98  ?  202 TYR A CG  1 
ATOM   1507  C CD1 . TYR A 1 208 ? 200.654 3.031   301.260 1.00 40.91  ?  202 TYR A CD1 1 
ATOM   1508  C CD2 . TYR A 1 208 ? 198.582 4.200   301.128 1.00 49.24  ?  202 TYR A CD2 1 
ATOM   1509  C CE1 . TYR A 1 208 ? 201.109 3.707   300.143 1.00 41.80  ?  202 TYR A CE1 1 
ATOM   1510  C CE2 . TYR A 1 208 ? 199.030 4.880   300.012 1.00 47.71  ?  202 TYR A CE2 1 
ATOM   1511  C CZ  . TYR A 1 208 ? 200.293 4.629   299.523 1.00 46.40  ?  202 TYR A CZ  1 
ATOM   1512  O OH  . TYR A 1 208 ? 200.742 5.304   298.411 1.00 54.51  ?  202 TYR A OH  1 
ATOM   1513  N N   . HIS A 1 209 ? 198.001 5.223   304.516 1.00 49.78  ?  203 HIS A N   1 
ATOM   1514  C CA  . HIS A 1 209 ? 197.836 6.672   304.474 1.00 47.70  ?  203 HIS A CA  1 
ATOM   1515  C C   . HIS A 1 209 ? 198.545 7.341   305.644 1.00 50.44  ?  203 HIS A C   1 
ATOM   1516  O O   . HIS A 1 209 ? 199.104 8.434   305.496 1.00 50.65  ?  203 HIS A O   1 
ATOM   1517  C CB  . HIS A 1 209 ? 196.350 7.029   304.471 1.00 42.86  ?  203 HIS A CB  1 
ATOM   1518  C CG  . HIS A 1 209 ? 196.042 8.334   303.806 1.00 53.73  ?  203 HIS A CG  1 
ATOM   1519  N ND1 . HIS A 1 209 ? 195.231 9.290   304.380 1.00 51.05  ?  203 HIS A ND1 1 
ATOM   1520  C CD2 . HIS A 1 209 ? 196.432 8.841   302.612 1.00 58.26  ?  203 HIS A CD2 1 
ATOM   1521  C CE1 . HIS A 1 209 ? 195.137 10.329  303.570 1.00 52.08  ?  203 HIS A CE1 1 
ATOM   1522  N NE2 . HIS A 1 209 ? 195.855 10.082  302.490 1.00 55.43  ?  203 HIS A NE2 1 
ATOM   1523  N N   . LEU A 1 210 ? 198.532 6.699   306.815 1.00 44.81  ?  204 LEU A N   1 
ATOM   1524  C CA  . LEU A 1 210 ? 199.196 7.275   307.980 1.00 43.20  ?  204 LEU A CA  1 
ATOM   1525  C C   . LEU A 1 210 ? 200.710 7.293   307.805 1.00 49.40  ?  204 LEU A C   1 
ATOM   1526  O O   . LEU A 1 210 ? 201.375 8.250   308.216 1.00 50.88  ?  204 LEU A O   1 
ATOM   1527  C CB  . LEU A 1 210 ? 198.808 6.505   309.242 1.00 41.89  ?  204 LEU A CB  1 
ATOM   1528  C CG  . LEU A 1 210 ? 197.435 6.823   309.835 1.00 44.40  ?  204 LEU A CG  1 
ATOM   1529  C CD1 . LEU A 1 210 ? 197.110 5.875   310.976 1.00 44.31  ?  204 LEU A CD1 1 
ATOM   1530  C CD2 . LEU A 1 210 ? 197.388 8.266   310.312 1.00 47.01  ?  204 LEU A CD2 1 
ATOM   1531  N N   . MET A 1 211 ? 201.276 6.247   307.199 1.00 49.05  ?  205 MET A N   1 
ATOM   1532  C CA  . MET A 1 211 ? 202.712 6.248   306.937 1.00 47.35  ?  205 MET A CA  1 
ATOM   1533  C C   . MET A 1 211 ? 203.085 7.337   305.941 1.00 51.55  ?  205 MET A C   1 
ATOM   1534  O O   . MET A 1 211 ? 204.126 7.989   306.081 1.00 58.42  ?  205 MET A O   1 
ATOM   1535  C CB  . MET A 1 211 ? 203.162 4.889   306.403 1.00 46.46  ?  205 MET A CB  1 
ATOM   1536  C CG  . MET A 1 211 ? 202.823 3.693   307.264 1.00 47.89  ?  205 MET A CG  1 
ATOM   1537  S SD  . MET A 1 211 ? 203.479 2.196   306.501 1.00 42.53  ?  205 MET A SD  1 
ATOM   1538  C CE  . MET A 1 211 ? 202.589 0.931   307.393 1.00 43.61  ?  205 MET A CE  1 
ATOM   1539  N N   . LYS A 1 212 ? 202.243 7.550   304.930 1.00 50.20  ?  206 LYS A N   1 
ATOM   1540  C CA  . LYS A 1 212 ? 202.611 8.420   303.820 1.00 53.06  ?  206 LYS A CA  1 
ATOM   1541  C C   . LYS A 1 212 ? 202.426 9.895   304.160 1.00 57.13  ?  206 LYS A C   1 
ATOM   1542  O O   . LYS A 1 212 ? 203.227 10.735  303.734 1.00 56.49  ?  206 LYS A O   1 
ATOM   1543  C CB  . LYS A 1 212 ? 201.793 8.052   302.581 1.00 43.45  ?  206 LYS A CB  1 
ATOM   1544  C CG  . LYS A 1 212 ? 202.323 8.640   301.285 1.00 52.17  ?  206 LYS A CG  1 
ATOM   1545  C CD  . LYS A 1 212 ? 201.417 8.296   300.114 1.00 49.84  ?  206 LYS A CD  1 
ATOM   1546  C CE  . LYS A 1 212 ? 200.074 8.997   300.233 1.00 63.78  ?  206 LYS A CE  1 
ATOM   1547  N NZ  . LYS A 1 212 ? 200.227 10.479  300.251 1.00 59.44  1  206 LYS A NZ  1 
ATOM   1548  N N   . ASP A 1 213 ? 201.386 10.233  304.926 1.00 54.82  ?  207 ASP A N   1 
ATOM   1549  C CA  . ASP A 1 213 ? 201.034 11.627  305.159 1.00 51.87  ?  207 ASP A CA  1 
ATOM   1550  C C   . ASP A 1 213 ? 201.346 12.132  306.560 1.00 51.31  ?  207 ASP A C   1 
ATOM   1551  O O   . ASP A 1 213 ? 201.337 13.348  306.770 1.00 57.05  ?  207 ASP A O   1 
ATOM   1552  C CB  . ASP A 1 213 ? 199.541 11.852  304.875 1.00 56.66  ?  207 ASP A CB  1 
ATOM   1553  C CG  . ASP A 1 213 ? 199.190 11.658  303.412 1.00 60.19  ?  207 ASP A CG  1 
ATOM   1554  O OD1 . ASP A 1 213 ? 200.109 11.392  302.607 1.00 51.34  ?  207 ASP A OD1 1 
ATOM   1555  O OD2 . ASP A 1 213 ? 197.995 11.774  303.066 1.00 61.16  -1 207 ASP A OD2 1 
ATOM   1556  N N   . VAL A 1 214 ? 201.613 11.249  307.515 1.00 45.32  ?  208 VAL A N   1 
ATOM   1557  C CA  . VAL A 1 214 ? 201.993 11.652  308.867 1.00 48.32  ?  208 VAL A CA  1 
ATOM   1558  C C   . VAL A 1 214 ? 203.492 11.501  309.091 1.00 54.97  ?  208 VAL A C   1 
ATOM   1559  O O   . VAL A 1 214 ? 204.147 12.410  309.599 1.00 52.03  ?  208 VAL A O   1 
ATOM   1560  C CB  . VAL A 1 214 ? 201.185 10.857  309.917 1.00 43.27  ?  208 VAL A CB  1 
ATOM   1561  C CG1 . VAL A 1 214 ? 201.685 11.161  311.322 1.00 47.69  ?  208 VAL A CG1 1 
ATOM   1562  C CG2 . VAL A 1 214 ? 199.705 11.171  309.794 1.00 46.12  ?  208 VAL A CG2 1 
ATOM   1563  N N   . LEU A 1 215 ? 204.053 10.355  308.711 1.00 59.91  ?  209 LEU A N   1 
ATOM   1564  C CA  . LEU A 1 215 ? 205.481 10.115  308.852 1.00 52.47  ?  209 LEU A CA  1 
ATOM   1565  C C   . LEU A 1 215 ? 206.267 10.447  307.590 1.00 47.09  ?  209 LEU A C   1 
ATOM   1566  O O   . LEU A 1 215 ? 207.502 10.411  307.624 1.00 56.32  ?  209 LEU A O   1 
ATOM   1567  C CB  . LEU A 1 215 ? 205.737 8.656   309.244 1.00 45.30  ?  209 LEU A CB  1 
ATOM   1568  C CG  . LEU A 1 215 ? 205.071 8.165   310.532 1.00 52.94  ?  209 LEU A CG  1 
ATOM   1569  C CD1 . LEU A 1 215 ? 205.436 6.714   310.809 1.00 54.73  ?  209 LEU A CD1 1 
ATOM   1570  C CD2 . LEU A 1 215 ? 205.452 9.051   311.708 1.00 57.44  ?  209 LEU A CD2 1 
ATOM   1571  N N   . GLY A 1 216 ? 205.587 10.766  306.490 1.00 47.50  ?  210 GLY A N   1 
ATOM   1572  C CA  . GLY A 1 216 ? 206.268 11.114  305.254 1.00 47.81  ?  210 GLY A CA  1 
ATOM   1573  C C   . GLY A 1 216 ? 207.175 10.031  304.717 1.00 48.96  ?  210 GLY A C   1 
ATOM   1574  O O   . GLY A 1 216 ? 208.178 10.339  304.064 1.00 59.25  ?  210 GLY A O   1 
ATOM   1575  N N   . MET A 1 217 ? 206.849 8.766   304.970 1.00 47.88  ?  211 MET A N   1 
ATOM   1576  C CA  . MET A 1 217 ? 207.713 7.672   304.561 1.00 47.58  ?  211 MET A CA  1 
ATOM   1577  C C   . MET A 1 217 ? 207.716 7.528   303.039 1.00 47.47  ?  211 MET A C   1 
ATOM   1578  O O   . MET A 1 217 ? 206.876 8.084   302.326 1.00 50.25  ?  211 MET A O   1 
ATOM   1579  C CB  . MET A 1 217 ? 207.272 6.366   305.219 1.00 39.38  ?  211 MET A CB  1 
ATOM   1580  C CG  . MET A 1 217 ? 207.025 6.481   306.713 1.00 41.08  ?  211 MET A CG  1 
ATOM   1581  S SD  . MET A 1 217 ? 207.639 5.074   307.660 1.00 60.21  ?  211 MET A SD  1 
ATOM   1582  C CE  . MET A 1 217 ? 206.740 3.722   306.908 1.00 48.67  ?  211 MET A CE  1 
ATOM   1583  N N   . ALA A 1 218 ? 208.687 6.767   302.545 1.00 53.14  ?  212 ALA A N   1 
ATOM   1584  C CA  . ALA A 1 218 ? 208.833 6.528   301.119 1.00 53.49  ?  212 ALA A CA  1 
ATOM   1585  C C   . ALA A 1 218 ? 208.121 5.238   300.718 1.00 46.32  ?  212 ALA A C   1 
ATOM   1586  O O   . ALA A 1 218 ? 207.738 4.420   301.557 1.00 43.16  ?  212 ALA A O   1 
ATOM   1587  C CB  . ALA A 1 218 ? 210.311 6.469   300.734 1.00 56.72  ?  212 ALA A CB  1 
ATOM   1588  N N   . GLN A 1 219 ? 207.947 5.065   299.406 1.00 43.42  ?  213 GLN A N   1 
ATOM   1589  C CA  . GLN A 1 219 ? 207.255 3.886   298.892 1.00 46.18  ?  213 GLN A CA  1 
ATOM   1590  C C   . GLN A 1 219 ? 207.994 2.607   299.263 1.00 49.12  ?  213 GLN A C   1 
ATOM   1591  O O   . GLN A 1 219 ? 207.403 1.672   299.815 1.00 45.24  ?  213 GLN A O   1 
ATOM   1592  C CB  . GLN A 1 219 ? 207.094 3.996   297.375 1.00 59.30  ?  213 GLN A CB  1 
ATOM   1593  C CG  . GLN A 1 219 ? 206.107 5.062   296.931 1.00 59.54  ?  213 GLN A CG  1 
ATOM   1594  C CD  . GLN A 1 219 ? 204.666 4.658   297.178 1.00 60.77  ?  213 GLN A CD  1 
ATOM   1595  O OE1 . GLN A 1 219 ? 203.937 5.329   297.908 1.00 55.80  ?  213 GLN A OE1 1 
ATOM   1596  N NE2 . GLN A 1 219 ? 204.248 3.557   296.563 1.00 53.58  ?  213 GLN A NE2 1 
ATOM   1597  N N   . ASP A 1 220 ? 209.295 2.549   298.968 1.00 53.54  ?  214 ASP A N   1 
ATOM   1598  C CA  . ASP A 1 220 ? 210.079 1.370   299.319 1.00 50.38  ?  214 ASP A CA  1 
ATOM   1599  C C   . ASP A 1 220 ? 210.235 1.228   300.827 1.00 44.38  ?  214 ASP A C   1 
ATOM   1600  O O   . ASP A 1 220 ? 210.425 0.112   301.327 1.00 35.63  ?  214 ASP A O   1 
ATOM   1601  C CB  . ASP A 1 220 ? 211.447 1.433   298.641 1.00 54.94  ?  214 ASP A CB  1 
ATOM   1602  C CG  . ASP A 1 220 ? 211.349 1.393   297.128 1.00 61.84  ?  214 ASP A CG  1 
ATOM   1603  O OD1 . ASP A 1 220 ? 210.683 0.479   296.599 1.00 59.26  ?  214 ASP A OD1 1 
ATOM   1604  O OD2 . ASP A 1 220 ? 211.931 2.280   296.469 1.00 73.35  -1 214 ASP A OD2 1 
ATOM   1605  N N   . GLU A 1 221 ? 210.156 2.337   301.566 1.00 40.71  ?  215 GLU A N   1 
ATOM   1606  C CA  . GLU A 1 221 ? 210.233 2.265   303.021 1.00 44.60  ?  215 GLU A CA  1 
ATOM   1607  C C   . GLU A 1 221 ? 208.961 1.665   303.607 1.00 48.11  ?  215 GLU A C   1 
ATOM   1608  O O   . GLU A 1 221 ? 209.020 0.771   304.460 1.00 40.02  ?  215 GLU A O   1 
ATOM   1609  C CB  . GLU A 1 221 ? 210.493 3.656   303.601 1.00 47.82  ?  215 GLU A CB  1 
ATOM   1610  C CG  . GLU A 1 221 ? 210.626 3.679   305.114 1.00 45.88  ?  215 GLU A CG  1 
ATOM   1611  C CD  . GLU A 1 221 ? 210.867 5.074   305.654 1.00 53.15  ?  215 GLU A CD  1 
ATOM   1612  O OE1 . GLU A 1 221 ? 210.887 6.028   304.847 1.00 48.63  ?  215 GLU A OE1 1 
ATOM   1613  O OE2 . GLU A 1 221 ? 211.035 5.216   306.884 1.00 52.97  -1 215 GLU A OE2 1 
ATOM   1614  N N   . MET A 1 222 ? 207.798 2.152   303.164 1.00 48.29  ?  216 MET A N   1 
ATOM   1615  C CA  . MET A 1 222 ? 206.535 1.562   303.598 1.00 41.73  ?  216 MET A CA  1 
ATOM   1616  C C   . MET A 1 222 ? 206.408 0.119   303.135 1.00 37.92  ?  216 MET A C   1 
ATOM   1617  O O   . MET A 1 222 ? 205.811 -0.708  303.834 1.00 38.42  ?  216 MET A O   1 
ATOM   1618  C CB  . MET A 1 222 ? 205.357 2.385   303.074 1.00 41.21  ?  216 MET A CB  1 
ATOM   1619  C CG  . MET A 1 222 ? 205.289 3.797   303.621 1.00 49.17  ?  216 MET A CG  1 
ATOM   1620  S SD  . MET A 1 222 ? 203.914 4.742   302.942 1.00 41.44  ?  216 MET A SD  1 
ATOM   1621  C CE  . MET A 1 222 ? 204.335 4.748   301.202 1.00 39.41  ?  216 MET A CE  1 
ATOM   1622  N N   . ALA A 1 223 ? 206.957 -0.199  301.962 1.00 33.38  ?  217 ALA A N   1 
ATOM   1623  C CA  . ALA A 1 223 ? 206.912 -1.570  301.466 1.00 40.00  ?  217 ALA A CA  1 
ATOM   1624  C C   . ALA A 1 223 ? 207.660 -2.513  302.398 1.00 45.38  ?  217 ALA A C   1 
ATOM   1625  O O   . ALA A 1 223 ? 207.158 -3.588  302.748 1.00 43.08  ?  217 ALA A O   1 
ATOM   1626  C CB  . ALA A 1 223 ? 207.494 -1.630  300.055 1.00 43.40  ?  217 ALA A CB  1 
ATOM   1627  N N   . GLN A 1 224 ? 208.870 -2.126  302.811 1.00 50.53  ?  218 GLN A N   1 
ATOM   1628  C CA  . GLN A 1 224 ? 209.615 -2.935  303.768 1.00 48.27  ?  218 GLN A CA  1 
ATOM   1629  C C   . GLN A 1 224 ? 208.925 -2.966  305.125 1.00 42.77  ?  218 GLN A C   1 
ATOM   1630  O O   . GLN A 1 224 ? 209.014 -3.968  305.842 1.00 44.33  ?  218 GLN A O   1 
ATOM   1631  C CB  . GLN A 1 224 ? 211.041 -2.403  303.912 1.00 54.89  ?  218 GLN A CB  1 
ATOM   1632  C CG  . GLN A 1 224 ? 212.103 -3.484  304.041 1.00 53.04  ?  218 GLN A CG  1 
ATOM   1633  C CD  . GLN A 1 224 ? 212.726 -3.848  302.706 1.00 66.47  ?  218 GLN A CD  1 
ATOM   1634  O OE1 . GLN A 1 224 ? 213.014 -2.978  301.885 1.00 67.56  ?  218 GLN A OE1 1 
ATOM   1635  N NE2 . GLN A 1 224 ? 212.934 -5.141  302.482 1.00 61.79  ?  218 GLN A NE2 1 
ATOM   1636  N N   . ALA A 1 225 ? 208.234 -1.882  305.490 1.00 42.80  ?  219 ALA A N   1 
ATOM   1637  C CA  . ALA A 1 225 ? 207.516 -1.852  306.760 1.00 47.09  ?  219 ALA A CA  1 
ATOM   1638  C C   . ALA A 1 225 ? 206.397 -2.885  306.786 1.00 49.56  ?  219 ALA A C   1 
ATOM   1639  O O   . ALA A 1 225 ? 206.180 -3.550  307.805 1.00 53.34  ?  219 ALA A O   1 
ATOM   1640  C CB  . ALA A 1 225 ? 206.962 -0.450  307.017 1.00 47.97  ?  219 ALA A CB  1 
ATOM   1641  N N   . PHE A 1 226 ? 205.671 -3.031  305.674 1.00 45.67  ?  220 PHE A N   1 
ATOM   1642  C CA  . PHE A 1 226 ? 204.671 -4.090  305.590 1.00 43.63  ?  220 PHE A CA  1 
ATOM   1643  C C   . PHE A 1 226 ? 205.322 -5.465  305.537 1.00 43.82  ?  220 PHE A C   1 
ATOM   1644  O O   . PHE A 1 226 ? 204.747 -6.440  306.034 1.00 43.56  ?  220 PHE A O   1 
ATOM   1645  C CB  . PHE A 1 226 ? 203.773 -3.883  304.370 1.00 44.34  ?  220 PHE A CB  1 
ATOM   1646  C CG  . PHE A 1 226 ? 202.730 -2.818  304.555 1.00 39.05  ?  220 PHE A CG  1 
ATOM   1647  C CD1 . PHE A 1 226 ? 201.644 -3.032  305.388 1.00 38.94  ?  220 PHE A CD1 1 
ATOM   1648  C CD2 . PHE A 1 226 ? 202.827 -1.609  303.888 1.00 39.19  ?  220 PHE A CD2 1 
ATOM   1649  C CE1 . PHE A 1 226 ? 200.680 -2.057  305.559 1.00 37.26  ?  220 PHE A CE1 1 
ATOM   1650  C CE2 . PHE A 1 226 ? 201.865 -0.629  304.054 1.00 38.16  ?  220 PHE A CE2 1 
ATOM   1651  C CZ  . PHE A 1 226 ? 200.790 -0.855  304.890 1.00 37.83  ?  220 PHE A CZ  1 
ATOM   1652  N N   . GLU A 1 227 ? 206.514 -5.565  304.945 1.00 49.08  ?  221 GLU A N   1 
ATOM   1653  C CA  . GLU A 1 227 ? 207.213 -6.845  304.913 1.00 52.90  ?  221 GLU A CA  1 
ATOM   1654  C C   . GLU A 1 227 ? 207.669 -7.253  306.309 1.00 49.69  ?  221 GLU A C   1 
ATOM   1655  O O   . GLU A 1 227 ? 207.600 -8.433  306.671 1.00 52.63  ?  221 GLU A O   1 
ATOM   1656  C CB  . GLU A 1 227 ? 208.400 -6.771  303.953 1.00 48.67  ?  221 GLU A CB  1 
ATOM   1657  C CG  . GLU A 1 227 ? 208.648 -8.053  303.172 1.00 58.20  ?  221 GLU A CG  1 
ATOM   1658  C CD  . GLU A 1 227 ? 209.888 -7.977  302.300 1.00 69.37  ?  221 GLU A CD  1 
ATOM   1659  O OE1 . GLU A 1 227 ? 210.806 -7.200  302.637 1.00 77.24  ?  221 GLU A OE1 1 
ATOM   1660  O OE2 . GLU A 1 227 ? 209.944 -8.692  301.277 1.00 59.50  -1 221 GLU A OE2 1 
ATOM   1661  N N   . ASP A 1 228 ? 208.134 -6.288  307.108 1.00 46.82  ?  222 ASP A N   1 
ATOM   1662  C CA  . ASP A 1 228 ? 208.508 -6.588  308.487 1.00 48.08  ?  222 ASP A CA  1 
ATOM   1663  C C   . ASP A 1 228 ? 207.277 -6.849  309.346 1.00 50.52  ?  222 ASP A C   1 
ATOM   1664  O O   . ASP A 1 228 ? 207.309 -7.698  310.244 1.00 49.46  ?  222 ASP A O   1 
ATOM   1665  C CB  . ASP A 1 228 ? 209.338 -5.444  309.067 1.00 56.14  ?  222 ASP A CB  1 
ATOM   1666  C CG  . ASP A 1 228 ? 210.681 -5.289  308.378 1.00 62.76  ?  222 ASP A CG  1 
ATOM   1667  O OD1 . ASP A 1 228 ? 211.004 -6.122  307.505 1.00 57.37  ?  222 ASP A OD1 1 
ATOM   1668  O OD2 . ASP A 1 228 ? 211.413 -4.332  308.709 1.00 56.55  -1 222 ASP A OD2 1 
ATOM   1669  N N   . TRP A 1 229 ? 206.184 -6.124  309.088 1.00 53.24  ?  223 TRP A N   1 
ATOM   1670  C CA  . TRP A 1 229 ? 204.928 -6.405  309.776 1.00 46.59  ?  223 TRP A CA  1 
ATOM   1671  C C   . TRP A 1 229 ? 204.425 -7.807  309.468 1.00 49.24  ?  223 TRP A C   1 
ATOM   1672  O O   . TRP A 1 229 ? 203.750 -8.423  310.301 1.00 50.07  ?  223 TRP A O   1 
ATOM   1673  C CB  . TRP A 1 229 ? 203.865 -5.380  309.385 1.00 45.79  ?  223 TRP A CB  1 
ATOM   1674  C CG  . TRP A 1 229 ? 204.019 -4.051  310.044 1.00 49.53  ?  223 TRP A CG  1 
ATOM   1675  C CD1 . TRP A 1 229 ? 205.067 -3.627  310.806 1.00 55.28  ?  223 TRP A CD1 1 
ATOM   1676  C CD2 . TRP A 1 229 ? 203.084 -2.967  310.006 1.00 49.75  ?  223 TRP A CD2 1 
ATOM   1677  N NE1 . TRP A 1 229 ? 204.844 -2.343  311.243 1.00 61.83  ?  223 TRP A NE1 1 
ATOM   1678  C CE2 . TRP A 1 229 ? 203.633 -1.916  310.765 1.00 55.49  ?  223 TRP A CE2 1 
ATOM   1679  C CE3 . TRP A 1 229 ? 201.837 -2.784  309.402 1.00 50.05  ?  223 TRP A CE3 1 
ATOM   1680  C CZ2 . TRP A 1 229 ? 202.978 -0.698  310.935 1.00 54.99  ?  223 TRP A CZ2 1 
ATOM   1681  C CZ3 . TRP A 1 229 ? 201.188 -1.575  309.573 1.00 52.22  ?  223 TRP A CZ3 1 
ATOM   1682  C CH2 . TRP A 1 229 ? 201.758 -0.549  310.337 1.00 51.43  ?  223 TRP A CH2 1 
ATOM   1683  N N   . ASN A 1 230 ? 204.740 -8.326  308.280 1.00 51.18  ?  224 ASN A N   1 
ATOM   1684  C CA  . ASN A 1 230 ? 204.282 -9.645  307.869 1.00 51.33  ?  224 ASN A CA  1 
ATOM   1685  C C   . ASN A 1 230 ? 204.987 -10.774 308.609 1.00 54.56  ?  224 ASN A C   1 
ATOM   1686  O O   . ASN A 1 230 ? 204.604 -11.936 308.440 1.00 59.22  ?  224 ASN A O   1 
ATOM   1687  C CB  . ASN A 1 230 ? 204.478 -9.814  306.363 1.00 55.13  ?  224 ASN A CB  1 
ATOM   1688  C CG  . ASN A 1 230 ? 203.420 -10.692 305.733 1.00 57.32  ?  224 ASN A CG  1 
ATOM   1689  O OD1 . ASN A 1 230 ? 202.670 -11.377 306.424 1.00 59.98  ?  224 ASN A OD1 1 
ATOM   1690  N ND2 . ASN A 1 230 ? 203.358 -10.679 304.411 1.00 57.42  ?  224 ASN A ND2 1 
ATOM   1691  N N   . LYS A 1 231 ? 206.003 -10.466 309.412 1.00 52.16  ?  225 LYS A N   1 
ATOM   1692  C CA  . LYS A 1 231 ? 206.705 -11.466 310.203 1.00 59.02  ?  225 LYS A CA  1 
ATOM   1693  C C   . LYS A 1 231 ? 206.228 -11.517 311.649 1.00 56.03  ?  225 LYS A C   1 
ATOM   1694  O O   . LYS A 1 231 ? 206.796 -12.267 312.449 1.00 63.40  ?  225 LYS A O   1 
ATOM   1695  C CB  . LYS A 1 231 ? 208.215 -11.205 310.164 1.00 61.73  ?  225 LYS A CB  1 
ATOM   1696  C CG  . LYS A 1 231 ? 208.829 -11.323 308.776 1.00 59.57  ?  225 LYS A CG  1 
ATOM   1697  C CD  . LYS A 1 231 ? 210.346 -11.206 308.822 1.00 61.42  ?  225 LYS A CD  1 
ATOM   1698  C CE  . LYS A 1 231 ? 210.798 -9.780  309.098 1.00 57.17  ?  225 LYS A CE  1 
ATOM   1699  N NZ  . LYS A 1 231 ? 210.590 -8.891  307.921 1.00 57.79  1  225 LYS A NZ  1 
ATOM   1700  N N   . THR A 1 232 ? 205.200 -10.746 312.000 1.00 53.13  ?  226 THR A N   1 
ATOM   1701  C CA  . THR A 1 232 ? 204.707 -10.701 313.371 1.00 58.59  ?  226 THR A CA  1 
ATOM   1702  C C   . THR A 1 232 ? 203.300 -11.276 313.467 1.00 60.22  ?  226 THR A C   1 
ATOM   1703  O O   . THR A 1 232 ? 202.971 -12.251 312.782 1.00 54.28  ?  226 THR A O   1 
ATOM   1704  C CB  . THR A 1 232 ? 204.723 -9.264  313.899 1.00 61.31  ?  226 THR A CB  1 
ATOM   1705  O OG1 . THR A 1 232 ? 203.846 -8.451  313.109 1.00 50.22  ?  226 THR A OG1 1 
ATOM   1706  C CG2 . THR A 1 232 ? 206.131 -8.690  313.841 1.00 59.14  ?  226 THR A CG2 1 
ATOM   1707  N N   . GLU A 1 233 ? 202.461 -10.675 314.314 1.00 61.13  ?  227 GLU A N   1 
ATOM   1708  C CA  . GLU A 1 233 ? 201.095 -11.155 314.486 1.00 58.36  ?  227 GLU A CA  1 
ATOM   1709  C C   . GLU A 1 233 ? 200.233 -10.909 313.254 1.00 64.51  ?  227 GLU A C   1 
ATOM   1710  O O   . GLU A 1 233 ? 199.189 -11.554 313.107 1.00 64.15  ?  227 GLU A O   1 
ATOM   1711  C CB  . GLU A 1 233 ? 200.443 -10.493 315.703 1.00 60.64  ?  227 GLU A CB  1 
ATOM   1712  C CG  . GLU A 1 233 ? 201.114 -10.780 317.042 1.00 69.07  ?  227 GLU A CG  1 
ATOM   1713  C CD  . GLU A 1 233 ? 202.325 -9.902  317.296 1.00 73.73  ?  227 GLU A CD  1 
ATOM   1714  O OE1 . GLU A 1 233 ? 203.389 -10.167 316.699 1.00 70.91  ?  227 GLU A OE1 1 
ATOM   1715  O OE2 . GLU A 1 233 ? 202.209 -8.942  318.087 1.00 71.09  -1 227 GLU A OE2 1 
ATOM   1716  N N   . LEU A 1 234 ? 200.640 -9.996  312.371 1.00 57.18  ?  228 LEU A N   1 
ATOM   1717  C CA  . LEU A 1 234 ? 199.869 -9.641  311.186 1.00 44.95  ?  228 LEU A CA  1 
ATOM   1718  C C   . LEU A 1 234 ? 200.314 -10.411 309.947 1.00 48.01  ?  228 LEU A C   1 
ATOM   1719  O O   . LEU A 1 234 ? 200.206 -9.898  308.828 1.00 56.26  ?  228 LEU A O   1 
ATOM   1720  C CB  . LEU A 1 234 ? 199.955 -8.137  310.931 1.00 41.21  ?  228 LEU A CB  1 
ATOM   1721  C CG  . LEU A 1 234 ? 199.213 -7.231  311.913 1.00 47.01  ?  228 LEU A CG  1 
ATOM   1722  C CD1 . LEU A 1 234 ? 199.604 -5.781  311.696 1.00 44.94  ?  228 LEU A CD1 1 
ATOM   1723  C CD2 . LEU A 1 234 ? 197.711 -7.407  311.762 1.00 42.21  ?  228 LEU A CD2 1 
ATOM   1724  N N   . ASP A 1 235 ? 200.819 -11.632 310.123 1.00 48.83  ?  229 ASP A N   1 
ATOM   1725  C CA  . ASP A 1 235 ? 201.206 -12.460 308.987 1.00 51.22  ?  229 ASP A CA  1 
ATOM   1726  C C   . ASP A 1 235 ? 199.975 -12.800 308.156 1.00 52.95  ?  229 ASP A C   1 
ATOM   1727  O O   . ASP A 1 235 ? 199.176 -13.658 308.545 1.00 51.85  ?  229 ASP A O   1 
ATOM   1728  C CB  . ASP A 1 235 ? 201.913 -13.732 309.465 1.00 52.97  ?  229 ASP A CB  1 
ATOM   1729  C CG  . ASP A 1 235 ? 202.615 -14.481 308.339 1.00 55.91  ?  229 ASP A CG  1 
ATOM   1730  O OD1 . ASP A 1 235 ? 202.226 -14.321 307.162 1.00 59.50  ?  229 ASP A OD1 1 
ATOM   1731  O OD2 . ASP A 1 235 ? 203.561 -15.240 308.637 1.00 63.08  -1 229 ASP A OD2 1 
ATOM   1732  N N   . SER A 1 236 ? 199.815 -12.133 307.013 1.00 50.14  ?  230 SER A N   1 
ATOM   1733  C CA  . SER A 1 236 ? 198.653 -12.325 306.159 1.00 47.13  ?  230 SER A CA  1 
ATOM   1734  C C   . SER A 1 236 ? 199.071 -12.224 304.699 1.00 46.15  ?  230 SER A C   1 
ATOM   1735  O O   . SER A 1 236 ? 200.162 -11.752 304.369 1.00 51.03  ?  230 SER A O   1 
ATOM   1736  C CB  . SER A 1 236 ? 197.552 -11.303 306.465 1.00 41.37  ?  230 SER A CB  1 
ATOM   1737  O OG  . SER A 1 236 ? 197.956 -9.995  306.111 1.00 35.19  ?  230 SER A OG  1 
ATOM   1738  N N   . PHE A 1 237 ? 198.174 -12.671 303.818 1.00 45.51  ?  231 PHE A N   1 
ATOM   1739  C CA  . PHE A 1 237 ? 198.440 -12.611 302.385 1.00 45.02  ?  231 PHE A CA  1 
ATOM   1740  C C   . PHE A 1 237 ? 198.214 -11.209 301.831 1.00 41.94  ?  231 PHE A C   1 
ATOM   1741  O O   . PHE A 1 237 ? 198.939 -10.774 300.930 1.00 42.93  ?  231 PHE A O   1 
ATOM   1742  C CB  . PHE A 1 237 ? 197.565 -13.628 301.650 1.00 47.67  ?  231 PHE A CB  1 
ATOM   1743  C CG  . PHE A 1 237 ? 197.727 -13.606 300.157 1.00 46.62  ?  231 PHE A CG  1 
ATOM   1744  C CD1 . PHE A 1 237 ? 198.931 -13.962 299.571 1.00 50.77  ?  231 PHE A CD1 1 
ATOM   1745  C CD2 . PHE A 1 237 ? 196.669 -13.246 299.338 1.00 46.35  ?  231 PHE A CD2 1 
ATOM   1746  C CE1 . PHE A 1 237 ? 199.080 -13.948 298.196 1.00 50.61  ?  231 PHE A CE1 1 
ATOM   1747  C CE2 . PHE A 1 237 ? 196.811 -13.232 297.964 1.00 44.85  ?  231 PHE A CE2 1 
ATOM   1748  C CZ  . PHE A 1 237 ? 198.017 -13.586 297.392 1.00 43.71  ?  231 PHE A CZ  1 
ATOM   1749  N N   . LEU A 1 238 ? 197.218 -10.490 302.355 1.00 41.62  ?  232 LEU A N   1 
ATOM   1750  C CA  . LEU A 1 238 ? 196.975 -9.127  301.893 1.00 35.79  ?  232 LEU A CA  1 
ATOM   1751  C C   . LEU A 1 238 ? 198.135 -8.207  302.252 1.00 36.40  ?  232 LEU A C   1 
ATOM   1752  O O   . LEU A 1 238 ? 198.480 -7.306  301.478 1.00 41.80  ?  232 LEU A O   1 
ATOM   1753  C CB  . LEU A 1 238 ? 195.664 -8.597  302.473 1.00 38.33  ?  232 LEU A CB  1 
ATOM   1754  C CG  . LEU A 1 238 ? 194.389 -9.070  301.771 1.00 40.68  ?  232 LEU A CG  1 
ATOM   1755  C CD1 . LEU A 1 238 ? 193.155 -8.478  302.430 1.00 28.33  ?  232 LEU A CD1 1 
ATOM   1756  C CD2 . LEU A 1 238 ? 194.431 -8.710  300.295 1.00 32.61  ?  232 LEU A CD2 1 
ATOM   1757  N N   . ILE A 1 239 ? 198.747 -8.415  303.419 1.00 40.25  ?  233 ILE A N   1 
ATOM   1758  C CA  . ILE A 1 239 ? 199.948 -7.663  303.769 1.00 41.63  ?  233 ILE A CA  1 
ATOM   1759  C C   . ILE A 1 239 ? 201.096 -8.038  302.838 1.00 38.24  ?  233 ILE A C   1 
ATOM   1760  O O   . ILE A 1 239 ? 201.901 -7.184  302.444 1.00 36.37  ?  233 ILE A O   1 
ATOM   1761  C CB  . ILE A 1 239 ? 200.309 -7.894  305.249 1.00 40.39  ?  233 ILE A CB  1 
ATOM   1762  C CG1 . ILE A 1 239 ? 199.300 -7.197  306.165 1.00 29.67  ?  233 ILE A CG1 1 
ATOM   1763  C CG2 . ILE A 1 239 ? 201.714 -7.402  305.551 1.00 44.45  ?  233 ILE A CG2 1 
ATOM   1764  C CD1 . ILE A 1 239 ? 199.330 -5.690  306.073 1.00 40.77  ?  233 ILE A CD1 1 
ATOM   1765  N N   . GLU A 1 240 ? 201.179 -9.315  302.458 1.00 32.37  ?  234 GLU A N   1 
ATOM   1766  C CA  . GLU A 1 240 ? 202.235 -9.763  301.555 1.00 33.69  ?  234 GLU A CA  1 
ATOM   1767  C C   . GLU A 1 240 ? 202.137 -9.070  300.202 1.00 46.22  ?  234 GLU A C   1 
ATOM   1768  O O   . GLU A 1 240 ? 203.127 -8.532  299.693 1.00 48.05  ?  234 GLU A O   1 
ATOM   1769  C CB  . GLU A 1 240 ? 202.166 -11.281 301.387 1.00 39.81  ?  234 GLU A CB  1 
ATOM   1770  C CG  . GLU A 1 240 ? 203.116 -11.836 300.340 1.00 42.75  ?  234 GLU A CG  1 
ATOM   1771  C CD  . GLU A 1 240 ? 202.954 -13.331 300.145 1.00 45.82  ?  234 GLU A CD  1 
ATOM   1772  O OE1 . GLU A 1 240 ? 202.237 -13.961 300.950 1.00 35.03  ?  234 GLU A OE1 1 
ATOM   1773  O OE2 . GLU A 1 240 ? 203.540 -13.875 299.185 1.00 60.89  -1 234 GLU A OE2 1 
ATOM   1774  N N   . ILE A 1 241 ? 200.944 -9.071  299.603 1.00 44.94  ?  235 ILE A N   1 
ATOM   1775  C CA  . ILE A 1 241 ? 200.790 -8.464  298.286 1.00 37.49  ?  235 ILE A CA  1 
ATOM   1776  C C   . ILE A 1 241 ? 200.868 -6.947  298.377 1.00 41.08  ?  235 ILE A C   1 
ATOM   1777  O O   . ILE A 1 241 ? 201.289 -6.285  297.421 1.00 41.40  ?  235 ILE A O   1 
ATOM   1778  C CB  . ILE A 1 241 ? 199.477 -8.930  297.630 1.00 37.46  ?  235 ILE A CB  1 
ATOM   1779  C CG1 . ILE A 1 241 ? 198.268 -8.257  298.281 1.00 40.33  ?  235 ILE A CG1 1 
ATOM   1780  C CG2 . ILE A 1 241 ? 199.344 -10.431 297.745 1.00 45.74  ?  235 ILE A CG2 1 
ATOM   1781  C CD1 . ILE A 1 241 ? 196.952 -8.623  297.633 1.00 41.87  ?  235 ILE A CD1 1 
ATOM   1782  N N   . THR A 1 242 ? 200.478 -6.370  299.517 1.00 41.09  ?  236 THR A N   1 
ATOM   1783  C CA  . THR A 1 242 ? 200.602 -4.926  299.688 1.00 47.15  ?  236 THR A CA  1 
ATOM   1784  C C   . THR A 1 242 ? 202.060 -4.494  299.622 1.00 49.63  ?  236 THR A C   1 
ATOM   1785  O O   . THR A 1 242 ? 202.387 -3.471  299.010 1.00 43.96  ?  236 THR A O   1 
ATOM   1786  C CB  . THR A 1 242 ? 199.971 -4.495  301.013 1.00 40.95  ?  236 THR A CB  1 
ATOM   1787  O OG1 . THR A 1 242 ? 198.574 -4.816  301.007 1.00 39.23  ?  236 THR A OG1 1 
ATOM   1788  C CG2 . THR A 1 242 ? 200.140 -2.998  301.226 1.00 36.87  ?  236 THR A CG2 1 
ATOM   1789  N N   . ALA A 1 243 ? 202.954 -5.273  300.236 1.00 47.68  ?  237 ALA A N   1 
ATOM   1790  C CA  . ALA A 1 243 ? 204.378 -4.964  300.161 1.00 46.21  ?  237 ALA A CA  1 
ATOM   1791  C C   . ALA A 1 243 ? 204.907 -5.133  298.743 1.00 49.25  ?  237 ALA A C   1 
ATOM   1792  O O   . ALA A 1 243 ? 205.730 -4.334  298.282 1.00 50.48  ?  237 ALA A O   1 
ATOM   1793  C CB  . ALA A 1 243 ? 205.157 -5.846  301.136 1.00 46.60  ?  237 ALA A CB  1 
ATOM   1794  N N   . ASN A 1 244 ? 204.442 -6.165  298.032 1.00 49.15  ?  238 ASN A N   1 
ATOM   1795  C CA  . ASN A 1 244 ? 204.903 -6.388  296.665 1.00 46.61  ?  238 ASN A CA  1 
ATOM   1796  C C   . ASN A 1 244 ? 204.396 -5.301  295.724 1.00 48.74  ?  238 ASN A C   1 
ATOM   1797  O O   . ASN A 1 244 ? 205.110 -4.890  294.802 1.00 47.93  ?  238 ASN A O   1 
ATOM   1798  C CB  . ASN A 1 244 ? 204.459 -7.767  296.179 1.00 40.89  ?  238 ASN A CB  1 
ATOM   1799  C CG  . ASN A 1 244 ? 205.128 -8.896  296.938 1.00 49.29  ?  238 ASN A CG  1 
ATOM   1800  O OD1 . ASN A 1 244 ? 206.270 -8.769  297.381 1.00 54.90  ?  238 ASN A OD1 1 
ATOM   1801  N ND2 . ASN A 1 244 ? 204.420 -10.009 297.090 1.00 47.87  ?  238 ASN A ND2 1 
ATOM   1802  N N   . ILE A 1 245 ? 203.167 -4.827  295.938 1.00 52.54  ?  239 ILE A N   1 
ATOM   1803  C CA  . ILE A 1 245 ? 202.619 -3.773  295.089 1.00 50.18  ?  239 ILE A CA  1 
ATOM   1804  C C   . ILE A 1 245 ? 203.370 -2.465  295.306 1.00 43.77  ?  239 ILE A C   1 
ATOM   1805  O O   . ILE A 1 245 ? 203.677 -1.744  294.349 1.00 47.76  ?  239 ILE A O   1 
ATOM   1806  C CB  . ILE A 1 245 ? 201.109 -3.615  295.344 1.00 51.38  ?  239 ILE A CB  1 
ATOM   1807  C CG1 . ILE A 1 245 ? 200.348 -4.824  294.797 1.00 43.26  ?  239 ILE A CG1 1 
ATOM   1808  C CG2 . ILE A 1 245 ? 200.589 -2.330  294.718 1.00 44.83  ?  239 ILE A CG2 1 
ATOM   1809  C CD1 . ILE A 1 245 ? 198.878 -4.827  295.142 1.00 38.20  ?  239 ILE A CD1 1 
ATOM   1810  N N   . LEU A 1 246 ? 203.685 -2.141  296.563 1.00 43.42  ?  240 LEU A N   1 
ATOM   1811  C CA  . LEU A 1 246 ? 204.424 -0.915  296.845 1.00 54.28  ?  240 LEU A CA  1 
ATOM   1812  C C   . LEU A 1 246 ? 205.815 -0.939  296.223 1.00 59.08  ?  240 LEU A C   1 
ATOM   1813  O O   . LEU A 1 246 ? 206.323 0.106   295.798 1.00 62.84  ?  240 LEU A O   1 
ATOM   1814  C CB  . LEU A 1 246 ? 204.519 -0.697  298.356 1.00 49.07  ?  240 LEU A CB  1 
ATOM   1815  C CG  . LEU A 1 246 ? 203.219 -0.387  299.098 1.00 45.73  ?  240 LEU A CG  1 
ATOM   1816  C CD1 . LEU A 1 246 ? 203.452 -0.356  300.599 1.00 42.45  ?  240 LEU A CD1 1 
ATOM   1817  C CD2 . LEU A 1 246 ? 202.640 0.931   298.620 1.00 43.44  ?  240 LEU A CD2 1 
ATOM   1818  N N   . LYS A 1 247 ? 206.444 -2.114  296.158 1.00 51.90  ?  241 LYS A N   1 
ATOM   1819  C CA  . LYS A 1 247 ? 207.755 -2.238  295.533 1.00 51.55  ?  241 LYS A CA  1 
ATOM   1820  C C   . LYS A 1 247 ? 207.686 -2.247  294.014 1.00 50.54  ?  241 LYS A C   1 
ATOM   1821  O O   . LYS A 1 247 ? 208.701 -1.978  293.363 1.00 62.42  ?  241 LYS A O   1 
ATOM   1822  C CB  . LYS A 1 247 ? 208.452 -3.519  295.999 1.00 53.77  ?  241 LYS A CB  1 
ATOM   1823  C CG  . LYS A 1 247 ? 208.811 -3.546  297.468 1.00 54.09  ?  241 LYS A CG  1 
ATOM   1824  C CD  . LYS A 1 247 ? 209.317 -4.916  297.886 1.00 59.24  ?  241 LYS A CD  1 
ATOM   1825  C CE  . LYS A 1 247 ? 209.540 -4.987  299.388 1.00 59.70  ?  241 LYS A CE  1 
ATOM   1826  N NZ  . LYS A 1 247 ? 209.981 -6.342  299.818 1.00 60.56  1  241 LYS A NZ  1 
ATOM   1827  N N   . PHE A 1 248 ? 206.522 -2.548  293.441 1.00 52.66  ?  242 PHE A N   1 
ATOM   1828  C CA  . PHE A 1 248 ? 206.423 -2.762  292.003 1.00 60.17  ?  242 PHE A CA  1 
ATOM   1829  C C   . PHE A 1 248 ? 206.785 -1.497  291.235 1.00 62.12  ?  242 PHE A C   1 
ATOM   1830  O O   . PHE A 1 248 ? 206.212 -0.428  291.462 1.00 55.74  ?  242 PHE A O   1 
ATOM   1831  C CB  . PHE A 1 248 ? 205.011 -3.218  291.635 1.00 49.33  ?  242 PHE A CB  1 
ATOM   1832  C CG  . PHE A 1 248 ? 204.899 -3.773  290.243 1.00 48.67  ?  242 PHE A CG  1 
ATOM   1833  C CD1 . PHE A 1 248 ? 205.024 -5.133  290.015 1.00 46.63  ?  242 PHE A CD1 1 
ATOM   1834  C CD2 . PHE A 1 248 ? 204.674 -2.934  289.163 1.00 47.53  ?  242 PHE A CD2 1 
ATOM   1835  C CE1 . PHE A 1 248 ? 204.924 -5.647  288.736 1.00 44.94  ?  242 PHE A CE1 1 
ATOM   1836  C CE2 . PHE A 1 248 ? 204.573 -3.443  287.882 1.00 45.98  ?  242 PHE A CE2 1 
ATOM   1837  C CZ  . PHE A 1 248 ? 204.698 -4.802  287.669 1.00 44.03  ?  242 PHE A CZ  1 
ATOM   1838  N N   . GLN A 1 249 ? 207.742 -1.629  290.322 1.00 64.70  ?  243 GLN A N   1 
ATOM   1839  C CA  . GLN A 1 249 ? 208.167 -0.537  289.461 1.00 62.46  ?  243 GLN A CA  1 
ATOM   1840  C C   . GLN A 1 249 ? 207.571 -0.700  288.069 1.00 65.43  ?  243 GLN A C   1 
ATOM   1841  O O   . GLN A 1 249 ? 207.376 -1.816  287.581 1.00 67.14  ?  243 GLN A O   1 
ATOM   1842  C CB  . GLN A 1 249 ? 209.693 -0.476  289.365 1.00 62.04  ?  243 GLN A CB  1 
ATOM   1843  C CG  . GLN A 1 249 ? 210.390 -0.141  290.672 1.00 67.17  ?  243 GLN A CG  1 
ATOM   1844  C CD  . GLN A 1 249 ? 211.896 -0.051  290.519 1.00 69.06  ?  243 GLN A CD  1 
ATOM   1845  O OE1 . GLN A 1 249 ? 212.442 -0.338  289.453 1.00 58.65  ?  243 GLN A OE1 1 
ATOM   1846  N NE2 . GLN A 1 249 ? 212.576 0.351   291.587 1.00 70.33  ?  243 GLN A NE2 1 
ATOM   1847  N N   . ASP A 1 250 ? 207.281 0.431   287.435 1.00 65.58  ?  244 ASP A N   1 
ATOM   1848  C CA  . ASP A 1 250 ? 206.740 0.430   286.087 1.00 74.56  ?  244 ASP A CA  1 
ATOM   1849  C C   . ASP A 1 250 ? 207.872 0.338   285.065 1.00 80.72  ?  244 ASP A C   1 
ATOM   1850  O O   . ASP A 1 250 ? 209.057 0.442   285.395 1.00 84.40  ?  244 ASP A O   1 
ATOM   1851  C CB  . ASP A 1 250 ? 205.897 1.685   285.855 1.00 68.98  ?  244 ASP A CB  1 
ATOM   1852  C CG  . ASP A 1 250 ? 204.962 1.553   284.669 1.00 70.65  ?  244 ASP A CG  1 
ATOM   1853  O OD1 . ASP A 1 250 ? 204.926 0.467   284.052 1.00 73.39  ?  244 ASP A OD1 1 
ATOM   1854  O OD2 . ASP A 1 250 ? 204.263 2.538   284.354 1.00 72.21  -1 244 ASP A OD2 1 
ATOM   1855  N N   . THR A 1 251 ? 207.493 0.134   283.801 1.00 78.23  ?  245 THR A N   1 
ATOM   1856  C CA  . THR A 1 251 ? 208.480 0.041   282.732 1.00 76.53  ?  245 THR A CA  1 
ATOM   1857  C C   . THR A 1 251 ? 209.227 1.350   282.510 1.00 77.10  ?  245 THR A C   1 
ATOM   1858  O O   . THR A 1 251 ? 210.305 1.336   281.907 1.00 74.40  ?  245 THR A O   1 
ATOM   1859  C CB  . THR A 1 251 ? 207.812 -0.400  281.429 1.00 77.86  ?  245 THR A CB  1 
ATOM   1860  O OG1 . THR A 1 251 ? 206.658 0.413   281.181 1.00 84.14  ?  245 THR A OG1 1 
ATOM   1861  C CG2 . THR A 1 251 ? 207.394 -1.861  281.511 1.00 70.27  ?  245 THR A CG2 1 
ATOM   1862  N N   . ASP A 1 252 ? 208.687 2.474   282.978 1.00 76.71  ?  246 ASP A N   1 
ATOM   1863  C CA  . ASP A 1 252 ? 209.359 3.759   282.845 1.00 81.58  ?  246 ASP A CA  1 
ATOM   1864  C C   . ASP A 1 252 ? 210.309 4.052   283.998 1.00 77.16  ?  246 ASP A C   1 
ATOM   1865  O O   . ASP A 1 252 ? 210.974 5.094   283.985 1.00 77.67  ?  246 ASP A O   1 
ATOM   1866  C CB  . ASP A 1 252 ? 208.328 4.891   282.724 1.00 84.34  ?  246 ASP A CB  1 
ATOM   1867  C CG  . ASP A 1 252 ? 207.885 5.430   284.073 1.00 78.15  ?  246 ASP A CG  1 
ATOM   1868  O OD1 . ASP A 1 252 ? 207.543 4.623   284.963 1.00 72.00  ?  246 ASP A OD1 1 
ATOM   1869  O OD2 . ASP A 1 252 ? 207.885 6.668   284.242 1.00 82.78  -1 246 ASP A OD2 1 
ATOM   1870  N N   . GLY A 1 253 ? 210.390 3.165   284.992 1.00 69.88  ?  247 GLY A N   1 
ATOM   1871  C CA  . GLY A 1 253 ? 211.264 3.325   286.129 1.00 65.82  ?  247 GLY A CA  1 
ATOM   1872  C C   . GLY A 1 253 ? 210.564 3.780   287.395 1.00 71.51  ?  247 GLY A C   1 
ATOM   1873  O O   . GLY A 1 253 ? 211.022 3.452   288.496 1.00 74.60  ?  247 GLY A O   1 
ATOM   1874  N N   . LYS A 1 254 ? 209.470 4.525   287.266 1.00 69.83  ?  248 LYS A N   1 
ATOM   1875  C CA  . LYS A 1 254 ? 208.736 5.016   288.421 1.00 70.23  ?  248 LYS A CA  1 
ATOM   1876  C C   . LYS A 1 254 ? 207.865 3.911   289.018 1.00 65.22  ?  248 LYS A C   1 
ATOM   1877  O O   . LYS A 1 254 ? 207.669 2.844   288.429 1.00 59.79  ?  248 LYS A O   1 
ATOM   1878  C CB  . LYS A 1 254 ? 207.872 6.215   288.034 1.00 66.83  ?  248 LYS A CB  1 
ATOM   1879  C CG  . LYS A 1 254 ? 208.652 7.475   287.701 1.00 69.39  ?  248 LYS A CG  1 
ATOM   1880  C CD  . LYS A 1 254 ? 207.757 8.503   287.026 1.00 76.47  ?  248 LYS A CD  1 
ATOM   1881  C CE  . LYS A 1 254 ? 208.380 9.889   287.053 1.00 81.25  ?  248 LYS A CE  1 
ATOM   1882  N NZ  . LYS A 1 254 ? 208.427 10.440  288.436 1.00 81.73  1  248 LYS A NZ  1 
ATOM   1883  N N   . HIS A 1 255 ? 207.338 4.182   290.209 1.00 66.22  ?  249 HIS A N   1 
ATOM   1884  C CA  . HIS A 1 255 ? 206.415 3.254   290.845 1.00 58.82  ?  249 HIS A CA  1 
ATOM   1885  C C   . HIS A 1 255 ? 205.047 3.323   290.174 1.00 48.42  ?  249 HIS A C   1 
ATOM   1886  O O   . HIS A 1 255 ? 204.613 4.376   289.699 1.00 41.03  ?  249 HIS A O   1 
ATOM   1887  C CB  . HIS A 1 255 ? 206.284 3.560   292.338 1.00 63.27  ?  249 HIS A CB  1 
ATOM   1888  C CG  . HIS A 1 255 ? 207.536 3.309   293.120 1.00 66.86  ?  249 HIS A CG  1 
ATOM   1889  N ND1 . HIS A 1 255 ? 208.512 4.267   293.293 1.00 63.80  ?  249 HIS A ND1 1 
ATOM   1890  C CD2 . HIS A 1 255 ? 207.971 2.207   293.776 1.00 59.61  ?  249 HIS A CD2 1 
ATOM   1891  C CE1 . HIS A 1 255 ? 209.493 3.767   294.022 1.00 64.94  ?  249 HIS A CE1 1 
ATOM   1892  N NE2 . HIS A 1 255 ? 209.190 2.518   294.328 1.00 62.84  ?  249 HIS A NE2 1 
ATOM   1893  N N   . LEU A 1 256 ? 204.365 2.177   290.141 1.00 49.07  ?  250 LEU A N   1 
ATOM   1894  C CA  . LEU A 1 256 ? 203.095 2.083   289.430 1.00 44.64  ?  250 LEU A CA  1 
ATOM   1895  C C   . LEU A 1 256 ? 201.921 2.582   290.263 1.00 38.65  ?  250 LEU A C   1 
ATOM   1896  O O   . LEU A 1 256 ? 200.970 3.143   289.707 1.00 41.45  ?  250 LEU A O   1 
ATOM   1897  C CB  . LEU A 1 256 ? 202.849 0.637   288.993 1.00 43.15  ?  250 LEU A CB  1 
ATOM   1898  C CG  . LEU A 1 256 ? 201.554 0.339   288.234 1.00 38.85  ?  250 LEU A CG  1 
ATOM   1899  C CD1 . LEU A 1 256 ? 201.488 1.143   286.944 1.00 42.11  ?  250 LEU A CD1 1 
ATOM   1900  C CD2 . LEU A 1 256 ? 201.428 -1.149  287.950 1.00 40.28  ?  250 LEU A CD2 1 
ATOM   1901  N N   . LEU A 1 257 ? 201.970 2.397   291.583 1.00 39.30  ?  251 LEU A N   1 
ATOM   1902  C CA  . LEU A 1 257 ? 200.826 2.739   292.427 1.00 37.66  ?  251 LEU A CA  1 
ATOM   1903  C C   . LEU A 1 257 ? 200.428 4.209   292.338 1.00 40.33  ?  251 LEU A C   1 
ATOM   1904  O O   . LEU A 1 257 ? 199.230 4.484   292.145 1.00 46.72  ?  251 LEU A O   1 
ATOM   1905  C CB  . LEU A 1 257 ? 201.113 2.314   293.873 1.00 35.21  ?  251 LEU A CB  1 
ATOM   1906  C CG  . LEU A 1 257 ? 199.981 2.400   294.902 1.00 46.60  ?  251 LEU A CG  1 
ATOM   1907  C CD1 . LEU A 1 257 ? 200.159 1.316   295.947 1.00 47.10  ?  251 LEU A CD1 1 
ATOM   1908  C CD2 . LEU A 1 257 ? 199.928 3.766   295.575 1.00 45.50  ?  251 LEU A CD2 1 
ATOM   1909  N N   . PRO A 1 258 ? 201.333 5.188   292.469 1.00 38.39  ?  252 PRO A N   1 
ATOM   1910  C CA  . PRO A 1 258 ? 200.896 6.594   292.390 1.00 41.93  ?  252 PRO A CA  1 
ATOM   1911  C C   . PRO A 1 258 ? 200.293 6.981   291.048 1.00 38.20  ?  252 PRO A C   1 
ATOM   1912  O O   . PRO A 1 258 ? 199.702 8.065   290.950 1.00 37.02  ?  252 PRO A O   1 
ATOM   1913  C CB  . PRO A 1 258 ? 202.183 7.383   292.667 1.00 38.64  ?  252 PRO A CB  1 
ATOM   1914  C CG  . PRO A 1 258 ? 203.054 6.435   293.409 1.00 44.25  ?  252 PRO A CG  1 
ATOM   1915  C CD  . PRO A 1 258 ? 202.766 5.096   292.804 1.00 46.46  ?  252 PRO A CD  1 
ATOM   1916  N N   . LYS A 1 259 ? 200.422 6.143   290.019 1.00 37.70  ?  253 LYS A N   1 
ATOM   1917  C CA  . LYS A 1 259 ? 199.796 6.405   288.731 1.00 43.00  ?  253 LYS A CA  1 
ATOM   1918  C C   . LYS A 1 259 ? 198.359 5.908   288.658 1.00 43.58  ?  253 LYS A C   1 
ATOM   1919  O O   . LYS A 1 259 ? 197.607 6.351   287.782 1.00 42.14  ?  253 LYS A O   1 
ATOM   1920  C CB  . LYS A 1 259 ? 200.607 5.756   287.605 1.00 41.54  ?  253 LYS A CB  1 
ATOM   1921  C CG  . LYS A 1 259 ? 202.061 6.189   287.550 1.00 39.78  ?  253 LYS A CG  1 
ATOM   1922  C CD  . LYS A 1 259 ? 202.803 5.472   286.433 1.00 47.03  ?  253 LYS A CD  1 
ATOM   1923  C CE  . LYS A 1 259 ? 204.265 5.879   286.388 1.00 55.43  ?  253 LYS A CE  1 
ATOM   1924  N NZ  . LYS A 1 259 ? 204.426 7.343   286.169 1.00 57.92  1  253 LYS A NZ  1 
ATOM   1925  N N   . ILE A 1 260 ? 197.964 5.004   289.549 1.00 41.51  ?  254 ILE A N   1 
ATOM   1926  C CA  . ILE A 1 260 ? 196.622 4.435   289.533 1.00 45.61  ?  254 ILE A CA  1 
ATOM   1927  C C   . ILE A 1 260 ? 195.653 5.408   290.187 1.00 45.48  ?  254 ILE A C   1 
ATOM   1928  O O   . ILE A 1 260 ? 195.962 6.021   291.216 1.00 42.24  ?  254 ILE A O   1 
ATOM   1929  C CB  . ILE A 1 260 ? 196.612 3.070   290.244 1.00 41.95  ?  254 ILE A CB  1 
ATOM   1930  C CG1 . ILE A 1 260 ? 197.697 2.162   289.660 1.00 41.96  ?  254 ILE A CG1 1 
ATOM   1931  C CG2 . ILE A 1 260 ? 195.243 2.417   290.136 1.00 37.78  ?  254 ILE A CG2 1 
ATOM   1932  C CD1 . ILE A 1 260 ? 197.780 0.803   290.320 1.00 42.23  ?  254 ILE A CD1 1 
ATOM   1933  N N   . ARG A 1 261 ? 194.472 5.557   289.591 1.00 48.70  ?  255 ARG A N   1 
ATOM   1934  C CA  . ARG A 1 261 ? 193.466 6.450   290.143 1.00 48.46  ?  255 ARG A CA  1 
ATOM   1935  C C   . ARG A 1 261 ? 192.798 5.816   291.358 1.00 41.14  ?  255 ARG A C   1 
ATOM   1936  O O   . ARG A 1 261 ? 192.724 4.591   291.487 1.00 41.70  ?  255 ARG A O   1 
ATOM   1937  C CB  . ARG A 1 261 ? 192.417 6.809   289.090 1.00 43.14  ?  255 ARG A CB  1 
ATOM   1938  C CG  . ARG A 1 261 ? 191.563 5.647   288.627 1.00 52.05  ?  255 ARG A CG  1 
ATOM   1939  C CD  . ARG A 1 261 ? 190.518 6.107   287.622 1.00 55.84  ?  255 ARG A CD  1 
ATOM   1940  N NE  . ARG A 1 261 ? 189.618 7.115   288.174 1.00 51.01  ?  255 ARG A NE  1 
ATOM   1941  C CZ  . ARG A 1 261 ? 188.548 7.582   287.540 1.00 45.02  ?  255 ARG A CZ  1 
ATOM   1942  N NH1 . ARG A 1 261 ? 188.242 7.127   286.332 1.00 52.69  1  255 ARG A NH1 1 
ATOM   1943  N NH2 . ARG A 1 261 ? 187.782 8.500   288.114 1.00 36.15  ?  255 ARG A NH2 1 
ATOM   1944  N N   . ASP A 1 262 ? 192.306 6.671   292.250 1.00 41.97  ?  256 ASP A N   1 
ATOM   1945  C CA  . ASP A 1 262 ? 191.788 6.235   293.546 1.00 40.41  ?  256 ASP A CA  1 
ATOM   1946  C C   . ASP A 1 262 ? 190.262 6.153   293.504 1.00 42.57  ?  256 ASP A C   1 
ATOM   1947  O O   . ASP A 1 262 ? 189.542 6.919   294.146 1.00 48.29  ?  256 ASP A O   1 
ATOM   1948  C CB  . ASP A 1 262 ? 192.271 7.177   294.643 1.00 41.60  ?  256 ASP A CB  1 
ATOM   1949  C CG  . ASP A 1 262 ? 192.247 8.632   294.212 1.00 47.21  ?  256 ASP A CG  1 
ATOM   1950  O OD1 . ASP A 1 262 ? 192.525 8.905   293.025 1.00 43.17  ?  256 ASP A OD1 1 
ATOM   1951  O OD2 . ASP A 1 262 ? 191.949 9.502   295.058 1.00 48.16  -1 256 ASP A OD2 1 
ATOM   1952  N N   . SER A 1 263 ? 189.776 5.186   292.730 1.00 43.11  ?  257 SER A N   1 
ATOM   1953  C CA  . SER A 1 263 ? 188.345 4.905   292.612 1.00 43.67  ?  257 SER A CA  1 
ATOM   1954  C C   . SER A 1 263 ? 188.155 3.402   292.790 1.00 45.28  ?  257 SER A C   1 
ATOM   1955  O O   . SER A 1 263 ? 188.419 2.623   291.870 1.00 36.60  ?  257 SER A O   1 
ATOM   1956  C CB  . SER A 1 263 ? 187.793 5.384   291.274 1.00 45.94  ?  257 SER A CB  1 
ATOM   1957  O OG  . SER A 1 263 ? 186.398 5.151   291.183 1.00 49.20  ?  257 SER A OG  1 
ATOM   1958  N N   . ALA A 1 264 ? 187.692 2.999   293.971 1.00 41.25  ?  258 ALA A N   1 
ATOM   1959  C CA  . ALA A 1 264 ? 187.584 1.590   294.327 1.00 41.85  ?  258 ALA A CA  1 
ATOM   1960  C C   . ALA A 1 264 ? 186.263 1.024   293.819 1.00 47.61  ?  258 ALA A C   1 
ATOM   1961  O O   . ALA A 1 264 ? 185.188 1.455   294.252 1.00 51.27  ?  258 ALA A O   1 
ATOM   1962  C CB  . ALA A 1 264 ? 187.701 1.410   295.840 1.00 40.02  ?  258 ALA A CB  1 
ATOM   1963  N N   . GLY A 1 265 ? 186.347 0.056   292.904 1.00 37.44  ?  259 GLY A N   1 
ATOM   1964  C CA  . GLY A 1 265 ? 185.164 -0.617  292.416 1.00 36.99  ?  259 GLY A CA  1 
ATOM   1965  C C   . GLY A 1 265 ? 184.735 -1.758  293.319 1.00 47.12  ?  259 GLY A C   1 
ATOM   1966  O O   . GLY A 1 265 ? 185.432 -2.149  294.255 1.00 44.59  ?  259 GLY A O   1 
ATOM   1967  N N   . GLN A 1 266 ? 183.556 -2.301  293.022 1.00 54.22  ?  260 GLN A N   1 
ATOM   1968  C CA  . GLN A 1 266 ? 182.991 -3.380  293.820 1.00 48.17  ?  260 GLN A CA  1 
ATOM   1969  C C   . GLN A 1 266 ? 181.936 -4.107  292.997 1.00 50.86  ?  260 GLN A C   1 
ATOM   1970  O O   . GLN A 1 266 ? 181.225 -3.484  292.204 1.00 52.68  ?  260 GLN A O   1 
ATOM   1971  C CB  . GLN A 1 266 ? 182.388 -2.846  295.125 1.00 41.28  ?  260 GLN A CB  1 
ATOM   1972  C CG  . GLN A 1 266 ? 181.320 -1.784  294.934 1.00 44.93  ?  260 GLN A CG  1 
ATOM   1973  C CD  . GLN A 1 266 ? 181.105 -0.949  296.180 1.00 51.81  ?  260 GLN A CD  1 
ATOM   1974  O OE1 . GLN A 1 266 ? 180.234 -1.243  296.999 1.00 53.89  ?  260 GLN A OE1 1 
ATOM   1975  N NE2 . GLN A 1 266 ? 181.903 0.102   296.330 1.00 49.89  ?  260 GLN A NE2 1 
ATOM   1976  N N   . LYS A 1 267 ? 181.841 -5.422  293.193 1.00 48.91  ?  261 LYS A N   1 
ATOM   1977  C CA  . LYS A 1 267 ? 180.925 -6.258  292.430 1.00 42.49  ?  261 LYS A CA  1 
ATOM   1978  C C   . LYS A 1 267 ? 179.686 -6.677  293.212 1.00 49.09  ?  261 LYS A C   1 
ATOM   1979  O O   . LYS A 1 267 ? 178.835 -7.379  292.658 1.00 52.05  ?  261 LYS A O   1 
ATOM   1980  C CB  . LYS A 1 267 ? 181.647 -7.506  291.910 1.00 49.40  ?  261 LYS A CB  1 
ATOM   1981  C CG  . LYS A 1 267 ? 182.323 -7.316  290.562 1.00 50.13  ?  261 LYS A CG  1 
ATOM   1982  C CD  . LYS A 1 267 ? 182.437 -8.639  289.818 1.00 71.00  ?  261 LYS A CD  1 
ATOM   1983  C CE  . LYS A 1 267 ? 181.065 -9.263  289.596 1.00 64.07  ?  261 LYS A CE  1 
ATOM   1984  N NZ  . LYS A 1 267 ? 181.142 -10.571 288.887 1.00 44.00  1  261 LYS A NZ  1 
ATOM   1985  N N   . GLY A 1 268 ? 179.561 -6.282  294.477 1.00 43.63  ?  262 GLY A N   1 
ATOM   1986  C CA  . GLY A 1 268 ? 178.311 -6.507  295.178 1.00 46.89  ?  262 GLY A CA  1 
ATOM   1987  C C   . GLY A 1 268 ? 178.396 -7.135  296.554 1.00 41.30  ?  262 GLY A C   1 
ATOM   1988  O O   . GLY A 1 268 ? 177.675 -6.720  297.466 1.00 38.88  ?  262 GLY A O   1 
ATOM   1989  N N   . THR A 1 269 ? 179.261 -8.139  296.725 1.00 42.05  ?  263 THR A N   1 
ATOM   1990  C CA  . THR A 1 269 ? 179.299 -8.872  297.987 1.00 42.22  ?  263 THR A CA  1 
ATOM   1991  C C   . THR A 1 269 ? 179.690 -7.992  299.168 1.00 37.87  ?  263 THR A C   1 
ATOM   1992  O O   . THR A 1 269 ? 179.451 -8.377  300.318 1.00 36.70  ?  263 THR A O   1 
ATOM   1993  C CB  . THR A 1 269 ? 180.257 -10.059 297.885 1.00 38.50  ?  263 THR A CB  1 
ATOM   1994  O OG1 . THR A 1 269 ? 181.512 -9.622  297.346 1.00 43.11  ?  263 THR A OG1 1 
ATOM   1995  C CG2 . THR A 1 269 ? 179.669 -11.143 296.991 1.00 34.47  ?  263 THR A CG2 1 
ATOM   1996  N N   . GLY A 1 270 ? 180.278 -6.826  298.918 1.00 37.06  ?  264 GLY A N   1 
ATOM   1997  C CA  . GLY A 1 270 ? 180.584 -5.901  299.990 1.00 36.04  ?  264 GLY A CA  1 
ATOM   1998  C C   . GLY A 1 270 ? 179.339 -5.271  300.580 1.00 39.55  ?  264 GLY A C   1 
ATOM   1999  O O   . GLY A 1 270 ? 179.101 -5.365  301.788 1.00 35.76  ?  264 GLY A O   1 
ATOM   2000  N N   . LYS A 1 271 ? 178.532 -4.628  299.732 1.00 41.92  ?  265 LYS A N   1 
ATOM   2001  C CA  . LYS A 1 271 ? 177.308 -4.000  300.218 1.00 33.32  ?  265 LYS A CA  1 
ATOM   2002  C C   . LYS A 1 271 ? 176.302 -5.034  300.708 1.00 34.03  ?  265 LYS A C   1 
ATOM   2003  O O   . LYS A 1 271 ? 175.561 -4.767  301.661 1.00 33.69  ?  265 LYS A O   1 
ATOM   2004  C CB  . LYS A 1 271 ? 176.691 -3.127  299.123 1.00 37.17  ?  265 LYS A CB  1 
ATOM   2005  C CG  . LYS A 1 271 ? 176.364 -3.869  297.836 1.00 45.34  ?  265 LYS A CG  1 
ATOM   2006  C CD  . LYS A 1 271 ? 175.764 -2.945  296.786 1.00 47.00  ?  265 LYS A CD  1 
ATOM   2007  C CE  . LYS A 1 271 ? 175.463 -3.703  295.501 1.00 51.41  ?  265 LYS A CE  1 
ATOM   2008  N NZ  . LYS A 1 271 ? 174.843 -2.832  294.464 1.00 47.78  1  265 LYS A NZ  1 
ATOM   2009  N N   . TRP A 1 272 ? 176.268 -6.215  300.084 1.00 39.79  ?  266 TRP A N   1 
ATOM   2010  C CA  . TRP A 1 272 ? 175.337 -7.256  300.512 1.00 32.77  ?  266 TRP A CA  1 
ATOM   2011  C C   . TRP A 1 272 ? 175.587 -7.659  301.958 1.00 31.11  ?  266 TRP A C   1 
ATOM   2012  O O   . TRP A 1 272 ? 174.645 -7.968  302.697 1.00 35.31  ?  266 TRP A O   1 
ATOM   2013  C CB  . TRP A 1 272 ? 175.448 -8.473  299.595 1.00 35.70  ?  266 TRP A CB  1 
ATOM   2014  C CG  . TRP A 1 272 ? 175.066 -8.208  298.171 1.00 36.99  ?  266 TRP A CG  1 
ATOM   2015  C CD1 . TRP A 1 272 ? 174.452 -7.093  297.678 1.00 33.20  ?  266 TRP A CD1 1 
ATOM   2016  C CD2 . TRP A 1 272 ? 175.280 -9.076  297.052 1.00 39.72  ?  266 TRP A CD2 1 
ATOM   2017  N NE1 . TRP A 1 272 ? 174.268 -7.215  296.322 1.00 40.80  ?  266 TRP A NE1 1 
ATOM   2018  C CE2 . TRP A 1 272 ? 174.768 -8.424  295.913 1.00 45.97  ?  266 TRP A CE2 1 
ATOM   2019  C CE3 . TRP A 1 272 ? 175.854 -10.343 296.904 1.00 35.01  ?  266 TRP A CE3 1 
ATOM   2020  C CZ2 . TRP A 1 272 ? 174.813 -8.995  294.643 1.00 48.96  ?  266 TRP A CZ2 1 
ATOM   2021  C CZ3 . TRP A 1 272 ? 175.898 -10.908 295.643 1.00 32.44  ?  266 TRP A CZ3 1 
ATOM   2022  C CH2 . TRP A 1 272 ? 175.381 -10.235 294.529 1.00 42.46  ?  266 TRP A CH2 1 
ATOM   2023  N N   . THR A 1 273 ? 176.854 -7.664  302.380 1.00 36.90  ?  267 THR A N   1 
ATOM   2024  C CA  . THR A 1 273 ? 177.168 -7.980  303.769 1.00 32.64  ?  267 THR A CA  1 
ATOM   2025  C C   . THR A 1 273 ? 176.677 -6.884  304.707 1.00 29.88  ?  267 THR A C   1 
ATOM   2026  O O   . THR A 1 273 ? 176.086 -7.174  305.754 1.00 31.09  ?  267 THR A O   1 
ATOM   2027  C CB  . THR A 1 273 ? 178.673 -8.189  303.934 1.00 31.21  ?  267 THR A CB  1 
ATOM   2028  O OG1 . THR A 1 273 ? 179.130 -9.164  302.989 1.00 29.98  ?  267 THR A OG1 1 
ATOM   2029  C CG2 . THR A 1 273 ? 178.992 -8.671  305.341 1.00 33.72  ?  267 THR A CG2 1 
ATOM   2030  N N   . ALA A 1 274 ? 176.909 -5.620  304.346 1.00 30.08  ?  268 ALA A N   1 
ATOM   2031  C CA  . ALA A 1 274 ? 176.448 -4.517  305.182 1.00 29.28  ?  268 ALA A CA  1 
ATOM   2032  C C   . ALA A 1 274 ? 174.930 -4.395  305.166 1.00 31.05  ?  268 ALA A C   1 
ATOM   2033  O O   . ALA A 1 274 ? 174.330 -4.013  306.178 1.00 26.71  ?  268 ALA A O   1 
ATOM   2034  C CB  . ALA A 1 274 ? 177.094 -3.209  304.729 1.00 22.87  ?  268 ALA A CB  1 
ATOM   2035  N N   . ILE A 1 275 ? 174.293 -4.708  304.035 1.00 30.17  ?  269 ILE A N   1 
ATOM   2036  C CA  . ILE A 1 275 ? 172.834 -4.706  303.983 1.00 28.24  ?  269 ILE A CA  1 
ATOM   2037  C C   . ILE A 1 275 ? 172.270 -5.810  304.870 1.00 33.32  ?  269 ILE A C   1 
ATOM   2038  O O   . ILE A 1 275 ? 171.283 -5.606  305.587 1.00 34.55  ?  269 ILE A O   1 
ATOM   2039  C CB  . ILE A 1 275 ? 172.350 -4.841  302.528 1.00 21.41  ?  269 ILE A CB  1 
ATOM   2040  C CG1 . ILE A 1 275 ? 172.653 -3.564  301.743 1.00 22.97  ?  269 ILE A CG1 1 
ATOM   2041  C CG2 . ILE A 1 275 ? 170.861 -5.151  302.479 1.00 23.75  ?  269 ILE A CG2 1 
ATOM   2042  C CD1 . ILE A 1 275 ? 172.280 -3.645  300.280 1.00 26.80  ?  269 ILE A CD1 1 
ATOM   2043  N N   . SER A 1 276 ? 172.893 -6.991  304.846 1.00 30.16  ?  270 SER A N   1 
ATOM   2044  C CA  . SER A 1 276 ? 172.438 -8.088  305.694 1.00 32.49  ?  270 SER A CA  1 
ATOM   2045  C C   . SER A 1 276 ? 172.584 -7.743  307.170 1.00 35.85  ?  270 SER A C   1 
ATOM   2046  O O   . SER A 1 276 ? 171.747 -8.132  307.993 1.00 43.17  ?  270 SER A O   1 
ATOM   2047  C CB  . SER A 1 276 ? 173.212 -9.363  305.363 1.00 38.04  ?  270 SER A CB  1 
ATOM   2048  O OG  . SER A 1 276 ? 172.900 -10.401 306.276 1.00 39.67  ?  270 SER A OG  1 
ATOM   2049  N N   . ALA A 1 277 ? 173.643 -7.012  307.526 1.00 33.23  ?  271 ALA A N   1 
ATOM   2050  C CA  . ALA A 1 277 ? 173.836 -6.624  308.919 1.00 34.49  ?  271 ALA A CA  1 
ATOM   2051  C C   . ALA A 1 277 ? 172.746 -5.667  309.381 1.00 33.21  ?  271 ALA A C   1 
ATOM   2052  O O   . ALA A 1 277 ? 172.224 -5.802  310.494 1.00 39.14  ?  271 ALA A O   1 
ATOM   2053  C CB  . ALA A 1 277 ? 175.215 -5.993  309.101 1.00 31.42  ?  271 ALA A CB  1 
ATOM   2054  N N   . LEU A 1 278 ? 172.387 -4.695  308.540 1.00 31.35  ?  272 LEU A N   1 
ATOM   2055  C CA  . LEU A 1 278 ? 171.346 -3.742  308.909 1.00 29.97  ?  272 LEU A CA  1 
ATOM   2056  C C   . LEU A 1 278 ? 169.989 -4.423  309.030 1.00 35.83  ?  272 LEU A C   1 
ATOM   2057  O O   . LEU A 1 278 ? 169.206 -4.101  309.932 1.00 37.85  ?  272 LEU A O   1 
ATOM   2058  C CB  . LEU A 1 278 ? 171.293 -2.608  307.886 1.00 34.62  ?  272 LEU A CB  1 
ATOM   2059  C CG  . LEU A 1 278 ? 172.523 -1.702  307.817 1.00 26.88  ?  272 LEU A CG  1 
ATOM   2060  C CD1 . LEU A 1 278 ? 172.507 -0.876  306.545 1.00 30.08  ?  272 LEU A CD1 1 
ATOM   2061  C CD2 . LEU A 1 278 ? 172.578 -0.795  309.031 1.00 28.75  ?  272 LEU A CD2 1 
ATOM   2062  N N   . GLU A 1 279 ? 169.696 -5.372  308.137 1.00 39.83  ?  273 GLU A N   1 
ATOM   2063  C CA  . GLU A 1 279 ? 168.404 -6.053  308.164 1.00 36.08  ?  273 GLU A CA  1 
ATOM   2064  C C   . GLU A 1 279 ? 168.198 -6.799  309.477 1.00 37.48  ?  273 GLU A C   1 
ATOM   2065  O O   . GLU A 1 279 ? 167.147 -6.676  310.117 1.00 50.21  ?  273 GLU A O   1 
ATOM   2066  C CB  . GLU A 1 279 ? 168.293 -7.016  306.981 1.00 35.40  ?  273 GLU A CB  1 
ATOM   2067  C CG  . GLU A 1 279 ? 168.145 -6.341  305.627 1.00 39.40  ?  273 GLU A CG  1 
ATOM   2068  C CD  . GLU A 1 279 ? 168.115 -7.338  304.483 1.00 41.75  ?  273 GLU A CD  1 
ATOM   2069  O OE1 . GLU A 1 279 ? 168.422 -8.525  304.720 1.00 47.69  ?  273 GLU A OE1 1 
ATOM   2070  O OE2 . GLU A 1 279 ? 167.783 -6.935  303.349 1.00 50.01  -1 273 GLU A OE2 1 
ATOM   2071  N N   . TYR A 1 280 ? 169.192 -7.578  309.896 1.00 37.19  ?  274 TYR A N   1 
ATOM   2072  C CA  . TYR A 1 280 ? 169.083 -8.410  311.086 1.00 40.23  ?  274 TYR A CA  1 
ATOM   2073  C C   . TYR A 1 280 ? 169.623 -7.728  312.338 1.00 46.78  ?  274 TYR A C   1 
ATOM   2074  O O   . TYR A 1 280 ? 169.709 -8.370  313.390 1.00 51.55  ?  274 TYR A O   1 
ATOM   2075  C CB  . TYR A 1 280 ? 169.799 -9.742  310.857 1.00 44.97  ?  274 TYR A CB  1 
ATOM   2076  C CG  . TYR A 1 280 ? 169.233 -10.523 309.694 1.00 53.11  ?  274 TYR A CG  1 
ATOM   2077  C CD1 . TYR A 1 280 ? 167.875 -10.484 309.404 1.00 53.37  ?  274 TYR A CD1 1 
ATOM   2078  C CD2 . TYR A 1 280 ? 170.055 -11.287 308.875 1.00 52.68  ?  274 TYR A CD2 1 
ATOM   2079  C CE1 . TYR A 1 280 ? 167.350 -11.189 308.342 1.00 54.35  ?  274 TYR A CE1 1 
ATOM   2080  C CE2 . TYR A 1 280 ? 169.538 -11.996 307.808 1.00 56.26  ?  274 TYR A CE2 1 
ATOM   2081  C CZ  . TYR A 1 280 ? 168.185 -11.943 307.546 1.00 62.50  ?  274 TYR A CZ  1 
ATOM   2082  O OH  . TYR A 1 280 ? 167.660 -12.644 306.486 1.00 71.38  ?  274 TYR A OH  1 
ATOM   2083  N N   . GLY A 1 281 ? 169.985 -6.450  312.248 1.00 38.93  ?  275 GLY A N   1 
ATOM   2084  C CA  . GLY A 1 281 ? 170.383 -5.682  313.410 1.00 41.39  ?  275 GLY A CA  1 
ATOM   2085  C C   . GLY A 1 281 ? 171.664 -6.142  314.076 1.00 42.76  ?  275 GLY A C   1 
ATOM   2086  O O   . GLY A 1 281 ? 171.717 -6.266  315.303 1.00 46.68  ?  275 GLY A O   1 
ATOM   2087  N N   . VAL A 1 282 ? 172.696 -6.397  313.287 1.00 40.54  ?  276 VAL A N   1 
ATOM   2088  C CA  . VAL A 1 282 ? 174.015 -6.779  313.789 1.00 38.10  ?  276 VAL A CA  1 
ATOM   2089  C C   . VAL A 1 282 ? 174.959 -5.606  313.568 1.00 35.73  ?  276 VAL A C   1 
ATOM   2090  O O   . VAL A 1 282 ? 175.086 -5.136  312.431 1.00 33.33  ?  276 VAL A O   1 
ATOM   2091  C CB  . VAL A 1 282 ? 174.552 -8.044  313.093 1.00 36.95  ?  276 VAL A CB  1 
ATOM   2092  C CG1 . VAL A 1 282 ? 175.867 -8.469  313.719 1.00 32.95  ?  276 VAL A CG1 1 
ATOM   2093  C CG2 . VAL A 1 282 ? 173.532 -9.162  313.177 1.00 39.12  ?  276 VAL A CG2 1 
ATOM   2094  N N   . PRO A 1 283 ? 175.631 -5.107  314.605 1.00 35.15  ?  277 PRO A N   1 
ATOM   2095  C CA  . PRO A 1 283 ? 176.498 -3.918  314.454 1.00 33.56  ?  277 PRO A CA  1 
ATOM   2096  C C   . PRO A 1 283 ? 177.813 -4.230  313.748 1.00 31.32  ?  277 PRO A C   1 
ATOM   2097  O O   . PRO A 1 283 ? 178.911 -4.143  314.309 1.00 31.91  ?  277 PRO A O   1 
ATOM   2098  C CB  . PRO A 1 283 ? 176.697 -3.473  315.906 1.00 33.54  ?  277 PRO A CB  1 
ATOM   2099  C CG  . PRO A 1 283 ? 176.620 -4.738  316.688 1.00 31.89  ?  277 PRO A CG  1 
ATOM   2100  C CD  . PRO A 1 283 ? 175.592 -5.591  315.996 1.00 33.36  ?  277 PRO A CD  1 
ATOM   2101  N N   . VAL A 1 284 ? 177.710 -4.608  312.474 1.00 28.56  ?  278 VAL A N   1 
ATOM   2102  C CA  . VAL A 1 284 ? 178.886 -4.814  311.637 1.00 24.57  ?  278 VAL A CA  1 
ATOM   2103  C C   . VAL A 1 284 ? 179.296 -3.460  311.075 1.00 31.25  ?  278 VAL A C   1 
ATOM   2104  O O   . VAL A 1 284 ? 179.001 -3.135  309.919 1.00 38.54  ?  278 VAL A O   1 
ATOM   2105  C CB  . VAL A 1 284 ? 178.612 -5.839  310.521 1.00 24.60  ?  278 VAL A CB  1 
ATOM   2106  C CG1 . VAL A 1 284 ? 179.885 -6.153  309.758 1.00 30.94  ?  278 VAL A CG1 1 
ATOM   2107  C CG2 . VAL A 1 284 ? 178.023 -7.110  311.107 1.00 30.18  ?  278 VAL A CG2 1 
ATOM   2108  N N   . THR A 1 285 ? 179.973 -2.658  311.898 1.00 36.37  ?  279 THR A N   1 
ATOM   2109  C CA  . THR A 1 285 ? 180.233 -1.267  311.545 1.00 37.95  ?  279 THR A CA  1 
ATOM   2110  C C   . THR A 1 285 ? 181.440 -1.126  310.625 1.00 38.20  ?  279 THR A C   1 
ATOM   2111  O O   . THR A 1 285 ? 181.406 -0.335  309.675 1.00 40.95  ?  279 THR A O   1 
ATOM   2112  C CB  . THR A 1 285 ? 180.442 -0.438  312.812 1.00 36.20  ?  279 THR A CB  1 
ATOM   2113  O OG1 . THR A 1 285 ? 181.693 -0.792  313.413 1.00 30.81  ?  279 THR A OG1 1 
ATOM   2114  C CG2 . THR A 1 285 ? 179.324 -0.700  313.806 1.00 29.88  ?  279 THR A CG2 1 
ATOM   2115  N N   . LEU A 1 286 ? 182.512 -1.875  310.894 1.00 32.98  ?  280 LEU A N   1 
ATOM   2116  C CA  . LEU A 1 286 ? 183.743 -1.710  310.126 1.00 31.97  ?  280 LEU A CA  1 
ATOM   2117  C C   . LEU A 1 286 ? 183.533 -2.066  308.660 1.00 33.55  ?  280 LEU A C   1 
ATOM   2118  O O   . LEU A 1 286 ? 184.001 -1.350  307.767 1.00 30.75  ?  280 LEU A O   1 
ATOM   2119  C CB  . LEU A 1 286 ? 184.859 -2.560  310.737 1.00 35.31  ?  280 LEU A CB  1 
ATOM   2120  C CG  . LEU A 1 286 ? 186.298 -2.279  310.290 1.00 36.78  ?  280 LEU A CG  1 
ATOM   2121  C CD1 . LEU A 1 286 ? 187.265 -2.560  311.428 1.00 32.88  ?  280 LEU A CD1 1 
ATOM   2122  C CD2 . LEU A 1 286 ? 186.676 -3.100  309.065 1.00 30.56  ?  280 LEU A CD2 1 
ATOM   2123  N N   . ILE A 1 287 ? 182.833 -3.170  308.393 1.00 39.64  ?  281 ILE A N   1 
ATOM   2124  C CA  . ILE A 1 287 ? 182.559 -3.560  307.013 1.00 34.49  ?  281 ILE A CA  1 
ATOM   2125  C C   . ILE A 1 287 ? 181.699 -2.504  306.329 1.00 34.10  ?  281 ILE A C   1 
ATOM   2126  O O   . ILE A 1 287 ? 181.918 -2.163  305.159 1.00 29.94  ?  281 ILE A O   1 
ATOM   2127  C CB  . ILE A 1 287 ? 181.902 -4.954  306.967 1.00 33.58  ?  281 ILE A CB  1 
ATOM   2128  C CG1 . ILE A 1 287 ? 182.938 -6.059  307.214 1.00 32.29  ?  281 ILE A CG1 1 
ATOM   2129  C CG2 . ILE A 1 287 ? 181.203 -5.183  305.634 1.00 28.31  ?  281 ILE A CG2 1 
ATOM   2130  C CD1 . ILE A 1 287 ? 183.316 -6.273  308.669 1.00 37.04  ?  281 ILE A CD1 1 
ATOM   2131  N N   . GLY A 1 288 ? 180.719 -1.956  307.051 1.00 27.59  ?  282 GLY A N   1 
ATOM   2132  C CA  . GLY A 1 288 ? 179.907 -0.891  306.488 1.00 24.87  ?  282 GLY A CA  1 
ATOM   2133  C C   . GLY A 1 288 ? 180.719 0.344   306.148 1.00 26.90  ?  282 GLY A C   1 
ATOM   2134  O O   . GLY A 1 288 ? 180.483 0.992   305.125 1.00 23.96  ?  282 GLY A O   1 
ATOM   2135  N N   . GLU A 1 289 ? 181.692 0.684   306.998 1.00 30.50  ?  283 GLU A N   1 
ATOM   2136  C CA  . GLU A 1 289 ? 182.559 1.820   306.705 1.00 30.65  ?  283 GLU A CA  1 
ATOM   2137  C C   . GLU A 1 289 ? 183.487 1.531   305.534 1.00 26.96  ?  283 GLU A C   1 
ATOM   2138  O O   . GLU A 1 289 ? 183.810 2.441   304.762 1.00 29.50  ?  283 GLU A O   1 
ATOM   2139  C CB  . GLU A 1 289 ? 183.371 2.200   307.943 1.00 31.32  ?  283 GLU A CB  1 
ATOM   2140  C CG  . GLU A 1 289 ? 182.601 3.011   308.975 1.00 36.03  ?  283 GLU A CG  1 
ATOM   2141  C CD  . GLU A 1 289 ? 182.383 4.455   308.551 1.00 39.12  ?  283 GLU A CD  1 
ATOM   2142  O OE1 . GLU A 1 289 ? 182.899 4.857   307.486 1.00 37.65  ?  283 GLU A OE1 1 
ATOM   2143  O OE2 . GLU A 1 289 ? 181.695 5.190   309.289 1.00 45.26  -1 283 GLU A OE2 1 
ATOM   2144  N N   . ALA A 1 290 ? 183.925 0.279   305.384 1.00 22.91  ?  284 ALA A N   1 
ATOM   2145  C CA  . ALA A 1 290 ? 184.772 -0.074  304.250 1.00 22.89  ?  284 ALA A CA  1 
ATOM   2146  C C   . ALA A 1 290 ? 184.006 0.035   302.937 1.00 25.37  ?  284 ALA A C   1 
ATOM   2147  O O   . ALA A 1 290 ? 184.568 0.456   301.918 1.00 24.29  ?  284 ALA A O   1 
ATOM   2148  C CB  . ALA A 1 290 ? 185.335 -1.483  304.433 1.00 23.00  ?  284 ALA A CB  1 
ATOM   2149  N N   . VAL A 1 291 ? 182.723 -0.334  302.941 1.00 26.68  ?  285 VAL A N   1 
ATOM   2150  C CA  . VAL A 1 291 ? 181.914 -0.216  301.732 1.00 28.03  ?  285 VAL A CA  1 
ATOM   2151  C C   . VAL A 1 291 ? 181.652 1.249   301.405 1.00 25.06  ?  285 VAL A C   1 
ATOM   2152  O O   . VAL A 1 291 ? 181.771 1.672   300.249 1.00 25.93  ?  285 VAL A O   1 
ATOM   2153  C CB  . VAL A 1 291 ? 180.603 -1.009  301.885 1.00 28.97  ?  285 VAL A CB  1 
ATOM   2154  C CG1 . VAL A 1 291 ? 179.727 -0.828  300.657 1.00 34.10  ?  285 VAL A CG1 1 
ATOM   2155  C CG2 . VAL A 1 291 ? 180.900 -2.481  302.117 1.00 25.87  ?  285 VAL A CG2 1 
ATOM   2156  N N   . PHE A 1 292 ? 181.294 2.047   302.415 1.00 25.09  ?  286 PHE A N   1 
ATOM   2157  C CA  . PHE A 1 292 ? 181.100 3.476   302.195 1.00 27.22  ?  286 PHE A CA  1 
ATOM   2158  C C   . PHE A 1 292 ? 182.399 4.163   301.793 1.00 31.56  ?  286 PHE A C   1 
ATOM   2159  O O   . PHE A 1 292 ? 182.369 5.195   301.112 1.00 31.82  ?  286 PHE A O   1 
ATOM   2160  C CB  . PHE A 1 292 ? 180.524 4.131   303.451 1.00 29.84  ?  286 PHE A CB  1 
ATOM   2161  C CG  . PHE A 1 292 ? 179.062 3.857   303.666 1.00 30.91  ?  286 PHE A CG  1 
ATOM   2162  C CD1 . PHE A 1 292 ? 178.202 3.724   302.587 1.00 32.41  ?  286 PHE A CD1 1 
ATOM   2163  C CD2 . PHE A 1 292 ? 178.547 3.731   304.946 1.00 27.72  ?  286 PHE A CD2 1 
ATOM   2164  C CE1 . PHE A 1 292 ? 176.857 3.473   302.781 1.00 26.01  ?  286 PHE A CE1 1 
ATOM   2165  C CE2 . PHE A 1 292 ? 177.203 3.478   305.148 1.00 26.03  ?  286 PHE A CE2 1 
ATOM   2166  C CZ  . PHE A 1 292 ? 176.356 3.348   304.063 1.00 24.72  ?  286 PHE A CZ  1 
ATOM   2167  N N   . ALA A 1 293 ? 183.545 3.614   302.205 1.00 33.28  ?  287 ALA A N   1 
ATOM   2168  C CA  . ALA A 1 293 ? 184.824 4.195   301.812 1.00 29.84  ?  287 ALA A CA  1 
ATOM   2169  C C   . ALA A 1 293 ? 185.069 4.029   300.318 1.00 31.16  ?  287 ALA A C   1 
ATOM   2170  O O   . ALA A 1 293 ? 185.587 4.942   299.664 1.00 30.83  ?  287 ALA A O   1 
ATOM   2171  C CB  . ALA A 1 293 ? 185.960 3.564   302.618 1.00 23.64  ?  287 ALA A CB  1 
ATOM   2172  N N   . ARG A 1 294 ? 184.704 2.871   299.760 1.00 28.71  ?  288 ARG A N   1 
ATOM   2173  C CA  . ARG A 1 294 ? 184.830 2.679   298.319 1.00 30.77  ?  288 ARG A CA  1 
ATOM   2174  C C   . ARG A 1 294 ? 183.877 3.593   297.558 1.00 32.58  ?  288 ARG A C   1 
ATOM   2175  O O   . ARG A 1 294 ? 184.206 4.072   296.467 1.00 38.03  ?  288 ARG A O   1 
ATOM   2176  C CB  . ARG A 1 294 ? 184.573 1.218   297.953 1.00 26.75  ?  288 ARG A CB  1 
ATOM   2177  C CG  . ARG A 1 294 ? 185.576 0.238   298.534 1.00 32.77  ?  288 ARG A CG  1 
ATOM   2178  C CD  . ARG A 1 294 ? 185.452 -1.123  297.868 1.00 29.55  ?  288 ARG A CD  1 
ATOM   2179  N NE  . ARG A 1 294 ? 186.459 -2.063  298.352 1.00 38.58  ?  288 ARG A NE  1 
ATOM   2180  C CZ  . ARG A 1 294 ? 186.646 -3.280  297.853 1.00 38.60  ?  288 ARG A CZ  1 
ATOM   2181  N NH1 . ARG A 1 294 ? 185.894 -3.709  296.848 1.00 39.92  1  288 ARG A NH1 1 
ATOM   2182  N NH2 . ARG A 1 294 ? 187.586 -4.068  298.356 1.00 39.09  ?  288 ARG A NH2 1 
ATOM   2183  N N   . CYS A 1 295 ? 182.691 3.841   298.116 1.00 30.90  ?  289 CYS A N   1 
ATOM   2184  C CA  . CYS A 1 295 ? 181.755 4.759   297.478 1.00 34.05  ?  289 CYS A CA  1 
ATOM   2185  C C   . CYS A 1 295 ? 182.281 6.188   297.507 1.00 35.90  ?  289 CYS A C   1 
ATOM   2186  O O   . CYS A 1 295 ? 182.128 6.933   296.532 1.00 40.33  ?  289 CYS A O   1 
ATOM   2187  C CB  . CYS A 1 295 ? 180.390 4.677   298.160 1.00 31.75  ?  289 CYS A CB  1 
ATOM   2188  S SG  . CYS A 1 295 ? 179.662 3.024   298.181 1.00 31.64  ?  289 CYS A SG  1 
ATOM   2189  N N   . LEU A 1 296 ? 182.903 6.587   298.620 1.00 32.98  ?  290 LEU A N   1 
ATOM   2190  C CA  . LEU A 1 296 ? 183.464 7.930   298.713 1.00 36.16  ?  290 LEU A CA  1 
ATOM   2191  C C   . LEU A 1 296 ? 184.632 8.115   297.753 1.00 35.14  ?  290 LEU A C   1 
ATOM   2192  O O   . LEU A 1 296 ? 184.854 9.223   297.253 1.00 35.31  ?  290 LEU A O   1 
ATOM   2193  C CB  . LEU A 1 296 ? 183.900 8.216   300.151 1.00 31.79  ?  290 LEU A CB  1 
ATOM   2194  C CG  . LEU A 1 296 ? 184.505 9.592   300.439 1.00 31.36  ?  290 LEU A CG  1 
ATOM   2195  C CD1 . LEU A 1 296 ? 183.588 10.696  299.941 1.00 39.15  ?  290 LEU A CD1 1 
ATOM   2196  C CD2 . LEU A 1 296 ? 184.778 9.751   301.925 1.00 32.87  ?  290 LEU A CD2 1 
ATOM   2197  N N   . SER A 1 297 ? 185.381 7.046   297.480 1.00 33.41  ?  291 SER A N   1 
ATOM   2198  C CA  . SER A 1 297 ? 186.493 7.143   296.544 1.00 34.15  ?  291 SER A CA  1 
ATOM   2199  C C   . SER A 1 297 ? 186.019 7.188   295.099 1.00 37.29  ?  291 SER A C   1 
ATOM   2200  O O   . SER A 1 297 ? 186.708 7.753   294.243 1.00 43.22  ?  291 SER A O   1 
ATOM   2201  C CB  . SER A 1 297 ? 187.448 5.970   296.740 1.00 32.74  ?  291 SER A CB  1 
ATOM   2202  O OG  . SER A 1 297 ? 186.847 4.749   296.347 1.00 39.04  ?  291 SER A OG  1 
ATOM   2203  N N   . SER A 1 298 ? 184.856 6.602   294.809 1.00 41.36  ?  292 SER A N   1 
ATOM   2204  C CA  . SER A 1 298 ? 184.305 6.672   293.462 1.00 38.98  ?  292 SER A CA  1 
ATOM   2205  C C   . SER A 1 298 ? 183.896 8.088   293.081 1.00 35.19  ?  292 SER A C   1 
ATOM   2206  O O   . SER A 1 298 ? 183.696 8.365   291.894 1.00 35.62  ?  292 SER A O   1 
ATOM   2207  C CB  . SER A 1 298 ? 183.110 5.727   293.336 1.00 40.62  ?  292 SER A CB  1 
ATOM   2208  O OG  . SER A 1 298 ? 183.496 4.386   293.584 1.00 45.67  ?  292 SER A OG  1 
ATOM   2209  N N   . LEU A 1 299 ? 183.774 8.986   294.058 1.00 38.13  ?  293 LEU A N   1 
ATOM   2210  C CA  . LEU A 1 299 ? 183.457 10.390  293.800 1.00 39.38  ?  293 LEU A CA  1 
ATOM   2211  C C   . LEU A 1 299 ? 184.745 11.189  293.601 1.00 39.52  ?  293 LEU A C   1 
ATOM   2212  O O   . LEU A 1 299 ? 185.019 12.175  294.284 1.00 40.65  ?  293 LEU A O   1 
ATOM   2213  C CB  . LEU A 1 299 ? 182.625 10.958  294.943 1.00 40.38  ?  293 LEU A CB  1 
ATOM   2214  C CG  . LEU A 1 299 ? 181.383 10.171  295.363 1.00 35.47  ?  293 LEU A CG  1 
ATOM   2215  C CD1 . LEU A 1 299 ? 180.762 10.784  296.608 1.00 33.85  ?  293 LEU A CD1 1 
ATOM   2216  C CD2 . LEU A 1 299 ? 180.375 10.124  294.229 1.00 34.94  ?  293 LEU A CD2 1 
ATOM   2217  N N   . LYS A 1 300 ? 185.547 10.725  292.639 1.00 43.14  ?  294 LYS A N   1 
ATOM   2218  C CA  . LYS A 1 300 ? 186.860 11.321  292.414 1.00 46.05  ?  294 LYS A CA  1 
ATOM   2219  C C   . LYS A 1 300 ? 186.739 12.773  291.971 1.00 47.14  ?  294 LYS A C   1 
ATOM   2220  O O   . LYS A 1 300 ? 187.333 13.670  292.579 1.00 46.56  ?  294 LYS A O   1 
ATOM   2221  C CB  . LYS A 1 300 ? 187.640 10.502  291.385 1.00 43.41  ?  294 LYS A CB  1 
ATOM   2222  C CG  . LYS A 1 300 ? 189.027 11.053  291.089 1.00 48.37  ?  294 LYS A CG  1 
ATOM   2223  C CD  . LYS A 1 300 ? 189.822 11.284  292.371 1.00 45.32  ?  294 LYS A CD  1 
ATOM   2224  C CE  . LYS A 1 300 ? 191.230 11.779  292.077 1.00 44.03  ?  294 LYS A CE  1 
ATOM   2225  N NZ  . LYS A 1 300 ? 192.067 10.721  291.452 1.00 43.28  1  294 LYS A NZ  1 
ATOM   2226  N N   . ASP A 1 301 ? 185.961 13.025  290.914 1.00 49.09  ?  295 ASP A N   1 
ATOM   2227  C CA  . ASP A 1 301 ? 185.824 14.388  290.410 1.00 49.88  ?  295 ASP A CA  1 
ATOM   2228  C C   . ASP A 1 301 ? 185.173 15.306  291.436 1.00 53.85  ?  295 ASP A C   1 
ATOM   2229  O O   . ASP A 1 301 ? 185.506 16.495  291.503 1.00 52.28  ?  295 ASP A O   1 
ATOM   2230  C CB  . ASP A 1 301 ? 185.023 14.394  289.108 1.00 48.76  ?  295 ASP A CB  1 
ATOM   2231  C CG  . ASP A 1 301 ? 185.765 13.730  287.964 1.00 61.99  ?  295 ASP A CG  1 
ATOM   2232  O OD1 . ASP A 1 301 ? 187.012 13.681  288.010 1.00 63.53  ?  295 ASP A OD1 1 
ATOM   2233  O OD2 . ASP A 1 301 ? 185.100 13.262  287.015 1.00 62.15  -1 295 ASP A OD2 1 
ATOM   2234  N N   . GLU A 1 302 ? 184.249 14.780  292.244 1.00 51.14  ?  296 GLU A N   1 
ATOM   2235  C CA  . GLU A 1 302 ? 183.629 15.603  293.275 1.00 46.41  ?  296 GLU A CA  1 
ATOM   2236  C C   . GLU A 1 302 ? 184.613 15.942  294.388 1.00 47.55  ?  296 GLU A C   1 
ATOM   2237  O O   . GLU A 1 302 ? 184.512 17.012  294.998 1.00 47.36  ?  296 GLU A O   1 
ATOM   2238  C CB  . GLU A 1 302 ? 182.401 14.898  293.849 1.00 51.30  ?  296 GLU A CB  1 
ATOM   2239  C CG  . GLU A 1 302 ? 181.468 15.820  294.618 1.00 57.68  ?  296 GLU A CG  1 
ATOM   2240  C CD  . GLU A 1 302 ? 180.356 15.074  295.327 1.00 56.09  ?  296 GLU A CD  1 
ATOM   2241  O OE1 . GLU A 1 302 ? 179.985 15.486  296.447 1.00 52.15  ?  296 GLU A OE1 1 
ATOM   2242  O OE2 . GLU A 1 302 ? 179.855 14.075  294.768 1.00 58.21  -1 296 GLU A OE2 1 
ATOM   2243  N N   . ARG A 1 303 ? 185.568 15.051  294.664 1.00 48.83  ?  297 ARG A N   1 
ATOM   2244  C CA  . ARG A 1 303 ? 186.571 15.329  295.685 1.00 50.18  ?  297 ARG A CA  1 
ATOM   2245  C C   . ARG A 1 303 ? 187.659 16.269  295.180 1.00 53.36  ?  297 ARG A C   1 
ATOM   2246  O O   . ARG A 1 303 ? 188.269 16.986  295.981 1.00 56.62  ?  297 ARG A O   1 
ATOM   2247  C CB  . ARG A 1 303 ? 187.193 14.025  296.187 1.00 44.03  ?  297 ARG A CB  1 
ATOM   2248  C CG  . ARG A 1 303 ? 186.272 13.212  297.083 1.00 44.35  ?  297 ARG A CG  1 
ATOM   2249  C CD  . ARG A 1 303 ? 186.971 11.991  297.661 1.00 42.55  ?  297 ARG A CD  1 
ATOM   2250  N NE  . ARG A 1 303 ? 187.301 10.997  296.642 1.00 38.59  ?  297 ARG A NE  1 
ATOM   2251  C CZ  . ARG A 1 303 ? 188.513 10.831  296.124 1.00 37.02  ?  297 ARG A CZ  1 
ATOM   2252  N NH1 . ARG A 1 303 ? 189.519 11.593  296.530 1.00 37.40  1  297 ARG A NH1 1 
ATOM   2253  N NH2 . ARG A 1 303 ? 188.721 9.899   295.204 1.00 34.46  ?  297 ARG A NH2 1 
ATOM   2254  N N   . ILE A 1 304 ? 187.919 16.278  293.870 1.00 49.56  ?  298 ILE A N   1 
ATOM   2255  C CA  . ILE A 1 304 ? 188.891 17.217  293.314 1.00 49.23  ?  298 ILE A CA  1 
ATOM   2256  C C   . ILE A 1 304 ? 188.424 18.650  293.532 1.00 51.46  ?  298 ILE A C   1 
ATOM   2257  O O   . ILE A 1 304 ? 189.210 19.525  293.916 1.00 53.29  ?  298 ILE A O   1 
ATOM   2258  C CB  . ILE A 1 304 ? 189.132 16.919  291.822 1.00 40.70  ?  298 ILE A CB  1 
ATOM   2259  C CG1 . ILE A 1 304 ? 189.743 15.528  291.647 1.00 42.32  ?  298 ILE A CG1 1 
ATOM   2260  C CG2 . ILE A 1 304 ? 190.035 17.974  291.204 1.00 33.10  ?  298 ILE A CG2 1 
ATOM   2261  C CD1 . ILE A 1 304 ? 189.933 15.124  290.202 1.00 39.75  ?  298 ILE A CD1 1 
ATOM   2262  N N   . GLN A 1 305 ? 187.136 18.912  293.298 1.00 53.20  ?  299 GLN A N   1 
ATOM   2263  C CA  . GLN A 1 305 ? 186.591 20.241  293.551 1.00 54.10  ?  299 GLN A CA  1 
ATOM   2264  C C   . GLN A 1 305 ? 186.472 20.522  295.044 1.00 57.57  ?  299 GLN A C   1 
ATOM   2265  O O   . GLN A 1 305 ? 186.654 21.667  295.474 1.00 61.83  ?  299 GLN A O   1 
ATOM   2266  C CB  . GLN A 1 305 ? 185.232 20.386  292.862 1.00 60.10  ?  299 GLN A CB  1 
ATOM   2267  C CG  . GLN A 1 305 ? 184.430 21.619  293.265 1.00 69.85  ?  299 GLN A CG  1 
ATOM   2268  C CD  . GLN A 1 305 ? 185.088 22.925  292.853 1.00 77.46  ?  299 GLN A CD  1 
ATOM   2269  O OE1 . GLN A 1 305 ? 186.007 22.944  292.034 1.00 80.06  ?  299 GLN A OE1 1 
ATOM   2270  N NE2 . GLN A 1 305 ? 184.615 24.027  293.423 1.00 68.72  ?  299 GLN A NE2 1 
ATOM   2271  N N   . ALA A 1 306 ? 186.180 19.496  295.847 1.00 60.35  ?  300 ALA A N   1 
ATOM   2272  C CA  . ALA A 1 306 ? 186.058 19.695  297.287 1.00 59.85  ?  300 ALA A CA  1 
ATOM   2273  C C   . ALA A 1 306 ? 187.398 20.033  297.925 1.00 61.83  ?  300 ALA A C   1 
ATOM   2274  O O   . ALA A 1 306 ? 187.447 20.806  298.889 1.00 60.89  ?  300 ALA A O   1 
ATOM   2275  C CB  . ALA A 1 306 ? 185.458 18.451  297.940 1.00 53.25  ?  300 ALA A CB  1 
ATOM   2276  N N   . SER A 1 307 ? 188.490 19.466  297.407 1.00 63.54  ?  301 SER A N   1 
ATOM   2277  C CA  . SER A 1 307 ? 189.812 19.769  297.945 1.00 59.33  ?  301 SER A CA  1 
ATOM   2278  C C   . SER A 1 307 ? 190.201 21.220  297.694 1.00 60.08  ?  301 SER A C   1 
ATOM   2279  O O   . SER A 1 307 ? 190.984 21.793  298.460 1.00 56.47  ?  301 SER A O   1 
ATOM   2280  C CB  . SER A 1 307 ? 190.852 18.829  297.336 1.00 53.97  ?  301 SER A CB  1 
ATOM   2281  O OG  . SER A 1 307 ? 190.879 18.941  295.924 1.00 54.87  ?  301 SER A OG  1 
ATOM   2282  N N   . LYS A 1 308 ? 189.663 21.826  296.636 1.00 58.41  ?  302 LYS A N   1 
ATOM   2283  C CA  . LYS A 1 308 ? 189.997 23.204  296.297 1.00 54.27  ?  302 LYS A CA  1 
ATOM   2284  C C   . LYS A 1 308 ? 189.263 24.208  297.179 1.00 58.43  ?  302 LYS A C   1 
ATOM   2285  O O   . LYS A 1 308 ? 189.755 25.324  297.382 1.00 62.93  ?  302 LYS A O   1 
ATOM   2286  C CB  . LYS A 1 308 ? 189.688 23.450  294.818 1.00 52.23  ?  302 LYS A CB  1 
ATOM   2287  C CG  . LYS A 1 308 ? 189.955 24.858  294.314 1.00 69.84  ?  302 LYS A CG  1 
ATOM   2288  C CD  . LYS A 1 308 ? 189.871 24.910  292.795 1.00 74.62  ?  302 LYS A CD  1 
ATOM   2289  C CE  . LYS A 1 308 ? 189.751 26.337  292.287 1.00 58.36  ?  302 LYS A CE  1 
ATOM   2290  N NZ  . LYS A 1 308 ? 188.423 26.928  292.612 1.00 64.08  1  302 LYS A NZ  1 
ATOM   2291  N N   . LYS A 1 309 ? 188.106 23.832  297.726 1.00 62.49  ?  303 LYS A N   1 
ATOM   2292  C CA  . LYS A 1 309 ? 187.278 24.749  298.501 1.00 64.77  ?  303 LYS A CA  1 
ATOM   2293  C C   . LYS A 1 309 ? 187.270 24.471  299.996 1.00 62.48  ?  303 LYS A C   1 
ATOM   2294  O O   . LYS A 1 309 ? 187.092 25.405  300.780 1.00 61.65  ?  303 LYS A O   1 
ATOM   2295  C CB  . LYS A 1 309 ? 185.832 24.716  297.989 1.00 59.66  ?  303 LYS A CB  1 
ATOM   2296  C CG  . LYS A 1 309 ? 185.353 26.028  297.389 1.00 63.71  ?  303 LYS A CG  1 
ATOM   2297  C CD  . LYS A 1 309 ? 186.268 26.494  296.269 1.00 53.40  ?  303 LYS A CD  1 
ATOM   2298  C CE  . LYS A 1 309 ? 185.728 27.750  295.605 1.00 49.72  ?  303 LYS A CE  1 
ATOM   2299  N NZ  . LYS A 1 309 ? 185.518 28.850  296.586 1.00 50.00  1  303 LYS A NZ  1 
ATOM   2300  N N   . LEU A 1 310 ? 187.452 23.222  300.413 1.00 65.21  ?  304 LEU A N   1 
ATOM   2301  C CA  . LEU A 1 310 ? 187.394 22.854  301.820 1.00 68.90  ?  304 LEU A CA  1 
ATOM   2302  C C   . LEU A 1 310 ? 188.788 22.846  302.432 1.00 79.22  ?  304 LEU A C   1 
ATOM   2303  O O   . LEU A 1 310 ? 189.737 22.325  301.838 1.00 84.42  ?  304 LEU A O   1 
ATOM   2304  C CB  . LEU A 1 310 ? 186.742 21.481  301.999 1.00 63.36  ?  304 LEU A CB  1 
ATOM   2305  C CG  . LEU A 1 310 ? 185.225 21.446  301.818 1.00 66.88  ?  304 LEU A CG  1 
ATOM   2306  C CD1 . LEU A 1 310 ? 184.702 20.023  301.917 1.00 64.31  ?  304 LEU A CD1 1 
ATOM   2307  C CD2 . LEU A 1 310 ? 184.557 22.340  302.851 1.00 63.40  ?  304 LEU A CD2 1 
ATOM   2308  N N   . LYS A 1 311 ? 188.903 23.422  303.625 1.00 73.66  ?  305 LYS A N   1 
ATOM   2309  C CA  . LYS A 1 311 ? 190.157 23.448  304.361 1.00 71.73  ?  305 LYS A CA  1 
ATOM   2310  C C   . LYS A 1 311 ? 190.128 22.425  305.489 1.00 71.75  ?  305 LYS A C   1 
ATOM   2311  O O   . LYS A 1 311 ? 189.084 22.161  306.091 1.00 74.56  ?  305 LYS A O   1 
ATOM   2312  C CB  . LYS A 1 311 ? 190.438 24.841  304.934 1.00 78.41  ?  305 LYS A CB  1 
ATOM   2313  C CG  . LYS A 1 311 ? 189.484 25.268  306.039 1.00 70.78  ?  305 LYS A CG  1 
ATOM   2314  C CD  . LYS A 1 311 ? 190.031 26.447  306.831 1.00 72.87  ?  305 LYS A CD  1 
ATOM   2315  C CE  . LYS A 1 311 ? 190.122 27.702  305.980 1.00 81.47  ?  305 LYS A CE  1 
ATOM   2316  N NZ  . LYS A 1 311 ? 190.576 28.877  306.777 1.00 76.57  1  305 LYS A NZ  1 
ATOM   2317  N N   . GLY A 1 312 ? 191.293 21.845  305.764 1.00 75.87  ?  306 GLY A N   1 
ATOM   2318  C CA  . GLY A 1 312 ? 191.450 20.929  306.866 1.00 71.22  ?  306 GLY A CA  1 
ATOM   2319  C C   . GLY A 1 312 ? 192.377 21.502  307.917 1.00 80.25  ?  306 GLY A C   1 
ATOM   2320  O O   . GLY A 1 312 ? 192.547 22.720  308.029 1.00 77.67  ?  306 GLY A O   1 
ATOM   2321  N N   . PRO A 1 313 ? 192.993 20.631  308.716 1.00 79.20  ?  307 PRO A N   1 
ATOM   2322  C CA  . PRO A 1 313 ? 193.979 21.102  309.697 1.00 73.15  ?  307 PRO A CA  1 
ATOM   2323  C C   . PRO A 1 313 ? 195.319 21.356  309.021 1.00 83.50  ?  307 PRO A C   1 
ATOM   2324  O O   . PRO A 1 313 ? 195.827 20.512  308.277 1.00 88.20  ?  307 PRO A O   1 
ATOM   2325  C CB  . PRO A 1 313 ? 194.063 19.946  310.699 1.00 64.89  ?  307 PRO A CB  1 
ATOM   2326  C CG  . PRO A 1 313 ? 193.743 18.740  309.882 1.00 65.19  ?  307 PRO A CG  1 
ATOM   2327  C CD  . PRO A 1 313 ? 192.766 19.179  308.814 1.00 72.86  ?  307 PRO A CD  1 
ATOM   2328  N N   . GLN A 1 314 ? 195.885 22.534  309.273 1.00 82.95  ?  308 GLN A N   1 
ATOM   2329  C CA  . GLN A 1 314 ? 197.176 22.907  308.718 1.00 94.93  ?  308 GLN A CA  1 
ATOM   2330  C C   . GLN A 1 314 ? 198.253 23.120  309.768 1.00 89.55  ?  308 GLN A C   1 
ATOM   2331  O O   . GLN A 1 314 ? 199.439 22.999  309.442 1.00 86.26  ?  308 GLN A O   1 
ATOM   2332  C CB  . GLN A 1 314 ? 197.048 24.185  307.874 1.00 96.28  ?  308 GLN A CB  1 
ATOM   2333  C CG  . GLN A 1 314 ? 196.106 24.047  306.690 1.00 96.54  ?  308 GLN A CG  1 
ATOM   2334  C CD  . GLN A 1 314 ? 195.152 25.217  306.566 1.00 94.96  ?  308 GLN A CD  1 
ATOM   2335  O OE1 . GLN A 1 314 ? 195.094 26.082  307.441 1.00 95.59  ?  308 GLN A OE1 1 
ATOM   2336  N NE2 . GLN A 1 314 ? 194.394 25.249  305.477 1.00 89.23  ?  308 GLN A NE2 1 
ATOM   2337  N N   . LYS A 1 315 ? 197.881 23.424  311.010 1.00 83.14  ?  309 LYS A N   1 
ATOM   2338  C CA  . LYS A 1 315 ? 198.847 23.655  312.083 1.00 87.32  ?  309 LYS A CA  1 
ATOM   2339  C C   . LYS A 1 315 ? 199.116 22.336  312.807 1.00 85.05  ?  309 LYS A C   1 
ATOM   2340  O O   . LYS A 1 315 ? 198.657 22.084  313.923 1.00 83.01  ?  309 LYS A O   1 
ATOM   2341  C CB  . LYS A 1 315 ? 198.332 24.734  313.028 1.00 88.02  ?  309 LYS A CB  1 
ATOM   2342  C CG  . LYS A 1 315 ? 197.986 26.033  312.317 1.00 91.58  ?  309 LYS A CG  1 
ATOM   2343  C CD  . LYS A 1 315 ? 196.880 26.793  313.028 1.00 88.03  ?  309 LYS A CD  1 
ATOM   2344  C CE  . LYS A 1 315 ? 196.413 27.977  312.195 1.00 75.38  ?  309 LYS A CE  1 
ATOM   2345  N NZ  . LYS A 1 315 ? 195.272 28.697  312.825 1.00 69.68  1  309 LYS A NZ  1 
ATOM   2346  N N   . PHE A 1 316 ? 199.875 21.477  312.130 1.00 79.49  ?  310 PHE A N   1 
ATOM   2347  C CA  . PHE A 1 316 ? 200.215 20.167  312.666 1.00 73.38  ?  310 PHE A CA  1 
ATOM   2348  C C   . PHE A 1 316 ? 201.520 19.688  312.051 1.00 76.69  ?  310 PHE A C   1 
ATOM   2349  O O   . PHE A 1 316 ? 201.712 19.790  310.836 1.00 81.10  ?  310 PHE A O   1 
ATOM   2350  C CB  . PHE A 1 316 ? 199.104 19.145  312.391 1.00 63.77  ?  310 PHE A CB  1 
ATOM   2351  C CG  . PHE A 1 316 ? 199.523 17.717  312.621 1.00 54.47  ?  310 PHE A CG  1 
ATOM   2352  C CD1 . PHE A 1 316 ? 199.464 17.159  313.887 1.00 49.65  ?  310 PHE A CD1 1 
ATOM   2353  C CD2 . PHE A 1 316 ? 199.976 16.934  311.569 1.00 53.20  ?  310 PHE A CD2 1 
ATOM   2354  C CE1 . PHE A 1 316 ? 199.851 15.848  314.101 1.00 51.73  ?  310 PHE A CE1 1 
ATOM   2355  C CE2 . PHE A 1 316 ? 200.368 15.626  311.777 1.00 51.50  ?  310 PHE A CE2 1 
ATOM   2356  C CZ  . PHE A 1 316 ? 200.303 15.080  313.044 1.00 49.35  ?  310 PHE A CZ  1 
ATOM   2357  N N   . GLN A 1 317 ? 202.405 19.164  312.895 1.00 76.18  ?  311 GLN A N   1 
ATOM   2358  C CA  . GLN A 1 317 ? 203.587 18.445  312.443 1.00 76.81  ?  311 GLN A CA  1 
ATOM   2359  C C   . GLN A 1 317 ? 203.935 17.400  313.490 1.00 75.05  ?  311 GLN A C   1 
ATOM   2360  O O   . GLN A 1 317 ? 203.774 17.636  314.691 1.00 67.66  ?  311 GLN A O   1 
ATOM   2361  C CB  . GLN A 1 317 ? 204.778 19.379  312.199 1.00 85.67  ?  311 GLN A CB  1 
ATOM   2362  C CG  . GLN A 1 317 ? 204.934 19.816  310.748 1.00 94.68  ?  311 GLN A CG  1 
ATOM   2363  C CD  . GLN A 1 317 ? 205.130 18.646  309.796 1.00 93.05  ?  311 GLN A CD  1 
ATOM   2364  O OE1 . GLN A 1 317 ? 205.637 17.591  310.180 1.00 86.77  ?  311 GLN A OE1 1 
ATOM   2365  N NE2 . GLN A 1 317 ? 204.725 18.831  308.544 1.00 77.75  ?  311 GLN A NE2 1 
ATOM   2366  N N   . PHE A 1 318 ? 204.402 16.244  313.027 1.00 76.95  ?  312 PHE A N   1 
ATOM   2367  C CA  . PHE A 1 318 ? 204.680 15.119  313.913 1.00 70.39  ?  312 PHE A CA  1 
ATOM   2368  C C   . PHE A 1 318 ? 206.011 15.347  314.618 1.00 76.07  ?  312 PHE A C   1 
ATOM   2369  O O   . PHE A 1 318 ? 207.074 15.297  313.990 1.00 74.67  ?  312 PHE A O   1 
ATOM   2370  C CB  . PHE A 1 318 ? 204.689 13.812  313.128 1.00 62.79  ?  312 PHE A CB  1 
ATOM   2371  C CG  . PHE A 1 318 ? 204.975 12.607  313.973 1.00 61.15  ?  312 PHE A CG  1 
ATOM   2372  C CD1 . PHE A 1 318 ? 204.028 12.134  314.866 1.00 62.57  ?  312 PHE A CD1 1 
ATOM   2373  C CD2 . PHE A 1 318 ? 206.190 11.950  313.879 1.00 59.22  ?  312 PHE A CD2 1 
ATOM   2374  C CE1 . PHE A 1 318 ? 204.287 11.028  315.648 1.00 67.16  ?  312 PHE A CE1 1 
ATOM   2375  C CE2 . PHE A 1 318 ? 206.455 10.842  314.658 1.00 58.63  ?  312 PHE A CE2 1 
ATOM   2376  C CZ  . PHE A 1 318 ? 205.503 10.382  315.544 1.00 67.51  ?  312 PHE A CZ  1 
ATOM   2377  N N   . ASP A 1 319 ? 205.955 15.594  315.927 1.00 78.04  ?  313 ASP A N   1 
ATOM   2378  C CA  . ASP A 1 319 ? 207.160 15.780  316.725 1.00 83.28  ?  313 ASP A CA  1 
ATOM   2379  C C   . ASP A 1 319 ? 207.375 14.598  317.663 1.00 85.34  ?  313 ASP A C   1 
ATOM   2380  O O   . ASP A 1 319 ? 207.585 14.781  318.867 1.00 90.44  ?  313 ASP A O   1 
ATOM   2381  C CB  . ASP A 1 319 ? 207.084 17.086  317.519 1.00 80.69  ?  313 ASP A CB  1 
ATOM   2382  C CG  . ASP A 1 319 ? 205.724 17.307  318.154 1.00 84.40  ?  313 ASP A CG  1 
ATOM   2383  O OD1 . ASP A 1 319 ? 205.255 16.417  318.895 1.00 80.82  ?  313 ASP A OD1 1 
ATOM   2384  O OD2 . ASP A 1 319 ? 205.126 18.378  317.916 1.00 89.58  -1 313 ASP A OD2 1 
ATOM   2385  N N   . GLY A 1 320 ? 207.322 13.384  317.121 1.00 72.19  ?  314 GLY A N   1 
ATOM   2386  C CA  . GLY A 1 320 ? 207.546 12.193  317.914 1.00 63.55  ?  314 GLY A CA  1 
ATOM   2387  C C   . GLY A 1 320 ? 208.670 11.337  317.369 1.00 61.99  ?  314 GLY A C   1 
ATOM   2388  O O   . GLY A 1 320 ? 209.631 11.856  316.794 1.00 69.93  ?  314 GLY A O   1 
ATOM   2389  N N   . ASP A 1 321 ? 208.563 10.023  317.544 1.00 59.56  ?  315 ASP A N   1 
ATOM   2390  C CA  . ASP A 1 321 ? 209.543 9.075   317.032 1.00 62.00  ?  315 ASP A CA  1 
ATOM   2391  C C   . ASP A 1 321 ? 208.924 8.335   315.854 1.00 55.16  ?  315 ASP A C   1 
ATOM   2392  O O   . ASP A 1 321 ? 207.943 7.602   316.023 1.00 55.09  ?  315 ASP A O   1 
ATOM   2393  C CB  . ASP A 1 321 ? 209.985 8.097   318.122 1.00 58.87  ?  315 ASP A CB  1 
ATOM   2394  C CG  . ASP A 1 321 ? 211.202 7.283   317.720 1.00 56.78  ?  315 ASP A CG  1 
ATOM   2395  O OD1 . ASP A 1 321 ? 211.754 7.527   316.626 1.00 57.63  ?  315 ASP A OD1 1 
ATOM   2396  O OD2 . ASP A 1 321 ? 211.608 6.397   318.502 1.00 50.96  -1 315 ASP A OD2 1 
ATOM   2397  N N   . LYS A 1 322 ? 209.496 8.534   314.663 1.00 50.55  ?  316 LYS A N   1 
ATOM   2398  C CA  . LYS A 1 322 ? 208.966 7.901   313.460 1.00 47.74  ?  316 LYS A CA  1 
ATOM   2399  C C   . LYS A 1 322 ? 209.042 6.382   313.530 1.00 52.19  ?  316 LYS A C   1 
ATOM   2400  O O   . LYS A 1 322 ? 208.309 5.701   312.804 1.00 62.11  ?  316 LYS A O   1 
ATOM   2401  C CB  . LYS A 1 322 ? 209.711 8.406   312.219 1.00 52.37  ?  316 LYS A CB  1 
ATOM   2402  C CG  . LYS A 1 322 ? 209.361 9.834   311.798 1.00 59.54  ?  316 LYS A CG  1 
ATOM   2403  C CD  . LYS A 1 322 ? 210.038 10.878  312.680 1.00 62.31  ?  316 LYS A CD  1 
ATOM   2404  C CE  . LYS A 1 322 ? 209.513 12.275  312.398 1.00 62.37  ?  316 LYS A CE  1 
ATOM   2405  N NZ  . LYS A 1 322 ? 210.035 13.265  313.381 1.00 54.07  1  316 LYS A NZ  1 
ATOM   2406  N N   . LYS A 1 323 ? 209.909 5.839   314.382 1.00 50.50  ?  317 LYS A N   1 
ATOM   2407  C CA  . LYS A 1 323 ? 209.985 4.401   314.600 1.00 52.63  ?  317 LYS A CA  1 
ATOM   2408  C C   . LYS A 1 323 ? 208.981 3.927   315.645 1.00 55.61  ?  317 LYS A C   1 
ATOM   2409  O O   . LYS A 1 323 ? 208.373 2.863   315.483 1.00 55.98  ?  317 LYS A O   1 
ATOM   2410  C CB  . LYS A 1 323 ? 211.410 4.014   315.013 1.00 57.57  ?  317 LYS A CB  1 
ATOM   2411  C CG  . LYS A 1 323 ? 211.580 2.573   315.475 1.00 61.03  ?  317 LYS A CG  1 
ATOM   2412  C CD  . LYS A 1 323 ? 211.681 2.490   316.993 1.00 62.11  ?  317 LYS A CD  1 
ATOM   2413  C CE  . LYS A 1 323 ? 211.744 1.049   317.471 1.00 70.45  ?  317 LYS A CE  1 
ATOM   2414  N NZ  . LYS A 1 323 ? 211.750 0.963   318.958 1.00 72.41  1  317 LYS A NZ  1 
ATOM   2415  N N   . SER A 1 324 ? 208.786 4.703   316.714 1.00 52.15  ?  318 SER A N   1 
ATOM   2416  C CA  . SER A 1 324 ? 207.862 4.297   317.767 1.00 50.99  ?  318 SER A CA  1 
ATOM   2417  C C   . SER A 1 324 ? 206.409 4.528   317.374 1.00 53.16  ?  318 SER A C   1 
ATOM   2418  O O   . SER A 1 324 ? 205.516 3.852   317.899 1.00 52.17  ?  318 SER A O   1 
ATOM   2419  C CB  . SER A 1 324 ? 208.179 5.035   319.067 1.00 56.63  ?  318 SER A CB  1 
ATOM   2420  O OG  . SER A 1 324 ? 209.441 4.645   319.580 1.00 65.53  ?  318 SER A OG  1 
ATOM   2421  N N   . PHE A 1 325 ? 206.148 5.471   316.468 1.00 56.14  ?  319 PHE A N   1 
ATOM   2422  C CA  . PHE A 1 325 ? 204.784 5.675   315.993 1.00 54.15  ?  319 PHE A CA  1 
ATOM   2423  C C   . PHE A 1 325 ? 204.406 4.666   314.919 1.00 52.27  ?  319 PHE A C   1 
ATOM   2424  O O   . PHE A 1 325 ? 203.234 4.283   314.820 1.00 52.12  ?  319 PHE A O   1 
ATOM   2425  C CB  . PHE A 1 325 ? 204.612 7.096   315.459 1.00 53.72  ?  319 PHE A CB  1 
ATOM   2426  C CG  . PHE A 1 325 ? 203.199 7.430   315.068 1.00 56.31  ?  319 PHE A CG  1 
ATOM   2427  C CD1 . PHE A 1 325 ? 202.248 7.713   316.035 1.00 54.04  ?  319 PHE A CD1 1 
ATOM   2428  C CD2 . PHE A 1 325 ? 202.823 7.464   313.735 1.00 62.79  ?  319 PHE A CD2 1 
ATOM   2429  C CE1 . PHE A 1 325 ? 200.946 8.021   315.680 1.00 47.54  ?  319 PHE A CE1 1 
ATOM   2430  C CE2 . PHE A 1 325 ? 201.522 7.773   313.373 1.00 56.23  ?  319 PHE A CE2 1 
ATOM   2431  C CZ  . PHE A 1 325 ? 200.583 8.052   314.347 1.00 45.83  ?  319 PHE A CZ  1 
ATOM   2432  N N   . LEU A 1 326 ? 205.376 4.230   314.111 1.00 51.42  ?  320 LEU A N   1 
ATOM   2433  C CA  . LEU A 1 326 ? 205.110 3.183   313.131 1.00 47.00  ?  320 LEU A CA  1 
ATOM   2434  C C   . LEU A 1 326 ? 204.652 1.900   313.810 1.00 43.52  ?  320 LEU A C   1 
ATOM   2435  O O   . LEU A 1 326 ? 203.824 1.166   313.259 1.00 44.51  ?  320 LEU A O   1 
ATOM   2436  C CB  . LEU A 1 326 ? 206.360 2.936   312.282 1.00 44.09  ?  320 LEU A CB  1 
ATOM   2437  C CG  . LEU A 1 326 ? 206.233 2.185   310.952 1.00 47.33  ?  320 LEU A CG  1 
ATOM   2438  C CD1 . LEU A 1 326 ? 206.306 0.676   311.144 1.00 48.28  ?  320 LEU A CD1 1 
ATOM   2439  C CD2 . LEU A 1 326 ? 204.948 2.575   310.236 1.00 51.81  ?  320 LEU A CD2 1 
ATOM   2440  N N   . GLU A 1 327 ? 205.170 1.619   315.007 1.00 46.44  ?  321 GLU A N   1 
ATOM   2441  C CA  . GLU A 1 327 ? 204.696 0.466   315.764 1.00 49.28  ?  321 GLU A CA  1 
ATOM   2442  C C   . GLU A 1 327 ? 203.284 0.688   316.290 1.00 49.93  ?  321 GLU A C   1 
ATOM   2443  O O   . GLU A 1 327 ? 202.517 -0.272  316.429 1.00 54.43  ?  321 GLU A O   1 
ATOM   2444  C CB  . GLU A 1 327 ? 205.660 0.164   316.913 1.00 51.03  ?  321 GLU A CB  1 
ATOM   2445  C CG  . GLU A 1 327 ? 205.302 -1.062  317.742 1.00 48.59  ?  321 GLU A CG  1 
ATOM   2446  C CD  . GLU A 1 327 ? 205.504 -2.369  316.995 1.00 57.60  ?  321 GLU A CD  1 
ATOM   2447  O OE1 . GLU A 1 327 ? 206.084 -2.350  315.888 1.00 56.18  ?  321 GLU A OE1 1 
ATOM   2448  O OE2 . GLU A 1 327 ? 205.082 -3.421  317.520 1.00 60.03  -1 321 GLU A OE2 1 
ATOM   2449  N N   . ASP A 1 328 ? 202.919 1.940   316.580 1.00 49.03  ?  322 ASP A N   1 
ATOM   2450  C CA  . ASP A 1 328 ? 201.561 2.225   317.030 1.00 50.63  ?  322 ASP A CA  1 
ATOM   2451  C C   . ASP A 1 328 ? 200.543 2.009   315.917 1.00 48.48  ?  322 ASP A C   1 
ATOM   2452  O O   . ASP A 1 328 ? 199.412 1.589   316.187 1.00 47.42  ?  322 ASP A O   1 
ATOM   2453  C CB  . ASP A 1 328 ? 201.471 3.655   317.565 1.00 49.84  ?  322 ASP A CB  1 
ATOM   2454  C CG  . ASP A 1 328 ? 202.379 3.889   318.757 1.00 56.85  ?  322 ASP A CG  1 
ATOM   2455  O OD1 . ASP A 1 328 ? 202.763 2.900   319.417 1.00 51.29  ?  322 ASP A OD1 1 
ATOM   2456  O OD2 . ASP A 1 328 ? 202.705 5.062   319.037 1.00 60.96  -1 322 ASP A OD2 1 
ATOM   2457  N N   . ILE A 1 329 ? 200.923 2.288   314.669 1.00 46.40  ?  323 ILE A N   1 
ATOM   2458  C CA  . ILE A 1 329 ? 200.042 2.000   313.543 1.00 38.11  ?  323 ILE A CA  1 
ATOM   2459  C C   . ILE A 1 329 ? 199.847 0.497   313.391 1.00 43.96  ?  323 ILE A C   1 
ATOM   2460  O O   . ILE A 1 329 ? 198.770 0.040   312.987 1.00 46.93  ?  323 ILE A O   1 
ATOM   2461  C CB  . ILE A 1 329 ? 200.605 2.635   312.258 1.00 36.45  ?  323 ILE A CB  1 
ATOM   2462  C CG1 . ILE A 1 329 ? 200.788 4.141   312.449 1.00 45.18  ?  323 ILE A CG1 1 
ATOM   2463  C CG2 . ILE A 1 329 ? 199.694 2.363   311.073 1.00 41.64  ?  323 ILE A CG2 1 
ATOM   2464  C CD1 . ILE A 1 329 ? 201.390 4.837   311.249 1.00 53.70  ?  323 ILE A CD1 1 
ATOM   2465  N N   . ARG A 1 330 ? 200.870 -0.294  313.721 1.00 48.35  ?  324 ARG A N   1 
ATOM   2466  C CA  . ARG A 1 330 ? 200.758 -1.746  313.618 1.00 42.20  ?  324 ARG A CA  1 
ATOM   2467  C C   . ARG A 1 330 ? 199.743 -2.290  314.616 1.00 41.57  ?  324 ARG A C   1 
ATOM   2468  O O   . ARG A 1 330 ? 198.876 -3.097  314.258 1.00 45.20  ?  324 ARG A O   1 
ATOM   2469  C CB  . ARG A 1 330 ? 202.125 -2.393  313.838 1.00 46.21  ?  324 ARG A CB  1 
ATOM   2470  C CG  . ARG A 1 330 ? 202.195 -3.851  313.418 1.00 48.39  ?  324 ARG A CG  1 
ATOM   2471  C CD  . ARG A 1 330 ? 203.468 -4.511  313.914 1.00 45.38  ?  324 ARG A CD  1 
ATOM   2472  N NE  . ARG A 1 330 ? 203.488 -4.619  315.370 1.00 49.51  ?  324 ARG A NE  1 
ATOM   2473  C CZ  . ARG A 1 330 ? 202.974 -5.640  316.050 1.00 51.72  ?  324 ARG A CZ  1 
ATOM   2474  N NH1 . ARG A 1 330 ? 202.398 -6.646  315.407 1.00 45.54  1  324 ARG A NH1 1 
ATOM   2475  N NH2 . ARG A 1 330 ? 203.037 -5.656  317.375 1.00 58.26  ?  324 ARG A NH2 1 
ATOM   2476  N N   . LYS A 1 331 ? 199.840 -1.863  315.877 1.00 43.70  ?  325 LYS A N   1 
ATOM   2477  C CA  . LYS A 1 331 ? 198.901 -2.329  316.891 1.00 46.14  ?  325 LYS A CA  1 
ATOM   2478  C C   . LYS A 1 331 ? 197.484 -1.843  316.613 1.00 47.86  ?  325 LYS A C   1 
ATOM   2479  O O   . LYS A 1 331 ? 196.518 -2.552  316.919 1.00 48.89  ?  325 LYS A O   1 
ATOM   2480  C CB  . LYS A 1 331 ? 199.359 -1.877  318.277 1.00 44.05  ?  325 LYS A CB  1 
ATOM   2481  C CG  . LYS A 1 331 ? 200.552 -2.650  318.816 1.00 48.35  ?  325 LYS A CG  1 
ATOM   2482  C CD  . LYS A 1 331 ? 201.665 -1.715  319.254 1.00 52.87  ?  325 LYS A CD  1 
ATOM   2483  C CE  . LYS A 1 331 ? 202.776 -2.472  319.960 1.00 51.07  ?  325 LYS A CE  1 
ATOM   2484  N NZ  . LYS A 1 331 ? 202.306 -3.073  321.238 1.00 58.26  1  325 LYS A NZ  1 
ATOM   2485  N N   . ALA A 1 332 ? 197.339 -0.646  316.041 1.00 42.60  ?  326 ALA A N   1 
ATOM   2486  C CA  . ALA A 1 332 ? 196.013 -0.174  315.657 1.00 45.00  ?  326 ALA A CA  1 
ATOM   2487  C C   . ALA A 1 332 ? 195.421 -1.047  314.558 1.00 45.34  ?  326 ALA A C   1 
ATOM   2488  O O   . ALA A 1 332 ? 194.220 -1.341  314.567 1.00 39.79  ?  326 ALA A O   1 
ATOM   2489  C CB  . ALA A 1 332 ? 196.083 1.286   315.208 1.00 39.81  ?  326 ALA A CB  1 
ATOM   2490  N N   . LEU A 1 333 ? 196.252 -1.475  313.605 1.00 48.43  ?  327 LEU A N   1 
ATOM   2491  C CA  . LEU A 1 333 ? 195.782 -2.369  312.552 1.00 38.57  ?  327 LEU A CA  1 
ATOM   2492  C C   . LEU A 1 333 ? 195.413 -3.737  313.112 1.00 39.51  ?  327 LEU A C   1 
ATOM   2493  O O   . LEU A 1 333 ? 194.383 -4.310  312.737 1.00 41.05  ?  327 LEU A O   1 
ATOM   2494  C CB  . LEU A 1 333 ? 196.852 -2.502  311.468 1.00 39.35  ?  327 LEU A CB  1 
ATOM   2495  C CG  . LEU A 1 333 ? 196.630 -3.563  310.388 1.00 35.66  ?  327 LEU A CG  1 
ATOM   2496  C CD1 . LEU A 1 333 ? 195.332 -3.310  309.655 1.00 38.40  ?  327 LEU A CD1 1 
ATOM   2497  C CD2 . LEU A 1 333 ? 197.796 -3.586  309.414 1.00 39.52  ?  327 LEU A CD2 1 
ATOM   2498  N N   . TYR A 1 334 ? 196.240 -4.274  314.011 1.00 41.69  ?  328 TYR A N   1 
ATOM   2499  C CA  . TYR A 1 334 ? 195.964 -5.589  314.580 1.00 44.49  ?  328 TYR A CA  1 
ATOM   2500  C C   . TYR A 1 334 ? 194.714 -5.563  315.451 1.00 39.50  ?  328 TYR A C   1 
ATOM   2501  O O   . TYR A 1 334 ? 193.905 -6.496  315.411 1.00 38.01  ?  328 TYR A O   1 
ATOM   2502  C CB  . TYR A 1 334 ? 197.172 -6.075  315.381 1.00 41.59  ?  328 TYR A CB  1 
ATOM   2503  C CG  . TYR A 1 334 ? 197.055 -7.494  315.892 1.00 44.09  ?  328 TYR A CG  1 
ATOM   2504  C CD1 . TYR A 1 334 ? 197.067 -8.571  315.015 1.00 48.77  ?  328 TYR A CD1 1 
ATOM   2505  C CD2 . TYR A 1 334 ? 196.950 -7.758  317.251 1.00 45.11  ?  328 TYR A CD2 1 
ATOM   2506  C CE1 . TYR A 1 334 ? 196.967 -9.871  315.475 1.00 53.97  ?  328 TYR A CE1 1 
ATOM   2507  C CE2 . TYR A 1 334 ? 196.850 -9.055  317.722 1.00 50.21  ?  328 TYR A CE2 1 
ATOM   2508  C CZ  . TYR A 1 334 ? 196.859 -10.107 316.829 1.00 56.03  ?  328 TYR A CZ  1 
ATOM   2509  O OH  . TYR A 1 334 ? 196.761 -11.400 317.291 1.00 49.53  ?  328 TYR A OH  1 
ATOM   2510  N N   . ALA A 1 335 ? 194.537 -4.500  316.238 1.00 35.72  ?  329 ALA A N   1 
ATOM   2511  C CA  . ALA A 1 335 ? 193.364 -4.412  317.102 1.00 36.39  ?  329 ALA A CA  1 
ATOM   2512  C C   . ALA A 1 335 ? 192.095 -4.178  316.291 1.00 39.61  ?  329 ALA A C   1 
ATOM   2513  O O   . ALA A 1 335 ? 191.046 -4.761  316.589 1.00 35.60  ?  329 ALA A O   1 
ATOM   2514  C CB  . ALA A 1 335 ? 193.555 -3.305  318.136 1.00 40.81  ?  329 ALA A CB  1 
ATOM   2515  N N   . SER A 1 336 ? 192.168 -3.327  315.265 1.00 40.92  ?  330 SER A N   1 
ATOM   2516  C CA  . SER A 1 336 ? 191.007 -3.107  314.409 1.00 34.36  ?  330 SER A CA  1 
ATOM   2517  C C   . SER A 1 336 ? 190.647 -4.361  313.625 1.00 37.20  ?  330 SER A C   1 
ATOM   2518  O O   . SER A 1 336 ? 189.463 -4.614  313.372 1.00 41.85  ?  330 SER A O   1 
ATOM   2519  C CB  . SER A 1 336 ? 191.267 -1.941  313.456 1.00 32.71  ?  330 SER A CB  1 
ATOM   2520  O OG  . SER A 1 336 ? 191.472 -0.736  314.171 1.00 37.34  ?  330 SER A OG  1 
ATOM   2521  N N   . LYS A 1 337 ? 191.647 -5.154  313.235 1.00 37.47  ?  331 LYS A N   1 
ATOM   2522  C CA  . LYS A 1 337 ? 191.367 -6.418  312.565 1.00 35.59  ?  331 LYS A CA  1 
ATOM   2523  C C   . LYS A 1 337 ? 190.680 -7.404  313.502 1.00 34.58  ?  331 LYS A C   1 
ATOM   2524  O O   . LYS A 1 337 ? 189.902 -8.250  313.047 1.00 40.02  ?  331 LYS A O   1 
ATOM   2525  C CB  . LYS A 1 337 ? 192.662 -7.012  312.011 1.00 34.46  ?  331 LYS A CB  1 
ATOM   2526  C CG  . LYS A 1 337 ? 192.469 -8.195  311.075 1.00 33.44  ?  331 LYS A CG  1 
ATOM   2527  C CD  . LYS A 1 337 ? 193.795 -8.635  310.474 1.00 32.26  ?  331 LYS A CD  1 
ATOM   2528  C CE  . LYS A 1 337 ? 193.609 -9.775  309.488 1.00 31.09  ?  331 LYS A CE  1 
ATOM   2529  N NZ  . LYS A 1 337 ? 194.900 -10.169 308.859 1.00 43.79  1  331 LYS A NZ  1 
ATOM   2530  N N   . ILE A 1 338 ? 190.945 -7.309  314.806 1.00 32.93  ?  332 ILE A N   1 
ATOM   2531  C CA  . ILE A 1 338 ? 190.272 -8.175  315.770 1.00 37.81  ?  332 ILE A CA  1 
ATOM   2532  C C   . ILE A 1 338 ? 188.802 -7.793  315.891 1.00 38.28  ?  332 ILE A C   1 
ATOM   2533  O O   . ILE A 1 338 ? 187.915 -8.655  315.887 1.00 36.34  ?  332 ILE A O   1 
ATOM   2534  C CB  . ILE A 1 338 ? 190.986 -8.117  317.133 1.00 38.91  ?  332 ILE A CB  1 
ATOM   2535  C CG1 . ILE A 1 338 ? 192.371 -8.758  317.041 1.00 38.38  ?  332 ILE A CG1 1 
ATOM   2536  C CG2 . ILE A 1 338 ? 190.154 -8.802  318.207 1.00 42.45  ?  332 ILE A CG2 1 
ATOM   2537  C CD1 . ILE A 1 338 ? 193.144 -8.718  318.339 1.00 42.17  ?  332 ILE A CD1 1 
ATOM   2538  N N   . ILE A 1 339 ? 188.523 -6.492  316.000 1.00 38.66  ?  333 ILE A N   1 
ATOM   2539  C CA  . ILE A 1 339 ? 187.141 -6.033  316.095 1.00 42.37  ?  333 ILE A CA  1 
ATOM   2540  C C   . ILE A 1 339 ? 186.385 -6.343  314.807 1.00 39.97  ?  333 ILE A C   1 
ATOM   2541  O O   . ILE A 1 339 ? 185.196 -6.686  314.836 1.00 37.63  ?  333 ILE A O   1 
ATOM   2542  C CB  . ILE A 1 339 ? 187.104 -4.531  316.445 1.00 38.61  ?  333 ILE A CB  1 
ATOM   2543  C CG1 . ILE A 1 339 ? 187.147 -4.323  317.964 1.00 40.25  ?  333 ILE A CG1 1 
ATOM   2544  C CG2 . ILE A 1 339 ? 185.872 -3.856  315.856 1.00 36.00  ?  333 ILE A CG2 1 
ATOM   2545  C CD1 . ILE A 1 339 ? 188.482 -4.642  318.611 1.00 39.30  ?  333 ILE A CD1 1 
ATOM   2546  N N   . SER A 1 340 ? 187.066 -6.256  313.661 1.00 38.08  ?  334 SER A N   1 
ATOM   2547  C CA  . SER A 1 340 ? 186.418 -6.544  312.384 1.00 42.32  ?  334 SER A CA  1 
ATOM   2548  C C   . SER A 1 340 ? 185.946 -7.993  312.322 1.00 39.82  ?  334 SER A C   1 
ATOM   2549  O O   . SER A 1 340 ? 184.783 -8.267  312.003 1.00 42.12  ?  334 SER A O   1 
ATOM   2550  C CB  . SER A 1 340 ? 187.374 -6.237  311.230 1.00 39.51  ?  334 SER A CB  1 
ATOM   2551  O OG  . SER A 1 340 ? 186.758 -6.465  309.974 1.00 40.59  ?  334 SER A OG  1 
ATOM   2552  N N   . TYR A 1 341 ? 186.839 -8.937  312.628 1.00 34.77  ?  335 TYR A N   1 
ATOM   2553  C CA  . TYR A 1 341 ? 186.456 -10.345 312.619 1.00 33.03  ?  335 TYR A CA  1 
ATOM   2554  C C   . TYR A 1 341 ? 185.449 -10.661 313.716 1.00 35.23  ?  335 TYR A C   1 
ATOM   2555  O O   . TYR A 1 341 ? 184.643 -11.587 313.565 1.00 38.67  ?  335 TYR A O   1 
ATOM   2556  C CB  . TYR A 1 341 ? 187.695 -11.228 312.762 1.00 32.16  ?  335 TYR A CB  1 
ATOM   2557  C CG  . TYR A 1 341 ? 188.475 -11.396 311.478 1.00 32.71  ?  335 TYR A CG  1 
ATOM   2558  C CD1 . TYR A 1 341 ? 189.192 -10.339 310.935 1.00 34.00  ?  335 TYR A CD1 1 
ATOM   2559  C CD2 . TYR A 1 341 ? 188.498 -12.613 310.812 1.00 40.28  ?  335 TYR A CD2 1 
ATOM   2560  C CE1 . TYR A 1 341 ? 189.906 -10.487 309.764 1.00 36.16  ?  335 TYR A CE1 1 
ATOM   2561  C CE2 . TYR A 1 341 ? 189.212 -12.772 309.639 1.00 38.93  ?  335 TYR A CE2 1 
ATOM   2562  C CZ  . TYR A 1 341 ? 189.915 -11.705 309.121 1.00 39.15  ?  335 TYR A CZ  1 
ATOM   2563  O OH  . TYR A 1 341 ? 190.626 -11.855 307.953 1.00 50.30  ?  335 TYR A OH  1 
ATOM   2564  N N   . ALA A 1 342 ? 185.479 -9.914  314.822 1.00 38.10  ?  336 ALA A N   1 
ATOM   2565  C CA  . ALA A 1 342 ? 184.469 -10.099 315.858 1.00 36.07  ?  336 ALA A CA  1 
ATOM   2566  C C   . ALA A 1 342 ? 183.086 -9.724  315.343 1.00 38.21  ?  336 ALA A C   1 
ATOM   2567  O O   . ALA A 1 342 ? 182.102 -10.418 315.624 1.00 44.51  ?  336 ALA A O   1 
ATOM   2568  C CB  . ALA A 1 342 ? 184.827 -9.278  317.096 1.00 36.99  ?  336 ALA A CB  1 
ATOM   2569  N N   . GLN A 1 343 ? 182.993 -8.634  314.578 1.00 36.46  ?  337 GLN A N   1 
ATOM   2570  C CA  . GLN A 1 343 ? 181.711 -8.238  314.004 1.00 33.39  ?  337 GLN A CA  1 
ATOM   2571  C C   . GLN A 1 343 ? 181.238 -9.241  312.960 1.00 35.98  ?  337 GLN A C   1 
ATOM   2572  O O   . GLN A 1 343 ? 180.035 -9.504  312.845 1.00 45.03  ?  337 GLN A O   1 
ATOM   2573  C CB  . GLN A 1 343 ? 181.817 -6.843  313.389 1.00 31.21  ?  337 GLN A CB  1 
ATOM   2574  C CG  . GLN A 1 343 ? 182.051 -5.728  314.394 1.00 34.39  ?  337 GLN A CG  1 
ATOM   2575  C CD  . GLN A 1 343 ? 182.239 -4.379  313.727 1.00 35.41  ?  337 GLN A CD  1 
ATOM   2576  O OE1 . GLN A 1 343 ? 182.507 -4.298  312.528 1.00 37.08  ?  337 GLN A OE1 1 
ATOM   2577  N NE2 . GLN A 1 343 ? 182.097 -3.310  314.503 1.00 33.03  ?  337 GLN A NE2 1 
ATOM   2578  N N   . GLY A 1 344 ? 182.168 -9.809  312.190 1.00 38.34  ?  338 GLY A N   1 
ATOM   2579  C CA  . GLY A 1 344 ? 181.780 -10.751 311.153 1.00 35.37  ?  338 GLY A CA  1 
ATOM   2580  C C   . GLY A 1 344 ? 181.135 -12.005 311.710 1.00 41.10  ?  338 GLY A C   1 
ATOM   2581  O O   . GLY A 1 344 ? 180.119 -12.475 311.191 1.00 42.39  ?  338 GLY A O   1 
ATOM   2582  N N   . PHE A 1 345 ? 181.712 -12.564 312.775 1.00 42.73  ?  339 PHE A N   1 
ATOM   2583  C CA  . PHE A 1 345 ? 181.146 -13.765 313.376 1.00 38.42  ?  339 PHE A CA  1 
ATOM   2584  C C   . PHE A 1 345 ? 179.861 -13.478 314.140 1.00 40.94  ?  339 PHE A C   1 
ATOM   2585  O O   . PHE A 1 345 ? 179.043 -14.388 314.312 1.00 47.80  ?  339 PHE A O   1 
ATOM   2586  C CB  . PHE A 1 345 ? 182.174 -14.431 314.290 1.00 35.46  ?  339 PHE A CB  1 
ATOM   2587  C CG  . PHE A 1 345 ? 183.178 -15.269 313.552 1.00 32.60  ?  339 PHE A CG  1 
ATOM   2588  C CD1 . PHE A 1 345 ? 184.179 -14.676 312.801 1.00 31.04  ?  339 PHE A CD1 1 
ATOM   2589  C CD2 . PHE A 1 345 ? 183.117 -16.652 313.605 1.00 37.07  ?  339 PHE A CD2 1 
ATOM   2590  C CE1 . PHE A 1 345 ? 185.102 -15.446 312.119 1.00 40.19  ?  339 PHE A CE1 1 
ATOM   2591  C CE2 . PHE A 1 345 ? 184.036 -17.427 312.926 1.00 40.77  ?  339 PHE A CE2 1 
ATOM   2592  C CZ  . PHE A 1 345 ? 185.031 -16.823 312.182 1.00 48.94  ?  339 PHE A CZ  1 
ATOM   2593  N N   . MET A 1 346 ? 179.666 -12.241 314.604 1.00 35.84  ?  340 MET A N   1 
ATOM   2594  C CA  . MET A 1 346 ? 178.364 -11.860 315.141 1.00 36.75  ?  340 MET A CA  1 
ATOM   2595  C C   . MET A 1 346 ? 177.291 -11.950 314.065 1.00 43.38  ?  340 MET A C   1 
ATOM   2596  O O   . MET A 1 346 ? 176.166 -12.389 314.331 1.00 48.52  ?  340 MET A O   1 
ATOM   2597  C CB  . MET A 1 346 ? 178.423 -10.448 315.719 1.00 31.97  ?  340 MET A CB  1 
ATOM   2598  C CG  . MET A 1 346 ? 179.279 -10.314 316.962 1.00 37.65  ?  340 MET A CG  1 
ATOM   2599  S SD  . MET A 1 346 ? 179.503 -8.591  317.433 1.00 42.16  ?  340 MET A SD  1 
ATOM   2600  C CE  . MET A 1 346 ? 177.802 -8.097  317.700 1.00 33.51  ?  340 MET A CE  1 
ATOM   2601  N N   . LEU A 1 347 ? 177.625 -11.538 312.840 1.00 40.92  ?  341 LEU A N   1 
ATOM   2602  C CA  . LEU A 1 347 ? 176.685 -11.658 311.732 1.00 43.00  ?  341 LEU A CA  1 
ATOM   2603  C C   . LEU A 1 347 ? 176.455 -13.118 311.361 1.00 41.07  ?  341 LEU A C   1 
ATOM   2604  O O   . LEU A 1 347 ? 175.341 -13.501 310.984 1.00 48.02  ?  341 LEU A O   1 
ATOM   2605  C CB  . LEU A 1 347 ? 177.199 -10.869 310.528 1.00 43.25  ?  341 LEU A CB  1 
ATOM   2606  C CG  . LEU A 1 347 ? 176.353 -10.905 309.254 1.00 41.43  ?  341 LEU A CG  1 
ATOM   2607  C CD1 . LEU A 1 347 ? 174.975 -10.314 309.505 1.00 35.81  ?  341 LEU A CD1 1 
ATOM   2608  C CD2 . LEU A 1 347 ? 177.061 -10.170 308.127 1.00 35.43  ?  341 LEU A CD2 1 
ATOM   2609  N N   . LEU A 1 348 ? 177.497 -13.948 311.460 1.00 34.64  ?  342 LEU A N   1 
ATOM   2610  C CA  . LEU A 1 348 ? 177.338 -15.368 311.164 1.00 35.59  ?  342 LEU A CA  1 
ATOM   2611  C C   . LEU A 1 348 ? 176.450 -16.052 312.196 1.00 44.19  ?  342 LEU A C   1 
ATOM   2612  O O   . LEU A 1 348 ? 175.626 -16.905 311.846 1.00 47.65  ?  342 LEU A O   1 
ATOM   2613  C CB  . LEU A 1 348 ? 178.704 -16.051 311.100 1.00 32.04  ?  342 LEU A CB  1 
ATOM   2614  C CG  . LEU A 1 348 ? 179.609 -15.688 309.922 1.00 29.81  ?  342 LEU A CG  1 
ATOM   2615  C CD1 . LEU A 1 348 ? 180.937 -16.422 310.025 1.00 35.47  ?  342 LEU A CD1 1 
ATOM   2616  C CD2 . LEU A 1 348 ? 178.922 -16.009 308.607 1.00 33.93  ?  342 LEU A CD2 1 
ATOM   2617  N N   . ARG A 1 349 ? 176.599 -15.689 313.473 1.00 49.34  ?  343 ARG A N   1 
ATOM   2618  C CA  . ARG A 1 349 ? 175.786 -16.314 314.511 1.00 55.06  ?  343 ARG A CA  1 
ATOM   2619  C C   . ARG A 1 349 ? 174.338 -15.845 314.449 1.00 51.93  ?  343 ARG A C   1 
ATOM   2620  O O   . ARG A 1 349 ? 173.430 -16.590 314.835 1.00 47.19  ?  343 ARG A O   1 
ATOM   2621  C CB  . ARG A 1 349 ? 176.388 -16.033 315.891 1.00 52.03  ?  343 ARG A CB  1 
ATOM   2622  C CG  . ARG A 1 349 ? 175.600 -15.049 316.748 1.00 59.84  ?  343 ARG A CG  1 
ATOM   2623  C CD  . ARG A 1 349 ? 176.268 -14.809 318.097 1.00 58.93  ?  343 ARG A CD  1 
ATOM   2624  N NE  . ARG A 1 349 ? 176.357 -16.027 318.900 1.00 66.07  ?  343 ARG A NE  1 
ATOM   2625  C CZ  . ARG A 1 349 ? 177.439 -16.796 318.976 1.00 67.91  ?  343 ARG A CZ  1 
ATOM   2626  N NH1 . ARG A 1 349 ? 178.531 -16.477 318.295 1.00 63.93  1  343 ARG A NH1 1 
ATOM   2627  N NH2 . ARG A 1 349 ? 177.429 -17.886 319.731 1.00 70.11  ?  343 ARG A NH2 1 
ATOM   2628  N N   . GLN A 1 350 ? 174.099 -14.625 313.963 1.00 45.53  ?  344 GLN A N   1 
ATOM   2629  C CA  . GLN A 1 350 ? 172.728 -14.146 313.841 1.00 49.53  ?  344 GLN A CA  1 
ATOM   2630  C C   . GLN A 1 350 ? 172.021 -14.806 312.665 1.00 52.46  ?  344 GLN A C   1 
ATOM   2631  O O   . GLN A 1 350 ? 170.819 -15.086 312.733 1.00 57.23  ?  344 GLN A O   1 
ATOM   2632  C CB  . GLN A 1 350 ? 172.713 -12.625 313.697 1.00 47.81  ?  344 GLN A CB  1 
ATOM   2633  C CG  . GLN A 1 350 ? 171.330 -12.000 313.811 1.00 48.70  ?  344 GLN A CG  1 
ATOM   2634  C CD  . GLN A 1 350 ? 170.752 -12.098 315.212 1.00 58.11  ?  344 GLN A CD  1 
ATOM   2635  O OE1 . GLN A 1 350 ? 170.281 -13.156 315.631 1.00 60.67  ?  344 GLN A OE1 1 
ATOM   2636  N NE2 . GLN A 1 350 ? 170.787 -10.990 315.944 1.00 59.54  ?  344 GLN A NE2 1 
ATOM   2637  N N   . ALA A 1 351 ? 172.752 -15.063 311.578 1.00 48.64  ?  345 ALA A N   1 
ATOM   2638  C CA  . ALA A 1 351 ? 172.169 -15.783 310.451 1.00 51.89  ?  345 ALA A CA  1 
ATOM   2639  C C   . ALA A 1 351 ? 171.803 -17.207 310.843 1.00 52.82  ?  345 ALA A C   1 
ATOM   2640  O O   . ALA A 1 351 ? 170.739 -17.710 310.463 1.00 59.44  ?  345 ALA A O   1 
ATOM   2641  C CB  . ALA A 1 351 ? 173.135 -15.785 309.269 1.00 47.89  ?  345 ALA A CB  1 
ATOM   2642  N N   . ALA A 1 352 ? 172.675 -17.875 311.602 1.00 53.98  ?  346 ALA A N   1 
ATOM   2643  C CA  . ALA A 1 352 ? 172.361 -19.216 312.083 1.00 50.78  ?  346 ALA A CA  1 
ATOM   2644  C C   . ALA A 1 352 ? 171.113 -19.216 312.954 1.00 51.65  ?  346 ALA A C   1 
ATOM   2645  O O   . ALA A 1 352 ? 170.362 -20.197 312.964 1.00 59.38  ?  346 ALA A O   1 
ATOM   2646  C CB  . ALA A 1 352 ? 173.550 -19.791 312.853 1.00 52.65  ?  346 ALA A CB  1 
ATOM   2647  N N   . THR A 1 353 ? 170.872 -18.127 313.686 1.00 52.34  ?  347 THR A N   1 
ATOM   2648  C CA  . THR A 1 353 ? 169.651 -18.014 314.475 1.00 47.33  ?  347 THR A CA  1 
ATOM   2649  C C   . THR A 1 353 ? 168.450 -17.678 313.599 1.00 55.70  ?  347 THR A C   1 
ATOM   2650  O O   . THR A 1 353 ? 167.372 -18.258 313.771 1.00 66.76  ?  347 THR A O   1 
ATOM   2651  C CB  . THR A 1 353 ? 169.831 -16.957 315.567 1.00 48.83  ?  347 THR A CB  1 
ATOM   2652  O OG1 . THR A 1 353 ? 170.767 -17.430 316.543 1.00 55.95  ?  347 THR A OG1 1 
ATOM   2653  C CG2 . THR A 1 353 ? 168.505 -16.650 316.249 1.00 55.01  ?  347 THR A CG2 1 
ATOM   2654  N N   . GLU A 1 354 ? 168.621 -16.755 312.648 1.00 63.42  ?  348 GLU A N   1 
ATOM   2655  C CA  . GLU A 1 354 ? 167.499 -16.326 311.817 1.00 60.76  ?  348 GLU A CA  1 
ATOM   2656  C C   . GLU A 1 354 ? 166.999 -17.457 310.926 1.00 55.60  ?  348 GLU A C   1 
ATOM   2657  O O   . GLU A 1 354 ? 165.787 -17.630 310.754 1.00 59.53  ?  348 GLU A O   1 
ATOM   2658  C CB  . GLU A 1 354 ? 167.906 -15.121 310.968 1.00 57.37  ?  348 GLU A CB  1 
ATOM   2659  C CG  . GLU A 1 354 ? 167.065 -13.877 311.200 1.00 59.81  ?  348 GLU A CG  1 
ATOM   2660  C CD  . GLU A 1 354 ? 167.380 -13.196 312.517 1.00 69.85  ?  348 GLU A CD  1 
ATOM   2661  O OE1 . GLU A 1 354 ? 168.488 -13.413 313.050 1.00 65.09  ?  348 GLU A OE1 1 
ATOM   2662  O OE2 . GLU A 1 354 ? 166.520 -12.442 313.019 1.00 86.80  -1 348 GLU A OE2 1 
ATOM   2663  N N   . PHE A 1 355 ? 167.916 -18.237 310.354 1.00 54.82  ?  349 PHE A N   1 
ATOM   2664  C CA  . PHE A 1 355 ? 167.559 -19.284 309.407 1.00 60.80  ?  349 PHE A CA  1 
ATOM   2665  C C   . PHE A 1 355 ? 167.548 -20.681 310.016 1.00 62.04  ?  349 PHE A C   1 
ATOM   2666  O O   . PHE A 1 355 ? 166.990 -21.598 309.404 1.00 63.21  ?  349 PHE A O   1 
ATOM   2667  C CB  . PHE A 1 355 ? 168.521 -19.267 308.213 1.00 57.18  ?  349 PHE A CB  1 
ATOM   2668  C CG  . PHE A 1 355 ? 168.585 -17.945 307.506 1.00 58.35  ?  349 PHE A CG  1 
ATOM   2669  C CD1 . PHE A 1 355 ? 167.562 -17.546 306.662 1.00 60.31  ?  349 PHE A CD1 1 
ATOM   2670  C CD2 . PHE A 1 355 ? 169.671 -17.105 307.679 1.00 55.93  ?  349 PHE A CD2 1 
ATOM   2671  C CE1 . PHE A 1 355 ? 167.620 -16.330 306.010 1.00 64.14  ?  349 PHE A CE1 1 
ATOM   2672  C CE2 . PHE A 1 355 ? 169.735 -15.889 307.030 1.00 58.70  ?  349 PHE A CE2 1 
ATOM   2673  C CZ  . PHE A 1 355 ? 168.709 -15.502 306.195 1.00 63.92  ?  349 PHE A CZ  1 
ATOM   2674  N N   . GLY A 1 356 ? 168.142 -20.871 311.190 1.00 60.22  ?  350 GLY A N   1 
ATOM   2675  C CA  . GLY A 1 356 ? 168.170 -22.189 311.792 1.00 55.84  ?  350 GLY A CA  1 
ATOM   2676  C C   . GLY A 1 356 ? 169.297 -23.070 311.307 1.00 60.81  ?  350 GLY A C   1 
ATOM   2677  O O   . GLY A 1 356 ? 169.169 -24.298 311.328 1.00 73.94  ?  350 GLY A O   1 
ATOM   2678  N N   . TRP A 1 357 ? 170.402 -22.477 310.867 1.00 52.58  ?  351 TRP A N   1 
ATOM   2679  C CA  . TRP A 1 357 ? 171.535 -23.246 310.385 1.00 49.35  ?  351 TRP A CA  1 
ATOM   2680  C C   . TRP A 1 357 ? 172.429 -23.669 311.547 1.00 49.58  ?  351 TRP A C   1 
ATOM   2681  O O   . TRP A 1 357 ? 172.371 -23.115 312.648 1.00 52.21  ?  351 TRP A O   1 
ATOM   2682  C CB  . TRP A 1 357 ? 172.344 -22.434 309.375 1.00 57.12  ?  351 TRP A CB  1 
ATOM   2683  C CG  . TRP A 1 357 ? 171.557 -21.995 308.177 1.00 57.27  ?  351 TRP A CG  1 
ATOM   2684  C CD1 . TRP A 1 357 ? 170.433 -22.581 307.672 1.00 52.88  ?  351 TRP A CD1 1 
ATOM   2685  C CD2 . TRP A 1 357 ? 171.834 -20.868 307.339 1.00 55.01  ?  351 TRP A CD2 1 
ATOM   2686  N NE1 . TRP A 1 357 ? 169.997 -21.891 306.566 1.00 55.61  ?  351 TRP A NE1 1 
ATOM   2687  C CE2 . TRP A 1 357 ? 170.841 -20.835 306.341 1.00 54.89  ?  351 TRP A CE2 1 
ATOM   2688  C CE3 . TRP A 1 357 ? 172.828 -19.884 307.334 1.00 50.98  ?  351 TRP A CE3 1 
ATOM   2689  C CZ2 . TRP A 1 357 ? 170.811 -19.856 305.350 1.00 56.85  ?  351 TRP A CZ2 1 
ATOM   2690  C CZ3 . TRP A 1 357 ? 172.798 -18.916 306.349 1.00 47.64  ?  351 TRP A CZ3 1 
ATOM   2691  C CH2 . TRP A 1 357 ? 171.797 -18.908 305.371 1.00 57.27  ?  351 TRP A CH2 1 
ATOM   2692  N N   . THR A 1 358 ? 173.266 -24.667 311.284 1.00 55.42  ?  352 THR A N   1 
ATOM   2693  C CA  . THR A 1 358 ? 174.237 -25.174 312.250 1.00 50.83  ?  352 THR A CA  1 
ATOM   2694  C C   . THR A 1 358 ? 175.628 -24.876 311.695 1.00 53.40  ?  352 THR A C   1 
ATOM   2695  O O   . THR A 1 358 ? 176.235 -25.706 311.016 1.00 52.03  ?  352 THR A O   1 
ATOM   2696  C CB  . THR A 1 358 ? 174.041 -26.667 312.507 1.00 46.01  ?  352 THR A CB  1 
ATOM   2697  O OG1 . THR A 1 358 ? 172.688 -26.910 312.910 1.00 54.00  ?  352 THR A OG1 1 
ATOM   2698  C CG2 . THR A 1 358 ? 174.980 -27.145 313.605 1.00 58.45  ?  352 THR A CG2 1 
ATOM   2699  N N   . LEU A 1 359 ? 176.127 -23.678 311.987 1.00 49.44  ?  353 LEU A N   1 
ATOM   2700  C CA  . LEU A 1 359 ? 177.435 -23.249 311.514 1.00 49.48  ?  353 LEU A CA  1 
ATOM   2701  C C   . LEU A 1 359 ? 178.505 -23.567 312.549 1.00 51.63  ?  353 LEU A C   1 
ATOM   2702  O O   . LEU A 1 359 ? 178.320 -23.331 313.747 1.00 47.62  ?  353 LEU A O   1 
ATOM   2703  C CB  . LEU A 1 359 ? 177.436 -21.749 311.212 1.00 50.43  ?  353 LEU A CB  1 
ATOM   2704  C CG  . LEU A 1 359 ? 176.412 -21.221 310.205 1.00 49.18  ?  353 LEU A CG  1 
ATOM   2705  C CD1 . LEU A 1 359 ? 176.596 -19.726 309.998 1.00 43.71  ?  353 LEU A CD1 1 
ATOM   2706  C CD2 . LEU A 1 359 ? 176.517 -21.961 308.883 1.00 45.62  ?  353 LEU A CD2 1 
ATOM   2707  N N   . ASN A 1 360 ? 179.627 -24.107 312.078 1.00 51.65  ?  354 ASN A N   1 
ATOM   2708  C CA  . ASN A 1 360 ? 180.789 -24.379 312.921 1.00 47.91  ?  354 ASN A CA  1 
ATOM   2709  C C   . ASN A 1 360 ? 181.771 -23.228 312.724 1.00 50.48  ?  354 ASN A C   1 
ATOM   2710  O O   . ASN A 1 360 ? 182.528 -23.202 311.750 1.00 52.30  ?  354 ASN A O   1 
ATOM   2711  C CB  . ASN A 1 360 ? 181.415 -25.725 312.572 1.00 55.52  ?  354 ASN A CB  1 
ATOM   2712  C CG  . ASN A 1 360 ? 182.569 -26.086 313.488 1.00 62.02  ?  354 ASN A CG  1 
ATOM   2713  O OD1 . ASN A 1 360 ? 182.699 -25.543 314.586 1.00 65.10  ?  354 ASN A OD1 1 
ATOM   2714  N ND2 . ASN A 1 360 ? 183.412 -27.009 313.041 1.00 59.54  ?  354 ASN A ND2 1 
ATOM   2715  N N   . TYR A 1 361 ? 181.754 -22.275 313.659 1.00 48.25  ?  355 TYR A N   1 
ATOM   2716  C CA  . TYR A 1 361 ? 182.555 -21.064 313.509 1.00 45.52  ?  355 TYR A CA  1 
ATOM   2717  C C   . TYR A 1 361 ? 184.048 -21.366 313.516 1.00 45.91  ?  355 TYR A C   1 
ATOM   2718  O O   . TYR A 1 361 ? 184.816 -20.695 312.816 1.00 43.93  ?  355 TYR A O   1 
ATOM   2719  C CB  . TYR A 1 361 ? 182.196 -20.072 314.614 1.00 37.66  ?  355 TYR A CB  1 
ATOM   2720  C CG  . TYR A 1 361 ? 180.704 -19.882 314.770 1.00 52.23  ?  355 TYR A CG  1 
ATOM   2721  C CD1 . TYR A 1 361 ? 179.889 -19.692 313.660 1.00 50.05  ?  355 TYR A CD1 1 
ATOM   2722  C CD2 . TYR A 1 361 ? 180.106 -19.917 316.022 1.00 59.37  ?  355 TYR A CD2 1 
ATOM   2723  C CE1 . TYR A 1 361 ? 178.524 -19.527 313.795 1.00 43.19  ?  355 TYR A CE1 1 
ATOM   2724  C CE2 . TYR A 1 361 ? 178.741 -19.754 316.167 1.00 55.30  ?  355 TYR A CE2 1 
ATOM   2725  C CZ  . TYR A 1 361 ? 177.956 -19.560 315.050 1.00 46.43  ?  355 TYR A CZ  1 
ATOM   2726  O OH  . TYR A 1 361 ? 176.597 -19.398 315.191 1.00 56.91  ?  355 TYR A OH  1 
ATOM   2727  N N   . GLY A 1 362 ? 184.479 -22.362 314.291 1.00 48.24  ?  356 GLY A N   1 
ATOM   2728  C CA  . GLY A 1 362 ? 185.874 -22.765 314.243 1.00 47.85  ?  356 GLY A CA  1 
ATOM   2729  C C   . GLY A 1 362 ? 186.243 -23.399 312.916 1.00 53.23  ?  356 GLY A C   1 
ATOM   2730  O O   . GLY A 1 362 ? 187.342 -23.182 312.397 1.00 52.72  ?  356 GLY A O   1 
ATOM   2731  N N   . GLY A 1 363 ? 185.331 -24.190 312.348 1.00 49.80  ?  357 GLY A N   1 
ATOM   2732  C CA  . GLY A 1 363 ? 185.582 -24.764 311.037 1.00 54.41  ?  357 GLY A CA  1 
ATOM   2733  C C   . GLY A 1 363 ? 185.632 -23.715 309.945 1.00 49.04  ?  357 GLY A C   1 
ATOM   2734  O O   . GLY A 1 363 ? 186.466 -23.790 309.039 1.00 42.63  ?  357 GLY A O   1 
ATOM   2735  N N   . ILE A 1 364 ? 184.743 -22.719 310.017 1.00 47.02  ?  358 ILE A N   1 
ATOM   2736  C CA  . ILE A 1 364 ? 184.750 -21.636 309.037 1.00 43.42  ?  358 ILE A CA  1 
ATOM   2737  C C   . ILE A 1 364 ? 186.091 -20.915 309.050 1.00 43.10  ?  358 ILE A C   1 
ATOM   2738  O O   . ILE A 1 364 ? 186.643 -20.580 307.994 1.00 39.95  ?  358 ILE A O   1 
ATOM   2739  C CB  . ILE A 1 364 ? 183.581 -20.668 309.304 1.00 37.29  ?  358 ILE A CB  1 
ATOM   2740  C CG1 . ILE A 1 364 ? 182.243 -21.377 309.089 1.00 39.39  ?  358 ILE A CG1 1 
ATOM   2741  C CG2 . ILE A 1 364 ? 183.686 -19.439 308.413 1.00 35.59  ?  358 ILE A CG2 1 
ATOM   2742  C CD1 . ILE A 1 364 ? 181.037 -20.503 309.360 1.00 39.67  ?  358 ILE A CD1 1 
ATOM   2743  N N   . ALA A 1 365 ? 186.641 -20.672 310.242 1.00 44.03  ?  359 ALA A N   1 
ATOM   2744  C CA  . ALA A 1 365 ? 187.963 -20.063 310.333 1.00 45.01  ?  359 ALA A CA  1 
ATOM   2745  C C   . ALA A 1 365 ? 189.032 -20.956 309.716 1.00 49.50  ?  359 ALA A C   1 
ATOM   2746  O O   . ALA A 1 365 ? 189.997 -20.453 309.129 1.00 42.66  ?  359 ALA A O   1 
ATOM   2747  C CB  . ALA A 1 365 ? 188.301 -19.754 311.792 1.00 45.33  ?  359 ALA A CB  1 
ATOM   2748  N N   . LEU A 1 366 ? 188.876 -22.277 309.836 1.00 51.93  ?  360 LEU A N   1 
ATOM   2749  C CA  . LEU A 1 366 ? 189.814 -23.195 309.196 1.00 50.53  ?  360 LEU A CA  1 
ATOM   2750  C C   . LEU A 1 366 ? 189.703 -23.126 307.678 1.00 47.67  ?  360 LEU A C   1 
ATOM   2751  O O   . LEU A 1 366 ? 190.720 -23.112 306.975 1.00 41.94  ?  360 LEU A O   1 
ATOM   2752  C CB  . LEU A 1 366 ? 189.571 -24.621 309.689 1.00 47.33  ?  360 LEU A CB  1 
ATOM   2753  C CG  . LEU A 1 366 ? 190.358 -25.724 308.976 1.00 48.23  ?  360 LEU A CG  1 
ATOM   2754  C CD1 . LEU A 1 366 ? 191.852 -25.579 309.229 1.00 48.48  ?  360 LEU A CD1 1 
ATOM   2755  C CD2 . LEU A 1 366 ? 189.864 -27.098 309.400 1.00 49.96  ?  360 LEU A CD2 1 
ATOM   2756  N N   . MET A 1 367 ? 188.474 -23.079 307.155 1.00 49.65  ?  361 MET A N   1 
ATOM   2757  C CA  . MET A 1 367 ? 188.269 -22.942 305.719 1.00 49.10  ?  361 MET A CA  1 
ATOM   2758  C C   . MET A 1 367 ? 188.802 -21.620 305.182 1.00 50.44  ?  361 MET A C   1 
ATOM   2759  O O   . MET A 1 367 ? 189.133 -21.535 303.995 1.00 51.91  ?  361 MET A O   1 
ATOM   2760  C CB  . MET A 1 367 ? 186.782 -23.079 305.399 1.00 43.04  ?  361 MET A CB  1 
ATOM   2761  C CG  . MET A 1 367 ? 186.159 -24.330 305.990 1.00 58.36  ?  361 MET A CG  1 
ATOM   2762  S SD  . MET A 1 367 ? 184.361 -24.289 306.010 1.00 55.62  ?  361 MET A SD  1 
ATOM   2763  C CE  . MET A 1 367 ? 184.033 -24.276 304.259 1.00 40.13  ?  361 MET A CE  1 
ATOM   2764  N N   . TRP A 1 368 ? 188.889 -20.593 306.027 1.00 48.21  ?  362 TRP A N   1 
ATOM   2765  C CA  . TRP A 1 368 ? 189.512 -19.328 305.663 1.00 43.81  ?  362 TRP A CA  1 
ATOM   2766  C C   . TRP A 1 368 ? 190.999 -19.286 305.988 1.00 50.87  ?  362 TRP A C   1 
ATOM   2767  O O   . TRP A 1 368 ? 191.674 -18.325 305.605 1.00 54.83  ?  362 TRP A O   1 
ATOM   2768  C CB  . TRP A 1 368 ? 188.808 -18.166 306.375 1.00 41.64  ?  362 TRP A CB  1 
ATOM   2769  C CG  . TRP A 1 368 ? 187.407 -17.915 305.910 1.00 43.21  ?  362 TRP A CG  1 
ATOM   2770  C CD1 . TRP A 1 368 ? 186.832 -18.365 304.758 1.00 41.84  ?  362 TRP A CD1 1 
ATOM   2771  C CD2 . TRP A 1 368 ? 186.399 -17.159 306.593 1.00 37.76  ?  362 TRP A CD2 1 
ATOM   2772  N NE1 . TRP A 1 368 ? 185.530 -17.933 304.679 1.00 38.58  ?  362 TRP A NE1 1 
ATOM   2773  C CE2 . TRP A 1 368 ? 185.239 -17.191 305.794 1.00 37.04  ?  362 TRP A CE2 1 
ATOM   2774  C CE3 . TRP A 1 368 ? 186.365 -16.458 307.803 1.00 36.55  ?  362 TRP A CE3 1 
ATOM   2775  C CZ2 . TRP A 1 368 ? 184.060 -16.550 306.164 1.00 36.62  ?  362 TRP A CZ2 1 
ATOM   2776  C CZ3 . TRP A 1 368 ? 185.192 -15.822 308.168 1.00 37.92  ?  362 TRP A CZ3 1 
ATOM   2777  C CH2 . TRP A 1 368 ? 184.056 -15.872 307.352 1.00 38.60  ?  362 TRP A CH2 1 
ATOM   2778  N N   . ARG A 1 369 ? 191.526 -20.296 306.678 1.00 49.75  ?  363 ARG A N   1 
ATOM   2779  C CA  . ARG A 1 369 ? 192.931 -20.326 307.064 1.00 44.44  ?  363 ARG A CA  1 
ATOM   2780  C C   . ARG A 1 369 ? 193.854 -20.749 305.929 1.00 50.15  ?  363 ARG A C   1 
ATOM   2781  O O   . ARG A 1 369 ? 195.039 -20.995 306.176 1.00 60.68  ?  363 ARG A O   1 
ATOM   2782  C CB  . ARG A 1 369 ? 193.126 -21.260 308.262 1.00 50.85  ?  363 ARG A CB  1 
ATOM   2783  C CG  . ARG A 1 369 ? 193.685 -20.575 309.497 1.00 53.18  ?  363 ARG A CG  1 
ATOM   2784  C CD  . ARG A 1 369 ? 195.126 -20.130 309.293 1.00 51.57  ?  363 ARG A CD  1 
ATOM   2785  N NE  . ARG A 1 369 ? 196.060 -21.252 309.308 1.00 48.50  ?  363 ARG A NE  1 
ATOM   2786  C CZ  . ARG A 1 369 ? 197.378 -21.129 309.187 1.00 55.51  ?  363 ARG A CZ  1 
ATOM   2787  N NH1 . ARG A 1 369 ? 197.924 -19.929 309.040 1.00 46.69  1  363 ARG A NH1 1 
ATOM   2788  N NH2 . ARG A 1 369 ? 198.151 -22.206 309.213 1.00 65.23  ?  363 ARG A NH2 1 
ATOM   2789  N N   . GLY A 1 370 ? 193.348 -20.842 304.703 1.00 48.44  ?  364 GLY A N   1 
ATOM   2790  C CA  . GLY A 1 370 ? 194.178 -21.232 303.583 1.00 53.31  ?  364 GLY A CA  1 
ATOM   2791  C C   . GLY A 1 370 ? 193.436 -21.248 302.264 1.00 47.45  ?  364 GLY A C   1 
ATOM   2792  O O   . GLY A 1 370 ? 192.335 -21.798 302.168 1.00 52.59  ?  364 GLY A O   1 
ATOM   2793  N N   . GLY A 1 371 ? 194.031 -20.645 301.239 1.00 44.02  ?  365 GLY A N   1 
ATOM   2794  C CA  . GLY A 1 371 ? 193.426 -20.628 299.924 1.00 43.80  ?  365 GLY A CA  1 
ATOM   2795  C C   . GLY A 1 371 ? 192.746 -19.318 299.587 1.00 45.05  ?  365 GLY A C   1 
ATOM   2796  O O   . GLY A 1 371 ? 192.936 -18.780 298.493 1.00 41.05  ?  365 GLY A O   1 
ATOM   2797  N N   . CYS A 1 372 ? 191.959 -18.790 300.521 1.00 42.83  ?  366 CYS A N   1 
ATOM   2798  C CA  . CYS A 1 372 ? 191.200 -17.574 300.270 1.00 39.31  ?  366 CYS A CA  1 
ATOM   2799  C C   . CYS A 1 372 ? 192.123 -16.356 300.288 1.00 41.01  ?  366 CYS A C   1 
ATOM   2800  O O   . CYS A 1 372 ? 193.346 -16.461 300.408 1.00 45.73  ?  366 CYS A O   1 
ATOM   2801  C CB  . CYS A 1 372 ? 190.083 -17.426 301.297 1.00 44.21  ?  366 CYS A CB  1 
ATOM   2802  S SG  . CYS A 1 372 ? 190.658 -17.112 302.974 1.00 58.23  ?  366 CYS A SG  1 
ATOM   2803  N N   . ILE A 1 373 ? 191.515 -15.175 300.169 1.00 44.11  ?  367 ILE A N   1 
ATOM   2804  C CA  . ILE A 1 373 ? 192.289 -13.940 300.103 1.00 42.54  ?  367 ILE A CA  1 
ATOM   2805  C C   . ILE A 1 373 ? 192.634 -13.439 301.501 1.00 45.47  ?  367 ILE A C   1 
ATOM   2806  O O   . ILE A 1 373 ? 193.730 -12.915 301.731 1.00 47.49  ?  367 ILE A O   1 
ATOM   2807  C CB  . ILE A 1 373 ? 191.524 -12.882 299.283 1.00 34.51  ?  367 ILE A CB  1 
ATOM   2808  C CG1 . ILE A 1 373 ? 191.625 -13.182 297.784 1.00 43.30  ?  367 ILE A CG1 1 
ATOM   2809  C CG2 . ILE A 1 373 ? 192.043 -11.480 299.573 1.00 37.12  ?  367 ILE A CG2 1 
ATOM   2810  C CD1 . ILE A 1 373 ? 190.625 -14.201 297.276 1.00 49.43  ?  367 ILE A CD1 1 
ATOM   2811  N N   . ILE A 1 374 ? 191.725 -13.610 302.460 1.00 37.01  ?  368 ILE A N   1 
ATOM   2812  C CA  . ILE A 1 374 ? 191.940 -13.116 303.816 1.00 40.48  ?  368 ILE A CA  1 
ATOM   2813  C C   . ILE A 1 374 ? 192.744 -14.124 304.626 1.00 43.08  ?  368 ILE A C   1 
ATOM   2814  O O   . ILE A 1 374 ? 192.778 -14.052 305.860 1.00 35.16  ?  368 ILE A O   1 
ATOM   2815  C CB  . ILE A 1 374 ? 190.604 -12.803 304.515 1.00 41.51  ?  368 ILE A CB  1 
ATOM   2816  C CG1 . ILE A 1 374 ? 189.762 -14.071 304.664 1.00 41.10  ?  368 ILE A CG1 1 
ATOM   2817  C CG2 . ILE A 1 374 ? 189.840 -11.745 303.747 1.00 36.64  ?  368 ILE A CG2 1 
ATOM   2818  C CD1 . ILE A 1 374 ? 188.498 -13.871 305.472 1.00 37.93  ?  368 ILE A CD1 1 
ATOM   2819  N N   . ARG A 1 375 ? 193.395 -15.067 303.944 1.00 45.40  ?  369 ARG A N   1 
ATOM   2820  C CA  . ARG A 1 375 ? 194.174 -16.081 304.643 1.00 41.55  ?  369 ARG A CA  1 
ATOM   2821  C C   . ARG A 1 375 ? 195.306 -15.435 305.432 1.00 46.54  ?  369 ARG A C   1 
ATOM   2822  O O   . ARG A 1 375 ? 195.970 -14.507 304.959 1.00 39.91  ?  369 ARG A O   1 
ATOM   2823  C CB  . ARG A 1 375 ? 194.729 -17.112 303.655 1.00 37.41  ?  369 ARG A CB  1 
ATOM   2824  C CG  . ARG A 1 375 ? 195.669 -16.557 302.598 1.00 42.64  ?  369 ARG A CG  1 
ATOM   2825  C CD  . ARG A 1 375 ? 196.323 -17.685 301.816 1.00 39.14  ?  369 ARG A CD  1 
ATOM   2826  N NE  . ARG A 1 375 ? 197.137 -17.202 300.704 1.00 40.00  ?  369 ARG A NE  1 
ATOM   2827  C CZ  . ARG A 1 375 ? 196.707 -17.111 299.450 1.00 43.48  ?  369 ARG A CZ  1 
ATOM   2828  N NH1 . ARG A 1 375 ? 195.468 -17.471 299.145 1.00 43.79  1  369 ARG A NH1 1 
ATOM   2829  N NH2 . ARG A 1 375 ? 197.516 -16.665 298.500 1.00 39.59  ?  369 ARG A NH2 1 
ATOM   2830  N N   . SER A 1 376 ? 195.514 -15.928 306.649 1.00 45.27  ?  370 SER A N   1 
ATOM   2831  C CA  . SER A 1 376 ? 196.469 -15.342 307.579 1.00 43.41  ?  370 SER A CA  1 
ATOM   2832  C C   . SER A 1 376 ? 196.636 -16.280 308.762 1.00 46.49  ?  370 SER A C   1 
ATOM   2833  O O   . SER A 1 376 ? 195.720 -17.035 309.099 1.00 43.77  ?  370 SER A O   1 
ATOM   2834  C CB  . SER A 1 376 ? 196.002 -13.964 308.064 1.00 40.20  ?  370 SER A CB  1 
ATOM   2835  O OG  . SER A 1 376 ? 194.706 -14.033 308.634 1.00 46.73  ?  370 SER A OG  1 
ATOM   2836  N N   . VAL A 1 377 ? 197.810 -16.215 309.396 1.00 48.12  ?  371 VAL A N   1 
ATOM   2837  C CA  . VAL A 1 377 ? 198.011 -16.960 310.632 1.00 48.04  ?  371 VAL A CA  1 
ATOM   2838  C C   . VAL A 1 377 ? 197.111 -16.429 311.739 1.00 47.95  ?  371 VAL A C   1 
ATOM   2839  O O   . VAL A 1 377 ? 196.867 -17.131 312.728 1.00 45.97  ?  371 VAL A O   1 
ATOM   2840  C CB  . VAL A 1 377 ? 199.490 -16.919 311.063 1.00 41.02  ?  371 VAL A CB  1 
ATOM   2841  C CG1 . VAL A 1 377 ? 200.397 -17.205 309.876 1.00 41.22  ?  371 VAL A CG1 1 
ATOM   2842  C CG2 . VAL A 1 377 ? 199.830 -15.579 311.698 1.00 45.82  ?  371 VAL A CG2 1 
ATOM   2843  N N   . PHE A 1 378 ? 196.610 -15.199 311.594 1.00 48.38  ?  372 PHE A N   1 
ATOM   2844  C CA  . PHE A 1 378 ? 195.658 -14.656 312.556 1.00 42.74  ?  372 PHE A CA  1 
ATOM   2845  C C   . PHE A 1 378 ? 194.355 -15.443 312.553 1.00 45.37  ?  372 PHE A C   1 
ATOM   2846  O O   . PHE A 1 378 ? 193.715 -15.587 313.602 1.00 46.35  ?  372 PHE A O   1 
ATOM   2847  C CB  . PHE A 1 378 ? 195.400 -13.180 312.250 1.00 42.42  ?  372 PHE A CB  1 
ATOM   2848  C CG  . PHE A 1 378 ? 194.190 -12.618 312.937 1.00 42.35  ?  372 PHE A CG  1 
ATOM   2849  C CD1 . PHE A 1 378 ? 194.222 -12.313 314.287 1.00 46.41  ?  372 PHE A CD1 1 
ATOM   2850  C CD2 . PHE A 1 378 ? 193.023 -12.382 312.229 1.00 45.91  ?  372 PHE A CD2 1 
ATOM   2851  C CE1 . PHE A 1 378 ? 193.111 -11.792 314.920 1.00 41.65  ?  372 PHE A CE1 1 
ATOM   2852  C CE2 . PHE A 1 378 ? 191.908 -11.861 312.856 1.00 44.52  ?  372 PHE A CE2 1 
ATOM   2853  C CZ  . PHE A 1 378 ? 191.953 -11.566 314.204 1.00 48.78  ?  372 PHE A CZ  1 
ATOM   2854  N N   . LEU A 1 379 ? 193.946 -15.958 311.391 1.00 49.21  ?  373 LEU A N   1 
ATOM   2855  C CA  . LEU A 1 379 ? 192.763 -16.807 311.328 1.00 51.25  ?  373 LEU A CA  1 
ATOM   2856  C C   . LEU A 1 379 ? 192.975 -18.144 312.024 1.00 49.17  ?  373 LEU A C   1 
ATOM   2857  O O   . LEU A 1 379 ? 191.995 -18.783 312.422 1.00 48.51  ?  373 LEU A O   1 
ATOM   2858  C CB  . LEU A 1 379 ? 192.356 -17.032 309.871 1.00 42.88  ?  373 LEU A CB  1 
ATOM   2859  C CG  . LEU A 1 379 ? 191.234 -16.125 309.368 1.00 39.75  ?  373 LEU A CG  1 
ATOM   2860  C CD1 . LEU A 1 379 ? 191.262 -16.029 307.857 1.00 44.56  ?  373 LEU A CD1 1 
ATOM   2861  C CD2 . LEU A 1 379 ? 189.887 -16.644 309.846 1.00 36.86  ?  373 LEU A CD2 1 
ATOM   2862  N N   . GLY A 1 380 ? 194.226 -18.581 312.176 1.00 50.87  ?  374 GLY A N   1 
ATOM   2863  C CA  . GLY A 1 380 ? 194.482 -19.790 312.939 1.00 50.95  ?  374 GLY A CA  1 
ATOM   2864  C C   . GLY A 1 380 ? 194.188 -19.611 314.415 1.00 48.31  ?  374 GLY A C   1 
ATOM   2865  O O   . GLY A 1 380 ? 193.654 -20.514 315.065 1.00 42.68  ?  374 GLY A O   1 
ATOM   2866  N N   . LYS A 1 381 ? 194.530 -18.442 314.964 1.00 51.41  ?  375 LYS A N   1 
ATOM   2867  C CA  . LYS A 1 381 ? 194.222 -18.159 316.361 1.00 49.96  ?  375 LYS A CA  1 
ATOM   2868  C C   . LYS A 1 381 ? 192.719 -18.123 316.603 1.00 50.12  ?  375 LYS A C   1 
ATOM   2869  O O   . LYS A 1 381 ? 192.260 -18.441 317.707 1.00 46.86  ?  375 LYS A O   1 
ATOM   2870  C CB  . LYS A 1 381 ? 194.857 -16.833 316.782 1.00 47.04  ?  375 LYS A CB  1 
ATOM   2871  C CG  . LYS A 1 381 ? 196.336 -16.700 316.437 1.00 48.41  ?  375 LYS A CG  1 
ATOM   2872  C CD  . LYS A 1 381 ? 197.198 -17.664 317.238 1.00 51.67  ?  375 LYS A CD  1 
ATOM   2873  C CE  . LYS A 1 381 ? 198.675 -17.450 316.938 1.00 52.55  ?  375 LYS A CE  1 
ATOM   2874  N NZ  . LYS A 1 381 ? 199.553 -18.355 317.732 1.00 50.70  1  375 LYS A NZ  1 
ATOM   2875  N N   . ILE A 1 382 ? 191.940 -17.737 315.590 1.00 53.97  ?  376 ILE A N   1 
ATOM   2876  C CA  . ILE A 1 382 ? 190.486 -17.740 315.724 1.00 49.24  ?  376 ILE A CA  1 
ATOM   2877  C C   . ILE A 1 382 ? 189.966 -19.167 315.844 1.00 46.10  ?  376 ILE A C   1 
ATOM   2878  O O   . ILE A 1 382 ? 189.015 -19.435 316.588 1.00 44.92  ?  376 ILE A O   1 
ATOM   2879  C CB  . ILE A 1 382 ? 189.838 -16.992 314.543 1.00 50.52  ?  376 ILE A CB  1 
ATOM   2880  C CG1 . ILE A 1 382 ? 190.228 -15.512 314.570 1.00 49.83  ?  376 ILE A CG1 1 
ATOM   2881  C CG2 . ILE A 1 382 ? 188.324 -17.144 314.569 1.00 48.47  ?  376 ILE A CG2 1 
ATOM   2882  C CD1 . ILE A 1 382 ? 189.442 -14.650 313.607 1.00 43.43  ?  376 ILE A CD1 1 
ATOM   2883  N N   . LYS A 1 383 ? 190.583 -20.107 315.121 1.00 52.94  ?  377 LYS A N   1 
ATOM   2884  C CA  . LYS A 1 383 ? 190.189 -21.507 315.244 1.00 54.18  ?  377 LYS A CA  1 
ATOM   2885  C C   . LYS A 1 383 ? 190.401 -22.012 316.665 1.00 55.69  ?  377 LYS A C   1 
ATOM   2886  O O   . LYS A 1 383 ? 189.549 -22.720 317.214 1.00 57.33  ?  377 LYS A O   1 
ATOM   2887  C CB  . LYS A 1 383 ? 190.971 -22.367 314.250 1.00 53.77  ?  377 LYS A CB  1 
ATOM   2888  C CG  . LYS A 1 383 ? 190.532 -23.822 314.225 1.00 57.63  ?  377 LYS A CG  1 
ATOM   2889  C CD  . LYS A 1 383 ? 191.473 -24.677 313.392 1.00 60.44  ?  377 LYS A CD  1 
ATOM   2890  C CE  . LYS A 1 383 ? 190.946 -26.097 313.249 1.00 62.91  ?  377 LYS A CE  1 
ATOM   2891  N NZ  . LYS A 1 383 ? 190.681 -26.735 314.568 1.00 69.32  1  377 LYS A NZ  1 
ATOM   2892  N N   . ASP A 1 384 ? 191.531 -21.650 317.279 1.00 54.27  ?  378 ASP A N   1 
ATOM   2893  C CA  . ASP A 1 384 ? 191.765 -22.016 318.671 1.00 47.90  ?  378 ASP A CA  1 
ATOM   2894  C C   . ASP A 1 384 ? 190.729 -21.392 319.594 1.00 53.04  ?  378 ASP A C   1 
ATOM   2895  O O   . ASP A 1 384 ? 190.341 -22.004 320.595 1.00 53.04  ?  378 ASP A O   1 
ATOM   2896  C CB  . ASP A 1 384 ? 193.171 -21.591 319.094 1.00 57.53  ?  378 ASP A CB  1 
ATOM   2897  C CG  . ASP A 1 384 ? 194.196 -21.801 318.000 1.00 64.18  ?  378 ASP A CG  1 
ATOM   2898  O OD1 . ASP A 1 384 ? 193.921 -22.590 317.071 1.00 66.68  ?  378 ASP A OD1 1 
ATOM   2899  O OD2 . ASP A 1 384 ? 195.277 -21.177 318.070 1.00 64.53  -1 378 ASP A OD2 1 
ATOM   2900  N N   . ALA A 1 385 ? 190.271 -20.178 319.275 1.00 57.30  ?  379 ALA A N   1 
ATOM   2901  C CA  . ALA A 1 385 ? 189.257 -19.527 320.098 1.00 58.44  ?  379 ALA A CA  1 
ATOM   2902  C C   . ALA A 1 385 ? 187.966 -20.333 320.125 1.00 54.70  ?  379 ALA A C   1 
ATOM   2903  O O   . ALA A 1 385 ? 187.324 -20.455 321.175 1.00 58.69  ?  379 ALA A O   1 
ATOM   2904  C CB  . ALA A 1 385 ? 188.991 -18.113 319.583 1.00 51.79  ?  379 ALA A CB  1 
ATOM   2905  N N   . PHE A 1 386 ? 187.568 -20.889 318.982 1.00 52.48  ?  380 PHE A N   1 
ATOM   2906  C CA  . PHE A 1 386 ? 186.352 -21.685 318.913 1.00 55.00  ?  380 PHE A CA  1 
ATOM   2907  C C   . PHE A 1 386 ? 186.590 -23.163 319.191 1.00 58.51  ?  380 PHE A C   1 
ATOM   2908  O O   . PHE A 1 386 ? 185.631 -23.884 319.483 1.00 57.29  ?  380 PHE A O   1 
ATOM   2909  C CB  . PHE A 1 386 ? 185.686 -21.520 317.544 1.00 50.36  ?  380 PHE A CB  1 
ATOM   2910  C CG  . PHE A 1 386 ? 185.115 -20.149 317.310 1.00 43.81  ?  380 PHE A CG  1 
ATOM   2911  C CD1 . PHE A 1 386 ? 183.889 -19.795 317.849 1.00 45.19  ?  380 PHE A CD1 1 
ATOM   2912  C CD2 . PHE A 1 386 ? 185.801 -19.216 316.550 1.00 43.08  ?  380 PHE A CD2 1 
ATOM   2913  C CE1 . PHE A 1 386 ? 183.359 -18.537 317.638 1.00 41.56  ?  380 PHE A CE1 1 
ATOM   2914  C CE2 . PHE A 1 386 ? 185.276 -17.955 316.335 1.00 41.35  ?  380 PHE A CE2 1 
ATOM   2915  C CZ  . PHE A 1 386 ? 184.053 -17.616 316.880 1.00 43.25  ?  380 PHE A CZ  1 
ATOM   2916  N N   . ASP A 1 387 ? 187.834 -23.636 319.105 1.00 57.35  ?  381 ASP A N   1 
ATOM   2917  C CA  . ASP A 1 387 ? 188.120 -24.993 319.559 1.00 59.95  ?  381 ASP A CA  1 
ATOM   2918  C C   . ASP A 1 387 ? 188.071 -25.077 321.079 1.00 66.30  ?  381 ASP A C   1 
ATOM   2919  O O   . ASP A 1 387 ? 187.633 -26.090 321.638 1.00 66.96  ?  381 ASP A O   1 
ATOM   2920  C CB  . ASP A 1 387 ? 189.479 -25.457 319.034 1.00 57.65  ?  381 ASP A CB  1 
ATOM   2921  C CG  . ASP A 1 387 ? 189.461 -25.749 317.546 1.00 64.15  ?  381 ASP A CG  1 
ATOM   2922  O OD1 . ASP A 1 387 ? 188.370 -26.025 317.004 1.00 61.72  ?  381 ASP A OD1 1 
ATOM   2923  O OD2 . ASP A 1 387 ? 190.541 -25.706 316.919 1.00 61.75  -1 381 ASP A OD2 1 
ATOM   2924  N N   . ARG A 1 388 ? 188.512 -24.018 321.763 1.00 64.99  ?  382 ARG A N   1 
ATOM   2925  C CA  . ARG A 1 388 ? 188.399 -23.977 323.217 1.00 62.35  ?  382 ARG A CA  1 
ATOM   2926  C C   . ARG A 1 388 ? 186.954 -23.789 323.661 1.00 64.59  ?  382 ARG A C   1 
ATOM   2927  O O   . ARG A 1 388 ? 186.577 -24.246 324.746 1.00 74.32  ?  382 ARG A O   1 
ATOM   2928  C CB  . ARG A 1 388 ? 189.277 -22.858 323.782 1.00 66.25  ?  382 ARG A CB  1 
ATOM   2929  C CG  . ARG A 1 388 ? 190.769 -23.051 323.553 1.00 70.06  ?  382 ARG A CG  1 
ATOM   2930  C CD  . ARG A 1 388 ? 191.584 -21.956 324.229 1.00 71.41  ?  382 ARG A CD  1 
ATOM   2931  N NE  . ARG A 1 388 ? 191.407 -20.649 323.599 1.00 73.19  ?  382 ARG A NE  1 
ATOM   2932  C CZ  . ARG A 1 388 ? 192.292 -20.088 322.779 1.00 72.79  ?  382 ARG A CZ  1 
ATOM   2933  N NH1 . ARG A 1 388 ? 193.423 -20.717 322.490 1.00 60.23  1  382 ARG A NH1 1 
ATOM   2934  N NH2 . ARG A 1 388 ? 192.049 -18.895 322.252 1.00 66.40  ?  382 ARG A NH2 1 
ATOM   2935  N N   . ASN A 1 389 ? 186.137 -23.129 322.842 1.00 59.32  ?  383 ASN A N   1 
ATOM   2936  C CA  . ASN A 1 389 ? 184.734 -22.881 323.176 1.00 62.56  ?  383 ASN A CA  1 
ATOM   2937  C C   . ASN A 1 389 ? 183.955 -22.708 321.883 1.00 64.31  ?  383 ASN A C   1 
ATOM   2938  O O   . ASN A 1 389 ? 183.869 -21.602 321.332 1.00 63.25  ?  383 ASN A O   1 
ATOM   2939  C CB  . ASN A 1 389 ? 184.575 -21.655 324.074 1.00 62.35  ?  383 ASN A CB  1 
ATOM   2940  C CG  . ASN A 1 389 ? 183.124 -21.348 324.396 1.00 65.10  ?  383 ASN A CG  1 
ATOM   2941  O OD1 . ASN A 1 389 ? 182.247 -22.200 324.251 1.00 66.72  ?  383 ASN A OD1 1 
ATOM   2942  N ND2 . ASN A 1 389 ? 182.864 -20.124 324.841 1.00 65.30  ?  383 ASN A ND2 1 
ATOM   2943  N N   . PRO A 1 390 ? 183.371 -23.790 321.360 1.00 65.21  ?  384 PRO A N   1 
ATOM   2944  C CA  . PRO A 1 390 ? 182.600 -23.673 320.111 1.00 65.54  ?  384 PRO A CA  1 
ATOM   2945  C C   . PRO A 1 390 ? 181.334 -22.844 320.248 1.00 63.60  ?  384 PRO A C   1 
ATOM   2946  O O   . PRO A 1 390 ? 180.810 -22.378 319.228 1.00 63.96  ?  384 PRO A O   1 
ATOM   2947  C CB  . PRO A 1 390 ? 182.281 -25.132 319.756 1.00 64.10  ?  384 PRO A CB  1 
ATOM   2948  C CG  . PRO A 1 390 ? 183.285 -25.948 320.517 1.00 61.01  ?  384 PRO A CG  1 
ATOM   2949  C CD  . PRO A 1 390 ? 183.535 -25.190 321.783 1.00 65.32  ?  384 PRO A CD  1 
ATOM   2950  N N   . GLU A 1 391 ? 180.828 -22.646 321.459 1.00 58.98  ?  385 GLU A N   1 
ATOM   2951  C CA  . GLU A 1 391 ? 179.677 -21.772 321.695 1.00 60.11  ?  385 GLU A CA  1 
ATOM   2952  C C   . GLU A 1 391 ? 180.119 -20.442 322.291 1.00 65.49  ?  385 GLU A C   1 
ATOM   2953  O O   . GLU A 1 391 ? 179.602 -19.984 323.310 1.00 68.36  ?  385 GLU A O   1 
ATOM   2954  C CB  . GLU A 1 391 ? 178.660 -22.466 322.593 1.00 73.93  ?  385 GLU A CB  1 
ATOM   2955  C CG  . GLU A 1 391 ? 178.161 -23.796 322.045 1.00 77.48  ?  385 GLU A CG  1 
ATOM   2956  C CD  . GLU A 1 391 ? 176.658 -23.953 322.168 1.00 90.05  ?  385 GLU A CD  1 
ATOM   2957  O OE1 . GLU A 1 391 ? 175.940 -22.942 322.016 1.00 85.39  ?  385 GLU A OE1 1 
ATOM   2958  O OE2 . GLU A 1 391 ? 176.194 -25.086 322.419 1.00 91.05  -1 385 GLU A OE2 1 
ATOM   2959  N N   . LEU A 1 392 ? 181.098 -19.812 321.645 1.00 66.17  ?  386 LEU A N   1 
ATOM   2960  C CA  . LEU A 1 392 ? 181.639 -18.540 322.107 1.00 53.93  ?  386 LEU A CA  1 
ATOM   2961  C C   . LEU A 1 392 ? 180.731 -17.405 321.646 1.00 50.79  ?  386 LEU A C   1 
ATOM   2962  O O   . LEU A 1 392 ? 180.518 -17.222 320.442 1.00 59.32  ?  386 LEU A O   1 
ATOM   2963  C CB  . LEU A 1 392 ? 183.060 -18.354 321.583 1.00 52.06  ?  386 LEU A CB  1 
ATOM   2964  C CG  . LEU A 1 392 ? 183.806 -17.088 322.007 1.00 58.63  ?  386 LEU A CG  1 
ATOM   2965  C CD1 . LEU A 1 392 ? 183.858 -16.966 323.523 1.00 64.68  ?  386 LEU A CD1 1 
ATOM   2966  C CD2 . LEU A 1 392 ? 185.208 -17.075 321.416 1.00 53.23  ?  386 LEU A CD2 1 
ATOM   2967  N N   . GLN A 1 393 ? 180.200 -16.642 322.603 1.00 52.22  ?  387 GLN A N   1 
ATOM   2968  C CA  . GLN A 1 393 ? 179.219 -15.613 322.279 1.00 62.15  ?  387 GLN A CA  1 
ATOM   2969  C C   . GLN A 1 393 ? 179.839 -14.409 321.581 1.00 57.22  ?  387 GLN A C   1 
ATOM   2970  O O   . GLN A 1 393 ? 179.118 -13.662 320.910 1.00 62.82  ?  387 GLN A O   1 
ATOM   2971  C CB  . GLN A 1 393 ? 178.491 -15.169 323.552 1.00 67.08  ?  387 GLN A CB  1 
ATOM   2972  C CG  . GLN A 1 393 ? 177.206 -14.381 323.312 1.00 71.15  ?  387 GLN A CG  1 
ATOM   2973  C CD  . GLN A 1 393 ? 176.090 -15.224 322.716 1.00 79.47  ?  387 GLN A CD  1 
ATOM   2974  O OE1 . GLN A 1 393 ? 176.202 -16.446 322.608 1.00 74.16  ?  387 GLN A OE1 1 
ATOM   2975  N NE2 . GLN A 1 393 ? 175.001 -14.569 322.327 1.00 74.59  ?  387 GLN A NE2 1 
ATOM   2976  N N   . ASN A 1 394 ? 181.147 -14.204 321.713 1.00 53.59  ?  388 ASN A N   1 
ATOM   2977  C CA  . ASN A 1 394 ? 181.804 -13.084 321.054 1.00 51.83  ?  388 ASN A CA  1 
ATOM   2978  C C   . ASN A 1 394 ? 183.301 -13.346 321.000 1.00 47.59  ?  388 ASN A C   1 
ATOM   2979  O O   . ASN A 1 394 ? 183.876 -13.928 321.923 1.00 48.09  ?  388 ASN A O   1 
ATOM   2980  C CB  . ASN A 1 394 ? 181.525 -11.761 321.775 1.00 50.26  ?  388 ASN A CB  1 
ATOM   2981  C CG  . ASN A 1 394 ? 181.955 -10.556 320.964 1.00 46.08  ?  388 ASN A CG  1 
ATOM   2982  O OD1 . ASN A 1 394 ? 183.146 -10.278 320.829 1.00 41.83  ?  388 ASN A OD1 1 
ATOM   2983  N ND2 . ASN A 1 394 ? 180.984 -9.831  320.420 1.00 45.20  ?  388 ASN A ND2 1 
ATOM   2984  N N   . LEU A 1 395 ? 183.926 -12.894 319.910 1.00 47.77  ?  389 LEU A N   1 
ATOM   2985  C CA  . LEU A 1 395 ? 185.362 -13.095 319.746 1.00 43.91  ?  389 LEU A CA  1 
ATOM   2986  C C   . LEU A 1 395 ? 186.166 -12.281 320.752 1.00 49.50  ?  389 LEU A C   1 
ATOM   2987  O O   . LEU A 1 395 ? 187.286 -12.668 321.104 1.00 51.20  ?  389 LEU A O   1 
ATOM   2988  C CB  . LEU A 1 395 ? 185.784 -12.739 318.320 1.00 44.02  ?  389 LEU A CB  1 
ATOM   2989  C CG  . LEU A 1 395 ? 186.603 -13.775 317.543 1.00 44.20  ?  389 LEU A CG  1 
ATOM   2990  C CD1 . LEU A 1 395 ? 187.857 -13.139 316.955 1.00 45.32  ?  389 LEU A CD1 1 
ATOM   2991  C CD2 . LEU A 1 395 ? 186.957 -14.980 318.406 1.00 44.93  ?  389 LEU A CD2 1 
ATOM   2992  N N   . LEU A 1 396 ? 185.619 -11.157 321.222 1.00 50.22  ?  390 LEU A N   1 
ATOM   2993  C CA  . LEU A 1 396 ? 186.315 -10.353 322.220 1.00 46.76  ?  390 LEU A CA  1 
ATOM   2994  C C   . LEU A 1 396 ? 186.338 -11.021 323.588 1.00 50.83  ?  390 LEU A C   1 
ATOM   2995  O O   . LEU A 1 396 ? 187.226 -10.723 324.394 1.00 62.51  ?  390 LEU A O   1 
ATOM   2996  C CB  . LEU A 1 396 ? 185.670 -8.970  322.326 1.00 48.42  ?  390 LEU A CB  1 
ATOM   2997  C CG  . LEU A 1 396 ? 185.794 -8.069  321.096 1.00 43.76  ?  390 LEU A CG  1 
ATOM   2998  C CD1 . LEU A 1 396 ? 184.964 -6.807  321.263 1.00 37.39  ?  390 LEU A CD1 1 
ATOM   2999  C CD2 . LEU A 1 396 ? 187.251 -7.722  320.841 1.00 39.26  ?  390 LEU A CD2 1 
ATOM   3000  N N   . LEU A 1 397 ? 185.391 -11.915 323.866 1.00 48.51  ?  391 LEU A N   1 
ATOM   3001  C CA  . LEU A 1 397 ? 185.340 -12.626 325.142 1.00 50.81  ?  391 LEU A CA  1 
ATOM   3002  C C   . LEU A 1 397 ? 186.392 -13.725 325.256 1.00 52.54  ?  391 LEU A C   1 
ATOM   3003  O O   . LEU A 1 397 ? 186.371 -14.458 326.253 1.00 60.50  ?  391 LEU A O   1 
ATOM   3004  C CB  . LEU A 1 397 ? 183.946 -13.218 325.356 1.00 57.15  ?  391 LEU A CB  1 
ATOM   3005  C CG  . LEU A 1 397 ? 182.789 -12.223 325.469 1.00 56.62  ?  391 LEU A CG  1 
ATOM   3006  C CD1 . LEU A 1 397 ? 181.471 -12.951 325.690 1.00 58.53  ?  391 LEU A CD1 1 
ATOM   3007  C CD2 . LEU A 1 397 ? 183.047 -11.225 326.587 1.00 59.60  ?  391 LEU A CD2 1 
ATOM   3008  N N   . ASP A 1 398 ? 187.293 -13.869 324.289 1.00 52.23  ?  392 ASP A N   1 
ATOM   3009  C CA  . ASP A 1 398 ? 188.351 -14.865 324.356 1.00 59.94  ?  392 ASP A CA  1 
ATOM   3010  C C   . ASP A 1 398 ? 189.616 -14.252 324.947 1.00 64.13  ?  392 ASP A C   1 
ATOM   3011  O O   . ASP A 1 398 ? 189.880 -13.057 324.791 1.00 65.16  ?  392 ASP A O   1 
ATOM   3012  C CB  . ASP A 1 398 ? 188.648 -15.437 322.968 1.00 59.73  ?  392 ASP A CB  1 
ATOM   3013  C CG  . ASP A 1 398 ? 189.659 -16.567 323.006 1.00 68.85  ?  392 ASP A CG  1 
ATOM   3014  O OD1 . ASP A 1 398 ? 189.883 -17.134 324.096 1.00 74.57  ?  392 ASP A OD1 1 
ATOM   3015  O OD2 . ASP A 1 398 ? 190.238 -16.882 321.946 1.00 67.19  -1 392 ASP A OD2 1 
ATOM   3016  N N   . ASP A 1 399 ? 190.402 -15.093 325.624 1.00 65.94  ?  393 ASP A N   1 
ATOM   3017  C CA  . ASP A 1 399 ? 191.600 -14.611 326.308 1.00 70.58  ?  393 ASP A CA  1 
ATOM   3018  C C   . ASP A 1 399 ? 192.641 -14.096 325.321 1.00 65.10  ?  393 ASP A C   1 
ATOM   3019  O O   . ASP A 1 399 ? 193.240 -13.036 325.536 1.00 63.32  ?  393 ASP A O   1 
ATOM   3020  C CB  . ASP A 1 399 ? 192.189 -15.722 327.178 1.00 71.01  ?  393 ASP A CB  1 
ATOM   3021  C CG  . ASP A 1 399 ? 191.771 -15.607 328.629 1.00 76.12  ?  393 ASP A CG  1 
ATOM   3022  O OD1 . ASP A 1 399 ? 190.572 -15.796 328.923 1.00 77.04  ?  393 ASP A OD1 1 
ATOM   3023  O OD2 . ASP A 1 399 ? 192.645 -15.325 329.476 1.00 89.01  -1 393 ASP A OD2 1 
ATOM   3024  N N   . PHE A 1 400 ? 192.877 -14.838 324.235 1.00 59.28  ?  394 PHE A N   1 
ATOM   3025  C CA  . PHE A 1 400 ? 193.901 -14.436 323.275 1.00 53.94  ?  394 PHE A CA  1 
ATOM   3026  C C   . PHE A 1 400 ? 193.583 -13.080 322.658 1.00 56.96  ?  394 PHE A C   1 
ATOM   3027  O O   . PHE A 1 400 ? 194.486 -12.268 322.426 1.00 61.06  ?  394 PHE A O   1 
ATOM   3028  C CB  . PHE A 1 400 ? 194.047 -15.497 322.182 1.00 56.08  ?  394 PHE A CB  1 
ATOM   3029  C CG  . PHE A 1 400 ? 195.126 -15.190 321.176 1.00 57.72  ?  394 PHE A CG  1 
ATOM   3030  C CD1 . PHE A 1 400 ? 196.421 -15.639 321.372 1.00 58.54  ?  394 PHE A CD1 1 
ATOM   3031  C CD2 . PHE A 1 400 ? 194.843 -14.457 320.033 1.00 59.58  ?  394 PHE A CD2 1 
ATOM   3032  C CE1 . PHE A 1 400 ? 197.415 -15.360 320.451 1.00 59.91  ?  394 PHE A CE1 1 
ATOM   3033  C CE2 . PHE A 1 400 ? 195.833 -14.174 319.110 1.00 55.75  ?  394 PHE A CE2 1 
ATOM   3034  C CZ  . PHE A 1 400 ? 197.119 -14.627 319.319 1.00 54.25  ?  394 PHE A CZ  1 
ATOM   3035  N N   . PHE A 1 401 ? 192.306 -12.814 322.389 1.00 60.95  ?  395 PHE A N   1 
ATOM   3036  C CA  . PHE A 1 401 ? 191.918 -11.575 321.728 1.00 58.54  ?  395 PHE A CA  1 
ATOM   3037  C C   . PHE A 1 401 ? 191.663 -10.435 322.702 1.00 54.09  ?  395 PHE A C   1 
ATOM   3038  O O   . PHE A 1 401 ? 191.942 -9.278  322.368 1.00 48.12  ?  395 PHE A O   1 
ATOM   3039  C CB  . PHE A 1 401 ? 190.681 -11.810 320.858 1.00 59.37  ?  395 PHE A CB  1 
ATOM   3040  C CG  . PHE A 1 401 ? 190.899 -12.818 319.768 1.00 52.59  ?  395 PHE A CG  1 
ATOM   3041  C CD1 . PHE A 1 401 ? 191.604 -12.476 318.625 1.00 48.88  ?  395 PHE A CD1 1 
ATOM   3042  C CD2 . PHE A 1 401 ? 190.414 -14.108 319.890 1.00 47.17  ?  395 PHE A CD2 1 
ATOM   3043  C CE1 . PHE A 1 401 ? 191.815 -13.402 317.623 1.00 42.38  ?  395 PHE A CE1 1 
ATOM   3044  C CE2 . PHE A 1 401 ? 190.622 -15.037 318.890 1.00 48.88  ?  395 PHE A CE2 1 
ATOM   3045  C CZ  . PHE A 1 401 ? 191.324 -14.683 317.756 1.00 42.97  ?  395 PHE A CZ  1 
ATOM   3046  N N   . LYS A 1 402 ? 191.144 -10.722 323.898 1.00 56.89  ?  396 LYS A N   1 
ATOM   3047  C CA  . LYS A 1 402 ? 190.999 -9.663  324.891 1.00 60.70  ?  396 LYS A CA  1 
ATOM   3048  C C   . LYS A 1 402 ? 192.356 -9.188  325.395 1.00 60.25  ?  396 LYS A C   1 
ATOM   3049  O O   . LYS A 1 402 ? 192.503 -8.019  325.768 1.00 61.17  ?  396 LYS A O   1 
ATOM   3050  C CB  . LYS A 1 402 ? 190.133 -10.134 326.063 1.00 60.23  ?  396 LYS A CB  1 
ATOM   3051  C CG  . LYS A 1 402 ? 190.853 -11.039 327.053 1.00 65.30  ?  396 LYS A CG  1 
ATOM   3052  C CD  . LYS A 1 402 ? 190.080 -11.185 328.351 1.00 69.50  ?  396 LYS A CD  1 
ATOM   3053  C CE  . LYS A 1 402 ? 190.919 -11.895 329.402 1.00 81.21  ?  396 LYS A CE  1 
ATOM   3054  N NZ  . LYS A 1 402 ? 192.210 -11.189 329.644 1.00 60.27  1  396 LYS A NZ  1 
ATOM   3055  N N   . SER A 1 403 ? 193.357 -10.072 325.405 1.00 52.97  ?  397 SER A N   1 
ATOM   3056  C CA  . SER A 1 403 ? 194.697 -9.678  325.824 1.00 55.02  ?  397 SER A CA  1 
ATOM   3057  C C   . SER A 1 403 ? 195.433 -8.951  324.707 1.00 59.33  ?  397 SER A C   1 
ATOM   3058  O O   . SER A 1 403 ? 196.204 -8.021  324.971 1.00 64.47  ?  397 SER A O   1 
ATOM   3059  C CB  . SER A 1 403 ? 195.489 -10.906 326.277 1.00 56.84  ?  397 SER A CB  1 
ATOM   3060  O OG  . SER A 1 403 ? 196.812 -10.554 326.642 1.00 75.92  ?  397 SER A OG  1 
ATOM   3061  N N   . ALA A 1 404 ? 195.211 -9.363  323.457 1.00 56.27  ?  398 ALA A N   1 
ATOM   3062  C CA  . ALA A 1 404 ? 195.822 -8.664  322.332 1.00 51.89  ?  398 ALA A CA  1 
ATOM   3063  C C   . ALA A 1 404 ? 195.262 -7.254  322.193 1.00 47.66  ?  398 ALA A C   1 
ATOM   3064  O O   . ALA A 1 404 ? 195.999 -6.317  321.868 1.00 49.25  ?  398 ALA A O   1 
ATOM   3065  C CB  . ALA A 1 404 ? 195.613 -9.458  321.044 1.00 43.73  ?  398 ALA A CB  1 
ATOM   3066  N N   . VAL A 1 405 ? 193.961 -7.085  322.436 1.00 49.70  ?  399 VAL A N   1 
ATOM   3067  C CA  . VAL A 1 405 ? 193.371 -5.750  322.412 1.00 46.61  ?  399 VAL A CA  1 
ATOM   3068  C C   . VAL A 1 405 ? 193.912 -4.910  323.563 1.00 48.79  ?  399 VAL A C   1 
ATOM   3069  O O   . VAL A 1 405 ? 194.159 -3.707  323.410 1.00 50.44  ?  399 VAL A O   1 
ATOM   3070  C CB  . VAL A 1 405 ? 191.834 -5.847  322.443 1.00 47.69  ?  399 VAL A CB  1 
ATOM   3071  C CG1 . VAL A 1 405 ? 191.212 -4.483  322.692 1.00 45.43  ?  399 VAL A CG1 1 
ATOM   3072  C CG2 . VAL A 1 405 ? 191.318 -6.430  321.137 1.00 42.06  ?  399 VAL A CG2 1 
ATOM   3073  N N   . GLU A 1 406 ? 194.119 -5.530  324.728 1.00 50.83  ?  400 GLU A N   1 
ATOM   3074  C CA  . GLU A 1 406 ? 194.678 -4.804  325.864 1.00 53.07  ?  400 GLU A CA  1 
ATOM   3075  C C   . GLU A 1 406 ? 196.106 -4.350  325.582 1.00 55.88  ?  400 GLU A C   1 
ATOM   3076  O O   . GLU A 1 406 ? 196.497 -3.236  325.952 1.00 52.04  ?  400 GLU A O   1 
ATOM   3077  C CB  . GLU A 1 406 ? 194.631 -5.677  327.118 1.00 54.82  ?  400 GLU A CB  1 
ATOM   3078  C CG  . GLU A 1 406 ? 195.183 -5.005  328.364 1.00 60.56  ?  400 GLU A CG  1 
ATOM   3079  C CD  . GLU A 1 406 ? 194.339 -3.828  328.811 1.00 73.74  ?  400 GLU A CD  1 
ATOM   3080  O OE1 . GLU A 1 406 ? 193.100 -3.893  328.662 1.00 81.17  ?  400 GLU A OE1 1 
ATOM   3081  O OE2 . GLU A 1 406 ? 194.914 -2.837  329.308 1.00 77.10  -1 400 GLU A OE2 1 
ATOM   3082  N N   . ASN A 1 407 ? 196.900 -5.198  324.924 1.00 53.38  ?  401 ASN A N   1 
ATOM   3083  C CA  . ASN A 1 407 ? 198.274 -4.846  324.591 1.00 56.71  ?  401 ASN A CA  1 
ATOM   3084  C C   . ASN A 1 407 ? 198.369 -3.862  323.434 1.00 54.01  ?  401 ASN A C   1 
ATOM   3085  O O   . ASN A 1 407 ? 199.416 -3.225  323.266 1.00 56.88  ?  401 ASN A O   1 
ATOM   3086  C CB  . ASN A 1 407 ? 199.074 -6.107  324.257 1.00 63.58  ?  401 ASN A CB  1 
ATOM   3087  C CG  . ASN A 1 407 ? 199.268 -7.008  325.459 1.00 78.13  ?  401 ASN A CG  1 
ATOM   3088  O OD1 . ASN A 1 407 ? 199.495 -6.534  326.573 1.00 79.23  ?  401 ASN A OD1 1 
ATOM   3089  N ND2 . ASN A 1 407 ? 199.175 -8.314  325.241 1.00 73.90  ?  401 ASN A ND2 1 
ATOM   3090  N N   . CYS A 1 408 ? 197.313 -3.724  322.634 1.00 53.74  ?  402 CYS A N   1 
ATOM   3091  C CA  . CYS A 1 408 ? 197.311 -2.795  321.513 1.00 53.80  ?  402 CYS A CA  1 
ATOM   3092  C C   . CYS A 1 408 ? 196.499 -1.536  321.777 1.00 52.24  ?  402 CYS A C   1 
ATOM   3093  O O   . CYS A 1 408 ? 196.506 -0.633  320.936 1.00 50.18  ?  402 CYS A O   1 
ATOM   3094  C CB  . CYS A 1 408 ? 196.763 -3.483  320.253 1.00 45.24  ?  402 CYS A CB  1 
ATOM   3095  S SG  . CYS A 1 408 ? 197.758 -4.862  319.652 1.00 55.72  ?  402 CYS A SG  1 
ATOM   3096  N N   . GLN A 1 409 ? 195.820 -1.448  322.923 1.00 48.74  ?  403 GLN A N   1 
ATOM   3097  C CA  . GLN A 1 409 ? 194.865 -0.365  323.144 1.00 41.34  ?  403 GLN A CA  1 
ATOM   3098  C C   . GLN A 1 409 ? 195.553 0.994   323.197 1.00 49.01  ?  403 GLN A C   1 
ATOM   3099  O O   . GLN A 1 409 ? 195.066 1.965   322.605 1.00 42.98  ?  403 GLN A O   1 
ATOM   3100  C CB  . GLN A 1 409 ? 194.081 -0.620  324.432 1.00 44.98  ?  403 GLN A CB  1 
ATOM   3101  C CG  . GLN A 1 409 ? 192.904 0.316   324.641 1.00 57.19  ?  403 GLN A CG  1 
ATOM   3102  C CD  . GLN A 1 409 ? 192.103 -0.027  325.880 1.00 56.45  ?  403 GLN A CD  1 
ATOM   3103  O OE1 . GLN A 1 409 ? 190.919 0.295   325.976 1.00 56.21  ?  403 GLN A OE1 1 
ATOM   3104  N NE2 . GLN A 1 409 ? 192.747 -0.683  326.838 1.00 58.59  ?  403 GLN A NE2 1 
ATOM   3105  N N   . ASP A 1 410 ? 196.682 1.086   323.903 1.00 63.89  ?  404 ASP A N   1 
ATOM   3106  C CA  . ASP A 1 410 ? 197.351 2.373   324.058 1.00 56.55  ?  404 ASP A CA  1 
ATOM   3107  C C   . ASP A 1 410 ? 197.879 2.883   322.722 1.00 48.84  ?  404 ASP A C   1 
ATOM   3108  O O   . ASP A 1 410 ? 197.687 4.054   322.373 1.00 50.14  ?  404 ASP A O   1 
ATOM   3109  C CB  . ASP A 1 410 ? 198.482 2.257   325.081 1.00 58.86  ?  404 ASP A CB  1 
ATOM   3110  C CG  . ASP A 1 410 ? 199.006 3.609   325.528 1.00 77.64  ?  404 ASP A CG  1 
ATOM   3111  O OD1 . ASP A 1 410 ? 198.418 4.638   325.131 1.00 76.35  ?  404 ASP A OD1 1 
ATOM   3112  O OD2 . ASP A 1 410 ? 200.005 3.644   326.276 1.00 81.11  -1 404 ASP A OD2 1 
ATOM   3113  N N   . SER A 1 411 ? 198.549 2.016   321.960 1.00 43.66  ?  405 SER A N   1 
ATOM   3114  C CA  . SER A 1 411 ? 199.021 2.413   320.638 1.00 51.30  ?  405 SER A CA  1 
ATOM   3115  C C   . SER A 1 411 ? 197.864 2.622   319.670 1.00 50.50  ?  405 SER A C   1 
ATOM   3116  O O   . SER A 1 411 ? 197.976 3.422   318.734 1.00 44.95  ?  405 SER A O   1 
ATOM   3117  C CB  . SER A 1 411 ? 199.990 1.366   320.093 1.00 54.12  ?  405 SER A CB  1 
ATOM   3118  O OG  . SER A 1 411 ? 201.200 1.360   320.831 1.00 60.49  ?  405 SER A OG  1 
ATOM   3119  N N   . TRP A 1 412 ? 196.753 1.911   319.876 1.00 48.33  ?  406 TRP A N   1 
ATOM   3120  C CA  . TRP A 1 412 ? 195.565 2.114   319.052 1.00 48.85  ?  406 TRP A CA  1 
ATOM   3121  C C   . TRP A 1 412 ? 195.045 3.539   319.191 1.00 45.63  ?  406 TRP A C   1 
ATOM   3122  O O   . TRP A 1 412 ? 194.828 4.236   318.194 1.00 43.80  ?  406 TRP A O   1 
ATOM   3123  C CB  . TRP A 1 412 ? 194.487 1.106   319.451 1.00 48.41  ?  406 TRP A CB  1 
ATOM   3124  C CG  . TRP A 1 412 ? 193.361 0.959   318.485 1.00 44.02  ?  406 TRP A CG  1 
ATOM   3125  C CD1 . TRP A 1 412 ? 193.226 1.570   317.273 1.00 46.44  ?  406 TRP A CD1 1 
ATOM   3126  C CD2 . TRP A 1 412 ? 192.203 0.134   318.651 1.00 39.62  ?  406 TRP A CD2 1 
ATOM   3127  N NE1 . TRP A 1 412 ? 192.053 1.178   316.675 1.00 41.21  ?  406 TRP A NE1 1 
ATOM   3128  C CE2 . TRP A 1 412 ? 191.407 0.296   317.501 1.00 39.38  ?  406 TRP A CE2 1 
ATOM   3129  C CE3 . TRP A 1 412 ? 191.762 -0.724  319.662 1.00 38.04  ?  406 TRP A CE3 1 
ATOM   3130  C CZ2 . TRP A 1 412 ? 190.197 -0.370  317.334 1.00 42.84  ?  406 TRP A CZ2 1 
ATOM   3131  C CZ3 . TRP A 1 412 ? 190.561 -1.384  319.495 1.00 40.77  ?  406 TRP A CZ3 1 
ATOM   3132  C CH2 . TRP A 1 412 ? 189.791 -1.203  318.341 1.00 41.37  ?  406 TRP A CH2 1 
ATOM   3133  N N   . ARG A 1 413 ? 194.848 3.991   320.432 1.00 43.18  ?  407 ARG A N   1 
ATOM   3134  C CA  . ARG A 1 413 ? 194.333 5.335   320.665 1.00 43.36  ?  407 ARG A CA  1 
ATOM   3135  C C   . ARG A 1 413 ? 195.351 6.407   320.297 1.00 43.61  ?  407 ARG A C   1 
ATOM   3136  O O   . ARG A 1 413 ? 194.970 7.480   319.818 1.00 39.64  ?  407 ARG A O   1 
ATOM   3137  C CB  . ARG A 1 413 ? 193.914 5.483   322.127 1.00 45.82  ?  407 ARG A CB  1 
ATOM   3138  C CG  . ARG A 1 413 ? 192.970 4.393   322.606 1.00 44.73  ?  407 ARG A CG  1 
ATOM   3139  C CD  . ARG A 1 413 ? 192.604 4.573   324.067 1.00 44.57  ?  407 ARG A CD  1 
ATOM   3140  N NE  . ARG A 1 413 ? 191.772 3.476   324.550 1.00 45.02  ?  407 ARG A NE  1 
ATOM   3141  C CZ  . ARG A 1 413 ? 190.455 3.412   324.389 1.00 48.06  ?  407 ARG A CZ  1 
ATOM   3142  N NH1 . ARG A 1 413 ? 189.816 4.385   323.754 1.00 48.15  1  407 ARG A NH1 1 
ATOM   3143  N NH2 . ARG A 1 413 ? 189.777 2.375   324.860 1.00 55.78  ?  407 ARG A NH2 1 
ATOM   3144  N N   . ARG A 1 414 ? 196.642 6.139   320.509 1.00 44.66  ?  408 ARG A N   1 
ATOM   3145  C CA  . ARG A 1 414 ? 197.663 7.133   320.192 1.00 44.15  ?  408 ARG A CA  1 
ATOM   3146  C C   . ARG A 1 414 ? 197.723 7.405   318.694 1.00 40.11  ?  408 ARG A C   1 
ATOM   3147  O O   . ARG A 1 414 ? 197.951 8.545   318.273 1.00 36.18  ?  408 ARG A O   1 
ATOM   3148  C CB  . ARG A 1 414 ? 199.026 6.669   320.709 1.00 45.27  ?  408 ARG A CB  1 
ATOM   3149  C CG  . ARG A 1 414 ? 200.098 7.752   320.707 1.00 49.27  ?  408 ARG A CG  1 
ATOM   3150  C CD  . ARG A 1 414 ? 201.460 7.202   321.111 1.00 44.27  ?  408 ARG A CD  1 
ATOM   3151  N NE  . ARG A 1 414 ? 201.444 6.573   322.430 1.00 42.90  ?  408 ARG A NE  1 
ATOM   3152  C CZ  . ARG A 1 414 ? 201.459 5.259   322.634 1.00 45.67  ?  408 ARG A CZ  1 
ATOM   3153  N NH1 . ARG A 1 414 ? 201.495 4.425   321.603 1.00 45.35  1  408 ARG A NH1 1 
ATOM   3154  N NH2 . ARG A 1 414 ? 201.443 4.778   323.869 1.00 40.21  ?  408 ARG A NH2 1 
ATOM   3155  N N   . ALA A 1 415 ? 197.522 6.372   317.873 1.00 40.57  ?  409 ALA A N   1 
ATOM   3156  C CA  . ALA A 1 415 ? 197.529 6.564   316.427 1.00 40.86  ?  409 ALA A CA  1 
ATOM   3157  C C   . ALA A 1 415 ? 196.231 7.197   315.941 1.00 44.59  ?  409 ALA A C   1 
ATOM   3158  O O   . ALA A 1 415 ? 196.246 8.018   315.017 1.00 43.96  ?  409 ALA A O   1 
ATOM   3159  C CB  . ALA A 1 415 ? 197.769 5.229   315.721 1.00 40.30  ?  409 ALA A CB  1 
ATOM   3160  N N   . VAL A 1 416 ? 195.101 6.827   316.548 1.00 43.75  ?  410 VAL A N   1 
ATOM   3161  C CA  . VAL A 1 416 ? 193.825 7.426   316.170 1.00 43.13  ?  410 VAL A CA  1 
ATOM   3162  C C   . VAL A 1 416 ? 193.803 8.906   316.529 1.00 41.46  ?  410 VAL A C   1 
ATOM   3163  O O   . VAL A 1 416 ? 193.337 9.742   315.746 1.00 45.57  ?  410 VAL A O   1 
ATOM   3164  C CB  . VAL A 1 416 ? 192.660 6.661   316.825 1.00 41.09  ?  410 VAL A CB  1 
ATOM   3165  C CG1 . VAL A 1 416 ? 191.357 7.429   316.667 1.00 35.52  ?  410 VAL A CG1 1 
ATOM   3166  C CG2 . VAL A 1 416 ? 192.531 5.273   316.217 1.00 34.98  ?  410 VAL A CG2 1 
ATOM   3167  N N   . SER A 1 417 ? 194.318 9.257   317.711 1.00 44.03  ?  411 SER A N   1 
ATOM   3168  C CA  . SER A 1 417 ? 194.355 10.660  318.113 1.00 43.27  ?  411 SER A CA  1 
ATOM   3169  C C   . SER A 1 417 ? 195.276 11.471  317.211 1.00 43.65  ?  411 SER A C   1 
ATOM   3170  O O   . SER A 1 417 ? 194.940 12.595  316.821 1.00 44.63  ?  411 SER A O   1 
ATOM   3171  C CB  . SER A 1 417 ? 194.795 10.775  319.572 1.00 40.29  ?  411 SER A CB  1 
ATOM   3172  O OG  . SER A 1 417 ? 193.950 10.018  320.421 1.00 54.78  ?  411 SER A OG  1 
ATOM   3173  N N   . THR A 1 418 ? 196.442 10.918  316.867 1.00 40.29  ?  412 THR A N   1 
ATOM   3174  C CA  . THR A 1 418 ? 197.371 11.628  315.993 1.00 36.12  ?  412 THR A CA  1 
ATOM   3175  C C   . THR A 1 418 ? 196.791 11.801  314.595 1.00 39.94  ?  412 THR A C   1 
ATOM   3176  O O   . THR A 1 418 ? 196.906 12.878  313.997 1.00 44.99  ?  412 THR A O   1 
ATOM   3177  C CB  . THR A 1 418 ? 198.708 10.887  315.933 1.00 39.10  ?  412 THR A CB  1 
ATOM   3178  O OG1 . THR A 1 418 ? 199.279 10.819  317.246 1.00 38.44  ?  412 THR A OG1 1 
ATOM   3179  C CG2 . THR A 1 418 ? 199.678 11.599  315.003 1.00 36.44  ?  412 THR A CG2 1 
ATOM   3180  N N   . GLY A 1 419 ? 196.160 10.753  314.059 1.00 40.72  ?  413 GLY A N   1 
ATOM   3181  C CA  . GLY A 1 419 ? 195.529 10.864  312.756 1.00 48.14  ?  413 GLY A CA  1 
ATOM   3182  C C   . GLY A 1 419 ? 194.387 11.860  312.724 1.00 45.21  ?  413 GLY A C   1 
ATOM   3183  O O   . GLY A 1 419 ? 194.177 12.534  311.712 1.00 42.87  ?  413 GLY A O   1 
ATOM   3184  N N   . VAL A 1 420 ? 193.634 11.966  313.822 1.00 42.19  ?  414 VAL A N   1 
ATOM   3185  C CA  . VAL A 1 420 ? 192.553 12.946  313.897 1.00 41.89  ?  414 VAL A CA  1 
ATOM   3186  C C   . VAL A 1 420 ? 193.116 14.361  313.859 1.00 48.83  ?  414 VAL A C   1 
ATOM   3187  O O   . VAL A 1 420 ? 192.591 15.237  313.161 1.00 51.64  ?  414 VAL A O   1 
ATOM   3188  C CB  . VAL A 1 420 ? 191.701 12.704  315.158 1.00 48.36  ?  414 VAL A CB  1 
ATOM   3189  C CG1 . VAL A 1 420 ? 190.902 13.948  315.523 1.00 53.67  ?  414 VAL A CG1 1 
ATOM   3190  C CG2 . VAL A 1 420 ? 190.773 11.516  314.948 1.00 41.95  ?  414 VAL A CG2 1 
ATOM   3191  N N   . GLN A 1 421 ? 194.198 14.605  314.604 1.00 53.63  ?  415 GLN A N   1 
ATOM   3192  C CA  . GLN A 1 421 ? 194.838 15.916  314.575 1.00 45.71  ?  415 GLN A CA  1 
ATOM   3193  C C   . GLN A 1 421 ? 195.465 16.206  313.218 1.00 42.71  ?  415 GLN A C   1 
ATOM   3194  O O   . GLN A 1 421 ? 195.560 17.372  312.817 1.00 41.97  ?  415 GLN A O   1 
ATOM   3195  C CB  . GLN A 1 421 ? 195.896 16.007  315.676 1.00 46.52  ?  415 GLN A CB  1 
ATOM   3196  C CG  . GLN A 1 421 ? 195.331 16.005  317.087 1.00 51.00  ?  415 GLN A CG  1 
ATOM   3197  C CD  . GLN A 1 421 ? 194.579 17.281  317.417 1.00 68.68  ?  415 GLN A CD  1 
ATOM   3198  O OE1 . GLN A 1 421 ? 194.808 18.326  316.807 1.00 63.03  ?  415 GLN A OE1 1 
ATOM   3199  N NE2 . GLN A 1 421 ? 193.674 17.200  318.385 1.00 75.05  ?  415 GLN A NE2 1 
ATOM   3200  N N   . ALA A 1 422 ? 195.893 15.167  312.500 1.00 43.98  ?  416 ALA A N   1 
ATOM   3201  C CA  . ALA A 1 422 ? 196.525 15.350  311.200 1.00 44.65  ?  416 ALA A CA  1 
ATOM   3202  C C   . ALA A 1 422 ? 195.520 15.568  310.079 1.00 51.06  ?  416 ALA A C   1 
ATOM   3203  O O   . ALA A 1 422 ? 195.895 16.092  309.024 1.00 45.35  ?  416 ALA A O   1 
ATOM   3204  C CB  . ALA A 1 422 ? 197.400 14.140  310.867 1.00 39.58  ?  416 ALA A CB  1 
ATOM   3205  N N   . GLY A 1 423 ? 194.264 15.189  310.281 1.00 53.76  ?  417 GLY A N   1 
ATOM   3206  C CA  . GLY A 1 423 ? 193.293 15.232  309.205 1.00 51.09  ?  417 GLY A CA  1 
ATOM   3207  C C   . GLY A 1 423 ? 193.402 14.061  308.256 1.00 49.60  ?  417 GLY A C   1 
ATOM   3208  O O   . GLY A 1 423 ? 193.221 14.229  307.043 1.00 47.55  ?  417 GLY A O   1 
ATOM   3209  N N   . ILE A 1 424 ? 193.700 12.879  308.773 1.00 47.84  ?  418 ILE A N   1 
ATOM   3210  C CA  . ILE A 1 424 ? 193.881 11.677  307.964 1.00 50.34  ?  418 ILE A CA  1 
ATOM   3211  C C   . ILE A 1 424 ? 192.604 10.849  308.043 1.00 50.97  ?  418 ILE A C   1 
ATOM   3212  O O   . ILE A 1 424 ? 192.163 10.524  309.154 1.00 50.98  ?  418 ILE A O   1 
ATOM   3213  C CB  . ILE A 1 424 ? 195.093 10.856  308.439 1.00 48.96  ?  418 ILE A CB  1 
ATOM   3214  C CG1 . ILE A 1 424 ? 196.371 11.682  308.311 1.00 51.96  ?  418 ILE A CG1 1 
ATOM   3215  C CG2 . ILE A 1 424 ? 195.202 9.561   307.653 1.00 43.92  ?  418 ILE A CG2 1 
ATOM   3216  C CD1 . ILE A 1 424 ? 196.580 12.263  306.930 1.00 53.22  ?  418 ILE A CD1 1 
ATOM   3217  N N   . PRO A 1 425 ? 191.989 10.495  306.915 1.00 44.91  ?  419 PRO A N   1 
ATOM   3218  C CA  . PRO A 1 425 ? 190.768 9.681   306.965 1.00 40.71  ?  419 PRO A CA  1 
ATOM   3219  C C   . PRO A 1 425 ? 191.034 8.276   307.481 1.00 43.85  ?  419 PRO A C   1 
ATOM   3220  O O   . PRO A 1 425 ? 191.733 7.489   306.832 1.00 37.81  ?  419 PRO A O   1 
ATOM   3221  C CB  . PRO A 1 425 ? 190.296 9.658   305.506 1.00 42.04  ?  419 PRO A CB  1 
ATOM   3222  C CG  . PRO A 1 425 ? 191.035 10.778  304.829 1.00 40.07  ?  419 PRO A CG  1 
ATOM   3223  C CD  . PRO A 1 425 ? 192.341 10.885  305.541 1.00 43.13  ?  419 PRO A CD  1 
ATOM   3224  N N   . MET A 1 426 ? 190.486 7.950   308.650 1.00 39.89  ?  420 MET A N   1 
ATOM   3225  C CA  . MET A 1 426 ? 190.597 6.611   309.231 1.00 40.06  ?  420 MET A CA  1 
ATOM   3226  C C   . MET A 1 426 ? 189.210 6.096   309.594 1.00 44.95  ?  420 MET A C   1 
ATOM   3227  O O   . MET A 1 426 ? 188.900 5.881   310.770 1.00 40.95  ?  420 MET A O   1 
ATOM   3228  C CB  . MET A 1 426 ? 191.508 6.628   310.457 1.00 41.06  ?  420 MET A CB  1 
ATOM   3229  C CG  . MET A 1 426 ? 192.862 7.274   310.231 1.00 41.82  ?  420 MET A CG  1 
ATOM   3230  S SD  . MET A 1 426 ? 193.808 7.405   311.759 1.00 48.23  ?  420 MET A SD  1 
ATOM   3231  C CE  . MET A 1 426 ? 192.681 8.360   312.772 1.00 32.84  ?  420 MET A CE  1 
ATOM   3232  N N   . PRO A 1 427 ? 188.342 5.879   308.600 1.00 44.88  ?  421 PRO A N   1 
ATOM   3233  C CA  . PRO A 1 427 ? 186.967 5.473   308.926 1.00 43.74  ?  421 PRO A CA  1 
ATOM   3234  C C   . PRO A 1 427 ? 186.881 4.113   309.590 1.00 41.85  ?  421 PRO A C   1 
ATOM   3235  O O   . PRO A 1 427 ? 185.989 3.901   310.419 1.00 37.12  ?  421 PRO A O   1 
ATOM   3236  C CB  . PRO A 1 427 ? 186.266 5.480   307.560 1.00 39.18  ?  421 PRO A CB  1 
ATOM   3237  C CG  . PRO A 1 427 ? 187.358 5.250   306.582 1.00 43.98  ?  421 PRO A CG  1 
ATOM   3238  C CD  . PRO A 1 427 ? 188.568 5.940   307.145 1.00 39.09  ?  421 PRO A CD  1 
ATOM   3239  N N   . CYS A 1 428 ? 187.780 3.186   309.260 1.00 41.36  ?  422 CYS A N   1 
ATOM   3240  C CA  . CYS A 1 428 ? 187.692 1.849   309.835 1.00 38.09  ?  422 CYS A CA  1 
ATOM   3241  C C   . CYS A 1 428 ? 188.401 1.769   311.180 1.00 38.31  ?  422 CYS A C   1 
ATOM   3242  O O   . CYS A 1 428 ? 187.917 1.093   312.096 1.00 39.66  ?  422 CYS A O   1 
ATOM   3243  C CB  . CYS A 1 428 ? 188.260 0.816   308.864 1.00 38.75  ?  422 CYS A CB  1 
ATOM   3244  S SG  . CYS A 1 428 ? 187.122 0.328   307.553 1.00 41.17  ?  422 CYS A SG  1 
ATOM   3245  N N   . PHE A 1 429 ? 189.550 2.435   311.316 1.00 42.49  ?  423 PHE A N   1 
ATOM   3246  C CA  . PHE A 1 429 ? 190.215 2.491   312.614 1.00 42.36  ?  423 PHE A CA  1 
ATOM   3247  C C   . PHE A 1 429 ? 189.325 3.156   313.656 1.00 41.98  ?  423 PHE A C   1 
ATOM   3248  O O   . PHE A 1 429 ? 189.245 2.698   314.802 1.00 45.82  ?  423 PHE A O   1 
ATOM   3249  C CB  . PHE A 1 429 ? 191.542 3.241   312.497 1.00 43.42  ?  423 PHE A CB  1 
ATOM   3250  C CG  . PHE A 1 429 ? 192.655 2.429   311.896 1.00 45.12  ?  423 PHE A CG  1 
ATOM   3251  C CD1 . PHE A 1 429 ? 192.572 1.048   311.824 1.00 48.32  ?  423 PHE A CD1 1 
ATOM   3252  C CD2 . PHE A 1 429 ? 193.793 3.053   311.413 1.00 42.91  ?  423 PHE A CD2 1 
ATOM   3253  C CE1 . PHE A 1 429 ? 193.604 0.306   311.274 1.00 42.21  ?  423 PHE A CE1 1 
ATOM   3254  C CE2 . PHE A 1 429 ? 194.824 2.318   310.863 1.00 45.60  ?  423 PHE A CE2 1 
ATOM   3255  C CZ  . PHE A 1 429 ? 194.730 0.943   310.793 1.00 43.26  ?  423 PHE A CZ  1 
ATOM   3256  N N   . THR A 1 430 ? 188.635 4.230   313.269 1.00 38.97  ?  424 THR A N   1 
ATOM   3257  C CA  . THR A 1 430 ? 187.818 4.969   314.224 1.00 38.69  ?  424 THR A CA  1 
ATOM   3258  C C   . THR A 1 430 ? 186.534 4.220   314.562 1.00 40.84  ?  424 THR A C   1 
ATOM   3259  O O   . THR A 1 430 ? 186.076 4.256   315.710 1.00 45.36  ?  424 THR A O   1 
ATOM   3260  C CB  . THR A 1 430 ? 187.503 6.358   313.673 1.00 42.25  ?  424 THR A CB  1 
ATOM   3261  O OG1 . THR A 1 430 ? 187.033 6.245   312.325 1.00 50.69  ?  424 THR A OG1 1 
ATOM   3262  C CG2 . THR A 1 430 ? 188.748 7.233   313.700 1.00 35.24  ?  424 THR A CG2 1 
ATOM   3263  N N   . THR A 1 431 ? 185.935 3.537   313.582 1.00 43.28  ?  425 THR A N   1 
ATOM   3264  C CA  . THR A 1 431 ? 184.710 2.797   313.869 1.00 43.87  ?  425 THR A CA  1 
ATOM   3265  C C   . THR A 1 431 ? 185.002 1.514   314.637 1.00 38.29  ?  425 THR A C   1 
ATOM   3266  O O   . THR A 1 431 ? 184.136 1.022   315.370 1.00 41.73  ?  425 THR A O   1 
ATOM   3267  C CB  . THR A 1 431 ? 183.947 2.489   312.577 1.00 41.84  ?  425 THR A CB  1 
ATOM   3268  O OG1 . THR A 1 431 ? 182.621 2.048   312.899 1.00 38.65  ?  425 THR A OG1 1 
ATOM   3269  C CG2 . THR A 1 431 ? 184.642 1.400   311.779 1.00 35.41  ?  425 THR A CG2 1 
ATOM   3270  N N   . ALA A 1 432 ? 186.209 0.963   314.492 1.00 35.35  ?  426 ALA A N   1 
ATOM   3271  C CA  . ALA A 1 432 ? 186.576 -0.213  315.272 1.00 37.33  ?  426 ALA A CA  1 
ATOM   3272  C C   . ALA A 1 432 ? 186.847 0.152   316.723 1.00 41.31  ?  426 ALA A C   1 
ATOM   3273  O O   . ALA A 1 432 ? 186.552 -0.638  317.628 1.00 41.03  ?  426 ALA A O   1 
ATOM   3274  C CB  . ALA A 1 432 ? 187.796 -0.896  314.657 1.00 33.08  ?  426 ALA A CB  1 
ATOM   3275  N N   . LEU A 1 433 ? 187.400 1.341   316.964 1.00 40.76  ?  427 LEU A N   1 
ATOM   3276  C CA  . LEU A 1 433 ? 187.646 1.787   318.330 1.00 43.33  ?  427 LEU A CA  1 
ATOM   3277  C C   . LEU A 1 433 ? 186.357 2.232   319.009 1.00 40.05  ?  427 LEU A C   1 
ATOM   3278  O O   . LEU A 1 433 ? 186.138 1.932   320.188 1.00 36.52  ?  427 LEU A O   1 
ATOM   3279  C CB  . LEU A 1 433 ? 188.674 2.918   318.331 1.00 38.45  ?  427 LEU A CB  1 
ATOM   3280  C CG  . LEU A 1 433 ? 189.186 3.374   319.698 1.00 42.02  ?  427 LEU A CG  1 
ATOM   3281  C CD1 . LEU A 1 433 ? 189.784 2.204   320.460 1.00 43.13  ?  427 LEU A CD1 1 
ATOM   3282  C CD2 . LEU A 1 433 ? 190.207 4.482   319.530 1.00 40.29  ?  427 LEU A CD2 1 
ATOM   3283  N N   . SER A 1 434 ? 185.493 2.941   318.279 1.00 39.59  ?  428 SER A N   1 
ATOM   3284  C CA  . SER A 1 434 ? 184.220 3.367   318.849 1.00 40.45  ?  428 SER A CA  1 
ATOM   3285  C C   . SER A 1 434 ? 183.320 2.180   319.162 1.00 41.66  ?  428 SER A C   1 
ATOM   3286  O O   . SER A 1 434 ? 182.523 2.240   320.106 1.00 39.21  ?  428 SER A O   1 
ATOM   3287  C CB  . SER A 1 434 ? 183.515 4.334   317.898 1.00 42.11  ?  428 SER A CB  1 
ATOM   3288  O OG  . SER A 1 434 ? 184.291 5.502   317.692 1.00 38.85  ?  428 SER A OG  1 
ATOM   3289  N N   . PHE A 1 435 ? 183.431 1.095   318.391 1.00 42.84  ?  429 PHE A N   1 
ATOM   3290  C CA  . PHE A 1 435 ? 182.639 -0.095  318.683 1.00 40.72  ?  429 PHE A CA  1 
ATOM   3291  C C   . PHE A 1 435 ? 183.158 -0.811  319.923 1.00 42.36  ?  429 PHE A C   1 
ATOM   3292  O O   . PHE A 1 435 ? 182.368 -1.319  320.728 1.00 40.39  ?  429 PHE A O   1 
ATOM   3293  C CB  . PHE A 1 435 ? 182.635 -1.040  317.482 1.00 32.90  ?  429 PHE A CB  1 
ATOM   3294  C CG  . PHE A 1 435 ? 181.923 -2.339  317.739 1.00 34.32  ?  429 PHE A CG  1 
ATOM   3295  C CD1 . PHE A 1 435 ? 180.544 -2.416  317.655 1.00 35.76  ?  429 PHE A CD1 1 
ATOM   3296  C CD2 . PHE A 1 435 ? 182.633 -3.483  318.068 1.00 34.39  ?  429 PHE A CD2 1 
ATOM   3297  C CE1 . PHE A 1 435 ? 179.885 -3.608  317.893 1.00 32.46  ?  429 PHE A CE1 1 
ATOM   3298  C CE2 . PHE A 1 435 ? 181.979 -4.677  318.307 1.00 29.43  ?  429 PHE A CE2 1 
ATOM   3299  C CZ  . PHE A 1 435 ? 180.605 -4.739  318.219 1.00 27.13  ?  429 PHE A CZ  1 
ATOM   3300  N N   . TYR A 1 436 ? 184.481 -0.868  320.093 1.00 44.40  ?  430 TYR A N   1 
ATOM   3301  C CA  . TYR A 1 436 ? 185.045 -1.540  321.259 1.00 47.21  ?  430 TYR A CA  1 
ATOM   3302  C C   . TYR A 1 436 ? 184.701 -0.795  322.541 1.00 46.45  ?  430 TYR A C   1 
ATOM   3303  O O   . TYR A 1 436 ? 184.279 -1.405  323.531 1.00 44.83  ?  430 TYR A O   1 
ATOM   3304  C CB  . TYR A 1 436 ? 186.561 -1.682  321.113 1.00 45.63  ?  430 TYR A CB  1 
ATOM   3305  C CG  . TYR A 1 436 ? 187.221 -2.274  322.338 1.00 42.32  ?  430 TYR A CG  1 
ATOM   3306  C CD1 . TYR A 1 436 ? 187.213 -3.644  322.560 1.00 41.75  ?  430 TYR A CD1 1 
ATOM   3307  C CD2 . TYR A 1 436 ? 187.843 -1.462  323.278 1.00 43.29  ?  430 TYR A CD2 1 
ATOM   3308  C CE1 . TYR A 1 436 ? 187.808 -4.191  323.680 1.00 46.41  ?  430 TYR A CE1 1 
ATOM   3309  C CE2 . TYR A 1 436 ? 188.441 -1.999  324.402 1.00 45.33  ?  430 TYR A CE2 1 
ATOM   3310  C CZ  . TYR A 1 436 ? 188.421 -3.364  324.598 1.00 47.05  ?  430 TYR A CZ  1 
ATOM   3311  O OH  . TYR A 1 436 ? 189.016 -3.903  325.715 1.00 51.95  ?  430 TYR A OH  1 
ATOM   3312  N N   . ASP A 1 437 ? 184.878 0.529   322.545 1.00 45.90  ?  431 ASP A N   1 
ATOM   3313  C CA  . ASP A 1 437 ? 184.546 1.313   323.730 1.00 52.14  ?  431 ASP A CA  1 
ATOM   3314  C C   . ASP A 1 437 ? 183.064 1.218   324.067 1.00 50.63  ?  431 ASP A C   1 
ATOM   3315  O O   . ASP A 1 437 ? 182.685 1.344   325.237 1.00 56.89  ?  431 ASP A O   1 
ATOM   3316  C CB  . ASP A 1 437 ? 184.954 2.773   323.527 1.00 54.37  ?  431 ASP A CB  1 
ATOM   3317  C CG  . ASP A 1 437 ? 186.457 2.949   323.429 1.00 56.20  ?  431 ASP A CG  1 
ATOM   3318  O OD1 . ASP A 1 437 ? 187.190 2.205   324.114 1.00 49.22  ?  431 ASP A OD1 1 
ATOM   3319  O OD2 . ASP A 1 437 ? 186.905 3.832   322.667 1.00 54.44  -1 431 ASP A OD2 1 
ATOM   3320  N N   . GLY A 1 438 ? 182.216 0.994   323.067 1.00 41.87  ?  432 GLY A N   1 
ATOM   3321  C CA  . GLY A 1 438 ? 180.798 0.826   323.304 1.00 43.47  ?  432 GLY A CA  1 
ATOM   3322  C C   . GLY A 1 438 ? 180.448 -0.567  323.779 1.00 45.03  ?  432 GLY A C   1 
ATOM   3323  O O   . GLY A 1 438 ? 179.635 -0.736  324.692 1.00 46.83  ?  432 GLY A O   1 
ATOM   3324  N N   . TYR A 1 439 ? 181.067 -1.578  323.166 1.00 42.43  ?  433 TYR A N   1 
ATOM   3325  C CA  . TYR A 1 439 ? 180.774 -2.960  323.522 1.00 43.14  ?  433 TYR A CA  1 
ATOM   3326  C C   . TYR A 1 439 ? 181.239 -3.309  324.929 1.00 47.39  ?  433 TYR A C   1 
ATOM   3327  O O   . TYR A 1 439 ? 180.700 -4.242  325.533 1.00 46.78  ?  433 TYR A O   1 
ATOM   3328  C CB  . TYR A 1 439 ? 181.417 -3.906  322.505 1.00 35.03  ?  433 TYR A CB  1 
ATOM   3329  C CG  . TYR A 1 439 ? 181.059 -5.358  322.711 1.00 40.68  ?  433 TYR A CG  1 
ATOM   3330  C CD1 . TYR A 1 439 ? 179.795 -5.832  322.388 1.00 44.60  ?  433 TYR A CD1 1 
ATOM   3331  C CD2 . TYR A 1 439 ? 181.984 -6.256  323.225 1.00 46.49  ?  433 TYR A CD2 1 
ATOM   3332  C CE1 . TYR A 1 439 ? 179.460 -7.159  322.574 1.00 49.14  ?  433 TYR A CE1 1 
ATOM   3333  C CE2 . TYR A 1 439 ? 181.659 -7.586  323.413 1.00 47.29  ?  433 TYR A CE2 1 
ATOM   3334  C CZ  . TYR A 1 439 ? 180.395 -8.031  323.086 1.00 44.25  ?  433 TYR A CZ  1 
ATOM   3335  O OH  . TYR A 1 439 ? 180.063 -9.352  323.271 1.00 48.20  ?  433 TYR A OH  1 
ATOM   3336  N N   . ARG A 1 440 ? 182.216 -2.579  325.466 1.00 57.66  ?  434 ARG A N   1 
ATOM   3337  C CA  . ARG A 1 440 ? 182.739 -2.842  326.799 1.00 57.84  ?  434 ARG A CA  1 
ATOM   3338  C C   . ARG A 1 440 ? 182.011 -2.072  327.893 1.00 54.94  ?  434 ARG A C   1 
ATOM   3339  O O   . ARG A 1 440 ? 182.161 -2.415  329.070 1.00 53.74  ?  434 ARG A O   1 
ATOM   3340  C CB  . ARG A 1 440 ? 184.232 -2.504  326.854 1.00 57.75  ?  434 ARG A CB  1 
ATOM   3341  C CG  . ARG A 1 440 ? 184.524 -1.027  326.672 1.00 56.13  ?  434 ARG A CG  1 
ATOM   3342  C CD  . ARG A 1 440 ? 186.004 -0.718  326.798 1.00 58.43  ?  434 ARG A CD  1 
ATOM   3343  N NE  . ARG A 1 440 ? 186.248 0.717   326.707 1.00 54.82  ?  434 ARG A NE  1 
ATOM   3344  C CZ  . ARG A 1 440 ? 186.126 1.559   327.728 1.00 53.07  ?  434 ARG A CZ  1 
ATOM   3345  N NH1 . ARG A 1 440 ? 185.768 1.106   328.922 1.00 47.35  1  434 ARG A NH1 1 
ATOM   3346  N NH2 . ARG A 1 440 ? 186.361 2.851   327.557 1.00 52.30  ?  434 ARG A NH2 1 
ATOM   3347  N N   . HIS A 1 441 ? 181.237 -1.048  327.543 1.00 57.07  ?  435 HIS A N   1 
ATOM   3348  C CA  . HIS A 1 441 ? 180.533 -0.254  328.540 1.00 61.76  ?  435 HIS A CA  1 
ATOM   3349  C C   . HIS A 1 441 ? 179.253 -0.954  328.978 1.00 67.01  ?  435 HIS A C   1 
ATOM   3350  O O   . HIS A 1 441 ? 178.445 -1.373  328.142 1.00 61.91  ?  435 HIS A O   1 
ATOM   3351  C CB  . HIS A 1 441 ? 180.207 1.134   327.989 1.00 55.27  ?  435 HIS A CB  1 
ATOM   3352  C CG  . HIS A 1 441 ? 181.195 2.188   328.381 1.00 61.48  ?  435 HIS A CG  1 
ATOM   3353  N ND1 . HIS A 1 441 ? 182.472 2.239   327.866 1.00 58.08  ?  435 HIS A ND1 1 
ATOM   3354  C CD2 . HIS A 1 441 ? 181.093 3.230   329.239 1.00 68.11  ?  435 HIS A CD2 1 
ATOM   3355  C CE1 . HIS A 1 441 ? 183.114 3.268   328.389 1.00 64.25  ?  435 HIS A CE1 1 
ATOM   3356  N NE2 . HIS A 1 441 ? 182.300 3.886   329.226 1.00 71.00  ?  435 HIS A NE2 1 
ATOM   3357  N N   . GLU A 1 442 ? 179.071 -1.080  330.294 1.00 72.26  ?  436 GLU A N   1 
ATOM   3358  C CA  . GLU A 1 442 ? 177.821 -1.622  330.815 1.00 66.34  ?  436 GLU A CA  1 
ATOM   3359  C C   . GLU A 1 442 ? 176.666 -0.654  330.600 1.00 64.60  ?  436 GLU A C   1 
ATOM   3360  O O   . GLU A 1 442 ? 175.531 -1.085  330.370 1.00 69.86  ?  436 GLU A O   1 
ATOM   3361  C CB  . GLU A 1 442 ? 177.967 -1.950  332.301 1.00 76.08  ?  436 GLU A CB  1 
ATOM   3362  C CG  . GLU A 1 442 ? 176.752 -2.635  332.911 1.00 82.40  ?  436 GLU A CG  1 
ATOM   3363  C CD  . GLU A 1 442 ? 176.794 -2.659  334.427 1.00 81.11  ?  436 GLU A CD  1 
ATOM   3364  O OE1 . GLU A 1 442 ? 177.349 -1.711  335.022 1.00 85.38  ?  436 GLU A OE1 1 
ATOM   3365  O OE2 . GLU A 1 442 ? 176.275 -3.626  335.023 1.00 69.60  -1 436 GLU A OE2 1 
ATOM   3366  N N   . MET A 1 443 ? 176.934 0.648   330.664 1.00 60.29  ?  437 MET A N   1 
ATOM   3367  C CA  . MET A 1 443 ? 175.921 1.679   330.489 1.00 57.80  ?  437 MET A CA  1 
ATOM   3368  C C   . MET A 1 443 ? 176.282 2.540   329.287 1.00 61.62  ?  437 MET A C   1 
ATOM   3369  O O   . MET A 1 443 ? 177.390 3.082   329.216 1.00 72.16  ?  437 MET A O   1 
ATOM   3370  C CB  . MET A 1 443 ? 175.794 2.542   331.746 1.00 67.17  ?  437 MET A CB  1 
ATOM   3371  C CG  . MET A 1 443 ? 175.523 1.750   333.017 1.00 74.87  ?  437 MET A CG  1 
ATOM   3372  S SD  . MET A 1 443 ? 173.999 0.789   332.931 1.00 97.29  ?  437 MET A SD  1 
ATOM   3373  C CE  . MET A 1 443 ? 174.065 -0.093  334.488 1.00 76.04  ?  437 MET A CE  1 
ATOM   3374  N N   . LEU A 1 444 ? 175.343 2.663   328.350 1.00 55.92  ?  438 LEU A N   1 
ATOM   3375  C CA  . LEU A 1 444 ? 175.500 3.444   327.130 1.00 55.16  ?  438 LEU A CA  1 
ATOM   3376  C C   . LEU A 1 444 ? 174.510 4.605   327.135 1.00 54.42  ?  438 LEU A C   1 
ATOM   3377  O O   . LEU A 1 444 ? 173.587 4.627   327.959 1.00 57.16  ?  438 LEU A O   1 
ATOM   3378  C CB  . LEU A 1 444 ? 175.294 2.556   325.900 1.00 60.56  ?  438 LEU A CB  1 
ATOM   3379  C CG  . LEU A 1 444 ? 176.362 1.505   325.596 1.00 53.06  ?  438 LEU A CG  1 
ATOM   3380  C CD1 . LEU A 1 444 ? 175.994 0.726   324.344 1.00 45.82  ?  438 LEU A CD1 1 
ATOM   3381  C CD2 . LEU A 1 444 ? 177.721 2.163   325.437 1.00 55.17  ?  438 LEU A CD2 1 
ATOM   3382  N N   . PRO A 1 445 ? 174.664 5.591   326.244 1.00 50.17  ?  439 PRO A N   1 
ATOM   3383  C CA  . PRO A 1 445 ? 173.701 6.703   326.212 1.00 52.39  ?  439 PRO A CA  1 
ATOM   3384  C C   . PRO A 1 445 ? 172.379 6.328   325.565 1.00 60.92  ?  439 PRO A C   1 
ATOM   3385  O O   . PRO A 1 445 ? 171.522 7.192   325.357 1.00 61.04  ?  439 PRO A O   1 
ATOM   3386  C CB  . PRO A 1 445 ? 174.427 7.780   325.394 1.00 53.25  ?  439 PRO A CB  1 
ATOM   3387  C CG  . PRO A 1 445 ? 175.846 7.340   325.316 1.00 59.32  ?  439 PRO A CG  1 
ATOM   3388  C CD  . PRO A 1 445 ? 175.836 5.859   325.396 1.00 58.03  ?  439 PRO A CD  1 
ATOM   3389  N N   . ALA A 1 446 ? 172.198 5.045   325.244 1.00 67.23  ?  440 ALA A N   1 
ATOM   3390  C CA  . ALA A 1 446 ? 170.964 4.609   324.602 1.00 66.62  ?  440 ALA A CA  1 
ATOM   3391  C C   . ALA A 1 446 ? 169.755 4.749   325.513 1.00 69.11  ?  440 ALA A C   1 
ATOM   3392  O O   . ALA A 1 446 ? 168.619 4.704   325.027 1.00 70.12  ?  440 ALA A O   1 
ATOM   3393  C CB  . ALA A 1 446 ? 171.092 3.162   324.135 1.00 68.13  ?  440 ALA A CB  1 
ATOM   3394  N N   . SER A 1 447 ? 169.968 4.901   326.822 1.00 69.38  ?  441 SER A N   1 
ATOM   3395  C CA  . SER A 1 447 ? 168.855 5.205   327.711 1.00 65.84  ?  441 SER A CA  1 
ATOM   3396  C C   . SER A 1 447 ? 168.247 6.561   327.384 1.00 65.46  ?  441 SER A C   1 
ATOM   3397  O O   . SER A 1 447 ? 167.042 6.764   327.570 1.00 70.29  ?  441 SER A O   1 
ATOM   3398  C CB  . SER A 1 447 ? 169.319 5.159   329.166 1.00 67.60  ?  441 SER A CB  1 
ATOM   3399  O OG  . SER A 1 447 ? 170.403 6.046   329.383 1.00 77.85  ?  441 SER A OG  1 
ATOM   3400  N N   . LEU A 1 448 ? 169.061 7.497   326.889 1.00 57.96  ?  442 LEU A N   1 
ATOM   3401  C CA  . LEU A 1 448 ? 168.541 8.790   326.460 1.00 65.23  ?  442 LEU A CA  1 
ATOM   3402  C C   . LEU A 1 448 ? 167.838 8.693   325.112 1.00 67.65  ?  442 LEU A C   1 
ATOM   3403  O O   . LEU A 1 448 ? 166.778 9.300   324.919 1.00 70.80  ?  442 LEU A O   1 
ATOM   3404  C CB  . LEU A 1 448 ? 169.672 9.818   326.394 1.00 66.61  ?  442 LEU A CB  1 
ATOM   3405  C CG  . LEU A 1 448 ? 169.326 11.177  325.779 1.00 59.39  ?  442 LEU A CG  1 
ATOM   3406  C CD1 . LEU A 1 448 ? 168.228 11.872  326.572 1.00 63.45  ?  442 LEU A CD1 1 
ATOM   3407  C CD2 . LEU A 1 448 ? 170.563 12.058  325.682 1.00 61.28  ?  442 LEU A CD2 1 
ATOM   3408  N N   . ILE A 1 449 ? 168.405 7.931   324.172 1.00 69.06  ?  443 ILE A N   1 
ATOM   3409  C CA  . ILE A 1 449 ? 167.819 7.826   322.840 1.00 65.41  ?  443 ILE A CA  1 
ATOM   3410  C C   . ILE A 1 449 ? 166.462 7.140   322.886 1.00 69.45  ?  443 ILE A C   1 
ATOM   3411  O O   . ILE A 1 449 ? 165.638 7.337   321.987 1.00 71.30  ?  443 ILE A O   1 
ATOM   3412  C CB  . ILE A 1 449 ? 168.786 7.093   321.880 1.00 58.45  ?  443 ILE A CB  1 
ATOM   3413  C CG1 . ILE A 1 449 ? 168.578 7.566   320.441 1.00 53.86  ?  443 ILE A CG1 1 
ATOM   3414  C CG2 . ILE A 1 449 ? 168.602 5.588   321.956 1.00 67.81  ?  443 ILE A CG2 1 
ATOM   3415  C CD1 . ILE A 1 449 ? 169.495 6.893   319.440 1.00 57.16  ?  443 ILE A CD1 1 
ATOM   3416  N N   . GLN A 1 450 ? 166.202 6.343   323.921 1.00 66.77  ?  444 GLN A N   1 
ATOM   3417  C CA  . GLN A 1 450 ? 164.892 5.731   324.090 1.00 69.62  ?  444 GLN A CA  1 
ATOM   3418  C C   . GLN A 1 450 ? 163.969 6.581   324.948 1.00 71.77  ?  444 GLN A C   1 
ATOM   3419  O O   . GLN A 1 450 ? 162.749 6.561   324.743 1.00 71.94  ?  444 GLN A O   1 
ATOM   3420  C CB  . GLN A 1 450 ? 165.036 4.332   324.696 1.00 68.27  ?  444 GLN A CB  1 
ATOM   3421  C CG  . GLN A 1 450 ? 163.732 3.556   324.765 1.00 70.27  ?  444 GLN A CG  1 
ATOM   3422  C CD  . GLN A 1 450 ? 163.941 2.057   324.743 1.00 67.70  ?  444 GLN A CD  1 
ATOM   3423  O OE1 . GLN A 1 450 ? 163.987 1.442   323.677 1.00 59.64  ?  444 GLN A OE1 1 
ATOM   3424  N NE2 . GLN A 1 450 ? 164.069 1.458   325.921 1.00 65.05  ?  444 GLN A NE2 1 
ATOM   3425  N N   . ALA A 1 451 ? 164.524 7.337   325.900 1.00 70.05  ?  445 ALA A N   1 
ATOM   3426  C CA  . ALA A 1 451 ? 163.712 8.283   326.655 1.00 66.98  ?  445 ALA A CA  1 
ATOM   3427  C C   . ALA A 1 451 ? 163.181 9.396   325.761 1.00 67.23  ?  445 ALA A C   1 
ATOM   3428  O O   . ALA A 1 451 ? 162.125 9.971   326.050 1.00 69.20  ?  445 ALA A O   1 
ATOM   3429  C CB  . ALA A 1 451 ? 164.522 8.870   327.810 1.00 74.67  ?  445 ALA A CB  1 
ATOM   3430  N N   . GLN A 1 452 ? 163.894 9.712   324.679 1.00 64.55  ?  446 GLN A N   1 
ATOM   3431  C CA  . GLN A 1 452 ? 163.406 10.713  323.736 1.00 63.86  ?  446 GLN A CA  1 
ATOM   3432  C C   . GLN A 1 452 ? 162.152 10.226  323.021 1.00 69.96  ?  446 GLN A C   1 
ATOM   3433  O O   . GLN A 1 452 ? 161.169 10.966  322.899 1.00 69.89  ?  446 GLN A O   1 
ATOM   3434  C CB  . GLN A 1 452 ? 164.504 11.064  322.730 1.00 59.07  ?  446 GLN A CB  1 
ATOM   3435  C CG  . GLN A 1 452 ? 165.674 11.829  323.332 1.00 65.18  ?  446 GLN A CG  1 
ATOM   3436  C CD  . GLN A 1 452 ? 166.849 11.945  322.381 1.00 59.14  ?  446 GLN A CD  1 
ATOM   3437  O OE1 . GLN A 1 452 ? 166.944 11.206  321.401 1.00 63.88  ?  446 GLN A OE1 1 
ATOM   3438  N NE2 . GLN A 1 452 ? 167.752 12.876  322.665 1.00 59.30  ?  446 GLN A NE2 1 
ATOM   3439  N N   . ARG A 1 453 ? 162.163 8.974   322.549 1.00 74.75  ?  447 ARG A N   1 
ATOM   3440  C CA  . ARG A 1 453 ? 161.006 8.442   321.834 1.00 71.09  ?  447 ARG A CA  1 
ATOM   3441  C C   . ARG A 1 453 ? 159.778 8.385   322.733 1.00 72.10  ?  447 ARG A C   1 
ATOM   3442  O O   . ARG A 1 453 ? 158.662 8.683   322.290 1.00 73.73  ?  447 ARG A O   1 
ATOM   3443  C CB  . ARG A 1 453 ? 161.325 7.058   321.267 1.00 65.97  ?  447 ARG A CB  1 
ATOM   3444  C CG  . ARG A 1 453 ? 162.471 7.043   320.268 1.00 62.74  ?  447 ARG A CG  1 
ATOM   3445  C CD  . ARG A 1 453 ? 162.604 5.684   319.600 1.00 62.73  ?  447 ARG A CD  1 
ATOM   3446  N NE  . ARG A 1 453 ? 161.558 5.451   318.609 1.00 73.16  ?  447 ARG A NE  1 
ATOM   3447  C CZ  . ARG A 1 453 ? 161.697 5.684   317.308 1.00 80.37  ?  447 ARG A CZ  1 
ATOM   3448  N NH1 . ARG A 1 453 ? 162.843 6.158   316.837 1.00 70.61  1  447 ARG A NH1 1 
ATOM   3449  N NH2 . ARG A 1 453 ? 160.693 5.443   316.476 1.00 85.43  ?  447 ARG A NH2 1 
ATOM   3450  N N   . ASP A 1 454 ? 159.961 8.005   323.999 1.00 73.15  ?  448 ASP A N   1 
ATOM   3451  C CA  . ASP A 1 454 ? 158.868 8.070   324.961 1.00 73.38  ?  448 ASP A CA  1 
ATOM   3452  C C   . ASP A 1 454 ? 158.429 9.505   325.229 1.00 73.62  ?  448 ASP A C   1 
ATOM   3453  O O   . ASP A 1 454 ? 157.275 9.726   325.610 1.00 71.65  ?  448 ASP A O   1 
ATOM   3454  C CB  . ASP A 1 454 ? 159.279 7.383   326.268 1.00 79.75  ?  448 ASP A CB  1 
ATOM   3455  C CG  . ASP A 1 454 ? 158.151 7.332   327.289 1.00 77.16  ?  448 ASP A CG  1 
ATOM   3456  O OD1 . ASP A 1 454 ? 157.855 8.370   327.917 1.00 72.51  ?  448 ASP A OD1 1 
ATOM   3457  O OD2 . ASP A 1 454 ? 157.553 6.249   327.459 1.00 77.24  -1 448 ASP A OD2 1 
ATOM   3458  N N   . TYR A 1 455 ? 159.316 10.481  325.028 1.00 73.71  ?  449 TYR A N   1 
ATOM   3459  C CA  . TYR A 1 455 ? 158.946 11.879  325.226 1.00 67.88  ?  449 TYR A CA  1 
ATOM   3460  C C   . TYR A 1 455 ? 158.079 12.388  324.077 1.00 69.04  ?  449 TYR A C   1 
ATOM   3461  O O   . TYR A 1 455 ? 156.933 12.797  324.289 1.00 74.62  ?  449 TYR A O   1 
ATOM   3462  C CB  . TYR A 1 455 ? 160.202 12.744  325.380 1.00 68.62  ?  449 TYR A CB  1 
ATOM   3463  C CG  . TYR A 1 455 ? 159.940 14.128  325.940 1.00 69.12  ?  449 TYR A CG  1 
ATOM   3464  C CD1 . TYR A 1 455 ? 160.306 14.453  327.239 1.00 67.62  ?  449 TYR A CD1 1 
ATOM   3465  C CD2 . TYR A 1 455 ? 159.327 15.110  325.170 1.00 69.83  ?  449 TYR A CD2 1 
ATOM   3466  C CE1 . TYR A 1 455 ? 160.069 15.715  327.754 1.00 67.28  ?  449 TYR A CE1 1 
ATOM   3467  C CE2 . TYR A 1 455 ? 159.084 16.370  325.677 1.00 64.92  ?  449 TYR A CE2 1 
ATOM   3468  C CZ  . TYR A 1 455 ? 159.458 16.668  326.968 1.00 65.24  ?  449 TYR A CZ  1 
ATOM   3469  O OH  . TYR A 1 455 ? 159.218 17.924  327.472 1.00 67.02  ?  449 TYR A OH  1 
ATOM   3470  N N   . PHE A 1 456 ? 158.613 12.383  322.850 1.00 70.99  ?  450 PHE A N   1 
ATOM   3471  C CA  . PHE A 1 456 ? 157.874 12.964  321.734 1.00 78.45  ?  450 PHE A CA  1 
ATOM   3472  C C   . PHE A 1 456 ? 156.773 12.050  321.207 1.00 78.36  ?  450 PHE A C   1 
ATOM   3473  O O   . PHE A 1 456 ? 155.891 12.524  320.483 1.00 67.87  ?  450 PHE A O   1 
ATOM   3474  C CB  . PHE A 1 456 ? 158.823 13.363  320.588 1.00 73.52  ?  450 PHE A CB  1 
ATOM   3475  C CG  . PHE A 1 456 ? 159.586 12.214  319.961 1.00 77.94  ?  450 PHE A CG  1 
ATOM   3476  C CD1 . PHE A 1 456 ? 158.954 11.299  319.130 1.00 73.87  ?  450 PHE A CD1 1 
ATOM   3477  C CD2 . PHE A 1 456 ? 160.954 12.094  320.151 1.00 79.23  ?  450 PHE A CD2 1 
ATOM   3478  C CE1 . PHE A 1 456 ? 159.659 10.261  318.546 1.00 66.23  ?  450 PHE A CE1 1 
ATOM   3479  C CE2 . PHE A 1 456 ? 161.666 11.060  319.567 1.00 70.63  ?  450 PHE A CE2 1 
ATOM   3480  C CZ  . PHE A 1 456 ? 161.017 10.144  318.762 1.00 69.54  ?  450 PHE A CZ  1 
ATOM   3481  N N   . GLY A 1 457 ? 156.800 10.761  321.548 1.00 72.72  ?  451 GLY A N   1 
ATOM   3482  C CA  . GLY A 1 457 ? 155.797 9.825   321.089 1.00 68.88  ?  451 GLY A CA  1 
ATOM   3483  C C   . GLY A 1 457 ? 155.257 8.984   322.232 1.00 76.35  ?  451 GLY A C   1 
ATOM   3484  O O   . GLY A 1 457 ? 155.721 9.071   323.370 1.00 79.53  ?  451 GLY A O   1 
ATOM   3485  N N   . ALA A 1 458 ? 154.261 8.166   321.896 1.00 78.18  ?  452 ALA A N   1 
ATOM   3486  C CA  . ALA A 1 458 ? 153.664 7.239   322.848 1.00 82.02  ?  452 ALA A CA  1 
ATOM   3487  C C   . ALA A 1 458 ? 154.514 5.996   323.070 1.00 83.44  ?  452 ALA A C   1 
ATOM   3488  O O   . ALA A 1 458 ? 154.023 5.023   323.653 1.00 91.93  ?  452 ALA A O   1 
ATOM   3489  C CB  . ALA A 1 458 ? 152.263 6.834   322.384 1.00 85.00  ?  452 ALA A CB  1 
ATOM   3490  N N   . HIS A 1 459 ? 155.767 6.008   322.620 1.00 74.35  ?  453 HIS A N   1 
ATOM   3491  C CA  . HIS A 1 459 ? 156.644 4.860   322.777 1.00 72.75  ?  453 HIS A CA  1 
ATOM   3492  C C   . HIS A 1 459 ? 156.921 4.601   324.255 1.00 75.64  ?  453 HIS A C   1 
ATOM   3493  O O   . HIS A 1 459 ? 156.702 5.456   325.118 1.00 75.66  ?  453 HIS A O   1 
ATOM   3494  C CB  . HIS A 1 459 ? 157.954 5.083   322.022 1.00 70.55  ?  453 HIS A CB  1 
ATOM   3495  C CG  . HIS A 1 459 ? 157.765 5.529   320.606 1.00 72.40  ?  453 HIS A CG  1 
ATOM   3496  N ND1 . HIS A 1 459 ? 157.299 6.784   320.276 1.00 73.63  ?  453 HIS A ND1 1 
ATOM   3497  C CD2 . HIS A 1 459 ? 157.978 4.888   319.432 1.00 73.11  ?  453 HIS A CD2 1 
ATOM   3498  C CE1 . HIS A 1 459 ? 157.233 6.896   318.962 1.00 70.28  ?  453 HIS A CE1 1 
ATOM   3499  N NE2 . HIS A 1 459 ? 157.639 5.760   318.426 1.00 81.01  ?  453 HIS A NE2 1 
ATOM   3500  N N   . THR A 1 460 ? 157.412 3.401   324.541 1.00 75.18  ?  454 THR A N   1 
ATOM   3501  C CA  . THR A 1 460 ? 157.600 2.947   325.907 1.00 81.21  ?  454 THR A CA  1 
ATOM   3502  C C   . THR A 1 460 ? 159.048 2.536   326.141 1.00 78.39  ?  454 THR A C   1 
ATOM   3503  O O   . THR A 1 460 ? 159.781 2.195   325.209 1.00 84.05  ?  454 THR A O   1 
ATOM   3504  C CB  . THR A 1 460 ? 156.667 1.776   326.227 1.00 81.75  ?  454 THR A CB  1 
ATOM   3505  O OG1 . THR A 1 460 ? 156.811 0.763   325.223 1.00 81.32  ?  454 THR A OG1 1 
ATOM   3506  C CG2 . THR A 1 460 ? 155.218 2.240   326.271 1.00 87.11  ?  454 THR A CG2 1 
ATOM   3507  N N   . TYR A 1 461 ? 159.451 2.571   327.410 1.00 75.65  ?  455 TYR A N   1 
ATOM   3508  C CA  . TYR A 1 461 ? 160.806 2.230   327.813 1.00 80.95  ?  455 TYR A CA  1 
ATOM   3509  C C   . TYR A 1 461 ? 160.768 1.231   328.961 1.00 82.26  ?  455 TYR A C   1 
ATOM   3510  O O   . TYR A 1 461 ? 159.748 1.061   329.634 1.00 86.25  ?  455 TYR A O   1 
ATOM   3511  C CB  . TYR A 1 461 ? 161.604 3.478   328.227 1.00 75.86  ?  455 TYR A CB  1 
ATOM   3512  C CG  . TYR A 1 461 ? 161.067 4.191   329.452 1.00 76.05  ?  455 TYR A CG  1 
ATOM   3513  C CD1 . TYR A 1 461 ? 161.514 3.860   330.726 1.00 78.25  ?  455 TYR A CD1 1 
ATOM   3514  C CD2 . TYR A 1 461 ? 160.123 5.203   329.334 1.00 78.90  ?  455 TYR A CD2 1 
ATOM   3515  C CE1 . TYR A 1 461 ? 161.031 4.509   331.846 1.00 81.50  ?  455 TYR A CE1 1 
ATOM   3516  C CE2 . TYR A 1 461 ? 159.634 5.859   330.451 1.00 81.60  ?  455 TYR A CE2 1 
ATOM   3517  C CZ  . TYR A 1 461 ? 160.092 5.507   331.704 1.00 83.42  ?  455 TYR A CZ  1 
ATOM   3518  O OH  . TYR A 1 461 ? 159.612 6.154   332.819 1.00 83.32  ?  455 TYR A OH  1 
ATOM   3519  N N   . GLU A 1 462 ? 161.902 0.572   329.179 1.00 80.93  ?  456 GLU A N   1 
ATOM   3520  C CA  . GLU A 1 462 ? 162.066 -0.368  330.276 1.00 84.23  ?  456 GLU A CA  1 
ATOM   3521  C C   . GLU A 1 462 ? 162.893 0.260   331.392 1.00 83.77  ?  456 GLU A C   1 
ATOM   3522  O O   . GLU A 1 462 ? 163.438 1.359   331.261 1.00 81.65  ?  456 GLU A O   1 
ATOM   3523  C CB  . GLU A 1 462 ? 162.733 -1.659  329.792 1.00 89.91  ?  456 GLU A CB  1 
ATOM   3524  C CG  . GLU A 1 462 ? 162.085 -2.286  328.574 1.00 92.24  ?  456 GLU A CG  1 
ATOM   3525  C CD  . GLU A 1 462 ? 162.710 -3.617  328.200 1.00 93.81  ?  456 GLU A CD  1 
ATOM   3526  O OE1 . GLU A 1 462 ? 163.357 -4.238  329.069 1.00 92.79  ?  456 GLU A OE1 1 
ATOM   3527  O OE2 . GLU A 1 462 ? 162.556 -4.042  327.035 1.00 93.72  -1 456 GLU A OE2 1 
ATOM   3528  N N   . LEU A 1 463 ? 162.982 -0.461  332.506 1.00 87.08  ?  457 LEU A N   1 
ATOM   3529  C CA  . LEU A 1 463 ? 163.842 -0.091  333.618 1.00 85.17  ?  457 LEU A CA  1 
ATOM   3530  C C   . LEU A 1 463 ? 164.795 -1.240  333.922 1.00 86.22  ?  457 LEU A C   1 
ATOM   3531  O O   . LEU A 1 463 ? 164.542 -2.394  333.563 1.00 87.01  ?  457 LEU A O   1 
ATOM   3532  C CB  . LEU A 1 463 ? 163.027 0.268   334.868 1.00 88.85  ?  457 LEU A CB  1 
ATOM   3533  C CG  . LEU A 1 463 ? 162.024 1.418   334.754 1.00 82.80  ?  457 LEU A CG  1 
ATOM   3534  C CD1 . LEU A 1 463 ? 161.284 1.611   336.068 1.00 76.11  ?  457 LEU A CD1 1 
ATOM   3535  C CD2 . LEU A 1 463 ? 162.717 2.703   334.336 1.00 74.19  ?  457 LEU A CD2 1 
ATOM   3536  N N   . LEU A 1 464 ? 165.902 -0.909  334.591 1.00 78.84  ?  458 LEU A N   1 
ATOM   3537  C CA  . LEU A 1 464 ? 166.925 -1.913  334.873 1.00 81.72  ?  458 LEU A CA  1 
ATOM   3538  C C   . LEU A 1 464 ? 166.388 -3.021  335.769 1.00 87.39  ?  458 LEU A C   1 
ATOM   3539  O O   . LEU A 1 464 ? 166.711 -4.199  335.575 1.00 90.26  ?  458 LEU A O   1 
ATOM   3540  C CB  . LEU A 1 464 ? 168.148 -1.258  335.519 1.00 87.81  ?  458 LEU A CB  1 
ATOM   3541  C CG  . LEU A 1 464 ? 169.175 -0.559  334.624 1.00 84.80  ?  458 LEU A CG  1 
ATOM   3542  C CD1 . LEU A 1 464 ? 168.655 0.772   334.115 1.00 82.06  ?  458 LEU A CD1 1 
ATOM   3543  C CD2 . LEU A 1 464 ? 170.489 -0.371  335.368 1.00 84.79  ?  458 LEU A CD2 1 
ATOM   3544  N N   . ALA A 1 465 ? 165.566 -2.664  336.754 1.00 88.35  ?  459 ALA A N   1 
ATOM   3545  C CA  . ALA A 1 465 ? 165.060 -3.611  337.738 1.00 88.37  ?  459 ALA A CA  1 
ATOM   3546  C C   . ALA A 1 465 ? 163.770 -4.297  337.302 1.00 97.27  ?  459 ALA A C   1 
ATOM   3547  O O   . ALA A 1 465 ? 163.136 -4.972  338.119 1.00 99.53  ?  459 ALA A O   1 
ATOM   3548  C CB  . ALA A 1 465 ? 164.843 -2.907  339.080 1.00 79.47  ?  459 ALA A CB  1 
ATOM   3549  N N   . LYS A 1 466 ? 163.368 -4.141  336.042 1.00 95.60  ?  460 LYS A N   1 
ATOM   3550  C CA  . LYS A 1 466 ? 162.178 -4.809  335.534 1.00 85.65  ?  460 LYS A CA  1 
ATOM   3551  C C   . LYS A 1 466 ? 162.271 -4.993  334.023 1.00 89.14  ?  460 LYS A C   1 
ATOM   3552  O O   . LYS A 1 466 ? 161.675 -4.216  333.264 1.00 84.04  ?  460 LYS A O   1 
ATOM   3553  C CB  . LYS A 1 466 ? 160.923 -4.016  335.897 1.00 86.03  ?  460 LYS A CB  1 
ATOM   3554  C CG  . LYS A 1 466 ? 161.142 -2.515  335.970 1.00 93.03  ?  460 LYS A CG  1 
ATOM   3555  C CD  . LYS A 1 466 ? 159.833 -1.773  335.824 1.00 100.18 ?  460 LYS A CD  1 
ATOM   3556  C CE  . LYS A 1 466 ? 159.273 -1.983  334.432 1.00 100.60 ?  460 LYS A CE  1 
ATOM   3557  N NZ  . LYS A 1 466 ? 157.873 -1.497  334.307 1.00 97.94  1  460 LYS A NZ  1 
ATOM   3558  N N   . PRO A 1 467 ? 163.004 -6.002  333.546 1.00 94.98  ?  461 PRO A N   1 
ATOM   3559  C CA  . PRO A 1 467 ? 163.110 -6.231  332.097 1.00 93.53  ?  461 PRO A CA  1 
ATOM   3560  C C   . PRO A 1 467 ? 161.879 -6.957  331.571 1.00 88.74  ?  461 PRO A C   1 
ATOM   3561  O O   . PRO A 1 467 ? 161.568 -8.070  332.000 1.00 89.78  ?  461 PRO A O   1 
ATOM   3562  C CB  . PRO A 1 467 ? 164.371 -7.092  331.969 1.00 92.11  ?  461 PRO A CB  1 
ATOM   3563  C CG  . PRO A 1 467 ? 164.441 -7.830  333.265 1.00 87.69  ?  461 PRO A CG  1 
ATOM   3564  C CD  . PRO A 1 467 ? 163.869 -6.912  334.317 1.00 89.88  ?  461 PRO A CD  1 
ATOM   3565  N N   . GLY A 1 468 ? 161.176 -6.323  330.635 1.00 89.95  ?  462 GLY A N   1 
ATOM   3566  C CA  . GLY A 1 468 ? 160.016 -6.946  330.030 1.00 92.38  ?  462 GLY A CA  1 
ATOM   3567  C C   . GLY A 1 468 ? 158.755 -6.108  330.093 1.00 95.86  ?  462 GLY A C   1 
ATOM   3568  O O   . GLY A 1 468 ? 157.810 -6.348  329.337 1.00 102.67 ?  462 GLY A O   1 
ATOM   3569  N N   . GLN A 1 469 ? 158.724 -5.123  330.987 1.00 89.08  ?  463 GLN A N   1 
ATOM   3570  C CA  . GLN A 1 469 ? 157.565 -4.258  331.162 1.00 88.46  ?  463 GLN A CA  1 
ATOM   3571  C C   . GLN A 1 469 ? 157.853 -2.893  330.552 1.00 85.55  ?  463 GLN A C   1 
ATOM   3572  O O   . GLN A 1 469 ? 158.916 -2.310  330.794 1.00 81.70  ?  463 GLN A O   1 
ATOM   3573  C CB  . GLN A 1 469 ? 157.199 -4.122  332.641 1.00 88.66  ?  463 GLN A CB  1 
ATOM   3574  C CG  . GLN A 1 469 ? 156.904 -5.446  333.327 1.00 87.35  ?  463 GLN A CG  1 
ATOM   3575  C CD  . GLN A 1 469 ? 156.596 -5.283  334.802 1.00 91.88  ?  463 GLN A CD  1 
ATOM   3576  O OE1 . GLN A 1 469 ? 156.546 -4.167  335.317 1.00 92.58  ?  463 GLN A OE1 1 
ATOM   3577  N NE2 . GLN A 1 469 ? 156.389 -6.400  335.490 1.00 85.09  ?  463 GLN A NE2 1 
ATOM   3578  N N   . PHE A 1 470 ? 156.904 -2.391  329.768 1.00 89.68  ?  464 PHE A N   1 
ATOM   3579  C CA  . PHE A 1 470 ? 157.063 -1.168  328.994 1.00 91.87  ?  464 PHE A CA  1 
ATOM   3580  C C   . PHE A 1 470 ? 156.235 -0.053  329.620 1.00 87.44  ?  464 PHE A C   1 
ATOM   3581  O O   . PHE A 1 470 ? 155.033 -0.222  329.851 1.00 84.63  ?  464 PHE A O   1 
ATOM   3582  C CB  . PHE A 1 470 ? 156.644 -1.406  327.542 1.00 91.94  ?  464 PHE A CB  1 
ATOM   3583  C CG  . PHE A 1 470 ? 157.524 -2.379  326.804 1.00 97.80  ?  464 PHE A CG  1 
ATOM   3584  C CD1 . PHE A 1 470 ? 158.896 -2.379  326.995 1.00 93.58  ?  464 PHE A CD1 1 
ATOM   3585  C CD2 . PHE A 1 470 ? 156.978 -3.297  325.920 1.00 101.01 ?  464 PHE A CD2 1 
ATOM   3586  C CE1 . PHE A 1 470 ? 159.706 -3.273  326.317 1.00 95.56  ?  464 PHE A CE1 1 
ATOM   3587  C CE2 . PHE A 1 470 ? 157.783 -4.193  325.241 1.00 104.77 ?  464 PHE A CE2 1 
ATOM   3588  C CZ  . PHE A 1 470 ? 159.149 -4.181  325.440 1.00 104.52 ?  464 PHE A CZ  1 
ATOM   3589  N N   . ILE A 1 471 ? 156.873 1.087   329.888 1.00 81.15  ?  465 ILE A N   1 
ATOM   3590  C CA  . ILE A 1 471 ? 156.252 2.172   330.638 1.00 76.58  ?  465 ILE A CA  1 
ATOM   3591  C C   . ILE A 1 471 ? 156.205 3.432   329.786 1.00 81.30  ?  465 ILE A C   1 
ATOM   3592  O O   . ILE A 1 471 ? 157.070 3.667   328.936 1.00 88.92  ?  465 ILE A O   1 
ATOM   3593  C CB  . ILE A 1 471 ? 157.004 2.463   331.955 1.00 86.09  ?  465 ILE A CB  1 
ATOM   3594  C CG1 . ILE A 1 471 ? 157.506 1.173   332.596 1.00 88.09  ?  465 ILE A CG1 1 
ATOM   3595  C CG2 . ILE A 1 471 ? 156.113 3.223   332.926 1.00 94.97  ?  465 ILE A CG2 1 
ATOM   3596  C CD1 . ILE A 1 471 ? 158.425 1.424   333.764 1.00 86.05  ?  465 ILE A CD1 1 
ATOM   3597  N N   . HIS A 1 472 ? 155.190 4.256   330.037 1.00 81.14  ?  466 HIS A N   1 
ATOM   3598  C CA  . HIS A 1 472 ? 155.110 5.608   329.502 1.00 77.58  ?  466 HIS A CA  1 
ATOM   3599  C C   . HIS A 1 472 ? 155.005 6.595   330.656 1.00 73.49  ?  466 HIS A C   1 
ATOM   3600  O O   . HIS A 1 472 ? 154.299 6.345   331.638 1.00 82.72  ?  466 HIS A O   1 
ATOM   3601  C CB  . HIS A 1 472 ? 153.913 5.777   328.561 1.00 71.70  ?  466 HIS A CB  1 
ATOM   3602  C CG  . HIS A 1 472 ? 153.756 7.169   328.031 1.00 73.85  ?  466 HIS A CG  1 
ATOM   3603  N ND1 . HIS A 1 472 ? 153.034 8.140   328.689 1.00 73.80  ?  466 HIS A ND1 1 
ATOM   3604  C CD2 . HIS A 1 472 ? 154.232 7.753   326.906 1.00 74.73  ?  466 HIS A CD2 1 
ATOM   3605  C CE1 . HIS A 1 472 ? 153.069 9.262   327.993 1.00 70.17  ?  466 HIS A CE1 1 
ATOM   3606  N NE2 . HIS A 1 472 ? 153.791 9.054   326.906 1.00 64.82  ?  466 HIS A NE2 1 
ATOM   3607  N N   . THR A 1 473 ? 155.712 7.714   330.533 1.00 66.80  ?  467 THR A N   1 
ATOM   3608  C CA  . THR A 1 473 ? 155.715 8.765   331.539 1.00 72.49  ?  467 THR A CA  1 
ATOM   3609  C C   . THR A 1 473 ? 155.073 10.020  330.963 1.00 76.00  ?  467 THR A C   1 
ATOM   3610  O O   . THR A 1 473 ? 155.279 10.352  329.792 1.00 71.68  ?  467 THR A O   1 
ATOM   3611  C CB  . THR A 1 473 ? 157.146 9.062   332.012 1.00 77.71  ?  467 THR A CB  1 
ATOM   3612  O OG1 . THR A 1 473 ? 157.615 7.980   332.827 1.00 72.25  ?  467 THR A OG1 1 
ATOM   3613  C CG2 . THR A 1 473 ? 157.212 10.356  332.813 1.00 76.50  ?  467 THR A CG2 1 
ATOM   3614  N N   . ASN A 1 474 ? 154.272 10.705  331.782 1.00 84.61  ?  468 ASN A N   1 
ATOM   3615  C CA  . ASN A 1 474 ? 153.664 11.974  331.383 1.00 84.58  ?  468 ASN A CA  1 
ATOM   3616  C C   . ASN A 1 474 ? 154.711 13.083  331.510 1.00 85.49  ?  468 ASN A C   1 
ATOM   3617  O O   . ASN A 1 474 ? 154.691 13.914  332.421 1.00 85.94  ?  468 ASN A O   1 
ATOM   3618  C CB  . ASN A 1 474 ? 152.426 12.261  332.221 1.00 91.50  ?  468 ASN A CB  1 
ATOM   3619  C CG  . ASN A 1 474 ? 151.446 13.181  331.518 1.00 103.77 ?  468 ASN A CG  1 
ATOM   3620  O OD1 . ASN A 1 474 ? 151.499 14.401  331.673 1.00 102.35 ?  468 ASN A OD1 1 
ATOM   3621  N ND2 . ASN A 1 474 ? 150.543 12.597  330.738 1.00 98.99  ?  468 ASN A ND2 1 
ATOM   3622  N N   . TRP A 1 475 ? 155.653 13.074  330.560 1.00 79.98  ?  469 TRP A N   1 
ATOM   3623  C CA  . TRP A 1 475 ? 156.745 14.042  330.581 1.00 77.87  ?  469 TRP A CA  1 
ATOM   3624  C C   . TRP A 1 475 ? 156.238 15.473  330.458 1.00 77.11  ?  469 TRP A C   1 
ATOM   3625  O O   . TRP A 1 475 ? 156.844 16.395  331.017 1.00 76.67  ?  469 TRP A O   1 
ATOM   3626  C CB  . TRP A 1 475 ? 157.736 13.751  329.452 1.00 79.66  ?  469 TRP A CB  1 
ATOM   3627  C CG  . TRP A 1 475 ? 158.427 12.419  329.530 1.00 81.02  ?  469 TRP A CG  1 
ATOM   3628  C CD1 . TRP A 1 475 ? 157.944 11.220  329.100 1.00 83.37  ?  469 TRP A CD1 1 
ATOM   3629  C CD2 . TRP A 1 475 ? 159.742 12.159  330.042 1.00 80.56  ?  469 TRP A CD2 1 
ATOM   3630  N NE1 . TRP A 1 475 ? 158.865 10.226  329.325 1.00 79.03  ?  469 TRP A NE1 1 
ATOM   3631  C CE2 . TRP A 1 475 ? 159.978 10.776  329.902 1.00 76.20  ?  469 TRP A CE2 1 
ATOM   3632  C CE3 . TRP A 1 475 ? 160.737 12.958  330.610 1.00 79.67  ?  469 TRP A CE3 1 
ATOM   3633  C CZ2 . TRP A 1 475 ? 161.168 10.177  330.310 1.00 76.87  ?  469 TRP A CZ2 1 
ATOM   3634  C CZ3 . TRP A 1 475 ? 161.917 12.360  331.017 1.00 80.50  ?  469 TRP A CZ3 1 
ATOM   3635  C CH2 . TRP A 1 475 ? 162.123 10.984  330.862 1.00 79.48  ?  469 TRP A CH2 1 
ATOM   3636  N N   . THR A 1 476 ? 155.143 15.678  329.733 1.00 86.15  ?  470 THR A N   1 
ATOM   3637  C CA  . THR A 1 476 ? 154.609 17.015  329.487 1.00 87.67  ?  470 THR A CA  1 
ATOM   3638  C C   . THR A 1 476 ? 154.176 17.699  330.781 1.00 85.04  ?  470 THR A C   1 
ATOM   3639  O O   . THR A 1 476 ? 153.672 17.053  331.698 1.00 88.37  ?  470 THR A O   1 
ATOM   3640  C CB  . THR A 1 476 ? 153.409 16.969  328.521 1.00 85.93  ?  470 THR A CB  1 
ATOM   3641  O OG1 . THR A 1 476 ? 153.786 16.289  327.317 1.00 77.47  ?  470 THR A OG1 1 
ATOM   3642  C CG2 . THR A 1 476 ? 152.946 18.378  328.177 1.00 71.21  ?  470 THR A CG2 1 
ATOM   3643  N N   . ALA B 1 8   ? 127.582 17.947  294.620 1.00 65.77  ?  2   ALA B N   1 
ATOM   3644  C CA  . ALA B 1 8   ? 128.981 17.987  295.030 1.00 60.02  ?  2   ALA B CA  1 
ATOM   3645  C C   . ALA B 1 8   ? 129.230 19.134  296.005 1.00 67.58  ?  2   ALA B C   1 
ATOM   3646  O O   . ALA B 1 8   ? 129.348 20.290  295.598 1.00 69.23  ?  2   ALA B O   1 
ATOM   3647  C CB  . ALA B 1 8   ? 129.885 18.115  293.815 1.00 50.51  ?  2   ALA B CB  1 
ATOM   3648  N N   . GLN B 1 9   ? 129.313 18.808  297.297 1.00 66.63  ?  3   GLN B N   1 
ATOM   3649  C CA  . GLN B 1 9   ? 129.502 19.809  298.336 1.00 68.84  ?  3   GLN B CA  1 
ATOM   3650  C C   . GLN B 1 9   ? 130.739 19.589  299.194 1.00 65.87  ?  3   GLN B C   1 
ATOM   3651  O O   . GLN B 1 9   ? 131.144 20.516  299.904 1.00 60.23  ?  3   GLN B O   1 
ATOM   3652  C CB  . GLN B 1 9   ? 128.270 19.868  299.256 1.00 66.27  ?  3   GLN B CB  1 
ATOM   3653  C CG  . GLN B 1 9   ? 128.288 18.884  300.424 1.00 70.22  ?  3   GLN B CG  1 
ATOM   3654  C CD  . GLN B 1 9   ? 128.050 17.439  300.009 1.00 71.77  ?  3   GLN B CD  1 
ATOM   3655  O OE1 . GLN B 1 9   ? 127.980 17.119  298.822 1.00 70.26  ?  3   GLN B OE1 1 
ATOM   3656  N NE2 . GLN B 1 9   ? 127.918 16.559  300.995 1.00 61.43  ?  3   GLN B NE2 1 
ATOM   3657  N N   . ALA B 1 10  ? 131.346 18.406  299.156 1.00 62.72  ?  4   ALA B N   1 
ATOM   3658  C CA  . ALA B 1 10  ? 132.550 18.132  299.927 1.00 52.26  ?  4   ALA B CA  1 
ATOM   3659  C C   . ALA B 1 10  ? 133.785 18.418  299.085 1.00 47.04  ?  4   ALA B C   1 
ATOM   3660  O O   . ALA B 1 10  ? 133.845 18.060  297.905 1.00 43.54  ?  4   ALA B O   1 
ATOM   3661  C CB  . ALA B 1 10  ? 132.566 16.681  300.412 1.00 50.15  ?  4   ALA B CB  1 
ATOM   3662  N N   . ASP B 1 11  ? 134.775 19.067  299.702 1.00 43.51  ?  5   ASP B N   1 
ATOM   3663  C CA  . ASP B 1 11  ? 135.969 19.463  298.965 1.00 47.51  ?  5   ASP B CA  1 
ATOM   3664  C C   . ASP B 1 11  ? 136.936 18.299  298.784 1.00 45.35  ?  5   ASP B C   1 
ATOM   3665  O O   . ASP B 1 11  ? 137.587 18.187  297.739 1.00 42.90  ?  5   ASP B O   1 
ATOM   3666  C CB  . ASP B 1 11  ? 136.670 20.621  299.677 1.00 49.07  ?  5   ASP B CB  1 
ATOM   3667  C CG  . ASP B 1 11  ? 135.713 21.720  300.088 1.00 51.24  ?  5   ASP B CG  1 
ATOM   3668  O OD1 . ASP B 1 11  ? 135.398 21.815  301.294 1.00 49.07  ?  5   ASP B OD1 1 
ATOM   3669  O OD2 . ASP B 1 11  ? 135.267 22.484  299.206 1.00 66.54  -1 5   ASP B OD2 1 
ATOM   3670  N N   . ILE B 1 12  ? 137.044 17.425  299.785 1.00 41.16  ?  6   ILE B N   1 
ATOM   3671  C CA  . ILE B 1 12  ? 138.027 16.349  299.776 1.00 39.20  ?  6   ILE B CA  1 
ATOM   3672  C C   . ILE B 1 12  ? 137.484 15.186  300.595 1.00 39.11  ?  6   ILE B C   1 
ATOM   3673  O O   . ILE B 1 12  ? 136.600 15.350  301.438 1.00 38.01  ?  6   ILE B O   1 
ATOM   3674  C CB  . ILE B 1 12  ? 139.393 16.831  300.326 1.00 42.04  ?  6   ILE B CB  1 
ATOM   3675  C CG1 . ILE B 1 12  ? 140.522 15.892  299.898 1.00 35.19  ?  6   ILE B CG1 1 
ATOM   3676  C CG2 . ILE B 1 12  ? 139.344 16.966  301.841 1.00 34.68  ?  6   ILE B CG2 1 
ATOM   3677  C CD1 . ILE B 1 12  ? 141.899 16.410  300.241 1.00 36.30  ?  6   ILE B CD1 1 
ATOM   3678  N N   . ALA B 1 13  ? 138.013 13.995  300.327 1.00 38.99  ?  7   ALA B N   1 
ATOM   3679  C CA  . ALA B 1 13  ? 137.652 12.791  301.058 1.00 34.32  ?  7   ALA B CA  1 
ATOM   3680  C C   . ALA B 1 13  ? 138.911 12.134  301.603 1.00 35.89  ?  7   ALA B C   1 
ATOM   3681  O O   . ALA B 1 13  ? 140.003 12.296  301.054 1.00 38.47  ?  7   ALA B O   1 
ATOM   3682  C CB  . ALA B 1 13  ? 136.886 11.800  300.174 1.00 35.26  ?  7   ALA B CB  1 
ATOM   3683  N N   . LEU B 1 14  ? 138.746 11.389  302.694 1.00 34.75  ?  8   LEU B N   1 
ATOM   3684  C CA  . LEU B 1 14  ? 139.853 10.686  303.328 1.00 32.16  ?  8   LEU B CA  1 
ATOM   3685  C C   . LEU B 1 14  ? 139.396 9.285   303.698 1.00 38.56  ?  8   LEU B C   1 
ATOM   3686  O O   . LEU B 1 14  ? 138.383 9.121   304.384 1.00 43.83  ?  8   LEU B O   1 
ATOM   3687  C CB  . LEU B 1 14  ? 140.350 11.438  304.571 1.00 33.91  ?  8   LEU B CB  1 
ATOM   3688  C CG  . LEU B 1 14  ? 141.633 10.940  305.245 1.00 43.75  ?  8   LEU B CG  1 
ATOM   3689  C CD1 . LEU B 1 14  ? 142.421 12.110  305.813 1.00 38.25  ?  8   LEU B CD1 1 
ATOM   3690  C CD2 . LEU B 1 14  ? 141.328 9.928   306.343 1.00 41.27  ?  8   LEU B CD2 1 
ATOM   3691  N N   . ILE B 1 15  ? 140.145 8.283   303.246 1.00 39.93  ?  9   ILE B N   1 
ATOM   3692  C CA  . ILE B 1 15  ? 139.847 6.883   303.522 1.00 39.88  ?  9   ILE B CA  1 
ATOM   3693  C C   . ILE B 1 15  ? 140.800 6.389   304.601 1.00 36.66  ?  9   ILE B C   1 
ATOM   3694  O O   . ILE B 1 15  ? 142.018 6.579   304.499 1.00 35.30  ?  9   ILE B O   1 
ATOM   3695  C CB  . ILE B 1 15  ? 139.959 6.028   302.249 1.00 35.09  ?  9   ILE B CB  1 
ATOM   3696  C CG1 . ILE B 1 15  ? 138.989 6.540   301.182 1.00 34.11  ?  9   ILE B CG1 1 
ATOM   3697  C CG2 . ILE B 1 15  ? 139.685 4.567   302.564 1.00 37.76  ?  9   ILE B CG2 1 
ATOM   3698  C CD1 . ILE B 1 15  ? 139.015 5.744   299.897 1.00 36.55  ?  9   ILE B CD1 1 
ATOM   3699  N N   . GLY B 1 16  ? 140.247 5.757   305.633 1.00 40.55  ?  10  GLY B N   1 
ATOM   3700  C CA  . GLY B 1 16  ? 141.042 5.287   306.749 1.00 42.31  ?  10  GLY B CA  1 
ATOM   3701  C C   . GLY B 1 16  ? 140.805 6.096   308.007 1.00 46.07  ?  10  GLY B C   1 
ATOM   3702  O O   . GLY B 1 16  ? 141.503 7.083   308.258 1.00 49.69  ?  10  GLY B O   1 
ATOM   3703  N N   . LEU B 1 17  ? 139.821 5.687   308.807 1.00 48.89  ?  11  LEU B N   1 
ATOM   3704  C CA  . LEU B 1 17  ? 139.434 6.437   310.003 1.00 51.29  ?  11  LEU B CA  1 
ATOM   3705  C C   . LEU B 1 17  ? 140.188 5.932   311.235 1.00 52.11  ?  11  LEU B C   1 
ATOM   3706  O O   . LEU B 1 17  ? 139.616 5.403   312.188 1.00 52.70  ?  11  LEU B O   1 
ATOM   3707  C CB  . LEU B 1 17  ? 137.925 6.366   310.207 1.00 52.02  ?  11  LEU B CB  1 
ATOM   3708  C CG  . LEU B 1 17  ? 137.100 7.147   309.185 1.00 52.52  ?  11  LEU B CG  1 
ATOM   3709  C CD1 . LEU B 1 17  ? 135.629 7.142   309.564 1.00 62.29  ?  11  LEU B CD1 1 
ATOM   3710  C CD2 . LEU B 1 17  ? 137.621 8.570   309.060 1.00 49.08  ?  11  LEU B CD2 1 
ATOM   3711  N N   . ALA B 1 18  ? 141.504 6.110   311.195 1.00 53.23  ?  12  ALA B N   1 
ATOM   3712  C CA  . ALA B 1 18  ? 142.364 5.895   312.347 1.00 45.03  ?  12  ALA B CA  1 
ATOM   3713  C C   . ALA B 1 18  ? 142.741 7.239   312.960 1.00 51.13  ?  12  ALA B C   1 
ATOM   3714  O O   . ALA B 1 18  ? 142.428 8.302   312.420 1.00 65.68  ?  12  ALA B O   1 
ATOM   3715  C CB  . ALA B 1 18  ? 143.618 5.111   311.951 1.00 44.89  ?  12  ALA B CB  1 
ATOM   3716  N N   . VAL B 1 19  ? 143.432 7.182   314.102 1.00 48.58  ?  13  VAL B N   1 
ATOM   3717  C CA  . VAL B 1 19  ? 143.809 8.406   314.807 1.00 56.63  ?  13  VAL B CA  1 
ATOM   3718  C C   . VAL B 1 19  ? 144.595 9.345   313.900 1.00 57.35  ?  13  VAL B C   1 
ATOM   3719  O O   . VAL B 1 19  ? 144.472 10.572  314.008 1.00 56.63  ?  13  VAL B O   1 
ATOM   3720  C CB  . VAL B 1 19  ? 144.597 8.063   316.086 1.00 57.17  ?  13  VAL B CB  1 
ATOM   3721  C CG1 . VAL B 1 19  ? 143.662 7.490   317.141 1.00 52.50  ?  13  VAL B CG1 1 
ATOM   3722  C CG2 . VAL B 1 19  ? 145.710 7.079   315.771 1.00 55.79  ?  13  VAL B CG2 1 
ATOM   3723  N N   . MET B 1 20  ? 145.399 8.796   312.987 1.00 50.46  ?  14  MET B N   1 
ATOM   3724  C CA  . MET B 1 20  ? 146.096 9.634   312.016 1.00 54.54  ?  14  MET B CA  1 
ATOM   3725  C C   . MET B 1 20  ? 145.123 10.216  310.999 1.00 53.94  ?  14  MET B C   1 
ATOM   3726  O O   . MET B 1 20  ? 145.135 11.423  310.732 1.00 54.36  ?  14  MET B O   1 
ATOM   3727  C CB  . MET B 1 20  ? 147.189 8.827   311.314 1.00 66.75  ?  14  MET B CB  1 
ATOM   3728  C CG  . MET B 1 20  ? 148.587 9.058   311.860 1.00 61.35  ?  14  MET B CG  1 
ATOM   3729  S SD  . MET B 1 20  ? 149.245 10.667  311.385 1.00 54.78  ?  14  MET B SD  1 
ATOM   3730  C CE  . MET B 1 20  ? 149.256 10.513  309.601 1.00 51.67  ?  14  MET B CE  1 
ATOM   3731  N N   . GLY B 1 21  ? 144.270 9.368   310.420 1.00 59.99  ?  15  GLY B N   1 
ATOM   3732  C CA  . GLY B 1 21  ? 143.321 9.849   309.430 1.00 58.40  ?  15  GLY B CA  1 
ATOM   3733  C C   . GLY B 1 21  ? 142.258 10.754  310.024 1.00 52.88  ?  15  GLY B C   1 
ATOM   3734  O O   . GLY B 1 21  ? 141.823 11.715  309.385 1.00 50.29  ?  15  GLY B O   1 
ATOM   3735  N N   . GLN B 1 22  ? 141.824 10.460  311.253 1.00 52.91  ?  16  GLN B N   1 
ATOM   3736  C CA  . GLN B 1 22  ? 140.822 11.299  311.902 1.00 52.51  ?  16  GLN B CA  1 
ATOM   3737  C C   . GLN B 1 22  ? 141.356 12.702  312.157 1.00 56.98  ?  16  GLN B C   1 
ATOM   3738  O O   . GLN B 1 22  ? 140.656 13.693  311.917 1.00 53.32  ?  16  GLN B O   1 
ATOM   3739  C CB  . GLN B 1 22  ? 140.365 10.659  313.213 1.00 51.78  ?  16  GLN B CB  1 
ATOM   3740  C CG  . GLN B 1 22  ? 139.562 9.380   313.049 1.00 53.27  ?  16  GLN B CG  1 
ATOM   3741  C CD  . GLN B 1 22  ? 139.216 8.741   314.380 1.00 62.20  ?  16  GLN B CD  1 
ATOM   3742  O OE1 . GLN B 1 22  ? 139.589 9.247   315.440 1.00 59.59  ?  16  GLN B OE1 1 
ATOM   3743  N NE2 . GLN B 1 22  ? 138.500 7.623   314.333 1.00 64.05  ?  16  GLN B NE2 1 
ATOM   3744  N N   . ASN B 1 23  ? 142.596 12.805  312.641 1.00 53.69  ?  17  ASN B N   1 
ATOM   3745  C CA  . ASN B 1 23  ? 143.159 14.114  312.960 1.00 48.22  ?  17  ASN B CA  1 
ATOM   3746  C C   . ASN B 1 23  ? 143.336 14.965  311.709 1.00 51.59  ?  17  ASN B C   1 
ATOM   3747  O O   . ASN B 1 23  ? 143.130 16.183  311.750 1.00 49.84  ?  17  ASN B O   1 
ATOM   3748  C CB  . ASN B 1 23  ? 144.489 13.948  313.695 1.00 59.19  ?  17  ASN B CB  1 
ATOM   3749  C CG  . ASN B 1 23  ? 144.311 13.441  315.112 1.00 61.05  ?  17  ASN B CG  1 
ATOM   3750  O OD1 . ASN B 1 23  ? 143.311 13.735  315.767 1.00 63.93  ?  17  ASN B OD1 1 
ATOM   3751  N ND2 . ASN B 1 23  ? 145.281 12.672  315.592 1.00 60.54  ?  17  ASN B ND2 1 
ATOM   3752  N N   . LEU B 1 24  ? 143.720 14.347  310.589 1.00 50.89  ?  18  LEU B N   1 
ATOM   3753  C CA  . LEU B 1 24  ? 143.831 15.099  309.342 1.00 47.39  ?  18  LEU B CA  1 
ATOM   3754  C C   . LEU B 1 24  ? 142.468 15.592  308.873 1.00 52.29  ?  18  LEU B C   1 
ATOM   3755  O O   . LEU B 1 24  ? 142.359 16.688  308.309 1.00 54.38  ?  18  LEU B O   1 
ATOM   3756  C CB  . LEU B 1 24  ? 144.493 14.244  308.262 1.00 49.20  ?  18  LEU B CB  1 
ATOM   3757  C CG  . LEU B 1 24  ? 146.014 14.104  308.342 1.00 52.61  ?  18  LEU B CG  1 
ATOM   3758  C CD1 . LEU B 1 24  ? 146.544 13.326  307.147 1.00 50.02  ?  18  LEU B CD1 1 
ATOM   3759  C CD2 . LEU B 1 24  ? 146.669 15.473  308.427 1.00 47.23  ?  18  LEU B CD2 1 
ATOM   3760  N N   . ILE B 1 25  ? 141.418 14.799  309.096 1.00 52.05  ?  19  ILE B N   1 
ATOM   3761  C CA  . ILE B 1 25  ? 140.070 15.230  308.738 1.00 48.67  ?  19  ILE B CA  1 
ATOM   3762  C C   . ILE B 1 25  ? 139.632 16.388  309.626 1.00 48.49  ?  19  ILE B C   1 
ATOM   3763  O O   . ILE B 1 25  ? 139.114 17.402  309.143 1.00 47.24  ?  19  ILE B O   1 
ATOM   3764  C CB  . ILE B 1 25  ? 139.088 14.048  308.824 1.00 48.20  ?  19  ILE B CB  1 
ATOM   3765  C CG1 . ILE B 1 25  ? 139.371 13.040  307.710 1.00 41.20  ?  19  ILE B CG1 1 
ATOM   3766  C CG2 . ILE B 1 25  ? 137.648 14.539  308.757 1.00 40.26  ?  19  ILE B CG2 1 
ATOM   3767  C CD1 . ILE B 1 25  ? 138.420 11.867  307.694 1.00 43.84  ?  19  ILE B CD1 1 
ATOM   3768  N N   . LEU B 1 26  ? 139.836 16.255  310.939 1.00 39.24  ?  20  LEU B N   1 
ATOM   3769  C CA  . LEU B 1 26  ? 139.497 17.341  311.851 1.00 42.75  ?  20  LEU B CA  1 
ATOM   3770  C C   . LEU B 1 26  ? 140.344 18.578  311.582 1.00 48.70  ?  20  LEU B C   1 
ATOM   3771  O O   . LEU B 1 26  ? 139.868 19.706  311.759 1.00 51.24  ?  20  LEU B O   1 
ATOM   3772  C CB  . LEU B 1 26  ? 139.666 16.883  313.299 1.00 48.80  ?  20  LEU B CB  1 
ATOM   3773  C CG  . LEU B 1 26  ? 138.820 15.688  313.744 1.00 54.76  ?  20  LEU B CG  1 
ATOM   3774  C CD1 . LEU B 1 26  ? 139.122 15.326  315.190 1.00 53.39  ?  20  LEU B CD1 1 
ATOM   3775  C CD2 . LEU B 1 26  ? 137.336 15.971  313.556 1.00 44.52  ?  20  LEU B CD2 1 
ATOM   3776  N N   . ASN B 1 27  ? 141.594 18.389  311.155 1.00 53.05  ?  21  ASN B N   1 
ATOM   3777  C CA  . ASN B 1 27  ? 142.439 19.525  310.799 1.00 49.51  ?  21  ASN B CA  1 
ATOM   3778  C C   . ASN B 1 27  ? 141.866 20.270  309.600 1.00 45.96  ?  21  ASN B C   1 
ATOM   3779  O O   . ASN B 1 27  ? 141.785 21.504  309.600 1.00 46.64  ?  21  ASN B O   1 
ATOM   3780  C CB  . ASN B 1 27  ? 143.863 19.045  310.511 1.00 52.20  ?  21  ASN B CB  1 
ATOM   3781  C CG  . ASN B 1 27  ? 144.880 20.173  310.523 1.00 49.15  ?  21  ASN B CG  1 
ATOM   3782  O OD1 . ASN B 1 27  ? 144.589 21.298  310.118 1.00 52.18  ?  21  ASN B OD1 1 
ATOM   3783  N ND2 . ASN B 1 27  ? 146.086 19.873  310.990 1.00 48.40  ?  21  ASN B ND2 1 
ATOM   3784  N N   . MET B 1 28  ? 141.458 19.532  308.565 1.00 44.27  ?  22  MET B N   1 
ATOM   3785  C CA  . MET B 1 28  ? 140.855 20.166  307.398 1.00 46.88  ?  22  MET B CA  1 
ATOM   3786  C C   . MET B 1 28  ? 139.502 20.782  307.730 1.00 48.38  ?  22  MET B C   1 
ATOM   3787  O O   . MET B 1 28  ? 139.104 21.771  307.105 1.00 48.83  ?  22  MET B O   1 
ATOM   3788  C CB  . MET B 1 28  ? 140.718 19.152  306.262 1.00 48.09  ?  22  MET B CB  1 
ATOM   3789  C CG  . MET B 1 28  ? 142.046 18.652  305.718 1.00 43.71  ?  22  MET B CG  1 
ATOM   3790  S SD  . MET B 1 28  ? 141.863 17.442  304.396 1.00 41.42  ?  22  MET B SD  1 
ATOM   3791  C CE  . MET B 1 28  ? 141.158 16.063  305.295 1.00 38.71  ?  22  MET B CE  1 
ATOM   3792  N N   . ASN B 1 29  ? 138.786 20.220  308.706 1.00 48.73  ?  23  ASN B N   1 
ATOM   3793  C CA  . ASN B 1 29  ? 137.516 20.808  309.118 1.00 45.59  ?  23  ASN B CA  1 
ATOM   3794  C C   . ASN B 1 29  ? 137.734 22.125  309.852 1.00 43.77  ?  23  ASN B C   1 
ATOM   3795  O O   . ASN B 1 29  ? 136.995 23.093  309.635 1.00 42.88  ?  23  ASN B O   1 
ATOM   3796  C CB  . ASN B 1 29  ? 136.739 19.825  309.993 1.00 46.70  ?  23  ASN B CB  1 
ATOM   3797  C CG  . ASN B 1 29  ? 135.333 20.304  310.304 1.00 49.67  ?  23  ASN B CG  1 
ATOM   3798  O OD1 . ASN B 1 29  ? 134.386 19.997  309.580 1.00 51.37  ?  23  ASN B OD1 1 
ATOM   3799  N ND2 . ASN B 1 29  ? 135.191 21.061  311.386 1.00 48.01  ?  23  ASN B ND2 1 
ATOM   3800  N N   . ASP B 1 30  ? 138.747 22.183  310.722 1.00 46.44  ?  24  ASP B N   1 
ATOM   3801  C CA  . ASP B 1 30  ? 139.052 23.420  311.432 1.00 42.94  ?  24  ASP B CA  1 
ATOM   3802  C C   . ASP B 1 30  ? 139.497 24.529  310.490 1.00 43.75  ?  24  ASP B C   1 
ATOM   3803  O O   . ASP B 1 30  ? 139.475 25.703  310.876 1.00 47.48  ?  24  ASP B O   1 
ATOM   3804  C CB  . ASP B 1 30  ? 140.128 23.171  312.490 1.00 41.99  ?  24  ASP B CB  1 
ATOM   3805  C CG  . ASP B 1 30  ? 139.677 22.200  313.563 1.00 52.66  ?  24  ASP B CG  1 
ATOM   3806  O OD1 . ASP B 1 30  ? 138.451 22.070  313.770 1.00 52.63  ?  24  ASP B OD1 1 
ATOM   3807  O OD2 . ASP B 1 30  ? 140.546 21.569  314.200 1.00 57.78  -1 24  ASP B OD2 1 
ATOM   3808  N N   . HIS B 1 31  ? 139.906 24.186  309.270 1.00 48.14  ?  25  HIS B N   1 
ATOM   3809  C CA  . HIS B 1 31  ? 140.240 25.168  308.251 1.00 48.13  ?  25  HIS B CA  1 
ATOM   3810  C C   . HIS B 1 31  ? 139.103 25.385  307.261 1.00 46.67  ?  25  HIS B C   1 
ATOM   3811  O O   . HIS B 1 31  ? 139.318 25.993  306.208 1.00 52.14  ?  25  HIS B O   1 
ATOM   3812  C CB  . HIS B 1 31  ? 141.517 24.754  307.516 1.00 45.28  ?  25  HIS B CB  1 
ATOM   3813  C CG  . HIS B 1 31  ? 142.750 24.837  308.361 1.00 46.07  ?  25  HIS B CG  1 
ATOM   3814  N ND1 . HIS B 1 31  ? 142.927 24.076  309.497 1.00 47.64  ?  25  HIS B ND1 1 
ATOM   3815  C CD2 . HIS B 1 31  ? 143.863 25.598  308.242 1.00 50.37  ?  25  HIS B CD2 1 
ATOM   3816  C CE1 . HIS B 1 31  ? 144.098 24.361  310.037 1.00 47.24  ?  25  HIS B CE1 1 
ATOM   3817  N NE2 . HIS B 1 31  ? 144.687 25.281  309.295 1.00 48.65  ?  25  HIS B NE2 1 
ATOM   3818  N N   . GLY B 1 32  ? 137.906 24.892  307.571 1.00 45.39  ?  26  GLY B N   1 
ATOM   3819  C CA  . GLY B 1 32  ? 136.723 25.207  306.796 1.00 53.94  ?  26  GLY B CA  1 
ATOM   3820  C C   . GLY B 1 32  ? 136.457 24.328  305.597 1.00 53.37  ?  26  GLY B C   1 
ATOM   3821  O O   . GLY B 1 32  ? 135.671 24.721  304.727 1.00 56.49  ?  26  GLY B O   1 
ATOM   3822  N N   . PHE B 1 33  ? 137.071 23.152  305.519 1.00 55.48  ?  27  PHE B N   1 
ATOM   3823  C CA  . PHE B 1 33  ? 136.883 22.251  304.390 1.00 52.51  ?  27  PHE B CA  1 
ATOM   3824  C C   . PHE B 1 33  ? 135.908 21.144  304.767 1.00 50.40  ?  27  PHE B C   1 
ATOM   3825  O O   . PHE B 1 33  ? 136.038 20.529  305.831 1.00 50.40  ?  27  PHE B O   1 
ATOM   3826  C CB  . PHE B 1 33  ? 138.216 21.649  303.940 1.00 50.72  ?  27  PHE B CB  1 
ATOM   3827  C CG  . PHE B 1 33  ? 139.225 22.672  303.499 1.00 52.06  ?  27  PHE B CG  1 
ATOM   3828  C CD1 . PHE B 1 33  ? 139.071 23.343  302.297 1.00 50.98  ?  27  PHE B CD1 1 
ATOM   3829  C CD2 . PHE B 1 33  ? 140.333 22.954  304.282 1.00 50.81  ?  27  PHE B CD2 1 
ATOM   3830  C CE1 . PHE B 1 33  ? 139.998 24.283  301.888 1.00 47.77  ?  27  PHE B CE1 1 
ATOM   3831  C CE2 . PHE B 1 33  ? 141.265 23.891  303.877 1.00 46.70  ?  27  PHE B CE2 1 
ATOM   3832  C CZ  . PHE B 1 33  ? 141.097 24.556  302.678 1.00 51.26  ?  27  PHE B CZ  1 
ATOM   3833  N N   . VAL B 1 34  ? 134.934 20.897  303.896 1.00 50.32  ?  28  VAL B N   1 
ATOM   3834  C CA  . VAL B 1 34  ? 133.982 19.807  304.086 1.00 50.12  ?  28  VAL B CA  1 
ATOM   3835  C C   . VAL B 1 34  ? 134.662 18.516  303.643 1.00 48.58  ?  28  VAL B C   1 
ATOM   3836  O O   . VAL B 1 34  ? 134.978 18.343  302.463 1.00 46.57  ?  28  VAL B O   1 
ATOM   3837  C CB  . VAL B 1 34  ? 132.684 20.050  303.308 1.00 51.08  ?  28  VAL B CB  1 
ATOM   3838  C CG1 . VAL B 1 34  ? 131.731 18.878  303.487 1.00 54.22  ?  28  VAL B CG1 1 
ATOM   3839  C CG2 . VAL B 1 34  ? 132.032 21.348  303.758 1.00 51.51  ?  28  VAL B CG2 1 
ATOM   3840  N N   . VAL B 1 35  ? 134.890 17.608  304.588 1.00 45.64  ?  29  VAL B N   1 
ATOM   3841  C CA  . VAL B 1 35  ? 135.614 16.367  304.339 1.00 50.26  ?  29  VAL B CA  1 
ATOM   3842  C C   . VAL B 1 35  ? 134.628 15.208  304.376 1.00 48.77  ?  29  VAL B C   1 
ATOM   3843  O O   . VAL B 1 35  ? 133.784 15.128  305.277 1.00 48.28  ?  29  VAL B O   1 
ATOM   3844  C CB  . VAL B 1 35  ? 136.743 16.160  305.363 1.00 48.21  ?  29  VAL B CB  1 
ATOM   3845  C CG1 . VAL B 1 35  ? 137.532 14.900  305.039 1.00 35.05  ?  29  VAL B CG1 1 
ATOM   3846  C CG2 . VAL B 1 35  ? 137.655 17.375  305.393 1.00 46.38  ?  29  VAL B CG2 1 
ATOM   3847  N N   . CYS B 1 36  ? 134.740 14.311  303.399 1.00 46.43  ?  30  CYS B N   1 
ATOM   3848  C CA  . CYS B 1 36  ? 133.921 13.107  303.330 1.00 47.53  ?  30  CYS B CA  1 
ATOM   3849  C C   . CYS B 1 36  ? 134.724 11.945  303.905 1.00 45.91  ?  30  CYS B C   1 
ATOM   3850  O O   . CYS B 1 36  ? 135.678 11.471  303.279 1.00 43.86  ?  30  CYS B O   1 
ATOM   3851  C CB  . CYS B 1 36  ? 133.493 12.820  301.893 1.00 42.13  ?  30  CYS B CB  1 
ATOM   3852  S SG  . CYS B 1 36  ? 132.552 11.291  301.692 1.00 49.46  ?  30  CYS B SG  1 
ATOM   3853  N N   . ALA B 1 37  ? 134.339 11.489  305.093 1.00 44.93  ?  31  ALA B N   1 
ATOM   3854  C CA  . ALA B 1 37  ? 135.042 10.396  305.745 1.00 44.07  ?  31  ALA B CA  1 
ATOM   3855  C C   . ALA B 1 37  ? 134.550 9.051   305.224 1.00 46.52  ?  31  ALA B C   1 
ATOM   3856  O O   . ALA B 1 37  ? 133.378 8.884   304.875 1.00 48.05  ?  31  ALA B O   1 
ATOM   3857  C CB  . ALA B 1 37  ? 134.860 10.467  307.262 1.00 45.63  ?  31  ALA B CB  1 
ATOM   3858  N N   . PHE B 1 38  ? 135.465 8.087   305.175 1.00 47.10  ?  32  PHE B N   1 
ATOM   3859  C CA  . PHE B 1 38  ? 135.148 6.751   304.693 1.00 43.15  ?  32  PHE B CA  1 
ATOM   3860  C C   . PHE B 1 38  ? 136.149 5.770   305.284 1.00 47.73  ?  32  PHE B C   1 
ATOM   3861  O O   . PHE B 1 38  ? 137.253 6.146   305.685 1.00 46.27  ?  32  PHE B O   1 
ATOM   3862  C CB  . PHE B 1 38  ? 135.160 6.689   303.160 1.00 47.09  ?  32  PHE B CB  1 
ATOM   3863  C CG  . PHE B 1 38  ? 134.767 5.350   302.601 1.00 45.89  ?  32  PHE B CG  1 
ATOM   3864  C CD1 . PHE B 1 38  ? 133.434 4.985   302.515 1.00 50.27  ?  32  PHE B CD1 1 
ATOM   3865  C CD2 . PHE B 1 38  ? 135.731 4.458   302.159 1.00 42.29  ?  32  PHE B CD2 1 
ATOM   3866  C CE1 . PHE B 1 38  ? 133.069 3.755   302.002 1.00 47.04  ?  32  PHE B CE1 1 
ATOM   3867  C CE2 . PHE B 1 38  ? 135.371 3.226   301.647 1.00 45.60  ?  32  PHE B CE2 1 
ATOM   3868  C CZ  . PHE B 1 38  ? 134.039 2.875   301.566 1.00 47.37  ?  32  PHE B CZ  1 
ATOM   3869  N N   . ASN B 1 39  ? 135.742 4.504   305.338 1.00 50.68  ?  33  ASN B N   1 
ATOM   3870  C CA  . ASN B 1 39  ? 136.588 3.441   305.856 1.00 47.55  ?  33  ASN B CA  1 
ATOM   3871  C C   . ASN B 1 39  ? 136.182 2.134   305.192 1.00 46.41  ?  33  ASN B C   1 
ATOM   3872  O O   . ASN B 1 39  ? 135.038 1.975   304.759 1.00 48.60  ?  33  ASN B O   1 
ATOM   3873  C CB  . ASN B 1 39  ? 136.477 3.334   307.382 1.00 48.03  ?  33  ASN B CB  1 
ATOM   3874  C CG  . ASN B 1 39  ? 137.611 2.538   307.997 1.00 51.83  ?  33  ASN B CG  1 
ATOM   3875  O OD1 . ASN B 1 39  ? 138.658 3.090   308.338 1.00 50.76  ?  33  ASN B OD1 1 
ATOM   3876  N ND2 . ASN B 1 39  ? 137.407 1.236   308.149 1.00 58.75  ?  33  ASN B ND2 1 
ATOM   3877  N N   . ARG B 1 40  ? 137.138 1.203   305.102 1.00 56.45  ?  34  ARG B N   1 
ATOM   3878  C CA  . ARG B 1 40  ? 136.838 -0.108  304.531 1.00 56.30  ?  34  ARG B CA  1 
ATOM   3879  C C   . ARG B 1 40  ? 135.710 -0.788  305.295 1.00 57.73  ?  34  ARG B C   1 
ATOM   3880  O O   . ARG B 1 40  ? 134.806 -1.379  304.692 1.00 55.54  ?  34  ARG B O   1 
ATOM   3881  C CB  . ARG B 1 40  ? 138.092 -0.980  304.528 1.00 61.18  ?  34  ARG B CB  1 
ATOM   3882  C CG  . ARG B 1 40  ? 137.913 -2.327  303.847 1.00 59.83  ?  34  ARG B CG  1 
ATOM   3883  C CD  . ARG B 1 40  ? 137.623 -2.172  302.364 1.00 62.94  ?  34  ARG B CD  1 
ATOM   3884  N NE  . ARG B 1 40  ? 137.660 -3.456  301.669 1.00 72.33  ?  34  ARG B NE  1 
ATOM   3885  C CZ  . ARG B 1 40  ? 138.746 -3.963  301.095 1.00 71.93  ?  34  ARG B CZ  1 
ATOM   3886  N NH1 . ARG B 1 40  ? 139.891 -3.294  301.131 1.00 78.76  1  34  ARG B NH1 1 
ATOM   3887  N NH2 . ARG B 1 40  ? 138.690 -5.139  300.485 1.00 58.83  ?  34  ARG B NH2 1 
ATOM   3888  N N   . THR B 1 41  ? 135.747 -0.716  306.623 1.00 58.04  ?  35  THR B N   1 
ATOM   3889  C CA  . THR B 1 41  ? 134.610 -1.079  307.459 1.00 58.10  ?  35  THR B CA  1 
ATOM   3890  C C   . THR B 1 41  ? 133.781 0.181   307.680 1.00 59.06  ?  35  THR B C   1 
ATOM   3891  O O   . THR B 1 41  ? 134.190 1.079   308.424 1.00 52.57  ?  35  THR B O   1 
ATOM   3892  C CB  . THR B 1 41  ? 135.070 -1.682  308.784 1.00 56.10  ?  35  THR B CB  1 
ATOM   3893  O OG1 . THR B 1 41  ? 135.695 -2.947  308.543 1.00 58.63  ?  35  THR B OG1 1 
ATOM   3894  C CG2 . THR B 1 41  ? 133.887 -1.882  309.721 1.00 61.16  ?  35  THR B CG2 1 
ATOM   3895  N N   . VAL B 1 42  ? 132.619 0.250   307.026 1.00 58.55  ?  36  VAL B N   1 
ATOM   3896  C CA  . VAL B 1 42  ? 131.769 1.431   307.083 1.00 56.04  ?  36  VAL B CA  1 
ATOM   3897  C C   . VAL B 1 42  ? 131.254 1.723   308.484 1.00 57.12  ?  36  VAL B C   1 
ATOM   3898  O O   . VAL B 1 42  ? 130.669 2.786   308.711 1.00 56.69  ?  36  VAL B O   1 
ATOM   3899  C CB  . VAL B 1 42  ? 130.584 1.278   306.105 1.00 53.86  ?  36  VAL B CB  1 
ATOM   3900  C CG1 . VAL B 1 42  ? 131.083 1.238   304.670 1.00 56.13  ?  36  VAL B CG1 1 
ATOM   3901  C CG2 . VAL B 1 42  ? 129.791 0.023   306.432 1.00 62.95  ?  36  VAL B CG2 1 
ATOM   3902  N N   . SER B 1 43  ? 131.458 0.805   309.430 1.00 56.83  ?  37  SER B N   1 
ATOM   3903  C CA  . SER B 1 43  ? 130.974 1.014   310.788 1.00 59.04  ?  37  SER B CA  1 
ATOM   3904  C C   . SER B 1 43  ? 131.695 2.164   311.478 1.00 62.03  ?  37  SER B C   1 
ATOM   3905  O O   . SER B 1 43  ? 131.100 2.853   312.315 1.00 69.66  ?  37  SER B O   1 
ATOM   3906  C CB  . SER B 1 43  ? 131.137 -0.268  311.595 1.00 59.54  ?  37  SER B CB  1 
ATOM   3907  O OG  . SER B 1 43  ? 130.585 -1.375  310.905 1.00 65.83  ?  37  SER B OG  1 
ATOM   3908  N N   . LYS B 1 44  ? 132.970 2.383   311.150 1.00 59.38  ?  38  LYS B N   1 
ATOM   3909  C CA  . LYS B 1 44  ? 133.713 3.481   311.757 1.00 61.81  ?  38  LYS B CA  1 
ATOM   3910  C C   . LYS B 1 44  ? 133.241 4.841   311.262 1.00 62.22  ?  38  LYS B C   1 
ATOM   3911  O O   . LYS B 1 44  ? 133.535 5.853   311.906 1.00 61.31  ?  38  LYS B O   1 
ATOM   3912  C CB  . LYS B 1 44  ? 135.210 3.319   311.485 1.00 61.16  ?  38  LYS B CB  1 
ATOM   3913  C CG  . LYS B 1 44  ? 135.843 2.125   312.179 1.00 58.05  ?  38  LYS B CG  1 
ATOM   3914  C CD  . LYS B 1 44  ? 135.866 2.309   313.688 1.00 71.21  ?  38  LYS B CD  1 
ATOM   3915  C CE  . LYS B 1 44  ? 136.758 3.472   314.090 1.00 62.75  ?  38  LYS B CE  1 
ATOM   3916  N NZ  . LYS B 1 44  ? 138.172 3.255   313.674 1.00 67.19  1  38  LYS B NZ  1 
ATOM   3917  N N   . VAL B 1 45  ? 132.518 4.888   310.142 1.00 59.30  ?  39  VAL B N   1 
ATOM   3918  C CA  . VAL B 1 45  ? 132.043 6.164   309.611 1.00 60.59  ?  39  VAL B CA  1 
ATOM   3919  C C   . VAL B 1 45  ? 131.040 6.797   310.568 1.00 63.61  ?  39  VAL B C   1 
ATOM   3920  O O   . VAL B 1 45  ? 131.286 7.870   311.131 1.00 62.17  ?  39  VAL B O   1 
ATOM   3921  C CB  . VAL B 1 45  ? 131.439 5.973   308.209 1.00 57.23  ?  39  VAL B CB  1 
ATOM   3922  C CG1 . VAL B 1 45  ? 130.972 7.307   307.647 1.00 52.07  ?  39  VAL B CG1 1 
ATOM   3923  C CG2 . VAL B 1 45  ? 132.451 5.321   307.280 1.00 51.60  ?  39  VAL B CG2 1 
ATOM   3924  N N   . ASP B 1 46  ? 129.896 6.136   310.771 1.00 70.71  ?  40  ASP B N   1 
ATOM   3925  C CA  . ASP B 1 46  ? 128.885 6.664   311.682 1.00 68.90  ?  40  ASP B CA  1 
ATOM   3926  C C   . ASP B 1 46  ? 129.407 6.762   313.109 1.00 63.18  ?  40  ASP B C   1 
ATOM   3927  O O   . ASP B 1 46  ? 128.944 7.607   313.884 1.00 56.73  ?  40  ASP B O   1 
ATOM   3928  C CB  . ASP B 1 46  ? 127.626 5.796   311.634 1.00 79.15  ?  40  ASP B CB  1 
ATOM   3929  C CG  . ASP B 1 46  ? 127.857 4.471   310.933 1.00 79.03  ?  40  ASP B CG  1 
ATOM   3930  O OD1 . ASP B 1 46  ? 128.410 4.478   309.812 1.00 77.65  ?  40  ASP B OD1 1 
ATOM   3931  O OD2 . ASP B 1 46  ? 127.490 3.422   311.503 1.00 74.48  -1 40  ASP B OD2 1 
ATOM   3932  N N   . ASP B 1 47  ? 130.367 5.909   313.477 1.00 61.44  ?  41  ASP B N   1 
ATOM   3933  C CA  . ASP B 1 47  ? 130.978 6.010   314.798 1.00 60.14  ?  41  ASP B CA  1 
ATOM   3934  C C   . ASP B 1 47  ? 131.820 7.274   314.918 1.00 63.46  ?  41  ASP B C   1 
ATOM   3935  O O   . ASP B 1 47  ? 131.769 7.968   315.940 1.00 61.90  ?  41  ASP B O   1 
ATOM   3936  C CB  . ASP B 1 47  ? 131.827 4.770   315.077 1.00 64.00  ?  41  ASP B CB  1 
ATOM   3937  C CG  . ASP B 1 47  ? 132.440 4.784   316.462 1.00 79.18  ?  41  ASP B CG  1 
ATOM   3938  O OD1 . ASP B 1 47  ? 131.768 4.333   317.413 1.00 83.23  ?  41  ASP B OD1 1 
ATOM   3939  O OD2 . ASP B 1 47  ? 133.591 5.251   316.602 1.00 80.53  -1 41  ASP B OD2 1 
ATOM   3940  N N   . PHE B 1 48  ? 132.597 7.591   313.880 1.00 63.46  ?  42  PHE B N   1 
ATOM   3941  C CA  . PHE B 1 48  ? 133.436 8.785   313.912 1.00 61.44  ?  42  PHE B CA  1 
ATOM   3942  C C   . PHE B 1 48  ? 132.616 10.058  313.737 1.00 58.79  ?  42  PHE B C   1 
ATOM   3943  O O   . PHE B 1 48  ? 133.016 11.121  314.226 1.00 60.21  ?  42  PHE B O   1 
ATOM   3944  C CB  . PHE B 1 48  ? 134.519 8.681   312.834 1.00 60.94  ?  42  PHE B CB  1 
ATOM   3945  C CG  . PHE B 1 48  ? 135.278 9.956   312.601 1.00 56.85  ?  42  PHE B CG  1 
ATOM   3946  C CD1 . PHE B 1 48  ? 136.166 10.435  313.549 1.00 49.23  ?  42  PHE B CD1 1 
ATOM   3947  C CD2 . PHE B 1 48  ? 135.118 10.666  311.422 1.00 50.04  ?  42  PHE B CD2 1 
ATOM   3948  C CE1 . PHE B 1 48  ? 136.868 11.606  313.331 1.00 48.88  ?  42  PHE B CE1 1 
ATOM   3949  C CE2 . PHE B 1 48  ? 135.818 11.836  311.198 1.00 42.81  ?  42  PHE B CE2 1 
ATOM   3950  C CZ  . PHE B 1 48  ? 136.695 12.306  312.154 1.00 40.85  ?  42  PHE B CZ  1 
ATOM   3951  N N   . LEU B 1 49  ? 131.468 9.972   313.062 1.00 59.62  ?  43  LEU B N   1 
ATOM   3952  C CA  . LEU B 1 49  ? 130.645 11.150  312.817 1.00 55.88  ?  43  LEU B CA  1 
ATOM   3953  C C   . LEU B 1 49  ? 129.848 11.589  314.038 1.00 58.70  ?  43  LEU B C   1 
ATOM   3954  O O   . LEU B 1 49  ? 129.372 12.729  314.069 1.00 60.23  ?  43  LEU B O   1 
ATOM   3955  C CB  . LEU B 1 49  ? 129.684 10.892  311.653 1.00 51.43  ?  43  LEU B CB  1 
ATOM   3956  C CG  . LEU B 1 49  ? 130.297 10.768  310.257 1.00 54.85  ?  43  LEU B CG  1 
ATOM   3957  C CD1 . LEU B 1 49  ? 129.222 10.457  309.228 1.00 60.16  ?  43  LEU B CD1 1 
ATOM   3958  C CD2 . LEU B 1 49  ? 131.049 12.035  309.887 1.00 51.37  ?  43  LEU B CD2 1 
ATOM   3959  N N   . ALA B 1 50  ? 129.687 10.721  315.037 1.00 58.15  ?  44  ALA B N   1 
ATOM   3960  C CA  . ALA B 1 50  ? 128.887 11.028  316.216 1.00 61.06  ?  44  ALA B CA  1 
ATOM   3961  C C   . ALA B 1 50  ? 129.733 11.184  317.475 1.00 64.24  ?  44  ALA B C   1 
ATOM   3962  O O   . ALA B 1 50  ? 129.211 11.060  318.587 1.00 64.04  ?  44  ALA B O   1 
ATOM   3963  C CB  . ALA B 1 50  ? 127.820 9.952   316.425 1.00 65.95  ?  44  ALA B CB  1 
ATOM   3964  N N   . ASN B 1 51  ? 131.029 11.456  317.325 1.00 66.68  ?  45  ASN B N   1 
ATOM   3965  C CA  . ASN B 1 51  ? 131.903 11.627  318.480 1.00 67.64  ?  45  ASN B CA  1 
ATOM   3966  C C   . ASN B 1 51  ? 132.844 12.808  318.282 1.00 72.56  ?  45  ASN B C   1 
ATOM   3967  O O   . ASN B 1 51  ? 132.474 13.955  318.554 1.00 75.07  ?  45  ASN B O   1 
ATOM   3968  C CB  . ASN B 1 51  ? 132.696 10.346  318.746 1.00 63.64  ?  45  ASN B CB  1 
ATOM   3969  C CG  . ASN B 1 51  ? 131.804 9.179   319.123 1.00 71.95  ?  45  ASN B CG  1 
ATOM   3970  O OD1 . ASN B 1 51  ? 131.305 9.102   320.245 1.00 81.62  ?  45  ASN B OD1 1 
ATOM   3971  N ND2 . ASN B 1 51  ? 131.600 8.262   318.185 1.00 66.49  ?  45  ASN B ND2 1 
ATOM   3972  N N   . GLU B 1 52  ? 134.065 12.542  317.811 1.00 67.95  ?  46  GLU B N   1 
ATOM   3973  C CA  . GLU B 1 52  ? 135.017 13.618  317.565 1.00 69.68  ?  46  GLU B CA  1 
ATOM   3974  C C   . GLU B 1 52  ? 134.633 14.487  316.374 1.00 62.48  ?  46  GLU B C   1 
ATOM   3975  O O   . GLU B 1 52  ? 135.267 15.526  316.160 1.00 58.07  ?  46  GLU B O   1 
ATOM   3976  C CB  . GLU B 1 52  ? 136.423 13.048  317.358 1.00 77.46  ?  46  GLU B CB  1 
ATOM   3977  C CG  . GLU B 1 52  ? 136.456 11.613  316.859 1.00 73.73  ?  46  GLU B CG  1 
ATOM   3978  C CD  . GLU B 1 52  ? 136.683 10.613  317.976 1.00 72.50  ?  46  GLU B CD  1 
ATOM   3979  O OE1 . GLU B 1 52  ? 137.003 11.044  319.104 1.00 72.91  ?  46  GLU B OE1 1 
ATOM   3980  O OE2 . GLU B 1 52  ? 136.545 9.397   317.726 1.00 72.13  -1 46  GLU B OE2 1 
ATOM   3981  N N   . ALA B 1 53  ? 133.621 14.092  315.600 1.00 63.44  ?  47  ALA B N   1 
ATOM   3982  C CA  . ALA B 1 53  ? 133.117 14.900  314.495 1.00 63.99  ?  47  ALA B CA  1 
ATOM   3983  C C   . ALA B 1 53  ? 131.667 15.317  314.712 1.00 54.22  ?  47  ALA B C   1 
ATOM   3984  O O   . ALA B 1 53  ? 130.983 15.695  313.755 1.00 57.22  ?  47  ALA B O   1 
ATOM   3985  C CB  . ALA B 1 53  ? 133.263 14.151  313.169 1.00 51.69  ?  47  ALA B CB  1 
ATOM   3986  N N   . LYS B 1 54  ? 131.182 15.255  315.950 1.00 57.26  ?  48  LYS B N   1 
ATOM   3987  C CA  . LYS B 1 54  ? 129.816 15.657  316.268 1.00 62.23  ?  48  LYS B CA  1 
ATOM   3988  C C   . LYS B 1 54  ? 129.749 17.179  316.303 1.00 61.22  ?  48  LYS B C   1 
ATOM   3989  O O   . LYS B 1 54  ? 130.337 17.814  317.184 1.00 59.18  ?  48  LYS B O   1 
ATOM   3990  C CB  . LYS B 1 54  ? 129.377 15.056  317.601 1.00 70.92  ?  48  LYS B CB  1 
ATOM   3991  C CG  . LYS B 1 54  ? 127.910 15.285  317.935 1.00 73.85  ?  48  LYS B CG  1 
ATOM   3992  C CD  . LYS B 1 54  ? 127.599 14.925  319.382 1.00 70.94  ?  48  LYS B CD  1 
ATOM   3993  C CE  . LYS B 1 54  ? 128.026 16.030  320.342 1.00 75.51  ?  48  LYS B CE  1 
ATOM   3994  N NZ  . LYS B 1 54  ? 129.491 16.301  320.305 1.00 65.65  1  48  LYS B NZ  1 
ATOM   3995  N N   . GLY B 1 55  ? 129.036 17.764  315.349 1.00 61.22  ?  49  GLY B N   1 
ATOM   3996  C CA  . GLY B 1 55  ? 128.925 19.202  315.250 1.00 66.34  ?  49  GLY B CA  1 
ATOM   3997  C C   . GLY B 1 55  ? 129.891 19.865  314.294 1.00 56.39  ?  49  GLY B C   1 
ATOM   3998  O O   . GLY B 1 55  ? 130.158 21.063  314.449 1.00 49.21  ?  49  GLY B O   1 
ATOM   3999  N N   . THR B 1 56  ? 130.419 19.134  313.319 1.00 56.77  ?  50  THR B N   1 
ATOM   4000  C CA  . THR B 1 56  ? 131.360 19.664  312.345 1.00 54.06  ?  50  THR B CA  1 
ATOM   4001  C C   . THR B 1 56  ? 130.764 19.568  310.947 1.00 50.35  ?  50  THR B C   1 
ATOM   4002  O O   . THR B 1 56  ? 129.686 19.007  310.739 1.00 52.62  ?  50  THR B O   1 
ATOM   4003  C CB  . THR B 1 56  ? 132.696 18.912  312.398 1.00 50.53  ?  50  THR B CB  1 
ATOM   4004  O OG1 . THR B 1 56  ? 132.493 17.551  312.000 1.00 51.88  ?  50  THR B OG1 1 
ATOM   4005  C CG2 . THR B 1 56  ? 133.269 18.941  313.806 1.00 51.99  ?  50  THR B CG2 1 
ATOM   4006  N N   . LYS B 1 57  ? 131.489 20.125  309.981 1.00 48.58  ?  51  LYS B N   1 
ATOM   4007  C CA  . LYS B 1 57  ? 131.100 20.060  308.579 1.00 42.71  ?  51  LYS B CA  1 
ATOM   4008  C C   . LYS B 1 57  ? 131.439 18.720  307.936 1.00 46.55  ?  51  LYS B C   1 
ATOM   4009  O O   . LYS B 1 57  ? 131.271 18.571  306.721 1.00 44.43  ?  51  LYS B O   1 
ATOM   4010  C CB  . LYS B 1 57  ? 131.770 21.193  307.797 1.00 46.21  ?  51  LYS B CB  1 
ATOM   4011  C CG  . LYS B 1 57  ? 131.554 22.574  308.395 1.00 45.19  ?  51  LYS B CG  1 
ATOM   4012  C CD  . LYS B 1 57  ? 132.435 23.614  307.719 1.00 59.70  ?  51  LYS B CD  1 
ATOM   4013  C CE  . LYS B 1 57  ? 132.284 24.977  308.376 1.00 70.02  ?  51  LYS B CE  1 
ATOM   4014  N NZ  . LYS B 1 57  ? 133.214 25.986  307.793 1.00 54.33  1  51  LYS B NZ  1 
ATOM   4015  N N   . VAL B 1 58  ? 131.907 17.749  308.720 1.00 51.20  ?  52  VAL B N   1 
ATOM   4016  C CA  . VAL B 1 58  ? 132.345 16.474  308.168 1.00 52.22  ?  52  VAL B CA  1 
ATOM   4017  C C   . VAL B 1 58  ? 131.135 15.643  307.769 1.00 41.94  ?  52  VAL B C   1 
ATOM   4018  O O   . VAL B 1 58  ? 130.184 15.486  308.545 1.00 50.81  ?  52  VAL B O   1 
ATOM   4019  C CB  . VAL B 1 58  ? 133.223 15.724  309.182 1.00 44.67  ?  52  VAL B CB  1 
ATOM   4020  C CG1 . VAL B 1 58  ? 133.638 14.370  308.630 1.00 42.14  ?  52  VAL B CG1 1 
ATOM   4021  C CG2 . VAL B 1 58  ? 134.444 16.555  309.543 1.00 50.56  ?  52  VAL B CG2 1 
ATOM   4022  N N   . VAL B 1 59  ? 131.166 15.107  306.554 1.00 43.66  ?  53  VAL B N   1 
ATOM   4023  C CA  . VAL B 1 59  ? 130.139 14.198  306.073 1.00 48.13  ?  53  VAL B CA  1 
ATOM   4024  C C   . VAL B 1 59  ? 130.751 12.807  305.935 1.00 49.98  ?  53  VAL B C   1 
ATOM   4025  O O   . VAL B 1 59  ? 131.970 12.633  305.955 1.00 51.02  ?  53  VAL B O   1 
ATOM   4026  C CB  . VAL B 1 59  ? 129.518 14.675  304.745 1.00 52.17  ?  53  VAL B CB  1 
ATOM   4027  C CG1 . VAL B 1 59  ? 128.948 16.076  304.900 1.00 54.02  ?  53  VAL B CG1 1 
ATOM   4028  C CG2 . VAL B 1 59  ? 130.550 14.634  303.631 1.00 50.59  ?  53  VAL B CG2 1 
ATOM   4029  N N   . GLY B 1 60  ? 129.881 11.801  305.803 1.00 46.06  ?  54  GLY B N   1 
ATOM   4030  C CA  . GLY B 1 60  ? 130.317 10.428  305.687 1.00 46.89  ?  54  GLY B CA  1 
ATOM   4031  C C   . GLY B 1 60  ? 129.671 9.740   304.497 1.00 50.77  ?  54  GLY B C   1 
ATOM   4032  O O   . GLY B 1 60  ? 128.717 10.244  303.898 1.00 54.69  ?  54  GLY B O   1 
ATOM   4033  N N   . ALA B 1 61  ? 130.216 8.571   304.167 1.00 50.34  ?  55  ALA B N   1 
ATOM   4034  C CA  . ALA B 1 61  ? 129.711 7.753   303.076 1.00 55.14  ?  55  ALA B CA  1 
ATOM   4035  C C   . ALA B 1 61  ? 129.863 6.284   303.441 1.00 56.45  ?  55  ALA B C   1 
ATOM   4036  O O   . ALA B 1 61  ? 130.815 5.894   304.121 1.00 52.33  ?  55  ALA B O   1 
ATOM   4037  C CB  . ALA B 1 61  ? 130.440 8.049   301.757 1.00 47.08  ?  55  ALA B CB  1 
ATOM   4038  N N   . GLN B 1 62  ? 128.909 5.472   302.986 1.00 58.18  ?  56  GLN B N   1 
ATOM   4039  C CA  . GLN B 1 62  ? 128.913 4.038   303.248 1.00 59.23  ?  56  GLN B CA  1 
ATOM   4040  C C   . GLN B 1 62  ? 129.311 3.220   302.026 1.00 54.99  ?  56  GLN B C   1 
ATOM   4041  O O   . GLN B 1 62  ? 129.164 1.994   302.037 1.00 58.89  ?  56  GLN B O   1 
ATOM   4042  C CB  . GLN B 1 62  ? 127.542 3.588   303.760 1.00 59.35  ?  56  GLN B CB  1 
ATOM   4043  C CG  . GLN B 1 62  ? 127.285 3.892   305.232 1.00 56.06  ?  56  GLN B CG  1 
ATOM   4044  C CD  . GLN B 1 62  ? 127.111 5.373   305.513 1.00 59.96  ?  56  GLN B CD  1 
ATOM   4045  O OE1 . GLN B 1 62  ? 126.899 6.171   304.599 1.00 60.86  ?  56  GLN B OE1 1 
ATOM   4046  N NE2 . GLN B 1 62  ? 127.198 5.748   306.785 1.00 55.45  ?  56  GLN B NE2 1 
ATOM   4047  N N   . SER B 1 63  ? 129.810 3.867   300.976 1.00 52.80  ?  57  SER B N   1 
ATOM   4048  C CA  . SER B 1 63  ? 130.271 3.165   299.787 1.00 51.27  ?  57  SER B CA  1 
ATOM   4049  C C   . SER B 1 63  ? 131.205 4.083   299.014 1.00 53.55  ?  57  SER B C   1 
ATOM   4050  O O   . SER B 1 63  ? 131.137 5.309   299.132 1.00 52.40  ?  57  SER B O   1 
ATOM   4051  C CB  . SER B 1 63  ? 129.101 2.717   298.904 1.00 60.69  ?  57  SER B CB  1 
ATOM   4052  O OG  . SER B 1 63  ? 128.400 3.831   298.381 1.00 63.56  ?  57  SER B OG  1 
ATOM   4053  N N   . LEU B 1 64  ? 132.083 3.467   298.218 1.00 47.53  ?  58  LEU B N   1 
ATOM   4054  C CA  . LEU B 1 64  ? 133.019 4.246   297.414 1.00 42.84  ?  58  LEU B CA  1 
ATOM   4055  C C   . LEU B 1 64  ? 132.292 5.059   296.350 1.00 41.80  ?  58  LEU B C   1 
ATOM   4056  O O   . LEU B 1 64  ? 132.689 6.191   296.049 1.00 41.12  ?  58  LEU B O   1 
ATOM   4057  C CB  . LEU B 1 64  ? 134.057 3.327   296.772 1.00 45.74  ?  58  LEU B CB  1 
ATOM   4058  C CG  . LEU B 1 64  ? 135.177 2.808   297.676 1.00 45.30  ?  58  LEU B CG  1 
ATOM   4059  C CD1 . LEU B 1 64  ? 136.103 1.889   296.898 1.00 43.50  ?  58  LEU B CD1 1 
ATOM   4060  C CD2 . LEU B 1 64  ? 135.955 3.965   298.275 1.00 33.32  ?  58  LEU B CD2 1 
ATOM   4061  N N   . LYS B 1 65  ? 131.226 4.501   295.770 1.00 44.36  ?  59  LYS B N   1 
ATOM   4062  C CA  . LYS B 1 65  ? 130.462 5.244   294.773 1.00 44.53  ?  59  LYS B CA  1 
ATOM   4063  C C   . LYS B 1 65  ? 129.789 6.463   295.392 1.00 45.20  ?  59  LYS B C   1 
ATOM   4064  O O   . LYS B 1 65  ? 129.764 7.540   294.784 1.00 41.74  ?  59  LYS B O   1 
ATOM   4065  C CB  . LYS B 1 65  ? 129.428 4.333   294.114 1.00 48.22  ?  59  LYS B CB  1 
ATOM   4066  C CG  . LYS B 1 65  ? 128.587 5.019   293.047 1.00 58.72  ?  59  LYS B CG  1 
ATOM   4067  C CD  . LYS B 1 65  ? 127.630 4.044   292.381 1.00 53.63  ?  59  LYS B CD  1 
ATOM   4068  C CE  . LYS B 1 65  ? 128.386 2.924   291.686 1.00 61.03  ?  59  LYS B CE  1 
ATOM   4069  N NZ  . LYS B 1 65  ? 127.465 1.942   291.052 1.00 66.95  1  59  LYS B NZ  1 
ATOM   4070  N N   . GLU B 1 66  ? 129.242 6.316   296.601 1.00 44.22  ?  60  GLU B N   1 
ATOM   4071  C CA  . GLU B 1 66  ? 128.660 7.463   297.289 1.00 49.56  ?  60  GLU B CA  1 
ATOM   4072  C C   . GLU B 1 66  ? 129.722 8.506   297.610 1.00 50.24  ?  60  GLU B C   1 
ATOM   4073  O O   . GLU B 1 66  ? 129.495 9.708   297.433 1.00 53.37  ?  60  GLU B O   1 
ATOM   4074  C CB  . GLU B 1 66  ? 127.952 7.010   298.566 1.00 53.51  ?  60  GLU B CB  1 
ATOM   4075  C CG  . GLU B 1 66  ? 127.359 8.148   299.384 1.00 51.96  ?  60  GLU B CG  1 
ATOM   4076  C CD  . GLU B 1 66  ? 126.860 7.694   300.741 1.00 57.88  ?  60  GLU B CD  1 
ATOM   4077  O OE1 . GLU B 1 66  ? 126.915 6.477   301.020 1.00 62.66  ?  60  GLU B OE1 1 
ATOM   4078  O OE2 . GLU B 1 66  ? 126.418 8.554   301.532 1.00 55.10  -1 60  GLU B OE2 1 
ATOM   4079  N N   . MET B 1 67  ? 130.891 8.063   298.079 1.00 49.87  ?  61  MET B N   1 
ATOM   4080  C CA  . MET B 1 67  ? 131.968 8.993   298.404 1.00 46.64  ?  61  MET B CA  1 
ATOM   4081  C C   . MET B 1 67  ? 132.414 9.768   297.170 1.00 45.99  ?  61  MET B C   1 
ATOM   4082  O O   . MET B 1 67  ? 132.591 10.991  297.220 1.00 47.24  ?  61  MET B O   1 
ATOM   4083  C CB  . MET B 1 67  ? 133.145 8.233   299.015 1.00 45.19  ?  61  MET B CB  1 
ATOM   4084  C CG  . MET B 1 67  ? 134.325 9.113   299.382 1.00 48.53  ?  61  MET B CG  1 
ATOM   4085  S SD  . MET B 1 67  ? 135.848 8.169   299.565 1.00 55.95  ?  61  MET B SD  1 
ATOM   4086  C CE  . MET B 1 67  ? 136.052 7.551   297.897 1.00 39.90  ?  61  MET B CE  1 
ATOM   4087  N N   . VAL B 1 68  ? 132.602 9.067   296.050 1.00 40.92  ?  62  VAL B N   1 
ATOM   4088  C CA  . VAL B 1 68  ? 133.011 9.722   294.811 1.00 43.91  ?  62  VAL B CA  1 
ATOM   4089  C C   . VAL B 1 68  ? 131.947 10.707  294.341 1.00 47.95  ?  62  VAL B C   1 
ATOM   4090  O O   . VAL B 1 68  ? 132.269 11.770  293.795 1.00 50.82  ?  62  VAL B O   1 
ATOM   4091  C CB  . VAL B 1 68  ? 133.326 8.657   293.740 1.00 38.94  ?  62  VAL B CB  1 
ATOM   4092  C CG1 . VAL B 1 68  ? 133.472 9.285   292.365 1.00 36.56  ?  62  VAL B CG1 1 
ATOM   4093  C CG2 . VAL B 1 68  ? 134.592 7.898   294.110 1.00 35.52  ?  62  VAL B CG2 1 
ATOM   4094  N N   . SER B 1 69  ? 130.672 10.392  294.572 1.00 46.41  ?  63  SER B N   1 
ATOM   4095  C CA  . SER B 1 69  ? 129.576 11.226  294.097 1.00 46.44  ?  63  SER B CA  1 
ATOM   4096  C C   . SER B 1 69  ? 129.349 12.474  294.943 1.00 45.04  ?  63  SER B C   1 
ATOM   4097  O O   . SER B 1 69  ? 128.515 13.306  294.570 1.00 38.59  ?  63  SER B O   1 
ATOM   4098  C CB  . SER B 1 69  ? 128.282 10.410  294.049 1.00 51.12  ?  63  SER B CB  1 
ATOM   4099  O OG  . SER B 1 69  ? 127.895 9.999   295.349 1.00 46.82  ?  63  SER B OG  1 
ATOM   4100  N N   . LYS B 1 70  ? 130.058 12.629  296.060 1.00 46.53  ?  64  LYS B N   1 
ATOM   4101  C CA  . LYS B 1 70  ? 129.853 13.758  296.960 1.00 47.47  ?  64  LYS B CA  1 
ATOM   4102  C C   . LYS B 1 70  ? 131.005 14.755  296.935 1.00 50.28  ?  64  LYS B C   1 
ATOM   4103  O O   . LYS B 1 70  ? 131.026 15.681  297.752 1.00 55.60  ?  64  LYS B O   1 
ATOM   4104  C CB  . LYS B 1 70  ? 129.625 13.258  298.390 1.00 40.40  ?  64  LYS B CB  1 
ATOM   4105  C CG  . LYS B 1 70  ? 128.373 12.412  298.556 1.00 45.61  ?  64  LYS B CG  1 
ATOM   4106  C CD  . LYS B 1 70  ? 128.246 11.855  299.966 1.00 45.40  ?  64  LYS B CD  1 
ATOM   4107  C CE  . LYS B 1 70  ? 127.945 12.952  300.974 1.00 57.21  ?  64  LYS B CE  1 
ATOM   4108  N NZ  . LYS B 1 70  ? 127.707 12.404  302.339 1.00 52.04  1  64  LYS B NZ  1 
ATOM   4109  N N   . LEU B 1 71  ? 131.953 14.600  296.016 1.00 44.38  ?  65  LEU B N   1 
ATOM   4110  C CA  . LEU B 1 71  ? 133.144 15.434  295.969 1.00 46.33  ?  65  LEU B CA  1 
ATOM   4111  C C   . LEU B 1 71  ? 133.098 16.368  294.768 1.00 43.76  ?  65  LEU B C   1 
ATOM   4112  O O   . LEU B 1 71  ? 132.743 15.954  293.660 1.00 46.45  ?  65  LEU B O   1 
ATOM   4113  C CB  . LEU B 1 71  ? 134.407 14.576  295.904 1.00 46.45  ?  65  LEU B CB  1 
ATOM   4114  C CG  . LEU B 1 71  ? 134.602 13.610  297.069 1.00 42.38  ?  65  LEU B CG  1 
ATOM   4115  C CD1 . LEU B 1 71  ? 135.824 12.762  296.821 1.00 42.08  ?  65  LEU B CD1 1 
ATOM   4116  C CD2 . LEU B 1 71  ? 134.728 14.369  298.381 1.00 37.99  ?  65  LEU B CD2 1 
ATOM   4117  N N   . LYS B 1 72  ? 133.469 17.626  294.994 1.00 45.37  ?  66  LYS B N   1 
ATOM   4118  C CA  . LYS B 1 72  ? 133.528 18.596  293.910 1.00 50.13  ?  66  LYS B CA  1 
ATOM   4119  C C   . LYS B 1 72  ? 134.755 18.338  293.043 1.00 44.53  ?  66  LYS B C   1 
ATOM   4120  O O   . LYS B 1 72  ? 135.862 18.141  293.553 1.00 47.63  ?  66  LYS B O   1 
ATOM   4121  C CB  . LYS B 1 72  ? 133.549 20.018  294.471 1.00 53.56  ?  66  LYS B CB  1 
ATOM   4122  C CG  . LYS B 1 72  ? 134.561 20.242  295.585 1.00 53.56  ?  66  LYS B CG  1 
ATOM   4123  C CD  . LYS B 1 72  ? 134.434 21.639  296.174 1.00 56.39  ?  66  LYS B CD  1 
ATOM   4124  C CE  . LYS B 1 72  ? 133.041 21.875  296.740 1.00 57.04  ?  66  LYS B CE  1 
ATOM   4125  N NZ  . LYS B 1 72  ? 132.895 23.242  297.313 1.00 53.62  1  66  LYS B NZ  1 
ATOM   4126  N N   . LYS B 1 73  ? 134.553 18.334  291.727 1.00 41.04  ?  67  LYS B N   1 
ATOM   4127  C CA  . LYS B 1 73  ? 135.612 17.997  290.791 1.00 42.76  ?  67  LYS B CA  1 
ATOM   4128  C C   . LYS B 1 73  ? 136.594 19.159  290.630 1.00 51.72  ?  67  LYS B C   1 
ATOM   4129  O O   . LYS B 1 73  ? 136.201 20.327  290.701 1.00 56.77  ?  67  LYS B O   1 
ATOM   4130  C CB  . LYS B 1 73  ? 135.021 17.626  289.435 1.00 39.72  ?  67  LYS B CB  1 
ATOM   4131  C CG  . LYS B 1 73  ? 134.091 16.426  289.487 1.00 46.51  ?  67  LYS B CG  1 
ATOM   4132  C CD  . LYS B 1 73  ? 133.514 16.106  288.120 1.00 46.73  ?  67  LYS B CD  1 
ATOM   4133  C CE  . LYS B 1 73  ? 134.609 15.764  287.125 1.00 47.95  ?  67  LYS B CE  1 
ATOM   4134  N NZ  . LYS B 1 73  ? 134.046 15.363  285.807 1.00 48.46  1  67  LYS B NZ  1 
ATOM   4135  N N   . PRO B 1 74  ? 137.889 18.864  290.418 1.00 55.09  ?  68  PRO B N   1 
ATOM   4136  C CA  . PRO B 1 74  ? 138.494 17.525  290.373 1.00 45.64  ?  68  PRO B CA  1 
ATOM   4137  C C   . PRO B 1 74  ? 138.506 16.824  291.731 1.00 37.45  ?  68  PRO B C   1 
ATOM   4138  O O   . PRO B 1 74  ? 138.941 17.405  292.726 1.00 38.36  ?  68  PRO B O   1 
ATOM   4139  C CB  . PRO B 1 74  ? 139.925 17.800  289.897 1.00 44.33  ?  68  PRO B CB  1 
ATOM   4140  C CG  . PRO B 1 74  ? 139.857 19.133  289.230 1.00 49.99  ?  68  PRO B CG  1 
ATOM   4141  C CD  . PRO B 1 74  ? 138.854 19.903  290.025 1.00 50.95  ?  68  PRO B CD  1 
ATOM   4142  N N   . ARG B 1 75  ? 138.022 15.586  291.756 1.00 37.54  ?  69  ARG B N   1 
ATOM   4143  C CA  . ARG B 1 75  ? 137.887 14.853  293.006 1.00 37.47  ?  69  ARG B CA  1 
ATOM   4144  C C   . ARG B 1 75  ? 139.254 14.540  293.601 1.00 38.72  ?  69  ARG B C   1 
ATOM   4145  O O   . ARG B 1 75  ? 140.197 14.187  292.888 1.00 32.30  ?  69  ARG B O   1 
ATOM   4146  C CB  . ARG B 1 75  ? 137.101 13.563  292.780 1.00 39.45  ?  69  ARG B CB  1 
ATOM   4147  C CG  . ARG B 1 75  ? 135.722 13.782  292.183 1.00 46.23  ?  69  ARG B CG  1 
ATOM   4148  C CD  . ARG B 1 75  ? 134.985 12.467  292.019 1.00 50.00  ?  69  ARG B CD  1 
ATOM   4149  N NE  . ARG B 1 75  ? 133.652 12.643  291.449 1.00 48.55  ?  69  ARG B NE  1 
ATOM   4150  C CZ  . ARG B 1 75  ? 133.373 12.537  290.153 1.00 52.11  ?  69  ARG B CZ  1 
ATOM   4151  N NH1 . ARG B 1 75  ? 134.336 12.254  289.286 1.00 54.77  1  69  ARG B NH1 1 
ATOM   4152  N NH2 . ARG B 1 75  ? 132.131 12.712  289.723 1.00 54.21  ?  69  ARG B NH2 1 
ATOM   4153  N N   . ARG B 1 76  ? 139.352 14.667  294.922 1.00 37.26  ?  70  ARG B N   1 
ATOM   4154  C CA  . ARG B 1 76  ? 140.607 14.495  295.643 1.00 34.22  ?  70  ARG B CA  1 
ATOM   4155  C C   . ARG B 1 76  ? 140.402 13.480  296.756 1.00 37.67  ?  70  ARG B C   1 
ATOM   4156  O O   . ARG B 1 76  ? 139.628 13.724  297.687 1.00 40.30  ?  70  ARG B O   1 
ATOM   4157  C CB  . ARG B 1 76  ? 141.097 15.834  296.203 1.00 37.90  ?  70  ARG B CB  1 
ATOM   4158  C CG  . ARG B 1 76  ? 141.586 16.798  295.131 1.00 35.85  ?  70  ARG B CG  1 
ATOM   4159  C CD  . ARG B 1 76  ? 141.574 18.241  295.611 1.00 41.66  ?  70  ARG B CD  1 
ATOM   4160  N NE  . ARG B 1 76  ? 140.234 18.820  295.560 1.00 52.60  ?  70  ARG B NE  1 
ATOM   4161  C CZ  . ARG B 1 76  ? 139.959 20.094  295.821 1.00 53.57  ?  70  ARG B CZ  1 
ATOM   4162  N NH1 . ARG B 1 76  ? 140.932 20.932  296.154 1.00 52.48  1  70  ARG B NH1 1 
ATOM   4163  N NH2 . ARG B 1 76  ? 138.710 20.533  295.748 1.00 61.14  ?  70  ARG B NH2 1 
ATOM   4164  N N   . ILE B 1 77  ? 141.092 12.346  296.657 1.00 38.43  ?  71  ILE B N   1 
ATOM   4165  C CA  . ILE B 1 77  ? 140.999 11.262  297.629 1.00 28.31  ?  71  ILE B CA  1 
ATOM   4166  C C   . ILE B 1 77  ? 142.328 11.160  298.361 1.00 33.10  ?  71  ILE B C   1 
ATOM   4167  O O   . ILE B 1 77  ? 143.390 11.128  297.728 1.00 39.73  ?  71  ILE B O   1 
ATOM   4168  C CB  . ILE B 1 77  ? 140.657 9.923   296.953 1.00 40.74  ?  71  ILE B CB  1 
ATOM   4169  C CG1 . ILE B 1 77  ? 139.529 10.098  295.937 1.00 38.91  ?  71  ILE B CG1 1 
ATOM   4170  C CG2 . ILE B 1 77  ? 140.284 8.881   298.001 1.00 35.71  ?  71  ILE B CG2 1 
ATOM   4171  C CD1 . ILE B 1 77  ? 138.165 10.171  296.557 1.00 51.13  ?  71  ILE B CD1 1 
ATOM   4172  N N   . ILE B 1 78  ? 142.270 11.099  299.689 1.00 36.74  ?  72  ILE B N   1 
ATOM   4173  C CA  . ILE B 1 78  ? 143.444 10.868  300.524 1.00 33.14  ?  72  ILE B CA  1 
ATOM   4174  C C   . ILE B 1 78  ? 143.353 9.459   301.088 1.00 35.91  ?  72  ILE B C   1 
ATOM   4175  O O   . ILE B 1 78  ? 142.342 9.092   301.700 1.00 33.32  ?  72  ILE B O   1 
ATOM   4176  C CB  . ILE B 1 78  ? 143.558 11.907  301.652 1.00 33.04  ?  72  ILE B CB  1 
ATOM   4177  C CG1 . ILE B 1 78  ? 143.851 13.294  301.078 1.00 35.32  ?  72  ILE B CG1 1 
ATOM   4178  C CG2 . ILE B 1 78  ? 144.643 11.502  302.639 1.00 33.45  ?  72  ILE B CG2 1 
ATOM   4179  C CD1 . ILE B 1 78  ? 144.170 14.334  302.132 1.00 31.35  ?  72  ILE B CD1 1 
ATOM   4180  N N   . LEU B 1 79  ? 144.402 8.669   300.878 1.00 39.69  ?  73  LEU B N   1 
ATOM   4181  C CA  . LEU B 1 79  ? 144.459 7.292   301.351 1.00 33.53  ?  73  LEU B CA  1 
ATOM   4182  C C   . LEU B 1 79  ? 145.351 7.220   302.583 1.00 33.42  ?  73  LEU B C   1 
ATOM   4183  O O   . LEU B 1 79  ? 146.546 7.527   302.508 1.00 43.72  ?  73  LEU B O   1 
ATOM   4184  C CB  . LEU B 1 79  ? 144.979 6.358   300.258 1.00 33.84  ?  73  LEU B CB  1 
ATOM   4185  C CG  . LEU B 1 79  ? 144.102 6.198   299.015 1.00 36.81  ?  73  LEU B CG  1 
ATOM   4186  C CD1 . LEU B 1 79  ? 144.715 5.187   298.058 1.00 33.13  ?  73  LEU B CD1 1 
ATOM   4187  C CD2 . LEU B 1 79  ? 142.692 5.786   299.404 1.00 30.76  ?  73  LEU B CD2 1 
ATOM   4188  N N   . LEU B 1 80  ? 144.770 6.816   303.711 1.00 32.58  ?  74  LEU B N   1 
ATOM   4189  C CA  . LEU B 1 80  ? 145.536 6.634   304.938 1.00 35.11  ?  74  LEU B CA  1 
ATOM   4190  C C   . LEU B 1 80  ? 145.361 5.217   305.466 1.00 37.51  ?  74  LEU B C   1 
ATOM   4191  O O   . LEU B 1 80  ? 145.120 5.016   306.661 1.00 40.80  ?  74  LEU B O   1 
ATOM   4192  C CB  . LEU B 1 80  ? 145.116 7.656   305.996 1.00 35.99  ?  74  LEU B CB  1 
ATOM   4193  C CG  . LEU B 1 80  ? 146.180 8.686   306.378 1.00 33.15  ?  74  LEU B CG  1 
ATOM   4194  C CD1 . LEU B 1 80  ? 147.404 7.995   306.955 1.00 42.49  ?  74  LEU B CD1 1 
ATOM   4195  C CD2 . LEU B 1 80  ? 146.561 9.534   305.176 1.00 33.86  ?  74  LEU B CD2 1 
ATOM   4196  N N   . VAL B 1 81  ? 145.476 4.233   304.583 1.00 41.64  ?  75  VAL B N   1 
ATOM   4197  C CA  . VAL B 1 81  ? 145.364 2.840   304.958 1.00 39.56  ?  75  VAL B CA  1 
ATOM   4198  C C   . VAL B 1 81  ? 146.764 2.266   305.140 1.00 41.21  ?  75  VAL B C   1 
ATOM   4199  O O   . VAL B 1 81  ? 147.768 2.914   304.857 1.00 47.32  ?  75  VAL B O   1 
ATOM   4200  C CB  . VAL B 1 81  ? 144.548 2.032   303.921 1.00 35.96  ?  75  VAL B CB  1 
ATOM   4201  C CG1 . VAL B 1 81  ? 143.125 2.555   303.851 1.00 34.15  ?  75  VAL B CG1 1 
ATOM   4202  C CG2 . VAL B 1 81  ? 145.209 2.101   302.556 1.00 41.83  ?  75  VAL B CG2 1 
ATOM   4203  N N   . LYS B 1 82  ? 146.833 1.028   305.627 1.00 45.81  ?  76  LYS B N   1 
ATOM   4204  C CA  . LYS B 1 82  ? 148.123 0.393   305.863 1.00 43.95  ?  76  LYS B CA  1 
ATOM   4205  C C   . LYS B 1 82  ? 148.892 0.230   304.558 1.00 44.52  ?  76  LYS B C   1 
ATOM   4206  O O   . LYS B 1 82  ? 148.337 -0.181  303.536 1.00 48.55  ?  76  LYS B O   1 
ATOM   4207  C CB  . LYS B 1 82  ? 147.936 -0.968  306.534 1.00 44.20  ?  76  LYS B CB  1 
ATOM   4208  C CG  . LYS B 1 82  ? 149.109 -1.906  306.311 1.00 57.23  ?  76  LYS B CG  1 
ATOM   4209  C CD  . LYS B 1 82  ? 149.201 -2.989  307.362 1.00 65.44  ?  76  LYS B CD  1 
ATOM   4210  C CE  . LYS B 1 82  ? 150.430 -3.845  307.120 1.00 68.47  ?  76  LYS B CE  1 
ATOM   4211  N NZ  . LYS B 1 82  ? 150.699 -4.765  308.249 1.00 87.56  1  76  LYS B NZ  1 
ATOM   4212  N N   . ALA B 1 83  ? 150.182 0.562   304.602 1.00 46.16  ?  77  ALA B N   1 
ATOM   4213  C CA  . ALA B 1 83  ? 151.032 0.429   303.428 1.00 48.33  ?  77  ALA B CA  1 
ATOM   4214  C C   . ALA B 1 83  ? 151.116 -1.027  302.986 1.00 53.35  ?  77  ALA B C   1 
ATOM   4215  O O   . ALA B 1 83  ? 151.270 -1.936  303.806 1.00 58.85  ?  77  ALA B O   1 
ATOM   4216  C CB  . ALA B 1 83  ? 152.430 0.972   303.724 1.00 46.92  ?  77  ALA B CB  1 
ATOM   4217  N N   . GLY B 1 84  ? 151.012 -1.243  301.678 1.00 44.26  ?  78  GLY B N   1 
ATOM   4218  C CA  . GLY B 1 84  ? 151.067 -2.582  301.128 1.00 51.84  ?  78  GLY B CA  1 
ATOM   4219  C C   . GLY B 1 84  ? 149.952 -2.866  300.144 1.00 55.56  ?  78  GLY B C   1 
ATOM   4220  O O   . GLY B 1 84  ? 149.596 -2.006  299.332 1.00 51.90  ?  78  GLY B O   1 
ATOM   4221  N N   . GLN B 1 85  ? 149.388 -4.074  300.210 1.00 59.07  ?  79  GLN B N   1 
ATOM   4222  C CA  . GLN B 1 85  ? 148.323 -4.456  299.290 1.00 56.42  ?  79  GLN B CA  1 
ATOM   4223  C C   . GLN B 1 85  ? 147.046 -3.658  299.518 1.00 55.07  ?  79  GLN B C   1 
ATOM   4224  O O   . GLN B 1 85  ? 146.242 -3.521  298.590 1.00 54.10  ?  79  GLN B O   1 
ATOM   4225  C CB  . GLN B 1 85  ? 148.039 -5.955  299.417 1.00 61.81  ?  79  GLN B CB  1 
ATOM   4226  C CG  . GLN B 1 85  ? 147.098 -6.512  298.359 1.00 67.47  ?  79  GLN B CG  1 
ATOM   4227  C CD  . GLN B 1 85  ? 147.642 -6.355  296.952 1.00 70.93  ?  79  GLN B CD  1 
ATOM   4228  O OE1 . GLN B 1 85  ? 148.848 -6.461  296.724 1.00 74.68  ?  79  GLN B OE1 1 
ATOM   4229  N NE2 . GLN B 1 85  ? 146.753 -6.096  295.999 1.00 62.28  ?  79  GLN B NE2 1 
ATOM   4230  N N   . ALA B 1 86  ? 146.848 -3.120  300.725 1.00 54.07  ?  80  ALA B N   1 
ATOM   4231  C CA  . ALA B 1 86  ? 145.629 -2.370  301.012 1.00 52.24  ?  80  ALA B CA  1 
ATOM   4232  C C   . ALA B 1 86  ? 145.521 -1.129  300.134 1.00 50.73  ?  80  ALA B C   1 
ATOM   4233  O O   . ALA B 1 86  ? 144.426 -0.777  299.677 1.00 49.70  ?  80  ALA B O   1 
ATOM   4234  C CB  . ALA B 1 86  ? 145.585 -1.988  302.491 1.00 49.69  ?  80  ALA B CB  1 
ATOM   4235  N N   . VAL B 1 87  ? 146.645 -0.454  299.882 1.00 50.97  ?  81  VAL B N   1 
ATOM   4236  C CA  . VAL B 1 87  ? 146.624 0.735   299.036 1.00 43.95  ?  81  VAL B CA  1 
ATOM   4237  C C   . VAL B 1 87  ? 146.257 0.368   297.604 1.00 43.55  ?  81  VAL B C   1 
ATOM   4238  O O   . VAL B 1 87  ? 145.433 1.038   296.970 1.00 40.43  ?  81  VAL B O   1 
ATOM   4239  C CB  . VAL B 1 87  ? 147.978 1.464   299.105 1.00 42.20  ?  81  VAL B CB  1 
ATOM   4240  C CG1 . VAL B 1 87  ? 147.991 2.654   298.157 1.00 37.07  ?  81  VAL B CG1 1 
ATOM   4241  C CG2 . VAL B 1 87  ? 148.270 1.907   300.530 1.00 36.27  ?  81  VAL B CG2 1 
ATOM   4242  N N   . ASP B 1 88  ? 146.857 -0.700  297.072 1.00 46.14  ?  82  ASP B N   1 
ATOM   4243  C CA  . ASP B 1 88  ? 146.554 -1.115  295.706 1.00 46.26  ?  82  ASP B CA  1 
ATOM   4244  C C   . ASP B 1 88  ? 145.111 -1.582  295.562 1.00 42.15  ?  82  ASP B C   1 
ATOM   4245  O O   . ASP B 1 88  ? 144.518 -1.427  294.489 1.00 39.79  ?  82  ASP B O   1 
ATOM   4246  C CB  . ASP B 1 88  ? 147.517 -2.218  295.266 1.00 51.45  ?  82  ASP B CB  1 
ATOM   4247  C CG  . ASP B 1 88  ? 148.915 -1.697  294.992 1.00 49.27  ?  82  ASP B CG  1 
ATOM   4248  O OD1 . ASP B 1 88  ? 149.039 -0.663  294.302 1.00 43.78  ?  82  ASP B OD1 1 
ATOM   4249  O OD2 . ASP B 1 88  ? 149.889 -2.317  295.468 1.00 53.49  -1 82  ASP B OD2 1 
ATOM   4250  N N   . ASP B 1 89  ? 144.531 -2.148  296.622 1.00 45.84  ?  83  ASP B N   1 
ATOM   4251  C CA  . ASP B 1 89  ? 143.142 -2.592  296.556 1.00 47.61  ?  83  ASP B CA  1 
ATOM   4252  C C   . ASP B 1 89  ? 142.194 -1.409  296.402 1.00 46.05  ?  83  ASP B C   1 
ATOM   4253  O O   . ASP B 1 89  ? 141.278 -1.438  295.571 1.00 41.04  ?  83  ASP B O   1 
ATOM   4254  C CB  . ASP B 1 89  ? 142.791 -3.407  297.801 1.00 51.26  ?  83  ASP B CB  1 
ATOM   4255  C CG  . ASP B 1 89  ? 143.516 -4.738  297.851 1.00 58.92  ?  83  ASP B CG  1 
ATOM   4256  O OD1 . ASP B 1 89  ? 144.218 -5.071  296.872 1.00 53.81  ?  83  ASP B OD1 1 
ATOM   4257  O OD2 . ASP B 1 89  ? 143.385 -5.449  298.869 1.00 68.16  -1 83  ASP B OD2 1 
ATOM   4258  N N   . PHE B 1 90  ? 142.399 -0.356  297.196 1.00 45.40  ?  84  PHE B N   1 
ATOM   4259  C CA  . PHE B 1 90  ? 141.546 0.823   297.093 1.00 36.00  ?  84  PHE B CA  1 
ATOM   4260  C C   . PHE B 1 90  ? 141.737 1.545   295.766 1.00 41.31  ?  84  PHE B C   1 
ATOM   4261  O O   . PHE B 1 90  ? 140.782 2.125   295.238 1.00 42.77  ?  84  PHE B O   1 
ATOM   4262  C CB  . PHE B 1 90  ? 141.815 1.769   298.261 1.00 30.19  ?  84  PHE B CB  1 
ATOM   4263  C CG  . PHE B 1 90  ? 140.906 1.551   299.434 1.00 36.91  ?  84  PHE B CG  1 
ATOM   4264  C CD1 . PHE B 1 90  ? 139.534 1.485   299.256 1.00 38.89  ?  84  PHE B CD1 1 
ATOM   4265  C CD2 . PHE B 1 90  ? 141.421 1.401   300.710 1.00 39.67  ?  84  PHE B CD2 1 
ATOM   4266  C CE1 . PHE B 1 90  ? 138.691 1.281   300.331 1.00 47.04  ?  84  PHE B CE1 1 
ATOM   4267  C CE2 . PHE B 1 90  ? 140.583 1.195   301.789 1.00 43.12  ?  84  PHE B CE2 1 
ATOM   4268  C CZ  . PHE B 1 90  ? 139.216 1.136   301.600 1.00 50.99  ?  84  PHE B CZ  1 
ATOM   4269  N N   . ILE B 1 91  ? 142.950 1.520   295.212 1.00 42.23  ?  85  ILE B N   1 
ATOM   4270  C CA  . ILE B 1 91  ? 143.179 2.142   293.911 1.00 42.72  ?  85  ILE B CA  1 
ATOM   4271  C C   . ILE B 1 91  ? 142.424 1.389   292.823 1.00 42.62  ?  85  ILE B C   1 
ATOM   4272  O O   . ILE B 1 91  ? 141.760 1.995   291.974 1.00 44.21  ?  85  ILE B O   1 
ATOM   4273  C CB  . ILE B 1 91  ? 144.686 2.218   293.610 1.00 40.69  ?  85  ILE B CB  1 
ATOM   4274  C CG1 . ILE B 1 91  ? 145.364 3.200   294.565 1.00 41.52  ?  85  ILE B CG1 1 
ATOM   4275  C CG2 . ILE B 1 91  ? 144.925 2.625   292.163 1.00 36.39  ?  85  ILE B CG2 1 
ATOM   4276  C CD1 . ILE B 1 91  ? 146.831 3.402   294.291 1.00 38.84  ?  85  ILE B CD1 1 
ATOM   4277  N N   . GLU B 1 92  ? 142.502 0.055   292.840 1.00 40.50  ?  86  GLU B N   1 
ATOM   4278  C CA  . GLU B 1 92  ? 141.769 -0.739  291.858 1.00 44.83  ?  86  GLU B CA  1 
ATOM   4279  C C   . GLU B 1 92  ? 140.264 -0.544  291.988 1.00 46.92  ?  86  GLU B C   1 
ATOM   4280  O O   . GLU B 1 92  ? 139.544 -0.593  290.985 1.00 47.47  ?  86  GLU B O   1 
ATOM   4281  C CB  . GLU B 1 92  ? 142.128 -2.218  292.006 1.00 45.31  ?  86  GLU B CB  1 
ATOM   4282  C CG  . GLU B 1 92  ? 143.572 -2.541  291.661 1.00 61.72  ?  86  GLU B CG  1 
ATOM   4283  C CD  . GLU B 1 92  ? 143.865 -2.397  290.181 1.00 68.65  ?  86  GLU B CD  1 
ATOM   4284  O OE1 . GLU B 1 92  ? 143.550 -3.336  289.418 1.00 72.67  ?  86  GLU B OE1 1 
ATOM   4285  O OE2 . GLU B 1 92  ? 144.401 -1.343  289.779 1.00 65.47  -1 86  GLU B OE2 1 
ATOM   4286  N N   . LYS B 1 93  ? 139.772 -0.318  293.206 1.00 44.30  ?  87  LYS B N   1 
ATOM   4287  C CA  . LYS B 1 93  ? 138.349 -0.096  293.427 1.00 40.82  ?  87  LYS B CA  1 
ATOM   4288  C C   . LYS B 1 93  ? 137.923 1.344   293.168 1.00 44.57  ?  87  LYS B C   1 
ATOM   4289  O O   . LYS B 1 93  ? 136.718 1.609   293.093 1.00 51.06  ?  87  LYS B O   1 
ATOM   4290  C CB  . LYS B 1 93  ? 137.972 -0.493  294.857 1.00 40.92  ?  87  LYS B CB  1 
ATOM   4291  C CG  . LYS B 1 93  ? 138.110 -1.980  295.150 1.00 39.95  ?  87  LYS B CG  1 
ATOM   4292  C CD  . LYS B 1 93  ? 137.948 -2.275  296.636 1.00 38.16  ?  87  LYS B CD  1 
ATOM   4293  C CE  . LYS B 1 93  ? 136.584 -1.838  297.147 1.00 57.37  ?  87  LYS B CE  1 
ATOM   4294  N NZ  . LYS B 1 93  ? 136.420 -2.103  298.604 1.00 50.97  1  87  LYS B NZ  1 
ATOM   4295  N N   . LEU B 1 94  ? 138.869 2.272   293.027 1.00 49.47  ?  88  LEU B N   1 
ATOM   4296  C CA  . LEU B 1 94  ? 138.551 3.673   292.778 1.00 43.42  ?  88  LEU B CA  1 
ATOM   4297  C C   . LEU B 1 94  ? 138.666 4.071   291.314 1.00 44.49  ?  88  LEU B C   1 
ATOM   4298  O O   . LEU B 1 94  ? 137.947 4.975   290.876 1.00 44.77  ?  88  LEU B O   1 
ATOM   4299  C CB  . LEU B 1 94  ? 139.466 4.584   293.606 1.00 42.48  ?  88  LEU B CB  1 
ATOM   4300  C CG  . LEU B 1 94  ? 139.089 4.852   295.064 1.00 40.20  ?  88  LEU B CG  1 
ATOM   4301  C CD1 . LEU B 1 94  ? 140.209 5.602   295.768 1.00 41.37  ?  88  LEU B CD1 1 
ATOM   4302  C CD2 . LEU B 1 94  ? 137.791 5.636   295.143 1.00 47.73  ?  88  LEU B CD2 1 
ATOM   4303  N N   . VAL B 1 95  ? 139.551 3.421   290.552 1.00 45.33  ?  89  VAL B N   1 
ATOM   4304  C CA  . VAL B 1 95  ? 139.788 3.835   289.166 1.00 46.88  ?  89  VAL B CA  1 
ATOM   4305  C C   . VAL B 1 95  ? 138.523 3.785   288.314 1.00 53.80  ?  89  VAL B C   1 
ATOM   4306  O O   . VAL B 1 95  ? 138.243 4.768   287.609 1.00 55.53  ?  89  VAL B O   1 
ATOM   4307  C CB  . VAL B 1 95  ? 140.944 3.019   288.561 1.00 50.43  ?  89  VAL B CB  1 
ATOM   4308  C CG1 . VAL B 1 95  ? 141.015 3.228   287.059 1.00 44.29  ?  89  VAL B CG1 1 
ATOM   4309  C CG2 . VAL B 1 95  ? 142.258 3.414   289.206 1.00 55.64  ?  89  VAL B CG2 1 
ATOM   4310  N N   . PRO B 1 96  ? 137.726 2.706   288.318 1.00 57.52  ?  90  PRO B N   1 
ATOM   4311  C CA  . PRO B 1 96  ? 136.500 2.720   287.502 1.00 50.40  ?  90  PRO B CA  1 
ATOM   4312  C C   . PRO B 1 96  ? 135.472 3.744   287.956 1.00 51.26  ?  90  PRO B C   1 
ATOM   4313  O O   . PRO B 1 96  ? 134.602 4.114   287.158 1.00 57.63  ?  90  PRO B O   1 
ATOM   4314  C CB  . PRO B 1 96  ? 135.963 1.289   287.646 1.00 56.06  ?  90  PRO B CB  1 
ATOM   4315  C CG  . PRO B 1 96  ? 136.539 0.800   288.922 1.00 51.92  ?  90  PRO B CG  1 
ATOM   4316  C CD  . PRO B 1 96  ? 137.905 1.405   288.990 1.00 53.27  ?  90  PRO B CD  1 
ATOM   4317  N N   . LEU B 1 97  ? 135.543 4.216   289.200 1.00 53.21  ?  91  LEU B N   1 
ATOM   4318  C CA  . LEU B 1 97  ? 134.593 5.193   289.713 1.00 45.85  ?  91  LEU B CA  1 
ATOM   4319  C C   . LEU B 1 97  ? 135.024 6.634   289.474 1.00 50.08  ?  91  LEU B C   1 
ATOM   4320  O O   . LEU B 1 97  ? 134.195 7.541   289.611 1.00 45.53  ?  91  LEU B O   1 
ATOM   4321  C CB  . LEU B 1 97  ? 134.373 4.980   291.214 1.00 42.97  ?  91  LEU B CB  1 
ATOM   4322  C CG  . LEU B 1 97  ? 133.839 3.616   291.652 1.00 41.74  ?  91  LEU B CG  1 
ATOM   4323  C CD1 . LEU B 1 97  ? 133.769 3.539   293.167 1.00 35.26  ?  91  LEU B CD1 1 
ATOM   4324  C CD2 . LEU B 1 97  ? 132.475 3.348   291.037 1.00 41.86  ?  91  LEU B CD2 1 
ATOM   4325  N N   . LEU B 1 98  ? 136.285 6.869   289.126 1.00 52.78  ?  92  LEU B N   1 
ATOM   4326  C CA  . LEU B 1 98  ? 136.813 8.213   288.950 1.00 50.11  ?  92  LEU B CA  1 
ATOM   4327  C C   . LEU B 1 98  ? 136.833 8.603   287.478 1.00 54.10  ?  92  LEU B C   1 
ATOM   4328  O O   . LEU B 1 98  ? 136.936 7.753   286.590 1.00 58.34  ?  92  LEU B O   1 
ATOM   4329  C CB  . LEU B 1 98  ? 138.225 8.325   289.529 1.00 44.80  ?  92  LEU B CB  1 
ATOM   4330  C CG  . LEU B 1 98  ? 138.360 8.194   291.046 1.00 43.23  ?  92  LEU B CG  1 
ATOM   4331  C CD1 . LEU B 1 98  ? 139.819 8.300   291.461 1.00 40.31  ?  92  LEU B CD1 1 
ATOM   4332  C CD2 . LEU B 1 98  ? 137.520 9.247   291.750 1.00 41.78  ?  92  LEU B CD2 1 
ATOM   4333  N N   . ASP B 1 99  ? 136.735 9.904   287.232 1.00 48.10  ?  93  ASP B N   1 
ATOM   4334  C CA  . ASP B 1 99  ? 136.834 10.470  285.896 1.00 53.39  ?  93  ASP B CA  1 
ATOM   4335  C C   . ASP B 1 99  ? 138.264 10.922  285.624 1.00 52.30  ?  93  ASP B C   1 
ATOM   4336  O O   . ASP B 1 99  ? 139.066 11.115  286.542 1.00 50.39  ?  93  ASP B O   1 
ATOM   4337  C CB  . ASP B 1 99  ? 135.870 11.649  285.732 1.00 61.19  ?  93  ASP B CB  1 
ATOM   4338  C CG  . ASP B 1 99  ? 134.418 11.241  285.886 1.00 67.83  ?  93  ASP B CG  1 
ATOM   4339  O OD1 . ASP B 1 99  ? 134.140 10.023  285.918 1.00 73.78  ?  93  ASP B OD1 1 
ATOM   4340  O OD2 . ASP B 1 99  ? 133.554 12.139  285.977 1.00 67.26  -1 93  ASP B OD2 1 
ATOM   4341  N N   . THR B 1 100 ? 138.576 11.088  284.341 1.00 51.74  ?  94  THR B N   1 
ATOM   4342  C CA  . THR B 1 100 ? 139.914 11.505  283.940 1.00 52.20  ?  94  THR B CA  1 
ATOM   4343  C C   . THR B 1 100 ? 140.229 12.883  284.505 1.00 53.21  ?  94  THR B C   1 
ATOM   4344  O O   . THR B 1 100 ? 139.523 13.857  284.225 1.00 56.90  ?  94  THR B O   1 
ATOM   4345  C CB  . THR B 1 100 ? 140.033 11.510  282.418 1.00 55.99  ?  94  THR B CB  1 
ATOM   4346  O OG1 . THR B 1 100 ? 139.960 10.165  281.930 1.00 61.56  ?  94  THR B OG1 1 
ATOM   4347  C CG2 . THR B 1 100 ? 141.353 12.130  281.988 1.00 49.23  ?  94  THR B CG2 1 
ATOM   4348  N N   . GLY B 1 101 ? 141.290 12.959  285.303 1.00 48.56  ?  95  GLY B N   1 
ATOM   4349  C CA  . GLY B 1 101 ? 141.670 14.177  285.988 1.00 46.14  ?  95  GLY B CA  1 
ATOM   4350  C C   . GLY B 1 101 ? 141.500 14.124  287.489 1.00 42.70  ?  95  GLY B C   1 
ATOM   4351  O O   . GLY B 1 101 ? 141.897 15.077  288.173 1.00 40.15  ?  95  GLY B O   1 
ATOM   4352  N N   . ASP B 1 102 ? 140.925 13.051  288.026 1.00 45.38  ?  96  ASP B N   1 
ATOM   4353  C CA  . ASP B 1 102 ? 140.762 12.927  289.466 1.00 41.95  ?  96  ASP B CA  1 
ATOM   4354  C C   . ASP B 1 102 ? 142.105 12.642  290.134 1.00 39.85  ?  96  ASP B C   1 
ATOM   4355  O O   . ASP B 1 102 ? 143.087 12.268  289.487 1.00 44.86  ?  96  ASP B O   1 
ATOM   4356  C CB  . ASP B 1 102 ? 139.756 11.827  289.802 1.00 44.26  ?  96  ASP B CB  1 
ATOM   4357  C CG  . ASP B 1 102 ? 138.333 12.219  289.459 1.00 51.73  ?  96  ASP B CG  1 
ATOM   4358  O OD1 . ASP B 1 102 ? 138.033 13.432  289.470 1.00 45.31  ?  96  ASP B OD1 1 
ATOM   4359  O OD2 . ASP B 1 102 ? 137.514 11.317  289.180 1.00 55.52  -1 96  ASP B OD2 1 
ATOM   4360  N N   . ILE B 1 103 ? 142.137 12.823  291.451 1.00 34.69  ?  97  ILE B N   1 
ATOM   4361  C CA  . ILE B 1 103 ? 143.373 12.794  292.221 1.00 34.50  ?  97  ILE B CA  1 
ATOM   4362  C C   . ILE B 1 103 ? 143.250 11.756  293.327 1.00 34.82  ?  97  ILE B C   1 
ATOM   4363  O O   . ILE B 1 103 ? 142.279 11.767  294.092 1.00 36.96  ?  97  ILE B O   1 
ATOM   4364  C CB  . ILE B 1 103 ? 143.702 14.179  292.809 1.00 37.83  ?  97  ILE B CB  1 
ATOM   4365  C CG1 . ILE B 1 103 ? 143.760 15.226  291.696 1.00 31.99  ?  97  ILE B CG1 1 
ATOM   4366  C CG2 . ILE B 1 103 ? 145.016 14.138  293.571 1.00 36.44  ?  97  ILE B CG2 1 
ATOM   4367  C CD1 . ILE B 1 103 ? 143.901 16.641  292.200 1.00 36.14  ?  97  ILE B CD1 1 
ATOM   4368  N N   . ILE B 1 104 ? 144.235 10.865  293.409 1.00 38.75  ?  98  ILE B N   1 
ATOM   4369  C CA  . ILE B 1 104 ? 144.371 9.913   294.505 1.00 36.02  ?  98  ILE B CA  1 
ATOM   4370  C C   . ILE B 1 104 ? 145.656 10.243  295.248 1.00 35.59  ?  98  ILE B C   1 
ATOM   4371  O O   . ILE B 1 104 ? 146.727 10.330  294.636 1.00 37.60  ?  98  ILE B O   1 
ATOM   4372  C CB  . ILE B 1 104 ? 144.388 8.457   294.003 1.00 31.04  ?  98  ILE B CB  1 
ATOM   4373  C CG1 . ILE B 1 104 ? 143.069 8.112   293.310 1.00 32.89  ?  98  ILE B CG1 1 
ATOM   4374  C CG2 . ILE B 1 104 ? 144.652 7.501   295.154 1.00 35.66  ?  98  ILE B CG2 1 
ATOM   4375  C CD1 . ILE B 1 104 ? 143.001 6.684   292.813 1.00 38.81  ?  98  ILE B CD1 1 
ATOM   4376  N N   . ILE B 1 105 ? 145.551 10.430  296.561 1.00 36.29  ?  99  ILE B N   1 
ATOM   4377  C CA  . ILE B 1 105 ? 146.678 10.835  297.394 1.00 37.49  ?  99  ILE B CA  1 
ATOM   4378  C C   . ILE B 1 105 ? 146.923 9.747   298.430 1.00 36.33  ?  99  ILE B C   1 
ATOM   4379  O O   . ILE B 1 105 ? 146.044 9.452   299.248 1.00 34.21  ?  99  ILE B O   1 
ATOM   4380  C CB  . ILE B 1 105 ? 146.427 12.187  298.078 1.00 33.44  ?  99  ILE B CB  1 
ATOM   4381  C CG1 . ILE B 1 105 ? 145.879 13.201  297.075 1.00 32.16  ?  99  ILE B CG1 1 
ATOM   4382  C CG2 . ILE B 1 105 ? 147.708 12.708  298.708 1.00 35.14  ?  99  ILE B CG2 1 
ATOM   4383  C CD1 . ILE B 1 105 ? 145.393 14.476  297.718 1.00 40.76  ?  99  ILE B CD1 1 
ATOM   4384  N N   . ASP B 1 106 ? 148.116 9.158   298.398 1.00 34.84  ?  100 ASP B N   1 
ATOM   4385  C CA  . ASP B 1 106 ? 148.532 8.169   299.386 1.00 33.23  ?  100 ASP B CA  1 
ATOM   4386  C C   . ASP B 1 106 ? 149.363 8.882   300.447 1.00 31.00  ?  100 ASP B C   1 
ATOM   4387  O O   . ASP B 1 106 ? 150.470 9.353   300.165 1.00 31.31  ?  100 ASP B O   1 
ATOM   4388  C CB  . ASP B 1 106 ? 149.323 7.039   298.732 1.00 34.58  ?  100 ASP B CB  1 
ATOM   4389  C CG  . ASP B 1 106 ? 149.713 5.951   299.718 1.00 34.86  ?  100 ASP B CG  1 
ATOM   4390  O OD1 . ASP B 1 106 ? 149.158 5.926   300.837 1.00 32.39  ?  100 ASP B OD1 1 
ATOM   4391  O OD2 . ASP B 1 106 ? 150.581 5.121   299.372 1.00 41.68  -1 100 ASP B OD2 1 
ATOM   4392  N N   . GLY B 1 107 ? 148.827 8.962   301.662 1.00 31.90  ?  101 GLY B N   1 
ATOM   4393  C CA  . GLY B 1 107 ? 149.496 9.607   302.768 1.00 30.23  ?  101 GLY B CA  1 
ATOM   4394  C C   . GLY B 1 107 ? 150.176 8.679   303.746 1.00 36.02  ?  101 GLY B C   1 
ATOM   4395  O O   . GLY B 1 107 ? 150.703 9.150   304.759 1.00 41.28  ?  101 GLY B O   1 
ATOM   4396  N N   . GLY B 1 108 ? 150.185 7.374   303.480 1.00 37.65  ?  102 GLY B N   1 
ATOM   4397  C CA  . GLY B 1 108 ? 150.813 6.423   304.369 1.00 43.31  ?  102 GLY B CA  1 
ATOM   4398  C C   . GLY B 1 108 ? 152.303 6.291   304.123 1.00 47.67  ?  102 GLY B C   1 
ATOM   4399  O O   . GLY B 1 108 ? 152.879 6.886   303.212 1.00 46.29  ?  102 GLY B O   1 
ATOM   4400  N N   . ASN B 1 109 ? 152.940 5.480   304.970 1.00 48.30  ?  103 ASN B N   1 
ATOM   4401  C CA  . ASN B 1 109 ? 154.379 5.230   304.880 1.00 43.78  ?  103 ASN B CA  1 
ATOM   4402  C C   . ASN B 1 109 ? 154.669 4.152   303.832 1.00 41.56  ?  103 ASN B C   1 
ATOM   4403  O O   . ASN B 1 109 ? 155.227 3.091   304.114 1.00 41.47  ?  103 ASN B O   1 
ATOM   4404  C CB  . ASN B 1 109 ? 154.932 4.840   306.244 1.00 42.02  ?  103 ASN B CB  1 
ATOM   4405  C CG  . ASN B 1 109 ? 154.627 5.871   307.313 1.00 48.26  ?  103 ASN B CG  1 
ATOM   4406  O OD1 . ASN B 1 109 ? 155.263 6.924   307.375 1.00 63.17  ?  103 ASN B OD1 1 
ATOM   4407  N ND2 . ASN B 1 109 ? 153.656 5.569   308.167 1.00 42.07  ?  103 ASN B ND2 1 
ATOM   4408  N N   . SER B 1 110 ? 154.276 4.449   302.598 1.00 32.40  ?  104 SER B N   1 
ATOM   4409  C CA  . SER B 1 110 ? 154.429 3.502   301.505 1.00 33.89  ?  104 SER B CA  1 
ATOM   4410  C C   . SER B 1 110 ? 155.852 3.525   300.962 1.00 31.24  ?  104 SER B C   1 
ATOM   4411  O O   . SER B 1 110 ? 156.522 4.562   300.953 1.00 34.44  ?  104 SER B O   1 
ATOM   4412  C CB  . SER B 1 110 ? 153.438 3.813   300.383 1.00 41.51  ?  104 SER B CB  1 
ATOM   4413  O OG  . SER B 1 110 ? 152.100 3.719   300.840 1.00 39.74  ?  104 SER B OG  1 
ATOM   4414  N N   . GLU B 1 111 ? 156.310 2.361   300.509 1.00 31.51  ?  105 GLU B N   1 
ATOM   4415  C CA  . GLU B 1 111 ? 157.628 2.259   299.896 1.00 35.12  ?  105 GLU B CA  1 
ATOM   4416  C C   . GLU B 1 111 ? 157.650 3.037   298.586 1.00 29.52  ?  105 GLU B C   1 
ATOM   4417  O O   . GLU B 1 111 ? 156.732 2.921   297.769 1.00 34.72  ?  105 GLU B O   1 
ATOM   4418  C CB  . GLU B 1 111 ? 157.986 0.793   299.659 1.00 43.63  ?  105 GLU B CB  1 
ATOM   4419  C CG  . GLU B 1 111 ? 157.943 -0.056  300.922 1.00 39.67  ?  105 GLU B CG  1 
ATOM   4420  C CD  . GLU B 1 111 ? 158.200 -1.525  300.654 1.00 47.25  ?  105 GLU B CD  1 
ATOM   4421  O OE1 . GLU B 1 111 ? 158.352 -1.901  299.472 1.00 51.04  ?  105 GLU B OE1 1 
ATOM   4422  O OE2 . GLU B 1 111 ? 158.248 -2.305  301.628 1.00 58.25  -1 105 GLU B OE2 1 
ATOM   4423  N N   . TYR B 1 112 ? 158.705 3.834   298.389 1.00 31.56  ?  106 TYR B N   1 
ATOM   4424  C CA  . TYR B 1 112 ? 158.735 4.757   297.259 1.00 31.25  ?  106 TYR B CA  1 
ATOM   4425  C C   . TYR B 1 112 ? 158.712 4.027   295.921 1.00 31.09  ?  106 TYR B C   1 
ATOM   4426  O O   . TYR B 1 112 ? 158.181 4.558   294.939 1.00 26.11  ?  106 TYR B O   1 
ATOM   4427  C CB  . TYR B 1 112 ? 159.962 5.667   297.350 1.00 29.04  ?  106 TYR B CB  1 
ATOM   4428  C CG  . TYR B 1 112 ? 161.287 4.955   297.196 1.00 27.01  ?  106 TYR B CG  1 
ATOM   4429  C CD1 . TYR B 1 112 ? 161.918 4.376   298.289 1.00 34.87  ?  106 TYR B CD1 1 
ATOM   4430  C CD2 . TYR B 1 112 ? 161.914 4.874   295.958 1.00 28.62  ?  106 TYR B CD2 1 
ATOM   4431  C CE1 . TYR B 1 112 ? 163.132 3.728   298.153 1.00 36.52  ?  106 TYR B CE1 1 
ATOM   4432  C CE2 . TYR B 1 112 ? 163.127 4.229   295.813 1.00 29.44  ?  106 TYR B CE2 1 
ATOM   4433  C CZ  . TYR B 1 112 ? 163.732 3.659   296.912 1.00 35.02  ?  106 TYR B CZ  1 
ATOM   4434  O OH  . TYR B 1 112 ? 164.940 3.015   296.772 1.00 42.14  ?  106 TYR B OH  1 
ATOM   4435  N N   . ARG B 1 113 ? 159.279 2.819   295.859 1.00 38.00  ?  107 ARG B N   1 
ATOM   4436  C CA  . ARG B 1 113 ? 159.222 2.050   294.620 1.00 29.50  ?  107 ARG B CA  1 
ATOM   4437  C C   . ARG B 1 113 ? 157.789 1.698   294.249 1.00 33.65  ?  107 ARG B C   1 
ATOM   4438  O O   . ARG B 1 113 ? 157.446 1.655   293.062 1.00 37.01  ?  107 ARG B O   1 
ATOM   4439  C CB  . ARG B 1 113 ? 160.062 0.779   294.744 1.00 27.48  ?  107 ARG B CB  1 
ATOM   4440  C CG  . ARG B 1 113 ? 161.542 1.027   294.974 1.00 23.91  ?  107 ARG B CG  1 
ATOM   4441  C CD  . ARG B 1 113 ? 162.330 -0.268  294.874 1.00 21.15  ?  107 ARG B CD  1 
ATOM   4442  N NE  . ARG B 1 113 ? 163.715 -0.099  295.299 1.00 25.38  ?  107 ARG B NE  1 
ATOM   4443  C CZ  . ARG B 1 113 ? 164.135 -0.263  296.549 1.00 28.53  ?  107 ARG B CZ  1 
ATOM   4444  N NH1 . ARG B 1 113 ? 163.273 -0.602  297.499 1.00 29.30  1  107 ARG B NH1 1 
ATOM   4445  N NH2 . ARG B 1 113 ? 165.414 -0.090  296.851 1.00 36.21  ?  107 ARG B NH2 1 
ATOM   4446  N N   . ASP B 1 114 ? 156.941 1.441   295.247 1.00 34.36  ?  108 ASP B N   1 
ATOM   4447  C CA  . ASP B 1 114 ? 155.528 1.210   294.968 1.00 34.88  ?  108 ASP B CA  1 
ATOM   4448  C C   . ASP B 1 114 ? 154.841 2.493   294.520 1.00 31.41  ?  108 ASP B C   1 
ATOM   4449  O O   . ASP B 1 114 ? 154.057 2.480   293.565 1.00 36.82  ?  108 ASP B O   1 
ATOM   4450  C CB  . ASP B 1 114 ? 154.835 0.632   296.202 1.00 33.99  ?  108 ASP B CB  1 
ATOM   4451  C CG  . ASP B 1 114 ? 155.163 -0.831  296.423 1.00 40.21  ?  108 ASP B CG  1 
ATOM   4452  O OD1 . ASP B 1 114 ? 155.746 -1.454  295.510 1.00 46.23  ?  108 ASP B OD1 1 
ATOM   4453  O OD2 . ASP B 1 114 ? 154.839 -1.357  297.508 1.00 39.58  -1 108 ASP B OD2 1 
ATOM   4454  N N   . THR B 1 115 ? 155.130 3.610   295.193 1.00 28.63  ?  109 THR B N   1 
ATOM   4455  C CA  . THR B 1 115 ? 154.521 4.883   294.819 1.00 25.90  ?  109 THR B CA  1 
ATOM   4456  C C   . THR B 1 115 ? 154.883 5.269   293.390 1.00 31.75  ?  109 THR B C   1 
ATOM   4457  O O   . THR B 1 115 ? 154.048 5.808   292.653 1.00 28.34  ?  109 THR B O   1 
ATOM   4458  C CB  . THR B 1 115 ? 154.953 5.975   295.797 1.00 24.81  ?  109 THR B CB  1 
ATOM   4459  O OG1 . THR B 1 115 ? 154.693 5.546   297.138 1.00 28.94  ?  109 THR B OG1 1 
ATOM   4460  C CG2 . THR B 1 115 ? 154.185 7.256   295.532 1.00 32.85  ?  109 THR B CG2 1 
ATOM   4461  N N   . THR B 1 116 ? 156.123 4.998   292.979 1.00 37.35  ?  110 THR B N   1 
ATOM   4462  C CA  . THR B 1 116 ? 156.517 5.261   291.599 1.00 31.68  ?  110 THR B CA  1 
ATOM   4463  C C   . THR B 1 116 ? 155.739 4.381   290.630 1.00 36.08  ?  110 THR B C   1 
ATOM   4464  O O   . THR B 1 116 ? 155.258 4.857   289.595 1.00 38.97  ?  110 THR B O   1 
ATOM   4465  C CB  . THR B 1 116 ? 158.021 5.041   291.430 1.00 27.64  ?  110 THR B CB  1 
ATOM   4466  O OG1 . THR B 1 116 ? 158.737 5.945   292.279 1.00 31.85  ?  110 THR B OG1 1 
ATOM   4467  C CG2 . THR B 1 116 ? 158.436 5.274   289.986 1.00 34.94  ?  110 THR B CG2 1 
ATOM   4468  N N   . ARG B 1 117 ? 155.599 3.093   290.954 1.00 36.74  ?  111 ARG B N   1 
ATOM   4469  C CA  . ARG B 1 117 ? 154.858 2.185   290.085 1.00 34.25  ?  111 ARG B CA  1 
ATOM   4470  C C   . ARG B 1 117 ? 153.398 2.603   289.967 1.00 35.72  ?  111 ARG B C   1 
ATOM   4471  O O   . ARG B 1 117 ? 152.836 2.618   288.866 1.00 37.43  ?  111 ARG B O   1 
ATOM   4472  C CB  . ARG B 1 117 ? 154.967 0.754   290.609 1.00 31.48  ?  111 ARG B CB  1 
ATOM   4473  C CG  . ARG B 1 117 ? 154.170 -0.263  289.814 1.00 35.56  ?  111 ARG B CG  1 
ATOM   4474  C CD  . ARG B 1 117 ? 154.204 -1.624  290.486 1.00 33.91  ?  111 ARG B CD  1 
ATOM   4475  N NE  . ARG B 1 117 ? 153.851 -1.535  291.900 1.00 37.80  ?  111 ARG B NE  1 
ATOM   4476  C CZ  . ARG B 1 117 ? 152.604 -1.494  292.358 1.00 41.41  ?  111 ARG B CZ  1 
ATOM   4477  N NH1 . ARG B 1 117 ? 151.584 -1.531  291.512 1.00 38.14  1  111 ARG B NH1 1 
ATOM   4478  N NH2 . ARG B 1 117 ? 152.377 -1.413  293.662 1.00 41.94  ?  111 ARG B NH2 1 
ATOM   4479  N N   . ARG B 1 118 ? 152.766 2.948   291.092 1.00 39.46  ?  112 ARG B N   1 
ATOM   4480  C CA  . ARG B 1 118 ? 151.380 3.402   291.051 1.00 34.70  ?  112 ARG B CA  1 
ATOM   4481  C C   . ARG B 1 118 ? 151.242 4.722   290.306 1.00 34.36  ?  112 ARG B C   1 
ATOM   4482  O O   . ARG B 1 118 ? 150.223 4.957   289.646 1.00 37.40  ?  112 ARG B O   1 
ATOM   4483  C CB  . ARG B 1 118 ? 150.825 3.544   292.468 1.00 31.69  ?  112 ARG B CB  1 
ATOM   4484  C CG  . ARG B 1 118 ? 150.940 2.295   293.324 1.00 30.86  ?  112 ARG B CG  1 
ATOM   4485  C CD  . ARG B 1 118 ? 150.249 2.500   294.661 1.00 37.56  ?  112 ARG B CD  1 
ATOM   4486  N NE  . ARG B 1 118 ? 150.465 1.390   295.583 1.00 36.21  ?  112 ARG B NE  1 
ATOM   4487  C CZ  . ARG B 1 118 ? 151.212 1.467   296.679 1.00 37.76  ?  112 ARG B CZ  1 
ATOM   4488  N NH1 . ARG B 1 118 ? 151.811 2.607   296.995 1.00 43.12  1  112 ARG B NH1 1 
ATOM   4489  N NH2 . ARG B 1 118 ? 151.354 0.407   297.463 1.00 38.88  ?  112 ARG B NH2 1 
ATOM   4490  N N   . CYS B 1 119 ? 152.250 5.593   290.398 1.00 37.12  ?  113 CYS B N   1 
ATOM   4491  C CA  . CYS B 1 119 ? 152.168 6.891   289.737 1.00 37.85  ?  113 CYS B CA  1 
ATOM   4492  C C   . CYS B 1 119 ? 152.158 6.743   288.220 1.00 40.81  ?  113 CYS B C   1 
ATOM   4493  O O   . CYS B 1 119 ? 151.381 7.415   287.532 1.00 40.70  ?  113 CYS B O   1 
ATOM   4494  C CB  . CYS B 1 119 ? 153.329 7.779   290.184 1.00 33.03  ?  113 CYS B CB  1 
ATOM   4495  S SG  . CYS B 1 119 ? 153.345 9.417   289.431 1.00 28.81  ?  113 CYS B SG  1 
ATOM   4496  N N   . ARG B 1 120 ? 153.011 5.869   287.680 1.00 43.46  ?  114 ARG B N   1 
ATOM   4497  C CA  . ARG B 1 120 ? 153.044 5.677   286.234 1.00 45.12  ?  114 ARG B CA  1 
ATOM   4498  C C   . ARG B 1 120 ? 151.801 4.946   285.743 1.00 40.02  ?  114 ARG B C   1 
ATOM   4499  O O   . ARG B 1 120 ? 151.233 5.305   284.705 1.00 40.21  ?  114 ARG B O   1 
ATOM   4500  C CB  . ARG B 1 120 ? 154.303 4.911   285.827 1.00 42.31  ?  114 ARG B CB  1 
ATOM   4501  C CG  . ARG B 1 120 ? 155.608 5.599   286.184 1.00 41.31  ?  114 ARG B CG  1 
ATOM   4502  C CD  . ARG B 1 120 ? 156.745 5.069   285.323 1.00 44.55  ?  114 ARG B CD  1 
ATOM   4503  N NE  . ARG B 1 120 ? 158.054 5.495   285.807 1.00 46.48  ?  114 ARG B NE  1 
ATOM   4504  C CZ  . ARG B 1 120 ? 158.876 4.720   286.508 1.00 48.99  ?  114 ARG B CZ  1 
ATOM   4505  N NH1 . ARG B 1 120 ? 158.524 3.476   286.802 1.00 49.02  1  114 ARG B NH1 1 
ATOM   4506  N NH2 . ARG B 1 120 ? 160.050 5.187   286.911 1.00 49.76  ?  114 ARG B NH2 1 
ATOM   4507  N N   . ASP B 1 121 ? 151.367 3.915   286.473 1.00 43.81  ?  115 ASP B N   1 
ATOM   4508  C CA  . ASP B 1 121 ? 150.206 3.142   286.043 1.00 48.85  ?  115 ASP B CA  1 
ATOM   4509  C C   . ASP B 1 121 ? 148.934 3.978   286.055 1.00 44.58  ?  115 ASP B C   1 
ATOM   4510  O O   . ASP B 1 121 ? 148.056 3.778   285.209 1.00 49.55  ?  115 ASP B O   1 
ATOM   4511  C CB  . ASP B 1 121 ? 150.040 1.908   286.931 1.00 53.12  ?  115 ASP B CB  1 
ATOM   4512  C CG  . ASP B 1 121 ? 151.259 1.002   286.907 1.00 56.28  ?  115 ASP B CG  1 
ATOM   4513  O OD1 . ASP B 1 121 ? 152.210 1.299   286.152 1.00 52.00  ?  115 ASP B OD1 1 
ATOM   4514  O OD2 . ASP B 1 121 ? 151.269 -0.004  287.649 1.00 51.89  -1 115 ASP B OD2 1 
ATOM   4515  N N   . LEU B 1 122 ? 148.815 4.917   286.996 1.00 45.32  ?  116 LEU B N   1 
ATOM   4516  C CA  . LEU B 1 122 ? 147.629 5.764   287.052 1.00 45.05  ?  116 LEU B CA  1 
ATOM   4517  C C   . LEU B 1 122 ? 147.720 6.943   286.093 1.00 49.51  ?  116 LEU B C   1 
ATOM   4518  O O   . LEU B 1 122 ? 146.686 7.437   285.629 1.00 51.05  ?  116 LEU B O   1 
ATOM   4519  C CB  . LEU B 1 122 ? 147.400 6.259   288.481 1.00 42.13  ?  116 LEU B CB  1 
ATOM   4520  C CG  . LEU B 1 122 ? 146.950 5.180   289.468 1.00 44.63  ?  116 LEU B CG  1 
ATOM   4521  C CD1 . LEU B 1 122 ? 146.700 5.767   290.844 1.00 39.79  ?  116 LEU B CD1 1 
ATOM   4522  C CD2 . LEU B 1 122 ? 145.706 4.482   288.948 1.00 48.29  ?  116 LEU B CD2 1 
ATOM   4523  N N   . LYS B 1 123 ? 148.935 7.408   285.788 1.00 48.05  ?  117 LYS B N   1 
ATOM   4524  C CA  . LYS B 1 123 ? 149.088 8.465   284.794 1.00 41.24  ?  117 LYS B CA  1 
ATOM   4525  C C   . LYS B 1 123 ? 148.647 7.994   283.414 1.00 42.89  ?  117 LYS B C   1 
ATOM   4526  O O   . LYS B 1 123 ? 148.088 8.779   282.639 1.00 41.43  ?  117 LYS B O   1 
ATOM   4527  C CB  . LYS B 1 123 ? 150.540 8.947   284.757 1.00 35.28  ?  117 LYS B CB  1 
ATOM   4528  C CG  . LYS B 1 123 ? 150.788 10.114  283.813 1.00 34.79  ?  117 LYS B CG  1 
ATOM   4529  C CD  . LYS B 1 123 ? 152.252 10.526  283.805 1.00 35.07  ?  117 LYS B CD  1 
ATOM   4530  C CE  . LYS B 1 123 ? 153.143 9.392   283.321 1.00 59.45  ?  117 LYS B CE  1 
ATOM   4531  N NZ  . LYS B 1 123 ? 154.580 9.786   283.283 1.00 53.38  1  117 LYS B NZ  1 
ATOM   4532  N N   . ALA B 1 124 ? 148.880 6.718   283.094 1.00 47.11  ?  118 ALA B N   1 
ATOM   4533  C CA  . ALA B 1 124 ? 148.441 6.184   281.810 1.00 47.11  ?  118 ALA B CA  1 
ATOM   4534  C C   . ALA B 1 124 ? 146.924 6.073   281.736 1.00 51.71  ?  118 ALA B C   1 
ATOM   4535  O O   . ALA B 1 124 ? 146.351 6.146   280.643 1.00 55.27  ?  118 ALA B O   1 
ATOM   4536  C CB  . ALA B 1 124 ? 149.085 4.822   281.559 1.00 40.28  ?  118 ALA B CB  1 
ATOM   4537  N N   . LYS B 1 125 ? 146.261 5.895   282.876 1.00 50.83  ?  119 LYS B N   1 
ATOM   4538  C CA  . LYS B 1 125 ? 144.810 5.794   282.932 1.00 44.19  ?  119 LYS B CA  1 
ATOM   4539  C C   . LYS B 1 125 ? 144.133 7.141   283.156 1.00 47.24  ?  119 LYS B C   1 
ATOM   4540  O O   . LYS B 1 125 ? 142.924 7.179   283.406 1.00 48.87  ?  119 LYS B O   1 
ATOM   4541  C CB  . LYS B 1 125 ? 144.393 4.811   284.030 1.00 40.70  ?  119 LYS B CB  1 
ATOM   4542  C CG  . LYS B 1 125 ? 144.897 3.393   283.813 1.00 36.56  ?  119 LYS B CG  1 
ATOM   4543  C CD  . LYS B 1 125 ? 144.371 2.448   284.880 1.00 35.13  ?  119 LYS B CD  1 
ATOM   4544  C CE  . LYS B 1 125 ? 144.836 1.022   284.632 1.00 36.53  ?  119 LYS B CE  1 
ATOM   4545  N NZ  . LYS B 1 125 ? 144.285 0.075   285.641 1.00 58.01  1  119 LYS B NZ  1 
ATOM   4546  N N   . GLY B 1 126 ? 144.881 8.239   283.074 1.00 42.42  ?  120 GLY B N   1 
ATOM   4547  C CA  . GLY B 1 126 ? 144.311 9.561   283.227 1.00 42.90  ?  120 GLY B CA  1 
ATOM   4548  C C   . GLY B 1 126 ? 144.042 9.992   284.649 1.00 44.66  ?  120 GLY B C   1 
ATOM   4549  O O   . GLY B 1 126 ? 143.377 11.014  284.852 1.00 43.81  ?  120 GLY B O   1 
ATOM   4550  N N   . ILE B 1 127 ? 144.535 9.253   285.639 1.00 44.71  ?  121 ILE B N   1 
ATOM   4551  C CA  . ILE B 1 127 ? 144.327 9.575   287.047 1.00 41.81  ?  121 ILE B CA  1 
ATOM   4552  C C   . ILE B 1 127 ? 145.600 10.194  287.605 1.00 42.21  ?  121 ILE B C   1 
ATOM   4553  O O   . ILE B 1 127 ? 146.710 9.715   287.340 1.00 40.21  ?  121 ILE B O   1 
ATOM   4554  C CB  . ILE B 1 127 ? 143.919 8.324   287.848 1.00 39.61  ?  121 ILE B CB  1 
ATOM   4555  C CG1 . ILE B 1 127 ? 142.646 7.710   287.262 1.00 45.07  ?  121 ILE B CG1 1 
ATOM   4556  C CG2 . ILE B 1 127 ? 143.715 8.667   289.317 1.00 29.23  ?  121 ILE B CG2 1 
ATOM   4557  C CD1 . ILE B 1 127 ? 141.451 8.637   287.293 1.00 40.63  ?  121 ILE B CD1 1 
ATOM   4558  N N   . LEU B 1 128 ? 145.441 11.266  288.377 1.00 36.76  ?  122 LEU B N   1 
ATOM   4559  C CA  . LEU B 1 128 ? 146.563 11.963  288.996 1.00 36.85  ?  122 LEU B CA  1 
ATOM   4560  C C   . LEU B 1 128 ? 146.848 11.323  290.351 1.00 37.02  ?  122 LEU B C   1 
ATOM   4561  O O   . LEU B 1 128 ? 146.038 11.430  291.276 1.00 39.74  ?  122 LEU B O   1 
ATOM   4562  C CB  . LEU B 1 128 ? 146.251 13.449  289.147 1.00 36.95  ?  122 LEU B CB  1 
ATOM   4563  C CG  . LEU B 1 128 ? 145.696 14.157  287.910 1.00 34.24  ?  122 LEU B CG  1 
ATOM   4564  C CD1 . LEU B 1 128 ? 145.350 15.603  288.232 1.00 34.88  ?  122 LEU B CD1 1 
ATOM   4565  C CD2 . LEU B 1 128 ? 146.684 14.081  286.757 1.00 35.42  ?  122 LEU B CD2 1 
ATOM   4566  N N   . PHE B 1 129 ? 147.993 10.661  290.472 1.00 36.46  ?  123 PHE B N   1 
ATOM   4567  C CA  . PHE B 1 129 ? 148.384 10.021  291.720 1.00 38.27  ?  123 PHE B CA  1 
ATOM   4568  C C   . PHE B 1 129 ? 149.434 10.861  292.434 1.00 34.75  ?  123 PHE B C   1 
ATOM   4569  O O   . PHE B 1 129 ? 150.332 11.424  291.801 1.00 38.92  ?  123 PHE B O   1 
ATOM   4570  C CB  . PHE B 1 129 ? 148.924 8.611   291.476 1.00 35.62  ?  123 PHE B CB  1 
ATOM   4571  C CG  . PHE B 1 129 ? 149.275 7.874   292.738 1.00 30.30  ?  123 PHE B CG  1 
ATOM   4572  C CD1 . PHE B 1 129 ? 148.281 7.371   293.560 1.00 35.09  ?  123 PHE B CD1 1 
ATOM   4573  C CD2 . PHE B 1 129 ? 150.596 7.687   293.103 1.00 34.88  ?  123 PHE B CD2 1 
ATOM   4574  C CE1 . PHE B 1 129 ? 148.598 6.694   294.723 1.00 37.38  ?  123 PHE B CE1 1 
ATOM   4575  C CE2 . PHE B 1 129 ? 150.920 7.011   294.264 1.00 33.23  ?  123 PHE B CE2 1 
ATOM   4576  C CZ  . PHE B 1 129 ? 149.920 6.514   295.075 1.00 35.65  ?  123 PHE B CZ  1 
ATOM   4577  N N   . VAL B 1 130 ? 149.312 10.943  293.756 1.00 32.53  ?  124 VAL B N   1 
ATOM   4578  C CA  . VAL B 1 130 ? 150.225 11.712  294.592 1.00 33.21  ?  124 VAL B CA  1 
ATOM   4579  C C   . VAL B 1 130 ? 150.631 10.845  295.774 1.00 40.15  ?  124 VAL B C   1 
ATOM   4580  O O   . VAL B 1 130 ? 149.769 10.349  296.510 1.00 31.25  ?  124 VAL B O   1 
ATOM   4581  C CB  . VAL B 1 130 ? 149.596 13.027  295.083 1.00 36.81  ?  124 VAL B CB  1 
ATOM   4582  C CG1 . VAL B 1 130 ? 150.512 13.711  296.089 1.00 34.62  ?  124 VAL B CG1 1 
ATOM   4583  C CG2 . VAL B 1 130 ? 149.308 13.951  293.911 1.00 40.05  ?  124 VAL B CG2 1 
ATOM   4584  N N   . GLY B 1 131 ? 151.936 10.657  295.949 1.00 43.83  ?  125 GLY B N   1 
ATOM   4585  C CA  . GLY B 1 131 ? 152.460 10.004  297.132 1.00 35.22  ?  125 GLY B CA  1 
ATOM   4586  C C   . GLY B 1 131 ? 153.061 11.020  298.078 1.00 30.24  ?  125 GLY B C   1 
ATOM   4587  O O   . GLY B 1 131 ? 154.072 11.652  297.756 1.00 38.24  ?  125 GLY B O   1 
ATOM   4588  N N   . SER B 1 132 ? 152.448 11.193  299.245 1.00 26.25  ?  126 SER B N   1 
ATOM   4589  C CA  . SER B 1 132 ? 152.822 12.244  300.179 1.00 36.53  ?  126 SER B CA  1 
ATOM   4590  C C   . SER B 1 132 ? 153.303 11.645  301.492 1.00 38.77  ?  126 SER B C   1 
ATOM   4591  O O   . SER B 1 132 ? 152.735 10.666  301.986 1.00 43.06  ?  126 SER B O   1 
ATOM   4592  C CB  . SER B 1 132 ? 151.645 13.188  300.443 1.00 38.20  ?  126 SER B CB  1 
ATOM   4593  O OG  . SER B 1 132 ? 151.999 14.190  301.379 1.00 42.27  ?  126 SER B OG  1 
ATOM   4594  N N   . GLY B 1 133 ? 154.352 12.242  302.052 1.00 32.20  ?  127 GLY B N   1 
ATOM   4595  C CA  . GLY B 1 133 ? 154.835 11.855  303.365 1.00 35.10  ?  127 GLY B CA  1 
ATOM   4596  C C   . GLY B 1 133 ? 154.235 12.743  304.443 1.00 40.06  ?  127 GLY B C   1 
ATOM   4597  O O   . GLY B 1 133 ? 154.146 13.959  304.288 1.00 42.32  ?  127 GLY B O   1 
ATOM   4598  N N   . VAL B 1 134 ? 153.814 12.113  305.538 1.00 45.57  ?  128 VAL B N   1 
ATOM   4599  C CA  . VAL B 1 134 ? 153.173 12.803  306.653 1.00 42.55  ?  128 VAL B CA  1 
ATOM   4600  C C   . VAL B 1 134 ? 153.906 12.423  307.932 1.00 48.03  ?  128 VAL B C   1 
ATOM   4601  O O   . VAL B 1 134 ? 153.887 11.254  308.336 1.00 50.32  ?  128 VAL B O   1 
ATOM   4602  C CB  . VAL B 1 134 ? 151.679 12.456  306.768 1.00 42.11  ?  128 VAL B CB  1 
ATOM   4603  C CG1 . VAL B 1 134 ? 151.005 13.355  307.793 1.00 51.02  ?  128 VAL B CG1 1 
ATOM   4604  C CG2 . VAL B 1 134 ? 150.993 12.570  305.414 1.00 47.85  ?  128 VAL B CG2 1 
ATOM   4605  N N   . SER B 1 135 ? 154.541 13.404  308.568 1.00 47.42  ?  129 SER B N   1 
ATOM   4606  C CA  . SER B 1 135 ? 155.260 13.198  309.817 1.00 47.94  ?  129 SER B CA  1 
ATOM   4607  C C   . SER B 1 135 ? 154.745 14.164  310.874 1.00 56.57  ?  129 SER B C   1 
ATOM   4608  O O   . SER B 1 135 ? 154.434 15.322  310.574 1.00 53.97  ?  129 SER B O   1 
ATOM   4609  C CB  . SER B 1 135 ? 156.769 13.386  309.629 1.00 61.51  ?  129 SER B CB  1 
ATOM   4610  O OG  . SER B 1 135 ? 157.458 13.239  310.859 1.00 71.75  ?  129 SER B OG  1 
ATOM   4611  N N   . GLY B 1 136 ? 154.660 13.684  312.112 1.00 64.64  ?  130 GLY B N   1 
ATOM   4612  C CA  . GLY B 1 136 ? 154.183 14.503  313.207 1.00 68.51  ?  130 GLY B CA  1 
ATOM   4613  C C   . GLY B 1 136 ? 153.326 13.735  314.191 1.00 66.87  ?  130 GLY B C   1 
ATOM   4614  O O   . GLY B 1 136 ? 152.860 14.294  315.188 1.00 68.99  ?  130 GLY B O   1 
ATOM   4615  N N   . GLY B 1 137 ? 153.113 12.448  313.922 1.00 68.86  ?  131 GLY B N   1 
ATOM   4616  C CA  . GLY B 1 137 ? 152.298 11.648  314.812 1.00 70.83  ?  131 GLY B CA  1 
ATOM   4617  C C   . GLY B 1 137 ? 150.836 12.060  314.769 1.00 76.14  ?  131 GLY B C   1 
ATOM   4618  O O   . GLY B 1 137 ? 150.317 12.531  313.752 1.00 78.46  ?  131 GLY B O   1 
ATOM   4619  N N   . GLU B 1 138 ? 150.163 11.882  315.907 1.00 84.17  ?  132 GLU B N   1 
ATOM   4620  C CA  . GLU B 1 138 ? 148.746 12.217  316.008 1.00 78.15  ?  132 GLU B CA  1 
ATOM   4621  C C   . GLU B 1 138 ? 148.541 13.701  316.289 1.00 73.44  ?  132 GLU B C   1 
ATOM   4622  O O   . GLU B 1 138 ? 147.694 14.347  315.662 1.00 68.42  ?  132 GLU B O   1 
ATOM   4623  C CB  . GLU B 1 138 ? 148.089 11.369  317.098 1.00 73.77  ?  132 GLU B CB  1 
ATOM   4624  C CG  . GLU B 1 138 ? 148.186 9.874   316.857 1.00 72.70  ?  132 GLU B CG  1 
ATOM   4625  C CD  . GLU B 1 138 ? 147.851 9.067   318.093 1.00 79.15  ?  132 GLU B CD  1 
ATOM   4626  O OE1 . GLU B 1 138 ? 147.813 9.655   319.194 1.00 85.70  ?  132 GLU B OE1 1 
ATOM   4627  O OE2 . GLU B 1 138 ? 147.626 7.845   317.967 1.00 72.42  -1 132 GLU B OE2 1 
ATOM   4628  N N   . GLU B 1 139 ? 149.307 14.257  317.233 1.00 72.45  ?  133 GLU B N   1 
ATOM   4629  C CA  . GLU B 1 139 ? 149.167 15.673  317.557 1.00 66.85  ?  133 GLU B CA  1 
ATOM   4630  C C   . GLU B 1 139 ? 149.562 16.549  316.375 1.00 63.87  ?  133 GLU B C   1 
ATOM   4631  O O   . GLU B 1 139 ? 148.974 17.614  316.157 1.00 63.37  ?  133 GLU B O   1 
ATOM   4632  C CB  . GLU B 1 139 ? 150.010 16.017  318.784 1.00 66.99  ?  133 GLU B CB  1 
ATOM   4633  C CG  . GLU B 1 139 ? 149.738 15.132  319.986 1.00 70.51  ?  133 GLU B CG  1 
ATOM   4634  C CD  . GLU B 1 139 ? 150.604 15.486  321.177 1.00 85.59  ?  133 GLU B CD  1 
ATOM   4635  O OE1 . GLU B 1 139 ? 151.127 16.620  321.220 1.00 92.71  ?  133 GLU B OE1 1 
ATOM   4636  O OE2 . GLU B 1 139 ? 150.764 14.628  322.070 1.00 89.68  -1 133 GLU B OE2 1 
ATOM   4637  N N   . GLY B 1 140 ? 150.560 16.117  315.603 1.00 65.64  ?  134 GLY B N   1 
ATOM   4638  C CA  . GLY B 1 140 ? 150.926 16.860  314.409 1.00 63.72  ?  134 GLY B CA  1 
ATOM   4639  C C   . GLY B 1 140 ? 149.828 16.840  313.364 1.00 55.36  ?  134 GLY B C   1 
ATOM   4640  O O   . GLY B 1 140 ? 149.476 17.876  312.795 1.00 51.94  ?  134 GLY B O   1 
ATOM   4641  N N   . ALA B 1 141 ? 149.256 15.661  313.113 1.00 53.49  ?  135 ALA B N   1 
ATOM   4642  C CA  . ALA B 1 141 ? 148.182 15.539  312.135 1.00 57.74  ?  135 ALA B CA  1 
ATOM   4643  C C   . ALA B 1 141 ? 146.921 16.291  312.540 1.00 54.83  ?  135 ALA B C   1 
ATOM   4644  O O   . ALA B 1 141 ? 146.020 16.444  311.709 1.00 56.29  ?  135 ALA B O   1 
ATOM   4645  C CB  . ALA B 1 141 ? 147.849 14.063  311.906 1.00 55.56  ?  135 ALA B CB  1 
ATOM   4646  N N   . ARG B 1 142 ? 146.836 16.768  313.782 1.00 52.12  ?  136 ARG B N   1 
ATOM   4647  C CA  . ARG B 1 142 ? 145.638 17.443  314.263 1.00 52.41  ?  136 ARG B CA  1 
ATOM   4648  C C   . ARG B 1 142 ? 145.676 18.949  314.027 1.00 59.30  ?  136 ARG B C   1 
ATOM   4649  O O   . ARG B 1 142 ? 144.661 19.538  313.639 1.00 66.44  ?  136 ARG B O   1 
ATOM   4650  C CB  . ARG B 1 142 ? 145.441 17.156  315.755 1.00 53.41  ?  136 ARG B CB  1 
ATOM   4651  C CG  . ARG B 1 142 ? 144.154 17.719  316.338 1.00 56.51  ?  136 ARG B CG  1 
ATOM   4652  C CD  . ARG B 1 142 ? 142.930 17.118  315.666 1.00 61.16  ?  136 ARG B CD  1 
ATOM   4653  N NE  . ARG B 1 142 ? 141.687 17.576  316.281 1.00 61.70  ?  136 ARG B NE  1 
ATOM   4654  C CZ  . ARG B 1 142 ? 141.042 18.685  315.930 1.00 60.79  ?  136 ARG B CZ  1 
ATOM   4655  N NH1 . ARG B 1 142 ? 141.522 19.456  314.964 1.00 52.33  1  136 ARG B NH1 1 
ATOM   4656  N NH2 . ARG B 1 142 ? 139.917 19.022  316.544 1.00 50.83  ?  136 ARG B NH2 1 
ATOM   4657  N N   . TYR B 1 143 ? 146.826 19.591  314.245 1.00 53.28  ?  137 TYR B N   1 
ATOM   4658  C CA  . TYR B 1 143 ? 146.924 21.039  314.148 1.00 56.54  ?  137 TYR B CA  1 
ATOM   4659  C C   . TYR B 1 143 ? 147.933 21.533  313.121 1.00 57.07  ?  137 TYR B C   1 
ATOM   4660  O O   . TYR B 1 143 ? 147.924 22.728  312.803 1.00 48.46  ?  137 TYR B O   1 
ATOM   4661  C CB  . TYR B 1 143 ? 147.272 21.644  315.517 1.00 60.22  ?  137 TYR B CB  1 
ATOM   4662  C CG  . TYR B 1 143 ? 146.323 21.231  316.619 1.00 65.47  ?  137 TYR B CG  1 
ATOM   4663  C CD1 . TYR B 1 143 ? 145.045 21.769  316.699 1.00 64.46  ?  137 TYR B CD1 1 
ATOM   4664  C CD2 . TYR B 1 143 ? 146.705 20.304  317.580 1.00 61.74  ?  137 TYR B CD2 1 
ATOM   4665  C CE1 . TYR B 1 143 ? 144.173 21.394  317.704 1.00 60.70  ?  137 TYR B CE1 1 
ATOM   4666  C CE2 . TYR B 1 143 ? 145.840 19.923  318.589 1.00 65.20  ?  137 TYR B CE2 1 
ATOM   4667  C CZ  . TYR B 1 143 ? 144.576 20.470  318.646 1.00 68.11  ?  137 TYR B CZ  1 
ATOM   4668  O OH  . TYR B 1 143 ? 143.712 20.093  319.649 1.00 78.05  ?  137 TYR B OH  1 
ATOM   4669  N N   . GLY B 1 144 ? 148.796 20.667  312.596 1.00 59.33  ?  138 GLY B N   1 
ATOM   4670  C CA  . GLY B 1 144 ? 149.771 21.076  311.614 1.00 62.33  ?  138 GLY B CA  1 
ATOM   4671  C C   . GLY B 1 144 ? 150.848 20.035  311.391 1.00 63.17  ?  138 GLY B C   1 
ATOM   4672  O O   . GLY B 1 144 ? 151.883 20.021  312.065 1.00 65.51  ?  138 GLY B O   1 
ATOM   4673  N N   . PRO B 1 145 ? 150.615 19.126  310.449 1.00 60.58  ?  139 PRO B N   1 
ATOM   4674  C CA  . PRO B 1 145 ? 151.614 18.106  310.131 1.00 61.09  ?  139 PRO B CA  1 
ATOM   4675  C C   . PRO B 1 145 ? 152.583 18.573  309.053 1.00 54.32  ?  139 PRO B C   1 
ATOM   4676  O O   . PRO B 1 145 ? 152.352 19.554  308.344 1.00 50.22  ?  139 PRO B O   1 
ATOM   4677  C CB  . PRO B 1 145 ? 150.757 16.940  309.623 1.00 57.77  ?  139 PRO B CB  1 
ATOM   4678  C CG  . PRO B 1 145 ? 149.612 17.623  308.950 1.00 50.24  ?  139 PRO B CG  1 
ATOM   4679  C CD  . PRO B 1 145 ? 149.346 18.891  309.736 1.00 52.11  ?  139 PRO B CD  1 
ATOM   4680  N N   . SER B 1 146 ? 153.686 17.839  308.945 1.00 52.55  ?  140 SER B N   1 
ATOM   4681  C CA  . SER B 1 146 ? 154.668 18.066  307.893 1.00 50.47  ?  140 SER B CA  1 
ATOM   4682  C C   . SER B 1 146 ? 154.305 17.204  306.691 1.00 40.94  ?  140 SER B C   1 
ATOM   4683  O O   . SER B 1 146 ? 154.318 15.971  306.779 1.00 45.09  ?  140 SER B O   1 
ATOM   4684  C CB  . SER B 1 146 ? 156.076 17.743  308.386 1.00 64.42  ?  140 SER B CB  1 
ATOM   4685  O OG  . SER B 1 146 ? 156.161 16.405  308.839 1.00 69.18  ?  140 SER B OG  1 
ATOM   4686  N N   . LEU B 1 147 ? 153.982 17.850  305.576 1.00 39.10  ?  141 LEU B N   1 
ATOM   4687  C CA  . LEU B 1 147 ? 153.503 17.171  304.380 1.00 41.01  ?  141 LEU B CA  1 
ATOM   4688  C C   . LEU B 1 147 ? 154.563 17.245  303.291 1.00 39.14  ?  141 LEU B C   1 
ATOM   4689  O O   . LEU B 1 147 ? 155.068 18.330  302.981 1.00 43.25  ?  141 LEU B O   1 
ATOM   4690  C CB  . LEU B 1 147 ? 152.190 17.792  303.899 1.00 41.99  ?  141 LEU B CB  1 
ATOM   4691  C CG  . LEU B 1 147 ? 151.106 17.861  304.979 1.00 41.64  ?  141 LEU B CG  1 
ATOM   4692  C CD1 . LEU B 1 147 ? 149.875 18.601  304.482 1.00 38.67  ?  141 LEU B CD1 1 
ATOM   4693  C CD2 . LEU B 1 147 ? 150.740 16.464  305.462 1.00 39.77  ?  141 LEU B CD2 1 
ATOM   4694  N N   . MET B 1 148 ? 154.898 16.088  302.713 1.00 34.74  ?  142 MET B N   1 
ATOM   4695  C CA  . MET B 1 148 ? 155.926 15.968  301.681 1.00 36.04  ?  142 MET B CA  1 
ATOM   4696  C C   . MET B 1 148 ? 155.299 15.321  300.450 1.00 38.00  ?  142 MET B C   1 
ATOM   4697  O O   . MET B 1 148 ? 155.524 14.132  300.179 1.00 38.23  ?  142 MET B O   1 
ATOM   4698  C CB  . MET B 1 148 ? 157.117 15.157  302.188 1.00 34.99  ?  142 MET B CB  1 
ATOM   4699  C CG  . MET B 1 148 ? 157.525 15.497  303.614 1.00 38.24  ?  142 MET B CG  1 
ATOM   4700  S SD  . MET B 1 148 ? 158.716 14.337  304.306 1.00 32.21  ?  142 MET B SD  1 
ATOM   4701  C CE  . MET B 1 148 ? 158.648 14.777  306.041 1.00 42.22  ?  142 MET B CE  1 
ATOM   4702  N N   . PRO B 1 149 ? 154.513 16.070  299.682 1.00 34.37  ?  143 PRO B N   1 
ATOM   4703  C CA  . PRO B 1 149 ? 153.819 15.480  298.535 1.00 37.33  ?  143 PRO B CA  1 
ATOM   4704  C C   . PRO B 1 149 ? 154.716 15.351  297.315 1.00 36.20  ?  143 PRO B C   1 
ATOM   4705  O O   . PRO B 1 149 ? 155.599 16.175  297.064 1.00 36.49  ?  143 PRO B O   1 
ATOM   4706  C CB  . PRO B 1 149 ? 152.680 16.470  298.274 1.00 44.23  ?  143 PRO B CB  1 
ATOM   4707  C CG  . PRO B 1 149 ? 153.247 17.781  298.702 1.00 39.70  ?  143 PRO B CG  1 
ATOM   4708  C CD  . PRO B 1 149 ? 154.157 17.488  299.872 1.00 38.15  ?  143 PRO B CD  1 
ATOM   4709  N N   . GLY B 1 150 ? 154.464 14.297  296.545 1.00 36.45  ?  144 GLY B N   1 
ATOM   4710  C CA  . GLY B 1 150 ? 155.205 14.059  295.321 1.00 32.80  ?  144 GLY B CA  1 
ATOM   4711  C C   . GLY B 1 150 ? 154.473 13.077  294.437 1.00 37.65  ?  144 GLY B C   1 
ATOM   4712  O O   . GLY B 1 150 ? 153.594 12.337  294.890 1.00 37.39  ?  144 GLY B O   1 
ATOM   4713  N N   . GLY B 1 151 ? 154.846 13.079  293.160 1.00 38.39  ?  145 GLY B N   1 
ATOM   4714  C CA  . GLY B 1 151 ? 154.232 12.182  292.201 1.00 40.08  ?  145 GLY B CA  1 
ATOM   4715  C C   . GLY B 1 151 ? 153.942 12.826  290.861 1.00 38.26  ?  145 GLY B C   1 
ATOM   4716  O O   . GLY B 1 151 ? 154.808 12.868  289.983 1.00 44.14  ?  145 GLY B O   1 
ATOM   4717  N N   . ASN B 1 152 ? 152.721 13.324  290.688 1.00 36.28  ?  146 ASN B N   1 
ATOM   4718  C CA  . ASN B 1 152 ? 152.293 13.970  289.452 1.00 33.38  ?  146 ASN B CA  1 
ATOM   4719  C C   . ASN B 1 152 ? 152.014 15.435  289.761 1.00 39.60  ?  146 ASN B C   1 
ATOM   4720  O O   . ASN B 1 152 ? 151.041 15.753  290.454 1.00 42.92  ?  146 ASN B O   1 
ATOM   4721  C CB  . ASN B 1 152 ? 151.060 13.276  288.876 1.00 33.11  ?  146 ASN B CB  1 
ATOM   4722  C CG  . ASN B 1 152 ? 150.800 13.649  287.428 1.00 39.31  ?  146 ASN B CG  1 
ATOM   4723  O OD1 . ASN B 1 152 ? 151.123 14.752  286.990 1.00 41.90  ?  146 ASN B OD1 1 
ATOM   4724  N ND2 . ASN B 1 152 ? 150.213 12.724  286.677 1.00 33.39  ?  146 ASN B ND2 1 
ATOM   4725  N N   . LYS B 1 153 ? 152.867 16.326  289.246 1.00 45.26  ?  147 LYS B N   1 
ATOM   4726  C CA  . LYS B 1 153 ? 152.730 17.750  289.537 1.00 44.97  ?  147 LYS B CA  1 
ATOM   4727  C C   . LYS B 1 153 ? 151.437 18.331  288.980 1.00 42.07  ?  147 LYS B C   1 
ATOM   4728  O O   . LYS B 1 153 ? 151.035 19.426  289.389 1.00 37.10  ?  147 LYS B O   1 
ATOM   4729  C CB  . LYS B 1 153 ? 153.933 18.521  288.984 1.00 48.06  ?  147 LYS B CB  1 
ATOM   4730  C CG  . LYS B 1 153 ? 154.095 19.925  289.559 1.00 52.48  ?  147 LYS B CG  1 
ATOM   4731  C CD  . LYS B 1 153 ? 154.933 20.814  288.651 1.00 60.76  ?  147 LYS B CD  1 
ATOM   4732  C CE  . LYS B 1 153 ? 156.391 20.389  288.635 1.00 61.31  ?  147 LYS B CE  1 
ATOM   4733  N NZ  . LYS B 1 153 ? 157.049 20.615  289.952 1.00 62.33  1  147 LYS B NZ  1 
ATOM   4734  N N   . GLU B 1 154 ? 150.774 17.623  288.063 1.00 43.14  ?  148 GLU B N   1 
ATOM   4735  C CA  . GLU B 1 154 ? 149.507 18.108  287.527 1.00 41.26  ?  148 GLU B CA  1 
ATOM   4736  C C   . GLU B 1 154 ? 148.442 18.204  288.612 1.00 38.21  ?  148 GLU B C   1 
ATOM   4737  O O   . GLU B 1 154 ? 147.518 19.019  288.504 1.00 40.39  ?  148 GLU B O   1 
ATOM   4738  C CB  . GLU B 1 154 ? 149.036 17.197  286.395 1.00 35.22  ?  148 GLU B CB  1 
ATOM   4739  C CG  . GLU B 1 154 ? 148.146 17.881  285.375 1.00 44.59  ?  148 GLU B CG  1 
ATOM   4740  C CD  . GLU B 1 154 ? 147.756 16.960  284.237 1.00 60.07  ?  148 GLU B CD  1 
ATOM   4741  O OE1 . GLU B 1 154 ? 146.682 16.328  284.323 1.00 64.11  ?  148 GLU B OE1 1 
ATOM   4742  O OE2 . GLU B 1 154 ? 148.530 16.859  283.262 1.00 63.34  -1 148 GLU B OE2 1 
ATOM   4743  N N   . ALA B 1 155 ? 148.555 17.389  289.661 1.00 36.34  ?  149 ALA B N   1 
ATOM   4744  C CA  . ALA B 1 155 ? 147.635 17.438  290.788 1.00 34.38  ?  149 ALA B CA  1 
ATOM   4745  C C   . ALA B 1 155 ? 148.037 18.461  291.841 1.00 36.26  ?  149 ALA B C   1 
ATOM   4746  O O   . ALA B 1 155 ? 147.253 18.718  292.762 1.00 33.67  ?  149 ALA B O   1 
ATOM   4747  C CB  . ALA B 1 155 ? 147.526 16.056  291.441 1.00 35.23  ?  149 ALA B CB  1 
ATOM   4748  N N   . TRP B 1 156 ? 149.229 19.044  291.730 1.00 41.24  ?  150 TRP B N   1 
ATOM   4749  C CA  . TRP B 1 156 ? 149.658 20.039  292.710 1.00 40.62  ?  150 TRP B CA  1 
ATOM   4750  C C   . TRP B 1 156 ? 148.787 21.292  292.736 1.00 34.10  ?  150 TRP B C   1 
ATOM   4751  O O   . TRP B 1 156 ? 148.474 21.758  293.845 1.00 35.21  ?  150 TRP B O   1 
ATOM   4752  C CB  . TRP B 1 156 ? 151.131 20.399  292.469 1.00 37.85  ?  150 TRP B CB  1 
ATOM   4753  C CG  . TRP B 1 156 ? 151.658 21.470  293.381 1.00 34.89  ?  150 TRP B CG  1 
ATOM   4754  C CD1 . TRP B 1 156 ? 152.168 22.682  293.013 1.00 36.99  ?  150 TRP B CD1 1 
ATOM   4755  C CD2 . TRP B 1 156 ? 151.719 21.429  294.814 1.00 32.98  ?  150 TRP B CD2 1 
ATOM   4756  N NE1 . TRP B 1 156 ? 152.547 23.395  294.125 1.00 37.83  ?  150 TRP B NE1 1 
ATOM   4757  C CE2 . TRP B 1 156 ? 152.280 22.648  295.243 1.00 34.89  ?  150 TRP B CE2 1 
ATOM   4758  C CE3 . TRP B 1 156 ? 151.355 20.480  295.774 1.00 32.72  ?  150 TRP B CE3 1 
ATOM   4759  C CZ2 . TRP B 1 156 ? 152.486 22.942  296.589 1.00 38.88  ?  150 TRP B CZ2 1 
ATOM   4760  C CZ3 . TRP B 1 156 ? 151.559 20.774  297.110 1.00 34.42  ?  150 TRP B CZ3 1 
ATOM   4761  C CH2 . TRP B 1 156 ? 152.120 21.995  297.505 1.00 42.29  ?  150 TRP B CH2 1 
ATOM   4762  N N   . PRO B 1 157 ? 148.366 21.882  291.609 1.00 30.53  ?  151 PRO B N   1 
ATOM   4763  C CA  . PRO B 1 157 ? 147.539 23.099  291.697 1.00 38.44  ?  151 PRO B CA  1 
ATOM   4764  C C   . PRO B 1 157 ? 146.221 22.907  292.429 1.00 38.37  ?  151 PRO B C   1 
ATOM   4765  O O   . PRO B 1 157 ? 145.642 23.897  292.893 1.00 36.17  ?  151 PRO B O   1 
ATOM   4766  C CB  . PRO B 1 157 ? 147.306 23.474  290.227 1.00 37.37  ?  151 PRO B CB  1 
ATOM   4767  C CG  . PRO B 1 157 ? 148.449 22.874  289.504 1.00 35.31  ?  151 PRO B CG  1 
ATOM   4768  C CD  . PRO B 1 157 ? 148.727 21.583  290.210 1.00 30.62  ?  151 PRO B CD  1 
ATOM   4769  N N   . HIS B 1 158 ? 145.729 21.675  292.553 1.00 37.11  ?  152 HIS B N   1 
ATOM   4770  C CA  . HIS B 1 158 ? 144.458 21.433  293.226 1.00 33.26  ?  152 HIS B CA  1 
ATOM   4771  C C   . HIS B 1 158 ? 144.632 21.118  294.706 1.00 37.36  ?  152 HIS B C   1 
ATOM   4772  O O   . HIS B 1 158 ? 143.846 21.590  295.535 1.00 37.01  ?  152 HIS B O   1 
ATOM   4773  C CB  . HIS B 1 158 ? 143.709 20.293  292.534 1.00 28.68  ?  152 HIS B CB  1 
ATOM   4774  C CG  . HIS B 1 158 ? 143.475 20.526  291.075 1.00 36.65  ?  152 HIS B CG  1 
ATOM   4775  N ND1 . HIS B 1 158 ? 144.418 20.230  290.114 1.00 39.36  ?  152 HIS B ND1 1 
ATOM   4776  C CD2 . HIS B 1 158 ? 142.411 21.036  290.412 1.00 43.98  ?  152 HIS B CD2 1 
ATOM   4777  C CE1 . HIS B 1 158 ? 143.942 20.542  288.922 1.00 42.36  ?  152 HIS B CE1 1 
ATOM   4778  N NE2 . HIS B 1 158 ? 142.725 21.032  289.075 1.00 45.92  ?  152 HIS B NE2 1 
ATOM   4779  N N   . ILE B 1 159 ? 145.649 20.327  295.059 1.00 38.63  ?  153 ILE B N   1 
ATOM   4780  C CA  . ILE B 1 159 ? 145.887 19.977  296.457 1.00 38.55  ?  153 ILE B CA  1 
ATOM   4781  C C   . ILE B 1 159 ? 146.745 21.003  297.182 1.00 40.88  ?  153 ILE B C   1 
ATOM   4782  O O   . ILE B 1 159 ? 146.872 20.928  298.414 1.00 39.28  ?  153 ILE B O   1 
ATOM   4783  C CB  . ILE B 1 159 ? 146.543 18.587  296.569 1.00 39.91  ?  153 ILE B CB  1 
ATOM   4784  C CG1 . ILE B 1 159 ? 147.951 18.614  295.973 1.00 43.56  ?  153 ILE B CG1 1 
ATOM   4785  C CG2 . ILE B 1 159 ? 145.692 17.547  295.862 1.00 34.80  ?  153 ILE B CG2 1 
ATOM   4786  C CD1 . ILE B 1 159 ? 148.651 17.275  296.005 1.00 46.08  ?  153 ILE B CD1 1 
ATOM   4787  N N   . LYS B 1 160 ? 147.337 21.958  296.459 1.00 39.64  ?  154 LYS B N   1 
ATOM   4788  C CA  . LYS B 1 160 ? 148.156 22.985  297.097 1.00 38.65  ?  154 LYS B CA  1 
ATOM   4789  C C   . LYS B 1 160 ? 147.346 23.797  298.100 1.00 42.89  ?  154 LYS B C   1 
ATOM   4790  O O   . LYS B 1 160 ? 147.861 24.191  299.153 1.00 44.42  ?  154 LYS B O   1 
ATOM   4791  C CB  . LYS B 1 160 ? 148.761 23.898  296.029 1.00 39.09  ?  154 LYS B CB  1 
ATOM   4792  C CG  . LYS B 1 160 ? 149.470 25.133  296.555 1.00 46.95  ?  154 LYS B CG  1 
ATOM   4793  C CD  . LYS B 1 160 ? 149.924 26.024  295.408 1.00 38.86  ?  154 LYS B CD  1 
ATOM   4794  C CE  . LYS B 1 160 ? 150.565 27.306  295.917 1.00 52.63  ?  154 LYS B CE  1 
ATOM   4795  N NZ  . LYS B 1 160 ? 151.794 27.039  296.713 1.00 57.54  1  154 LYS B NZ  1 
ATOM   4796  N N   . THR B 1 161 ? 146.070 24.042  297.798 1.00 49.25  ?  155 THR B N   1 
ATOM   4797  C CA  . THR B 1 161 ? 145.252 24.883  298.666 1.00 50.68  ?  155 THR B CA  1 
ATOM   4798  C C   . THR B 1 161 ? 144.962 24.199  299.997 1.00 49.59  ?  155 THR B C   1 
ATOM   4799  O O   . THR B 1 161 ? 145.069 24.824  301.059 1.00 52.32  ?  155 THR B O   1 
ATOM   4800  C CB  . THR B 1 161 ? 143.949 25.248  297.958 1.00 49.76  ?  155 THR B CB  1 
ATOM   4801  O OG1 . THR B 1 161 ? 144.231 25.641  296.609 1.00 55.56  ?  155 THR B OG1 1 
ATOM   4802  C CG2 . THR B 1 161 ? 143.259 26.395  298.676 1.00 58.12  ?  155 THR B CG2 1 
ATOM   4803  N N   . ILE B 1 162 ? 144.601 22.916  299.964 1.00 48.25  ?  156 ILE B N   1 
ATOM   4804  C CA  . ILE B 1 162 ? 144.221 22.219  301.189 1.00 45.91  ?  156 ILE B CA  1 
ATOM   4805  C C   . ILE B 1 162 ? 145.451 21.773  301.969 1.00 42.57  ?  156 ILE B C   1 
ATOM   4806  O O   . ILE B 1 162 ? 145.491 21.881  303.199 1.00 39.38  ?  156 ILE B O   1 
ATOM   4807  C CB  . ILE B 1 162 ? 143.299 21.031  300.855 1.00 49.45  ?  156 ILE B CB  1 
ATOM   4808  C CG1 . ILE B 1 162 ? 142.050 21.519  300.117 1.00 50.20  ?  156 ILE B CG1 1 
ATOM   4809  C CG2 . ILE B 1 162 ? 142.913 20.275  302.121 1.00 43.32  ?  156 ILE B CG2 1 
ATOM   4810  C CD1 . ILE B 1 162 ? 141.095 20.411  299.731 1.00 44.19  ?  156 ILE B CD1 1 
ATOM   4811  N N   . PHE B 1 163 ? 146.471 21.266  301.272 1.00 45.75  ?  157 PHE B N   1 
ATOM   4812  C CA  . PHE B 1 163 ? 147.662 20.765  301.951 1.00 43.94  ?  157 PHE B CA  1 
ATOM   4813  C C   . PHE B 1 163 ? 148.397 21.885  302.679 1.00 49.74  ?  157 PHE B C   1 
ATOM   4814  O O   . PHE B 1 163 ? 148.711 21.766  303.869 1.00 44.43  ?  157 PHE B O   1 
ATOM   4815  C CB  . PHE B 1 163 ? 148.585 20.075  300.946 1.00 45.69  ?  157 PHE B CB  1 
ATOM   4816  C CG  . PHE B 1 163 ? 148.395 18.587  300.869 1.00 49.69  ?  157 PHE B CG  1 
ATOM   4817  C CD1 . PHE B 1 163 ? 147.170 18.046  300.515 1.00 50.29  ?  157 PHE B CD1 1 
ATOM   4818  C CD2 . PHE B 1 163 ? 149.448 17.727  301.139 1.00 43.96  ?  157 PHE B CD2 1 
ATOM   4819  C CE1 . PHE B 1 163 ? 146.996 16.677  300.442 1.00 47.79  ?  157 PHE B CE1 1 
ATOM   4820  C CE2 . PHE B 1 163 ? 149.281 16.358  301.068 1.00 39.40  ?  157 PHE B CE2 1 
ATOM   4821  C CZ  . PHE B 1 163 ? 148.053 15.832  300.719 1.00 46.39  ?  157 PHE B CZ  1 
ATOM   4822  N N   . GLN B 1 164 ? 148.678 22.986  301.978 1.00 50.18  ?  158 GLN B N   1 
ATOM   4823  C CA  . GLN B 1 164 ? 149.391 24.097  302.600 1.00 43.94  ?  158 GLN B CA  1 
ATOM   4824  C C   . GLN B 1 164 ? 148.575 24.746  303.710 1.00 45.84  ?  158 GLN B C   1 
ATOM   4825  O O   . GLN B 1 164 ? 149.149 25.269  304.672 1.00 48.79  ?  158 GLN B O   1 
ATOM   4826  C CB  . GLN B 1 164 ? 149.765 25.138  301.546 1.00 46.52  ?  158 GLN B CB  1 
ATOM   4827  C CG  . GLN B 1 164 ? 150.781 24.653  300.527 1.00 51.83  ?  158 GLN B CG  1 
ATOM   4828  C CD  . GLN B 1 164 ? 151.133 25.717  299.509 1.00 54.54  ?  158 GLN B CD  1 
ATOM   4829  O OE1 . GLN B 1 164 ? 152.145 25.618  298.816 1.00 54.22  ?  158 GLN B OE1 1 
ATOM   4830  N NE2 . GLN B 1 164 ? 150.293 26.742  299.409 1.00 56.12  ?  158 GLN B NE2 1 
ATOM   4831  N N   . GLY B 1 165 ? 147.247 24.723  303.600 1.00 47.37  ?  159 GLY B N   1 
ATOM   4832  C CA  . GLY B 1 165 ? 146.422 25.320  304.636 1.00 44.92  ?  159 GLY B CA  1 
ATOM   4833  C C   . GLY B 1 165 ? 146.498 24.570  305.952 1.00 43.99  ?  159 GLY B C   1 
ATOM   4834  O O   . GLY B 1 165 ? 146.594 25.181  307.019 1.00 45.40  ?  159 GLY B O   1 
ATOM   4835  N N   . ILE B 1 166 ? 146.462 23.235  305.896 1.00 46.65  ?  160 ILE B N   1 
ATOM   4836  C CA  . ILE B 1 166 ? 146.493 22.427  307.112 1.00 47.38  ?  160 ILE B CA  1 
ATOM   4837  C C   . ILE B 1 166 ? 147.904 22.086  307.565 1.00 50.22  ?  160 ILE B C   1 
ATOM   4838  O O   . ILE B 1 166 ? 148.082 21.626  308.703 1.00 52.55  ?  160 ILE B O   1 
ATOM   4839  C CB  . ILE B 1 166 ? 145.700 21.117  306.933 1.00 47.10  ?  160 ILE B CB  1 
ATOM   4840  C CG1 . ILE B 1 166 ? 146.457 20.155  306.016 1.00 43.10  ?  160 ILE B CG1 1 
ATOM   4841  C CG2 . ILE B 1 166 ? 144.319 21.409  306.374 1.00 45.03  ?  160 ILE B CG2 1 
ATOM   4842  C CD1 . ILE B 1 166 ? 145.817 18.789  305.906 1.00 32.02  ?  160 ILE B CD1 1 
ATOM   4843  N N   . ALA B 1 167 ? 148.912 22.295  306.720 1.00 53.07  ?  161 ALA B N   1 
ATOM   4844  C CA  . ALA B 1 167 ? 150.278 21.954  307.081 1.00 54.06  ?  161 ALA B CA  1 
ATOM   4845  C C   . ALA B 1 167 ? 150.771 22.830  308.230 1.00 52.73  ?  161 ALA B C   1 
ATOM   4846  O O   . ALA B 1 167 ? 150.210 23.888  308.530 1.00 56.54  ?  161 ALA B O   1 
ATOM   4847  C CB  . ALA B 1 167 ? 151.207 22.101  305.876 1.00 48.19  ?  161 ALA B CB  1 
ATOM   4848  N N   . ALA B 1 168 ? 151.840 22.370  308.878 1.00 56.23  ?  162 ALA B N   1 
ATOM   4849  C CA  . ALA B 1 168 ? 152.433 23.124  309.972 1.00 52.66  ?  162 ALA B CA  1 
ATOM   4850  C C   . ALA B 1 168 ? 152.992 24.449  309.469 1.00 54.82  ?  162 ALA B C   1 
ATOM   4851  O O   . ALA B 1 168 ? 153.508 24.542  308.352 1.00 51.98  ?  162 ALA B O   1 
ATOM   4852  C CB  . ALA B 1 168 ? 153.540 22.309  310.641 1.00 51.07  ?  162 ALA B CB  1 
ATOM   4853  N N   . LYS B 1 169 ? 152.881 25.479  310.303 1.00 66.17  ?  163 LYS B N   1 
ATOM   4854  C CA  . LYS B 1 169 ? 153.398 26.799  309.976 1.00 70.91  ?  163 LYS B CA  1 
ATOM   4855  C C   . LYS B 1 169 ? 154.814 26.939  310.519 1.00 70.94  ?  163 LYS B C   1 
ATOM   4856  O O   . LYS B 1 169 ? 155.080 26.602  311.678 1.00 54.81  ?  163 LYS B O   1 
ATOM   4857  C CB  . LYS B 1 169 ? 152.488 27.891  310.538 1.00 63.85  ?  163 LYS B CB  1 
ATOM   4858  C CG  . LYS B 1 169 ? 151.135 27.959  309.844 1.00 62.75  ?  163 LYS B CG  1 
ATOM   4859  C CD  . LYS B 1 169 ? 151.304 28.222  308.354 1.00 65.70  ?  163 LYS B CD  1 
ATOM   4860  C CE  . LYS B 1 169 ? 150.025 27.935  307.585 1.00 60.17  ?  163 LYS B CE  1 
ATOM   4861  N NZ  . LYS B 1 169 ? 149.682 26.485  307.601 1.00 50.13  1  163 LYS B NZ  1 
ATOM   4862  N N   . VAL B 1 170 ? 155.719 27.435  309.676 1.00 71.06  ?  164 VAL B N   1 
ATOM   4863  C CA  . VAL B 1 170 ? 157.135 27.420  310.025 1.00 76.65  ?  164 VAL B CA  1 
ATOM   4864  C C   . VAL B 1 170 ? 157.512 28.631  310.873 1.00 77.72  ?  164 VAL B C   1 
ATOM   4865  O O   . VAL B 1 170 ? 158.421 28.549  311.707 1.00 83.27  ?  164 VAL B O   1 
ATOM   4866  C CB  . VAL B 1 170 ? 157.987 27.324  308.746 1.00 81.40  ?  164 VAL B CB  1 
ATOM   4867  C CG1 . VAL B 1 170 ? 157.784 28.545  307.868 1.00 75.49  ?  164 VAL B CG1 1 
ATOM   4868  C CG2 . VAL B 1 170 ? 159.454 27.140  309.085 1.00 64.20  ?  164 VAL B CG2 1 
ATOM   4869  N N   . GLY B 1 171 ? 156.830 29.759  310.691 1.00 66.73  ?  165 GLY B N   1 
ATOM   4870  C CA  . GLY B 1 171 ? 157.142 30.951  311.453 1.00 68.82  ?  165 GLY B CA  1 
ATOM   4871  C C   . GLY B 1 171 ? 157.256 32.198  310.602 1.00 73.42  ?  165 GLY B C   1 
ATOM   4872  O O   . GLY B 1 171 ? 156.934 33.297  311.063 1.00 72.92  ?  165 GLY B O   1 
ATOM   4873  N N   . THR B 1 172 ? 157.725 32.049  309.365 1.00 76.97  ?  166 THR B N   1 
ATOM   4874  C CA  . THR B 1 172 ? 157.806 33.157  308.423 1.00 78.35  ?  166 THR B CA  1 
ATOM   4875  C C   . THR B 1 172 ? 156.577 33.255  307.530 1.00 84.20  ?  166 THR B C   1 
ATOM   4876  O O   . THR B 1 172 ? 156.594 34.006  306.548 1.00 82.11  ?  166 THR B O   1 
ATOM   4877  C CB  . THR B 1 172 ? 159.066 33.034  307.559 1.00 80.12  ?  166 THR B CB  1 
ATOM   4878  O OG1 . THR B 1 172 ? 159.103 34.106  306.609 1.00 79.04  ?  166 THR B OG1 1 
ATOM   4879  C CG2 . THR B 1 172 ? 159.075 31.711  306.816 1.00 71.64  ?  166 THR B CG2 1 
ATOM   4880  N N   . GLY B 1 173 ? 155.513 32.513  307.846 1.00 81.92  ?  167 GLY B N   1 
ATOM   4881  C CA  . GLY B 1 173 ? 154.290 32.513  307.084 1.00 84.85  ?  167 GLY B CA  1 
ATOM   4882  C C   . GLY B 1 173 ? 154.186 31.388  306.074 1.00 88.77  ?  167 GLY B C   1 
ATOM   4883  O O   . GLY B 1 173 ? 153.071 30.977  305.731 1.00 91.59  ?  167 GLY B O   1 
ATOM   4884  N N   . GLU B 1 174 ? 155.318 30.882  305.589 1.00 80.06  ?  168 GLU B N   1 
ATOM   4885  C CA  . GLU B 1 174 ? 155.291 29.814  304.607 1.00 78.40  ?  168 GLU B CA  1 
ATOM   4886  C C   . GLU B 1 174 ? 154.782 28.517  305.235 1.00 74.78  ?  168 GLU B C   1 
ATOM   4887  O O   . GLU B 1 174 ? 155.003 28.260  306.421 1.00 66.10  ?  168 GLU B O   1 
ATOM   4888  C CB  . GLU B 1 174 ? 156.679 29.586  304.014 1.00 75.49  ?  168 GLU B CB  1 
ATOM   4889  C CG  . GLU B 1 174 ? 156.978 30.422  302.779 1.00 82.09  ?  168 GLU B CG  1 
ATOM   4890  C CD  . GLU B 1 174 ? 157.469 31.816  303.113 1.00 93.34  ?  168 GLU B CD  1 
ATOM   4891  O OE1 . GLU B 1 174 ? 158.594 31.939  303.643 1.00 84.76  ?  168 GLU B OE1 1 
ATOM   4892  O OE2 . GLU B 1 174 ? 156.730 32.787  302.850 1.00 95.87  -1 168 GLU B OE2 1 
ATOM   4893  N N   . PRO B 1 175 ? 154.081 27.692  304.463 1.00 65.44  ?  169 PRO B N   1 
ATOM   4894  C CA  . PRO B 1 175 ? 153.673 26.375  304.954 1.00 59.38  ?  169 PRO B CA  1 
ATOM   4895  C C   . PRO B 1 175 ? 154.755 25.330  304.738 1.00 63.81  ?  169 PRO B C   1 
ATOM   4896  O O   . PRO B 1 175 ? 155.534 25.380  303.785 1.00 67.44  ?  169 PRO B O   1 
ATOM   4897  C CB  . PRO B 1 175 ? 152.435 26.066  304.100 1.00 56.96  ?  169 PRO B CB  1 
ATOM   4898  C CG  . PRO B 1 175 ? 152.727 26.745  302.803 1.00 61.81  ?  169 PRO B CG  1 
ATOM   4899  C CD  . PRO B 1 175 ? 153.504 27.995  303.141 1.00 63.14  ?  169 PRO B CD  1 
ATOM   4900  N N   . CYS B 1 176 ? 154.791 24.362  305.655 1.00 56.30  ?  170 CYS B N   1 
ATOM   4901  C CA  . CYS B 1 176 ? 155.741 23.253  305.570 1.00 58.31  ?  170 CYS B CA  1 
ATOM   4902  C C   . CYS B 1 176 ? 155.205 22.166  304.635 1.00 52.88  ?  170 CYS B C   1 
ATOM   4903  O O   . CYS B 1 176 ? 155.040 21.002  305.001 1.00 47.82  ?  170 CYS B O   1 
ATOM   4904  C CB  . CYS B 1 176 ? 156.034 22.701  306.959 1.00 61.61  ?  170 CYS B CB  1 
ATOM   4905  S SG  . CYS B 1 176 ? 156.925 23.845  308.035 1.00 63.61  ?  170 CYS B SG  1 
ATOM   4906  N N   . CYS B 1 177 ? 154.934 22.577  303.397 1.00 47.09  ?  171 CYS B N   1 
ATOM   4907  C CA  . CYS B 1 177 ? 154.370 21.676  302.395 1.00 51.37  ?  171 CYS B CA  1 
ATOM   4908  C C   . CYS B 1 177 ? 154.552 22.312  301.024 1.00 50.71  ?  171 CYS B C   1 
ATOM   4909  O O   . CYS B 1 177 ? 153.880 23.297  300.704 1.00 60.40  ?  171 CYS B O   1 
ATOM   4910  C CB  . CYS B 1 177 ? 152.898 21.400  302.679 1.00 54.93  ?  171 CYS B CB  1 
ATOM   4911  S SG  . CYS B 1 177 ? 152.050 20.506  301.357 1.00 48.71  ?  171 CYS B SG  1 
ATOM   4912  N N   . ASP B 1 178 ? 155.453 21.750  300.223 1.00 43.64  ?  172 ASP B N   1 
ATOM   4913  C CA  . ASP B 1 178 ? 155.659 22.183  298.851 1.00 43.16  ?  172 ASP B CA  1 
ATOM   4914  C C   . ASP B 1 178 ? 155.841 20.942  297.988 1.00 44.30  ?  172 ASP B C   1 
ATOM   4915  O O   . ASP B 1 178 ? 155.897 19.816  298.490 1.00 42.47  ?  172 ASP B O   1 
ATOM   4916  C CB  . ASP B 1 178 ? 156.863 23.129  298.734 1.00 48.95  ?  172 ASP B CB  1 
ATOM   4917  C CG  . ASP B 1 178 ? 156.851 23.938  297.449 1.00 50.95  ?  172 ASP B CG  1 
ATOM   4918  O OD1 . ASP B 1 178 ? 155.909 23.769  296.646 1.00 46.40  ?  172 ASP B OD1 1 
ATOM   4919  O OD2 . ASP B 1 178 ? 157.783 24.743  297.243 1.00 51.72  -1 172 ASP B OD2 1 
ATOM   4920  N N   . TRP B 1 179 ? 155.924 21.147  296.678 1.00 38.47  ?  173 TRP B N   1 
ATOM   4921  C CA  . TRP B 1 179 ? 156.117 20.024  295.772 1.00 37.08  ?  173 TRP B CA  1 
ATOM   4922  C C   . TRP B 1 179 ? 157.533 19.478  295.909 1.00 46.70  ?  173 TRP B C   1 
ATOM   4923  O O   . TRP B 1 179 ? 158.512 20.223  295.801 1.00 49.05  ?  173 TRP B O   1 
ATOM   4924  C CB  . TRP B 1 179 ? 155.843 20.442  294.330 1.00 37.61  ?  173 TRP B CB  1 
ATOM   4925  C CG  . TRP B 1 179 ? 155.822 19.282  293.389 1.00 41.93  ?  173 TRP B CG  1 
ATOM   4926  C CD1 . TRP B 1 179 ? 156.716 19.013  292.395 1.00 43.81  ?  173 TRP B CD1 1 
ATOM   4927  C CD2 . TRP B 1 179 ? 154.867 18.216  293.370 1.00 39.79  ?  173 TRP B CD2 1 
ATOM   4928  N NE1 . TRP B 1 179 ? 156.370 17.850  291.750 1.00 42.31  ?  173 TRP B NE1 1 
ATOM   4929  C CE2 . TRP B 1 179 ? 155.238 17.341  292.331 1.00 40.22  ?  173 TRP B CE2 1 
ATOM   4930  C CE3 . TRP B 1 179 ? 153.730 17.918  294.129 1.00 36.73  ?  173 TRP B CE3 1 
ATOM   4931  C CZ2 . TRP B 1 179 ? 154.516 16.188  292.032 1.00 37.94  ?  173 TRP B CZ2 1 
ATOM   4932  C CZ3 . TRP B 1 179 ? 153.014 16.775  293.830 1.00 40.54  ?  173 TRP B CZ3 1 
ATOM   4933  C CH2 . TRP B 1 179 ? 153.408 15.925  292.790 1.00 41.31  ?  173 TRP B CH2 1 
ATOM   4934  N N   . VAL B 1 180 ? 157.639 18.173  296.153 1.00 42.91  ?  174 VAL B N   1 
ATOM   4935  C CA  . VAL B 1 180 ? 158.930 17.519  296.340 1.00 33.33  ?  174 VAL B CA  1 
ATOM   4936  C C   . VAL B 1 180 ? 159.509 17.126  294.989 1.00 35.66  ?  174 VAL B C   1 
ATOM   4937  O O   . VAL B 1 180 ? 160.575 17.608  294.591 1.00 43.68  ?  174 VAL B O   1 
ATOM   4938  C CB  . VAL B 1 180 ? 158.803 16.289  297.257 1.00 30.93  ?  174 VAL B CB  1 
ATOM   4939  C CG1 . VAL B 1 180 ? 160.101 15.505  297.269 1.00 37.24  ?  174 VAL B CG1 1 
ATOM   4940  C CG2 . VAL B 1 180 ? 158.416 16.713  298.663 1.00 32.00  ?  174 VAL B CG2 1 
ATOM   4941  N N   . GLY B 1 181 ? 158.816 16.245  294.280 1.00 37.21  ?  175 GLY B N   1 
ATOM   4942  C CA  . GLY B 1 181 ? 159.310 15.772  293.003 1.00 39.49  ?  175 GLY B CA  1 
ATOM   4943  C C   . GLY B 1 181 ? 158.311 14.839  292.360 1.00 39.92  ?  175 GLY B C   1 
ATOM   4944  O O   . GLY B 1 181 ? 157.161 14.734  292.791 1.00 47.66  ?  175 GLY B O   1 
ATOM   4945  N N   . ASP B 1 182 ? 158.770 14.150  291.323 1.00 36.72  ?  176 ASP B N   1 
ATOM   4946  C CA  . ASP B 1 182 ? 157.917 13.281  290.529 1.00 39.12  ?  176 ASP B CA  1 
ATOM   4947  C C   . ASP B 1 182 ? 158.048 11.829  290.974 1.00 38.54  ?  176 ASP B C   1 
ATOM   4948  O O   . ASP B 1 182 ? 159.079 11.411  291.506 1.00 38.54  ?  176 ASP B O   1 
ATOM   4949  C CB  . ASP B 1 182 ? 158.247 13.398  289.037 1.00 44.42  ?  176 ASP B CB  1 
ATOM   4950  C CG  . ASP B 1 182 ? 159.587 14.070  288.780 1.00 53.70  ?  176 ASP B CG  1 
ATOM   4951  O OD1 . ASP B 1 182 ? 160.191 14.607  289.732 1.00 47.96  ?  176 ASP B OD1 1 
ATOM   4952  O OD2 . ASP B 1 182 ? 160.037 14.064  287.614 1.00 56.25  -1 176 ASP B OD2 1 
ATOM   4953  N N   . GLU B 1 183 ? 156.970 11.070  290.757 1.00 37.85  ?  177 GLU B N   1 
ATOM   4954  C CA  . GLU B 1 183 ? 156.945 9.622   290.971 1.00 34.32  ?  177 GLU B CA  1 
ATOM   4955  C C   . GLU B 1 183 ? 157.291 9.252   292.413 1.00 33.31  ?  177 GLU B C   1 
ATOM   4956  O O   . GLU B 1 183 ? 158.143 8.401   292.676 1.00 35.27  ?  177 GLU B O   1 
ATOM   4957  C CB  . GLU B 1 183 ? 157.872 8.911   289.983 1.00 33.56  ?  177 GLU B CB  1 
ATOM   4958  C CG  . GLU B 1 183 ? 157.414 9.010   288.539 1.00 31.13  ?  177 GLU B CG  1 
ATOM   4959  C CD  . GLU B 1 183 ? 158.421 8.436   287.569 1.00 40.53  ?  177 GLU B CD  1 
ATOM   4960  O OE1 . GLU B 1 183 ? 159.608 8.324   287.942 1.00 45.82  ?  177 GLU B OE1 1 
ATOM   4961  O OE2 . GLU B 1 183 ? 158.026 8.094   286.434 1.00 52.58  -1 177 GLU B OE2 1 
ATOM   4962  N N   . GLY B 1 184 ? 156.611 9.898   293.353 1.00 29.18  ?  178 GLY B N   1 
ATOM   4963  C CA  . GLY B 1 184 ? 156.766 9.551   294.755 1.00 44.76  ?  178 GLY B CA  1 
ATOM   4964  C C   . GLY B 1 184 ? 158.123 9.862   295.348 1.00 44.37  ?  178 GLY B C   1 
ATOM   4965  O O   . GLY B 1 184 ? 158.643 9.070   296.145 1.00 36.12  ?  178 GLY B O   1 
ATOM   4966  N N   . ALA B 1 185 ? 158.716 10.996  294.976 1.00 43.16  ?  179 ALA B N   1 
ATOM   4967  C CA  . ALA B 1 185 ? 159.949 11.424  295.621 1.00 34.03  ?  179 ALA B CA  1 
ATOM   4968  C C   . ALA B 1 185 ? 159.721 11.835  297.069 1.00 36.25  ?  179 ALA B C   1 
ATOM   4969  O O   . ALA B 1 185 ? 160.674 11.841  297.855 1.00 32.71  ?  179 ALA B O   1 
ATOM   4970  C CB  . ALA B 1 185 ? 160.578 12.578  294.842 1.00 30.58  ?  179 ALA B CB  1 
ATOM   4971  N N   . GLY B 1 186 ? 158.483 12.173  297.435 1.00 32.80  ?  180 GLY B N   1 
ATOM   4972  C CA  . GLY B 1 186 ? 158.206 12.559  298.808 1.00 30.30  ?  180 GLY B CA  1 
ATOM   4973  C C   . GLY B 1 186 ? 158.314 11.397  299.776 1.00 35.41  ?  180 GLY B C   1 
ATOM   4974  O O   . GLY B 1 186 ? 158.814 11.554  300.894 1.00 39.47  ?  180 GLY B O   1 
ATOM   4975  N N   . HIS B 1 187 ? 157.842 10.216  299.366 1.00 31.68  ?  181 HIS B N   1 
ATOM   4976  C CA  . HIS B 1 187 ? 158.011 9.029   300.199 1.00 29.27  ?  181 HIS B CA  1 
ATOM   4977  C C   . HIS B 1 187 ? 159.485 8.688   300.369 1.00 34.61  ?  181 HIS B C   1 
ATOM   4978  O O   . HIS B 1 187 ? 159.909 8.246   301.443 1.00 37.55  ?  181 HIS B O   1 
ATOM   4979  C CB  . HIS B 1 187 ? 157.247 7.850   299.599 1.00 33.93  ?  181 HIS B CB  1 
ATOM   4980  C CG  . HIS B 1 187 ? 155.773 7.891   299.857 1.00 36.21  ?  181 HIS B CG  1 
ATOM   4981  N ND1 . HIS B 1 187 ? 154.846 7.382   298.973 1.00 31.62  ?  181 HIS B ND1 1 
ATOM   4982  C CD2 . HIS B 1 187 ? 155.066 8.376   300.906 1.00 32.42  ?  181 HIS B CD2 1 
ATOM   4983  C CE1 . HIS B 1 187 ? 153.632 7.556   299.464 1.00 34.03  ?  181 HIS B CE1 1 
ATOM   4984  N NE2 . HIS B 1 187 ? 153.737 8.156   300.635 1.00 31.15  ?  181 HIS B NE2 1 
ATOM   4985  N N   . PHE B 1 188 ? 160.282 8.889   299.317 1.00 35.72  ?  182 PHE B N   1 
ATOM   4986  C CA  . PHE B 1 188 ? 161.727 8.743   299.453 1.00 33.23  ?  182 PHE B CA  1 
ATOM   4987  C C   . PHE B 1 188 ? 162.289 9.799   300.397 1.00 34.35  ?  182 PHE B C   1 
ATOM   4988  O O   . PHE B 1 188 ? 163.190 9.514   301.196 1.00 39.81  ?  182 PHE B O   1 
ATOM   4989  C CB  . PHE B 1 188 ? 162.395 8.832   298.080 1.00 30.41  ?  182 PHE B CB  1 
ATOM   4990  C CG  . PHE B 1 188 ? 163.855 8.476   298.092 1.00 28.99  ?  182 PHE B CG  1 
ATOM   4991  C CD1 . PHE B 1 188 ? 164.817 9.445   298.321 1.00 25.07  ?  182 PHE B CD1 1 
ATOM   4992  C CD2 . PHE B 1 188 ? 164.263 7.171   297.875 1.00 32.59  ?  182 PHE B CD2 1 
ATOM   4993  C CE1 . PHE B 1 188 ? 166.158 9.118   298.336 1.00 33.04  ?  182 PHE B CE1 1 
ATOM   4994  C CE2 . PHE B 1 188 ? 165.603 6.838   297.886 1.00 34.94  ?  182 PHE B CE2 1 
ATOM   4995  C CZ  . PHE B 1 188 ? 166.552 7.812   298.120 1.00 34.49  ?  182 PHE B CZ  1 
ATOM   4996  N N   . VAL B 1 189 ? 161.768 11.026  300.319 1.00 29.65  ?  183 VAL B N   1 
ATOM   4997  C CA  . VAL B 1 189 ? 162.175 12.073  301.252 1.00 30.36  ?  183 VAL B CA  1 
ATOM   4998  C C   . VAL B 1 189 ? 161.754 11.712  302.670 1.00 34.38  ?  183 VAL B C   1 
ATOM   4999  O O   . VAL B 1 189 ? 162.490 11.955  303.635 1.00 38.69  ?  183 VAL B O   1 
ATOM   5000  C CB  . VAL B 1 189 ? 161.598 13.431  300.808 1.00 31.18  ?  183 VAL B CB  1 
ATOM   5001  C CG1 . VAL B 1 189 ? 161.678 14.449  301.934 1.00 32.51  ?  183 VAL B CG1 1 
ATOM   5002  C CG2 . VAL B 1 189 ? 162.344 13.937  299.590 1.00 34.51  ?  183 VAL B CG2 1 
ATOM   5003  N N   . LYS B 1 190 ? 160.568 11.116  302.819 1.00 30.84  ?  184 LYS B N   1 
ATOM   5004  C CA  . LYS B 1 190 ? 160.130 10.660  304.134 1.00 35.27  ?  184 LYS B CA  1 
ATOM   5005  C C   . LYS B 1 190 ? 161.065 9.597   304.696 1.00 36.09  ?  184 LYS B C   1 
ATOM   5006  O O   . LYS B 1 190 ? 161.289 9.546   305.911 1.00 34.12  ?  184 LYS B O   1 
ATOM   5007  C CB  . LYS B 1 190 ? 158.700 10.123  304.053 1.00 39.55  ?  184 LYS B CB  1 
ATOM   5008  C CG  . LYS B 1 190 ? 158.122 9.686   305.389 1.00 37.26  ?  184 LYS B CG  1 
ATOM   5009  C CD  . LYS B 1 190 ? 157.855 10.877  306.293 1.00 38.95  ?  184 LYS B CD  1 
ATOM   5010  C CE  . LYS B 1 190 ? 157.637 10.434  307.729 1.00 43.41  ?  184 LYS B CE  1 
ATOM   5011  N NZ  . LYS B 1 190 ? 156.604 9.369   307.834 1.00 46.36  1  184 LYS B NZ  1 
ATOM   5012  N N   . MET B 1 191 ? 161.625 8.746   303.832 1.00 34.12  ?  185 MET B N   1 
ATOM   5013  C CA  . MET B 1 191 ? 162.570 7.734   304.295 1.00 34.89  ?  185 MET B CA  1 
ATOM   5014  C C   . MET B 1 191 ? 163.872 8.372   304.764 1.00 38.59  ?  185 MET B C   1 
ATOM   5015  O O   . MET B 1 191 ? 164.344 8.098   305.873 1.00 39.38  ?  185 MET B O   1 
ATOM   5016  C CB  . MET B 1 191 ? 162.843 6.720   303.186 1.00 35.83  ?  185 MET B CB  1 
ATOM   5017  C CG  . MET B 1 191 ? 163.886 5.681   303.561 1.00 31.98  ?  185 MET B CG  1 
ATOM   5018  S SD  . MET B 1 191 ? 164.704 4.970   302.124 1.00 42.23  ?  185 MET B SD  1 
ATOM   5019  C CE  . MET B 1 191 ? 165.456 6.430   301.412 1.00 28.84  ?  185 MET B CE  1 
ATOM   5020  N N   . VAL B 1 192 ? 164.474 9.219   303.922 1.00 33.74  ?  186 VAL B N   1 
ATOM   5021  C CA  . VAL B 1 192 ? 165.698 9.916   304.307 1.00 37.38  ?  186 VAL B CA  1 
ATOM   5022  C C   . VAL B 1 192 ? 165.468 10.746  305.561 1.00 39.97  ?  186 VAL B C   1 
ATOM   5023  O O   . VAL B 1 192 ? 166.368 10.886  306.399 1.00 41.29  ?  186 VAL B O   1 
ATOM   5024  C CB  . VAL B 1 192 ? 166.207 10.783  303.138 1.00 40.33  ?  186 VAL B CB  1 
ATOM   5025  C CG1 . VAL B 1 192 ? 167.510 11.477  303.509 1.00 33.97  ?  186 VAL B CG1 1 
ATOM   5026  C CG2 . VAL B 1 192 ? 166.389 9.935   301.891 1.00 33.91  ?  186 VAL B CG2 1 
ATOM   5027  N N   . HIS B 1 193 ? 164.263 11.299  305.716 1.00 42.67  ?  187 HIS B N   1 
ATOM   5028  C CA  . HIS B 1 193 ? 163.919 12.016  306.940 1.00 42.63  ?  187 HIS B CA  1 
ATOM   5029  C C   . HIS B 1 193 ? 164.030 11.112  308.162 1.00 40.59  ?  187 HIS B C   1 
ATOM   5030  O O   . HIS B 1 193 ? 164.474 11.550  309.230 1.00 36.15  ?  187 HIS B O   1 
ATOM   5031  C CB  . HIS B 1 193 ? 162.508 12.594  306.820 1.00 42.79  ?  187 HIS B CB  1 
ATOM   5032  C CG  . HIS B 1 193 ? 161.792 12.724  308.128 1.00 44.11  ?  187 HIS B CG  1 
ATOM   5033  N ND1 . HIS B 1 193 ? 161.029 11.708  308.663 1.00 39.41  ?  187 HIS B ND1 1 
ATOM   5034  C CD2 . HIS B 1 193 ? 161.716 13.753  309.005 1.00 48.74  ?  187 HIS B CD2 1 
ATOM   5035  C CE1 . HIS B 1 193 ? 160.518 12.103  309.815 1.00 44.09  ?  187 HIS B CE1 1 
ATOM   5036  N NE2 . HIS B 1 193 ? 160.919 13.341  310.046 1.00 52.58  ?  187 HIS B NE2 1 
ATOM   5037  N N   . ASN B 1 194 ? 163.637 9.843   308.023 1.00 40.93  ?  188 ASN B N   1 
ATOM   5038  C CA  . ASN B 1 194 ? 163.696 8.925   309.156 1.00 43.42  ?  188 ASN B CA  1 
ATOM   5039  C C   . ASN B 1 194 ? 165.136 8.598   309.532 1.00 48.10  ?  188 ASN B C   1 
ATOM   5040  O O   . ASN B 1 194 ? 165.456 8.456   310.718 1.00 53.29  ?  188 ASN B O   1 
ATOM   5041  C CB  . ASN B 1 194 ? 162.922 7.646   308.838 1.00 44.28  ?  188 ASN B CB  1 
ATOM   5042  C CG  . ASN B 1 194 ? 161.459 7.910   308.547 1.00 49.13  ?  188 ASN B CG  1 
ATOM   5043  O OD1 . ASN B 1 194 ? 160.933 8.976   308.868 1.00 48.00  ?  188 ASN B OD1 1 
ATOM   5044  N ND2 . ASN B 1 194 ? 160.790 6.936   307.940 1.00 44.85  ?  188 ASN B ND2 1 
ATOM   5045  N N   . GLY B 1 195 ? 166.019 8.475   308.539 1.00 47.43  ?  189 GLY B N   1 
ATOM   5046  C CA  . GLY B 1 195 ? 167.409 8.176   308.837 1.00 40.76  ?  189 GLY B CA  1 
ATOM   5047  C C   . GLY B 1 195 ? 168.135 9.344   309.475 1.00 44.91  ?  189 GLY B C   1 
ATOM   5048  O O   . GLY B 1 195 ? 168.956 9.157   310.378 1.00 44.65  ?  189 GLY B O   1 
ATOM   5049  N N   . ILE B 1 196 ? 167.844 10.564  309.017 1.00 46.89  ?  190 ILE B N   1 
ATOM   5050  C CA  . ILE B 1 196 ? 168.455 11.750  309.608 1.00 41.83  ?  190 ILE B CA  1 
ATOM   5051  C C   . ILE B 1 196 ? 168.039 11.899  311.066 1.00 43.15  ?  190 ILE B C   1 
ATOM   5052  O O   . ILE B 1 196 ? 168.805 12.413  311.891 1.00 47.15  ?  190 ILE B O   1 
ATOM   5053  C CB  . ILE B 1 196 ? 168.093 12.995  308.773 1.00 34.27  ?  190 ILE B CB  1 
ATOM   5054  C CG1 . ILE B 1 196 ? 168.729 12.899  307.385 1.00 34.59  ?  190 ILE B CG1 1 
ATOM   5055  C CG2 . ILE B 1 196 ? 168.534 14.269  309.469 1.00 38.68  ?  190 ILE B CG2 1 
ATOM   5056  C CD1 . ILE B 1 196 ? 168.489 14.110  306.515 1.00 39.00  ?  190 ILE B CD1 1 
ATOM   5057  N N   . GLU B 1 197 ? 166.836 11.434  311.412 1.00 44.16  ?  191 GLU B N   1 
ATOM   5058  C CA  . GLU B 1 197 ? 166.401 11.469  312.805 1.00 48.67  ?  191 GLU B CA  1 
ATOM   5059  C C   . GLU B 1 197 ? 167.301 10.612  313.686 1.00 48.66  ?  191 GLU B C   1 
ATOM   5060  O O   . GLU B 1 197 ? 167.641 11.004  314.809 1.00 50.35  ?  191 GLU B O   1 
ATOM   5061  C CB  . GLU B 1 197 ? 164.948 11.007  312.913 1.00 49.49  ?  191 GLU B CB  1 
ATOM   5062  C CG  . GLU B 1 197 ? 164.416 10.965  314.335 1.00 50.43  ?  191 GLU B CG  1 
ATOM   5063  C CD  . GLU B 1 197 ? 162.985 10.474  314.406 1.00 60.34  ?  191 GLU B CD  1 
ATOM   5064  O OE1 . GLU B 1 197 ? 162.287 10.525  313.373 1.00 66.65  ?  191 GLU B OE1 1 
ATOM   5065  O OE2 . GLU B 1 197 ? 162.561 10.031  315.494 1.00 66.07  -1 191 GLU B OE2 1 
ATOM   5066  N N   . TYR B 1 198 ? 167.700 9.437   313.191 1.00 43.76  ?  192 TYR B N   1 
ATOM   5067  C CA  . TYR B 1 198 ? 168.593 8.574   313.957 1.00 42.76  ?  192 TYR B CA  1 
ATOM   5068  C C   . TYR B 1 198 ? 169.936 9.242   314.214 1.00 43.73  ?  192 TYR B C   1 
ATOM   5069  O O   . TYR B 1 198 ? 170.536 9.041   315.276 1.00 44.16  ?  192 TYR B O   1 
ATOM   5070  C CB  . TYR B 1 198 ? 168.795 7.248   313.224 1.00 40.73  ?  192 TYR B CB  1 
ATOM   5071  C CG  . TYR B 1 198 ? 167.653 6.271   313.387 1.00 42.00  ?  192 TYR B CG  1 
ATOM   5072  C CD1 . TYR B 1 198 ? 167.887 4.962   313.786 1.00 37.92  ?  192 TYR B CD1 1 
ATOM   5073  C CD2 . TYR B 1 198 ? 166.342 6.661   313.154 1.00 39.17  ?  192 TYR B CD2 1 
ATOM   5074  C CE1 . TYR B 1 198 ? 166.847 4.068   313.937 1.00 40.26  ?  192 TYR B CE1 1 
ATOM   5075  C CE2 . TYR B 1 198 ? 165.298 5.777   313.306 1.00 42.39  ?  192 TYR B CE2 1 
ATOM   5076  C CZ  . TYR B 1 198 ? 165.555 4.482   313.697 1.00 42.41  ?  192 TYR B CZ  1 
ATOM   5077  O OH  . TYR B 1 198 ? 164.512 3.600   313.848 1.00 51.55  ?  192 TYR B OH  1 
ATOM   5078  N N   . GLY B 1 199 ? 170.420 10.041  313.262 1.00 44.48  ?  193 GLY B N   1 
ATOM   5079  C CA  . GLY B 1 199 ? 171.701 10.700  313.452 1.00 47.90  ?  193 GLY B CA  1 
ATOM   5080  C C   . GLY B 1 199 ? 171.657 11.754  314.541 1.00 49.47  ?  193 GLY B C   1 
ATOM   5081  O O   . GLY B 1 199 ? 172.503 11.771  315.438 1.00 44.88  ?  193 GLY B O   1 
ATOM   5082  N N   . ASP B 1 200 ? 170.666 12.648  314.477 1.00 46.54  ?  194 ASP B N   1 
ATOM   5083  C CA  . ASP B 1 200 ? 170.573 13.726  315.457 1.00 39.79  ?  194 ASP B CA  1 
ATOM   5084  C C   . ASP B 1 200 ? 170.420 13.182  316.872 1.00 42.00  ?  194 ASP B C   1 
ATOM   5085  O O   . ASP B 1 200 ? 171.053 13.683  317.808 1.00 48.95  ?  194 ASP B O   1 
ATOM   5086  C CB  . ASP B 1 200 ? 169.407 14.651  315.111 1.00 46.70  ?  194 ASP B CB  1 
ATOM   5087  C CG  . ASP B 1 200 ? 169.559 15.299  313.750 1.00 53.62  ?  194 ASP B CG  1 
ATOM   5088  O OD1 . ASP B 1 200 ? 170.577 15.034  313.074 1.00 54.89  ?  194 ASP B OD1 1 
ATOM   5089  O OD2 . ASP B 1 200 ? 168.662 16.073  313.355 1.00 48.26  -1 194 ASP B OD2 1 
ATOM   5090  N N   . MET B 1 201 ? 169.590 12.151  317.046 1.00 40.03  ?  195 MET B N   1 
ATOM   5091  C CA  . MET B 1 201 ? 169.387 11.586  318.377 1.00 46.95  ?  195 MET B CA  1 
ATOM   5092  C C   . MET B 1 201 ? 170.655 10.918  318.897 1.00 49.95  ?  195 MET B C   1 
ATOM   5093  O O   . MET B 1 201 ? 171.018 11.091  320.066 1.00 46.01  ?  195 MET B O   1 
ATOM   5094  C CB  . MET B 1 201 ? 168.225 10.593  318.350 1.00 44.88  ?  195 MET B CB  1 
ATOM   5095  C CG  . MET B 1 201 ? 166.881 11.226  318.030 1.00 43.09  ?  195 MET B CG  1 
ATOM   5096  S SD  . MET B 1 201 ? 165.583 10.014  317.718 1.00 56.08  ?  195 MET B SD  1 
ATOM   5097  C CE  . MET B 1 201 ? 165.529 9.150   319.284 1.00 40.91  ?  195 MET B CE  1 
ATOM   5098  N N   . GLN B 1 202 ? 171.342 10.154  318.045 1.00 52.04  ?  196 GLN B N   1 
ATOM   5099  C CA  . GLN B 1 202 ? 172.578 9.506   318.473 1.00 52.54  ?  196 GLN B CA  1 
ATOM   5100  C C   . GLN B 1 202 ? 173.694 10.524  318.678 1.00 56.24  ?  196 GLN B C   1 
ATOM   5101  O O   . GLN B 1 202 ? 174.524 10.368  319.582 1.00 57.00  ?  196 GLN B O   1 
ATOM   5102  C CB  . GLN B 1 202 ? 172.993 8.443   317.455 1.00 51.02  ?  196 GLN B CB  1 
ATOM   5103  C CG  . GLN B 1 202 ? 174.338 7.789   317.744 1.00 47.22  ?  196 GLN B CG  1 
ATOM   5104  C CD  . GLN B 1 202 ? 174.376 7.088   319.088 1.00 47.84  ?  196 GLN B CD  1 
ATOM   5105  O OE1 . GLN B 1 202 ? 173.363 6.579   319.567 1.00 60.15  ?  196 GLN B OE1 1 
ATOM   5106  N NE2 . GLN B 1 202 ? 175.552 7.059   319.706 1.00 47.23  ?  196 GLN B NE2 1 
ATOM   5107  N N   . LEU B 1 203 ? 173.731 11.572  317.850 1.00 49.60  ?  197 LEU B N   1 
ATOM   5108  C CA  . LEU B 1 203 ? 174.723 12.627  318.033 1.00 47.91  ?  197 LEU B CA  1 
ATOM   5109  C C   . LEU B 1 203 ? 174.565 13.302  319.390 1.00 57.03  ?  197 LEU B C   1 
ATOM   5110  O O   . LEU B 1 203 ? 175.559 13.607  320.060 1.00 54.13  ?  197 LEU B O   1 
ATOM   5111  C CB  . LEU B 1 203 ? 174.612 13.655  316.907 1.00 41.99  ?  197 LEU B CB  1 
ATOM   5112  C CG  . LEU B 1 203 ? 175.258 13.322  315.562 1.00 50.42  ?  197 LEU B CG  1 
ATOM   5113  C CD1 . LEU B 1 203 ? 174.890 14.365  314.520 1.00 48.66  ?  197 LEU B CD1 1 
ATOM   5114  C CD2 . LEU B 1 203 ? 176.761 13.231  315.712 1.00 47.32  ?  197 LEU B CD2 1 
ATOM   5115  N N   . ILE B 1 204 ? 173.322 13.545  319.809 1.00 52.34  ?  198 ILE B N   1 
ATOM   5116  C CA  . ILE B 1 204 ? 173.079 14.141  321.119 1.00 50.14  ?  198 ILE B CA  1 
ATOM   5117  C C   . ILE B 1 204 ? 173.490 13.179  322.227 1.00 51.66  ?  198 ILE B C   1 
ATOM   5118  O O   . ILE B 1 204 ? 174.032 13.593  323.259 1.00 59.50  ?  198 ILE B O   1 
ATOM   5119  C CB  . ILE B 1 204 ? 171.603 14.559  321.244 1.00 49.60  ?  198 ILE B CB  1 
ATOM   5120  C CG1 . ILE B 1 204 ? 171.284 15.687  320.261 1.00 54.60  ?  198 ILE B CG1 1 
ATOM   5121  C CG2 . ILE B 1 204 ? 171.277 14.987  322.667 1.00 56.42  ?  198 ILE B CG2 1 
ATOM   5122  C CD1 . ILE B 1 204 ? 169.818 16.046  320.206 1.00 61.31  ?  198 ILE B CD1 1 
ATOM   5123  N N   . CYS B 1 205 ? 173.251 11.881  322.028 1.00 48.04  ?  199 CYS B N   1 
ATOM   5124  C CA  . CYS B 1 205 ? 173.619 10.895  323.039 1.00 54.25  ?  199 CYS B CA  1 
ATOM   5125  C C   . CYS B 1 205 ? 175.129 10.829  323.230 1.00 62.68  ?  199 CYS B C   1 
ATOM   5126  O O   . CYS B 1 205 ? 175.610 10.625  324.351 1.00 57.34  ?  199 CYS B O   1 
ATOM   5127  C CB  . CYS B 1 205 ? 173.064 9.526   322.658 1.00 51.42  ?  199 CYS B CB  1 
ATOM   5128  S SG  . CYS B 1 205 ? 171.278 9.390   322.839 1.00 69.85  ?  199 CYS B SG  1 
ATOM   5129  N N   . GLU B 1 206 ? 175.894 10.997  322.148 1.00 63.97  ?  200 GLU B N   1 
ATOM   5130  C CA  . GLU B 1 206 ? 177.348 10.999  322.271 1.00 55.48  ?  200 GLU B CA  1 
ATOM   5131  C C   . GLU B 1 206 ? 177.832 12.225  323.036 1.00 55.86  ?  200 GLU B C   1 
ATOM   5132  O O   . GLU B 1 206 ? 178.778 12.136  323.828 1.00 60.46  ?  200 GLU B O   1 
ATOM   5133  C CB  . GLU B 1 206 ? 177.990 10.934  320.885 1.00 54.55  ?  200 GLU B CB  1 
ATOM   5134  C CG  . GLU B 1 206 ? 177.670 9.661   320.116 1.00 52.69  ?  200 GLU B CG  1 
ATOM   5135  C CD  . GLU B 1 206 ? 178.206 9.681   318.697 1.00 52.13  ?  200 GLU B CD  1 
ATOM   5136  O OE1 . GLU B 1 206 ? 178.767 10.717  318.284 1.00 49.60  ?  200 GLU B OE1 1 
ATOM   5137  O OE2 . GLU B 1 206 ? 178.066 8.659   317.993 1.00 47.91  -1 200 GLU B OE2 1 
ATOM   5138  N N   . ALA B 1 207 ? 177.194 13.377  322.815 1.00 61.65  ?  201 ALA B N   1 
ATOM   5139  C CA  . ALA B 1 207 ? 177.546 14.574  323.573 1.00 60.08  ?  201 ALA B CA  1 
ATOM   5140  C C   . ALA B 1 207 ? 177.177 14.421  325.043 1.00 55.96  ?  201 ALA B C   1 
ATOM   5141  O O   . ALA B 1 207 ? 177.939 14.831  325.927 1.00 51.93  ?  201 ALA B O   1 
ATOM   5142  C CB  . ALA B 1 207 ? 176.859 15.798  322.969 1.00 55.97  ?  201 ALA B CB  1 
ATOM   5143  N N   . TYR B 1 208 ? 176.010 13.836  325.323 1.00 57.12  ?  202 TYR B N   1 
ATOM   5144  C CA  . TYR B 1 208 ? 175.628 13.560  326.704 1.00 57.80  ?  202 TYR B CA  1 
ATOM   5145  C C   . TYR B 1 208 ? 176.578 12.566  327.358 1.00 65.60  ?  202 TYR B C   1 
ATOM   5146  O O   . TYR B 1 208 ? 176.790 12.618  328.575 1.00 65.00  ?  202 TYR B O   1 
ATOM   5147  C CB  . TYR B 1 208 ? 174.188 13.045  326.750 1.00 56.80  ?  202 TYR B CB  1 
ATOM   5148  C CG  . TYR B 1 208 ? 173.818 12.334  328.033 1.00 60.82  ?  202 TYR B CG  1 
ATOM   5149  C CD1 . TYR B 1 208 ? 173.533 13.047  329.189 1.00 59.50  ?  202 TYR B CD1 1 
ATOM   5150  C CD2 . TYR B 1 208 ? 173.746 10.947  328.085 1.00 64.53  ?  202 TYR B CD2 1 
ATOM   5151  C CE1 . TYR B 1 208 ? 173.194 12.399  330.362 1.00 61.65  ?  202 TYR B CE1 1 
ATOM   5152  C CE2 . TYR B 1 208 ? 173.407 10.291  329.253 1.00 62.78  ?  202 TYR B CE2 1 
ATOM   5153  C CZ  . TYR B 1 208 ? 173.132 11.022  330.389 1.00 62.37  ?  202 TYR B CZ  1 
ATOM   5154  O OH  . TYR B 1 208 ? 172.794 10.376  331.555 1.00 59.23  ?  202 TYR B OH  1 
ATOM   5155  N N   . HIS B 1 209 ? 177.163 11.659  326.570 1.00 73.21  ?  203 HIS B N   1 
ATOM   5156  C CA  . HIS B 1 209 ? 178.110 10.697  327.124 1.00 67.25  ?  203 HIS B CA  1 
ATOM   5157  C C   . HIS B 1 209 ? 179.412 11.375  327.530 1.00 63.49  ?  203 HIS B C   1 
ATOM   5158  O O   . HIS B 1 209 ? 180.019 11.012  328.544 1.00 68.83  ?  203 HIS B O   1 
ATOM   5159  C CB  . HIS B 1 209 ? 178.386 9.589   326.110 1.00 59.51  ?  203 HIS B CB  1 
ATOM   5160  C CG  . HIS B 1 209 ? 178.789 8.287   326.730 1.00 61.49  ?  203 HIS B CG  1 
ATOM   5161  N ND1 . HIS B 1 209 ? 178.716 8.052   328.086 1.00 69.53  ?  203 HIS B ND1 1 
ATOM   5162  C CD2 . HIS B 1 209 ? 179.261 7.145   326.176 1.00 61.75  ?  203 HIS B CD2 1 
ATOM   5163  C CE1 . HIS B 1 209 ? 179.128 6.823   328.341 1.00 64.17  ?  203 HIS B CE1 1 
ATOM   5164  N NE2 . HIS B 1 209 ? 179.465 6.252   327.199 1.00 59.69  ?  203 HIS B NE2 1 
ATOM   5165  N N   . LEU B 1 210 ? 179.859 12.357  326.744 1.00 61.49  ?  204 LEU B N   1 
ATOM   5166  C CA  . LEU B 1 210 ? 181.095 13.060  327.070 1.00 70.13  ?  204 LEU B CA  1 
ATOM   5167  C C   . LEU B 1 210 ? 180.944 13.884  328.342 1.00 74.99  ?  204 LEU B C   1 
ATOM   5168  O O   . LEU B 1 210 ? 181.853 13.914  329.180 1.00 70.87  ?  204 LEU B O   1 
ATOM   5169  C CB  . LEU B 1 210 ? 181.519 13.946  325.899 1.00 60.66  ?  204 LEU B CB  1 
ATOM   5170  C CG  . LEU B 1 210 ? 182.058 13.241  324.653 1.00 57.77  ?  204 LEU B CG  1 
ATOM   5171  C CD1 . LEU B 1 210 ? 182.320 14.244  323.540 1.00 54.29  ?  204 LEU B CD1 1 
ATOM   5172  C CD2 . LEU B 1 210 ? 183.325 12.471  324.986 1.00 57.89  ?  204 LEU B CD2 1 
ATOM   5173  N N   . MET B 1 211 ? 179.803 14.557  328.510 1.00 71.57  ?  205 MET B N   1 
ATOM   5174  C CA  . MET B 1 211 ? 179.585 15.354  329.710 1.00 65.35  ?  205 MET B CA  1 
ATOM   5175  C C   . MET B 1 211 ? 179.433 14.496  330.958 1.00 69.13  ?  205 MET B C   1 
ATOM   5176  O O   . MET B 1 211 ? 179.684 14.985  332.065 1.00 80.25  ?  205 MET B O   1 
ATOM   5177  C CB  . MET B 1 211 ? 178.347 16.236  329.545 1.00 68.26  ?  205 MET B CB  1 
ATOM   5178  C CG  . MET B 1 211 ? 178.354 17.115  328.308 1.00 74.17  ?  205 MET B CG  1 
ATOM   5179  S SD  . MET B 1 211 ? 176.922 18.208  328.273 1.00 67.83  ?  205 MET B SD  1 
ATOM   5180  C CE  . MET B 1 211 ? 175.625 17.054  328.704 1.00 60.28  ?  205 MET B CE  1 
ATOM   5181  N N   . LYS B 1 212 ? 179.031 13.235  330.809 1.00 70.48  ?  206 LYS B N   1 
ATOM   5182  C CA  . LYS B 1 212 ? 178.777 12.375  331.957 1.00 73.95  ?  206 LYS B CA  1 
ATOM   5183  C C   . LYS B 1 212 ? 180.014 11.621  332.422 1.00 76.95  ?  206 LYS B C   1 
ATOM   5184  O O   . LYS B 1 212 ? 180.135 11.322  333.616 1.00 74.74  ?  206 LYS B O   1 
ATOM   5185  C CB  . LYS B 1 212 ? 177.667 11.372  331.628 1.00 69.40  ?  206 LYS B CB  1 
ATOM   5186  C CG  . LYS B 1 212 ? 177.017 10.739  332.849 1.00 77.93  ?  206 LYS B CG  1 
ATOM   5187  C CD  . LYS B 1 212 ? 176.067 9.618   332.459 1.00 72.43  ?  206 LYS B CD  1 
ATOM   5188  C CE  . LYS B 1 212 ? 176.749 8.261   332.539 1.00 75.32  ?  206 LYS B CE  1 
ATOM   5189  N NZ  . LYS B 1 212 ? 177.093 7.904   333.945 1.00 72.18  1  206 LYS B NZ  1 
ATOM   5190  N N   . ASP B 1 213 ? 180.940 11.308  331.512 1.00 79.14  ?  207 ASP B N   1 
ATOM   5191  C CA  . ASP B 1 213 ? 182.091 10.478  331.839 1.00 74.58  ?  207 ASP B CA  1 
ATOM   5192  C C   . ASP B 1 213 ? 183.426 11.202  331.765 1.00 78.48  ?  207 ASP B C   1 
ATOM   5193  O O   . ASP B 1 213 ? 184.384 10.754  332.403 1.00 82.76  ?  207 ASP B O   1 
ATOM   5194  C CB  . ASP B 1 213 ? 182.137 9.254   330.914 1.00 70.42  ?  207 ASP B CB  1 
ATOM   5195  C CG  . ASP B 1 213 ? 181.104 8.207   331.283 1.00 81.13  ?  207 ASP B CG  1 
ATOM   5196  O OD1 . ASP B 1 213 ? 181.311 7.493   332.287 1.00 87.78  ?  207 ASP B OD1 1 
ATOM   5197  O OD2 . ASP B 1 213 ? 180.075 8.112   330.583 1.00 79.18  -1 207 ASP B OD2 1 
ATOM   5198  N N   . VAL B 1 214 ? 183.521 12.293  331.014 1.00 76.26  ?  208 VAL B N   1 
ATOM   5199  C CA  . VAL B 1 214 ? 184.744 13.086  330.940 1.00 72.96  ?  208 VAL B CA  1 
ATOM   5200  C C   . VAL B 1 214 ? 184.696 14.271  331.895 1.00 76.78  ?  208 VAL B C   1 
ATOM   5201  O O   . VAL B 1 214 ? 185.658 14.537  332.615 1.00 74.28  ?  208 VAL B O   1 
ATOM   5202  C CB  . VAL B 1 214 ? 184.999 13.547  329.487 1.00 60.47  ?  208 VAL B CB  1 
ATOM   5203  C CG1 . VAL B 1 214 ? 186.275 14.370  329.406 1.00 59.17  ?  208 VAL B CG1 1 
ATOM   5204  C CG2 . VAL B 1 214 ? 185.071 12.348  328.558 1.00 67.92  ?  208 VAL B CG2 1 
ATOM   5205  N N   . LEU B 1 215 ? 183.578 14.992  331.918 1.00 74.94  ?  209 LEU B N   1 
ATOM   5206  C CA  . LEU B 1 215 ? 183.429 16.142  332.795 1.00 71.29  ?  209 LEU B CA  1 
ATOM   5207  C C   . LEU B 1 215 ? 182.778 15.792  334.128 1.00 74.02  ?  209 LEU B C   1 
ATOM   5208  O O   . LEU B 1 215 ? 182.737 16.647  335.020 1.00 76.37  ?  209 LEU B O   1 
ATOM   5209  C CB  . LEU B 1 215 ? 182.619 17.235  332.089 1.00 72.24  ?  209 LEU B CB  1 
ATOM   5210  C CG  . LEU B 1 215 ? 183.230 17.765  330.788 1.00 70.33  ?  209 LEU B CG  1 
ATOM   5211  C CD1 . LEU B 1 215 ? 182.340 18.827  330.163 1.00 75.03  ?  209 LEU B CD1 1 
ATOM   5212  C CD2 . LEU B 1 215 ? 184.629 18.312  331.032 1.00 64.39  ?  209 LEU B CD2 1 
ATOM   5213  N N   . GLY B 1 216 ? 182.279 14.566  334.278 1.00 68.25  ?  210 GLY B N   1 
ATOM   5214  C CA  . GLY B 1 216 ? 181.680 14.113  335.523 1.00 69.07  ?  210 GLY B CA  1 
ATOM   5215  C C   . GLY B 1 216 ? 180.584 15.003  336.066 1.00 77.66  ?  210 GLY B C   1 
ATOM   5216  O O   . GLY B 1 216 ? 180.489 15.180  337.285 1.00 74.73  ?  210 GLY B O   1 
ATOM   5217  N N   . MET B 1 217 ? 179.746 15.563  335.197 1.00 81.83  ?  211 MET B N   1 
ATOM   5218  C CA  . MET B 1 217 ? 178.722 16.501  335.628 1.00 79.08  ?  211 MET B CA  1 
ATOM   5219  C C   . MET B 1 217 ? 177.502 15.764  336.181 1.00 81.18  ?  211 MET B C   1 
ATOM   5220  O O   . MET B 1 217 ? 177.329 14.556  335.998 1.00 79.17  ?  211 MET B O   1 
ATOM   5221  C CB  . MET B 1 217 ? 178.311 17.409  334.471 1.00 69.63  ?  211 MET B CB  1 
ATOM   5222  C CG  . MET B 1 217 ? 179.484 17.959  333.688 1.00 70.69  ?  211 MET B CG  1 
ATOM   5223  S SD  . MET B 1 217 ? 179.119 19.505  332.842 1.00 80.53  ?  211 MET B SD  1 
ATOM   5224  C CE  . MET B 1 217 ? 177.684 19.046  331.879 1.00 77.58  ?  211 MET B CE  1 
ATOM   5225  N N   . ALA B 1 218 ? 176.648 16.517  336.869 1.00 88.83  ?  212 ALA B N   1 
ATOM   5226  C CA  . ALA B 1 218 ? 175.414 15.984  337.422 1.00 83.34  ?  212 ALA B CA  1 
ATOM   5227  C C   . ALA B 1 218 ? 174.282 16.096  336.403 1.00 82.38  ?  212 ALA B C   1 
ATOM   5228  O O   . ALA B 1 218 ? 174.424 16.701  335.338 1.00 79.64  ?  212 ALA B O   1 
ATOM   5229  C CB  . ALA B 1 218 ? 175.046 16.708  338.717 1.00 78.59  ?  212 ALA B CB  1 
ATOM   5230  N N   . GLN B 1 219 ? 173.138 15.502  336.748 1.00 85.36  ?  213 GLN B N   1 
ATOM   5231  C CA  . GLN B 1 219 ? 172.009 15.450  335.823 1.00 76.78  ?  213 GLN B CA  1 
ATOM   5232  C C   . GLN B 1 219 ? 171.494 16.847  335.494 1.00 78.01  ?  213 GLN B C   1 
ATOM   5233  O O   . GLN B 1 219 ? 171.482 17.261  334.329 1.00 76.92  ?  213 GLN B O   1 
ATOM   5234  C CB  . GLN B 1 219 ? 170.894 14.582  336.409 1.00 89.04  ?  213 GLN B CB  1 
ATOM   5235  C CG  . GLN B 1 219 ? 171.171 13.090  336.335 1.00 87.92  ?  213 GLN B CG  1 
ATOM   5236  C CD  . GLN B 1 219 ? 171.033 12.543  334.927 1.00 90.98  ?  213 GLN B CD  1 
ATOM   5237  O OE1 . GLN B 1 219 ? 170.231 13.037  334.134 1.00 88.91  ?  213 GLN B OE1 1 
ATOM   5238  N NE2 . GLN B 1 219 ? 171.819 11.521  334.608 1.00 86.81  ?  213 GLN B NE2 1 
ATOM   5239  N N   . ASP B 1 220 ? 171.062 17.593  336.515 1.00 79.84  ?  214 ASP B N   1 
ATOM   5240  C CA  . ASP B 1 220 ? 170.500 18.917  336.266 1.00 77.79  ?  214 ASP B CA  1 
ATOM   5241  C C   . ASP B 1 220 ? 171.549 19.886  335.736 1.00 73.50  ?  214 ASP B C   1 
ATOM   5242  O O   . ASP B 1 220 ? 171.204 20.848  335.038 1.00 67.02  ?  214 ASP B O   1 
ATOM   5243  C CB  . ASP B 1 220 ? 169.858 19.471  337.538 1.00 74.14  ?  214 ASP B CB  1 
ATOM   5244  C CG  . ASP B 1 220 ? 168.795 18.548  338.103 1.00 87.08  ?  214 ASP B CG  1 
ATOM   5245  O OD1 . ASP B 1 220 ? 168.816 18.292  339.325 1.00 88.40  ?  214 ASP B OD1 1 
ATOM   5246  O OD2 . ASP B 1 220 ? 167.950 18.064  337.320 1.00 92.91  -1 214 ASP B OD2 1 
ATOM   5247  N N   . GLU B 1 221 ? 172.825 19.657  336.053 1.00 81.10  ?  215 GLU B N   1 
ATOM   5248  C CA  . GLU B 1 221 ? 173.884 20.461  335.454 1.00 76.04  ?  215 GLU B CA  1 
ATOM   5249  C C   . GLU B 1 221 ? 174.002 20.180  333.961 1.00 76.34  ?  215 GLU B C   1 
ATOM   5250  O O   . GLU B 1 221 ? 174.270 21.093  333.171 1.00 73.32  ?  215 GLU B O   1 
ATOM   5251  C CB  . GLU B 1 221 ? 175.212 20.192  336.163 1.00 75.39  ?  215 GLU B CB  1 
ATOM   5252  C CG  . GLU B 1 221 ? 176.389 20.965  335.593 1.00 80.14  ?  215 GLU B CG  1 
ATOM   5253  C CD  . GLU B 1 221 ? 177.685 20.676  336.326 1.00 78.80  ?  215 GLU B CD  1 
ATOM   5254  O OE1 . GLU B 1 221 ? 178.634 21.476  336.193 1.00 66.78  ?  215 GLU B OE1 1 
ATOM   5255  O OE2 . GLU B 1 221 ? 177.752 19.651  337.036 1.00 80.38  -1 215 GLU B OE2 1 
ATOM   5256  N N   . MET B 1 222 ? 173.799 18.923  333.557 1.00 80.62  ?  216 MET B N   1 
ATOM   5257  C CA  . MET B 1 222 ? 173.800 18.591  332.136 1.00 80.93  ?  216 MET B CA  1 
ATOM   5258  C C   . MET B 1 222 ? 172.563 19.143  331.440 1.00 77.65  ?  216 MET B C   1 
ATOM   5259  O O   . MET B 1 222 ? 172.632 19.560  330.277 1.00 75.25  ?  216 MET B O   1 
ATOM   5260  C CB  . MET B 1 222 ? 173.890 17.075  331.949 1.00 74.45  ?  216 MET B CB  1 
ATOM   5261  C CG  . MET B 1 222 ? 175.246 16.484  332.299 1.00 73.52  ?  216 MET B CG  1 
ATOM   5262  S SD  . MET B 1 222 ? 175.357 14.707  332.017 1.00 77.29  ?  216 MET B SD  1 
ATOM   5263  C CE  . MET B 1 222 ? 174.254 14.086  333.284 1.00 74.71  ?  216 MET B CE  1 
ATOM   5264  N N   . ALA B 1 223 ? 171.422 19.152  332.133 1.00 76.27  ?  217 ALA B N   1 
ATOM   5265  C CA  . ALA B 1 223 ? 170.206 19.710  331.551 1.00 71.20  ?  217 ALA B CA  1 
ATOM   5266  C C   . ALA B 1 223 ? 170.346 21.207  331.310 1.00 73.46  ?  217 ALA B C   1 
ATOM   5267  O O   . ALA B 1 223 ? 169.839 21.731  330.311 1.00 76.91  ?  217 ALA B O   1 
ATOM   5268  C CB  . ALA B 1 223 ? 169.010 19.421  332.456 1.00 69.78  ?  217 ALA B CB  1 
ATOM   5269  N N   . GLN B 1 224 ? 171.031 21.912  332.213 1.00 75.69  ?  218 GLN B N   1 
ATOM   5270  C CA  . GLN B 1 224 ? 171.240 23.343  332.024 1.00 79.44  ?  218 GLN B CA  1 
ATOM   5271  C C   . GLN B 1 224 ? 172.188 23.617  330.865 1.00 75.95  ?  218 GLN B C   1 
ATOM   5272  O O   . GLN B 1 224 ? 172.047 24.635  330.178 1.00 73.83  ?  218 GLN B O   1 
ATOM   5273  C CB  . GLN B 1 224 ? 171.775 23.972  333.311 1.00 74.89  ?  218 GLN B CB  1 
ATOM   5274  C CG  . GLN B 1 224 ? 171.425 25.441  333.472 1.00 71.53  ?  218 GLN B CG  1 
ATOM   5275  C CD  . GLN B 1 224 ? 169.945 25.659  333.728 1.00 78.40  ?  218 GLN B CD  1 
ATOM   5276  O OE1 . GLN B 1 224 ? 169.285 24.835  334.363 1.00 78.36  ?  218 GLN B OE1 1 
ATOM   5277  N NE2 . GLN B 1 224 ? 169.414 26.769  333.228 1.00 77.09  ?  218 GLN B NE2 1 
ATOM   5278  N N   . ALA B 1 225 ? 173.155 22.726  330.635 1.00 77.22  ?  219 ALA B N   1 
ATOM   5279  C CA  . ALA B 1 225 ? 174.054 22.887  329.498 1.00 71.03  ?  219 ALA B CA  1 
ATOM   5280  C C   . ALA B 1 225 ? 173.303 22.750  328.180 1.00 67.15  ?  219 ALA B C   1 
ATOM   5281  O O   . ALA B 1 225 ? 173.565 23.497  327.230 1.00 62.28  ?  219 ALA B O   1 
ATOM   5282  C CB  . ALA B 1 225 ? 175.191 21.869  329.580 1.00 67.60  ?  219 ALA B CB  1 
ATOM   5283  N N   . PHE B 1 226 ? 172.362 21.804  328.104 1.00 67.14  ?  220 PHE B N   1 
ATOM   5284  C CA  . PHE B 1 226 ? 171.568 21.649  326.889 1.00 66.14  ?  220 PHE B CA  1 
ATOM   5285  C C   . PHE B 1 226 ? 170.620 22.824  326.692 1.00 70.39  ?  220 PHE B C   1 
ATOM   5286  O O   . PHE B 1 226 ? 170.390 23.256  325.556 1.00 69.38  ?  220 PHE B O   1 
ATOM   5287  C CB  . PHE B 1 226 ? 170.787 20.336  326.927 1.00 59.51  ?  220 PHE B CB  1 
ATOM   5288  C CG  . PHE B 1 226 ? 171.576 19.145  326.468 1.00 61.28  ?  220 PHE B CG  1 
ATOM   5289  C CD1 . PHE B 1 226 ? 171.952 19.017  325.140 1.00 64.45  ?  220 PHE B CD1 1 
ATOM   5290  C CD2 . PHE B 1 226 ? 171.930 18.146  327.357 1.00 61.60  ?  220 PHE B CD2 1 
ATOM   5291  C CE1 . PHE B 1 226 ? 172.676 17.920  324.710 1.00 53.80  ?  220 PHE B CE1 1 
ATOM   5292  C CE2 . PHE B 1 226 ? 172.650 17.045  326.933 1.00 60.79  ?  220 PHE B CE2 1 
ATOM   5293  C CZ  . PHE B 1 226 ? 173.025 16.933  325.608 1.00 51.38  ?  220 PHE B CZ  1 
ATOM   5294  N N   . GLU B 1 227 ? 170.053 23.350  327.781 1.00 70.94  ?  221 GLU B N   1 
ATOM   5295  C CA  . GLU B 1 227 ? 169.166 24.502  327.659 1.00 69.67  ?  221 GLU B CA  1 
ATOM   5296  C C   . GLU B 1 227 ? 169.924 25.719  327.147 1.00 64.92  ?  221 GLU B C   1 
ATOM   5297  O O   . GLU B 1 227 ? 169.391 26.508  326.359 1.00 61.75  ?  221 GLU B O   1 
ATOM   5298  C CB  . GLU B 1 227 ? 168.500 24.807  329.001 1.00 73.83  ?  221 GLU B CB  1 
ATOM   5299  C CG  . GLU B 1 227 ? 167.102 25.390  328.867 1.00 82.09  ?  221 GLU B CG  1 
ATOM   5300  C CD  . GLU B 1 227 ? 166.705 26.248  330.052 1.00 86.98  ?  221 GLU B CD  1 
ATOM   5301  O OE1 . GLU B 1 227 ? 167.601 26.860  330.671 1.00 80.20  ?  221 GLU B OE1 1 
ATOM   5302  O OE2 . GLU B 1 227 ? 165.497 26.313  330.363 1.00 84.66  -1 221 GLU B OE2 1 
ATOM   5303  N N   . ASP B 1 228 ? 171.174 25.887  327.586 1.00 68.00  ?  222 ASP B N   1 
ATOM   5304  C CA  . ASP B 1 228 ? 172.021 26.927  327.015 1.00 72.63  ?  222 ASP B CA  1 
ATOM   5305  C C   . ASP B 1 228 ? 172.488 26.552  325.615 1.00 69.28  ?  222 ASP B C   1 
ATOM   5306  O O   . ASP B 1 228 ? 172.687 27.433  324.771 1.00 70.71  ?  222 ASP B O   1 
ATOM   5307  C CB  . ASP B 1 228 ? 173.216 27.191  327.930 1.00 71.92  ?  222 ASP B CB  1 
ATOM   5308  C CG  . ASP B 1 228 ? 172.801 27.689  329.302 1.00 71.44  ?  222 ASP B CG  1 
ATOM   5309  O OD1 . ASP B 1 228 ? 171.965 28.614  329.373 1.00 66.30  ?  222 ASP B OD1 1 
ATOM   5310  O OD2 . ASP B 1 228 ? 173.304 27.148  330.309 1.00 76.08  -1 222 ASP B OD2 1 
ATOM   5311  N N   . TRP B 1 229 ? 172.665 25.254  325.351 1.00 65.71  ?  223 TRP B N   1 
ATOM   5312  C CA  . TRP B 1 229 ? 172.975 24.800  324.001 1.00 66.92  ?  223 TRP B CA  1 
ATOM   5313  C C   . TRP B 1 229 ? 171.802 24.980  323.048 1.00 73.12  ?  223 TRP B C   1 
ATOM   5314  O O   . TRP B 1 229 ? 172.008 25.011  321.831 1.00 72.57  ?  223 TRP B O   1 
ATOM   5315  C CB  . TRP B 1 229 ? 173.394 23.330  324.016 1.00 66.61  ?  223 TRP B CB  1 
ATOM   5316  C CG  . TRP B 1 229 ? 174.815 23.102  324.421 1.00 78.08  ?  223 TRP B CG  1 
ATOM   5317  C CD1 . TRP B 1 229 ? 175.758 24.052  324.682 1.00 78.77  ?  223 TRP B CD1 1 
ATOM   5318  C CD2 . TRP B 1 229 ? 175.458 21.836  324.610 1.00 74.53  ?  223 TRP B CD2 1 
ATOM   5319  N NE1 . TRP B 1 229 ? 176.949 23.457  325.022 1.00 76.41  ?  223 TRP B NE1 1 
ATOM   5320  C CE2 . TRP B 1 229 ? 176.790 22.096  324.985 1.00 65.57  ?  223 TRP B CE2 1 
ATOM   5321  C CE3 . TRP B 1 229 ? 175.036 20.508  324.498 1.00 71.80  ?  223 TRP B CE3 1 
ATOM   5322  C CZ2 . TRP B 1 229 ? 177.703 21.078  325.249 1.00 70.95  ?  223 TRP B CZ2 1 
ATOM   5323  C CZ3 . TRP B 1 229 ? 175.943 19.499  324.761 1.00 63.41  ?  223 TRP B CZ3 1 
ATOM   5324  C CH2 . TRP B 1 229 ? 177.260 19.789  325.132 1.00 68.31  ?  223 TRP B CH2 1 
ATOM   5325  N N   . ASN B 1 230 ? 170.582 25.085  323.567 1.00 73.11  ?  224 ASN B N   1 
ATOM   5326  C CA  . ASN B 1 230 ? 169.405 25.289  322.737 1.00 74.55  ?  224 ASN B CA  1 
ATOM   5327  C C   . ASN B 1 230 ? 169.139 26.761  322.455 1.00 75.94  ?  224 ASN B C   1 
ATOM   5328  O O   . ASN B 1 230 ? 168.074 27.097  321.929 1.00 84.24  ?  224 ASN B O   1 
ATOM   5329  C CB  . ASN B 1 230 ? 168.178 24.651  323.393 1.00 79.50  ?  224 ASN B CB  1 
ATOM   5330  C CG  . ASN B 1 230 ? 167.177 24.135  322.377 1.00 76.16  ?  224 ASN B CG  1 
ATOM   5331  O OD1 . ASN B 1 230 ? 166.888 22.941  322.329 1.00 72.20  ?  224 ASN B OD1 1 
ATOM   5332  N ND2 . ASN B 1 230 ? 166.647 25.034  321.556 1.00 74.70  ?  224 ASN B ND2 1 
ATOM   5333  N N   . LYS B 1 231 ? 170.075 27.643  322.801 1.00 76.69  ?  225 LYS B N   1 
ATOM   5334  C CA  . LYS B 1 231 ? 169.967 29.062  322.501 1.00 77.77  ?  225 LYS B CA  1 
ATOM   5335  C C   . LYS B 1 231 ? 170.989 29.520  321.470 1.00 81.47  ?  225 LYS B C   1 
ATOM   5336  O O   . LYS B 1 231 ? 171.029 30.711  321.143 1.00 85.33  ?  225 LYS B O   1 
ATOM   5337  C CB  . LYS B 1 231 ? 170.114 29.888  323.785 1.00 70.95  ?  225 LYS B CB  1 
ATOM   5338  C CG  . LYS B 1 231 ? 169.084 29.553  324.854 1.00 73.24  ?  225 LYS B CG  1 
ATOM   5339  C CD  . LYS B 1 231 ? 169.293 30.380  326.113 1.00 61.61  ?  225 LYS B CD  1 
ATOM   5340  C CE  . LYS B 1 231 ? 168.261 30.033  327.175 1.00 62.94  ?  225 LYS B CE  1 
ATOM   5341  N NZ  . LYS B 1 231 ? 168.446 30.833  328.418 1.00 66.52  1  225 LYS B NZ  1 
ATOM   5342  N N   . THR B 1 232 ? 171.812 28.608  320.952 1.00 78.62  ?  226 THR B N   1 
ATOM   5343  C CA  . THR B 1 232 ? 172.807 28.948  319.942 1.00 79.50  ?  226 THR B CA  1 
ATOM   5344  C C   . THR B 1 232 ? 172.425 28.331  318.599 1.00 78.38  ?  226 THR B C   1 
ATOM   5345  O O   . THR B 1 232 ? 171.243 28.301  318.244 1.00 78.00  ?  226 THR B O   1 
ATOM   5346  C CB  . THR B 1 232 ? 174.201 28.489  320.390 1.00 75.91  ?  226 THR B CB  1 
ATOM   5347  O OG1 . THR B 1 232 ? 175.136 28.653  319.318 1.00 75.96  ?  226 THR B OG1 1 
ATOM   5348  C CG2 . THR B 1 232 ? 174.183 27.032  320.833 1.00 69.25  ?  226 THR B CG2 1 
ATOM   5349  N N   . GLU B 1 233 ? 173.410 27.840  317.842 1.00 79.89  ?  227 GLU B N   1 
ATOM   5350  C CA  . GLU B 1 233 ? 173.125 27.232  316.547 1.00 73.81  ?  227 GLU B CA  1 
ATOM   5351  C C   . GLU B 1 233 ? 172.376 25.909  316.656 1.00 71.09  ?  227 GLU B C   1 
ATOM   5352  O O   . GLU B 1 233 ? 171.859 25.429  315.642 1.00 71.15  ?  227 GLU B O   1 
ATOM   5353  C CB  . GLU B 1 233 ? 174.423 27.008  315.766 1.00 72.79  ?  227 GLU B CB  1 
ATOM   5354  C CG  . GLU B 1 233 ? 175.122 28.274  315.289 1.00 76.59  ?  227 GLU B CG  1 
ATOM   5355  C CD  . GLU B 1 233 ? 176.022 28.886  316.345 1.00 73.88  ?  227 GLU B CD  1 
ATOM   5356  O OE1 . GLU B 1 233 ? 175.496 29.405  317.350 1.00 74.10  ?  227 GLU B OE1 1 
ATOM   5357  O OE2 . GLU B 1 233 ? 177.259 28.842  316.172 1.00 65.22  -1 227 GLU B OE2 1 
ATOM   5358  N N   . LEU B 1 234 ? 172.300 25.313  317.848 1.00 71.61  ?  228 LEU B N   1 
ATOM   5359  C CA  . LEU B 1 234 ? 171.723 23.987  318.031 1.00 66.88  ?  228 LEU B CA  1 
ATOM   5360  C C   . LEU B 1 234 ? 170.264 24.034  318.476 1.00 71.68  ?  228 LEU B C   1 
ATOM   5361  O O   . LEU B 1 234 ? 169.796 23.119  319.162 1.00 70.40  ?  228 LEU B O   1 
ATOM   5362  C CB  . LEU B 1 234 ? 172.554 23.185  319.032 1.00 67.94  ?  228 LEU B CB  1 
ATOM   5363  C CG  . LEU B 1 234 ? 173.986 22.832  318.628 1.00 56.45  ?  228 LEU B CG  1 
ATOM   5364  C CD1 . LEU B 1 234 ? 174.651 22.002  319.713 1.00 52.58  ?  228 LEU B CD1 1 
ATOM   5365  C CD2 . LEU B 1 234 ? 174.000 22.091  317.302 1.00 58.40  ?  228 LEU B CD2 1 
ATOM   5366  N N   . ASP B 1 235 ? 169.534 25.083  318.099 1.00 80.54  ?  229 ASP B N   1 
ATOM   5367  C CA  . ASP B 1 235 ? 168.111 25.183  318.410 1.00 77.82  ?  229 ASP B CA  1 
ATOM   5368  C C   . ASP B 1 235 ? 167.328 24.055  317.751 1.00 74.29  ?  229 ASP B C   1 
ATOM   5369  O O   . ASP B 1 235 ? 167.143 24.059  316.530 1.00 71.42  ?  229 ASP B O   1 
ATOM   5370  C CB  . ASP B 1 235 ? 167.563 26.536  317.955 1.00 81.61  ?  229 ASP B CB  1 
ATOM   5371  C CG  . ASP B 1 235 ? 167.761 27.625  318.986 1.00 85.64  ?  229 ASP B CG  1 
ATOM   5372  O OD1 . ASP B 1 235 ? 166.764 28.033  319.618 1.00 86.84  ?  229 ASP B OD1 1 
ATOM   5373  O OD2 . ASP B 1 235 ? 168.916 28.059  319.181 1.00 90.78  -1 229 ASP B OD2 1 
ATOM   5374  N N   . SER B 1 236 ? 166.862 23.088  318.541 1.00 69.74  ?  230 SER B N   1 
ATOM   5375  C CA  . SER B 1 236 ? 166.095 21.977  317.996 1.00 68.13  ?  230 SER B CA  1 
ATOM   5376  C C   . SER B 1 236 ? 165.179 21.414  319.072 1.00 63.07  ?  230 SER B C   1 
ATOM   5377  O O   . SER B 1 236 ? 165.405 21.597  320.271 1.00 65.08  ?  230 SER B O   1 
ATOM   5378  C CB  . SER B 1 236 ? 167.007 20.871  317.450 1.00 69.36  ?  230 SER B CB  1 
ATOM   5379  O OG  . SER B 1 236 ? 167.585 20.117  318.502 1.00 64.08  ?  230 SER B OG  1 
ATOM   5380  N N   . PHE B 1 237 ? 164.136 20.713  318.620 1.00 59.27  ?  231 PHE B N   1 
ATOM   5381  C CA  . PHE B 1 237 ? 163.204 20.084  319.549 1.00 62.36  ?  231 PHE B CA  1 
ATOM   5382  C C   . PHE B 1 237 ? 163.844 18.907  320.274 1.00 64.23  ?  231 PHE B C   1 
ATOM   5383  O O   . PHE B 1 237 ? 163.520 18.649  321.439 1.00 54.84  ?  231 PHE B O   1 
ATOM   5384  C CB  . PHE B 1 237 ? 161.947 19.637  318.801 1.00 61.10  ?  231 PHE B CB  1 
ATOM   5385  C CG  . PHE B 1 237 ? 160.896 19.018  319.681 1.00 62.17  ?  231 PHE B CG  1 
ATOM   5386  C CD1 . PHE B 1 237 ? 160.278 19.760  320.674 1.00 67.45  ?  231 PHE B CD1 1 
ATOM   5387  C CD2 . PHE B 1 237 ? 160.512 17.700  319.499 1.00 62.73  ?  231 PHE B CD2 1 
ATOM   5388  C CE1 . PHE B 1 237 ? 159.306 19.193  321.479 1.00 71.34  ?  231 PHE B CE1 1 
ATOM   5389  C CE2 . PHE B 1 237 ? 159.540 17.128  320.299 1.00 65.88  ?  231 PHE B CE2 1 
ATOM   5390  C CZ  . PHE B 1 237 ? 158.935 17.876  321.290 1.00 72.16  ?  231 PHE B CZ  1 
ATOM   5391  N N   . LEU B 1 238 ? 164.757 18.192  319.610 1.00 69.87  ?  232 LEU B N   1 
ATOM   5392  C CA  . LEU B 1 238 ? 165.429 17.066  320.250 1.00 65.38  ?  232 LEU B CA  1 
ATOM   5393  C C   . LEU B 1 238 ? 166.311 17.515  321.407 1.00 65.38  ?  232 LEU B C   1 
ATOM   5394  O O   . LEU B 1 238 ? 166.497 16.763  322.370 1.00 63.84  ?  232 LEU B O   1 
ATOM   5395  C CB  . LEU B 1 238 ? 166.257 16.294  319.224 1.00 61.82  ?  232 LEU B CB  1 
ATOM   5396  C CG  . LEU B 1 238 ? 165.492 15.332  318.316 1.00 56.91  ?  232 LEU B CG  1 
ATOM   5397  C CD1 . LEU B 1 238 ? 166.402 14.787  317.230 1.00 50.62  ?  232 LEU B CD1 1 
ATOM   5398  C CD2 . LEU B 1 238 ? 164.896 14.199  319.135 1.00 61.92  ?  232 LEU B CD2 1 
ATOM   5399  N N   . ILE B 1 239 ? 166.864 18.725  321.333 1.00 68.22  ?  233 ILE B N   1 
ATOM   5400  C CA  . ILE B 1 239 ? 167.672 19.227  322.438 1.00 68.29  ?  233 ILE B CA  1 
ATOM   5401  C C   . ILE B 1 239 ? 166.786 19.795  323.543 1.00 64.89  ?  233 ILE B C   1 
ATOM   5402  O O   . ILE B 1 239 ? 167.124 19.690  324.728 1.00 58.16  ?  233 ILE B O   1 
ATOM   5403  C CB  . ILE B 1 239 ? 168.689 20.261  321.925 1.00 67.37  ?  233 ILE B CB  1 
ATOM   5404  C CG1 . ILE B 1 239 ? 169.639 19.602  320.924 1.00 61.51  ?  233 ILE B CG1 1 
ATOM   5405  C CG2 . ILE B 1 239 ? 169.473 20.875  323.076 1.00 68.16  ?  233 ILE B CG2 1 
ATOM   5406  C CD1 . ILE B 1 239 ? 170.840 20.438  320.571 1.00 63.26  ?  233 ILE B CD1 1 
ATOM   5407  N N   . GLU B 1 240 ? 165.644 20.387  323.184 1.00 67.41  ?  234 GLU B N   1 
ATOM   5408  C CA  . GLU B 1 240 ? 164.696 20.841  324.198 1.00 68.78  ?  234 GLU B CA  1 
ATOM   5409  C C   . GLU B 1 240 ? 164.219 19.678  325.057 1.00 68.99  ?  234 GLU B C   1 
ATOM   5410  O O   . GLU B 1 240 ? 164.205 19.766  326.290 1.00 73.59  ?  234 GLU B O   1 
ATOM   5411  C CB  . GLU B 1 240 ? 163.504 21.537  323.540 1.00 69.02  ?  234 GLU B CB  1 
ATOM   5412  C CG  . GLU B 1 240 ? 163.810 22.904  322.958 1.00 78.08  ?  234 GLU B CG  1 
ATOM   5413  C CD  . GLU B 1 240 ? 162.563 23.625  322.485 1.00 83.61  ?  234 GLU B CD  1 
ATOM   5414  O OE1 . GLU B 1 240 ? 161.449 23.146  322.781 1.00 80.80  ?  234 GLU B OE1 1 
ATOM   5415  O OE2 . GLU B 1 240 ? 162.699 24.673  321.817 1.00 84.07  -1 234 GLU B OE2 1 
ATOM   5416  N N   . ILE B 1 241 ? 163.827 18.572  324.419 1.00 68.69  ?  235 ILE B N   1 
ATOM   5417  C CA  . ILE B 1 241 ? 163.356 17.422  325.181 1.00 70.73  ?  235 ILE B CA  1 
ATOM   5418  C C   . ILE B 1 241 ? 164.509 16.759  325.921 1.00 69.09  ?  235 ILE B C   1 
ATOM   5419  O O   . ILE B 1 241 ? 164.314 16.192  327.001 1.00 67.70  ?  235 ILE B O   1 
ATOM   5420  C CB  . ILE B 1 241 ? 162.618 16.427  324.262 1.00 73.01  ?  235 ILE B CB  1 
ATOM   5421  C CG1 . ILE B 1 241 ? 163.597 15.683  323.351 1.00 72.82  ?  235 ILE B CG1 1 
ATOM   5422  C CG2 . ILE B 1 241 ? 161.584 17.154  323.425 1.00 60.85  ?  235 ILE B CG2 1 
ATOM   5423  C CD1 . ILE B 1 241 ? 162.942 14.622  322.489 1.00 62.40  ?  235 ILE B CD1 1 
ATOM   5424  N N   . THR B 1 242 ? 165.725 16.830  325.372 1.00 71.49  ?  236 THR B N   1 
ATOM   5425  C CA  . THR B 1 242 ? 166.877 16.241  326.046 1.00 71.03  ?  236 THR B CA  1 
ATOM   5426  C C   . THR B 1 242 ? 167.131 16.924  327.384 1.00 72.72  ?  236 THR B C   1 
ATOM   5427  O O   . THR B 1 242 ? 167.352 16.259  328.403 1.00 71.14  ?  236 THR B O   1 
ATOM   5428  C CB  . THR B 1 242 ? 168.114 16.330  325.150 1.00 66.63  ?  236 THR B CB  1 
ATOM   5429  O OG1 . THR B 1 242 ? 167.904 15.555  323.964 1.00 75.21  ?  236 THR B OG1 1 
ATOM   5430  C CG2 . THR B 1 242 ? 169.343 15.808  325.880 1.00 59.64  ?  236 THR B CG2 1 
ATOM   5431  N N   . ALA B 1 243 ? 167.089 18.258  327.401 1.00 72.14  ?  237 ALA B N   1 
ATOM   5432  C CA  . ALA B 1 243 ? 167.269 18.987  328.652 1.00 74.97  ?  237 ALA B CA  1 
ATOM   5433  C C   . ALA B 1 243 ? 166.133 18.700  329.626 1.00 72.36  ?  237 ALA B C   1 
ATOM   5434  O O   . ALA B 1 243 ? 166.363 18.535  330.829 1.00 71.78  ?  237 ALA B O   1 
ATOM   5435  C CB  . ALA B 1 243 ? 167.376 20.486  328.375 1.00 67.90  ?  237 ALA B CB  1 
ATOM   5436  N N   . ASN B 1 244 ? 164.898 18.634  329.123 1.00 68.53  ?  238 ASN B N   1 
ATOM   5437  C CA  . ASN B 1 244 ? 163.764 18.340  329.991 1.00 69.48  ?  238 ASN B CA  1 
ATOM   5438  C C   . ASN B 1 244 ? 163.807 16.908  330.511 1.00 74.74  ?  238 ASN B C   1 
ATOM   5439  O O   . ASN B 1 244 ? 163.320 16.637  331.615 1.00 73.93  ?  238 ASN B O   1 
ATOM   5440  C CB  . ASN B 1 244 ? 162.453 18.599  329.249 1.00 66.62  ?  238 ASN B CB  1 
ATOM   5441  C CG  . ASN B 1 244 ? 162.202 20.077  329.009 1.00 73.48  ?  238 ASN B CG  1 
ATOM   5442  O OD1 . ASN B 1 244 ? 161.421 20.708  329.720 1.00 81.01  ?  238 ASN B OD1 1 
ATOM   5443  N ND2 . ASN B 1 244 ? 162.869 20.636  328.006 1.00 71.49  ?  238 ASN B ND2 1 
ATOM   5444  N N   . ILE B 1 245 ? 164.382 15.982  329.740 1.00 76.61  ?  239 ILE B N   1 
ATOM   5445  C CA  . ILE B 1 245 ? 164.504 14.603  330.203 1.00 75.18  ?  239 ILE B CA  1 
ATOM   5446  C C   . ILE B 1 245 ? 165.555 14.500  331.303 1.00 78.67  ?  239 ILE B C   1 
ATOM   5447  O O   . ILE B 1 245 ? 165.366 13.786  332.296 1.00 76.53  ?  239 ILE B O   1 
ATOM   5448  C CB  . ILE B 1 245 ? 164.820 13.668  329.020 1.00 71.32  ?  239 ILE B CB  1 
ATOM   5449  C CG1 . ILE B 1 245 ? 163.575 13.449  328.160 1.00 68.64  ?  239 ILE B CG1 1 
ATOM   5450  C CG2 . ILE B 1 245 ? 165.357 12.332  329.511 1.00 79.04  ?  239 ILE B CG2 1 
ATOM   5451  C CD1 . ILE B 1 245 ? 163.840 12.673  326.892 1.00 68.63  ?  239 ILE B CD1 1 
ATOM   5452  N N   . LEU B 1 246 ? 166.671 15.218  331.152 1.00 81.11  ?  240 LEU B N   1 
ATOM   5453  C CA  . LEU B 1 246 ? 167.733 15.155  332.152 1.00 76.85  ?  240 LEU B CA  1 
ATOM   5454  C C   . LEU B 1 246 ? 167.287 15.755  333.480 1.00 79.12  ?  240 LEU B C   1 
ATOM   5455  O O   . LEU B 1 246 ? 167.642 15.242  334.548 1.00 74.90  ?  240 LEU B O   1 
ATOM   5456  C CB  . LEU B 1 246 ? 168.982 15.870  331.637 1.00 78.38  ?  240 LEU B CB  1 
ATOM   5457  C CG  . LEU B 1 246 ? 169.653 15.287  330.393 1.00 69.90  ?  240 LEU B CG  1 
ATOM   5458  C CD1 . LEU B 1 246 ? 170.888 16.089  330.025 1.00 69.30  ?  240 LEU B CD1 1 
ATOM   5459  C CD2 . LEU B 1 246 ? 170.008 13.833  330.618 1.00 70.25  ?  240 LEU B CD2 1 
ATOM   5460  N N   . LYS B 1 247 ? 166.511 16.838  333.436 1.00 86.83  ?  241 LYS B N   1 
ATOM   5461  C CA  . LYS B 1 247 ? 166.057 17.498  334.654 1.00 81.77  ?  241 LYS B CA  1 
ATOM   5462  C C   . LYS B 1 247 ? 164.846 16.824  335.284 1.00 82.95  ?  241 LYS B C   1 
ATOM   5463  O O   . LYS B 1 247 ? 164.499 17.159  336.422 1.00 89.73  ?  241 LYS B O   1 
ATOM   5464  C CB  . LYS B 1 247 ? 165.719 18.964  334.370 1.00 71.46  ?  241 LYS B CB  1 
ATOM   5465  C CG  . LYS B 1 247 ? 164.454 19.156  333.549 1.00 71.90  ?  241 LYS B CG  1 
ATOM   5466  C CD  . LYS B 1 247 ? 163.981 20.604  333.556 1.00 72.75  ?  241 LYS B CD  1 
ATOM   5467  C CE  . LYS B 1 247 ? 164.911 21.514  332.766 1.00 76.28  ?  241 LYS B CE  1 
ATOM   5468  N NZ  . LYS B 1 247 ? 166.225 21.723  333.435 1.00 79.70  1  241 LYS B NZ  1 
ATOM   5469  N N   . PHE B 1 248 ? 164.198 15.898  334.580 1.00 83.17  ?  242 PHE B N   1 
ATOM   5470  C CA  . PHE B 1 248 ? 163.006 15.248  335.108 1.00 83.90  ?  242 PHE B CA  1 
ATOM   5471  C C   . PHE B 1 248 ? 163.342 14.470  336.374 1.00 93.58  ?  242 PHE B C   1 
ATOM   5472  O O   . PHE B 1 248 ? 164.287 13.675  336.400 1.00 94.84  ?  242 PHE B O   1 
ATOM   5473  C CB  . PHE B 1 248 ? 162.403 14.317  334.054 1.00 85.29  ?  242 PHE B CB  1 
ATOM   5474  C CG  . PHE B 1 248 ? 161.005 13.850  334.370 1.00 90.16  ?  242 PHE B CG  1 
ATOM   5475  C CD1 . PHE B 1 248 ? 159.919 14.363  333.679 1.00 83.74  ?  242 PHE B CD1 1 
ATOM   5476  C CD2 . PHE B 1 248 ? 160.776 12.894  335.348 1.00 91.95  ?  242 PHE B CD2 1 
ATOM   5477  C CE1 . PHE B 1 248 ? 158.635 13.936  333.960 1.00 84.88  ?  242 PHE B CE1 1 
ATOM   5478  C CE2 . PHE B 1 248 ? 159.494 12.464  335.635 1.00 81.50  ?  242 PHE B CE2 1 
ATOM   5479  C CZ  . PHE B 1 248 ? 158.423 12.986  334.940 1.00 86.75  ?  242 PHE B CZ  1 
ATOM   5480  N N   . GLN B 1 249 ? 162.563 14.704  337.425 1.00 98.40  ?  243 GLN B N   1 
ATOM   5481  C CA  . GLN B 1 249 ? 162.719 14.021  338.702 1.00 99.94  ?  243 GLN B CA  1 
ATOM   5482  C C   . GLN B 1 249 ? 161.506 13.134  338.941 1.00 97.76  ?  243 GLN B C   1 
ATOM   5483  O O   . GLN B 1 249 ? 160.365 13.572  338.756 1.00 97.20  ?  243 GLN B O   1 
ATOM   5484  C CB  . GLN B 1 249 ? 162.891 15.030  339.840 1.00 107.21 ?  243 GLN B CB  1 
ATOM   5485  C CG  . GLN B 1 249 ? 164.150 15.881  339.718 1.00 102.50 ?  243 GLN B CG  1 
ATOM   5486  C CD  . GLN B 1 249 ? 163.863 17.371  339.753 1.00 90.62  ?  243 GLN B CD  1 
ATOM   5487  O OE1 . GLN B 1 249 ? 162.841 17.807  340.283 1.00 87.72  ?  243 GLN B OE1 1 
ATOM   5488  N NE2 . GLN B 1 249 ? 164.765 18.160  339.181 1.00 75.16  ?  243 GLN B NE2 1 
ATOM   5489  N N   . ASP B 1 250 ? 161.755 11.890  339.352 1.00 99.40  ?  244 ASP B N   1 
ATOM   5490  C CA  . ASP B 1 250 ? 160.700 10.892  339.486 1.00 109.76 ?  244 ASP B CA  1 
ATOM   5491  C C   . ASP B 1 250 ? 159.851 11.130  340.730 1.00 114.84 ?  244 ASP B C   1 
ATOM   5492  O O   . ASP B 1 250 ? 159.719 12.267  341.195 1.00 112.69 ?  244 ASP B O   1 
ATOM   5493  C CB  . ASP B 1 250 ? 161.303 9.485   339.530 1.00 104.32 ?  244 ASP B CB  1 
ATOM   5494  C CG  . ASP B 1 250 ? 160.377 8.432   338.949 1.00 97.88  ?  244 ASP B CG  1 
ATOM   5495  O OD1 . ASP B 1 250 ? 160.867 7.546   338.218 1.00 91.77  ?  244 ASP B OD1 1 
ATOM   5496  O OD2 . ASP B 1 250 ? 159.157 8.503   339.211 1.00 101.15 -1 244 ASP B OD2 1 
ATOM   5497  N N   . THR B 1 251 ? 159.264 10.057  341.267 1.00 115.06 ?  245 THR B N   1 
ATOM   5498  C CA  . THR B 1 251 ? 158.487 10.159  342.498 1.00 108.37 ?  245 THR B CA  1 
ATOM   5499  C C   . THR B 1 251 ? 159.346 10.688  343.639 1.00 107.24 ?  245 THR B C   1 
ATOM   5500  O O   . THR B 1 251 ? 159.011 11.692  344.277 1.00 111.30 ?  245 THR B O   1 
ATOM   5501  C CB  . THR B 1 251 ? 157.891 8.795   342.854 1.00 99.49  ?  245 THR B CB  1 
ATOM   5502  O OG1 . THR B 1 251 ? 156.889 8.441   341.891 1.00 82.62  ?  245 THR B OG1 1 
ATOM   5503  C CG2 . THR B 1 251 ? 157.268 8.829   344.242 1.00 102.28 ?  245 THR B CG2 1 
ATOM   5504  N N   . ASP B 1 252 ? 160.462 10.019  343.911 1.00 106.54 ?  246 ASP B N   1 
ATOM   5505  C CA  . ASP B 1 252 ? 161.446 10.518  344.857 1.00 108.77 ?  246 ASP B CA  1 
ATOM   5506  C C   . ASP B 1 252 ? 162.466 11.381  344.124 1.00 110.08 ?  246 ASP B C   1 
ATOM   5507  O O   . ASP B 1 252 ? 162.731 11.183  342.935 1.00 112.87 ?  246 ASP B O   1 
ATOM   5508  C CB  . ASP B 1 252 ? 162.138 9.362   345.582 1.00 102.64 ?  246 ASP B CB  1 
ATOM   5509  C CG  . ASP B 1 252 ? 162.695 8.323   344.628 1.00 106.85 ?  246 ASP B CG  1 
ATOM   5510  O OD1 . ASP B 1 252 ? 163.916 8.346   344.369 1.00 105.76 ?  246 ASP B OD1 1 
ATOM   5511  O OD2 . ASP B 1 252 ? 161.909 7.487   344.133 1.00 95.30  -1 246 ASP B OD2 1 
ATOM   5512  N N   . GLY B 1 253 ? 163.039 12.341  344.851 1.00 110.35 ?  247 GLY B N   1 
ATOM   5513  C CA  . GLY B 1 253 ? 163.908 13.362  344.287 1.00 109.70 ?  247 GLY B CA  1 
ATOM   5514  C C   . GLY B 1 253 ? 164.973 12.894  343.314 1.00 113.92 ?  247 GLY B C   1 
ATOM   5515  O O   . GLY B 1 253 ? 165.488 13.692  342.524 1.00 103.44 ?  247 GLY B O   1 
ATOM   5516  N N   . LYS B 1 254 ? 165.314 11.608  343.363 1.00 113.02 ?  248 LYS B N   1 
ATOM   5517  C CA  . LYS B 1 254 ? 166.286 11.051  342.432 1.00 110.05 ?  248 LYS B CA  1 
ATOM   5518  C C   . LYS B 1 254 ? 165.749 11.109  341.005 1.00 112.03 ?  248 LYS B C   1 
ATOM   5519  O O   . LYS B 1 254 ? 164.538 11.101  340.770 1.00 111.13 ?  248 LYS B O   1 
ATOM   5520  C CB  . LYS B 1 254 ? 166.614 9.609   342.819 1.00 99.92  ?  248 LYS B CB  1 
ATOM   5521  C CG  . LYS B 1 254 ? 167.977 9.126   342.358 1.00 98.70  ?  248 LYS B CG  1 
ATOM   5522  C CD  . LYS B 1 254 ? 168.791 8.608   343.534 1.00 98.34  ?  248 LYS B CD  1 
ATOM   5523  C CE  . LYS B 1 254 ? 168.033 7.535   344.302 1.00 92.87  ?  248 LYS B CE  1 
ATOM   5524  N NZ  . LYS B 1 254 ? 168.786 7.064   345.497 1.00 72.57  1  248 LYS B NZ  1 
ATOM   5525  N N   . HIS B 1 255 ? 166.667 11.171  340.044 1.00 111.05 ?  249 HIS B N   1 
ATOM   5526  C CA  . HIS B 1 255 ? 166.276 11.281  338.648 1.00 102.26 ?  249 HIS B CA  1 
ATOM   5527  C C   . HIS B 1 255 ? 165.874 9.918   338.089 1.00 96.70  ?  249 HIS B C   1 
ATOM   5528  O O   . HIS B 1 255 ? 166.175 8.865   338.659 1.00 90.91  ?  249 HIS B O   1 
ATOM   5529  C CB  . HIS B 1 255 ? 167.408 11.887  337.819 1.00 95.04  ?  249 HIS B CB  1 
ATOM   5530  C CG  . HIS B 1 255 ? 167.722 13.305  338.179 1.00 94.06  ?  249 HIS B CG  1 
ATOM   5531  N ND1 . HIS B 1 255 ? 168.512 13.642  339.258 1.00 89.39  ?  249 HIS B ND1 1 
ATOM   5532  C CD2 . HIS B 1 255 ? 167.343 14.474  337.611 1.00 90.56  ?  249 HIS B CD2 1 
ATOM   5533  C CE1 . HIS B 1 255 ? 168.611 14.957  339.334 1.00 89.74  ?  249 HIS B CE1 1 
ATOM   5534  N NE2 . HIS B 1 255 ? 167.911 15.486  338.347 1.00 89.17  ?  249 HIS B NE2 1 
ATOM   5535  N N   . LEU B 1 256 ? 165.184 9.951   336.947 1.00 95.28  ?  250 LEU B N   1 
ATOM   5536  C CA  . LEU B 1 256 ? 164.604 8.750   336.360 1.00 93.13  ?  250 LEU B CA  1 
ATOM   5537  C C   . LEU B 1 256 ? 165.421 8.169   335.213 1.00 88.42  ?  250 LEU B C   1 
ATOM   5538  O O   . LEU B 1 256 ? 165.296 6.971   334.937 1.00 84.81  ?  250 LEU B O   1 
ATOM   5539  C CB  . LEU B 1 256 ? 163.181 9.036   335.860 1.00 93.06  ?  250 LEU B CB  1 
ATOM   5540  C CG  . LEU B 1 256 ? 163.003 9.624   334.456 1.00 98.03  ?  250 LEU B CG  1 
ATOM   5541  C CD1 . LEU B 1 256 ? 161.527 9.689   334.092 1.00 87.05  ?  250 LEU B CD1 1 
ATOM   5542  C CD2 . LEU B 1 256 ? 163.648 10.999  334.327 1.00 94.49  ?  250 LEU B CD2 1 
ATOM   5543  N N   . LEU B 1 257 ? 166.241 8.976   334.540 1.00 85.79  ?  251 LEU B N   1 
ATOM   5544  C CA  . LEU B 1 257 ? 166.985 8.467   333.391 1.00 80.18  ?  251 LEU B CA  1 
ATOM   5545  C C   . LEU B 1 257 ? 168.000 7.387   333.752 1.00 75.77  ?  251 LEU B C   1 
ATOM   5546  O O   . LEU B 1 257 ? 168.086 6.395   333.007 1.00 74.70  ?  251 LEU B O   1 
ATOM   5547  C CB  . LEU B 1 257 ? 167.666 9.625   332.650 1.00 69.33  ?  251 LEU B CB  1 
ATOM   5548  C CG  . LEU B 1 257 ? 168.448 9.200   331.405 1.00 68.51  ?  251 LEU B CG  1 
ATOM   5549  C CD1 . LEU B 1 257 ? 167.541 8.474   330.423 1.00 67.32  ?  251 LEU B CD1 1 
ATOM   5550  C CD2 . LEU B 1 257 ? 169.106 10.393  330.741 1.00 73.16  ?  251 LEU B CD2 1 
ATOM   5551  N N   . PRO B 1 258 ? 168.788 7.496   334.829 1.00 69.95  ?  252 PRO B N   1 
ATOM   5552  C CA  . PRO B 1 258 ? 169.672 6.375   335.191 1.00 77.53  ?  252 PRO B CA  1 
ATOM   5553  C C   . PRO B 1 258 ? 168.928 5.085   335.488 1.00 86.57  ?  252 PRO B C   1 
ATOM   5554  O O   . PRO B 1 258 ? 169.555 4.019   335.519 1.00 86.76  ?  252 PRO B O   1 
ATOM   5555  C CB  . PRO B 1 258 ? 170.409 6.893   336.433 1.00 79.31  ?  252 PRO B CB  1 
ATOM   5556  C CG  . PRO B 1 258 ? 170.378 8.368   336.293 1.00 80.36  ?  252 PRO B CG  1 
ATOM   5557  C CD  . PRO B 1 258 ? 169.048 8.676   335.676 1.00 76.65  ?  252 PRO B CD  1 
ATOM   5558  N N   . LYS B 1 259 ? 167.615 5.144   335.705 1.00 81.26  ?  253 LYS B N   1 
ATOM   5559  C CA  . LYS B 1 259 ? 166.811 3.956   335.948 1.00 80.05  ?  253 LYS B CA  1 
ATOM   5560  C C   . LYS B 1 259 ? 166.294 3.314   334.667 1.00 80.72  ?  253 LYS B C   1 
ATOM   5561  O O   . LYS B 1 259 ? 165.822 2.174   334.713 1.00 83.68  ?  253 LYS B O   1 
ATOM   5562  C CB  . LYS B 1 259 ? 165.627 4.302   336.859 1.00 81.44  ?  253 LYS B CB  1 
ATOM   5563  C CG  . LYS B 1 259 ? 166.027 4.960   338.171 1.00 78.32  ?  253 LYS B CG  1 
ATOM   5564  C CD  . LYS B 1 259 ? 164.814 5.476   338.932 1.00 78.61  ?  253 LYS B CD  1 
ATOM   5565  C CE  . LYS B 1 259 ? 163.867 4.347   339.304 1.00 87.11  ?  253 LYS B CE  1 
ATOM   5566  N NZ  . LYS B 1 259 ? 162.688 4.843   340.068 1.00 69.80  1  253 LYS B NZ  1 
ATOM   5567  N N   . ILE B 1 260 ? 166.379 4.007   333.533 1.00 80.61  ?  254 ILE B N   1 
ATOM   5568  C CA  . ILE B 1 260 ? 165.857 3.496   332.270 1.00 82.79  ?  254 ILE B CA  1 
ATOM   5569  C C   . ILE B 1 260 ? 166.846 2.504   331.674 1.00 77.23  ?  254 ILE B C   1 
ATOM   5570  O O   . ILE B 1 260 ? 168.062 2.734   331.680 1.00 68.02  ?  254 ILE B O   1 
ATOM   5571  C CB  . ILE B 1 260 ? 165.571 4.656   331.299 1.00 73.20  ?  254 ILE B CB  1 
ATOM   5572  C CG1 . ILE B 1 260 ? 164.592 5.648   331.929 1.00 72.52  ?  254 ILE B CG1 1 
ATOM   5573  C CG2 . ILE B 1 260 ? 165.019 4.133   329.980 1.00 70.31  ?  254 ILE B CG2 1 
ATOM   5574  C CD1 . ILE B 1 260 ? 164.261 6.827   331.042 1.00 71.29  ?  254 ILE B CD1 1 
ATOM   5575  N N   . ARG B 1 261 ? 166.322 1.394   331.153 1.00 80.54  ?  255 ARG B N   1 
ATOM   5576  C CA  . ARG B 1 261 ? 167.161 0.364   330.555 1.00 71.61  ?  255 ARG B CA  1 
ATOM   5577  C C   . ARG B 1 261 ? 167.972 0.936   329.396 1.00 73.44  ?  255 ARG B C   1 
ATOM   5578  O O   . ARG B 1 261 ? 167.558 1.883   328.722 1.00 69.11  ?  255 ARG B O   1 
ATOM   5579  C CB  . ARG B 1 261 ? 166.305 -0.808  330.068 1.00 73.03  ?  255 ARG B CB  1 
ATOM   5580  C CG  . ARG B 1 261 ? 167.105 -2.011  329.585 1.00 68.70  ?  255 ARG B CG  1 
ATOM   5581  C CD  . ARG B 1 261 ? 166.269 -2.924  328.705 1.00 85.10  ?  255 ARG B CD  1 
ATOM   5582  N NE  . ARG B 1 261 ? 167.077 -3.963  328.071 1.00 86.62  ?  255 ARG B NE  1 
ATOM   5583  C CZ  . ARG B 1 261 ? 167.246 -5.186  328.564 1.00 84.25  ?  255 ARG B CZ  1 
ATOM   5584  N NH1 . ARG B 1 261 ? 166.660 -5.532  329.702 1.00 86.72  1  255 ARG B NH1 1 
ATOM   5585  N NH2 . ARG B 1 261 ? 168.000 -6.065  327.918 1.00 79.29  ?  255 ARG B NH2 1 
ATOM   5586  N N   . ASP B 1 262 ? 169.139 0.344   329.169 1.00 81.01  ?  256 ASP B N   1 
ATOM   5587  C CA  . ASP B 1 262 ? 170.090 0.817   328.163 1.00 77.49  ?  256 ASP B CA  1 
ATOM   5588  C C   . ASP B 1 262 ? 169.964 0.036   326.861 1.00 77.40  ?  256 ASP B C   1 
ATOM   5589  O O   . ASP B 1 262 ? 170.950 -0.465  326.320 1.00 76.17  ?  256 ASP B O   1 
ATOM   5590  C CB  . ASP B 1 262 ? 171.505 0.730   328.716 1.00 71.03  ?  256 ASP B CB  1 
ATOM   5591  C CG  . ASP B 1 262 ? 172.426 1.760   328.114 1.00 77.08  ?  256 ASP B CG  1 
ATOM   5592  O OD1 . ASP B 1 262 ? 172.176 2.189   326.968 1.00 69.92  ?  256 ASP B OD1 1 
ATOM   5593  O OD2 . ASP B 1 262 ? 173.401 2.145   328.791 1.00 85.29  -1 256 ASP B OD2 1 
ATOM   5594  N N   . SER B 1 263 ? 168.746 -0.074  326.336 1.00 77.34  ?  257 SER B N   1 
ATOM   5595  C CA  . SER B 1 263 ? 168.499 -0.796  325.094 1.00 66.76  ?  257 SER B CA  1 
ATOM   5596  C C   . SER B 1 263 ? 167.544 0.010   324.229 1.00 63.33  ?  257 SER B C   1 
ATOM   5597  O O   . SER B 1 263 ? 166.462 0.389   324.686 1.00 58.99  ?  257 SER B O   1 
ATOM   5598  C CB  . SER B 1 263 ? 167.920 -2.189  325.365 1.00 66.04  ?  257 SER B CB  1 
ATOM   5599  O OG  . SER B 1 263 ? 167.636 -2.868  324.153 1.00 70.61  ?  257 SER B OG  1 
ATOM   5600  N N   . ALA B 1 264 ? 167.943 0.265   322.988 1.00 70.51  ?  258 ALA B N   1 
ATOM   5601  C CA  . ALA B 1 264 ? 167.132 1.007   322.040 1.00 67.24  ?  258 ALA B CA  1 
ATOM   5602  C C   . ALA B 1 264 ? 166.468 0.040   321.062 1.00 71.51  ?  258 ALA B C   1 
ATOM   5603  O O   . ALA B 1 264 ? 166.510 -1.183  321.233 1.00 69.50  ?  258 ALA B O   1 
ATOM   5604  C CB  . ALA B 1 264 ? 167.988 2.051   321.320 1.00 51.89  ?  258 ALA B CB  1 
ATOM   5605  N N   . GLY B 1 265 ? 165.847 0.589   320.021 1.00 72.28  ?  259 GLY B N   1 
ATOM   5606  C CA  . GLY B 1 265 ? 165.175 -0.247  319.045 1.00 83.47  ?  259 GLY B CA  1 
ATOM   5607  C C   . GLY B 1 265 ? 166.153 -1.046  318.204 1.00 88.28  ?  259 GLY B C   1 
ATOM   5608  O O   . GLY B 1 265 ? 167.311 -0.669  318.017 1.00 80.79  ?  259 GLY B O   1 
ATOM   5609  N N   . GLN B 1 266 ? 165.672 -2.176  317.693 1.00 91.54  ?  260 GLN B N   1 
ATOM   5610  C CA  . GLN B 1 266 ? 166.464 -3.050  316.840 1.00 79.25  ?  260 GLN B CA  1 
ATOM   5611  C C   . GLN B 1 266 ? 165.911 -3.186  315.431 1.00 75.94  ?  260 GLN B C   1 
ATOM   5612  O O   . GLN B 1 266 ? 166.692 -3.353  314.491 1.00 80.52  ?  260 GLN B O   1 
ATOM   5613  C CB  . GLN B 1 266 ? 166.579 -4.448  317.470 1.00 77.25  ?  260 GLN B CB  1 
ATOM   5614  C CG  . GLN B 1 266 ? 167.655 -5.328  316.856 1.00 73.24  ?  260 GLN B CG  1 
ATOM   5615  C CD  . GLN B 1 266 ? 167.706 -6.706  317.487 1.00 76.88  ?  260 GLN B CD  1 
ATOM   5616  O OE1 . GLN B 1 266 ? 166.749 -7.145  318.124 1.00 80.62  ?  260 GLN B OE1 1 
ATOM   5617  N NE2 . GLN B 1 266 ? 168.829 -7.395  317.315 1.00 67.82  ?  260 GLN B NE2 1 
ATOM   5618  N N   . LYS B 1 267 ? 164.591 -3.120  315.257 1.00 72.51  ?  261 LYS B N   1 
ATOM   5619  C CA  . LYS B 1 267 ? 163.957 -3.147  313.945 1.00 74.69  ?  261 LYS B CA  1 
ATOM   5620  C C   . LYS B 1 267 ? 163.402 -1.774  313.569 1.00 70.19  ?  261 LYS B C   1 
ATOM   5621  O O   . LYS B 1 267 ? 162.371 -1.670  312.900 1.00 69.84  ?  261 LYS B O   1 
ATOM   5622  C CB  . LYS B 1 267 ? 162.855 -4.207  313.907 1.00 82.93  ?  261 LYS B CB  1 
ATOM   5623  C CG  . LYS B 1 267 ? 162.457 -4.662  312.505 1.00 80.31  ?  261 LYS B CG  1 
ATOM   5624  C CD  . LYS B 1 267 ? 161.257 -5.595  312.538 1.00 66.47  ?  261 LYS B CD  1 
ATOM   5625  C CE  . LYS B 1 267 ? 161.675 -7.040  312.329 1.00 67.70  ?  261 LYS B CE  1 
ATOM   5626  N NZ  . LYS B 1 267 ? 162.283 -7.245  310.984 1.00 56.20  1  261 LYS B NZ  1 
ATOM   5627  N N   . GLY B 1 268 ? 164.073 -0.711  314.004 1.00 76.61  ?  262 GLY B N   1 
ATOM   5628  C CA  . GLY B 1 268 ? 163.603 0.625   313.692 1.00 67.83  ?  262 GLY B CA  1 
ATOM   5629  C C   . GLY B 1 268 ? 163.663 0.913   312.204 1.00 60.35  ?  262 GLY B C   1 
ATOM   5630  O O   . GLY B 1 268 ? 164.502 0.381   311.475 1.00 62.61  ?  262 GLY B O   1 
ATOM   5631  N N   . THR B 1 269 ? 162.755 1.781   311.754 1.00 58.08  ?  263 THR B N   1 
ATOM   5632  C CA  . THR B 1 269 ? 162.633 2.089   310.334 1.00 51.34  ?  263 THR B CA  1 
ATOM   5633  C C   . THR B 1 269 ? 163.816 2.877   309.786 1.00 44.20  ?  263 THR B C   1 
ATOM   5634  O O   . THR B 1 269 ? 163.933 3.008   308.563 1.00 37.80  ?  263 THR B O   1 
ATOM   5635  C CB  . THR B 1 269 ? 161.342 2.869   310.079 1.00 52.32  ?  263 THR B CB  1 
ATOM   5636  O OG1 . THR B 1 269 ? 161.262 3.226   308.693 1.00 58.74  ?  263 THR B OG1 1 
ATOM   5637  C CG2 . THR B 1 269 ? 161.308 4.133   310.926 1.00 46.68  ?  263 THR B CG2 1 
ATOM   5638  N N   . GLY B 1 270 ? 164.693 3.397   310.647 1.00 46.91  ?  264 GLY B N   1 
ATOM   5639  C CA  . GLY B 1 270 ? 165.799 4.214   310.181 1.00 42.06  ?  264 GLY B CA  1 
ATOM   5640  C C   . GLY B 1 270 ? 166.859 3.455   309.411 1.00 40.77  ?  264 GLY B C   1 
ATOM   5641  O O   . GLY B 1 270 ? 167.655 4.077   308.699 1.00 43.05  ?  264 GLY B O   1 
ATOM   5642  N N   . LYS B 1 271 ? 166.888 2.125   309.534 1.00 33.83  ?  265 LYS B N   1 
ATOM   5643  C CA  . LYS B 1 271 ? 167.907 1.345   308.840 1.00 29.68  ?  265 LYS B CA  1 
ATOM   5644  C C   . LYS B 1 271 ? 167.721 1.382   307.329 1.00 35.25  ?  265 LYS B C   1 
ATOM   5645  O O   . LYS B 1 271 ? 168.705 1.294   306.585 1.00 41.92  ?  265 LYS B O   1 
ATOM   5646  C CB  . LYS B 1 271 ? 167.892 -0.101  309.334 1.00 31.81  ?  265 LYS B CB  1 
ATOM   5647  C CG  . LYS B 1 271 ? 166.554 -0.797  309.172 1.00 36.71  ?  265 LYS B CG  1 
ATOM   5648  C CD  . LYS B 1 271 ? 166.705 -2.302  309.278 1.00 34.43  ?  265 LYS B CD  1 
ATOM   5649  C CE  . LYS B 1 271 ? 165.355 -2.994  309.274 1.00 48.26  ?  265 LYS B CE  1 
ATOM   5650  N NZ  . LYS B 1 271 ? 164.558 -2.639  310.480 1.00 60.01  1  265 LYS B NZ  1 
ATOM   5651  N N   . TRP B 1 272 ? 166.479 1.511   306.856 1.00 34.19  ?  266 TRP B N   1 
ATOM   5652  C CA  . TRP B 1 272 ? 166.232 1.522   305.420 1.00 29.88  ?  266 TRP B CA  1 
ATOM   5653  C C   . TRP B 1 272 ? 166.856 2.731   304.740 1.00 33.37  ?  266 TRP B C   1 
ATOM   5654  O O   . TRP B 1 272 ? 167.102 2.690   303.529 1.00 34.73  ?  266 TRP B O   1 
ATOM   5655  C CB  . TRP B 1 272 ? 164.727 1.472   305.150 1.00 32.83  ?  266 TRP B CB  1 
ATOM   5656  C CG  . TRP B 1 272 ? 164.077 0.268   305.754 1.00 30.17  ?  266 TRP B CG  1 
ATOM   5657  C CD1 . TRP B 1 272 ? 163.276 0.234   306.857 1.00 34.19  ?  266 TRP B CD1 1 
ATOM   5658  C CD2 . TRP B 1 272 ? 164.198 -1.087  305.304 1.00 29.87  ?  266 TRP B CD2 1 
ATOM   5659  N NE1 . TRP B 1 272 ? 162.881 -1.057  307.115 1.00 32.18  ?  266 TRP B NE1 1 
ATOM   5660  C CE2 . TRP B 1 272 ? 163.434 -1.886  306.176 1.00 27.85  ?  266 TRP B CE2 1 
ATOM   5661  C CE3 . TRP B 1 272 ? 164.874 -1.700  304.244 1.00 26.89  ?  266 TRP B CE3 1 
ATOM   5662  C CZ2 . TRP B 1 272 ? 163.326 -3.266  306.022 1.00 34.00  ?  266 TRP B CZ2 1 
ATOM   5663  C CZ3 . TRP B 1 272 ? 164.766 -3.071  304.093 1.00 26.94  ?  266 TRP B CZ3 1 
ATOM   5664  C CH2 . TRP B 1 272 ? 163.998 -3.838  304.976 1.00 34.64  ?  266 TRP B CH2 1 
ATOM   5665  N N   . THR B 1 273 ? 167.121 3.803   305.489 1.00 32.26  ?  267 THR B N   1 
ATOM   5666  C CA  . THR B 1 273 ? 167.863 4.926   304.927 1.00 36.62  ?  267 THR B CA  1 
ATOM   5667  C C   . THR B 1 273 ? 169.310 4.537   304.648 1.00 40.82  ?  267 THR B C   1 
ATOM   5668  O O   . THR B 1 273 ? 169.876 4.921   303.618 1.00 40.23  ?  267 THR B O   1 
ATOM   5669  C CB  . THR B 1 273 ? 167.803 6.122   305.875 1.00 35.47  ?  267 THR B CB  1 
ATOM   5670  O OG1 . THR B 1 273 ? 166.443 6.362   306.254 1.00 41.30  ?  267 THR B OG1 1 
ATOM   5671  C CG2 . THR B 1 273 ? 168.364 7.366   305.201 1.00 35.19  ?  267 THR B CG2 1 
ATOM   5672  N N   . ALA B 1 274 ? 169.921 3.771   305.555 1.00 37.37  ?  268 ALA B N   1 
ATOM   5673  C CA  . ALA B 1 274 ? 171.282 3.300   305.328 1.00 29.33  ?  268 ALA B CA  1 
ATOM   5674  C C   . ALA B 1 274 ? 171.329 2.212   304.264 1.00 25.92  ?  268 ALA B C   1 
ATOM   5675  O O   . ALA B 1 274 ? 172.314 2.113   303.525 1.00 27.68  ?  268 ALA B O   1 
ATOM   5676  C CB  . ALA B 1 274 ? 171.888 2.793   306.636 1.00 28.50  ?  268 ALA B CB  1 
ATOM   5677  N N   . ILE B 1 275 ? 170.281 1.390   304.171 1.00 26.44  ?  269 ILE B N   1 
ATOM   5678  C CA  . ILE B 1 275 ? 170.239 0.363   303.135 1.00 26.45  ?  269 ILE B CA  1 
ATOM   5679  C C   . ILE B 1 275 ? 170.091 1.001   301.760 1.00 24.10  ?  269 ILE B C   1 
ATOM   5680  O O   . ILE B 1 275 ? 170.705 0.554   300.784 1.00 24.21  ?  269 ILE B O   1 
ATOM   5681  C CB  . ILE B 1 275 ? 169.112 -0.644  303.424 1.00 22.18  ?  269 ILE B CB  1 
ATOM   5682  C CG1 . ILE B 1 275 ? 169.358 -1.347  304.760 1.00 24.31  ?  269 ILE B CG1 1 
ATOM   5683  C CG2 . ILE B 1 275 ? 169.005 -1.667  302.304 1.00 16.59  ?  269 ILE B CG2 1 
ATOM   5684  C CD1 . ILE B 1 275 ? 168.348 -2.424  305.084 1.00 34.22  ?  269 ILE B CD1 1 
ATOM   5685  N N   . SER B 1 276 ? 169.282 2.060   301.658 1.00 25.04  ?  270 SER B N   1 
ATOM   5686  C CA  . SER B 1 276 ? 169.183 2.789   300.398 1.00 33.53  ?  270 SER B CA  1 
ATOM   5687  C C   . SER B 1 276 ? 170.503 3.456   300.038 1.00 33.62  ?  270 SER B C   1 
ATOM   5688  O O   . SER B 1 276 ? 170.804 3.640   298.853 1.00 30.12  ?  270 SER B O   1 
ATOM   5689  C CB  . SER B 1 276 ? 168.065 3.829   300.472 1.00 32.89  ?  270 SER B CB  1 
ATOM   5690  O OG  . SER B 1 276 ? 166.791 3.209   300.440 1.00 43.00  ?  270 SER B OG  1 
ATOM   5691  N N   . ALA B 1 277 ? 171.301 3.824   301.043 1.00 31.42  ?  271 ALA B N   1 
ATOM   5692  C CA  . ALA B 1 277 ? 172.624 4.377   300.774 1.00 26.38  ?  271 ALA B CA  1 
ATOM   5693  C C   . ALA B 1 277 ? 173.556 3.317   300.201 1.00 27.53  ?  271 ALA B C   1 
ATOM   5694  O O   . ALA B 1 277 ? 174.332 3.596   299.280 1.00 30.35  ?  271 ALA B O   1 
ATOM   5695  C CB  . ALA B 1 277 ? 173.211 4.974   302.050 1.00 27.41  ?  271 ALA B CB  1 
ATOM   5696  N N   . LEU B 1 278 ? 173.495 2.096   300.736 1.00 22.66  ?  272 LEU B N   1 
ATOM   5697  C CA  . LEU B 1 278 ? 174.329 1.018   300.216 1.00 24.73  ?  272 LEU B CA  1 
ATOM   5698  C C   . LEU B 1 278 ? 173.851 0.562   298.843 1.00 28.78  ?  272 LEU B C   1 
ATOM   5699  O O   . LEU B 1 278 ? 174.667 0.229   297.976 1.00 35.59  ?  272 LEU B O   1 
ATOM   5700  C CB  . LEU B 1 278 ? 174.339 -0.153  301.196 1.00 25.01  ?  272 LEU B CB  1 
ATOM   5701  C CG  . LEU B 1 278 ? 175.036 0.095   302.534 1.00 30.27  ?  272 LEU B CG  1 
ATOM   5702  C CD1 . LEU B 1 278 ? 174.562 -0.911  303.563 1.00 29.89  ?  272 LEU B CD1 1 
ATOM   5703  C CD2 . LEU B 1 278 ? 176.545 0.018   302.369 1.00 26.57  ?  272 LEU B CD2 1 
ATOM   5704  N N   . GLU B 1 279 ? 172.533 0.536   298.629 1.00 24.60  ?  273 GLU B N   1 
ATOM   5705  C CA  . GLU B 1 279 ? 172.003 0.127   297.332 1.00 26.83  ?  273 GLU B CA  1 
ATOM   5706  C C   . GLU B 1 279 ? 172.425 1.095   296.234 1.00 31.52  ?  273 GLU B C   1 
ATOM   5707  O O   . GLU B 1 279 ? 172.722 0.677   295.108 1.00 31.82  ?  273 GLU B O   1 
ATOM   5708  C CB  . GLU B 1 279 ? 170.478 0.021   297.394 1.00 31.45  ?  273 GLU B CB  1 
ATOM   5709  C CG  . GLU B 1 279 ? 169.961 -1.178  298.175 1.00 37.72  ?  273 GLU B CG  1 
ATOM   5710  C CD  . GLU B 1 279 ? 168.447 -1.190  298.295 1.00 42.85  ?  273 GLU B CD  1 
ATOM   5711  O OE1 . GLU B 1 279 ? 167.811 -0.176  297.935 1.00 39.00  ?  273 GLU B OE1 1 
ATOM   5712  O OE2 . GLU B 1 279 ? 167.893 -2.213  298.750 1.00 37.61  -1 273 GLU B OE2 1 
ATOM   5713  N N   . TYR B 1 280 ? 172.464 2.389   296.542 1.00 32.80  ?  274 TYR B N   1 
ATOM   5714  C CA  . TYR B 1 280 ? 172.815 3.414   295.570 1.00 29.37  ?  274 TYR B CA  1 
ATOM   5715  C C   . TYR B 1 280 ? 174.272 3.845   295.654 1.00 32.75  ?  274 TYR B C   1 
ATOM   5716  O O   . TYR B 1 280 ? 174.687 4.725   294.894 1.00 41.98  ?  274 TYR B O   1 
ATOM   5717  C CB  . TYR B 1 280 ? 171.901 4.632   295.741 1.00 36.16  ?  274 TYR B CB  1 
ATOM   5718  C CG  . TYR B 1 280 ? 170.465 4.364   295.352 1.00 38.82  ?  274 TYR B CG  1 
ATOM   5719  C CD1 . TYR B 1 280 ? 170.162 3.610   294.226 1.00 41.42  ?  274 TYR B CD1 1 
ATOM   5720  C CD2 . TYR B 1 280 ? 169.413 4.853   296.115 1.00 34.78  ?  274 TYR B CD2 1 
ATOM   5721  C CE1 . TYR B 1 280 ? 168.854 3.357   293.865 1.00 39.28  ?  274 TYR B CE1 1 
ATOM   5722  C CE2 . TYR B 1 280 ? 168.101 4.604   295.763 1.00 33.81  ?  274 TYR B CE2 1 
ATOM   5723  C CZ  . TYR B 1 280 ? 167.827 3.856   294.637 1.00 36.25  ?  274 TYR B CZ  1 
ATOM   5724  O OH  . TYR B 1 280 ? 166.523 3.604   294.281 1.00 40.71  ?  274 TYR B OH  1 
ATOM   5725  N N   . GLY B 1 281 ? 175.054 3.251   296.550 1.00 27.46  ?  275 GLY B N   1 
ATOM   5726  C CA  . GLY B 1 281 ? 176.470 3.573   296.641 1.00 26.05  ?  275 GLY B CA  1 
ATOM   5727  C C   . GLY B 1 281 ? 176.759 4.997   297.064 1.00 29.28  ?  275 GLY B C   1 
ATOM   5728  O O   . GLY B 1 281 ? 177.628 5.653   296.475 1.00 26.73  ?  275 GLY B O   1 
ATOM   5729  N N   . VAL B 1 282 ? 176.054 5.489   298.070 1.00 29.39  ?  276 VAL B N   1 
ATOM   5730  C CA  . VAL B 1 282 ? 176.218 6.850   298.577 1.00 31.77  ?  276 VAL B CA  1 
ATOM   5731  C C   . VAL B 1 282 ? 176.805 6.763   299.980 1.00 31.72  ?  276 VAL B C   1 
ATOM   5732  O O   . VAL B 1 282 ? 176.251 6.052   300.826 1.00 36.53  ?  276 VAL B O   1 
ATOM   5733  C CB  . VAL B 1 282 ? 174.885 7.621   298.593 1.00 35.86  ?  276 VAL B CB  1 
ATOM   5734  C CG1 . VAL B 1 282 ? 175.100 9.046   299.077 1.00 39.40  ?  276 VAL B CG1 1 
ATOM   5735  C CG2 . VAL B 1 282 ? 174.254 7.609   297.212 1.00 27.50  ?  276 VAL B CG2 1 
ATOM   5736  N N   . PRO B 1 283 ? 177.907 7.459   300.269 1.00 28.33  ?  277 PRO B N   1 
ATOM   5737  C CA  . PRO B 1 283 ? 178.531 7.336   301.593 1.00 30.34  ?  277 PRO B CA  1 
ATOM   5738  C C   . PRO B 1 283 ? 177.748 8.033   302.696 1.00 31.84  ?  277 PRO B C   1 
ATOM   5739  O O   . PRO B 1 283 ? 178.200 9.043   303.244 1.00 37.84  ?  277 PRO B O   1 
ATOM   5740  C CB  . PRO B 1 283 ? 179.904 7.986   301.388 1.00 33.29  ?  277 PRO B CB  1 
ATOM   5741  C CG  . PRO B 1 283 ? 179.684 8.969   300.289 1.00 28.13  ?  277 PRO B CG  1 
ATOM   5742  C CD  . PRO B 1 283 ? 178.676 8.336   299.370 1.00 32.20  ?  277 PRO B CD  1 
ATOM   5743  N N   . VAL B 1 284 ? 176.576 7.503   303.033 1.00 28.78  ?  278 VAL B N   1 
ATOM   5744  C CA  . VAL B 1 284 ? 175.785 8.034   304.157 1.00 32.94  ?  278 VAL B CA  1 
ATOM   5745  C C   . VAL B 1 284 ? 176.256 7.270   305.389 1.00 31.15  ?  278 VAL B C   1 
ATOM   5746  O O   . VAL B 1 284 ? 175.610 6.345   305.888 1.00 37.49  ?  278 VAL B O   1 
ATOM   5747  C CB  . VAL B 1 284 ? 174.278 7.913   303.911 1.00 29.78  ?  278 VAL B CB  1 
ATOM   5748  C CG1 . VAL B 1 284 ? 173.497 8.604   305.014 1.00 26.88  ?  278 VAL B CG1 1 
ATOM   5749  C CG2 . VAL B 1 284 ? 173.918 8.503   302.557 1.00 27.90  ?  278 VAL B CG2 1 
ATOM   5750  N N   . THR B 1 285 ? 177.423 7.671   305.895 1.00 28.63  ?  279 THR B N   1 
ATOM   5751  C CA  . THR B 1 285 ? 178.094 6.903   306.939 1.00 34.32  ?  279 THR B CA  1 
ATOM   5752  C C   . THR B 1 285 ? 177.507 7.174   308.319 1.00 41.32  ?  279 THR B C   1 
ATOM   5753  O O   . THR B 1 285 ? 177.404 6.256   309.141 1.00 42.07  ?  279 THR B O   1 
ATOM   5754  C CB  . THR B 1 285 ? 179.590 7.214   306.937 1.00 28.08  ?  279 THR B CB  1 
ATOM   5755  O OG1 . THR B 1 285 ? 179.797 8.558   307.389 1.00 34.91  ?  279 THR B OG1 1 
ATOM   5756  C CG2 . THR B 1 285 ? 180.157 7.071   305.536 1.00 26.38  ?  279 THR B CG2 1 
ATOM   5757  N N   . LEU B 1 286 ? 177.122 8.422   308.594 1.00 44.06  ?  280 LEU B N   1 
ATOM   5758  C CA  . LEU B 1 286 ? 176.657 8.770   309.934 1.00 40.80  ?  280 LEU B CA  1 
ATOM   5759  C C   . LEU B 1 286 ? 175.332 8.090   310.257 1.00 43.05  ?  280 LEU B C   1 
ATOM   5760  O O   . LEU B 1 286 ? 175.118 7.645   311.391 1.00 38.98  ?  280 LEU B O   1 
ATOM   5761  C CB  . LEU B 1 286 ? 176.536 10.289  310.067 1.00 34.40  ?  280 LEU B CB  1 
ATOM   5762  C CG  . LEU B 1 286 ? 176.383 10.876  311.474 1.00 39.99  ?  280 LEU B CG  1 
ATOM   5763  C CD1 . LEU B 1 286 ? 177.016 12.255  311.537 1.00 41.45  ?  280 LEU B CD1 1 
ATOM   5764  C CD2 . LEU B 1 286 ? 174.922 10.954  311.888 1.00 44.76  ?  280 LEU B CD2 1 
ATOM   5765  N N   . ILE B 1 287 ? 174.429 8.005   309.277 1.00 39.95  ?  281 ILE B N   1 
ATOM   5766  C CA  . ILE B 1 287 ? 173.144 7.350   309.506 1.00 35.09  ?  281 ILE B CA  1 
ATOM   5767  C C   . ILE B 1 287 ? 173.349 5.866   309.785 1.00 37.24  ?  281 ILE B C   1 
ATOM   5768  O O   . ILE B 1 287 ? 172.699 5.288   310.665 1.00 36.41  ?  281 ILE B O   1 
ATOM   5769  C CB  . ILE B 1 287 ? 172.199 7.585   308.310 1.00 37.72  ?  281 ILE B CB  1 
ATOM   5770  C CG1 . ILE B 1 287 ? 171.513 8.953   308.411 1.00 39.09  ?  281 ILE B CG1 1 
ATOM   5771  C CG2 . ILE B 1 287 ? 171.154 6.481   308.217 1.00 32.77  ?  281 ILE B CG2 1 
ATOM   5772  C CD1 . ILE B 1 287 ? 172.404 10.143  308.107 1.00 43.35  ?  281 ILE B CD1 1 
ATOM   5773  N N   . GLY B 1 288 ? 174.268 5.231   309.054 1.00 38.89  ?  282 GLY B N   1 
ATOM   5774  C CA  . GLY B 1 288 ? 174.553 3.827   309.301 1.00 36.97  ?  282 GLY B CA  1 
ATOM   5775  C C   . GLY B 1 288 ? 175.139 3.582   310.678 1.00 36.07  ?  282 GLY B C   1 
ATOM   5776  O O   . GLY B 1 288 ? 174.852 2.564   311.313 1.00 35.40  ?  282 GLY B O   1 
ATOM   5777  N N   . GLU B 1 289 ? 175.968 4.511   311.160 1.00 37.85  ?  283 GLU B N   1 
ATOM   5778  C CA  . GLU B 1 289 ? 176.527 4.372   312.501 1.00 44.03  ?  283 GLU B CA  1 
ATOM   5779  C C   . GLU B 1 289 ? 175.451 4.532   313.566 1.00 35.28  ?  283 GLU B C   1 
ATOM   5780  O O   . GLU B 1 289 ? 175.472 3.835   314.587 1.00 34.57  ?  283 GLU B O   1 
ATOM   5781  C CB  . GLU B 1 289 ? 177.650 5.388   312.714 1.00 48.74  ?  283 GLU B CB  1 
ATOM   5782  C CG  . GLU B 1 289 ? 178.925 5.086   311.939 1.00 41.31  ?  283 GLU B CG  1 
ATOM   5783  C CD  . GLU B 1 289 ? 179.684 3.894   312.494 1.00 46.89  ?  283 GLU B CD  1 
ATOM   5784  O OE1 . GLU B 1 289 ? 179.361 3.442   313.613 1.00 47.02  ?  283 GLU B OE1 1 
ATOM   5785  O OE2 . GLU B 1 289 ? 180.609 3.409   311.809 1.00 49.05  -1 283 GLU B OE2 1 
ATOM   5786  N N   . ALA B 1 290 ? 174.502 5.445   313.348 1.00 33.77  ?  284 ALA B N   1 
ATOM   5787  C CA  . ALA B 1 290 ? 173.399 5.603   314.289 1.00 36.58  ?  284 ALA B CA  1 
ATOM   5788  C C   . ALA B 1 290 ? 172.539 4.346   314.342 1.00 36.82  ?  284 ALA B C   1 
ATOM   5789  O O   . ALA B 1 290 ? 172.051 3.962   315.411 1.00 36.42  ?  284 ALA B O   1 
ATOM   5790  C CB  . ALA B 1 290 ? 172.554 6.818   313.910 1.00 36.25  ?  284 ALA B CB  1 
ATOM   5791  N N   . VAL B 1 291 ? 172.344 3.692   313.196 1.00 34.16  ?  285 VAL B N   1 
ATOM   5792  C CA  . VAL B 1 291 ? 171.579 2.449   313.172 1.00 32.75  ?  285 VAL B CA  1 
ATOM   5793  C C   . VAL B 1 291 ? 172.349 1.341   313.878 1.00 33.56  ?  285 VAL B C   1 
ATOM   5794  O O   . VAL B 1 291 ? 171.800 0.620   314.720 1.00 30.38  ?  285 VAL B O   1 
ATOM   5795  C CB  . VAL B 1 291 ? 171.231 2.061   311.724 1.00 26.33  ?  285 VAL B CB  1 
ATOM   5796  C CG1 . VAL B 1 291 ? 170.558 0.700   311.689 1.00 26.25  ?  285 VAL B CG1 1 
ATOM   5797  C CG2 . VAL B 1 291 ? 170.336 3.116   311.095 1.00 28.51  ?  285 VAL B CG2 1 
ATOM   5798  N N   . PHE B 1 292 ? 173.635 1.192   313.549 1.00 39.47  ?  286 PHE B N   1 
ATOM   5799  C CA  . PHE B 1 292 ? 174.457 0.178   314.201 1.00 41.38  ?  286 PHE B CA  1 
ATOM   5800  C C   . PHE B 1 292 ? 174.594 0.438   315.695 1.00 41.53  ?  286 PHE B C   1 
ATOM   5801  O O   . PHE B 1 292 ? 174.739 -0.509  316.478 1.00 35.07  ?  286 PHE B O   1 
ATOM   5802  C CB  . PHE B 1 292 ? 175.837 0.123   313.546 1.00 41.88  ?  286 PHE B CB  1 
ATOM   5803  C CG  . PHE B 1 292 ? 175.864 -0.618  312.239 1.00 39.26  ?  286 PHE B CG  1 
ATOM   5804  C CD1 . PHE B 1 292 ? 175.056 -1.723  312.035 1.00 33.64  ?  286 PHE B CD1 1 
ATOM   5805  C CD2 . PHE B 1 292 ? 176.705 -0.211  311.215 1.00 43.27  ?  286 PHE B CD2 1 
ATOM   5806  C CE1 . PHE B 1 292 ? 175.085 -2.408  310.834 1.00 34.49  ?  286 PHE B CE1 1 
ATOM   5807  C CE2 . PHE B 1 292 ? 176.736 -0.890  310.011 1.00 35.47  ?  286 PHE B CE2 1 
ATOM   5808  C CZ  . PHE B 1 292 ? 175.925 -1.990  309.821 1.00 31.32  ?  286 PHE B CZ  1 
ATOM   5809  N N   . ALA B 1 293 ? 174.550 1.707   316.110 1.00 39.21  ?  287 ALA B N   1 
ATOM   5810  C CA  . ALA B 1 293 ? 174.659 2.025   317.531 1.00 34.48  ?  287 ALA B CA  1 
ATOM   5811  C C   . ALA B 1 293 ? 173.460 1.500   318.311 1.00 44.13  ?  287 ALA B C   1 
ATOM   5812  O O   . ALA B 1 293 ? 173.620 0.954   319.410 1.00 44.80  ?  287 ALA B O   1 
ATOM   5813  C CB  . ALA B 1 293 ? 174.805 3.534   317.722 1.00 28.52  ?  287 ALA B CB  1 
ATOM   5814  N N   . ARG B 1 294 ? 172.252 1.658   317.764 1.00 45.05  ?  288 ARG B N   1 
ATOM   5815  C CA  . ARG B 1 294 ? 171.068 1.121   318.429 1.00 43.41  ?  288 ARG B CA  1 
ATOM   5816  C C   . ARG B 1 294 ? 171.127 -0.399  318.512 1.00 50.11  ?  288 ARG B C   1 
ATOM   5817  O O   . ARG B 1 294 ? 170.730 -0.989  319.524 1.00 53.17  ?  288 ARG B O   1 
ATOM   5818  C CB  . ARG B 1 294 ? 169.799 1.564   317.699 1.00 41.77  ?  288 ARG B CB  1 
ATOM   5819  C CG  . ARG B 1 294 ? 169.492 3.049   317.801 1.00 50.49  ?  288 ARG B CG  1 
ATOM   5820  C CD  . ARG B 1 294 ? 168.081 3.343   317.313 1.00 47.15  ?  288 ARG B CD  1 
ATOM   5821  N NE  . ARG B 1 294 ? 167.765 4.768   317.348 1.00 42.52  ?  288 ARG B NE  1 
ATOM   5822  C CZ  . ARG B 1 294 ? 166.569 5.273   317.065 1.00 44.11  ?  288 ARG B CZ  1 
ATOM   5823  N NH1 . ARG B 1 294 ? 165.570 4.469   316.727 1.00 46.98  1  288 ARG B NH1 1 
ATOM   5824  N NH2 . ARG B 1 294 ? 166.369 6.583   317.120 1.00 44.55  ?  288 ARG B NH2 1 
ATOM   5825  N N   . CYS B 1 295 ? 171.619 -1.050  317.455 1.00 49.16  ?  289 CYS B N   1 
ATOM   5826  C CA  . CYS B 1 295 ? 171.738 -2.503  317.471 1.00 52.62  ?  289 CYS B CA  1 
ATOM   5827  C C   . CYS B 1 295 ? 172.771 -2.970  318.487 1.00 50.53  ?  289 CYS B C   1 
ATOM   5828  O O   . CYS B 1 295 ? 172.609 -4.038  319.088 1.00 46.71  ?  289 CYS B O   1 
ATOM   5829  C CB  . CYS B 1 295 ? 172.091 -3.013  316.074 1.00 49.91  ?  289 CYS B CB  1 
ATOM   5830  S SG  . CYS B 1 295 ? 170.947 -2.468  314.785 1.00 52.67  ?  289 CYS B SG  1 
ATOM   5831  N N   . LEU B 1 296 ? 173.836 -2.190  318.689 1.00 50.10  ?  290 LEU B N   1 
ATOM   5832  C CA  . LEU B 1 296 ? 174.790 -2.502  319.748 1.00 50.09  ?  290 LEU B CA  1 
ATOM   5833  C C   . LEU B 1 296 ? 174.160 -2.345  321.125 1.00 50.76  ?  290 LEU B C   1 
ATOM   5834  O O   . LEU B 1 296 ? 174.526 -3.066  322.061 1.00 50.20  ?  290 LEU B O   1 
ATOM   5835  C CB  . LEU B 1 296 ? 176.024 -1.607  319.619 1.00 41.48  ?  290 LEU B CB  1 
ATOM   5836  C CG  . LEU B 1 296 ? 177.104 -1.723  320.697 1.00 37.38  ?  290 LEU B CG  1 
ATOM   5837  C CD1 . LEU B 1 296 ? 177.661 -3.136  320.753 1.00 45.01  ?  290 LEU B CD1 1 
ATOM   5838  C CD2 . LEU B 1 296 ? 178.213 -0.713  320.451 1.00 35.28  ?  290 LEU B CD2 1 
ATOM   5839  N N   . SER B 1 297 ? 173.206 -1.421  321.263 1.00 50.42  ?  291 SER B N   1 
ATOM   5840  C CA  . SER B 1 297 ? 172.550 -1.208  322.548 1.00 49.90  ?  291 SER B CA  1 
ATOM   5841  C C   . SER B 1 297 ? 171.683 -2.395  322.944 1.00 57.45  ?  291 SER B C   1 
ATOM   5842  O O   . SER B 1 297 ? 171.557 -2.697  324.136 1.00 62.61  ?  291 SER B O   1 
ATOM   5843  C CB  . SER B 1 297 ? 171.707 0.064   322.496 1.00 47.71  ?  291 SER B CB  1 
ATOM   5844  O OG  . SER B 1 297 ? 172.464 1.154   322.000 1.00 64.66  ?  291 SER B OG  1 
ATOM   5845  N N   . SER B 1 298 ? 171.081 -3.076  321.965 1.00 56.20  ?  292 SER B N   1 
ATOM   5846  C CA  . SER B 1 298 ? 170.208 -4.205  322.266 1.00 57.44  ?  292 SER B CA  1 
ATOM   5847  C C   . SER B 1 298 ? 170.960 -5.365  322.903 1.00 61.23  ?  292 SER B C   1 
ATOM   5848  O O   . SER B 1 298 ? 170.331 -6.235  323.515 1.00 67.19  ?  292 SER B O   1 
ATOM   5849  C CB  . SER B 1 298 ? 169.503 -4.676  320.994 1.00 56.79  ?  292 SER B CB  1 
ATOM   5850  O OG  . SER B 1 298 ? 168.686 -3.652  320.454 1.00 70.33  ?  292 SER B OG  1 
ATOM   5851  N N   . LEU B 1 299 ? 172.285 -5.399  322.777 1.00 58.82  ?  293 LEU B N   1 
ATOM   5852  C CA  . LEU B 1 299 ? 173.096 -6.455  323.383 1.00 60.39  ?  293 LEU B CA  1 
ATOM   5853  C C   . LEU B 1 299 ? 173.474 -6.077  324.817 1.00 67.24  ?  293 LEU B C   1 
ATOM   5854  O O   . LEU B 1 299 ? 174.644 -5.987  325.187 1.00 67.02  ?  293 LEU B O   1 
ATOM   5855  C CB  . LEU B 1 299 ? 174.331 -6.721  322.531 1.00 58.62  ?  293 LEU B CB  1 
ATOM   5856  C CG  . LEU B 1 299 ? 174.060 -7.080  321.069 1.00 52.53  ?  293 LEU B CG  1 
ATOM   5857  C CD1 . LEU B 1 299 ? 175.363 -7.298  320.319 1.00 56.57  ?  293 LEU B CD1 1 
ATOM   5858  C CD2 . LEU B 1 299 ? 173.170 -8.309  320.974 1.00 57.53  ?  293 LEU B CD2 1 
ATOM   5859  N N   . LYS B 1 300 ? 172.437 -5.853  325.628 1.00 65.77  ?  294 LYS B N   1 
ATOM   5860  C CA  . LYS B 1 300 ? 172.648 -5.441  327.013 1.00 58.98  ?  294 LYS B CA  1 
ATOM   5861  C C   . LYS B 1 300 ? 173.358 -6.528  327.810 1.00 60.34  ?  294 LYS B C   1 
ATOM   5862  O O   . LYS B 1 300 ? 174.322 -6.254  328.533 1.00 65.60  ?  294 LYS B O   1 
ATOM   5863  C CB  . LYS B 1 300 ? 171.309 -5.084  327.660 1.00 63.59  ?  294 LYS B CB  1 
ATOM   5864  C CG  . LYS B 1 300 ? 171.408 -4.692  329.126 1.00 61.04  ?  294 LYS B CG  1 
ATOM   5865  C CD  . LYS B 1 300 ? 172.126 -3.365  329.301 1.00 62.40  ?  294 LYS B CD  1 
ATOM   5866  C CE  . LYS B 1 300 ? 172.172 -2.953  330.764 1.00 67.87  ?  294 LYS B CE  1 
ATOM   5867  N NZ  . LYS B 1 300 ? 172.777 -1.604  330.944 1.00 73.01  1  294 LYS B NZ  1 
ATOM   5868  N N   . ASP B 1 301 ? 172.896 -7.775  327.685 1.00 64.90  ?  295 ASP B N   1 
ATOM   5869  C CA  . ASP B 1 301 ? 173.501 -8.867  328.441 1.00 69.43  ?  295 ASP B CA  1 
ATOM   5870  C C   . ASP B 1 301 ? 174.943 -9.123  328.020 1.00 71.73  ?  295 ASP B C   1 
ATOM   5871  O O   . ASP B 1 301 ? 175.775 -9.486  328.859 1.00 64.72  ?  295 ASP B O   1 
ATOM   5872  C CB  . ASP B 1 301 ? 172.667 -10.138 328.283 1.00 75.82  ?  295 ASP B CB  1 
ATOM   5873  C CG  . ASP B 1 301 ? 171.272 -9.996  328.859 1.00 84.93  ?  295 ASP B CG  1 
ATOM   5874  O OD1 . ASP B 1 301 ? 171.095 -9.188  329.797 1.00 85.33  ?  295 ASP B OD1 1 
ATOM   5875  O OD2 . ASP B 1 301 ? 170.353 -10.694 328.379 1.00 87.57  -1 295 ASP B OD2 1 
ATOM   5876  N N   . GLU B 1 302 ? 175.261 -8.942  326.735 1.00 73.48  ?  296 GLU B N   1 
ATOM   5877  C CA  . GLU B 1 302 ? 176.641 -9.119  326.295 1.00 71.76  ?  296 GLU B CA  1 
ATOM   5878  C C   . GLU B 1 302 ? 177.533 -7.997  326.809 1.00 67.53  ?  296 GLU B C   1 
ATOM   5879  O O   . GLU B 1 302 ? 178.705 -8.227  327.127 1.00 64.66  ?  296 GLU B O   1 
ATOM   5880  C CB  . GLU B 1 302 ? 176.712 -9.200  324.770 1.00 73.02  ?  296 GLU B CB  1 
ATOM   5881  C CG  . GLU B 1 302 ? 176.069 -10.442 324.177 1.00 76.87  ?  296 GLU B CG  1 
ATOM   5882  C CD  . GLU B 1 302 ? 176.488 -10.682 322.740 1.00 79.12  ?  296 GLU B CD  1 
ATOM   5883  O OE1 . GLU B 1 302 ? 177.560 -10.179 322.341 1.00 72.45  ?  296 GLU B OE1 1 
ATOM   5884  O OE2 . GLU B 1 302 ? 175.747 -11.373 322.009 1.00 86.62  -1 296 GLU B OE2 1 
ATOM   5885  N N   . ARG B 1 303 ? 177.000 -6.776  326.897 1.00 66.73  ?  297 ARG B N   1 
ATOM   5886  C CA  . ARG B 1 303 ? 177.795 -5.654  327.385 1.00 63.52  ?  297 ARG B CA  1 
ATOM   5887  C C   . ARG B 1 303 ? 177.984 -5.697  328.896 1.00 64.21  ?  297 ARG B C   1 
ATOM   5888  O O   . ARG B 1 303 ? 178.985 -5.178  329.404 1.00 64.77  ?  297 ARG B O   1 
ATOM   5889  C CB  . ARG B 1 303 ? 177.150 -4.331  326.969 1.00 60.97  ?  297 ARG B CB  1 
ATOM   5890  C CG  . ARG B 1 303 ? 177.202 -4.077  325.471 1.00 56.44  ?  297 ARG B CG  1 
ATOM   5891  C CD  . ARG B 1 303 ? 176.658 -2.707  325.101 1.00 56.11  ?  297 ARG B CD  1 
ATOM   5892  N NE  . ARG B 1 303 ? 175.218 -2.595  325.320 1.00 57.52  ?  297 ARG B NE  1 
ATOM   5893  C CZ  . ARG B 1 303 ? 174.666 -1.979  326.360 1.00 60.39  ?  297 ARG B CZ  1 
ATOM   5894  N NH1 . ARG B 1 303 ? 175.433 -1.413  327.281 1.00 58.78  1  297 ARG B NH1 1 
ATOM   5895  N NH2 . ARG B 1 303 ? 173.345 -1.926  326.477 1.00 64.74  ?  297 ARG B NH2 1 
ATOM   5896  N N   . ILE B 1 304 ? 177.044 -6.299  329.627 1.00 68.09  ?  298 ILE B N   1 
ATOM   5897  C CA  . ILE B 1 304 ? 177.229 -6.477  331.064 1.00 68.14  ?  298 ILE B CA  1 
ATOM   5898  C C   . ILE B 1 304 ? 178.360 -7.462  331.332 1.00 65.76  ?  298 ILE B C   1 
ATOM   5899  O O   . ILE B 1 304 ? 179.215 -7.228  332.194 1.00 66.84  ?  298 ILE B O   1 
ATOM   5900  C CB  . ILE B 1 304 ? 175.913 -6.929  331.723 1.00 62.44  ?  298 ILE B CB  1 
ATOM   5901  C CG1 . ILE B 1 304 ? 174.869 -5.811  331.658 1.00 62.82  ?  298 ILE B CG1 1 
ATOM   5902  C CG2 . ILE B 1 304 ? 176.152 -7.351  333.166 1.00 67.31  ?  298 ILE B CG2 1 
ATOM   5903  C CD1 . ILE B 1 304 ? 173.529 -6.191  332.252 1.00 56.15  ?  298 ILE B CD1 1 
ATOM   5904  N N   . GLN B 1 305 ? 178.388 -8.574  330.593 1.00 61.03  ?  299 GLN B N   1 
ATOM   5905  C CA  . GLN B 1 305 ? 179.463 -9.546  330.757 1.00 66.83  ?  299 GLN B CA  1 
ATOM   5906  C C   . GLN B 1 305 ? 180.782 -9.023  330.199 1.00 69.24  ?  299 GLN B C   1 
ATOM   5907  O O   . GLN B 1 305 ? 181.853 -9.389  330.697 1.00 68.86  ?  299 GLN B O   1 
ATOM   5908  C CB  . GLN B 1 305 ? 179.076 -10.865 330.085 1.00 75.94  ?  299 GLN B CB  1 
ATOM   5909  C CG  . GLN B 1 305 ? 180.115 -11.970 330.204 1.00 81.22  ?  299 GLN B CG  1 
ATOM   5910  C CD  . GLN B 1 305 ? 179.574 -13.323 329.786 1.00 86.73  ?  299 GLN B CD  1 
ATOM   5911  O OE1 . GLN B 1 305 ? 178.479 -13.717 330.189 1.00 89.93  ?  299 GLN B OE1 1 
ATOM   5912  N NE2 . GLN B 1 305 ? 180.336 -14.041 328.970 1.00 78.64  ?  299 GLN B NE2 1 
ATOM   5913  N N   . ALA B 1 306 ? 180.727 -8.164  329.179 1.00 68.08  ?  300 ALA B N   1 
ATOM   5914  C CA  . ALA B 1 306 ? 181.955 -7.623  328.605 1.00 60.39  ?  300 ALA B CA  1 
ATOM   5915  C C   . ALA B 1 306 ? 182.604 -6.608  329.537 1.00 65.49  ?  300 ALA B C   1 
ATOM   5916  O O   . ALA B 1 306 ? 183.835 -6.526  329.612 1.00 66.93  ?  300 ALA B O   1 
ATOM   5917  C CB  . ALA B 1 306 ? 181.668 -6.992  327.243 1.00 61.53  ?  300 ALA B CB  1 
ATOM   5918  N N   . SER B 1 307 ? 181.793 -5.826  330.257 1.00 66.88  ?  301 SER B N   1 
ATOM   5919  C CA  . SER B 1 307 ? 182.346 -4.836  331.175 1.00 62.39  ?  301 SER B CA  1 
ATOM   5920  C C   . SER B 1 307 ? 183.138 -5.492  332.297 1.00 62.76  ?  301 SER B C   1 
ATOM   5921  O O   . SER B 1 307 ? 184.053 -4.874  332.855 1.00 60.64  ?  301 SER B O   1 
ATOM   5922  C CB  . SER B 1 307 ? 181.225 -3.969  331.752 1.00 64.90  ?  301 SER B CB  1 
ATOM   5923  O OG  . SER B 1 307 ? 180.295 -4.751  332.480 1.00 74.36  ?  301 SER B OG  1 
ATOM   5924  N N   . LYS B 1 308 ? 182.808 -6.737  332.639 1.00 67.73  ?  302 LYS B N   1 
ATOM   5925  C CA  . LYS B 1 308 ? 183.546 -7.460  333.665 1.00 66.22  ?  302 LYS B CA  1 
ATOM   5926  C C   . LYS B 1 308 ? 184.832 -8.079  333.133 1.00 64.20  ?  302 LYS B C   1 
ATOM   5927  O O   . LYS B 1 308 ? 185.739 -8.363  333.922 1.00 69.47  ?  302 LYS B O   1 
ATOM   5928  C CB  . LYS B 1 308 ? 182.664 -8.553  334.273 1.00 68.60  ?  302 LYS B CB  1 
ATOM   5929  C CG  . LYS B 1 308 ? 181.272 -8.081  334.669 1.00 66.83  ?  302 LYS B CG  1 
ATOM   5930  C CD  . LYS B 1 308 ? 181.328 -7.029  335.765 1.00 74.27  ?  302 LYS B CD  1 
ATOM   5931  C CE  . LYS B 1 308 ? 179.962 -6.399  335.994 1.00 77.59  ?  302 LYS B CE  1 
ATOM   5932  N NZ  . LYS B 1 308 ? 178.917 -7.415  336.302 1.00 78.43  1  302 LYS B NZ  1 
ATOM   5933  N N   . LYS B 1 309 ? 184.932 -8.288  331.822 1.00 65.79  ?  303 LYS B N   1 
ATOM   5934  C CA  . LYS B 1 309 ? 186.091 -8.927  331.208 1.00 67.55  ?  303 LYS B CA  1 
ATOM   5935  C C   . LYS B 1 309 ? 186.926 -7.986  330.355 1.00 69.36  ?  303 LYS B C   1 
ATOM   5936  O O   . LYS B 1 309 ? 188.155 -8.083  330.366 1.00 69.11  ?  303 LYS B O   1 
ATOM   5937  C CB  . LYS B 1 309 ? 185.643 -10.117 330.350 1.00 64.71  ?  303 LYS B CB  1 
ATOM   5938  C CG  . LYS B 1 309 ? 184.849 -11.168 331.112 1.00 69.04  ?  303 LYS B CG  1 
ATOM   5939  C CD  . LYS B 1 309 ? 184.451 -12.337 330.218 1.00 71.28  ?  303 LYS B CD  1 
ATOM   5940  C CE  . LYS B 1 309 ? 185.641 -13.223 329.871 1.00 71.97  ?  303 LYS B CE  1 
ATOM   5941  N NZ  . LYS B 1 309 ? 186.635 -12.546 328.991 1.00 69.27  1  303 LYS B NZ  1 
ATOM   5942  N N   . LEU B 1 310 ? 186.296 -7.079  329.613 1.00 71.21  ?  304 LEU B N   1 
ATOM   5943  C CA  . LEU B 1 310 ? 187.014 -6.142  328.760 1.00 64.81  ?  304 LEU B CA  1 
ATOM   5944  C C   . LEU B 1 310 ? 187.286 -4.846  329.512 1.00 69.28  ?  304 LEU B C   1 
ATOM   5945  O O   . LEU B 1 310 ? 186.405 -4.310  330.190 1.00 76.35  ?  304 LEU B O   1 
ATOM   5946  C CB  . LEU B 1 310 ? 186.216 -5.849  327.488 1.00 68.11  ?  304 LEU B CB  1 
ATOM   5947  C CG  . LEU B 1 310 ? 185.936 -7.040  326.570 1.00 62.22  ?  304 LEU B CG  1 
ATOM   5948  C CD1 . LEU B 1 310 ? 184.996 -6.640  325.443 1.00 51.41  ?  304 LEU B CD1 1 
ATOM   5949  C CD2 . LEU B 1 310 ? 187.234 -7.601  326.014 1.00 52.68  ?  304 LEU B CD2 1 
ATOM   5950  N N   . LYS B 1 311 ? 188.510 -4.345  329.384 1.00 69.51  ?  305 LYS B N   1 
ATOM   5951  C CA  . LYS B 1 311 ? 188.934 -3.141  330.081 1.00 71.31  ?  305 LYS B CA  1 
ATOM   5952  C C   . LYS B 1 311 ? 189.096 -1.986  329.102 1.00 67.63  ?  305 LYS B C   1 
ATOM   5953  O O   . LYS B 1 311 ? 189.263 -2.179  327.894 1.00 70.72  ?  305 LYS B O   1 
ATOM   5954  C CB  . LYS B 1 311 ? 190.246 -3.376  330.840 1.00 67.61  ?  305 LYS B CB  1 
ATOM   5955  C CG  . LYS B 1 311 ? 190.230 -4.591  331.762 1.00 64.18  ?  305 LYS B CG  1 
ATOM   5956  C CD  . LYS B 1 311 ? 188.965 -4.643  332.614 1.00 76.05  ?  305 LYS B CD  1 
ATOM   5957  C CE  . LYS B 1 311 ? 188.882 -3.479  333.592 1.00 84.66  ?  305 LYS B CE  1 
ATOM   5958  N NZ  . LYS B 1 311 ? 187.532 -3.389  334.216 1.00 70.09  1  305 LYS B NZ  1 
ATOM   5959  N N   . GLY B 1 312 ? 189.043 -0.772  329.645 1.00 58.54  ?  306 GLY B N   1 
ATOM   5960  C CA  . GLY B 1 312 ? 189.147 0.425   328.848 1.00 57.59  ?  306 GLY B CA  1 
ATOM   5961  C C   . GLY B 1 312 ? 190.530 1.040   328.895 1.00 61.54  ?  306 GLY B C   1 
ATOM   5962  O O   . GLY B 1 312 ? 191.527 0.368   329.182 1.00 64.73  ?  306 GLY B O   1 
ATOM   5963  N N   . PRO B 1 313 ? 190.617 2.339   328.611 1.00 58.29  ?  307 PRO B N   1 
ATOM   5964  C CA  . PRO B 1 313 ? 191.926 3.003   328.591 1.00 62.08  ?  307 PRO B CA  1 
ATOM   5965  C C   . PRO B 1 313 ? 192.474 3.171   330.000 1.00 70.77  ?  307 PRO B C   1 
ATOM   5966  O O   . PRO B 1 313 ? 191.772 3.625   330.907 1.00 69.80  ?  307 PRO B O   1 
ATOM   5967  C CB  . PRO B 1 313 ? 191.627 4.355   327.936 1.00 53.65  ?  307 PRO B CB  1 
ATOM   5968  C CG  . PRO B 1 313 ? 190.204 4.617   328.289 1.00 62.92  ?  307 PRO B CG  1 
ATOM   5969  C CD  . PRO B 1 313 ? 189.520 3.273   328.302 1.00 59.30  ?  307 PRO B CD  1 
ATOM   5970  N N   . GLN B 1 314 ? 193.736 2.798   330.176 1.00 80.87  ?  308 GLN B N   1 
ATOM   5971  C CA  . GLN B 1 314 ? 194.388 2.948   331.464 1.00 85.52  ?  308 GLN B CA  1 
ATOM   5972  C C   . GLN B 1 314 ? 194.945 4.361   331.614 1.00 78.56  ?  308 GLN B C   1 
ATOM   5973  O O   . GLN B 1 314 ? 195.103 5.100   330.638 1.00 79.21  ?  308 GLN B O   1 
ATOM   5974  C CB  . GLN B 1 314 ? 195.511 1.921   331.622 1.00 84.49  ?  308 GLN B CB  1 
ATOM   5975  C CG  . GLN B 1 314 ? 195.107 0.488   331.295 1.00 85.31  ?  308 GLN B CG  1 
ATOM   5976  C CD  . GLN B 1 314 ? 194.129 -0.097  332.298 1.00 85.94  ?  308 GLN B CD  1 
ATOM   5977  O OE1 . GLN B 1 314 ? 192.929 0.176   332.248 1.00 73.29  ?  308 GLN B OE1 1 
ATOM   5978  N NE2 . GLN B 1 314 ? 194.640 -0.911  333.215 1.00 77.02  ?  308 GLN B NE2 1 
ATOM   5979  N N   . LYS B 1 315 ? 195.258 4.715   332.865 1.00 73.58  ?  309 LYS B N   1 
ATOM   5980  C CA  . LYS B 1 315 ? 195.882 5.978   333.262 1.00 86.11  ?  309 LYS B CA  1 
ATOM   5981  C C   . LYS B 1 315 ? 195.446 7.175   332.422 1.00 85.19  ?  309 LYS B C   1 
ATOM   5982  O O   . LYS B 1 315 ? 196.255 7.762   331.695 1.00 84.90  ?  309 LYS B O   1 
ATOM   5983  C CB  . LYS B 1 315 ? 197.414 5.845   333.239 1.00 97.30  ?  309 LYS B CB  1 
ATOM   5984  C CG  . LYS B 1 315 ? 198.003 5.199   331.989 1.00 94.12  ?  309 LYS B CG  1 
ATOM   5985  C CD  . LYS B 1 315 ? 199.465 4.841   332.169 1.00 91.75  ?  309 LYS B CD  1 
ATOM   5986  C CE  . LYS B 1 315 ? 199.925 3.898   331.071 1.00 87.32  ?  309 LYS B CE  1 
ATOM   5987  N NZ  . LYS B 1 315 ? 199.709 4.470   329.713 1.00 82.29  1  309 LYS B NZ  1 
ATOM   5988  N N   . PHE B 1 316 ? 194.173 7.550   332.519 1.00 82.34  ?  310 PHE B N   1 
ATOM   5989  C CA  . PHE B 1 316 ? 193.650 8.729   331.846 1.00 80.82  ?  310 PHE B CA  1 
ATOM   5990  C C   . PHE B 1 316 ? 193.238 9.775   332.872 1.00 76.21  ?  310 PHE B C   1 
ATOM   5991  O O   . PHE B 1 316 ? 192.746 9.440   333.954 1.00 71.98  ?  310 PHE B O   1 
ATOM   5992  C CB  . PHE B 1 316 ? 192.454 8.386   330.953 1.00 72.63  ?  310 PHE B CB  1 
ATOM   5993  C CG  . PHE B 1 316 ? 191.715 9.594   330.447 1.00 66.97  ?  310 PHE B CG  1 
ATOM   5994  C CD1 . PHE B 1 316 ? 192.246 10.373  329.431 1.00 67.00  ?  310 PHE B CD1 1 
ATOM   5995  C CD2 . PHE B 1 316 ? 190.496 9.960   330.997 1.00 61.31  ?  310 PHE B CD2 1 
ATOM   5996  C CE1 . PHE B 1 316 ? 191.574 11.489  328.968 1.00 56.26  ?  310 PHE B CE1 1 
ATOM   5997  C CE2 . PHE B 1 316 ? 189.820 11.076  330.539 1.00 61.14  ?  310 PHE B CE2 1 
ATOM   5998  C CZ  . PHE B 1 316 ? 190.360 11.841  329.523 1.00 58.26  ?  310 PHE B CZ  1 
ATOM   5999  N N   . GLN B 1 317 ? 193.440 11.044  332.522 1.00 73.16  ?  311 GLN B N   1 
ATOM   6000  C CA  . GLN B 1 317 ? 193.027 12.156  333.364 1.00 79.05  ?  311 GLN B CA  1 
ATOM   6001  C C   . GLN B 1 317 ? 192.817 13.375  332.479 1.00 77.55  ?  311 GLN B C   1 
ATOM   6002  O O   . GLN B 1 317 ? 193.586 13.609  331.542 1.00 76.71  ?  311 GLN B O   1 
ATOM   6003  C CB  . GLN B 1 317 ? 194.063 12.448  334.456 1.00 86.08  ?  311 GLN B CB  1 
ATOM   6004  C CG  . GLN B 1 317 ? 193.559 13.353  335.567 1.00 76.78  ?  311 GLN B CG  1 
ATOM   6005  C CD  . GLN B 1 317 ? 194.471 13.347  336.778 1.00 87.88  ?  311 GLN B CD  1 
ATOM   6006  O OE1 . GLN B 1 317 ? 195.570 12.795  336.738 1.00 98.61  ?  311 GLN B OE1 1 
ATOM   6007  N NE2 . GLN B 1 317 ? 194.015 13.957  337.865 1.00 90.82  ?  311 GLN B NE2 1 
ATOM   6008  N N   . PHE B 1 318 ? 191.771 14.142  332.776 1.00 77.14  ?  312 PHE B N   1 
ATOM   6009  C CA  . PHE B 1 318 ? 191.391 15.289  331.958 1.00 80.75  ?  312 PHE B CA  1 
ATOM   6010  C C   . PHE B 1 318 ? 192.064 16.543  332.504 1.00 79.92  ?  312 PHE B C   1 
ATOM   6011  O O   . PHE B 1 318 ? 191.698 17.038  333.575 1.00 71.40  ?  312 PHE B O   1 
ATOM   6012  C CB  . PHE B 1 318 ? 189.873 15.450  331.925 1.00 75.06  ?  312 PHE B CB  1 
ATOM   6013  C CG  . PHE B 1 318 ? 189.411 16.665  331.173 1.00 72.40  ?  312 PHE B CG  1 
ATOM   6014  C CD1 . PHE B 1 318 ? 189.603 16.762  329.805 1.00 75.50  ?  312 PHE B CD1 1 
ATOM   6015  C CD2 . PHE B 1 318 ? 188.783 17.708  331.833 1.00 72.83  ?  312 PHE B CD2 1 
ATOM   6016  C CE1 . PHE B 1 318 ? 189.180 17.879  329.109 1.00 75.70  ?  312 PHE B CE1 1 
ATOM   6017  C CE2 . PHE B 1 318 ? 188.358 18.828  331.142 1.00 77.20  ?  312 PHE B CE2 1 
ATOM   6018  C CZ  . PHE B 1 318 ? 188.557 18.913  329.778 1.00 74.13  ?  312 PHE B CZ  1 
ATOM   6019  N N   . ASP B 1 319 ? 193.045 17.054  331.766 1.00 89.02  ?  313 ASP B N   1 
ATOM   6020  C CA  . ASP B 1 319 ? 193.710 18.311  332.085 1.00 91.45  ?  313 ASP B CA  1 
ATOM   6021  C C   . ASP B 1 319 ? 193.334 19.341  331.029 1.00 88.23  ?  313 ASP B C   1 
ATOM   6022  O O   . ASP B 1 319 ? 193.620 19.152  329.842 1.00 90.77  ?  313 ASP B O   1 
ATOM   6023  C CB  . ASP B 1 319 ? 195.227 18.137  332.153 1.00 97.80  ?  313 ASP B CB  1 
ATOM   6024  C CG  . ASP B 1 319 ? 195.700 17.669  333.516 1.00 101.25 ?  313 ASP B CG  1 
ATOM   6025  O OD1 . ASP B 1 319 ? 195.544 16.468  333.824 1.00 96.12  ?  313 ASP B OD1 1 
ATOM   6026  O OD2 . ASP B 1 319 ? 196.228 18.505  334.280 1.00 94.95  -1 313 ASP B OD2 1 
ATOM   6027  N N   . GLY B 1 320 ? 192.694 20.422  331.464 1.00 84.21  ?  314 GLY B N   1 
ATOM   6028  C CA  . GLY B 1 320 ? 192.273 21.472  330.560 1.00 89.54  ?  314 GLY B CA  1 
ATOM   6029  C C   . GLY B 1 320 ? 191.340 22.455  331.231 1.00 95.44  ?  314 GLY B C   1 
ATOM   6030  O O   . GLY B 1 320 ? 191.783 23.320  331.993 1.00 103.05 ?  314 GLY B O   1 
ATOM   6031  N N   . ASP B 1 321 ? 190.041 22.324  330.960 1.00 94.73  ?  315 ASP B N   1 
ATOM   6032  C CA  . ASP B 1 321 ? 189.033 23.183  331.568 1.00 84.71  ?  315 ASP B CA  1 
ATOM   6033  C C   . ASP B 1 321 ? 187.639 22.624  331.308 1.00 80.53  ?  315 ASP B C   1 
ATOM   6034  O O   . ASP B 1 321 ? 187.248 22.428  330.153 1.00 83.45  ?  315 ASP B O   1 
ATOM   6035  C CB  . ASP B 1 321 ? 189.158 24.614  331.038 1.00 83.29  ?  315 ASP B CB  1 
ATOM   6036  C CG  . ASP B 1 321 ? 188.184 25.569  331.694 1.00 88.48  ?  315 ASP B CG  1 
ATOM   6037  O OD1 . ASP B 1 321 ? 187.001 25.577  331.301 1.00 89.47  ?  315 ASP B OD1 1 
ATOM   6038  O OD2 . ASP B 1 321 ? 188.601 26.306  332.611 1.00 85.46  -1 315 ASP B OD2 1 
ATOM   6039  N N   . LYS B 1 322 ? 186.890 22.357  332.382 1.00 72.96  ?  316 LYS B N   1 
ATOM   6040  C CA  . LYS B 1 322 ? 185.554 21.784  332.242 1.00 76.78  ?  316 LYS B CA  1 
ATOM   6041  C C   . LYS B 1 322 ? 184.640 22.696  331.431 1.00 82.12  ?  316 LYS B C   1 
ATOM   6042  O O   . LYS B 1 322 ? 183.824 22.221  330.633 1.00 83.15  ?  316 LYS B O   1 
ATOM   6043  C CB  . LYS B 1 322 ? 184.963 21.507  333.627 1.00 71.66  ?  316 LYS B CB  1 
ATOM   6044  C CG  . LYS B 1 322 ? 183.469 21.201  333.651 1.00 75.75  ?  316 LYS B CG  1 
ATOM   6045  C CD  . LYS B 1 322 ? 182.661 22.417  334.090 1.00 78.54  ?  316 LYS B CD  1 
ATOM   6046  C CE  . LYS B 1 322 ? 181.184 22.089  334.222 1.00 72.62  ?  316 LYS B CE  1 
ATOM   6047  N NZ  . LYS B 1 322 ? 180.932 21.096  335.304 1.00 67.33  1  316 LYS B NZ  1 
ATOM   6048  N N   . LYS B 1 323 ? 184.768 24.009  331.617 1.00 84.91  ?  317 LYS B N   1 
ATOM   6049  C CA  . LYS B 1 323 ? 183.931 24.960  330.899 1.00 80.45  ?  317 LYS B CA  1 
ATOM   6050  C C   . LYS B 1 323 ? 184.405 25.197  329.471 1.00 77.65  ?  317 LYS B C   1 
ATOM   6051  O O   . LYS B 1 323 ? 183.621 25.676  328.644 1.00 84.38  ?  317 LYS B O   1 
ATOM   6052  C CB  . LYS B 1 323 ? 183.881 26.282  331.668 1.00 84.41  ?  317 LYS B CB  1 
ATOM   6053  C CG  . LYS B 1 323 ? 183.555 26.101  333.145 1.00 85.62  ?  317 LYS B CG  1 
ATOM   6054  C CD  . LYS B 1 323 ? 183.774 27.375  333.942 1.00 92.89  ?  317 LYS B CD  1 
ATOM   6055  C CE  . LYS B 1 323 ? 182.799 28.466  333.535 1.00 92.44  ?  317 LYS B CE  1 
ATOM   6056  N NZ  . LYS B 1 323 ? 182.970 29.688  334.368 1.00 86.10  1  317 LYS B NZ  1 
ATOM   6057  N N   . SER B 1 324 ? 185.664 24.873  329.161 1.00 72.97  ?  318 SER B N   1 
ATOM   6058  C CA  . SER B 1 324 ? 186.130 24.954  327.780 1.00 75.38  ?  318 SER B CA  1 
ATOM   6059  C C   . SER B 1 324 ? 185.755 23.703  326.998 1.00 76.18  ?  318 SER B C   1 
ATOM   6060  O O   . SER B 1 324 ? 185.428 23.785  325.808 1.00 74.72  ?  318 SER B O   1 
ATOM   6061  C CB  . SER B 1 324 ? 187.644 25.161  327.740 1.00 79.61  ?  318 SER B CB  1 
ATOM   6062  O OG  . SER B 1 324 ? 188.330 23.958  328.041 1.00 79.05  ?  318 SER B OG  1 
ATOM   6063  N N   . PHE B 1 325 ? 185.805 22.539  327.648 1.00 78.53  ?  319 PHE B N   1 
ATOM   6064  C CA  . PHE B 1 325 ? 185.420 21.302  326.981 1.00 82.27  ?  319 PHE B CA  1 
ATOM   6065  C C   . PHE B 1 325 ? 183.924 21.266  326.699 1.00 80.29  ?  319 PHE B C   1 
ATOM   6066  O O   . PHE B 1 325 ? 183.487 20.591  325.761 1.00 75.17  ?  319 PHE B O   1 
ATOM   6067  C CB  . PHE B 1 325 ? 185.839 20.104  327.833 1.00 80.55  ?  319 PHE B CB  1 
ATOM   6068  C CG  . PHE B 1 325 ? 185.858 18.802  327.087 1.00 77.03  ?  319 PHE B CG  1 
ATOM   6069  C CD1 . PHE B 1 325 ? 186.663 18.638  325.972 1.00 66.59  ?  319 PHE B CD1 1 
ATOM   6070  C CD2 . PHE B 1 325 ? 185.089 17.734  327.516 1.00 74.37  ?  319 PHE B CD2 1 
ATOM   6071  C CE1 . PHE B 1 325 ? 186.688 17.436  325.289 1.00 64.90  ?  319 PHE B CE1 1 
ATOM   6072  C CE2 . PHE B 1 325 ? 185.110 16.530  326.839 1.00 67.75  ?  319 PHE B CE2 1 
ATOM   6073  C CZ  . PHE B 1 325 ? 185.910 16.381  325.725 1.00 66.27  ?  319 PHE B CZ  1 
ATOM   6074  N N   . LEU B 1 326 ? 183.130 21.990  327.490 1.00 79.22  ?  320 LEU B N   1 
ATOM   6075  C CA  . LEU B 1 326 ? 181.699 22.096  327.236 1.00 76.96  ?  320 LEU B CA  1 
ATOM   6076  C C   . LEU B 1 326 ? 181.380 22.938  326.009 1.00 72.40  ?  320 LEU B C   1 
ATOM   6077  O O   . LEU B 1 326 ? 180.243 22.895  325.529 1.00 75.99  ?  320 LEU B O   1 
ATOM   6078  C CB  . LEU B 1 326 ? 180.995 22.673  328.464 1.00 80.83  ?  320 LEU B CB  1 
ATOM   6079  C CG  . LEU B 1 326 ? 180.138 21.701  329.275 1.00 71.86  ?  320 LEU B CG  1 
ATOM   6080  C CD1 . LEU B 1 326 ? 179.972 22.211  330.692 1.00 76.16  ?  320 LEU B CD1 1 
ATOM   6081  C CD2 . LEU B 1 326 ? 178.783 21.515  328.615 1.00 59.45  ?  320 LEU B CD2 1 
ATOM   6082  N N   . GLU B 1 327 ? 182.344 23.704  325.497 1.00 67.73  ?  321 GLU B N   1 
ATOM   6083  C CA  . GLU B 1 327 ? 182.170 24.418  324.241 1.00 68.02  ?  321 GLU B CA  1 
ATOM   6084  C C   . GLU B 1 327 ? 182.750 23.669  323.051 1.00 69.62  ?  321 GLU B C   1 
ATOM   6085  O O   . GLU B 1 327 ? 182.327 23.918  321.916 1.00 66.79  ?  321 GLU B O   1 
ATOM   6086  C CB  . GLU B 1 327 ? 182.806 25.811  324.326 1.00 76.53  ?  321 GLU B CB  1 
ATOM   6087  C CG  . GLU B 1 327 ? 182.184 26.701  325.389 1.00 83.25  ?  321 GLU B CG  1 
ATOM   6088  C CD  . GLU B 1 327 ? 180.703 26.936  325.158 1.00 83.37  ?  321 GLU B CD  1 
ATOM   6089  O OE1 . GLU B 1 327 ? 180.309 27.160  323.994 1.00 75.33  ?  321 GLU B OE1 1 
ATOM   6090  O OE2 . GLU B 1 327 ? 179.932 26.888  326.140 1.00 78.24  -1 321 GLU B OE2 1 
ATOM   6091  N N   . ASP B 1 328 ? 183.703 22.763  323.282 1.00 75.57  ?  322 ASP B N   1 
ATOM   6092  C CA  . ASP B 1 328 ? 184.221 21.928  322.204 1.00 78.92  ?  322 ASP B CA  1 
ATOM   6093  C C   . ASP B 1 328 ? 183.241 20.817  321.847 1.00 71.37  ?  322 ASP B C   1 
ATOM   6094  O O   . ASP B 1 328 ? 183.090 20.473  320.670 1.00 64.62  ?  322 ASP B O   1 
ATOM   6095  C CB  . ASP B 1 328 ? 185.575 21.339  322.601 1.00 79.21  ?  322 ASP B CB  1 
ATOM   6096  C CG  . ASP B 1 328 ? 186.553 22.393  323.081 1.00 73.12  ?  322 ASP B CG  1 
ATOM   6097  O OD1 . ASP B 1 328 ? 186.482 23.541  322.594 1.00 69.90  ?  322 ASP B OD1 1 
ATOM   6098  O OD2 . ASP B 1 328 ? 187.392 22.073  323.949 1.00 70.59  -1 322 ASP B OD2 1 
ATOM   6099  N N   . ILE B 1 329 ? 182.575 20.245  322.854 1.00 69.12  ?  323 ILE B N   1 
ATOM   6100  C CA  . ILE B 1 329 ? 181.552 19.234  322.600 1.00 59.07  ?  323 ILE B CA  1 
ATOM   6101  C C   . ILE B 1 329 ? 180.418 19.825  321.773 1.00 60.01  ?  323 ILE B C   1 
ATOM   6102  O O   . ILE B 1 329 ? 179.872 19.167  320.878 1.00 63.85  ?  323 ILE B O   1 
ATOM   6103  C CB  . ILE B 1 329 ? 181.038 18.653  323.930 1.00 56.14  ?  323 ILE B CB  1 
ATOM   6104  C CG1 . ILE B 1 329 ? 182.158 17.924  324.671 1.00 61.63  ?  323 ILE B CG1 1 
ATOM   6105  C CG2 . ILE B 1 329 ? 179.870 17.712  323.693 1.00 61.23  ?  323 ILE B CG2 1 
ATOM   6106  C CD1 . ILE B 1 329 ? 181.776 17.506  326.071 1.00 62.34  ?  323 ILE B CD1 1 
ATOM   6107  N N   . ARG B 1 330 ? 180.053 21.077  322.054 1.00 63.64  ?  324 ARG B N   1 
ATOM   6108  C CA  . ARG B 1 330 ? 178.966 21.719  321.323 1.00 63.80  ?  324 ARG B CA  1 
ATOM   6109  C C   . ARG B 1 330 ? 179.324 21.898  319.852 1.00 61.12  ?  324 ARG B C   1 
ATOM   6110  O O   . ARG B 1 330 ? 178.537 21.555  318.963 1.00 66.13  ?  324 ARG B O   1 
ATOM   6111  C CB  . ARG B 1 330 ? 178.632 23.066  321.965 1.00 60.50  ?  324 ARG B CB  1 
ATOM   6112  C CG  . ARG B 1 330 ? 177.356 23.702  321.443 1.00 61.31  ?  324 ARG B CG  1 
ATOM   6113  C CD  . ARG B 1 330 ? 177.288 25.178  321.792 1.00 60.22  ?  324 ARG B CD  1 
ATOM   6114  N NE  . ARG B 1 330 ? 178.281 25.956  321.057 1.00 65.42  ?  324 ARG B NE  1 
ATOM   6115  C CZ  . ARG B 1 330 ? 178.091 26.445  319.836 1.00 63.16  ?  324 ARG B CZ  1 
ATOM   6116  N NH1 . ARG B 1 330 ? 176.942 26.236  319.208 1.00 67.69  1  324 ARG B NH1 1 
ATOM   6117  N NH2 . ARG B 1 330 ? 179.049 27.142  319.240 1.00 54.89  ?  324 ARG B NH2 1 
ATOM   6118  N N   . LYS B 1 331 ? 180.516 22.433  319.578 1.00 57.09  ?  325 LYS B N   1 
ATOM   6119  C CA  . LYS B 1 331 ? 180.926 22.653  318.195 1.00 59.06  ?  325 LYS B CA  1 
ATOM   6120  C C   . LYS B 1 331 ? 181.130 21.339  317.452 1.00 59.09  ?  325 LYS B C   1 
ATOM   6121  O O   . LYS B 1 331 ? 180.885 21.269  316.241 1.00 51.84  ?  325 LYS B O   1 
ATOM   6122  C CB  . LYS B 1 331 ? 182.200 23.496  318.158 1.00 62.48  ?  325 LYS B CB  1 
ATOM   6123  C CG  . LYS B 1 331 ? 182.057 24.843  318.846 1.00 58.15  ?  325 LYS B CG  1 
ATOM   6124  C CD  . LYS B 1 331 ? 183.394 25.553  318.970 1.00 67.71  ?  325 LYS B CD  1 
ATOM   6125  C CE  . LYS B 1 331 ? 183.277 26.788  319.850 1.00 66.37  ?  325 LYS B CE  1 
ATOM   6126  N NZ  . LYS B 1 331 ? 182.831 26.446  321.231 1.00 62.16  1  325 LYS B NZ  1 
ATOM   6127  N N   . ALA B 1 332 ? 181.575 20.292  318.151 1.00 58.93  ?  326 ALA B N   1 
ATOM   6128  C CA  . ALA B 1 332 ? 181.693 18.981  317.519 1.00 61.05  ?  326 ALA B CA  1 
ATOM   6129  C C   . ALA B 1 332 ? 180.320 18.395  317.217 1.00 60.25  ?  326 ALA B C   1 
ATOM   6130  O O   . ALA B 1 332 ? 180.126 17.755  316.177 1.00 60.49  ?  326 ALA B O   1 
ATOM   6131  C CB  . ALA B 1 332 ? 182.498 18.036  318.410 1.00 60.54  ?  326 ALA B CB  1 
ATOM   6132  N N   . LEU B 1 333 ? 179.358 18.600  318.120 1.00 60.38  ?  327 LEU B N   1 
ATOM   6133  C CA  . LEU B 1 333 ? 177.988 18.171  317.861 1.00 55.13  ?  327 LEU B CA  1 
ATOM   6134  C C   . LEU B 1 333 ? 177.373 18.941  316.699 1.00 57.72  ?  327 LEU B C   1 
ATOM   6135  O O   . LEU B 1 333 ? 176.572 18.383  315.941 1.00 56.58  ?  327 LEU B O   1 
ATOM   6136  C CB  . LEU B 1 333 ? 177.144 18.343  319.125 1.00 57.96  ?  327 LEU B CB  1 
ATOM   6137  C CG  . LEU B 1 333 ? 175.642 18.073  319.033 1.00 56.56  ?  327 LEU B CG  1 
ATOM   6138  C CD1 . LEU B 1 333 ? 175.385 16.661  318.554 1.00 54.48  ?  327 LEU B CD1 1 
ATOM   6139  C CD2 . LEU B 1 333 ? 174.974 18.310  320.378 1.00 49.59  ?  327 LEU B CD2 1 
ATOM   6140  N N   . TYR B 1 334 ? 177.743 20.213  316.539 1.00 59.49  ?  328 TYR B N   1 
ATOM   6141  C CA  . TYR B 1 334 ? 177.200 21.023  315.455 1.00 54.69  ?  328 TYR B CA  1 
ATOM   6142  C C   . TYR B 1 334 ? 177.867 20.700  314.123 1.00 54.29  ?  328 TYR B C   1 
ATOM   6143  O O   . TYR B 1 334 ? 177.196 20.656  313.086 1.00 56.57  ?  328 TYR B O   1 
ATOM   6144  C CB  . TYR B 1 334 ? 177.355 22.507  315.787 1.00 55.12  ?  328 TYR B CB  1 
ATOM   6145  C CG  . TYR B 1 334 ? 176.849 23.439  314.711 1.00 57.57  ?  328 TYR B CG  1 
ATOM   6146  C CD1 . TYR B 1 334 ? 175.492 23.552  314.444 1.00 63.81  ?  328 TYR B CD1 1 
ATOM   6147  C CD2 . TYR B 1 334 ? 177.729 24.217  313.969 1.00 62.13  ?  328 TYR B CD2 1 
ATOM   6148  C CE1 . TYR B 1 334 ? 175.024 24.404  313.463 1.00 69.60  ?  328 TYR B CE1 1 
ATOM   6149  C CE2 . TYR B 1 334 ? 177.272 25.074  312.988 1.00 62.79  ?  328 TYR B CE2 1 
ATOM   6150  C CZ  . TYR B 1 334 ? 175.919 25.163  312.739 1.00 70.77  ?  328 TYR B CZ  1 
ATOM   6151  O OH  . TYR B 1 334 ? 175.460 26.015  311.762 1.00 74.99  ?  328 TYR B OH  1 
ATOM   6152  N N   . ALA B 1 335 ? 179.182 20.470  314.131 1.00 56.93  ?  329 ALA B N   1 
ATOM   6153  C CA  . ALA B 1 335 ? 179.883 20.163  312.888 1.00 59.23  ?  329 ALA B CA  1 
ATOM   6154  C C   . ALA B 1 335 ? 179.506 18.784  312.362 1.00 54.04  ?  329 ALA B C   1 
ATOM   6155  O O   . ALA B 1 335 ? 179.392 18.587  311.146 1.00 49.01  ?  329 ALA B O   1 
ATOM   6156  C CB  . ALA B 1 335 ? 181.393 20.264  313.100 1.00 59.01  ?  329 ALA B CB  1 
ATOM   6157  N N   . SER B 1 336 ? 179.311 17.815  313.261 1.00 52.04  ?  330 SER B N   1 
ATOM   6158  C CA  . SER B 1 336 ? 178.913 16.479  312.831 1.00 50.31  ?  330 SER B CA  1 
ATOM   6159  C C   . SER B 1 336 ? 177.509 16.484  312.240 1.00 50.68  ?  330 SER B C   1 
ATOM   6160  O O   . SER B 1 336 ? 177.234 15.765  311.272 1.00 51.09  ?  330 SER B O   1 
ATOM   6161  C CB  . SER B 1 336 ? 178.997 15.503  314.004 1.00 49.00  ?  330 SER B CB  1 
ATOM   6162  O OG  . SER B 1 336 ? 180.314 15.430  314.518 1.00 53.08  ?  330 SER B OG  1 
ATOM   6163  N N   . LYS B 1 337 ? 176.608 17.287  312.812 1.00 53.73  ?  331 LYS B N   1 
ATOM   6164  C CA  . LYS B 1 337 ? 175.256 17.389  312.274 1.00 47.61  ?  331 LYS B CA  1 
ATOM   6165  C C   . LYS B 1 337 ? 175.262 17.948  310.857 1.00 44.62  ?  331 LYS B C   1 
ATOM   6166  O O   . LYS B 1 337 ? 174.433 17.553  310.030 1.00 45.44  ?  331 LYS B O   1 
ATOM   6167  C CB  . LYS B 1 337 ? 174.396 18.257  313.193 1.00 47.59  ?  331 LYS B CB  1 
ATOM   6168  C CG  . LYS B 1 337 ? 172.915 18.269  312.854 1.00 53.00  ?  331 LYS B CG  1 
ATOM   6169  C CD  . LYS B 1 337 ? 172.123 19.034  313.905 1.00 56.66  ?  331 LYS B CD  1 
ATOM   6170  C CE  . LYS B 1 337 ? 170.629 18.978  313.630 1.00 53.32  ?  331 LYS B CE  1 
ATOM   6171  N NZ  . LYS B 1 337 ? 169.841 19.637  314.708 1.00 47.56  1  331 LYS B NZ  1 
ATOM   6172  N N   . ILE B 1 338 ? 176.191 18.858  310.557 1.00 44.21  ?  332 ILE B N   1 
ATOM   6173  C CA  . ILE B 1 338 ? 176.312 19.379  309.199 1.00 39.78  ?  332 ILE B CA  1 
ATOM   6174  C C   . ILE B 1 338 ? 176.743 18.276  308.241 1.00 41.67  ?  332 ILE B C   1 
ATOM   6175  O O   . ILE B 1 338 ? 176.260 18.197  307.105 1.00 42.22  ?  332 ILE B O   1 
ATOM   6176  C CB  . ILE B 1 338 ? 177.289 20.568  309.172 1.00 44.26  ?  332 ILE B CB  1 
ATOM   6177  C CG1 . ILE B 1 338 ? 176.789 21.689  310.085 1.00 51.12  ?  332 ILE B CG1 1 
ATOM   6178  C CG2 . ILE B 1 338 ? 177.478 21.078  307.751 1.00 44.03  ?  332 ILE B CG2 1 
ATOM   6179  C CD1 . ILE B 1 338 ? 177.754 22.845  310.215 1.00 57.40  ?  332 ILE B CD1 1 
ATOM   6180  N N   . ILE B 1 339 ? 177.654 17.406  308.684 1.00 46.27  ?  333 ILE B N   1 
ATOM   6181  C CA  . ILE B 1 339 ? 178.105 16.301  307.841 1.00 47.11  ?  333 ILE B CA  1 
ATOM   6182  C C   . ILE B 1 339 ? 176.961 15.331  307.578 1.00 44.78  ?  333 ILE B C   1 
ATOM   6183  O O   . ILE B 1 339 ? 176.844 14.763  306.485 1.00 40.77  ?  333 ILE B O   1 
ATOM   6184  C CB  . ILE B 1 339 ? 179.310 15.595  308.491 1.00 43.79  ?  333 ILE B CB  1 
ATOM   6185  C CG1 . ILE B 1 339 ? 180.462 16.580  308.688 1.00 48.37  ?  333 ILE B CG1 1 
ATOM   6186  C CG2 . ILE B 1 339 ? 179.763 14.410  307.648 1.00 39.63  ?  333 ILE B CG2 1 
ATOM   6187  C CD1 . ILE B 1 339 ? 181.007 17.148  307.399 1.00 42.93  ?  333 ILE B CD1 1 
ATOM   6188  N N   . SER B 1 340 ? 176.094 15.135  308.573 1.00 42.74  ?  334 SER B N   1 
ATOM   6189  C CA  . SER B 1 340 ? 174.973 14.214  308.414 1.00 34.73  ?  334 SER B CA  1 
ATOM   6190  C C   . SER B 1 340 ? 174.014 14.698  307.333 1.00 39.83  ?  334 SER B C   1 
ATOM   6191  O O   . SER B 1 340 ? 173.674 13.950  306.409 1.00 41.90  ?  334 SER B O   1 
ATOM   6192  C CB  . SER B 1 340 ? 174.246 14.047  309.749 1.00 28.41  ?  334 SER B CB  1 
ATOM   6193  O OG  . SER B 1 340 ? 173.161 13.144  309.629 1.00 35.47  ?  334 SER B OG  1 
ATOM   6194  N N   . TYR B 1 341 ? 173.572 15.955  307.428 1.00 43.49  ?  335 TYR B N   1 
ATOM   6195  C CA  . TYR B 1 341 ? 172.651 16.490  306.430 1.00 42.24  ?  335 TYR B CA  1 
ATOM   6196  C C   . TYR B 1 341 ? 173.310 16.616  305.063 1.00 38.79  ?  335 TYR B C   1 
ATOM   6197  O O   . TYR B 1 341 ? 172.622 16.541  304.038 1.00 41.82  ?  335 TYR B O   1 
ATOM   6198  C CB  . TYR B 1 341 ? 172.108 17.843  306.884 1.00 42.11  ?  335 TYR B CB  1 
ATOM   6199  C CG  . TYR B 1 341 ? 171.053 17.747  307.962 1.00 44.29  ?  335 TYR B CG  1 
ATOM   6200  C CD1 . TYR B 1 341 ? 171.404 17.540  309.288 1.00 44.49  ?  335 TYR B CD1 1 
ATOM   6201  C CD2 . TYR B 1 341 ? 169.704 17.863  307.652 1.00 38.31  ?  335 TYR B CD2 1 
ATOM   6202  C CE1 . TYR B 1 341 ? 170.444 17.452  310.276 1.00 47.29  ?  335 TYR B CE1 1 
ATOM   6203  C CE2 . TYR B 1 341 ? 168.737 17.778  308.633 1.00 39.04  ?  335 TYR B CE2 1 
ATOM   6204  C CZ  . TYR B 1 341 ? 169.112 17.574  309.944 1.00 46.13  ?  335 TYR B CZ  1 
ATOM   6205  O OH  . TYR B 1 341 ? 168.152 17.485  310.925 1.00 52.10  ?  335 TYR B OH  1 
ATOM   6206  N N   . ALA B 1 342 ? 174.630 16.812  305.024 1.00 38.99  ?  336 ALA B N   1 
ATOM   6207  C CA  . ALA B 1 342 ? 175.331 16.823  303.745 1.00 40.93  ?  336 ALA B CA  1 
ATOM   6208  C C   . ALA B 1 342 ? 175.238 15.465  303.063 1.00 37.61  ?  336 ALA B C   1 
ATOM   6209  O O   . ALA B 1 342 ? 175.030 15.385  301.847 1.00 31.95  ?  336 ALA B O   1 
ATOM   6210  C CB  . ALA B 1 342 ? 176.791 17.231  303.946 1.00 40.80  ?  336 ALA B CB  1 
ATOM   6211  N N   . GLN B 1 343 ? 175.376 14.384  303.836 1.00 38.98  ?  337 GLN B N   1 
ATOM   6212  C CA  . GLN B 1 343 ? 175.227 13.045  303.276 1.00 41.38  ?  337 GLN B CA  1 
ATOM   6213  C C   . GLN B 1 343 ? 173.782 12.751  302.891 1.00 35.56  ?  337 GLN B C   1 
ATOM   6214  O O   . GLN B 1 343 ? 173.538 12.043  301.907 1.00 35.65  ?  337 GLN B O   1 
ATOM   6215  C CB  . GLN B 1 343 ? 175.724 12.000  304.276 1.00 39.07  ?  337 GLN B CB  1 
ATOM   6216  C CG  . GLN B 1 343 ? 177.200 12.106  304.617 1.00 33.69  ?  337 GLN B CG  1 
ATOM   6217  C CD  . GLN B 1 343 ? 177.595 11.198  305.764 1.00 38.24  ?  337 GLN B CD  1 
ATOM   6218  O OE1 . GLN B 1 343 ? 176.740 10.667  306.474 1.00 37.91  ?  337 GLN B OE1 1 
ATOM   6219  N NE2 . GLN B 1 343 ? 178.896 11.014  305.952 1.00 39.41  ?  337 GLN B NE2 1 
ATOM   6220  N N   . GLY B 1 344 ? 172.818 13.276  303.649 1.00 35.26  ?  338 GLY B N   1 
ATOM   6221  C CA  . GLY B 1 344 ? 171.422 13.010  303.340 1.00 31.13  ?  338 GLY B CA  1 
ATOM   6222  C C   . GLY B 1 344 ? 171.015 13.550  301.983 1.00 33.68  ?  338 GLY B C   1 
ATOM   6223  O O   . GLY B 1 344 ? 170.341 12.870  301.205 1.00 36.24  ?  338 GLY B O   1 
ATOM   6224  N N   . PHE B 1 345 ? 171.417 14.787  301.681 1.00 31.20  ?  339 PHE B N   1 
ATOM   6225  C CA  . PHE B 1 345 ? 171.113 15.363  300.377 1.00 33.76  ?  339 PHE B CA  1 
ATOM   6226  C C   . PHE B 1 345 ? 171.923 14.719  299.260 1.00 39.73  ?  339 PHE B C   1 
ATOM   6227  O O   . PHE B 1 345 ? 171.515 14.792  298.096 1.00 42.37  ?  339 PHE B O   1 
ATOM   6228  C CB  . PHE B 1 345 ? 171.345 16.875  300.403 1.00 33.01  ?  339 PHE B CB  1 
ATOM   6229  C CG  . PHE B 1 345 ? 170.251 17.640  301.093 1.00 36.63  ?  339 PHE B CG  1 
ATOM   6230  C CD1 . PHE B 1 345 ? 170.135 17.621  302.474 1.00 41.74  ?  339 PHE B CD1 1 
ATOM   6231  C CD2 . PHE B 1 345 ? 169.335 18.378  300.361 1.00 36.21  ?  339 PHE B CD2 1 
ATOM   6232  C CE1 . PHE B 1 345 ? 169.127 18.321  303.111 1.00 38.88  ?  339 PHE B CE1 1 
ATOM   6233  C CE2 . PHE B 1 345 ? 168.326 19.082  300.993 1.00 33.52  ?  339 PHE B CE2 1 
ATOM   6234  C CZ  . PHE B 1 345 ? 168.222 19.053  302.369 1.00 34.84  ?  339 PHE B CZ  1 
ATOM   6235  N N   . MET B 1 346 ? 173.060 14.095  299.582 1.00 42.35  ?  340 MET B N   1 
ATOM   6236  C CA  . MET B 1 346 ? 173.764 13.296  298.584 1.00 41.16  ?  340 MET B CA  1 
ATOM   6237  C C   . MET B 1 346 ? 172.943 12.078  298.188 1.00 41.92  ?  340 MET B C   1 
ATOM   6238  O O   . MET B 1 346 ? 172.902 11.704  297.009 1.00 40.67  ?  340 MET B O   1 
ATOM   6239  C CB  . MET B 1 346 ? 175.132 12.868  299.116 1.00 42.08  ?  340 MET B CB  1 
ATOM   6240  C CG  . MET B 1 346 ? 176.130 14.002  299.269 1.00 48.24  ?  340 MET B CG  1 
ATOM   6241  S SD  . MET B 1 346 ? 177.654 13.467  300.069 1.00 36.47  ?  340 MET B SD  1 
ATOM   6242  C CE  . MET B 1 346 ? 178.274 12.298  298.863 1.00 36.35  ?  340 MET B CE  1 
ATOM   6243  N N   . LEU B 1 347 ? 172.283 11.445  299.161 1.00 36.26  ?  341 LEU B N   1 
ATOM   6244  C CA  . LEU B 1 347 ? 171.401 10.326  298.853 1.00 30.06  ?  341 LEU B CA  1 
ATOM   6245  C C   . LEU B 1 347 ? 170.186 10.789  298.061 1.00 36.09  ?  341 LEU B C   1 
ATOM   6246  O O   . LEU B 1 347 ? 169.751 10.107  297.125 1.00 43.43  ?  341 LEU B O   1 
ATOM   6247  C CB  . LEU B 1 347 ? 170.975 9.628   300.144 1.00 31.38  ?  341 LEU B CB  1 
ATOM   6248  C CG  . LEU B 1 347 ? 170.074 8.400   300.006 1.00 31.51  ?  341 LEU B CG  1 
ATOM   6249  C CD1 . LEU B 1 347 ? 170.712 7.365   299.093 1.00 32.45  ?  341 LEU B CD1 1 
ATOM   6250  C CD2 . LEU B 1 347 ? 169.782 7.804   301.373 1.00 22.47  ?  341 LEU B CD2 1 
ATOM   6251  N N   . LEU B 1 348 ? 169.626 11.947  298.420 1.00 37.18  ?  342 LEU B N   1 
ATOM   6252  C CA  . LEU B 1 348 ? 168.520 12.506  297.649 1.00 34.86  ?  342 LEU B CA  1 
ATOM   6253  C C   . LEU B 1 348 ? 168.961 12.861  296.235 1.00 38.68  ?  342 LEU B C   1 
ATOM   6254  O O   . LEU B 1 348 ? 168.202 12.680  295.275 1.00 41.38  ?  342 LEU B O   1 
ATOM   6255  C CB  . LEU B 1 348 ? 167.953 13.736  298.357 1.00 30.74  ?  342 LEU B CB  1 
ATOM   6256  C CG  . LEU B 1 348 ? 167.253 13.506  299.698 1.00 40.04  ?  342 LEU B CG  1 
ATOM   6257  C CD1 . LEU B 1 348 ? 166.926 14.832  300.366 1.00 40.91  ?  342 LEU B CD1 1 
ATOM   6258  C CD2 . LEU B 1 348 ? 165.993 12.680  299.504 1.00 35.80  ?  342 LEU B CD2 1 
ATOM   6259  N N   . ARG B 1 349 ? 170.187 13.368  296.087 1.00 38.91  ?  343 ARG B N   1 
ATOM   6260  C CA  . ARG B 1 349 ? 170.684 13.728  294.763 1.00 39.38  ?  343 ARG B CA  1 
ATOM   6261  C C   . ARG B 1 349 ? 170.869 12.495  293.887 1.00 41.24  ?  343 ARG B C   1 
ATOM   6262  O O   . ARG B 1 349 ? 170.511 12.508  292.703 1.00 34.53  ?  343 ARG B O   1 
ATOM   6263  C CB  . ARG B 1 349 ? 171.999 14.500  294.886 1.00 41.18  ?  343 ARG B CB  1 
ATOM   6264  C CG  . ARG B 1 349 ? 172.604 14.909  293.551 1.00 47.63  ?  343 ARG B CG  1 
ATOM   6265  C CD  . ARG B 1 349 ? 173.919 14.192  293.281 1.00 47.50  ?  343 ARG B CD  1 
ATOM   6266  N NE  . ARG B 1 349 ? 175.079 15.029  293.581 1.00 68.70  ?  343 ARG B NE  1 
ATOM   6267  C CZ  . ARG B 1 349 ? 175.750 15.001  294.729 1.00 65.52  ?  343 ARG B CZ  1 
ATOM   6268  N NH1 . ARG B 1 349 ? 175.381 14.174  295.698 1.00 67.73  1  343 ARG B NH1 1 
ATOM   6269  N NH2 . ARG B 1 349 ? 176.793 15.798  294.908 1.00 53.90  ?  343 ARG B NH2 1 
ATOM   6270  N N   . GLN B 1 350 ? 171.421 11.419  294.452 1.00 42.80  ?  344 GLN B N   1 
ATOM   6271  C CA  . GLN B 1 350 ? 171.679 10.221  293.659 1.00 39.22  ?  344 GLN B CA  1 
ATOM   6272  C C   . GLN B 1 350 ? 170.381 9.545   293.238 1.00 38.73  ?  344 GLN B C   1 
ATOM   6273  O O   . GLN B 1 350 ? 170.289 9.000   292.131 1.00 37.51  ?  344 GLN B O   1 
ATOM   6274  C CB  . GLN B 1 350 ? 172.564 9.253   294.443 1.00 35.09  ?  344 GLN B CB  1 
ATOM   6275  C CG  . GLN B 1 350 ? 173.034 8.053   293.638 1.00 31.72  ?  344 GLN B CG  1 
ATOM   6276  C CD  . GLN B 1 350 ? 173.867 8.447   292.433 1.00 32.76  ?  344 GLN B CD  1 
ATOM   6277  O OE1 . GLN B 1 350 ? 174.512 9.496   292.424 1.00 36.57  ?  344 GLN B OE1 1 
ATOM   6278  N NE2 . GLN B 1 350 ? 173.855 7.605   291.406 1.00 35.32  ?  344 GLN B NE2 1 
ATOM   6279  N N   . ALA B 1 351 ? 169.367 9.567   294.106 1.00 37.91  ?  345 ALA B N   1 
ATOM   6280  C CA  . ALA B 1 351 ? 168.069 9.015   293.731 1.00 32.94  ?  345 ALA B CA  1 
ATOM   6281  C C   . ALA B 1 351 ? 167.433 9.824   292.610 1.00 35.03  ?  345 ALA B C   1 
ATOM   6282  O O   . ALA B 1 351 ? 166.834 9.256   291.689 1.00 38.38  ?  345 ALA B O   1 
ATOM   6283  C CB  . ALA B 1 351 ? 167.146 8.968   294.946 1.00 35.51  ?  345 ALA B CB  1 
ATOM   6284  N N   . ALA B 1 352 ? 167.550 11.153  292.670 1.00 33.01  ?  346 ALA B N   1 
ATOM   6285  C CA  . ALA B 1 352 ? 167.024 11.989  291.598 1.00 37.05  ?  346 ALA B CA  1 
ATOM   6286  C C   . ALA B 1 352 ? 167.731 11.714  290.278 1.00 41.31  ?  346 ALA B C   1 
ATOM   6287  O O   . ALA B 1 352 ? 167.114 11.810  289.211 1.00 43.85  ?  346 ALA B O   1 
ATOM   6288  C CB  . ALA B 1 352 ? 167.151 13.465  291.973 1.00 36.56  ?  346 ALA B CB  1 
ATOM   6289  N N   . THR B 1 353 ? 169.019 11.368  290.327 1.00 39.95  ?  347 THR B N   1 
ATOM   6290  C CA  . THR B 1 353 ? 169.750 11.045  289.108 1.00 38.80  ?  347 THR B CA  1 
ATOM   6291  C C   . THR B 1 353 ? 169.380 9.661   288.588 1.00 36.15  ?  347 THR B C   1 
ATOM   6292  O O   . THR B 1 353 ? 169.288 9.454   287.373 1.00 32.85  ?  347 THR B O   1 
ATOM   6293  C CB  . THR B 1 353 ? 171.256 11.134  289.362 1.00 38.71  ?  347 THR B CB  1 
ATOM   6294  O OG1 . THR B 1 353 ? 171.579 12.434  289.872 1.00 41.52  ?  347 THR B OG1 1 
ATOM   6295  C CG2 . THR B 1 353 ? 172.035 10.892  288.076 1.00 33.17  ?  347 THR B CG2 1 
ATOM   6296  N N   . GLU B 1 354 ? 169.154 8.707   289.494 1.00 38.62  ?  348 GLU B N   1 
ATOM   6297  C CA  . GLU B 1 354 ? 168.869 7.339   289.075 1.00 40.85  ?  348 GLU B CA  1 
ATOM   6298  C C   . GLU B 1 354 ? 167.524 7.243   288.364 1.00 41.53  ?  348 GLU B C   1 
ATOM   6299  O O   . GLU B 1 354 ? 167.391 6.512   287.375 1.00 45.82  ?  348 GLU B O   1 
ATOM   6300  C CB  . GLU B 1 354 ? 168.904 6.406   290.286 1.00 35.86  ?  348 GLU B CB  1 
ATOM   6301  C CG  . GLU B 1 354 ? 168.951 4.929   289.935 1.00 45.76  ?  348 GLU B CG  1 
ATOM   6302  C CD  . GLU B 1 354 ? 170.320 4.484   289.453 1.00 65.59  ?  348 GLU B CD  1 
ATOM   6303  O OE1 . GLU B 1 354 ? 171.288 5.264   289.591 1.00 48.04  ?  348 GLU B OE1 1 
ATOM   6304  O OE2 . GLU B 1 354 ? 170.428 3.351   288.937 1.00 76.38  -1 348 GLU B OE2 1 
ATOM   6305  N N   . PHE B 1 355 ? 166.519 7.973   288.848 1.00 42.26  ?  349 PHE B N   1 
ATOM   6306  C CA  . PHE B 1 355 ? 165.179 7.906   288.280 1.00 36.27  ?  349 PHE B CA  1 
ATOM   6307  C C   . PHE B 1 355 ? 164.852 9.065   287.349 1.00 39.72  ?  349 PHE B C   1 
ATOM   6308  O O   . PHE B 1 355 ? 163.883 8.970   286.588 1.00 39.93  ?  349 PHE B O   1 
ATOM   6309  C CB  . PHE B 1 355 ? 164.130 7.863   289.397 1.00 35.93  ?  349 PHE B CB  1 
ATOM   6310  C CG  . PHE B 1 355 ? 164.291 6.707   290.340 1.00 33.56  ?  349 PHE B CG  1 
ATOM   6311  C CD1 . PHE B 1 355 ? 163.935 5.426   289.953 1.00 35.90  ?  349 PHE B CD1 1 
ATOM   6312  C CD2 . PHE B 1 355 ? 164.788 6.901   291.618 1.00 31.02  ?  349 PHE B CD2 1 
ATOM   6313  C CE1 . PHE B 1 355 ? 164.079 4.360   290.819 1.00 27.89  ?  349 PHE B CE1 1 
ATOM   6314  C CE2 . PHE B 1 355 ? 164.935 5.839   292.487 1.00 35.46  ?  349 PHE B CE2 1 
ATOM   6315  C CZ  . PHE B 1 355 ? 164.578 4.567   292.087 1.00 27.99  ?  349 PHE B CZ  1 
ATOM   6316  N N   . GLY B 1 356 ? 165.626 10.146  287.388 1.00 36.76  ?  350 GLY B N   1 
ATOM   6317  C CA  . GLY B 1 356 ? 165.332 11.306  286.575 1.00 35.69  ?  350 GLY B CA  1 
ATOM   6318  C C   . GLY B 1 356 ? 164.399 12.304  287.218 1.00 39.40  ?  350 GLY B C   1 
ATOM   6319  O O   . GLY B 1 356 ? 163.606 12.940  286.514 1.00 44.71  ?  350 GLY B O   1 
ATOM   6320  N N   . TRP B 1 357 ? 164.467 12.463  288.535 1.00 40.87  ?  351 TRP B N   1 
ATOM   6321  C CA  . TRP B 1 357 ? 163.582 13.359  289.259 1.00 43.96  ?  351 TRP B CA  1 
ATOM   6322  C C   . TRP B 1 357 ? 164.202 14.748  289.384 1.00 38.24  ?  351 TRP B C   1 
ATOM   6323  O O   . TRP B 1 357 ? 165.417 14.928  289.275 1.00 48.74  ?  351 TRP B O   1 
ATOM   6324  C CB  . TRP B 1 357 ? 163.271 12.797  290.647 1.00 44.84  ?  351 TRP B CB  1 
ATOM   6325  C CG  . TRP B 1 357 ? 162.566 11.472  290.622 1.00 40.11  ?  351 TRP B CG  1 
ATOM   6326  C CD1 . TRP B 1 357 ? 161.882 10.926  289.575 1.00 38.02  ?  351 TRP B CD1 1 
ATOM   6327  C CD2 . TRP B 1 357 ? 162.485 10.523  291.692 1.00 33.90  ?  351 TRP B CD2 1 
ATOM   6328  N NE1 . TRP B 1 357 ? 161.375 9.699   289.929 1.00 34.99  ?  351 TRP B NE1 1 
ATOM   6329  C CE2 . TRP B 1 357 ? 161.731 9.429   291.224 1.00 33.73  ?  351 TRP B CE2 1 
ATOM   6330  C CE3 . TRP B 1 357 ? 162.973 10.495  293.002 1.00 33.92  ?  351 TRP B CE3 1 
ATOM   6331  C CZ2 . TRP B 1 357 ? 161.456 8.317   292.018 1.00 34.31  ?  351 TRP B CZ2 1 
ATOM   6332  C CZ3 . TRP B 1 357 ? 162.698 9.390   293.789 1.00 40.29  ?  351 TRP B CZ3 1 
ATOM   6333  C CH2 . TRP B 1 357 ? 161.946 8.317   293.294 1.00 37.11  ?  351 TRP B CH2 1 
ATOM   6334  N N   . THR B 1 358 ? 163.341 15.735  289.616 1.00 41.38  ?  352 THR B N   1 
ATOM   6335  C CA  . THR B 1 358 ? 163.751 17.117  289.855 1.00 37.42  ?  352 THR B CA  1 
ATOM   6336  C C   . THR B 1 358 ? 163.258 17.495  291.248 1.00 42.15  ?  352 THR B C   1 
ATOM   6337  O O   . THR B 1 358 ? 162.088 17.853  291.424 1.00 49.08  ?  352 THR B O   1 
ATOM   6338  C CB  . THR B 1 358 ? 163.195 18.054  288.786 1.00 41.94  ?  352 THR B CB  1 
ATOM   6339  O OG1 . THR B 1 358 ? 163.627 17.615  287.492 1.00 42.19  ?  352 THR B OG1 1 
ATOM   6340  C CG2 . THR B 1 358 ? 163.682 19.477  289.019 1.00 35.33  ?  352 THR B CG2 1 
ATOM   6341  N N   . LEU B 1 359 ? 164.146 17.416  292.233 1.00 36.86  ?  353 LEU B N   1 
ATOM   6342  C CA  . LEU B 1 359 ? 163.761 17.581  293.626 1.00 41.52  ?  353 LEU B CA  1 
ATOM   6343  C C   . LEU B 1 359 ? 163.857 19.039  294.058 1.00 42.61  ?  353 LEU B C   1 
ATOM   6344  O O   . LEU B 1 359 ? 164.692 19.804  293.566 1.00 37.65  ?  353 LEU B O   1 
ATOM   6345  C CB  . LEU B 1 359 ? 164.637 16.714  294.532 1.00 42.70  ?  353 LEU B CB  1 
ATOM   6346  C CG  . LEU B 1 359 ? 164.714 15.228  294.175 1.00 40.23  ?  353 LEU B CG  1 
ATOM   6347  C CD1 . LEU B 1 359 ? 165.401 14.442  295.281 1.00 32.75  ?  353 LEU B CD1 1 
ATOM   6348  C CD2 . LEU B 1 359 ? 163.330 14.668  293.891 1.00 34.79  ?  353 LEU B CD2 1 
ATOM   6349  N N   . ASN B 1 360 ? 162.983 19.414  294.991 1.00 41.39  ?  354 ASN B N   1 
ATOM   6350  C CA  . ASN B 1 360 ? 162.981 20.750  295.582 1.00 39.96  ?  354 ASN B CA  1 
ATOM   6351  C C   . ASN B 1 360 ? 163.743 20.667  296.902 1.00 43.89  ?  354 ASN B C   1 
ATOM   6352  O O   . ASN B 1 360 ? 163.164 20.632  297.988 1.00 45.19  ?  354 ASN B O   1 
ATOM   6353  C CB  . ASN B 1 360 ? 161.550 21.250  295.774 1.00 48.79  ?  354 ASN B CB  1 
ATOM   6354  C CG  . ASN B 1 360 ? 161.482 22.718  296.162 1.00 55.40  ?  354 ASN B CG  1 
ATOM   6355  O OD1 . ASN B 1 360 ? 162.345 23.231  296.876 1.00 51.35  ?  354 ASN B OD1 1 
ATOM   6356  N ND2 . ASN B 1 360 ? 160.446 23.403  295.692 1.00 62.33  ?  354 ASN B ND2 1 
ATOM   6357  N N   . TYR B 1 361 ? 165.074 20.634  296.789 1.00 46.20  ?  355 TYR B N   1 
ATOM   6358  C CA  . TYR B 1 361 ? 165.918 20.462  297.969 1.00 43.53  ?  355 TYR B CA  1 
ATOM   6359  C C   . TYR B 1 361 ? 165.671 21.560  298.996 1.00 43.55  ?  355 TYR B C   1 
ATOM   6360  O O   . TYR B 1 361 ? 165.696 21.305  300.206 1.00 41.22  ?  355 TYR B O   1 
ATOM   6361  C CB  . TYR B 1 361 ? 167.392 20.438  297.564 1.00 34.67  ?  355 TYR B CB  1 
ATOM   6362  C CG  . TYR B 1 361 ? 167.732 19.455  296.467 1.00 30.62  ?  355 TYR B CG  1 
ATOM   6363  C CD1 . TYR B 1 361 ? 167.999 18.123  296.757 1.00 37.69  ?  355 TYR B CD1 1 
ATOM   6364  C CD2 . TYR B 1 361 ? 167.803 19.863  295.141 1.00 32.76  ?  355 TYR B CD2 1 
ATOM   6365  C CE1 . TYR B 1 361 ? 168.318 17.223  295.757 1.00 38.82  ?  355 TYR B CE1 1 
ATOM   6366  C CE2 . TYR B 1 361 ? 168.121 18.971  294.134 1.00 39.31  ?  355 TYR B CE2 1 
ATOM   6367  C CZ  . TYR B 1 361 ? 168.377 17.653  294.447 1.00 43.84  ?  355 TYR B CZ  1 
ATOM   6368  O OH  . TYR B 1 361 ? 168.695 16.763  293.446 1.00 43.81  ?  355 TYR B OH  1 
ATOM   6369  N N   . GLY B 1 362 ? 165.433 22.789  298.534 1.00 39.76  ?  356 GLY B N   1 
ATOM   6370  C CA  . GLY B 1 362 ? 165.141 23.870  299.461 1.00 47.63  ?  356 GLY B CA  1 
ATOM   6371  C C   . GLY B 1 362 ? 163.834 23.656  300.201 1.00 53.80  ?  356 GLY B C   1 
ATOM   6372  O O   . GLY B 1 362 ? 163.761 23.820  301.422 1.00 49.47  ?  356 GLY B O   1 
ATOM   6373  N N   . GLY B 1 363 ? 162.782 23.284  299.469 1.00 49.16  ?  357 GLY B N   1 
ATOM   6374  C CA  . GLY B 1 363 ? 161.512 22.996  300.110 1.00 48.64  ?  357 GLY B CA  1 
ATOM   6375  C C   . GLY B 1 363 ? 161.554 21.761  300.985 1.00 47.58  ?  357 GLY B C   1 
ATOM   6376  O O   . GLY B 1 363 ? 160.874 21.706  302.014 1.00 50.31  ?  357 GLY B O   1 
ATOM   6377  N N   . ILE B 1 364 ? 162.347 20.759  300.595 1.00 45.06  ?  358 ILE B N   1 
ATOM   6378  C CA  . ILE B 1 364 ? 162.475 19.544  301.396 1.00 42.39  ?  358 ILE B CA  1 
ATOM   6379  C C   . ILE B 1 364 ? 162.971 19.878  302.798 1.00 48.63  ?  358 ILE B C   1 
ATOM   6380  O O   . ILE B 1 364 ? 162.464 19.348  303.795 1.00 46.02  ?  358 ILE B O   1 
ATOM   6381  C CB  . ILE B 1 364 ? 163.401 18.535  300.690 1.00 44.41  ?  358 ILE B CB  1 
ATOM   6382  C CG1 . ILE B 1 364 ? 162.705 17.932  299.469 1.00 38.71  ?  358 ILE B CG1 1 
ATOM   6383  C CG2 . ILE B 1 364 ? 163.840 17.440  301.650 1.00 43.37  ?  358 ILE B CG2 1 
ATOM   6384  C CD1 . ILE B 1 364 ? 163.636 17.165  298.555 1.00 36.57  ?  358 ILE B CD1 1 
ATOM   6385  N N   . ALA B 1 365 ? 163.961 20.768  302.899 1.00 46.38  ?  359 ALA B N   1 
ATOM   6386  C CA  . ALA B 1 365 ? 164.432 21.199  304.211 1.00 49.28  ?  359 ALA B CA  1 
ATOM   6387  C C   . ALA B 1 365 ? 163.355 21.961  304.971 1.00 50.11  ?  359 ALA B C   1 
ATOM   6388  O O   . ALA B 1 365 ? 163.304 21.896  306.205 1.00 50.66  ?  359 ALA B O   1 
ATOM   6389  C CB  . ALA B 1 365 ? 165.688 22.056  304.063 1.00 53.23  ?  359 ALA B CB  1 
ATOM   6390  N N   . LEU B 1 366 ? 162.487 22.683  304.258 1.00 54.20  ?  360 LEU B N   1 
ATOM   6391  C CA  . LEU B 1 366 ? 161.401 23.401  304.918 1.00 51.49  ?  360 LEU B CA  1 
ATOM   6392  C C   . LEU B 1 366 ? 160.367 22.437  305.488 1.00 51.53  ?  360 LEU B C   1 
ATOM   6393  O O   . LEU B 1 366 ? 159.842 22.660  306.585 1.00 51.21  ?  360 LEU B O   1 
ATOM   6394  C CB  . LEU B 1 366 ? 160.742 24.372  303.938 1.00 50.88  ?  360 LEU B CB  1 
ATOM   6395  C CG  . LEU B 1 366 ? 159.515 25.129  304.449 1.00 56.44  ?  360 LEU B CG  1 
ATOM   6396  C CD1 . LEU B 1 366 ? 159.897 26.057  305.590 1.00 60.85  ?  360 LEU B CD1 1 
ATOM   6397  C CD2 . LEU B 1 366 ? 158.847 25.903  303.321 1.00 58.45  ?  360 LEU B CD2 1 
ATOM   6398  N N   . MET B 1 367 ? 160.063 21.360  304.758 1.00 49.98  ?  361 MET B N   1 
ATOM   6399  C CA  . MET B 1 367 ? 159.072 20.399  305.230 1.00 48.07  ?  361 MET B CA  1 
ATOM   6400  C C   . MET B 1 367 ? 159.562 19.644  306.458 1.00 53.48  ?  361 MET B C   1 
ATOM   6401  O O   . MET B 1 367 ? 158.749 19.210  307.281 1.00 59.85  ?  361 MET B O   1 
ATOM   6402  C CB  . MET B 1 367 ? 158.716 19.425  304.108 1.00 42.04  ?  361 MET B CB  1 
ATOM   6403  C CG  . MET B 1 367 ? 158.292 20.113  302.824 1.00 44.27  ?  361 MET B CG  1 
ATOM   6404  S SD  . MET B 1 367 ? 158.233 19.002  301.409 1.00 48.97  ?  361 MET B SD  1 
ATOM   6405  C CE  . MET B 1 367 ? 158.604 20.142  300.079 1.00 40.08  ?  361 MET B CE  1 
ATOM   6406  N N   . TRP B 1 368 ? 160.877 19.473  306.597 1.00 53.40  ?  362 TRP B N   1 
ATOM   6407  C CA  . TRP B 1 368 ? 161.434 18.887  307.809 1.00 52.04  ?  362 TRP B CA  1 
ATOM   6408  C C   . TRP B 1 368 ? 161.525 19.890  308.950 1.00 54.94  ?  362 TRP B C   1 
ATOM   6409  O O   . TRP B 1 368 ? 161.636 19.481  310.110 1.00 56.98  ?  362 TRP B O   1 
ATOM   6410  C CB  . TRP B 1 368 ? 162.826 18.313  307.530 1.00 51.50  ?  362 TRP B CB  1 
ATOM   6411  C CG  . TRP B 1 368 ? 162.845 17.187  306.544 1.00 52.09  ?  362 TRP B CG  1 
ATOM   6412  C CD1 . TRP B 1 368 ? 161.784 16.435  306.133 1.00 50.92  ?  362 TRP B CD1 1 
ATOM   6413  C CD2 . TRP B 1 368 ? 163.987 16.687  305.838 1.00 50.39  ?  362 TRP B CD2 1 
ATOM   6414  N NE1 . TRP B 1 368 ? 162.195 15.496  305.218 1.00 43.97  ?  362 TRP B NE1 1 
ATOM   6415  C CE2 . TRP B 1 368 ? 163.544 15.631  305.019 1.00 50.19  ?  362 TRP B CE2 1 
ATOM   6416  C CE3 . TRP B 1 368 ? 165.342 17.031  305.820 1.00 46.41  ?  362 TRP B CE3 1 
ATOM   6417  C CZ2 . TRP B 1 368 ? 164.407 14.914  304.192 1.00 47.26  ?  362 TRP B CZ2 1 
ATOM   6418  C CZ3 . TRP B 1 368 ? 166.196 16.320  304.998 1.00 46.48  ?  362 TRP B CZ3 1 
ATOM   6419  C CH2 . TRP B 1 368 ? 165.726 15.274  304.196 1.00 43.63  ?  362 TRP B CH2 1 
ATOM   6420  N N   . ARG B 1 369 ? 161.473 21.188  308.647 1.00 61.51  ?  363 ARG B N   1 
ATOM   6421  C CA  . ARG B 1 369 ? 161.669 22.229  309.648 1.00 63.17  ?  363 ARG B CA  1 
ATOM   6422  C C   . ARG B 1 369 ? 160.431 22.489  310.498 1.00 67.60  ?  363 ARG B C   1 
ATOM   6423  O O   . ARG B 1 369 ? 160.528 23.200  311.504 1.00 76.36  ?  363 ARG B O   1 
ATOM   6424  C CB  . ARG B 1 369 ? 162.106 23.531  308.966 1.00 56.80  ?  363 ARG B CB  1 
ATOM   6425  C CG  . ARG B 1 369 ? 162.796 24.518  309.893 1.00 63.73  ?  363 ARG B CG  1 
ATOM   6426  C CD  . ARG B 1 369 ? 162.826 25.918  309.309 1.00 56.32  ?  363 ARG B CD  1 
ATOM   6427  N NE  . ARG B 1 369 ? 163.267 26.899  310.297 1.00 55.92  ?  363 ARG B NE  1 
ATOM   6428  C CZ  . ARG B 1 369 ? 162.515 27.330  311.305 1.00 62.19  ?  363 ARG B CZ  1 
ATOM   6429  N NH1 . ARG B 1 369 ? 161.285 26.861  311.465 1.00 76.42  1  363 ARG B NH1 1 
ATOM   6430  N NH2 . ARG B 1 369 ? 162.994 28.225  312.158 1.00 67.15  ?  363 ARG B NH2 1 
ATOM   6431  N N   . GLY B 1 370 ? 159.278 21.938  310.131 1.00 58.60  ?  364 GLY B N   1 
ATOM   6432  C CA  . GLY B 1 370 ? 158.074 22.166  310.905 1.00 61.18  ?  364 GLY B CA  1 
ATOM   6433  C C   . GLY B 1 370 ? 157.176 20.951  310.994 1.00 64.83  ?  364 GLY B C   1 
ATOM   6434  O O   . GLY B 1 370 ? 156.797 20.376  309.971 1.00 68.32  ?  364 GLY B O   1 
ATOM   6435  N N   . GLY B 1 371 ? 156.827 20.552  312.216 1.00 58.70  ?  365 GLY B N   1 
ATOM   6436  C CA  . GLY B 1 371 ? 155.994 19.397  312.452 1.00 55.32  ?  365 GLY B CA  1 
ATOM   6437  C C   . GLY B 1 371 ? 156.756 18.108  312.683 1.00 61.86  ?  365 GLY B C   1 
ATOM   6438  O O   . GLY B 1 371 ? 156.252 17.215  313.372 1.00 68.93  ?  365 GLY B O   1 
ATOM   6439  N N   . CYS B 1 372 ? 157.957 17.987  312.122 1.00 66.48  ?  366 CYS B N   1 
ATOM   6440  C CA  . CYS B 1 372 ? 158.776 16.803  312.319 1.00 66.01  ?  366 CYS B CA  1 
ATOM   6441  C C   . CYS B 1 372 ? 159.451 16.847  313.688 1.00 66.83  ?  366 CYS B C   1 
ATOM   6442  O O   . CYS B 1 372 ? 159.354 17.826  314.434 1.00 66.74  ?  366 CYS B O   1 
ATOM   6443  C CB  . CYS B 1 372 ? 159.816 16.682  311.207 1.00 62.75  ?  366 CYS B CB  1 
ATOM   6444  S SG  . CYS B 1 372 ? 159.135 16.421  309.554 1.00 58.52  ?  366 CYS B SG  1 
ATOM   6445  N N   . ILE B 1 373 ? 160.147 15.761  314.024 1.00 62.90  ?  367 ILE B N   1 
ATOM   6446  C CA  . ILE B 1 373 ? 160.916 15.726  315.263 1.00 58.36  ?  367 ILE B CA  1 
ATOM   6447  C C   . ILE B 1 373 ? 162.287 16.368  315.060 1.00 62.42  ?  367 ILE B C   1 
ATOM   6448  O O   . ILE B 1 373 ? 162.856 16.940  315.998 1.00 66.22  ?  367 ILE B O   1 
ATOM   6449  C CB  . ILE B 1 373 ? 161.017 14.274  315.774 1.00 60.82  ?  367 ILE B CB  1 
ATOM   6450  C CG1 . ILE B 1 373 ? 159.862 13.951  316.729 1.00 54.43  ?  367 ILE B CG1 1 
ATOM   6451  C CG2 . ILE B 1 373 ? 162.358 14.000  316.448 1.00 61.91  ?  367 ILE B CG2 1 
ATOM   6452  C CD1 . ILE B 1 373 ? 158.500 13.892  316.068 1.00 61.22  ?  367 ILE B CD1 1 
ATOM   6453  N N   . ILE B 1 374 ? 162.814 16.328  313.837 1.00 58.36  ?  368 ILE B N   1 
ATOM   6454  C CA  . ILE B 1 374 ? 164.149 16.836  313.536 1.00 56.67  ?  368 ILE B CA  1 
ATOM   6455  C C   . ILE B 1 374 ? 164.099 18.322  313.209 1.00 54.05  ?  368 ILE B C   1 
ATOM   6456  O O   . ILE B 1 374 ? 165.072 18.886  312.694 1.00 53.60  ?  368 ILE B O   1 
ATOM   6457  C CB  . ILE B 1 374 ? 164.779 16.051  312.373 1.00 57.14  ?  368 ILE B CB  1 
ATOM   6458  C CG1 . ILE B 1 374 ? 164.054 16.365  311.063 1.00 55.01  ?  368 ILE B CG1 1 
ATOM   6459  C CG2 . ILE B 1 374 ? 164.702 14.572  312.647 1.00 54.05  ?  368 ILE B CG2 1 
ATOM   6460  C CD1 . ILE B 1 374 ? 164.683 15.718  309.846 1.00 45.97  ?  368 ILE B CD1 1 
ATOM   6461  N N   . ARG B 1 375 ? 162.972 18.965  313.504 1.00 56.91  ?  369 ARG B N   1 
ATOM   6462  C CA  . ARG B 1 375 ? 162.814 20.373  313.165 1.00 61.94  ?  369 ARG B CA  1 
ATOM   6463  C C   . ARG B 1 375 ? 163.822 21.226  313.927 1.00 64.89  ?  369 ARG B C   1 
ATOM   6464  O O   . ARG B 1 375 ? 164.108 20.983  315.103 1.00 60.57  ?  369 ARG B O   1 
ATOM   6465  C CB  . ARG B 1 375 ? 161.385 20.832  313.461 1.00 62.16  ?  369 ARG B CB  1 
ATOM   6466  C CG  . ARG B 1 375 ? 160.948 20.686  314.911 1.00 62.18  ?  369 ARG B CG  1 
ATOM   6467  C CD  . ARG B 1 375 ? 159.504 21.129  315.087 1.00 53.42  ?  369 ARG B CD  1 
ATOM   6468  N NE  . ARG B 1 375 ? 159.127 21.237  316.492 1.00 50.35  ?  369 ARG B NE  1 
ATOM   6469  C CZ  . ARG B 1 375 ? 158.560 20.261  317.193 1.00 61.76  ?  369 ARG B CZ  1 
ATOM   6470  N NH1 . ARG B 1 375 ? 158.252 20.455  318.468 1.00 64.04  1  369 ARG B NH1 1 
ATOM   6471  N NH2 . ARG B 1 375 ? 158.300 19.093  316.621 1.00 57.28  ?  369 ARG B NH2 1 
ATOM   6472  N N   . SER B 1 376 ? 164.367 22.227  313.240 1.00 65.46  ?  370 SER B N   1 
ATOM   6473  C CA  . SER B 1 376 ? 165.409 23.083  313.790 1.00 66.39  ?  370 SER B CA  1 
ATOM   6474  C C   . SER B 1 376 ? 165.625 24.258  312.850 1.00 65.97  ?  370 SER B C   1 
ATOM   6475  O O   . SER B 1 376 ? 165.423 24.139  311.638 1.00 56.90  ?  370 SER B O   1 
ATOM   6476  C CB  . SER B 1 376 ? 166.722 22.312  313.984 1.00 69.56  ?  370 SER B CB  1 
ATOM   6477  O OG  . SER B 1 376 ? 167.736 23.153  314.508 1.00 80.18  ?  370 SER B OG  1 
ATOM   6478  N N   . VAL B 1 377 ? 166.042 25.392  313.422 1.00 71.93  ?  371 VAL B N   1 
ATOM   6479  C CA  . VAL B 1 377 ? 166.397 26.548  312.601 1.00 71.86  ?  371 VAL B CA  1 
ATOM   6480  C C   . VAL B 1 377 ? 167.586 26.217  311.709 1.00 64.21  ?  371 VAL B C   1 
ATOM   6481  O O   . VAL B 1 377 ? 167.749 26.803  310.630 1.00 51.50  ?  371 VAL B O   1 
ATOM   6482  C CB  . VAL B 1 377 ? 166.671 27.776  313.496 1.00 58.94  ?  371 VAL B CB  1 
ATOM   6483  C CG1 . VAL B 1 377 ? 167.827 27.502  314.447 1.00 69.25  ?  371 VAL B CG1 1 
ATOM   6484  C CG2 . VAL B 1 377 ? 166.942 29.018  312.653 1.00 50.50  ?  371 VAL B CG2 1 
ATOM   6485  N N   . PHE B 1 378 ? 168.424 25.267  312.134 1.00 58.35  ?  372 PHE B N   1 
ATOM   6486  C CA  . PHE B 1 378 ? 169.520 24.795  311.294 1.00 56.73  ?  372 PHE B CA  1 
ATOM   6487  C C   . PHE B 1 378 ? 169.016 24.267  309.956 1.00 62.42  ?  372 PHE B C   1 
ATOM   6488  O O   . PHE B 1 378 ? 169.702 24.406  308.936 1.00 58.72  ?  372 PHE B O   1 
ATOM   6489  C CB  . PHE B 1 378 ? 170.310 23.718  312.040 1.00 62.16  ?  372 PHE B CB  1 
ATOM   6490  C CG  . PHE B 1 378 ? 171.197 22.889  311.157 1.00 68.28  ?  372 PHE B CG  1 
ATOM   6491  C CD1 . PHE B 1 378 ? 172.386 23.402  310.667 1.00 69.48  ?  372 PHE B CD1 1 
ATOM   6492  C CD2 . PHE B 1 378 ? 170.846 21.591  310.827 1.00 59.28  ?  372 PHE B CD2 1 
ATOM   6493  C CE1 . PHE B 1 378 ? 173.205 22.637  309.857 1.00 62.91  ?  372 PHE B CE1 1 
ATOM   6494  C CE2 . PHE B 1 378 ? 171.659 20.823  310.019 1.00 53.68  ?  372 PHE B CE2 1 
ATOM   6495  C CZ  . PHE B 1 378 ? 172.840 21.346  309.533 1.00 58.17  ?  372 PHE B CZ  1 
ATOM   6496  N N   . LEU B 1 379 ? 167.824 23.663  309.937 1.00 67.34  ?  373 LEU B N   1 
ATOM   6497  C CA  . LEU B 1 379 ? 167.220 23.258  308.672 1.00 59.10  ?  373 LEU B CA  1 
ATOM   6498  C C   . LEU B 1 379 ? 166.859 24.461  307.811 1.00 60.70  ?  373 LEU B C   1 
ATOM   6499  O O   . LEU B 1 379 ? 166.892 24.371  306.579 1.00 57.16  ?  373 LEU B O   1 
ATOM   6500  C CB  . LEU B 1 379 ? 165.981 22.401  308.930 1.00 49.85  ?  373 LEU B CB  1 
ATOM   6501  C CG  . LEU B 1 379 ? 166.216 20.894  309.016 1.00 48.51  ?  373 LEU B CG  1 
ATOM   6502  C CD1 . LEU B 1 379 ? 165.034 20.208  309.677 1.00 49.73  ?  373 LEU B CD1 1 
ATOM   6503  C CD2 . LEU B 1 379 ? 166.457 20.326  307.627 1.00 41.05  ?  373 LEU B CD2 1 
ATOM   6504  N N   . GLY B 1 380 ? 166.508 25.586  308.437 1.00 56.88  ?  374 GLY B N   1 
ATOM   6505  C CA  . GLY B 1 380 ? 166.261 26.796  307.673 1.00 61.27  ?  374 GLY B CA  1 
ATOM   6506  C C   . GLY B 1 380 ? 167.501 27.310  306.973 1.00 62.90  ?  374 GLY B C   1 
ATOM   6507  O O   . GLY B 1 380 ? 167.412 27.890  305.887 1.00 64.28  ?  374 GLY B O   1 
ATOM   6508  N N   . LYS B 1 381 ? 168.674 27.107  307.579 1.00 55.82  ?  375 LYS B N   1 
ATOM   6509  C CA  . LYS B 1 381 ? 169.919 27.475  306.915 1.00 58.74  ?  375 LYS B CA  1 
ATOM   6510  C C   . LYS B 1 381 ? 170.188 26.585  305.710 1.00 59.49  ?  375 LYS B C   1 
ATOM   6511  O O   . LYS B 1 381 ? 170.781 27.041  304.725 1.00 60.10  ?  375 LYS B O   1 
ATOM   6512  C CB  . LYS B 1 381 ? 171.086 27.412  307.901 1.00 63.89  ?  375 LYS B CB  1 
ATOM   6513  C CG  . LYS B 1 381 ? 171.262 28.665  308.755 1.00 66.61  ?  375 LYS B CG  1 
ATOM   6514  C CD  . LYS B 1 381 ? 170.173 28.804  309.808 1.00 59.25  ?  375 LYS B CD  1 
ATOM   6515  C CE  . LYS B 1 381 ? 170.357 30.070  310.629 1.00 45.21  ?  375 LYS B CE  1 
ATOM   6516  N NZ  . LYS B 1 381 ? 170.321 31.292  309.780 1.00 51.68  1  375 LYS B NZ  1 
ATOM   6517  N N   . ILE B 1 382 ? 169.765 25.320  305.768 1.00 54.78  ?  376 ILE B N   1 
ATOM   6518  C CA  . ILE B 1 382 ? 169.819 24.468  304.585 1.00 56.17  ?  376 ILE B CA  1 
ATOM   6519  C C   . ILE B 1 382 ? 168.883 25.002  303.510 1.00 53.44  ?  376 ILE B C   1 
ATOM   6520  O O   . ILE B 1 382 ? 169.194 24.953  302.314 1.00 45.61  ?  376 ILE B O   1 
ATOM   6521  C CB  . ILE B 1 382 ? 169.483 23.012  304.957 1.00 58.27  ?  376 ILE B CB  1 
ATOM   6522  C CG1 . ILE B 1 382 ? 170.456 22.490  306.014 1.00 52.30  ?  376 ILE B CG1 1 
ATOM   6523  C CG2 . ILE B 1 382 ? 169.506 22.123  303.721 1.00 48.73  ?  376 ILE B CG2 1 
ATOM   6524  C CD1 . ILE B 1 382 ? 170.292 21.024  306.321 1.00 44.26  ?  376 ILE B CD1 1 
ATOM   6525  N N   . LYS B 1 383 ? 167.724 25.525  303.919 1.00 58.95  ?  377 LYS B N   1 
ATOM   6526  C CA  . LYS B 1 383 ? 166.805 26.129  302.962 1.00 54.89  ?  377 LYS B CA  1 
ATOM   6527  C C   . LYS B 1 383 ? 167.424 27.358  302.308 1.00 67.64  ?  377 LYS B C   1 
ATOM   6528  O O   . LYS B 1 383 ? 167.287 27.561  301.096 1.00 69.17  ?  377 LYS B O   1 
ATOM   6529  C CB  . LYS B 1 383 ? 165.493 26.497  303.652 1.00 55.90  ?  377 LYS B CB  1 
ATOM   6530  C CG  . LYS B 1 383 ? 164.407 26.965  302.699 1.00 70.43  ?  377 LYS B CG  1 
ATOM   6531  C CD  . LYS B 1 383 ? 163.415 27.883  303.392 1.00 61.71  ?  377 LYS B CD  1 
ATOM   6532  C CE  . LYS B 1 383 ? 162.231 28.181  302.489 1.00 54.19  ?  377 LYS B CE  1 
ATOM   6533  N NZ  . LYS B 1 383 ? 162.665 28.563  301.117 1.00 52.30  1  377 LYS B NZ  1 
ATOM   6534  N N   . ASP B 1 384 ? 168.109 28.192  303.096 1.00 70.39  ?  378 ASP B N   1 
ATOM   6535  C CA  . ASP B 1 384 ? 168.769 29.365  302.531 1.00 69.43  ?  378 ASP B CA  1 
ATOM   6536  C C   . ASP B 1 384 ? 169.879 28.965  301.568 1.00 69.94  ?  378 ASP B C   1 
ATOM   6537  O O   . ASP B 1 384 ? 170.023 29.561  300.495 1.00 70.35  ?  378 ASP B O   1 
ATOM   6538  C CB  . ASP B 1 384 ? 169.327 30.254  303.644 1.00 78.26  ?  378 ASP B CB  1 
ATOM   6539  C CG  . ASP B 1 384 ? 168.321 31.278  304.133 1.00 89.14  ?  378 ASP B CG  1 
ATOM   6540  O OD1 . ASP B 1 384 ? 167.885 31.179  305.300 1.00 91.26  ?  378 ASP B OD1 1 
ATOM   6541  O OD2 . ASP B 1 384 ? 167.961 32.178  303.345 1.00 90.52  -1 378 ASP B OD2 1 
ATOM   6542  N N   . ALA B 1 385 ? 170.675 27.957  301.937 1.00 61.85  ?  379 ALA B N   1 
ATOM   6543  C CA  . ALA B 1 385 ? 171.750 27.505  301.059 1.00 57.58  ?  379 ALA B CA  1 
ATOM   6544  C C   . ALA B 1 385 ? 171.202 27.011  299.727 1.00 56.51  ?  379 ALA B C   1 
ATOM   6545  O O   . ALA B 1 385 ? 171.821 27.219  298.677 1.00 54.97  ?  379 ALA B O   1 
ATOM   6546  C CB  . ALA B 1 385 ? 172.564 26.409  301.745 1.00 62.52  ?  379 ALA B CB  1 
ATOM   6547  N N   . PHE B 1 386 ? 170.043 26.359  299.748 1.00 60.47  ?  380 PHE B N   1 
ATOM   6548  C CA  . PHE B 1 386 ? 169.378 25.923  298.530 1.00 57.83  ?  380 PHE B CA  1 
ATOM   6549  C C   . PHE B 1 386 ? 168.447 26.983  297.957 1.00 65.48  ?  380 PHE B C   1 
ATOM   6550  O O   . PHE B 1 386 ? 167.670 26.681  297.046 1.00 80.98  ?  380 PHE B O   1 
ATOM   6551  C CB  . PHE B 1 386 ? 168.611 24.623  298.779 1.00 45.11  ?  380 PHE B CB  1 
ATOM   6552  C CG  . PHE B 1 386 ? 169.452 23.389  298.626 1.00 36.74  ?  380 PHE B CG  1 
ATOM   6553  C CD1 . PHE B 1 386 ? 169.833 22.951  297.368 1.00 36.25  ?  380 PHE B CD1 1 
ATOM   6554  C CD2 . PHE B 1 386 ? 169.865 22.669  299.735 1.00 41.43  ?  380 PHE B CD2 1 
ATOM   6555  C CE1 . PHE B 1 386 ? 170.610 21.818  297.218 1.00 35.74  ?  380 PHE B CE1 1 
ATOM   6556  C CE2 . PHE B 1 386 ? 170.642 21.534  299.592 1.00 41.85  ?  380 PHE B CE2 1 
ATOM   6557  C CZ  . PHE B 1 386 ? 171.014 21.108  298.331 1.00 39.60  ?  380 PHE B CZ  1 
ATOM   6558  N N   . ASP B 1 387 ? 168.498 28.208  298.478 1.00 69.74  ?  381 ASP B N   1 
ATOM   6559  C CA  . ASP B 1 387 ? 167.850 29.349  297.846 1.00 71.66  ?  381 ASP B CA  1 
ATOM   6560  C C   . ASP B 1 387 ? 168.817 30.187  297.023 1.00 68.05  ?  381 ASP B C   1 
ATOM   6561  O O   . ASP B 1 387 ? 168.369 31.019  296.228 1.00 65.05  ?  381 ASP B O   1 
ATOM   6562  C CB  . ASP B 1 387 ? 167.179 30.242  298.900 1.00 71.39  ?  381 ASP B CB  1 
ATOM   6563  C CG  . ASP B 1 387 ? 165.828 29.714  299.342 1.00 72.42  ?  381 ASP B CG  1 
ATOM   6564  O OD1 . ASP B 1 387 ? 165.516 28.541  299.047 1.00 73.63  ?  381 ASP B OD1 1 
ATOM   6565  O OD2 . ASP B 1 387 ? 165.073 30.478  299.980 1.00 74.06  -1 381 ASP B OD2 1 
ATOM   6566  N N   . ARG B 1 388 ? 170.123 29.982  297.190 1.00 73.12  ?  382 ARG B N   1 
ATOM   6567  C CA  . ARG B 1 388 ? 171.129 30.771  296.491 1.00 74.71  ?  382 ARG B CA  1 
ATOM   6568  C C   . ARG B 1 388 ? 171.558 30.136  295.173 1.00 77.86  ?  382 ARG B C   1 
ATOM   6569  O O   . ARG B 1 388 ? 171.760 30.846  294.182 1.00 68.56  ?  382 ARG B O   1 
ATOM   6570  C CB  . ARG B 1 388 ? 172.354 30.974  297.388 1.00 75.01  ?  382 ARG B CB  1 
ATOM   6571  C CG  . ARG B 1 388 ? 172.024 31.400  298.811 1.00 71.24  ?  382 ARG B CG  1 
ATOM   6572  C CD  . ARG B 1 388 ? 173.280 31.749  299.596 1.00 57.86  ?  382 ARG B CD  1 
ATOM   6573  N NE  . ARG B 1 388 ? 172.990 32.025  301.001 1.00 62.69  ?  382 ARG B NE  1 
ATOM   6574  C CZ  . ARG B 1 388 ? 173.281 31.200  302.002 1.00 72.07  ?  382 ARG B CZ  1 
ATOM   6575  N NH1 . ARG B 1 388 ? 172.978 31.534  303.249 1.00 65.20  1  382 ARG B NH1 1 
ATOM   6576  N NH2 . ARG B 1 388 ? 173.883 30.044  301.759 1.00 73.21  ?  382 ARG B NH2 1 
ATOM   6577  N N   . ASN B 1 389 ? 171.698 28.812  295.137 1.00 81.78  ?  383 ASN B N   1 
ATOM   6578  C CA  . ASN B 1 389 ? 172.202 28.144  293.943 1.00 80.55  ?  383 ASN B CA  1 
ATOM   6579  C C   . ASN B 1 389 ? 171.228 27.148  293.306 1.00 80.19  ?  383 ASN B C   1 
ATOM   6580  O O   . ASN B 1 389 ? 171.447 26.762  292.151 1.00 79.39  ?  383 ASN B O   1 
ATOM   6581  C CB  . ASN B 1 389 ? 173.513 27.430  294.289 1.00 75.07  ?  383 ASN B CB  1 
ATOM   6582  C CG  . ASN B 1 389 ? 174.360 27.128  293.067 1.00 73.96  ?  383 ASN B CG  1 
ATOM   6583  O OD1 . ASN B 1 389 ? 174.081 27.606  291.968 1.00 80.07  ?  383 ASN B OD1 1 
ATOM   6584  N ND2 . ASN B 1 389 ? 175.412 26.339  293.258 1.00 63.02  ?  383 ASN B ND2 1 
ATOM   6585  N N   . PRO B 1 390 ? 170.101 26.761  293.978 1.00 77.55  ?  384 PRO B N   1 
ATOM   6586  C CA  . PRO B 1 390 ? 169.445 25.465  293.702 1.00 74.88  ?  384 PRO B CA  1 
ATOM   6587  C C   . PRO B 1 390 ? 170.149 24.480  292.770 1.00 79.32  ?  384 PRO B C   1 
ATOM   6588  O O   . PRO B 1 390 ? 169.495 23.778  291.992 1.00 79.47  ?  384 PRO B O   1 
ATOM   6589  C CB  . PRO B 1 390 ? 168.094 25.899  293.112 1.00 77.73  ?  384 PRO B CB  1 
ATOM   6590  C CG  . PRO B 1 390 ? 167.903 27.361  293.569 1.00 77.89  ?  384 PRO B CG  1 
ATOM   6591  C CD  . PRO B 1 390 ? 169.083 27.718  294.435 1.00 72.86  ?  384 PRO B CD  1 
ATOM   6592  N N   . GLU B 1 391 ? 171.479 24.415  292.854 1.00 82.51  ?  385 GLU B N   1 
ATOM   6593  C CA  . GLU B 1 391 ? 172.279 23.458  292.102 1.00 72.85  ?  385 GLU B CA  1 
ATOM   6594  C C   . GLU B 1 391 ? 173.460 22.983  292.934 1.00 55.23  ?  385 GLU B C   1 
ATOM   6595  O O   . GLU B 1 391 ? 174.391 22.383  292.382 1.00 42.22  ?  385 GLU B O   1 
ATOM   6596  C CB  . GLU B 1 391 ? 172.777 24.065  290.781 1.00 68.71  ?  385 GLU B CB  1 
ATOM   6597  C CG  . GLU B 1 391 ? 171.709 24.197  289.708 1.00 64.54  ?  385 GLU B CG  1 
ATOM   6598  C CD  . GLU B 1 391 ? 171.309 22.858  289.119 1.00 71.42  ?  385 GLU B CD  1 
ATOM   6599  O OE1 . GLU B 1 391 ? 172.156 22.222  288.457 1.00 61.68  ?  385 GLU B OE1 1 
ATOM   6600  O OE2 . GLU B 1 391 ? 170.150 22.438  289.326 1.00 79.06  -1 385 GLU B OE2 1 
ATOM   6601  N N   . LEU B 1 392 ? 173.449 23.248  294.239 1.00 53.88  ?  386 LEU B N   1 
ATOM   6602  C CA  . LEU B 1 392 ? 174.531 22.894  295.144 1.00 51.67  ?  386 LEU B CA  1 
ATOM   6603  C C   . LEU B 1 392 ? 174.702 21.384  295.220 1.00 62.06  ?  386 LEU B C   1 
ATOM   6604  O O   . LEU B 1 392 ? 173.834 20.679  295.745 1.00 66.81  ?  386 LEU B O   1 
ATOM   6605  C CB  . LEU B 1 392 ? 174.254 23.480  296.529 1.00 41.37  ?  386 LEU B CB  1 
ATOM   6606  C CG  . LEU B 1 392 ? 175.354 23.385  297.580 1.00 65.48  ?  386 LEU B CG  1 
ATOM   6607  C CD1 . LEU B 1 392 ? 176.593 24.145  297.132 1.00 76.45  ?  386 LEU B CD1 1 
ATOM   6608  C CD2 . LEU B 1 392 ? 174.847 23.910  298.913 1.00 68.39  ?  386 LEU B CD2 1 
ATOM   6609  N N   . GLN B 1 393 ? 175.819 20.877  294.695 1.00 61.57  ?  387 GLN B N   1 
ATOM   6610  C CA  . GLN B 1 393 ? 176.064 19.442  294.695 1.00 57.39  ?  387 GLN B CA  1 
ATOM   6611  C C   . GLN B 1 393 ? 176.462 18.909  296.066 1.00 60.00  ?  387 GLN B C   1 
ATOM   6612  O O   . GLN B 1 393 ? 176.550 17.688  296.231 1.00 64.60  ?  387 GLN B O   1 
ATOM   6613  C CB  . GLN B 1 393 ? 177.146 19.102  293.666 1.00 56.73  ?  387 GLN B CB  1 
ATOM   6614  C CG  . GLN B 1 393 ? 176.706 18.118  292.584 1.00 68.79  ?  387 GLN B CG  1 
ATOM   6615  C CD  . GLN B 1 393 ? 175.621 18.669  291.672 1.00 68.46  ?  387 GLN B CD  1 
ATOM   6616  O OE1 . GLN B 1 393 ? 175.321 19.863  291.688 1.00 56.99  ?  387 GLN B OE1 1 
ATOM   6617  N NE2 . GLN B 1 393 ? 175.028 17.794  290.866 1.00 67.70  ?  387 GLN B NE2 1 
ATOM   6618  N N   . ASN B 1 394 ? 176.695 19.784  297.045 1.00 52.69  ?  388 ASN B N   1 
ATOM   6619  C CA  . ASN B 1 394 ? 177.043 19.348  298.391 1.00 57.18  ?  388 ASN B CA  1 
ATOM   6620  C C   . ASN B 1 394 ? 176.925 20.504  299.375 1.00 56.09  ?  388 ASN B C   1 
ATOM   6621  O O   . ASN B 1 394 ? 177.427 21.600  299.110 1.00 48.91  ?  388 ASN B O   1 
ATOM   6622  C CB  . ASN B 1 394 ? 178.459 18.772  298.424 1.00 52.60  ?  388 ASN B CB  1 
ATOM   6623  C CG  . ASN B 1 394 ? 178.550 17.506  299.248 1.00 51.27  ?  388 ASN B CG  1 
ATOM   6624  O OD1 . ASN B 1 394 ? 178.618 17.554  300.476 1.00 44.26  ?  388 ASN B OD1 1 
ATOM   6625  N ND2 . ASN B 1 394 ? 178.548 16.361  298.574 1.00 47.38  ?  388 ASN B ND2 1 
ATOM   6626  N N   . LEU B 1 395 ? 176.269 20.272  300.515 1.00 56.30  ?  389 LEU B N   1 
ATOM   6627  C CA  . LEU B 1 395 ? 176.161 21.317  301.527 1.00 57.93  ?  389 LEU B CA  1 
ATOM   6628  C C   . LEU B 1 395 ? 177.523 21.757  302.044 1.00 65.62  ?  389 LEU B C   1 
ATOM   6629  O O   . LEU B 1 395 ? 177.640 22.863  302.586 1.00 71.36  ?  389 LEU B O   1 
ATOM   6630  C CB  . LEU B 1 395 ? 175.287 20.852  302.693 1.00 57.62  ?  389 LEU B CB  1 
ATOM   6631  C CG  . LEU B 1 395 ? 173.778 20.832  302.440 1.00 59.15  ?  389 LEU B CG  1 
ATOM   6632  C CD1 . LEU B 1 395 ? 173.004 20.452  303.697 1.00 52.93  ?  389 LEU B CD1 1 
ATOM   6633  C CD2 . LEU B 1 395 ? 173.314 22.181  301.910 1.00 62.65  ?  389 LEU B CD2 1 
ATOM   6634  N N   . LEU B 1 396 ? 178.556 20.925  301.882 1.00 63.93  ?  390 LEU B N   1 
ATOM   6635  C CA  . LEU B 1 396 ? 179.903 21.270  302.320 1.00 62.80  ?  390 LEU B CA  1 
ATOM   6636  C C   . LEU B 1 396 ? 180.574 22.150  301.277 1.00 69.40  ?  390 LEU B C   1 
ATOM   6637  O O   . LEU B 1 396 ? 181.803 22.259  301.242 1.00 71.19  ?  390 LEU B O   1 
ATOM   6638  C CB  . LEU B 1 396 ? 180.741 20.007  302.567 1.00 49.80  ?  390 LEU B CB  1 
ATOM   6639  C CG  . LEU B 1 396 ? 180.387 19.152  303.779 1.00 51.73  ?  390 LEU B CG  1 
ATOM   6640  C CD1 . LEU B 1 396 ? 181.258 17.911  303.811 1.00 48.91  ?  390 LEU B CD1 1 
ATOM   6641  C CD2 . LEU B 1 396 ? 180.550 19.956  305.060 1.00 59.21  ?  390 LEU B CD2 1 
ATOM   6642  N N   . LEU B 1 397 ? 179.772 22.779  300.417 1.00 68.38  ?  391 LEU B N   1 
ATOM   6643  C CA  . LEU B 1 397 ? 180.300 23.609  299.343 1.00 59.03  ?  391 LEU B CA  1 
ATOM   6644  C C   . LEU B 1 397 ? 179.613 24.970  299.287 1.00 63.42  ?  391 LEU B C   1 
ATOM   6645  O O   . LEU B 1 397 ? 179.688 25.654  298.262 1.00 65.18  ?  391 LEU B O   1 
ATOM   6646  C CB  . LEU B 1 397 ? 180.177 22.885  297.999 1.00 52.12  ?  391 LEU B CB  1 
ATOM   6647  C CG  . LEU B 1 397 ? 181.478 22.608  297.239 1.00 44.51  ?  391 LEU B CG  1 
ATOM   6648  C CD1 . LEU B 1 397 ? 182.536 21.983  298.138 1.00 61.33  ?  391 LEU B CD1 1 
ATOM   6649  C CD2 . LEU B 1 397 ? 181.193 21.707  296.053 1.00 52.24  ?  391 LEU B CD2 1 
ATOM   6650  N N   . ASP B 1 398 ? 178.948 25.380  300.365 1.00 63.70  ?  392 ASP B N   1 
ATOM   6651  C CA  . ASP B 1 398 ? 178.285 26.676  300.429 1.00 72.75  ?  392 ASP B CA  1 
ATOM   6652  C C   . ASP B 1 398 ? 178.839 27.484  301.598 1.00 69.65  ?  392 ASP B C   1 
ATOM   6653  O O   . ASP B 1 398 ? 179.514 26.957  302.484 1.00 64.51  ?  392 ASP B O   1 
ATOM   6654  C CB  . ASP B 1 398 ? 176.763 26.521  300.553 1.00 75.96  ?  392 ASP B CB  1 
ATOM   6655  C CG  . ASP B 1 398 ? 176.000 27.531  299.704 1.00 80.05  ?  392 ASP B CG  1 
ATOM   6656  O OD1 . ASP B 1 398 ? 175.838 27.290  298.487 1.00 74.47  ?  392 ASP B OD1 1 
ATOM   6657  O OD2 . ASP B 1 398 ? 175.565 28.566  300.251 1.00 77.35  -1 392 ASP B OD2 1 
ATOM   6658  N N   . ASP B 1 399 ? 178.519 28.780  301.603 1.00 71.31  ?  393 ASP B N   1 
ATOM   6659  C CA  . ASP B 1 399 ? 179.210 29.720  302.485 1.00 67.72  ?  393 ASP B CA  1 
ATOM   6660  C C   . ASP B 1 399 ? 178.940 29.426  303.959 1.00 64.19  ?  393 ASP B C   1 
ATOM   6661  O O   . ASP B 1 399 ? 179.876 29.356  304.765 1.00 71.92  ?  393 ASP B O   1 
ATOM   6662  C CB  . ASP B 1 399 ? 178.805 31.153  302.136 1.00 81.59  ?  393 ASP B CB  1 
ATOM   6663  C CG  . ASP B 1 399 ? 179.738 32.185  302.738 1.00 89.45  ?  393 ASP B CG  1 
ATOM   6664  O OD1 . ASP B 1 399 ? 180.955 32.120  302.459 1.00 91.39  ?  393 ASP B OD1 1 
ATOM   6665  O OD2 . ASP B 1 399 ? 179.256 33.064  303.484 1.00 81.14  -1 393 ASP B OD2 1 
ATOM   6666  N N   . PHE B 1 400 ? 177.670 29.254  304.334 1.00 66.41  ?  394 PHE B N   1 
ATOM   6667  C CA  . PHE B 1 400 ? 177.331 29.121  305.749 1.00 63.30  ?  394 PHE B CA  1 
ATOM   6668  C C   . PHE B 1 400 ? 177.921 27.849  306.349 1.00 72.37  ?  394 PHE B C   1 
ATOM   6669  O O   . PHE B 1 400 ? 178.489 27.874  307.447 1.00 77.90  ?  394 PHE B O   1 
ATOM   6670  C CB  . PHE B 1 400 ? 175.812 29.148  305.935 1.00 61.53  ?  394 PHE B CB  1 
ATOM   6671  C CG  . PHE B 1 400 ? 175.375 29.037  307.370 1.00 68.11  ?  394 PHE B CG  1 
ATOM   6672  C CD1 . PHE B 1 400 ? 175.265 30.166  308.165 1.00 66.09  ?  394 PHE B CD1 1 
ATOM   6673  C CD2 . PHE B 1 400 ? 175.075 27.803  307.926 1.00 73.19  ?  394 PHE B CD2 1 
ATOM   6674  C CE1 . PHE B 1 400 ? 174.864 30.067  309.485 1.00 61.47  ?  394 PHE B CE1 1 
ATOM   6675  C CE2 . PHE B 1 400 ? 174.676 27.698  309.245 1.00 65.93  ?  394 PHE B CE2 1 
ATOM   6676  C CZ  . PHE B 1 400 ? 174.570 28.832  310.025 1.00 56.69  ?  394 PHE B CZ  1 
ATOM   6677  N N   . PHE B 1 401 ? 177.791 26.723  305.645 1.00 76.61  ?  395 PHE B N   1 
ATOM   6678  C CA  . PHE B 1 401 ? 178.263 25.454  306.189 1.00 75.75  ?  395 PHE B CA  1 
ATOM   6679  C C   . PHE B 1 401 ? 179.781 25.339  306.125 1.00 68.88  ?  395 PHE B C   1 
ATOM   6680  O O   . PHE B 1 401 ? 180.403 24.820  307.059 1.00 71.04  ?  395 PHE B O   1 
ATOM   6681  C CB  . PHE B 1 401 ? 177.610 24.287  305.450 1.00 73.39  ?  395 PHE B CB  1 
ATOM   6682  C CG  . PHE B 1 401 ? 176.115 24.290  305.523 1.00 63.74  ?  395 PHE B CG  1 
ATOM   6683  C CD1 . PHE B 1 401 ? 175.466 23.905  306.684 1.00 58.41  ?  395 PHE B CD1 1 
ATOM   6684  C CD2 . PHE B 1 401 ? 175.356 24.681  304.434 1.00 61.75  ?  395 PHE B CD2 1 
ATOM   6685  C CE1 . PHE B 1 401 ? 174.089 23.910  306.757 1.00 64.89  ?  395 PHE B CE1 1 
ATOM   6686  C CE2 . PHE B 1 401 ? 173.979 24.688  304.500 1.00 61.60  ?  395 PHE B CE2 1 
ATOM   6687  C CZ  . PHE B 1 401 ? 173.345 24.303  305.663 1.00 68.49  ?  395 PHE B CZ  1 
ATOM   6688  N N   . LYS B 1 402 ? 180.390 25.807  305.033 1.00 68.64  ?  396 LYS B N   1 
ATOM   6689  C CA  . LYS B 1 402 ? 181.845 25.755  304.923 1.00 68.96  ?  396 LYS B CA  1 
ATOM   6690  C C   . LYS B 1 402 ? 182.505 26.561  306.034 1.00 65.39  ?  396 LYS B C   1 
ATOM   6691  O O   . LYS B 1 402 ? 183.513 26.133  306.607 1.00 64.24  ?  396 LYS B O   1 
ATOM   6692  C CB  . LYS B 1 402 ? 182.286 26.264  303.551 1.00 55.44  ?  396 LYS B CB  1 
ATOM   6693  C CG  . LYS B 1 402 ? 183.732 25.972  303.197 1.00 66.49  ?  396 LYS B CG  1 
ATOM   6694  C CD  . LYS B 1 402 ? 184.061 26.472  301.798 1.00 73.92  ?  396 LYS B CD  1 
ATOM   6695  C CE  . LYS B 1 402 ? 183.873 27.977  301.690 1.00 75.40  ?  396 LYS B CE  1 
ATOM   6696  N NZ  . LYS B 1 402 ? 184.248 28.492  300.344 1.00 69.51  1  396 LYS B NZ  1 
ATOM   6697  N N   . SER B 1 403 ? 181.938 27.723  306.364 1.00 63.07  ?  397 SER B N   1 
ATOM   6698  C CA  . SER B 1 403 ? 182.508 28.551  307.422 1.00 72.04  ?  397 SER B CA  1 
ATOM   6699  C C   . SER B 1 403 ? 182.244 27.953  308.798 1.00 72.50  ?  397 SER B C   1 
ATOM   6700  O O   . SER B 1 403 ? 183.087 28.057  309.697 1.00 75.50  ?  397 SER B O   1 
ATOM   6701  C CB  . SER B 1 403 ? 181.943 29.969  307.337 1.00 72.82  ?  397 SER B CB  1 
ATOM   6702  O OG  . SER B 1 403 ? 182.159 30.531  306.055 1.00 68.09  ?  397 SER B OG  1 
ATOM   6703  N N   . ALA B 1 404 ? 181.078 27.326  308.983 1.00 71.15  ?  398 ALA B N   1 
ATOM   6704  C CA  . ALA B 1 404 ? 180.729 26.778  310.290 1.00 72.94  ?  398 ALA B CA  1 
ATOM   6705  C C   . ALA B 1 404 ? 181.690 25.670  310.701 1.00 70.80  ?  398 ALA B C   1 
ATOM   6706  O O   . ALA B 1 404 ? 182.055 25.559  311.877 1.00 64.75  ?  398 ALA B O   1 
ATOM   6707  C CB  . ALA B 1 404 ? 179.290 26.265  310.277 1.00 69.27  ?  398 ALA B CB  1 
ATOM   6708  N N   . VAL B 1 405 ? 182.110 24.839  309.746 1.00 66.55  ?  399 VAL B N   1 
ATOM   6709  C CA  . VAL B 1 405 ? 183.082 23.795  310.053 1.00 66.23  ?  399 VAL B CA  1 
ATOM   6710  C C   . VAL B 1 405 ? 184.438 24.409  310.382 1.00 69.78  ?  399 VAL B C   1 
ATOM   6711  O O   . VAL B 1 405 ? 185.123 23.967  311.311 1.00 70.79  ?  399 VAL B O   1 
ATOM   6712  C CB  . VAL B 1 405 ? 183.177 22.794  308.887 1.00 71.81  ?  399 VAL B CB  1 
ATOM   6713  C CG1 . VAL B 1 405 ? 184.355 21.850  309.082 1.00 63.09  ?  399 VAL B CG1 1 
ATOM   6714  C CG2 . VAL B 1 405 ? 181.880 22.009  308.760 1.00 58.21  ?  399 VAL B CG2 1 
ATOM   6715  N N   . GLU B 1 406 ? 184.833 25.453  309.645 1.00 68.36  ?  400 GLU B N   1 
ATOM   6716  C CA  . GLU B 1 406 ? 186.156 26.045  309.829 1.00 63.76  ?  400 GLU B CA  1 
ATOM   6717  C C   . GLU B 1 406 ? 186.374 26.531  311.257 1.00 65.20  ?  400 GLU B C   1 
ATOM   6718  O O   . GLU B 1 406 ? 187.505 26.498  311.754 1.00 73.80  ?  400 GLU B O   1 
ATOM   6719  C CB  . GLU B 1 406 ? 186.358 27.192  308.839 1.00 62.05  ?  400 GLU B CB  1 
ATOM   6720  C CG  . GLU B 1 406 ? 186.460 26.739  307.393 1.00 74.46  ?  400 GLU B CG  1 
ATOM   6721  C CD  . GLU B 1 406 ? 186.480 27.897  306.414 1.00 78.98  ?  400 GLU B CD  1 
ATOM   6722  O OE1 . GLU B 1 406 ? 186.466 29.060  306.867 1.00 86.14  ?  400 GLU B OE1 1 
ATOM   6723  O OE2 . GLU B 1 406 ? 186.506 27.641  305.191 1.00 67.74  -1 400 GLU B OE2 1 
ATOM   6724  N N   . ASN B 1 407 ? 185.317 26.981  311.930 1.00 65.76  ?  401 ASN B N   1 
ATOM   6725  C CA  . ASN B 1 407 ? 185.427 27.354  313.334 1.00 74.62  ?  401 ASN B CA  1 
ATOM   6726  C C   . ASN B 1 407 ? 185.250 26.167  314.269 1.00 80.38  ?  401 ASN B C   1 
ATOM   6727  O O   . ASN B 1 407 ? 185.893 26.117  315.325 1.00 82.55  ?  401 ASN B O   1 
ATOM   6728  C CB  . ASN B 1 407 ? 184.397 28.432  313.683 1.00 76.84  ?  401 ASN B CB  1 
ATOM   6729  C CG  . ASN B 1 407 ? 184.346 28.732  315.171 1.00 83.04  ?  401 ASN B CG  1 
ATOM   6730  O OD1 . ASN B 1 407 ? 183.525 28.176  315.901 1.00 66.57  ?  401 ASN B OD1 1 
ATOM   6731  N ND2 . ASN B 1 407 ? 185.233 29.609  315.629 1.00 76.31  ?  401 ASN B ND2 1 
ATOM   6732  N N   . CYS B 1 408 ? 184.401 25.207  313.900 1.00 75.15  ?  402 CYS B N   1 
ATOM   6733  C CA  . CYS B 1 408 ? 184.122 24.082  314.783 1.00 72.39  ?  402 CYS B CA  1 
ATOM   6734  C C   . CYS B 1 408 ? 185.150 22.966  314.649 1.00 65.51  ?  402 CYS B C   1 
ATOM   6735  O O   . CYS B 1 408 ? 185.363 22.219  315.610 1.00 63.89  ?  402 CYS B O   1 
ATOM   6736  C CB  . CYS B 1 408 ? 182.722 23.530  314.507 1.00 60.82  ?  402 CYS B CB  1 
ATOM   6737  S SG  . CYS B 1 408 ? 181.375 24.678  314.865 1.00 64.39  ?  402 CYS B SG  1 
ATOM   6738  N N   . GLN B 1 409 ? 185.801 22.843  313.487 1.00 62.05  ?  403 GLN B N   1 
ATOM   6739  C CA  . GLN B 1 409 ? 186.627 21.665  313.230 1.00 67.36  ?  403 GLN B CA  1 
ATOM   6740  C C   . GLN B 1 409 ? 187.824 21.584  314.170 1.00 63.22  ?  403 GLN B C   1 
ATOM   6741  O O   . GLN B 1 409 ? 188.309 20.484  314.456 1.00 57.81  ?  403 GLN B O   1 
ATOM   6742  C CB  . GLN B 1 409 ? 187.094 21.641  311.774 1.00 63.24  ?  403 GLN B CB  1 
ATOM   6743  C CG  . GLN B 1 409 ? 188.129 22.689  311.419 1.00 56.34  ?  403 GLN B CG  1 
ATOM   6744  C CD  . GLN B 1 409 ? 189.339 22.086  310.738 1.00 65.15  ?  403 GLN B CD  1 
ATOM   6745  O OE1 . GLN B 1 409 ? 190.025 21.237  311.308 1.00 66.01  ?  403 GLN B OE1 1 
ATOM   6746  N NE2 . GLN B 1 409 ? 189.603 22.514  309.509 1.00 68.85  ?  403 GLN B NE2 1 
ATOM   6747  N N   . ASP B 1 410 ? 188.311 22.722  314.668 1.00 64.99  ?  404 ASP B N   1 
ATOM   6748  C CA  . ASP B 1 410 ? 189.435 22.684  315.597 1.00 68.92  ?  404 ASP B CA  1 
ATOM   6749  C C   . ASP B 1 410 ? 189.008 22.122  316.948 1.00 64.78  ?  404 ASP B C   1 
ATOM   6750  O O   . ASP B 1 410 ? 189.691 21.262  317.517 1.00 69.76  ?  404 ASP B O   1 
ATOM   6751  C CB  . ASP B 1 410 ? 190.048 24.076  315.747 1.00 90.04  ?  404 ASP B CB  1 
ATOM   6752  C CG  . ASP B 1 410 ? 190.856 24.490  314.530 1.00 93.38  ?  404 ASP B CG  1 
ATOM   6753  O OD1 . ASP B 1 410 ? 190.283 25.124  313.618 1.00 83.56  ?  404 ASP B OD1 1 
ATOM   6754  O OD2 . ASP B 1 410 ? 192.063 24.169  314.481 1.00 91.19  -1 404 ASP B OD2 1 
ATOM   6755  N N   . SER B 1 411 ? 187.878 22.594  317.478 1.00 66.00  ?  405 SER B N   1 
ATOM   6756  C CA  . SER B 1 411 ? 187.313 21.981  318.674 1.00 70.24  ?  405 SER B CA  1 
ATOM   6757  C C   . SER B 1 411 ? 186.697 20.620  318.376 1.00 63.93  ?  405 SER B C   1 
ATOM   6758  O O   . SER B 1 411 ? 186.571 19.793  319.286 1.00 52.58  ?  405 SER B O   1 
ATOM   6759  C CB  . SER B 1 411 ? 186.268 22.906  319.299 1.00 67.17  ?  405 SER B CB  1 
ATOM   6760  O OG  . SER B 1 411 ? 186.863 24.097  319.785 1.00 63.80  ?  405 SER B OG  1 
ATOM   6761  N N   . TRP B 1 412 ? 186.308 20.381  317.122 1.00 65.36  ?  406 TRP B N   1 
ATOM   6762  C CA  . TRP B 1 412 ? 185.803 19.073  316.716 1.00 55.20  ?  406 TRP B CA  1 
ATOM   6763  C C   . TRP B 1 412 ? 186.854 17.993  316.936 1.00 53.67  ?  406 TRP B C   1 
ATOM   6764  O O   . TRP B 1 412 ? 186.575 16.950  317.538 1.00 43.16  ?  406 TRP B O   1 
ATOM   6765  C CB  . TRP B 1 412 ? 185.387 19.135  315.246 1.00 59.84  ?  406 TRP B CB  1 
ATOM   6766  C CG  . TRP B 1 412 ? 184.604 17.983  314.717 1.00 55.68  ?  406 TRP B CG  1 
ATOM   6767  C CD1 . TRP B 1 412 ? 184.139 16.906  315.411 1.00 52.10  ?  406 TRP B CD1 1 
ATOM   6768  C CD2 . TRP B 1 412 ? 184.186 17.800  313.360 1.00 44.46  ?  406 TRP B CD2 1 
ATOM   6769  N NE1 . TRP B 1 412 ? 183.456 16.061  314.567 1.00 48.20  ?  406 TRP B NE1 1 
ATOM   6770  C CE2 . TRP B 1 412 ? 183.472 16.589  313.303 1.00 43.95  ?  406 TRP B CE2 1 
ATOM   6771  C CE3 . TRP B 1 412 ? 184.348 18.545  312.188 1.00 39.52  ?  406 TRP B CE3 1 
ATOM   6772  C CZ2 . TRP B 1 412 ? 182.919 16.107  312.120 1.00 45.65  ?  406 TRP B CZ2 1 
ATOM   6773  C CZ3 . TRP B 1 412 ? 183.800 18.064  311.015 1.00 39.05  ?  406 TRP B CZ3 1 
ATOM   6774  C CH2 . TRP B 1 412 ? 183.096 16.856  310.989 1.00 43.60  ?  406 TRP B CH2 1 
ATOM   6775  N N   . ARG B 1 413 ? 188.076 18.234  316.455 1.00 59.53  ?  407 ARG B N   1 
ATOM   6776  C CA  . ARG B 1 413 ? 189.147 17.256  316.610 1.00 56.08  ?  407 ARG B CA  1 
ATOM   6777  C C   . ARG B 1 413 ? 189.612 17.153  318.056 1.00 58.57  ?  407 ARG B C   1 
ATOM   6778  O O   . ARG B 1 413 ? 190.128 16.107  318.466 1.00 61.15  ?  407 ARG B O   1 
ATOM   6779  C CB  . ARG B 1 413 ? 190.316 17.618  315.695 1.00 45.76  ?  407 ARG B CB  1 
ATOM   6780  C CG  . ARG B 1 413 ? 189.913 17.761  314.240 1.00 47.35  ?  407 ARG B CG  1 
ATOM   6781  C CD  . ARG B 1 413 ? 191.069 18.206  313.364 1.00 43.02  ?  407 ARG B CD  1 
ATOM   6782  N NE  . ARG B 1 413 ? 190.627 18.436  311.993 1.00 45.97  ?  407 ARG B NE  1 
ATOM   6783  C CZ  . ARG B 1 413 ? 190.449 17.472  311.096 1.00 49.64  ?  407 ARG B CZ  1 
ATOM   6784  N NH1 . ARG B 1 413 ? 190.676 16.208  311.426 1.00 52.83  1  407 ARG B NH1 1 
ATOM   6785  N NH2 . ARG B 1 413 ? 190.040 17.769  309.870 1.00 50.40  ?  407 ARG B NH2 1 
ATOM   6786  N N   . ARG B 1 414 ? 189.444 18.220  318.840 1.00 55.70  ?  408 ARG B N   1 
ATOM   6787  C CA  . ARG B 1 414 ? 189.814 18.159  320.250 1.00 56.33  ?  408 ARG B CA  1 
ATOM   6788  C C   . ARG B 1 414 ? 188.854 17.271  321.031 1.00 59.41  ?  408 ARG B C   1 
ATOM   6789  O O   . ARG B 1 414 ? 189.275 16.524  321.920 1.00 61.08  ?  408 ARG B O   1 
ATOM   6790  C CB  . ARG B 1 414 ? 189.852 19.566  320.846 1.00 63.77  ?  408 ARG B CB  1 
ATOM   6791  C CG  . ARG B 1 414 ? 190.420 19.629  322.255 1.00 55.56  ?  408 ARG B CG  1 
ATOM   6792  C CD  . ARG B 1 414 ? 190.455 21.057  322.785 1.00 55.14  ?  408 ARG B CD  1 
ATOM   6793  N NE  . ARG B 1 414 ? 191.165 21.963  321.885 1.00 63.17  ?  408 ARG B NE  1 
ATOM   6794  C CZ  . ARG B 1 414 ? 190.568 22.838  321.082 1.00 64.15  ?  408 ARG B CZ  1 
ATOM   6795  N NH1 . ARG B 1 414 ? 189.245 22.931  321.067 1.00 62.88  1  408 ARG B NH1 1 
ATOM   6796  N NH2 . ARG B 1 414 ? 191.293 23.621  320.294 1.00 58.93  ?  408 ARG B NH2 1 
ATOM   6797  N N   . ALA B 1 415 ? 187.559 17.339  320.713 1.00 62.55  ?  409 ALA B N   1 
ATOM   6798  C CA  . ALA B 1 415 ? 186.591 16.471  321.375 1.00 58.35  ?  409 ALA B CA  1 
ATOM   6799  C C   . ALA B 1 415 ? 186.753 15.024  320.928 1.00 57.39  ?  409 ALA B C   1 
ATOM   6800  O O   . ALA B 1 415 ? 186.581 14.097  321.728 1.00 52.59  ?  409 ALA B O   1 
ATOM   6801  C CB  . ALA B 1 415 ? 185.170 16.962  321.102 1.00 54.91  ?  409 ALA B CB  1 
ATOM   6802  N N   . VAL B 1 416 ? 187.086 14.812  319.653 1.00 59.68  ?  410 VAL B N   1 
ATOM   6803  C CA  . VAL B 1 416 ? 187.295 13.457  319.155 1.00 56.65  ?  410 VAL B CA  1 
ATOM   6804  C C   . VAL B 1 416 ? 188.548 12.850  319.774 1.00 56.44  ?  410 VAL B C   1 
ATOM   6805  O O   . VAL B 1 416 ? 188.535 11.708  320.249 1.00 49.35  ?  410 VAL B O   1 
ATOM   6806  C CB  . VAL B 1 416 ? 187.363 13.454  317.617 1.00 56.95  ?  410 VAL B CB  1 
ATOM   6807  C CG1 . VAL B 1 416 ? 187.814 12.097  317.109 1.00 59.68  ?  410 VAL B CG1 1 
ATOM   6808  C CG2 . VAL B 1 416 ? 186.010 13.817  317.027 1.00 50.74  ?  410 VAL B CG2 1 
ATOM   6809  N N   . SER B 1 417 ? 189.647 13.609  319.785 1.00 58.30  ?  411 SER B N   1 
ATOM   6810  C CA  . SER B 1 417 ? 190.892 13.099  320.349 1.00 53.61  ?  411 SER B CA  1 
ATOM   6811  C C   . SER B 1 417 ? 190.762 12.853  321.848 1.00 52.66  ?  411 SER B C   1 
ATOM   6812  O O   . SER B 1 417 ? 191.297 11.869  322.371 1.00 54.24  ?  411 SER B O   1 
ATOM   6813  C CB  . SER B 1 417 ? 192.036 14.072  320.062 1.00 49.91  ?  411 SER B CB  1 
ATOM   6814  O OG  . SER B 1 417 ? 193.255 13.605  320.613 1.00 61.47  ?  411 SER B OG  1 
ATOM   6815  N N   . THR B 1 418 ? 190.054 13.736  322.555 1.00 51.19  ?  412 THR B N   1 
ATOM   6816  C CA  . THR B 1 418 ? 189.881 13.558  323.994 1.00 53.59  ?  412 THR B CA  1 
ATOM   6817  C C   . THR B 1 418 ? 189.005 12.348  324.294 1.00 53.38  ?  412 THR B C   1 
ATOM   6818  O O   . THR B 1 418 ? 189.328 11.538  325.170 1.00 54.96  ?  412 THR B O   1 
ATOM   6819  C CB  . THR B 1 418 ? 189.286 14.823  324.616 1.00 56.47  ?  412 THR B CB  1 
ATOM   6820  O OG1 . THR B 1 418 ? 190.128 15.945  324.322 1.00 47.09  ?  412 THR B OG1 1 
ATOM   6821  C CG2 . THR B 1 418 ? 189.164 14.670  326.125 1.00 50.69  ?  412 THR B CG2 1 
ATOM   6822  N N   . GLY B 1 419 ? 187.891 12.207  323.572 1.00 51.45  ?  413 GLY B N   1 
ATOM   6823  C CA  . GLY B 1 419 ? 187.018 11.066  323.786 1.00 51.51  ?  413 GLY B CA  1 
ATOM   6824  C C   . GLY B 1 419 ? 187.661 9.744   323.421 1.00 50.89  ?  413 GLY B C   1 
ATOM   6825  O O   . GLY B 1 419 ? 187.357 8.714   324.030 1.00 39.75  ?  413 GLY B O   1 
ATOM   6826  N N   . VAL B 1 420 ? 188.553 9.750   322.429 1.00 50.57  ?  414 VAL B N   1 
ATOM   6827  C CA  . VAL B 1 420 ? 189.271 8.533   322.062 1.00 50.13  ?  414 VAL B CA  1 
ATOM   6828  C C   . VAL B 1 420 ? 190.195 8.100   323.193 1.00 54.57  ?  414 VAL B C   1 
ATOM   6829  O O   . VAL B 1 420 ? 190.200 6.932   323.601 1.00 60.64  ?  414 VAL B O   1 
ATOM   6830  C CB  . VAL B 1 420 ? 190.042 8.745   320.746 1.00 54.59  ?  414 VAL B CB  1 
ATOM   6831  C CG1 . VAL B 1 420 ? 191.199 7.764   320.638 1.00 47.59  ?  414 VAL B CG1 1 
ATOM   6832  C CG2 . VAL B 1 420 ? 189.106 8.600   319.556 1.00 48.93  ?  414 VAL B CG2 1 
ATOM   6833  N N   . GLN B 1 421 ? 190.985 9.036   323.724 1.00 51.95  ?  415 GLN B N   1 
ATOM   6834  C CA  . GLN B 1 421 ? 191.894 8.713   324.817 1.00 53.27  ?  415 GLN B CA  1 
ATOM   6835  C C   . GLN B 1 421 ? 191.157 8.444   326.123 1.00 51.26  ?  415 GLN B C   1 
ATOM   6836  O O   . GLN B 1 421 ? 191.708 7.777   327.004 1.00 52.49  ?  415 GLN B O   1 
ATOM   6837  C CB  . GLN B 1 421 ? 192.904 9.845   325.008 1.00 54.77  ?  415 GLN B CB  1 
ATOM   6838  C CG  . GLN B 1 421 ? 193.764 10.111  323.783 1.00 58.58  ?  415 GLN B CG  1 
ATOM   6839  C CD  . GLN B 1 421 ? 194.642 11.335  323.940 1.00 65.29  ?  415 GLN B CD  1 
ATOM   6840  O OE1 . GLN B 1 421 ? 194.323 12.410  323.431 1.00 54.96  ?  415 GLN B OE1 1 
ATOM   6841  N NE2 . GLN B 1 421 ? 195.755 11.180  324.647 1.00 72.05  ?  415 GLN B NE2 1 
ATOM   6842  N N   . ALA B 1 422 ? 189.930 8.945   326.265 1.00 55.28  ?  416 ALA B N   1 
ATOM   6843  C CA  . ALA B 1 422 ? 189.114 8.694   327.446 1.00 54.52  ?  416 ALA B CA  1 
ATOM   6844  C C   . ALA B 1 422 ? 188.346 7.382   327.372 1.00 57.41  ?  416 ALA B C   1 
ATOM   6845  O O   . ALA B 1 422 ? 187.824 6.930   328.397 1.00 52.38  ?  416 ALA B O   1 
ATOM   6846  C CB  . ALA B 1 422 ? 188.124 9.843   327.662 1.00 46.28  ?  416 ALA B CB  1 
ATOM   6847  N N   . GLY B 1 423 ? 188.264 6.765   326.196 1.00 58.64  ?  417 GLY B N   1 
ATOM   6848  C CA  . GLY B 1 423 ? 187.500 5.543   326.048 1.00 54.23  ?  417 GLY B CA  1 
ATOM   6849  C C   . GLY B 1 423 ? 186.008 5.752   325.948 1.00 53.10  ?  417 GLY B C   1 
ATOM   6850  O O   . GLY B 1 423 ? 185.237 4.886   326.374 1.00 52.23  ?  417 GLY B O   1 
ATOM   6851  N N   . ILE B 1 424 ? 185.577 6.876   325.395 1.00 53.08  ?  418 ILE B N   1 
ATOM   6852  C CA  . ILE B 1 424 ? 184.160 7.212   325.277 1.00 55.25  ?  418 ILE B CA  1 
ATOM   6853  C C   . ILE B 1 424 ? 183.705 6.884   323.859 1.00 52.72  ?  418 ILE B C   1 
ATOM   6854  O O   . ILE B 1 424 ? 184.319 7.369   322.899 1.00 46.01  ?  418 ILE B O   1 
ATOM   6855  C CB  . ILE B 1 424 ? 183.900 8.693   325.603 1.00 60.36  ?  418 ILE B CB  1 
ATOM   6856  C CG1 . ILE B 1 424 ? 184.477 9.040   326.976 1.00 58.70  ?  418 ILE B CG1 1 
ATOM   6857  C CG2 . ILE B 1 424 ? 182.409 8.991   325.555 1.00 60.80  ?  418 ILE B CG2 1 
ATOM   6858  C CD1 . ILE B 1 424 ? 184.017 8.115   328.081 1.00 60.59  ?  418 ILE B CD1 1 
ATOM   6859  N N   . PRO B 1 425 ? 182.652 6.084   323.686 1.00 53.35  ?  419 PRO B N   1 
ATOM   6860  C CA  . PRO B 1 425 ? 182.196 5.724   322.334 1.00 44.24  ?  419 PRO B CA  1 
ATOM   6861  C C   . PRO B 1 425 ? 181.523 6.909   321.659 1.00 43.71  ?  419 PRO B C   1 
ATOM   6862  O O   . PRO B 1 425 ? 180.514 7.423   322.145 1.00 51.63  ?  419 PRO B O   1 
ATOM   6863  C CB  . PRO B 1 425 ? 181.204 4.579   322.585 1.00 42.63  ?  419 PRO B CB  1 
ATOM   6864  C CG  . PRO B 1 425 ? 181.374 4.201   324.033 1.00 47.00  ?  419 PRO B CG  1 
ATOM   6865  C CD  . PRO B 1 425 ? 181.864 5.417   324.731 1.00 55.73  ?  419 PRO B CD  1 
ATOM   6866  N N   . MET B 1 426 ? 182.090 7.344   320.537 1.00 36.92  ?  420 MET B N   1 
ATOM   6867  C CA  . MET B 1 426 ? 181.513 8.408   319.716 1.00 44.84  ?  420 MET B CA  1 
ATOM   6868  C C   . MET B 1 426 ? 181.506 7.957   318.261 1.00 47.57  ?  420 MET B C   1 
ATOM   6869  O O   . MET B 1 426 ? 182.262 8.478   317.433 1.00 44.55  ?  420 MET B O   1 
ATOM   6870  C CB  . MET B 1 426 ? 182.291 9.715   319.871 1.00 46.11  ?  420 MET B CB  1 
ATOM   6871  C CG  . MET B 1 426 ? 183.074 9.844   321.163 1.00 54.40  ?  420 MET B CG  1 
ATOM   6872  S SD  . MET B 1 426 ? 184.280 11.172  321.039 1.00 50.57  ?  420 MET B SD  1 
ATOM   6873  C CE  . MET B 1 426 ? 184.979 10.799  319.433 1.00 55.18  ?  420 MET B CE  1 
ATOM   6874  N N   . PRO B 1 427 ? 180.657 6.984   317.913 1.00 49.54  ?  421 PRO B N   1 
ATOM   6875  C CA  . PRO B 1 427 ? 180.669 6.479   316.530 1.00 47.53  ?  421 PRO B CA  1 
ATOM   6876  C C   . PRO B 1 427 ? 180.305 7.533   315.501 1.00 51.67  ?  421 PRO B C   1 
ATOM   6877  O O   . PRO B 1 427 ? 180.923 7.585   314.431 1.00 53.83  ?  421 PRO B O   1 
ATOM   6878  C CB  . PRO B 1 427 ? 179.639 5.338   316.564 1.00 52.11  ?  421 PRO B CB  1 
ATOM   6879  C CG  . PRO B 1 427 ? 179.502 4.978   318.010 1.00 47.72  ?  421 PRO B CG  1 
ATOM   6880  C CD  . PRO B 1 427 ? 179.684 6.263   318.752 1.00 50.27  ?  421 PRO B CD  1 
ATOM   6881  N N   . CYS B 1 428 ? 179.322 8.385   315.798 1.00 48.99  ?  422 CYS B N   1 
ATOM   6882  C CA  . CYS B 1 428 ? 178.884 9.377   314.824 1.00 48.00  ?  422 CYS B CA  1 
ATOM   6883  C C   . CYS B 1 428 ? 179.805 10.590  314.778 1.00 48.15  ?  422 CYS B C   1 
ATOM   6884  O O   . CYS B 1 428 ? 179.992 11.177  313.706 1.00 44.74  ?  422 CYS B O   1 
ATOM   6885  C CB  . CYS B 1 428 ? 177.451 9.810   315.127 1.00 48.27  ?  422 CYS B CB  1 
ATOM   6886  S SG  . CYS B 1 428 ? 176.215 8.529   314.830 1.00 54.65  ?  422 CYS B SG  1 
ATOM   6887  N N   . PHE B 1 429 ? 180.382 10.983  315.916 1.00 55.86  ?  423 PHE B N   1 
ATOM   6888  C CA  . PHE B 1 429 ? 181.353 12.073  315.908 1.00 48.33  ?  423 PHE B CA  1 
ATOM   6889  C C   . PHE B 1 429 ? 182.570 11.716  315.065 1.00 49.40  ?  423 PHE B C   1 
ATOM   6890  O O   . PHE B 1 429 ? 183.075 12.550  314.304 1.00 47.05  ?  423 PHE B O   1 
ATOM   6891  C CB  . PHE B 1 429 ? 181.782 12.414  317.336 1.00 44.68  ?  423 PHE B CB  1 
ATOM   6892  C CG  . PHE B 1 429 ? 180.760 13.197  318.112 1.00 46.07  ?  423 PHE B CG  1 
ATOM   6893  C CD1 . PHE B 1 429 ? 179.776 13.922  317.463 1.00 53.24  ?  423 PHE B CD1 1 
ATOM   6894  C CD2 . PHE B 1 429 ? 180.792 13.213  319.498 1.00 50.25  ?  423 PHE B CD2 1 
ATOM   6895  C CE1 . PHE B 1 429 ? 178.840 14.644  318.181 1.00 57.25  ?  423 PHE B CE1 1 
ATOM   6896  C CE2 . PHE B 1 429 ? 179.859 13.933  320.220 1.00 51.47  ?  423 PHE B CE2 1 
ATOM   6897  C CZ  . PHE B 1 429 ? 178.882 14.649  319.561 1.00 49.78  ?  423 PHE B CZ  1 
ATOM   6898  N N   . THR B 1 430 ? 183.050 10.476  315.180 1.00 51.21  ?  424 THR B N   1 
ATOM   6899  C CA  . THR B 1 430 ? 184.261 10.078  314.473 1.00 44.18  ?  424 THR B CA  1 
ATOM   6900  C C   . THR B 1 430 ? 183.996 9.811   312.995 1.00 47.83  ?  424 THR B C   1 
ATOM   6901  O O   . THR B 1 430 ? 184.823 10.161  312.145 1.00 44.95  ?  424 THR B O   1 
ATOM   6902  C CB  . THR B 1 430 ? 184.876 8.844   315.133 1.00 39.67  ?  424 THR B CB  1 
ATOM   6903  O OG1 . THR B 1 430 ? 184.076 8.451   316.254 1.00 44.17  ?  424 THR B OG1 1 
ATOM   6904  C CG2 . THR B 1 430 ? 186.281 9.152   315.616 1.00 50.35  ?  424 THR B CG2 1 
ATOM   6905  N N   . THR B 1 431 ? 182.857 9.194   312.664 1.00 49.60  ?  425 THR B N   1 
ATOM   6906  C CA  . THR B 1 431 ? 182.570 8.918   311.260 1.00 47.25  ?  425 THR B CA  1 
ATOM   6907  C C   . THR B 1 431 ? 182.252 10.194  310.491 1.00 45.08  ?  425 THR B C   1 
ATOM   6908  O O   . THR B 1 431 ? 182.503 10.265  309.283 1.00 45.21  ?  425 THR B O   1 
ATOM   6909  C CB  . THR B 1 431 ? 181.421 7.913   311.127 1.00 43.83  ?  425 THR B CB  1 
ATOM   6910  O OG1 . THR B 1 431 ? 181.345 7.455   309.772 1.00 43.16  ?  425 THR B OG1 1 
ATOM   6911  C CG2 . THR B 1 431 ? 180.091 8.547   311.507 1.00 40.86  ?  425 THR B CG2 1 
ATOM   6912  N N   . ALA B 1 432 ? 181.709 11.210  311.166 1.00 41.26  ?  426 ALA B N   1 
ATOM   6913  C CA  . ALA B 1 432 ? 181.508 12.497  310.512 1.00 44.69  ?  426 ALA B CA  1 
ATOM   6914  C C   . ALA B 1 432 ? 182.840 13.186  310.254 1.00 47.84  ?  426 ALA B C   1 
ATOM   6915  O O   . ALA B 1 432 ? 183.032 13.811  309.205 1.00 41.11  ?  426 ALA B O   1 
ATOM   6916  C CB  . ALA B 1 432 ? 180.596 13.383  311.360 1.00 44.39  ?  426 ALA B CB  1 
ATOM   6917  N N   . LEU B 1 433 ? 183.774 13.073  311.200 1.00 45.89  ?  427 LEU B N   1 
ATOM   6918  C CA  . LEU B 1 433 ? 185.102 13.641  311.004 1.00 39.44  ?  427 LEU B CA  1 
ATOM   6919  C C   . LEU B 1 433 ? 185.895 12.842  309.979 1.00 43.99  ?  427 LEU B C   1 
ATOM   6920  O O   . LEU B 1 433 ? 186.662 13.413  309.196 1.00 44.42  ?  427 LEU B O   1 
ATOM   6921  C CB  . LEU B 1 433 ? 185.841 13.700  312.339 1.00 43.48  ?  427 LEU B CB  1 
ATOM   6922  C CG  . LEU B 1 433 ? 187.217 14.365  312.352 1.00 50.72  ?  427 LEU B CG  1 
ATOM   6923  C CD1 . LEU B 1 433 ? 187.133 15.793  311.837 1.00 44.04  ?  427 LEU B CD1 1 
ATOM   6924  C CD2 . LEU B 1 433 ? 187.789 14.335  313.757 1.00 51.36  ?  427 LEU B CD2 1 
ATOM   6925  N N   . SER B 1 434 ? 185.719 11.518  309.966 1.00 42.83  ?  428 SER B N   1 
ATOM   6926  C CA  . SER B 1 434 ? 186.413 10.692  308.983 1.00 42.51  ?  428 SER B CA  1 
ATOM   6927  C C   . SER B 1 434 ? 185.900 10.963  307.574 1.00 42.39  ?  428 SER B C   1 
ATOM   6928  O O   . SER B 1 434 ? 186.687 11.010  306.621 1.00 40.16  ?  428 SER B O   1 
ATOM   6929  C CB  . SER B 1 434 ? 186.260 9.213   309.336 1.00 42.10  ?  428 SER B CB  1 
ATOM   6930  O OG  . SER B 1 434 ? 186.874 8.918   310.578 1.00 45.16  ?  428 SER B OG  1 
ATOM   6931  N N   . PHE B 1 435 ? 184.586 11.142  307.422 1.00 43.67  ?  429 PHE B N   1 
ATOM   6932  C CA  . PHE B 1 435 ? 184.036 11.441  306.104 1.00 42.69  ?  429 PHE B CA  1 
ATOM   6933  C C   . PHE B 1 435 ? 184.481 12.814  305.619 1.00 43.75  ?  429 PHE B C   1 
ATOM   6934  O O   . PHE B 1 435 ? 184.712 13.009  304.420 1.00 42.87  ?  429 PHE B O   1 
ATOM   6935  C CB  . PHE B 1 435 ? 182.510 11.353  306.132 1.00 43.69  ?  429 PHE B CB  1 
ATOM   6936  C CG  . PHE B 1 435 ? 181.856 11.775  304.845 1.00 39.88  ?  429 PHE B CG  1 
ATOM   6937  C CD1 . PHE B 1 435 ? 181.797 10.907  303.767 1.00 36.85  ?  429 PHE B CD1 1 
ATOM   6938  C CD2 . PHE B 1 435 ? 181.301 13.038  304.712 1.00 38.21  ?  429 PHE B CD2 1 
ATOM   6939  C CE1 . PHE B 1 435 ? 181.198 11.292  302.582 1.00 37.35  ?  429 PHE B CE1 1 
ATOM   6940  C CE2 . PHE B 1 435 ? 180.702 13.428  303.529 1.00 34.96  ?  429 PHE B CE2 1 
ATOM   6941  C CZ  . PHE B 1 435 ? 180.651 12.553  302.463 1.00 35.34  ?  429 PHE B CZ  1 
ATOM   6942  N N   . TYR B 1 436 ? 184.606 13.779  306.534 1.00 44.79  ?  430 TYR B N   1 
ATOM   6943  C CA  . TYR B 1 436 ? 185.032 15.116  306.137 1.00 45.48  ?  430 TYR B CA  1 
ATOM   6944  C C   . TYR B 1 436 ? 186.470 15.111  305.636 1.00 43.87  ?  430 TYR B C   1 
ATOM   6945  O O   . TYR B 1 436 ? 186.780 15.740  304.619 1.00 44.86  ?  430 TYR B O   1 
ATOM   6946  C CB  . TYR B 1 436 ? 184.869 16.091  307.303 1.00 50.02  ?  430 TYR B CB  1 
ATOM   6947  C CG  . TYR B 1 436 ? 185.334 17.495  306.989 1.00 54.89  ?  430 TYR B CG  1 
ATOM   6948  C CD1 . TYR B 1 436 ? 184.788 18.207  305.929 1.00 55.74  ?  430 TYR B CD1 1 
ATOM   6949  C CD2 . TYR B 1 436 ? 186.314 18.112  307.757 1.00 56.26  ?  430 TYR B CD2 1 
ATOM   6950  C CE1 . TYR B 1 436 ? 185.209 19.492  305.637 1.00 63.50  ?  430 TYR B CE1 1 
ATOM   6951  C CE2 . TYR B 1 436 ? 186.740 19.397  307.475 1.00 61.85  ?  430 TYR B CE2 1 
ATOM   6952  C CZ  . TYR B 1 436 ? 186.185 20.082  306.414 1.00 66.52  ?  430 TYR B CZ  1 
ATOM   6953  O OH  . TYR B 1 436 ? 186.606 21.360  306.128 1.00 66.00  ?  430 TYR B OH  1 
ATOM   6954  N N   . ASP B 1 437 ? 187.362 14.401  306.333 1.00 43.60  ?  431 ASP B N   1 
ATOM   6955  C CA  . ASP B 1 437 ? 188.746 14.315  305.882 1.00 41.05  ?  431 ASP B CA  1 
ATOM   6956  C C   . ASP B 1 437 ? 188.867 13.534  304.580 1.00 42.89  ?  431 ASP B C   1 
ATOM   6957  O O   . ASP B 1 437 ? 189.742 13.832  303.760 1.00 49.36  ?  431 ASP B O   1 
ATOM   6958  C CB  . ASP B 1 437 ? 189.616 13.679  306.966 1.00 40.55  ?  431 ASP B CB  1 
ATOM   6959  C CG  . ASP B 1 437 ? 189.741 14.551  308.201 1.00 50.86  ?  431 ASP B CG  1 
ATOM   6960  O OD1 . ASP B 1 437 ? 189.651 15.789  308.067 1.00 50.28  ?  431 ASP B OD1 1 
ATOM   6961  O OD2 . ASP B 1 437 ? 189.932 13.997  309.305 1.00 48.96  -1 431 ASP B OD2 1 
ATOM   6962  N N   . GLY B 1 438 ? 188.007 12.541  304.370 1.00 41.77  ?  432 GLY B N   1 
ATOM   6963  C CA  . GLY B 1 438 ? 188.048 11.761  303.150 1.00 41.27  ?  432 GLY B CA  1 
ATOM   6964  C C   . GLY B 1 438 ? 187.477 12.501  301.959 1.00 44.04  ?  432 GLY B C   1 
ATOM   6965  O O   . GLY B 1 438 ? 187.997 12.399  300.844 1.00 40.32  ?  432 GLY B O   1 
ATOM   6966  N N   . TYR B 1 439 ? 186.403 13.259  302.189 1.00 43.58  ?  433 TYR B N   1 
ATOM   6967  C CA  . TYR B 1 439 ? 185.760 13.983  301.099 1.00 44.40  ?  433 TYR B CA  1 
ATOM   6968  C C   . TYR B 1 439 ? 186.606 15.158  300.623 1.00 47.78  ?  433 TYR B C   1 
ATOM   6969  O O   . TYR B 1 439 ? 186.514 15.553  299.455 1.00 44.94  ?  433 TYR B O   1 
ATOM   6970  C CB  . TYR B 1 439 ? 184.375 14.461  301.540 1.00 44.15  ?  433 TYR B CB  1 
ATOM   6971  C CG  . TYR B 1 439 ? 183.599 15.194  300.469 1.00 49.98  ?  433 TYR B CG  1 
ATOM   6972  C CD1 . TYR B 1 439 ? 183.146 14.530  299.336 1.00 45.89  ?  433 TYR B CD1 1 
ATOM   6973  C CD2 . TYR B 1 439 ? 183.308 16.546  300.596 1.00 46.98  ?  433 TYR B CD2 1 
ATOM   6974  C CE1 . TYR B 1 439 ? 182.435 15.193  298.356 1.00 46.30  ?  433 TYR B CE1 1 
ATOM   6975  C CE2 . TYR B 1 439 ? 182.594 17.218  299.622 1.00 42.85  ?  433 TYR B CE2 1 
ATOM   6976  C CZ  . TYR B 1 439 ? 182.161 16.537  298.504 1.00 45.79  ?  433 TYR B CZ  1 
ATOM   6977  O OH  . TYR B 1 439 ? 181.451 17.202  297.530 1.00 48.14  ?  433 TYR B OH  1 
ATOM   6978  N N   . ARG B 1 440 ? 187.438 15.719  301.500 1.00 47.23  ?  434 ARG B N   1 
ATOM   6979  C CA  . ARG B 1 440 ? 188.254 16.876  301.160 1.00 43.60  ?  434 ARG B CA  1 
ATOM   6980  C C   . ARG B 1 440 ? 189.600 16.509  300.548 1.00 48.33  ?  434 ARG B C   1 
ATOM   6981  O O   . ARG B 1 440 ? 190.327 17.408  300.113 1.00 51.71  ?  434 ARG B O   1 
ATOM   6982  C CB  . ARG B 1 440 ? 188.489 17.740  302.403 1.00 46.90  ?  434 ARG B CB  1 
ATOM   6983  C CG  . ARG B 1 440 ? 189.393 17.091  303.433 1.00 48.42  ?  434 ARG B CG  1 
ATOM   6984  C CD  . ARG B 1 440 ? 189.610 17.993  304.634 1.00 51.53  ?  434 ARG B CD  1 
ATOM   6985  N NE  . ARG B 1 440 ? 190.545 17.399  305.585 1.00 46.31  ?  434 ARG B NE  1 
ATOM   6986  C CZ  . ARG B 1 440 ? 191.865 17.423  305.441 1.00 56.18  ?  434 ARG B CZ  1 
ATOM   6987  N NH1 . ARG B 1 440 ? 192.407 18.011  304.383 1.00 50.72  1  434 ARG B NH1 1 
ATOM   6988  N NH2 . ARG B 1 440 ? 192.644 16.856  306.352 1.00 61.34  ?  434 ARG B NH2 1 
ATOM   6989  N N   . HIS B 1 441 ? 189.956 15.228  300.513 1.00 50.30  ?  435 HIS B N   1 
ATOM   6990  C CA  . HIS B 1 441 ? 191.215 14.792  299.924 1.00 40.97  ?  435 HIS B CA  1 
ATOM   6991  C C   . HIS B 1 441 ? 191.041 14.562  298.429 1.00 40.84  ?  435 HIS B C   1 
ATOM   6992  O O   . HIS B 1 441 ? 190.160 13.804  298.010 1.00 45.43  ?  435 HIS B O   1 
ATOM   6993  C CB  . HIS B 1 441 ? 191.712 13.508  300.592 1.00 43.39  ?  435 HIS B CB  1 
ATOM   6994  C CG  . HIS B 1 441 ? 192.667 13.739  301.721 1.00 38.63  ?  435 HIS B CG  1 
ATOM   6995  N ND1 . HIS B 1 441 ? 192.270 14.234  302.944 1.00 44.61  ?  435 HIS B ND1 1 
ATOM   6996  C CD2 . HIS B 1 441 ? 194.003 13.537  301.813 1.00 38.56  ?  435 HIS B CD2 1 
ATOM   6997  C CE1 . HIS B 1 441 ? 193.320 14.328  303.741 1.00 47.40  ?  435 HIS B CE1 1 
ATOM   6998  N NE2 . HIS B 1 441 ? 194.384 13.912  303.078 1.00 49.72  ?  435 HIS B NE2 1 
ATOM   6999  N N   . GLU B 1 442 ? 191.882 15.219  297.627 1.00 41.06  ?  436 GLU B N   1 
ATOM   7000  C CA  . GLU B 1 442 ? 191.890 14.936  296.197 1.00 44.53  ?  436 GLU B CA  1 
ATOM   7001  C C   . GLU B 1 442 ? 192.430 13.541  295.913 1.00 44.50  ?  436 GLU B C   1 
ATOM   7002  O O   . GLU B 1 442 ? 191.969 12.876  294.979 1.00 44.78  ?  436 GLU B O   1 
ATOM   7003  C CB  . GLU B 1 442 ? 192.713 15.985  295.450 1.00 49.92  ?  436 GLU B CB  1 
ATOM   7004  C CG  . GLU B 1 442 ? 192.719 15.800  293.939 1.00 53.95  ?  436 GLU B CG  1 
ATOM   7005  C CD  . GLU B 1 442 ? 193.664 16.752  293.232 1.00 65.72  ?  436 GLU B CD  1 
ATOM   7006  O OE1 . GLU B 1 442 ? 194.384 17.502  293.925 1.00 70.30  ?  436 GLU B OE1 1 
ATOM   7007  O OE2 . GLU B 1 442 ? 193.686 16.750  291.983 1.00 65.73  -1 436 GLU B OE2 1 
ATOM   7008  N N   . MET B 1 443 ? 193.394 13.080  296.706 1.00 45.57  ?  437 MET B N   1 
ATOM   7009  C CA  . MET B 1 443 ? 193.975 11.754  296.557 1.00 48.06  ?  437 MET B CA  1 
ATOM   7010  C C   . MET B 1 443 ? 193.666 10.930  297.799 1.00 43.29  ?  437 MET B C   1 
ATOM   7011  O O   . MET B 1 443 ? 193.906 11.381  298.924 1.00 40.37  ?  437 MET B O   1 
ATOM   7012  C CB  . MET B 1 443 ? 195.487 11.836  296.331 1.00 45.65  ?  437 MET B CB  1 
ATOM   7013  C CG  . MET B 1 443 ? 195.885 12.624  295.093 1.00 48.31  ?  437 MET B CG  1 
ATOM   7014  S SD  . MET B 1 443 ? 195.115 11.996  293.588 1.00 58.75  ?  437 MET B SD  1 
ATOM   7015  C CE  . MET B 1 443 ? 195.697 10.301  293.588 1.00 41.99  ?  437 MET B CE  1 
ATOM   7016  N N   . LEU B 1 444 ? 193.133 9.734   297.590 1.00 41.03  ?  438 LEU B N   1 
ATOM   7017  C CA  . LEU B 1 444 ? 192.782 8.805   298.650 1.00 37.81  ?  438 LEU B CA  1 
ATOM   7018  C C   . LEU B 1 444 ? 193.519 7.486   298.454 1.00 39.42  ?  438 LEU B C   1 
ATOM   7019  O O   . LEU B 1 444 ? 193.954 7.167   297.341 1.00 40.04  ?  438 LEU B O   1 
ATOM   7020  C CB  . LEU B 1 444 ? 191.265 8.563   298.681 1.00 41.00  ?  438 LEU B CB  1 
ATOM   7021  C CG  . LEU B 1 444 ? 190.431 9.679   299.313 1.00 40.59  ?  438 LEU B CG  1 
ATOM   7022  C CD1 . LEU B 1 444 ? 188.953 9.326   299.290 1.00 36.95  ?  438 LEU B CD1 1 
ATOM   7023  C CD2 . LEU B 1 444 ? 190.897 9.949   300.736 1.00 36.56  ?  438 LEU B CD2 1 
ATOM   7024  N N   . PRO B 1 445 ? 193.685 6.691   299.520 1.00 37.79  ?  439 PRO B N   1 
ATOM   7025  C CA  . PRO B 1 445 ? 194.441 5.436   299.392 1.00 35.17  ?  439 PRO B CA  1 
ATOM   7026  C C   . PRO B 1 445 ? 193.703 4.349   298.625 1.00 38.31  ?  439 PRO B C   1 
ATOM   7027  O O   . PRO B 1 445 ? 194.186 3.215   298.542 1.00 36.93  ?  439 PRO B O   1 
ATOM   7028  C CB  . PRO B 1 445 ? 194.672 5.012   300.850 1.00 37.86  ?  439 PRO B CB  1 
ATOM   7029  C CG  . PRO B 1 445 ? 194.380 6.220   301.669 1.00 39.30  ?  439 PRO B CG  1 
ATOM   7030  C CD  . PRO B 1 445 ? 193.348 6.985   300.922 1.00 38.38  ?  439 PRO B CD  1 
ATOM   7031  N N   . ALA B 1 446 ? 192.536 4.674   298.063 1.00 35.39  ?  440 ALA B N   1 
ATOM   7032  C CA  . ALA B 1 446 ? 191.750 3.676   297.348 1.00 35.69  ?  440 ALA B CA  1 
ATOM   7033  C C   . ALA B 1 446 ? 192.449 3.161   296.098 1.00 40.26  ?  440 ALA B C   1 
ATOM   7034  O O   . ALA B 1 446 ? 192.066 2.105   295.583 1.00 38.40  ?  440 ALA B O   1 
ATOM   7035  C CB  . ALA B 1 446 ? 190.388 4.248   296.970 1.00 41.91  ?  440 ALA B CB  1 
ATOM   7036  N N   . SER B 1 447 ? 193.449 3.886   295.590 1.00 41.15  ?  441 SER B N   1 
ATOM   7037  C CA  . SER B 1 447 ? 194.246 3.361   294.488 1.00 37.38  ?  441 SER B CA  1 
ATOM   7038  C C   . SER B 1 447 ? 194.947 2.069   294.883 1.00 40.28  ?  441 SER B C   1 
ATOM   7039  O O   . SER B 1 447 ? 195.125 1.176   294.046 1.00 45.51  ?  441 SER B O   1 
ATOM   7040  C CB  . SER B 1 447 ? 195.264 4.405   294.033 1.00 38.80  ?  441 SER B CB  1 
ATOM   7041  O OG  . SER B 1 447 ? 196.120 4.777   295.100 1.00 42.43  ?  441 SER B OG  1 
ATOM   7042  N N   . LEU B 1 448 ? 195.345 1.950   296.152 1.00 39.84  ?  442 LEU B N   1 
ATOM   7043  C CA  . LEU B 1 448 ? 195.933 0.707   296.636 1.00 39.75  ?  442 LEU B CA  1 
ATOM   7044  C C   . LEU B 1 448 ? 194.915 -0.426  296.647 1.00 37.74  ?  442 LEU B C   1 
ATOM   7045  O O   . LEU B 1 448 ? 195.275 -1.581  296.397 1.00 39.08  ?  442 LEU B O   1 
ATOM   7046  C CB  . LEU B 1 448 ? 196.522 0.918   298.031 1.00 44.15  ?  442 LEU B CB  1 
ATOM   7047  C CG  . LEU B 1 448 ? 197.105 -0.292  298.765 1.00 43.29  ?  442 LEU B CG  1 
ATOM   7048  C CD1 . LEU B 1 448 ? 198.151 -0.997  297.916 1.00 36.80  ?  442 LEU B CD1 1 
ATOM   7049  C CD2 . LEU B 1 448 ? 197.696 0.138   300.099 1.00 36.23  ?  442 LEU B CD2 1 
ATOM   7050  N N   . ILE B 1 449 ? 193.646 -0.118  296.932 1.00 42.90  ?  443 ILE B N   1 
ATOM   7051  C CA  . ILE B 1 449 ? 192.598 -1.133  296.861 1.00 39.06  ?  443 ILE B CA  1 
ATOM   7052  C C   . ILE B 1 449 ? 192.475 -1.672  295.442 1.00 34.09  ?  443 ILE B C   1 
ATOM   7053  O O   . ILE B 1 449 ? 192.367 -2.886  295.229 1.00 32.66  ?  443 ILE B O   1 
ATOM   7054  C CB  . ILE B 1 449 ? 191.261 -0.560  297.370 1.00 31.24  ?  443 ILE B CB  1 
ATOM   7055  C CG1 . ILE B 1 449 ? 191.226 -0.554  298.898 1.00 31.79  ?  443 ILE B CG1 1 
ATOM   7056  C CG2 . ILE B 1 449 ? 190.085 -1.350  296.814 1.00 35.51  ?  443 ILE B CG2 1 
ATOM   7057  C CD1 . ILE B 1 449 ? 189.962 0.040   299.478 1.00 44.27  ?  443 ILE B CD1 1 
ATOM   7058  N N   . GLN B 1 450 ? 192.500 -0.779  294.449 1.00 37.42  ?  444 GLN B N   1 
ATOM   7059  C CA  . GLN B 1 450 ? 192.419 -1.217  293.059 1.00 36.63  ?  444 GLN B CA  1 
ATOM   7060  C C   . GLN B 1 450 ? 193.624 -2.065  292.676 1.00 41.22  ?  444 GLN B C   1 
ATOM   7061  O O   . GLN B 1 450 ? 193.491 -3.051  291.942 1.00 41.82  ?  444 GLN B O   1 
ATOM   7062  C CB  . GLN B 1 450 ? 192.298 -0.006  292.135 1.00 39.34  ?  444 GLN B CB  1 
ATOM   7063  C CG  . GLN B 1 450 ? 190.959 0.697   292.224 1.00 38.73  ?  444 GLN B CG  1 
ATOM   7064  C CD  . GLN B 1 450 ? 189.804 -0.220  291.873 1.00 45.81  ?  444 GLN B CD  1 
ATOM   7065  O OE1 . GLN B 1 450 ? 189.138 -0.764  292.754 1.00 43.52  ?  444 GLN B OE1 1 
ATOM   7066  N NE2 . GLN B 1 450 ? 189.564 -0.401  290.579 1.00 47.63  ?  444 GLN B NE2 1 
ATOM   7067  N N   . ALA B 1 451 ? 194.812 -1.695  293.162 1.00 38.26  ?  445 ALA B N   1 
ATOM   7068  C CA  . ALA B 1 451 ? 196.002 -2.489  292.878 1.00 35.99  ?  445 ALA B CA  1 
ATOM   7069  C C   . ALA B 1 451 ? 195.895 -3.879  293.493 1.00 40.00  ?  445 ALA B C   1 
ATOM   7070  O O   . ALA B 1 451 ? 196.355 -4.864  292.903 1.00 42.74  ?  445 ALA B O   1 
ATOM   7071  C CB  . ALA B 1 451 ? 197.247 -1.766  293.390 1.00 33.60  ?  445 ALA B CB  1 
ATOM   7072  N N   . GLN B 1 452 ? 195.287 -3.978  294.677 1.00 40.26  ?  446 GLN B N   1 
ATOM   7073  C CA  . GLN B 1 452 ? 195.100 -5.280  295.308 1.00 35.74  ?  446 GLN B CA  1 
ATOM   7074  C C   . GLN B 1 452 ? 194.115 -6.135  294.520 1.00 42.84  ?  446 GLN B C   1 
ATOM   7075  O O   . GLN B 1 452 ? 194.411 -7.286  294.182 1.00 43.23  ?  446 GLN B O   1 
ATOM   7076  C CB  . GLN B 1 452 ? 194.626 -5.101  296.750 1.00 31.35  ?  446 GLN B CB  1 
ATOM   7077  C CG  . GLN B 1 452 ? 195.663 -4.484  297.671 1.00 36.54  ?  446 GLN B CG  1 
ATOM   7078  C CD  . GLN B 1 452 ? 195.101 -4.152  299.038 1.00 40.07  ?  446 GLN B CD  1 
ATOM   7079  O OE1 . GLN B 1 452 ? 193.896 -4.239  299.262 1.00 34.67  ?  446 GLN B OE1 1 
ATOM   7080  N NE2 . GLN B 1 452 ? 195.975 -3.767  299.961 1.00 43.81  ?  446 GLN B NE2 1 
ATOM   7081  N N   . ARG B 1 453 ? 192.937 -5.581  294.210 1.00 47.75  ?  447 ARG B N   1 
ATOM   7082  C CA  . ARG B 1 453 ? 191.926 -6.340  293.479 1.00 45.86  ?  447 ARG B CA  1 
ATOM   7083  C C   . ARG B 1 453 ? 192.458 -6.822  292.135 1.00 45.90  ?  447 ARG B C   1 
ATOM   7084  O O   . ARG B 1 453 ? 192.106 -7.915  291.675 1.00 45.79  ?  447 ARG B O   1 
ATOM   7085  C CB  . ARG B 1 453 ? 190.668 -5.491  293.289 1.00 38.85  ?  447 ARG B CB  1 
ATOM   7086  C CG  . ARG B 1 453 ? 190.049 -5.016  294.595 1.00 36.95  ?  447 ARG B CG  1 
ATOM   7087  C CD  . ARG B 1 453 ? 188.816 -4.148  294.378 1.00 37.88  ?  447 ARG B CD  1 
ATOM   7088  N NE  . ARG B 1 453 ? 187.678 -4.915  293.880 1.00 42.39  ?  447 ARG B NE  1 
ATOM   7089  C CZ  . ARG B 1 453 ? 187.238 -4.873  292.627 1.00 44.83  ?  447 ARG B CZ  1 
ATOM   7090  N NH1 . ARG B 1 453 ? 187.837 -4.094  291.737 1.00 44.38  1  447 ARG B NH1 1 
ATOM   7091  N NH2 . ARG B 1 453 ? 186.195 -5.608  292.265 1.00 47.28  ?  447 ARG B NH2 1 
ATOM   7092  N N   . ASP B 1 454 ? 193.312 -6.024  291.492 1.00 40.45  ?  448 ASP B N   1 
ATOM   7093  C CA  . ASP B 1 454 ? 193.932 -6.470  290.250 1.00 42.32  ?  448 ASP B CA  1 
ATOM   7094  C C   . ASP B 1 454 ? 195.038 -7.484  290.515 1.00 46.70  ?  448 ASP B C   1 
ATOM   7095  O O   . ASP B 1 454 ? 195.320 -8.331  289.659 1.00 49.89  ?  448 ASP B O   1 
ATOM   7096  C CB  . ASP B 1 454 ? 194.480 -5.270  289.476 1.00 47.94  ?  448 ASP B CB  1 
ATOM   7097  C CG  . ASP B 1 454 ? 194.933 -5.634  288.074 1.00 51.86  ?  448 ASP B CG  1 
ATOM   7098  O OD1 . ASP B 1 454 ? 194.489 -6.677  287.549 1.00 51.34  ?  448 ASP B OD1 1 
ATOM   7099  O OD2 . ASP B 1 454 ? 195.740 -4.876  287.498 1.00 53.25  -1 448 ASP B OD2 1 
ATOM   7100  N N   . TYR B 1 455 ? 195.665 -7.421  291.691 1.00 53.09  ?  449 TYR B N   1 
ATOM   7101  C CA  . TYR B 1 455 ? 196.753 -8.341  292.008 1.00 48.25  ?  449 TYR B CA  1 
ATOM   7102  C C   . TYR B 1 455 ? 196.239 -9.771  292.142 1.00 50.03  ?  449 TYR B C   1 
ATOM   7103  O O   . TYR B 1 455 ? 196.675 -10.671 291.415 1.00 48.70  ?  449 TYR B O   1 
ATOM   7104  C CB  . TYR B 1 455 ? 197.459 -7.892  293.291 1.00 44.73  ?  449 TYR B CB  1 
ATOM   7105  C CG  . TYR B 1 455 ? 198.770 -8.600  293.571 1.00 42.09  ?  449 TYR B CG  1 
ATOM   7106  C CD1 . TYR B 1 455 ? 199.985 -7.985  293.302 1.00 43.59  ?  449 TYR B CD1 1 
ATOM   7107  C CD2 . TYR B 1 455 ? 198.791 -9.879  294.112 1.00 43.05  ?  449 TYR B CD2 1 
ATOM   7108  C CE1 . TYR B 1 455 ? 201.184 -8.625  293.559 1.00 39.71  ?  449 TYR B CE1 1 
ATOM   7109  C CE2 . TYR B 1 455 ? 199.983 -10.528 294.367 1.00 38.38  ?  449 TYR B CE2 1 
ATOM   7110  C CZ  . TYR B 1 455 ? 201.176 -9.897  294.092 1.00 38.56  ?  449 TYR B CZ  1 
ATOM   7111  O OH  . TYR B 1 455 ? 202.364 -10.542 294.350 1.00 47.40  ?  449 TYR B OH  1 
ATOM   7112  N N   . PHE B 1 456 ? 195.305 -10.000 293.068 1.00 46.57  ?  450 PHE B N   1 
ATOM   7113  C CA  . PHE B 1 456 ? 194.840 -11.353 293.342 1.00 52.02  ?  450 PHE B CA  1 
ATOM   7114  C C   . PHE B 1 456 ? 193.624 -11.759 292.520 1.00 51.21  ?  450 PHE B C   1 
ATOM   7115  O O   . PHE B 1 456 ? 193.350 -12.959 292.403 1.00 54.76  ?  450 PHE B O   1 
ATOM   7116  C CB  . PHE B 1 456 ? 194.522 -11.521 294.837 1.00 46.66  ?  450 PHE B CB  1 
ATOM   7117  C CG  . PHE B 1 456 ? 193.427 -10.615 295.347 1.00 50.38  ?  450 PHE B CG  1 
ATOM   7118  C CD1 . PHE B 1 456 ? 192.090 -10.923 295.138 1.00 46.99  ?  450 PHE B CD1 1 
ATOM   7119  C CD2 . PHE B 1 456 ? 193.736 -9.474  296.069 1.00 44.70  ?  450 PHE B CD2 1 
ATOM   7120  C CE1 . PHE B 1 456 ? 191.089 -10.098 295.612 1.00 39.56  ?  450 PHE B CE1 1 
ATOM   7121  C CE2 . PHE B 1 456 ? 192.737 -8.644  296.547 1.00 38.83  ?  450 PHE B CE2 1 
ATOM   7122  C CZ  . PHE B 1 456 ? 191.412 -8.959  296.319 1.00 39.50  ?  450 PHE B CZ  1 
ATOM   7123  N N   . GLY B 1 457 ? 192.891 -10.804 291.953 1.00 49.68  ?  451 GLY B N   1 
ATOM   7124  C CA  . GLY B 1 457 ? 191.664 -11.135 291.254 1.00 56.89  ?  451 GLY B CA  1 
ATOM   7125  C C   . GLY B 1 457 ? 191.623 -10.703 289.802 1.00 53.91  ?  451 GLY B C   1 
ATOM   7126  O O   . GLY B 1 457 ? 190.669 -11.024 289.086 1.00 46.95  ?  451 GLY B O   1 
ATOM   7127  N N   . ALA B 1 458 ? 192.651 -9.975  289.360 1.00 56.54  ?  452 ALA B N   1 
ATOM   7128  C CA  . ALA B 1 458 ? 192.734 -9.459  287.992 1.00 47.54  ?  452 ALA B CA  1 
ATOM   7129  C C   . ALA B 1 458 ? 191.516 -8.616  287.628 1.00 52.16  ?  452 ALA B C   1 
ATOM   7130  O O   . ALA B 1 458 ? 191.069 -8.612  286.478 1.00 54.26  ?  452 ALA B O   1 
ATOM   7131  C CB  . ALA B 1 458 ? 192.925 -10.591 286.978 1.00 51.78  ?  452 ALA B CB  1 
ATOM   7132  N N   . HIS B 1 459 ? 190.971 -7.888  288.605 1.00 52.94  ?  453 HIS B N   1 
ATOM   7133  C CA  . HIS B 1 459 ? 189.803 -7.031  288.407 1.00 49.22  ?  453 HIS B CA  1 
ATOM   7134  C C   . HIS B 1 459 ? 190.122 -5.750  287.649 1.00 45.97  ?  453 HIS B C   1 
ATOM   7135  O O   . HIS B 1 459 ? 189.264 -4.855  287.628 1.00 52.79  ?  453 HIS B O   1 
ATOM   7136  C CB  . HIS B 1 459 ? 189.173 -6.694  289.760 1.00 42.99  ?  453 HIS B CB  1 
ATOM   7137  C CG  . HIS B 1 459 ? 188.657 -7.889  290.500 1.00 47.42  ?  453 HIS B CG  1 
ATOM   7138  N ND1 . HIS B 1 459 ? 188.328 -7.851  291.837 1.00 48.29  ?  453 HIS B ND1 1 
ATOM   7139  C CD2 . HIS B 1 459 ? 188.411 -9.155  290.088 1.00 46.20  ?  453 HIS B CD2 1 
ATOM   7140  C CE1 . HIS B 1 459 ? 187.903 -9.043  292.218 1.00 45.09  ?  453 HIS B CE1 1 
ATOM   7141  N NE2 . HIS B 1 459 ? 187.944 -9.852  291.175 1.00 45.84  ?  453 HIS B NE2 1 
ATOM   7142  N N   . THR B 1 460 ? 191.316 -5.666  287.055 1.00 42.47  ?  454 THR B N   1 
ATOM   7143  C CA  . THR B 1 460 ? 191.763 -4.531  286.251 1.00 48.90  ?  454 THR B CA  1 
ATOM   7144  C C   . THR B 1 460 ? 191.812 -3.234  287.050 1.00 48.53  ?  454 THR B C   1 
ATOM   7145  O O   . THR B 1 460 ? 191.384 -3.182  288.208 1.00 49.39  ?  454 THR B O   1 
ATOM   7146  C CB  . THR B 1 460 ? 190.873 -4.347  285.016 1.00 43.16  ?  454 THR B CB  1 
ATOM   7147  O OG1 . THR B 1 460 ? 189.572 -3.897  285.416 1.00 42.20  ?  454 THR B OG1 1 
ATOM   7148  C CG2 . THR B 1 460 ? 190.743 -5.657  284.249 1.00 41.10  ?  454 THR B CG2 1 
ATOM   7149  N N   . TYR B 1 461 ? 192.350 -2.183  286.438 1.00 40.59  ?  455 TYR B N   1 
ATOM   7150  C CA  . TYR B 1 461 ? 192.442 -0.877  287.075 1.00 42.80  ?  455 TYR B CA  1 
ATOM   7151  C C   . TYR B 1 461 ? 192.636 0.169   285.989 1.00 43.81  ?  455 TYR B C   1 
ATOM   7152  O O   . TYR B 1 461 ? 192.921 -0.151  284.833 1.00 52.03  ?  455 TYR B O   1 
ATOM   7153  C CB  . TYR B 1 461 ? 193.583 -0.826  288.097 1.00 49.37  ?  455 TYR B CB  1 
ATOM   7154  C CG  . TYR B 1 461 ? 194.965 -0.861  287.483 1.00 48.83  ?  455 TYR B CG  1 
ATOM   7155  C CD1 . TYR B 1 461 ? 195.534 -2.060  287.074 1.00 53.10  ?  455 TYR B CD1 1 
ATOM   7156  C CD2 . TYR B 1 461 ? 195.704 0.303   287.318 1.00 43.94  ?  455 TYR B CD2 1 
ATOM   7157  C CE1 . TYR B 1 461 ? 196.796 -2.098  286.514 1.00 46.15  ?  455 TYR B CE1 1 
ATOM   7158  C CE2 . TYR B 1 461 ? 196.968 0.275   286.758 1.00 48.98  ?  455 TYR B CE2 1 
ATOM   7159  C CZ  . TYR B 1 461 ? 197.509 -0.928  286.359 1.00 48.53  ?  455 TYR B CZ  1 
ATOM   7160  O OH  . TYR B 1 461 ? 198.768 -0.959  285.802 1.00 51.54  ?  455 TYR B OH  1 
ATOM   7161  N N   . GLU B 1 462 ? 192.479 1.428   286.378 1.00 41.29  ?  456 GLU B N   1 
ATOM   7162  C CA  . GLU B 1 462 ? 192.643 2.558   285.478 1.00 44.84  ?  456 GLU B CA  1 
ATOM   7163  C C   . GLU B 1 462 ? 193.892 3.348   285.848 1.00 48.63  ?  456 GLU B C   1 
ATOM   7164  O O   . GLU B 1 462 ? 194.472 3.183   286.924 1.00 45.33  ?  456 GLU B O   1 
ATOM   7165  C CB  . GLU B 1 462 ? 191.417 3.474   285.522 1.00 41.60  ?  456 GLU B CB  1 
ATOM   7166  C CG  . GLU B 1 462 ? 190.117 2.838   285.077 1.00 48.92  ?  456 GLU B CG  1 
ATOM   7167  C CD  . GLU B 1 462 ? 188.922 3.734   285.345 1.00 50.64  ?  456 GLU B CD  1 
ATOM   7168  O OE1 . GLU B 1 462 ? 188.510 3.843   286.520 1.00 42.66  ?  456 GLU B OE1 1 
ATOM   7169  O OE2 . GLU B 1 462 ? 188.405 4.342   284.385 1.00 53.66  -1 456 GLU B OE2 1 
ATOM   7170  N N   . LEU B 1 463 ? 194.296 4.222   284.933 1.00 50.13  ?  457 LEU B N   1 
ATOM   7171  C CA  . LEU B 1 463 ? 195.370 5.170   285.179 1.00 47.20  ?  457 LEU B CA  1 
ATOM   7172  C C   . LEU B 1 463 ? 194.778 6.528   285.528 1.00 41.47  ?  457 LEU B C   1 
ATOM   7173  O O   . LEU B 1 463 ? 193.724 6.916   285.016 1.00 46.07  ?  457 LEU B O   1 
ATOM   7174  C CB  . LEU B 1 463 ? 196.294 5.298   283.964 1.00 49.51  ?  457 LEU B CB  1 
ATOM   7175  C CG  . LEU B 1 463 ? 197.253 4.140   283.669 1.00 41.19  ?  457 LEU B CG  1 
ATOM   7176  C CD1 . LEU B 1 463 ? 197.944 3.680   284.946 1.00 38.60  ?  457 LEU B CD1 1 
ATOM   7177  C CD2 . LEU B 1 463 ? 196.535 2.977   283.000 1.00 58.32  ?  457 LEU B CD2 1 
ATOM   7178  N N   . LEU B 1 464 ? 195.470 7.249   286.414 1.00 39.74  ?  458 LEU B N   1 
ATOM   7179  C CA  . LEU B 1 464 ? 194.950 8.524   286.897 1.00 40.24  ?  458 LEU B CA  1 
ATOM   7180  C C   . LEU B 1 464 ? 194.798 9.539   285.771 1.00 48.74  ?  458 LEU B C   1 
ATOM   7181  O O   . LEU B 1 464 ? 193.927 10.415  285.838 1.00 54.14  ?  458 LEU B O   1 
ATOM   7182  C CB  . LEU B 1 464 ? 195.859 9.073   287.997 1.00 36.98  ?  458 LEU B CB  1 
ATOM   7183  C CG  . LEU B 1 464 ? 195.396 10.350  288.698 1.00 44.98  ?  458 LEU B CG  1 
ATOM   7184  C CD1 . LEU B 1 464 ? 193.986 10.174  289.228 1.00 43.23  ?  458 LEU B CD1 1 
ATOM   7185  C CD2 . LEU B 1 464 ? 196.351 10.723  289.820 1.00 56.95  ?  458 LEU B CD2 1 
ATOM   7186  N N   . ALA B 1 465 ? 195.618 9.433   284.726 1.00 50.78  ?  459 ALA B N   1 
ATOM   7187  C CA  . ALA B 1 465 ? 195.557 10.353  283.599 1.00 55.81  ?  459 ALA B CA  1 
ATOM   7188  C C   . ALA B 1 465 ? 194.772 9.807   282.414 1.00 54.33  ?  459 ALA B C   1 
ATOM   7189  O O   . ALA B 1 465 ? 194.496 10.562  281.475 1.00 52.41  ?  459 ALA B O   1 
ATOM   7190  C CB  . ALA B 1 465 ? 196.974 10.724  283.141 1.00 60.00  ?  459 ALA B CB  1 
ATOM   7191  N N   . LYS B 1 466 ? 194.408 8.524   282.428 1.00 50.86  ?  460 LYS B N   1 
ATOM   7192  C CA  . LYS B 1 466 ? 193.676 7.886   281.333 1.00 48.63  ?  460 LYS B CA  1 
ATOM   7193  C C   . LYS B 1 466 ? 192.478 7.142   281.909 1.00 53.74  ?  460 LYS B C   1 
ATOM   7194  O O   . LYS B 1 466 ? 192.508 5.912   282.052 1.00 53.42  ?  460 LYS B O   1 
ATOM   7195  C CB  . LYS B 1 466 ? 194.576 6.932   280.544 1.00 45.69  ?  460 LYS B CB  1 
ATOM   7196  C CG  . LYS B 1 466 ? 196.064 7.239   280.635 1.00 52.08  ?  460 LYS B CG  1 
ATOM   7197  C CD  . LYS B 1 466 ? 196.473 8.362   279.698 1.00 51.44  ?  460 LYS B CD  1 
ATOM   7198  C CE  . LYS B 1 466 ? 196.457 7.904   278.249 1.00 48.63  ?  460 LYS B CE  1 
ATOM   7199  N NZ  . LYS B 1 466 ? 197.046 8.927   277.340 1.00 57.19  1  460 LYS B NZ  1 
ATOM   7200  N N   . PRO B 1 467 ? 191.405 7.853   282.249 1.00 53.35  ?  461 PRO B N   1 
ATOM   7201  C CA  . PRO B 1 467 ? 190.220 7.184   282.797 1.00 44.58  ?  461 PRO B CA  1 
ATOM   7202  C C   . PRO B 1 467 ? 189.459 6.434   281.713 1.00 44.41  ?  461 PRO B C   1 
ATOM   7203  O O   . PRO B 1 467 ? 189.692 6.594   280.514 1.00 53.12  ?  461 PRO B O   1 
ATOM   7204  C CB  . PRO B 1 467 ? 189.394 8.339   283.366 1.00 39.48  ?  461 PRO B CB  1 
ATOM   7205  C CG  . PRO B 1 467 ? 189.772 9.506   282.520 1.00 40.13  ?  461 PRO B CG  1 
ATOM   7206  C CD  . PRO B 1 467 ? 191.228 9.314   282.170 1.00 51.22  ?  461 PRO B CD  1 
ATOM   7207  N N   . GLY B 1 468 ? 188.530 5.590   282.163 1.00 37.19  ?  462 GLY B N   1 
ATOM   7208  C CA  . GLY B 1 468 ? 187.712 4.796   281.269 1.00 41.54  ?  462 GLY B CA  1 
ATOM   7209  C C   . GLY B 1 468 ? 188.417 3.645   280.587 1.00 54.06  ?  462 GLY B C   1 
ATOM   7210  O O   . GLY B 1 468 ? 187.745 2.828   279.944 1.00 45.71  ?  462 GLY B O   1 
ATOM   7211  N N   . GLN B 1 469 ? 189.739 3.546   280.701 1.00 55.57  ?  463 GLN B N   1 
ATOM   7212  C CA  . GLN B 1 469 ? 190.521 2.485   280.075 1.00 51.32  ?  463 GLN B CA  1 
ATOM   7213  C C   . GLN B 1 469 ? 191.077 1.591   281.176 1.00 44.20  ?  463 GLN B C   1 
ATOM   7214  O O   . GLN B 1 469 ? 191.914 2.026   281.974 1.00 43.11  ?  463 GLN B O   1 
ATOM   7215  C CB  . GLN B 1 469 ? 191.639 3.071   279.216 1.00 43.42  ?  463 GLN B CB  1 
ATOM   7216  C CG  . GLN B 1 469 ? 191.145 3.956   278.083 1.00 38.94  ?  463 GLN B CG  1 
ATOM   7217  C CD  . GLN B 1 469 ? 191.892 5.272   278.000 1.00 50.51  ?  463 GLN B CD  1 
ATOM   7218  O OE1 . GLN B 1 469 ? 192.966 5.354   277.404 1.00 56.34  ?  463 GLN B OE1 1 
ATOM   7219  N NE2 . GLN B 1 469 ? 191.325 6.313   278.601 1.00 46.91  ?  463 GLN B NE2 1 
ATOM   7220  N N   . PHE B 1 470 ? 190.610 0.347   281.218 1.00 47.48  ?  464 PHE B N   1 
ATOM   7221  C CA  . PHE B 1 470 ? 191.008 -0.611  282.241 1.00 50.02  ?  464 PHE B CA  1 
ATOM   7222  C C   . PHE B 1 470 ? 192.103 -1.519  281.696 1.00 53.33  ?  464 PHE B C   1 
ATOM   7223  O O   . PHE B 1 470 ? 191.934 -2.137  280.639 1.00 60.60  ?  464 PHE B O   1 
ATOM   7224  C CB  . PHE B 1 470 ? 189.810 -1.444  282.702 1.00 49.25  ?  464 PHE B CB  1 
ATOM   7225  C CG  . PHE B 1 470 ? 188.713 -0.635  283.338 1.00 51.65  ?  464 PHE B CG  1 
ATOM   7226  C CD1 . PHE B 1 470 ? 188.659 -0.477  284.713 1.00 50.56  ?  464 PHE B CD1 1 
ATOM   7227  C CD2 . PHE B 1 470 ? 187.734 -0.037  282.560 1.00 54.50  ?  464 PHE B CD2 1 
ATOM   7228  C CE1 . PHE B 1 470 ? 187.650 0.265   285.301 1.00 49.67  ?  464 PHE B CE1 1 
ATOM   7229  C CE2 . PHE B 1 470 ? 186.723 0.707   283.143 1.00 51.85  ?  464 PHE B CE2 1 
ATOM   7230  C CZ  . PHE B 1 470 ? 186.682 0.858   284.515 1.00 49.61  ?  464 PHE B CZ  1 
ATOM   7231  N N   . ILE B 1 471 ? 193.220 -1.598  282.417 1.00 43.40  ?  465 ILE B N   1 
ATOM   7232  C CA  . ILE B 1 471 ? 194.344 -2.437  282.030 1.00 54.60  ?  465 ILE B CA  1 
ATOM   7233  C C   . ILE B 1 471 ? 194.628 -3.431  283.152 1.00 51.62  ?  465 ILE B C   1 
ATOM   7234  O O   . ILE B 1 471 ? 194.119 -3.310  284.267 1.00 48.85  ?  465 ILE B O   1 
ATOM   7235  C CB  . ILE B 1 471 ? 195.606 -1.617  281.699 1.00 55.89  ?  465 ILE B CB  1 
ATOM   7236  C CG1 . ILE B 1 471 ? 196.198 -1.009  282.971 1.00 48.73  ?  465 ILE B CG1 1 
ATOM   7237  C CG2 . ILE B 1 471 ? 195.286 -0.530  280.683 1.00 55.32  ?  465 ILE B CG2 1 
ATOM   7238  C CD1 . ILE B 1 471 ? 197.600 -0.473  282.788 1.00 48.92  ?  465 ILE B CD1 1 
ATOM   7239  N N   . HIS B 1 472 ? 195.461 -4.422  282.838 1.00 46.15  ?  466 HIS B N   1 
ATOM   7240  C CA  . HIS B 1 472 ? 195.837 -5.468  283.779 1.00 51.72  ?  466 HIS B CA  1 
ATOM   7241  C C   . HIS B 1 472 ? 197.354 -5.570  283.836 1.00 56.13  ?  466 HIS B C   1 
ATOM   7242  O O   . HIS B 1 472 ? 198.016 -5.613  282.794 1.00 65.71  ?  466 HIS B O   1 
ATOM   7243  C CB  . HIS B 1 472 ? 195.226 -6.815  283.379 1.00 48.11  ?  466 HIS B CB  1 
ATOM   7244  C CG  . HIS B 1 472 ? 195.639 -7.953  284.260 1.00 52.79  ?  466 HIS B CG  1 
ATOM   7245  N ND1 . HIS B 1 472 ? 195.676 -7.856  285.634 1.00 53.49  ?  466 HIS B ND1 1 
ATOM   7246  C CD2 . HIS B 1 472 ? 196.031 -9.214  283.962 1.00 57.89  ?  466 HIS B CD2 1 
ATOM   7247  C CE1 . HIS B 1 472 ? 196.074 -9.008  286.145 1.00 54.86  ?  466 HIS B CE1 1 
ATOM   7248  N NE2 . HIS B 1 472 ? 196.296 -9.849  285.151 1.00 59.37  ?  466 HIS B NE2 1 
ATOM   7249  N N   . THR B 1 473 ? 197.897 -5.606  285.049 1.00 50.60  ?  467 THR B N   1 
ATOM   7250  C CA  . THR B 1 473 ? 199.331 -5.701  285.276 1.00 57.15  ?  467 THR B CA  1 
ATOM   7251  C C   . THR B 1 473 ? 199.698 -7.122  285.691 1.00 63.29  ?  467 THR B C   1 
ATOM   7252  O O   . THR B 1 473 ? 198.910 -7.825  286.329 1.00 60.66  ?  467 THR B O   1 
ATOM   7253  C CB  . THR B 1 473 ? 199.774 -4.691  286.344 1.00 48.19  ?  467 THR B CB  1 
ATOM   7254  O OG1 . THR B 1 473 ? 199.512 -3.362  285.878 1.00 52.20  ?  467 THR B OG1 1 
ATOM   7255  C CG2 . THR B 1 473 ? 201.259 -4.812  286.652 1.00 38.46  ?  467 THR B CG2 1 
ATOM   7256  N N   . ASN B 1 474 ? 200.901 -7.549  285.298 1.00 66.15  ?  468 ASN B N   1 
ATOM   7257  C CA  . ASN B 1 474 ? 201.351 -8.904  285.603 1.00 69.80  ?  468 ASN B CA  1 
ATOM   7258  C C   . ASN B 1 474 ? 201.561 -9.094  287.102 1.00 66.77  ?  468 ASN B C   1 
ATOM   7259  O O   . ASN B 1 474 ? 201.152 -10.114 287.670 1.00 67.88  ?  468 ASN B O   1 
ATOM   7260  C CB  . ASN B 1 474 ? 202.637 -9.209  284.835 1.00 64.38  ?  468 ASN B CB  1 
ATOM   7261  C CG  . ASN B 1 474 ? 202.822 -10.689 284.570 1.00 67.03  ?  468 ASN B CG  1 
ATOM   7262  O OD1 . ASN B 1 474 ? 202.303 -11.534 285.298 1.00 67.55  ?  468 ASN B OD1 1 
ATOM   7263  N ND2 . ASN B 1 474 ? 203.566 -11.011 283.517 1.00 64.05  ?  468 ASN B ND2 1 
ATOM   7264  N N   . TRP B 1 475 ? 202.215 -8.127  287.753 1.00 58.84  ?  469 TRP B N   1 
ATOM   7265  C CA  . TRP B 1 475 ? 202.528 -8.157  289.182 1.00 56.52  ?  469 TRP B CA  1 
ATOM   7266  C C   . TRP B 1 475 ? 203.481 -9.293  289.546 1.00 61.32  ?  469 TRP B C   1 
ATOM   7267  O O   . TRP B 1 475 ? 204.446 -9.080  290.287 1.00 57.73  ?  469 TRP B O   1 
ATOM   7268  C CB  . TRP B 1 475 ? 201.253 -8.255  290.027 1.00 53.90  ?  469 TRP B CB  1 
ATOM   7269  C CG  . TRP B 1 475 ? 200.290 -7.120  289.833 1.00 52.37  ?  469 TRP B CG  1 
ATOM   7270  C CD1 . TRP B 1 475 ? 199.084 -7.172  289.198 1.00 52.84  ?  469 TRP B CD1 1 
ATOM   7271  C CD2 . TRP B 1 475 ? 200.448 -5.767  290.281 1.00 50.46  ?  469 TRP B CD2 1 
ATOM   7272  N NE1 . TRP B 1 475 ? 198.482 -5.938  289.219 1.00 52.85  ?  469 TRP B NE1 1 
ATOM   7273  C CE2 . TRP B 1 475 ? 199.298 -5.057  289.879 1.00 51.37  ?  469 TRP B CE2 1 
ATOM   7274  C CE3 . TRP B 1 475 ? 201.448 -5.087  290.983 1.00 47.80  ?  469 TRP B CE3 1 
ATOM   7275  C CZ2 . TRP B 1 475 ? 199.122 -3.702  290.154 1.00 41.62  ?  469 TRP B CZ2 1 
ATOM   7276  C CZ3 . TRP B 1 475 ? 201.271 -3.740  291.254 1.00 46.03  ?  469 TRP B CZ3 1 
ATOM   7277  C CH2 . TRP B 1 475 ? 200.117 -3.063  290.840 1.00 43.57  ?  469 TRP B CH2 1 
ATOM   7278  N N   . THR B 1 476 ? 203.220 -10.501 289.045 1.00 67.31  ?  470 THR B N   1 
ATOM   7279  C CA  . THR B 1 476 ? 204.064 -11.652 289.344 1.00 65.36  ?  470 THR B CA  1 
ATOM   7280  C C   . THR B 1 476 ? 205.296 -11.668 288.446 1.00 65.68  ?  470 THR B C   1 
ATOM   7281  O O   . THR B 1 476 ? 206.348 -11.138 288.818 1.00 61.93  ?  470 THR B O   1 
ATOM   7282  C CB  . THR B 1 476 ? 203.273 -12.954 289.186 1.00 70.60  ?  470 THR B CB  1 
ATOM   7283  O OG1 . THR B 1 476 ? 202.042 -12.857 289.913 1.00 75.03  ?  470 THR B OG1 1 
ATOM   7284  C CG2 . THR B 1 476 ? 204.074 -14.134 289.722 1.00 69.09  ?  470 THR B CG2 1 
ATOM   7285  N N   . GLY B 1 477 ? 205.177 -12.271 287.267 1.00 69.42  ?  471 GLY B N   1 
ATOM   7286  C CA  . GLY B 1 477 ? 206.292 -12.362 286.342 1.00 68.79  ?  471 GLY B CA  1 
ATOM   7287  C C   . GLY B 1 477 ? 205.892 -12.804 284.948 1.00 66.44  ?  471 GLY B C   1 
ATOM   7288  O O   . GLY B 1 477 ? 206.611 -12.561 283.979 1.00 65.06  ?  471 GLY B O   1 
ATOM   7289  N N   . ALA C 1 8   ? 153.367 -42.602 274.622 1.00 56.40  ?  2   ALA C N   1 
ATOM   7290  C CA  . ALA C 1 8   ? 153.114 -42.871 273.212 1.00 59.84  ?  2   ALA C CA  1 
ATOM   7291  C C   . ALA C 1 8   ? 151.617 -42.891 272.920 1.00 59.84  ?  2   ALA C C   1 
ATOM   7292  O O   . ALA C 1 8   ? 151.156 -43.619 272.041 1.00 65.66  ?  2   ALA C O   1 
ATOM   7293  C CB  . ALA C 1 8   ? 153.754 -44.188 272.799 1.00 56.68  ?  2   ALA C CB  1 
ATOM   7294  N N   . GLN C 1 9   ? 150.858 -42.087 273.667 1.00 55.76  ?  3   GLN C N   1 
ATOM   7295  C CA  . GLN C 1 9   ? 149.419 -41.989 273.482 1.00 59.06  ?  3   GLN C CA  1 
ATOM   7296  C C   . GLN C 1 9   ? 148.940 -40.603 273.079 1.00 60.38  ?  3   GLN C C   1 
ATOM   7297  O O   . GLN C 1 9   ? 147.802 -40.479 272.614 1.00 63.55  ?  3   GLN C O   1 
ATOM   7298  C CB  . GLN C 1 9   ? 148.680 -42.411 274.764 1.00 58.50  ?  3   GLN C CB  1 
ATOM   7299  C CG  . GLN C 1 9   ? 149.010 -43.819 275.233 1.00 63.81  ?  3   GLN C CG  1 
ATOM   7300  C CD  . GLN C 1 9   ? 148.221 -44.225 276.463 1.00 72.01  ?  3   GLN C CD  1 
ATOM   7301  O OE1 . GLN C 1 9   ? 148.766 -44.807 277.401 1.00 63.80  ?  3   GLN C OE1 1 
ATOM   7302  N NE2 . GLN C 1 9   ? 146.927 -43.923 276.462 1.00 71.04  ?  3   GLN C NE2 1 
ATOM   7303  N N   . ALA C 1 10  ? 149.760 -39.569 273.239 1.00 61.80  ?  4   ALA C N   1 
ATOM   7304  C CA  . ALA C 1 10  ? 149.399 -38.213 272.851 1.00 57.72  ?  4   ALA C CA  1 
ATOM   7305  C C   . ALA C 1 10  ? 149.936 -37.923 271.457 1.00 58.74  ?  4   ALA C C   1 
ATOM   7306  O O   . ALA C 1 10  ? 151.096 -38.225 271.158 1.00 58.09  ?  4   ALA C O   1 
ATOM   7307  C CB  . ALA C 1 10  ? 149.940 -37.192 273.852 1.00 56.29  ?  4   ALA C CB  1 
ATOM   7308  N N   . ASP C 1 11  ? 149.089 -37.338 270.608 1.00 59.65  ?  5   ASP C N   1 
ATOM   7309  C CA  . ASP C 1 11  ? 149.504 -37.043 269.241 1.00 60.10  ?  5   ASP C CA  1 
ATOM   7310  C C   . ASP C 1 11  ? 150.447 -35.848 269.193 1.00 62.90  ?  5   ASP C C   1 
ATOM   7311  O O   . ASP C 1 11  ? 151.456 -35.872 268.478 1.00 61.26  ?  5   ASP C O   1 
ATOM   7312  C CB  . ASP C 1 11  ? 148.278 -36.787 268.364 1.00 65.32  ?  5   ASP C CB  1 
ATOM   7313  C CG  . ASP C 1 11  ? 147.222 -37.867 268.505 1.00 68.05  ?  5   ASP C CG  1 
ATOM   7314  O OD1 . ASP C 1 11  ? 147.588 -39.027 268.782 1.00 68.50  ?  5   ASP C OD1 1 
ATOM   7315  O OD2 . ASP C 1 11  ? 146.025 -37.553 268.338 1.00 65.77  -1 5   ASP C OD2 1 
ATOM   7316  N N   . ILE C 1 12  ? 150.138 -34.794 269.951 1.00 62.40  ?  6   ILE C N   1 
ATOM   7317  C CA  . ILE C 1 12  ? 150.885 -33.543 269.896 1.00 60.18  ?  6   ILE C CA  1 
ATOM   7318  C C   . ILE C 1 12  ? 150.857 -32.906 271.278 1.00 59.52  ?  6   ILE C C   1 
ATOM   7319  O O   . ILE C 1 12  ? 149.984 -33.191 272.099 1.00 61.16  ?  6   ILE C O   1 
ATOM   7320  C CB  . ILE C 1 12  ? 150.298 -32.591 268.823 1.00 53.73  ?  6   ILE C CB  1 
ATOM   7321  C CG1 . ILE C 1 12  ? 151.268 -31.454 268.499 1.00 56.18  ?  6   ILE C CG1 1 
ATOM   7322  C CG2 . ILE C 1 12  ? 148.955 -32.038 269.275 1.00 54.12  ?  6   ILE C CG2 1 
ATOM   7323  C CD1 . ILE C 1 12  ? 150.950 -30.745 267.202 1.00 52.61  ?  6   ILE C CD1 1 
ATOM   7324  N N   . ALA C 1 13  ? 151.841 -32.049 271.543 1.00 59.53  ?  7   ALA C N   1 
ATOM   7325  C CA  . ALA C 1 13  ? 151.920 -31.307 272.791 1.00 55.05  ?  7   ALA C CA  1 
ATOM   7326  C C   . ALA C 1 13  ? 151.856 -29.813 272.507 1.00 54.69  ?  7   ALA C C   1 
ATOM   7327  O O   . ALA C 1 13  ? 152.299 -29.345 271.454 1.00 61.37  ?  7   ALA C O   1 
ATOM   7328  C CB  . ALA C 1 13  ? 153.205 -31.631 273.562 1.00 44.69  ?  7   ALA C CB  1 
ATOM   7329  N N   . LEU C 1 14  ? 151.299 -29.068 273.459 1.00 57.13  ?  8   LEU C N   1 
ATOM   7330  C CA  . LEU C 1 14  ? 151.196 -27.618 273.362 1.00 58.96  ?  8   LEU C CA  1 
ATOM   7331  C C   . LEU C 1 14  ? 151.650 -27.016 274.683 1.00 67.66  ?  8   LEU C C   1 
ATOM   7332  O O   . LEU C 1 14  ? 151.120 -27.368 275.742 1.00 66.55  ?  8   LEU C O   1 
ATOM   7333  C CB  . LEU C 1 14  ? 149.767 -27.182 273.022 1.00 49.32  ?  8   LEU C CB  1 
ATOM   7334  C CG  . LEU C 1 14  ? 149.531 -25.708 272.678 1.00 50.77  ?  8   LEU C CG  1 
ATOM   7335  C CD1 . LEU C 1 14  ? 148.397 -25.576 271.673 1.00 53.21  ?  8   LEU C CD1 1 
ATOM   7336  C CD2 . LEU C 1 14  ? 149.227 -24.889 273.924 1.00 55.86  ?  8   LEU C CD2 1 
ATOM   7337  N N   . ILE C 1 15  ? 152.623 -26.112 274.618 1.00 69.16  ?  9   ILE C N   1 
ATOM   7338  C CA  . ILE C 1 15  ? 153.168 -25.438 275.790 1.00 56.17  ?  9   ILE C CA  1 
ATOM   7339  C C   . ILE C 1 15  ? 152.690 -23.993 275.775 1.00 56.76  ?  9   ILE C C   1 
ATOM   7340  O O   . ILE C 1 15  ? 152.843 -23.292 274.768 1.00 62.10  ?  9   ILE C O   1 
ATOM   7341  C CB  . ILE C 1 15  ? 154.704 -25.513 275.821 1.00 53.38  ?  9   ILE C CB  1 
ATOM   7342  C CG1 . ILE C 1 15  ? 155.166 -26.966 275.697 1.00 55.96  ?  9   ILE C CG1 1 
ATOM   7343  C CG2 . ILE C 1 15  ? 155.239 -24.894 277.101 1.00 60.37  ?  9   ILE C CG2 1 
ATOM   7344  C CD1 . ILE C 1 15  ? 156.668 -27.137 275.745 1.00 51.98  ?  9   ILE C CD1 1 
ATOM   7345  N N   . GLY C 1 16  ? 152.114 -23.551 276.890 1.00 59.43  ?  10  GLY C N   1 
ATOM   7346  C CA  . GLY C 1 16  ? 151.567 -22.211 276.981 1.00 62.16  ?  10  GLY C CA  1 
ATOM   7347  C C   . GLY C 1 16  ? 150.065 -22.222 277.166 1.00 71.92  ?  10  GLY C C   1 
ATOM   7348  O O   . GLY C 1 16  ? 149.312 -22.292 276.190 1.00 69.63  ?  10  GLY C O   1 
ATOM   7349  N N   . LEU C 1 17  ? 149.615 -22.151 278.417 1.00 78.58  ?  11  LEU C N   1 
ATOM   7350  C CA  . LEU C 1 17  ? 148.196 -22.291 278.738 1.00 82.21  ?  11  LEU C CA  1 
ATOM   7351  C C   . LEU C 1 17  ? 147.553 -20.915 278.905 1.00 84.43  ?  11  LEU C C   1 
ATOM   7352  O O   . LEU C 1 17  ? 147.220 -20.467 280.003 1.00 90.07  ?  11  LEU C O   1 
ATOM   7353  C CB  . LEU C 1 17  ? 148.019 -23.153 279.984 1.00 81.01  ?  11  LEU C CB  1 
ATOM   7354  C CG  . LEU C 1 17  ? 147.727 -24.634 279.740 1.00 84.55  ?  11  LEU C CG  1 
ATOM   7355  C CD1 . LEU C 1 17  ? 148.783 -25.274 278.851 1.00 73.92  ?  11  LEU C CD1 1 
ATOM   7356  C CD2 . LEU C 1 17  ? 147.632 -25.365 281.059 1.00 89.84  ?  11  LEU C CD2 1 
ATOM   7357  N N   . ALA C 1 18  ? 147.381 -20.247 277.771 1.00 84.57  ?  12  ALA C N   1 
ATOM   7358  C CA  . ALA C 1 18  ? 146.629 -19.007 277.677 1.00 84.61  ?  12  ALA C CA  1 
ATOM   7359  C C   . ALA C 1 18  ? 145.327 -19.271 276.928 1.00 76.17  ?  12  ALA C C   1 
ATOM   7360  O O   . ALA C 1 18  ? 145.029 -20.403 276.537 1.00 77.07  ?  12  ALA C O   1 
ATOM   7361  C CB  . ALA C 1 18  ? 147.459 -17.920 276.989 1.00 82.34  ?  12  ALA C CB  1 
ATOM   7362  N N   . VAL C 1 19  ? 144.545 -18.207 276.725 1.00 72.71  ?  13  VAL C N   1 
ATOM   7363  C CA  . VAL C 1 19  ? 143.290 -18.346 275.990 1.00 78.37  ?  13  VAL C CA  1 
ATOM   7364  C C   . VAL C 1 19  ? 143.550 -18.851 274.577 1.00 77.48  ?  13  VAL C C   1 
ATOM   7365  O O   . VAL C 1 19  ? 142.705 -19.536 273.986 1.00 79.67  ?  13  VAL C O   1 
ATOM   7366  C CB  . VAL C 1 19  ? 142.518 -17.009 275.992 1.00 77.35  ?  13  VAL C CB  1 
ATOM   7367  C CG1 . VAL C 1 19  ? 143.324 -15.916 275.303 1.00 72.17  ?  13  VAL C CG1 1 
ATOM   7368  C CG2 . VAL C 1 19  ? 141.150 -17.174 275.340 1.00 72.50  ?  13  VAL C CG2 1 
ATOM   7369  N N   . MET C 1 20  ? 144.724 -18.547 274.020 1.00 75.72  ?  14  MET C N   1 
ATOM   7370  C CA  . MET C 1 20  ? 145.090 -19.066 272.708 1.00 72.11  ?  14  MET C CA  1 
ATOM   7371  C C   . MET C 1 20  ? 145.472 -20.540 272.787 1.00 66.04  ?  14  MET C C   1 
ATOM   7372  O O   . MET C 1 20  ? 145.028 -21.350 271.966 1.00 67.35  ?  14  MET C O   1 
ATOM   7373  C CB  . MET C 1 20  ? 146.243 -18.246 272.125 1.00 71.07  ?  14  MET C CB  1 
ATOM   7374  C CG  . MET C 1 20  ? 146.435 -18.414 270.629 1.00 59.85  ?  14  MET C CG  1 
ATOM   7375  S SD  . MET C 1 20  ? 145.076 -17.688 269.695 1.00 78.58  ?  14  MET C SD  1 
ATOM   7376  C CE  . MET C 1 20  ? 145.083 -16.018 270.341 1.00 84.06  ?  14  MET C CE  1 
ATOM   7377  N N   . GLY C 1 21  ? 146.292 -20.903 273.774 1.00 68.17  ?  15  GLY C N   1 
ATOM   7378  C CA  . GLY C 1 21  ? 146.731 -22.284 273.887 1.00 68.79  ?  15  GLY C CA  1 
ATOM   7379  C C   . GLY C 1 21  ? 145.622 -23.223 274.321 1.00 74.85  ?  15  GLY C C   1 
ATOM   7380  O O   . GLY C 1 21  ? 145.508 -24.339 273.807 1.00 77.24  ?  15  GLY C O   1 
ATOM   7381  N N   . GLN C 1 22  ? 144.795 -22.790 275.276 1.00 80.86  ?  16  GLN C N   1 
ATOM   7382  C CA  . GLN C 1 22  ? 143.678 -23.617 275.725 1.00 80.49  ?  16  GLN C CA  1 
ATOM   7383  C C   . GLN C 1 22  ? 142.720 -23.912 274.578 1.00 75.86  ?  16  GLN C C   1 
ATOM   7384  O O   . GLN C 1 22  ? 142.299 -25.058 274.382 1.00 74.89  ?  16  GLN C O   1 
ATOM   7385  C CB  . GLN C 1 22  ? 142.938 -22.925 276.870 1.00 81.51  ?  16  GLN C CB  1 
ATOM   7386  C CG  . GLN C 1 22  ? 143.741 -22.769 278.149 1.00 81.48  ?  16  GLN C CG  1 
ATOM   7387  C CD  . GLN C 1 22  ? 142.971 -22.025 279.223 1.00 81.98  ?  16  GLN C CD  1 
ATOM   7388  O OE1 . GLN C 1 22  ? 141.889 -21.492 278.970 1.00 79.51  ?  16  GLN C OE1 1 
ATOM   7389  N NE2 . GLN C 1 22  ? 143.523 -21.985 280.430 1.00 75.53  ?  16  GLN C NE2 1 
ATOM   7390  N N   . ASN C 1 23  ? 142.368 -22.882 273.807 1.00 71.33  ?  17  ASN C N   1 
ATOM   7391  C CA  . ASN C 1 23  ? 141.413 -23.062 272.719 1.00 70.22  ?  17  ASN C CA  1 
ATOM   7392  C C   . ASN C 1 23  ? 141.982 -23.948 271.618 1.00 76.12  ?  17  ASN C C   1 
ATOM   7393  O O   . ASN C 1 23  ? 141.264 -24.783 271.057 1.00 75.03  ?  17  ASN C O   1 
ATOM   7394  C CB  . ASN C 1 23  ? 140.995 -21.702 272.163 1.00 73.40  ?  17  ASN C CB  1 
ATOM   7395  C CG  . ASN C 1 23  ? 140.131 -20.919 273.132 1.00 73.18  ?  17  ASN C CG  1 
ATOM   7396  O OD1 . ASN C 1 23  ? 139.392 -21.499 273.928 1.00 74.23  ?  17  ASN C OD1 1 
ATOM   7397  N ND2 . ASN C 1 23  ? 140.222 -19.597 273.072 1.00 74.75  ?  17  ASN C ND2 1 
ATOM   7398  N N   . LEU C 1 24  ? 143.268 -23.789 271.298 1.00 77.82  ?  18  LEU C N   1 
ATOM   7399  C CA  . LEU C 1 24  ? 143.876 -24.633 270.274 1.00 75.44  ?  18  LEU C CA  1 
ATOM   7400  C C   . LEU C 1 24  ? 144.042 -26.070 270.751 1.00 69.67  ?  18  LEU C C   1 
ATOM   7401  O O   . LEU C 1 24  ? 144.029 -26.997 269.932 1.00 68.17  ?  18  LEU C O   1 
ATOM   7402  C CB  . LEU C 1 24  ? 145.225 -24.056 269.843 1.00 71.21  ?  18  LEU C CB  1 
ATOM   7403  C CG  . LEU C 1 24  ? 145.174 -22.904 268.836 1.00 68.25  ?  18  LEU C CG  1 
ATOM   7404  C CD1 . LEU C 1 24  ? 146.571 -22.402 268.515 1.00 62.10  ?  18  LEU C CD1 1 
ATOM   7405  C CD2 . LEU C 1 24  ? 144.463 -23.338 267.565 1.00 64.18  ?  18  LEU C CD2 1 
ATOM   7406  N N   . ILE C 1 25  ? 144.197 -26.278 272.059 1.00 68.48  ?  19  ILE C N   1 
ATOM   7407  C CA  . ILE C 1 25  ? 144.323 -27.635 272.585 1.00 73.12  ?  19  ILE C CA  1 
ATOM   7408  C C   . ILE C 1 25  ? 143.001 -28.381 272.453 1.00 76.02  ?  19  ILE C C   1 
ATOM   7409  O O   . ILE C 1 25  ? 142.945 -29.484 271.896 1.00 71.62  ?  19  ILE C O   1 
ATOM   7410  C CB  . ILE C 1 25  ? 144.814 -27.605 274.044 1.00 69.40  ?  19  ILE C CB  1 
ATOM   7411  C CG1 . ILE C 1 25  ? 146.328 -27.397 274.091 1.00 71.67  ?  19  ILE C CG1 1 
ATOM   7412  C CG2 . ILE C 1 25  ? 144.432 -28.887 274.769 1.00 64.83  ?  19  ILE C CG2 1 
ATOM   7413  C CD1 . ILE C 1 25  ? 146.908 -27.431 275.487 1.00 75.99  ?  19  ILE C CD1 1 
ATOM   7414  N N   . LEU C 1 26  ? 141.914 -27.790 272.957 1.00 76.82  ?  20  LEU C N   1 
ATOM   7415  C CA  . LEU C 1 26  ? 140.617 -28.448 272.870 1.00 76.26  ?  20  LEU C CA  1 
ATOM   7416  C C   . LEU C 1 26  ? 140.086 -28.481 271.444 1.00 70.33  ?  20  LEU C C   1 
ATOM   7417  O O   . LEU C 1 26  ? 139.264 -29.343 271.122 1.00 75.78  ?  20  LEU C O   1 
ATOM   7418  C CB  . LEU C 1 26  ? 139.608 -27.761 273.797 1.00 73.14  ?  20  LEU C CB  1 
ATOM   7419  C CG  . LEU C 1 26  ? 139.021 -26.403 273.404 1.00 75.50  ?  20  LEU C CG  1 
ATOM   7420  C CD1 . LEU C 1 26  ? 137.701 -26.566 272.656 1.00 70.06  ?  20  LEU C CD1 1 
ATOM   7421  C CD2 . LEU C 1 26  ? 138.835 -25.527 274.634 1.00 69.44  ?  20  LEU C CD2 1 
ATOM   7422  N N   . ASN C 1 27  ? 140.532 -27.563 270.584 1.00 69.14  ?  21  ASN C N   1 
ATOM   7423  C CA  . ASN C 1 27  ? 140.094 -27.592 269.194 1.00 71.82  ?  21  ASN C CA  1 
ATOM   7424  C C   . ASN C 1 27  ? 140.623 -28.821 268.467 1.00 69.44  ?  21  ASN C C   1 
ATOM   7425  O O   . ASN C 1 27  ? 139.998 -29.291 267.510 1.00 70.48  ?  21  ASN C O   1 
ATOM   7426  C CB  . ASN C 1 27  ? 140.535 -26.317 268.478 1.00 78.13  ?  21  ASN C CB  1 
ATOM   7427  C CG  . ASN C 1 27  ? 140.178 -26.320 267.009 1.00 73.65  ?  21  ASN C CG  1 
ATOM   7428  O OD1 . ASN C 1 27  ? 141.028 -26.560 266.157 1.00 72.33  ?  21  ASN C OD1 1 
ATOM   7429  N ND2 . ASN C 1 27  ? 138.914 -26.060 266.706 1.00 77.50  ?  21  ASN C ND2 1 
ATOM   7430  N N   . MET C 1 28  ? 141.759 -29.361 268.912 1.00 71.96  ?  22  MET C N   1 
ATOM   7431  C CA  . MET C 1 28  ? 142.328 -30.530 268.253 1.00 71.29  ?  22  MET C CA  1 
ATOM   7432  C C   . MET C 1 28  ? 141.619 -31.815 268.666 1.00 70.94  ?  22  MET C C   1 
ATOM   7433  O O   . MET C 1 28  ? 141.366 -32.680 267.820 1.00 70.93  ?  22  MET C O   1 
ATOM   7434  C CB  . MET C 1 28  ? 143.828 -30.619 268.544 1.00 69.55  ?  22  MET C CB  1 
ATOM   7435  C CG  . MET C 1 28  ? 144.656 -29.563 267.821 1.00 70.40  ?  22  MET C CG  1 
ATOM   7436  S SD  . MET C 1 28  ? 146.426 -29.695 268.138 1.00 65.19  ?  22  MET C SD  1 
ATOM   7437  C CE  . MET C 1 28  ? 146.488 -29.306 269.885 1.00 59.32  ?  22  MET C CE  1 
ATOM   7438  N N   . ASN C 1 29  ? 141.281 -31.964 269.951 1.00 72.07  ?  23  ASN C N   1 
ATOM   7439  C CA  . ASN C 1 29  ? 140.603 -33.187 270.374 1.00 73.00  ?  23  ASN C CA  1 
ATOM   7440  C C   . ASN C 1 29  ? 139.191 -33.267 269.810 1.00 69.15  ?  23  ASN C C   1 
ATOM   7441  O O   . ASN C 1 29  ? 138.670 -34.369 269.602 1.00 65.41  ?  23  ASN C O   1 
ATOM   7442  C CB  . ASN C 1 29  ? 140.595 -33.305 271.906 1.00 66.92  ?  23  ASN C CB  1 
ATOM   7443  C CG  . ASN C 1 29  ? 139.726 -32.254 272.595 1.00 71.81  ?  23  ASN C CG  1 
ATOM   7444  O OD1 . ASN C 1 29  ? 138.710 -31.805 272.069 1.00 77.23  ?  23  ASN C OD1 1 
ATOM   7445  N ND2 . ASN C 1 29  ? 140.122 -31.878 273.801 1.00 77.36  ?  23  ASN C ND2 1 
ATOM   7446  N N   . ASP C 1 30  ? 138.557 -32.117 269.564 1.00 62.67  ?  24  ASP C N   1 
ATOM   7447  C CA  . ASP C 1 30  ? 137.265 -32.107 268.889 1.00 67.59  ?  24  ASP C CA  1 
ATOM   7448  C C   . ASP C 1 30  ? 137.352 -32.720 267.500 1.00 70.31  ?  24  ASP C C   1 
ATOM   7449  O O   . ASP C 1 30  ? 136.329 -33.148 266.954 1.00 68.88  ?  24  ASP C O   1 
ATOM   7450  C CB  . ASP C 1 30  ? 136.723 -30.679 268.801 1.00 68.37  ?  24  ASP C CB  1 
ATOM   7451  C CG  . ASP C 1 30  ? 136.484 -30.059 270.165 1.00 75.14  ?  24  ASP C CG  1 
ATOM   7452  O OD1 . ASP C 1 30  ? 136.234 -30.814 271.127 1.00 74.05  ?  24  ASP C OD1 1 
ATOM   7453  O OD2 . ASP C 1 30  ? 136.547 -28.816 270.274 1.00 76.30  -1 24  ASP C OD2 1 
ATOM   7454  N N   . HIS C 1 31  ? 138.549 -32.765 266.918 1.00 63.57  ?  25  HIS C N   1 
ATOM   7455  C CA  . HIS C 1 31  ? 138.802 -33.489 265.682 1.00 66.31  ?  25  HIS C CA  1 
ATOM   7456  C C   . HIS C 1 31  ? 139.424 -34.858 265.929 1.00 67.12  ?  25  HIS C C   1 
ATOM   7457  O O   . HIS C 1 31  ? 139.778 -35.551 264.971 1.00 65.22  ?  25  HIS C O   1 
ATOM   7458  C CB  . HIS C 1 31  ? 139.695 -32.660 264.757 1.00 63.39  ?  25  HIS C CB  1 
ATOM   7459  C CG  . HIS C 1 31  ? 139.059 -31.389 264.287 1.00 62.08  ?  25  HIS C CG  1 
ATOM   7460  N ND1 . HIS C 1 31  ? 138.782 -30.336 265.133 1.00 63.46  ?  25  HIS C ND1 1 
ATOM   7461  C CD2 . HIS C 1 31  ? 138.642 -31.003 263.058 1.00 54.80  ?  25  HIS C CD2 1 
ATOM   7462  C CE1 . HIS C 1 31  ? 138.224 -29.356 264.445 1.00 55.94  ?  25  HIS C CE1 1 
ATOM   7463  N NE2 . HIS C 1 31  ? 138.128 -29.735 263.183 1.00 55.31  ?  25  HIS C NE2 1 
ATOM   7464  N N   . GLY C 1 32  ? 139.570 -35.262 267.189 1.00 64.22  ?  26  GLY C N   1 
ATOM   7465  C CA  . GLY C 1 32  ? 140.014 -36.605 267.504 1.00 62.13  ?  26  GLY C CA  1 
ATOM   7466  C C   . GLY C 1 32  ? 141.494 -36.763 267.761 1.00 58.50  ?  26  GLY C C   1 
ATOM   7467  O O   . GLY C 1 32  ? 142.056 -37.819 267.449 1.00 58.93  ?  26  GLY C O   1 
ATOM   7468  N N   . PHE C 1 33  ? 142.145 -35.753 268.330 1.00 60.71  ?  27  PHE C N   1 
ATOM   7469  C CA  . PHE C 1 33  ? 143.576 -35.791 268.595 1.00 58.35  ?  27  PHE C CA  1 
ATOM   7470  C C   . PHE C 1 33  ? 143.823 -35.715 270.094 1.00 59.49  ?  27  PHE C C   1 
ATOM   7471  O O   . PHE C 1 33  ? 143.237 -34.873 270.783 1.00 58.45  ?  27  PHE C O   1 
ATOM   7472  C CB  . PHE C 1 33  ? 144.301 -34.646 267.884 1.00 51.99  ?  27  PHE C CB  1 
ATOM   7473  C CG  . PHE C 1 33  ? 144.145 -34.659 266.389 1.00 49.23  ?  27  PHE C CG  1 
ATOM   7474  C CD1 . PHE C 1 33  ? 144.770 -35.628 265.621 1.00 51.29  ?  27  PHE C CD1 1 
ATOM   7475  C CD2 . PHE C 1 33  ? 143.388 -33.692 265.750 1.00 51.17  ?  27  PHE C CD2 1 
ATOM   7476  C CE1 . PHE C 1 33  ? 144.631 -35.638 264.245 1.00 44.92  ?  27  PHE C CE1 1 
ATOM   7477  C CE2 . PHE C 1 33  ? 143.246 -33.696 264.377 1.00 48.88  ?  27  PHE C CE2 1 
ATOM   7478  C CZ  . PHE C 1 33  ? 143.869 -34.669 263.623 1.00 44.71  ?  27  PHE C CZ  1 
ATOM   7479  N N   . VAL C 1 34  ? 144.689 -36.590 270.594 1.00 60.46  ?  28  VAL C N   1 
ATOM   7480  C CA  . VAL C 1 34  ? 145.095 -36.571 271.994 1.00 67.09  ?  28  VAL C CA  1 
ATOM   7481  C C   . VAL C 1 34  ? 146.249 -35.588 272.140 1.00 63.01  ?  28  VAL C C   1 
ATOM   7482  O O   . VAL C 1 34  ? 147.333 -35.803 271.587 1.00 60.65  ?  28  VAL C O   1 
ATOM   7483  C CB  . VAL C 1 34  ? 145.497 -37.972 272.478 1.00 63.38  ?  28  VAL C CB  1 
ATOM   7484  C CG1 . VAL C 1 34  ? 145.904 -37.927 273.942 1.00 58.57  ?  28  VAL C CG1 1 
ATOM   7485  C CG2 . VAL C 1 34  ? 144.354 -38.953 272.269 1.00 59.87  ?  28  VAL C CG2 1 
ATOM   7486  N N   . VAL C 1 35  ? 146.018 -34.511 272.886 1.00 60.26  ?  29  VAL C N   1 
ATOM   7487  C CA  . VAL C 1 35  ? 146.980 -33.428 273.039 1.00 61.81  ?  29  VAL C CA  1 
ATOM   7488  C C   . VAL C 1 35  ? 147.402 -33.351 274.500 1.00 62.44  ?  29  VAL C C   1 
ATOM   7489  O O   . VAL C 1 35  ? 146.554 -33.392 275.400 1.00 67.31  ?  29  VAL C O   1 
ATOM   7490  C CB  . VAL C 1 35  ? 146.397 -32.086 272.555 1.00 57.33  ?  29  VAL C CB  1 
ATOM   7491  C CG1 . VAL C 1 35  ? 144.924 -31.990 272.914 1.00 64.96  ?  29  VAL C CG1 1 
ATOM   7492  C CG2 . VAL C 1 35  ? 147.172 -30.915 273.143 1.00 55.96  ?  29  VAL C CG2 1 
ATOM   7493  N N   . CYS C 1 36  ? 148.709 -33.245 274.732 1.00 62.14  ?  30  CYS C N   1 
ATOM   7494  C CA  . CYS C 1 36  ? 149.274 -33.139 276.072 1.00 63.21  ?  30  CYS C CA  1 
ATOM   7495  C C   . CYS C 1 36  ? 149.522 -31.671 276.396 1.00 65.83  ?  30  CYS C C   1 
ATOM   7496  O O   . CYS C 1 36  ? 150.216 -30.975 275.646 1.00 64.24  ?  30  CYS C O   1 
ATOM   7497  C CB  . CYS C 1 36  ? 150.570 -33.941 276.178 1.00 65.26  ?  30  CYS C CB  1 
ATOM   7498  S SG  . CYS C 1 36  ? 151.361 -33.876 277.802 1.00 69.63  ?  30  CYS C SG  1 
ATOM   7499  N N   . ALA C 1 37  ? 148.962 -31.206 277.510 1.00 67.22  ?  31  ALA C N   1 
ATOM   7500  C CA  . ALA C 1 37  ? 149.099 -29.818 277.926 1.00 70.34  ?  31  ALA C CA  1 
ATOM   7501  C C   . ALA C 1 37  ? 150.258 -29.661 278.902 1.00 74.78  ?  31  ALA C C   1 
ATOM   7502  O O   . ALA C 1 37  ? 150.520 -30.545 279.722 1.00 73.10  ?  31  ALA C O   1 
ATOM   7503  C CB  . ALA C 1 37  ? 147.804 -29.317 278.567 1.00 68.51  ?  31  ALA C CB  1 
ATOM   7504  N N   . PHE C 1 38  ? 150.946 -28.526 278.808 1.00 76.50  ?  32  PHE C N   1 
ATOM   7505  C CA  . PHE C 1 38  ? 152.080 -28.234 279.674 1.00 74.90  ?  32  PHE C CA  1 
ATOM   7506  C C   . PHE C 1 38  ? 152.272 -26.726 279.734 1.00 76.17  ?  32  PHE C C   1 
ATOM   7507  O O   . PHE C 1 38  ? 151.943 -26.010 278.785 1.00 81.48  ?  32  PHE C O   1 
ATOM   7508  C CB  . PHE C 1 38  ? 153.355 -28.923 279.177 1.00 71.20  ?  32  PHE C CB  1 
ATOM   7509  C CG  . PHE C 1 38  ? 154.558 -28.670 280.039 1.00 77.58  ?  32  PHE C CG  1 
ATOM   7510  C CD1 . PHE C 1 38  ? 154.681 -29.283 281.274 1.00 81.71  ?  32  PHE C CD1 1 
ATOM   7511  C CD2 . PHE C 1 38  ? 155.568 -27.825 279.611 1.00 75.02  ?  32  PHE C CD2 1 
ATOM   7512  C CE1 . PHE C 1 38  ? 155.787 -29.053 282.070 1.00 81.02  ?  32  PHE C CE1 1 
ATOM   7513  C CE2 . PHE C 1 38  ? 156.677 -27.592 280.403 1.00 82.16  ?  32  PHE C CE2 1 
ATOM   7514  C CZ  . PHE C 1 38  ? 156.787 -28.208 281.633 1.00 82.86  ?  32  PHE C CZ  1 
ATOM   7515  N N   . ASN C 1 39  ? 152.808 -26.253 280.857 1.00 80.07  ?  33  ASN C N   1 
ATOM   7516  C CA  . ASN C 1 39  ? 152.950 -24.822 281.074 1.00 82.04  ?  33  ASN C CA  1 
ATOM   7517  C C   . ASN C 1 39  ? 154.198 -24.550 281.902 1.00 86.97  ?  33  ASN C C   1 
ATOM   7518  O O   . ASN C 1 39  ? 154.712 -25.429 282.600 1.00 79.52  ?  33  ASN C O   1 
ATOM   7519  C CB  . ASN C 1 39  ? 151.709 -24.241 281.763 1.00 76.71  ?  33  ASN C CB  1 
ATOM   7520  C CG  . ASN C 1 39  ? 151.703 -22.726 281.775 1.00 83.35  ?  33  ASN C CG  1 
ATOM   7521  O OD1 . ASN C 1 39  ? 152.268 -22.084 280.890 1.00 84.69  ?  33  ASN C OD1 1 
ATOM   7522  N ND2 . ASN C 1 39  ? 151.069 -22.147 282.785 1.00 87.43  ?  33  ASN C ND2 1 
ATOM   7523  N N   . ARG C 1 40  ? 154.685 -23.310 281.805 1.00 91.95  ?  34  ARG C N   1 
ATOM   7524  C CA  . ARG C 1 40  ? 155.822 -22.875 282.610 1.00 89.79  ?  34  ARG C CA  1 
ATOM   7525  C C   . ARG C 1 40  ? 155.500 -22.964 284.097 1.00 83.95  ?  34  ARG C C   1 
ATOM   7526  O O   . ARG C 1 40  ? 156.216 -23.615 284.867 1.00 79.50  ?  34  ARG C O   1 
ATOM   7527  C CB  . ARG C 1 40  ? 156.213 -21.448 282.218 1.00 86.27  ?  34  ARG C CB  1 
ATOM   7528  C CG  . ARG C 1 40  ? 157.270 -20.801 283.101 1.00 83.14  ?  34  ARG C CG  1 
ATOM   7529  C CD  . ARG C 1 40  ? 158.626 -21.467 282.946 1.00 81.33  ?  34  ARG C CD  1 
ATOM   7530  N NE  . ARG C 1 40  ? 159.712 -20.571 283.339 1.00 88.92  ?  34  ARG C NE  1 
ATOM   7531  C CZ  . ARG C 1 40  ? 160.111 -20.380 284.592 1.00 88.98  ?  34  ARG C CZ  1 
ATOM   7532  N NH1 . ARG C 1 40  ? 159.513 -21.023 285.586 1.00 87.17  1  34  ARG C NH1 1 
ATOM   7533  N NH2 . ARG C 1 40  ? 161.107 -19.544 284.852 1.00 78.75  ?  34  ARG C NH2 1 
ATOM   7534  N N   . THR C 1 41  ? 154.421 -22.309 284.520 1.00 84.24  ?  35  THR C N   1 
ATOM   7535  C CA  . THR C 1 41  ? 153.931 -22.415 285.893 1.00 87.00  ?  35  THR C CA  1 
ATOM   7536  C C   . THR C 1 41  ? 153.026 -23.638 285.963 1.00 88.06  ?  35  THR C C   1 
ATOM   7537  O O   . THR C 1 41  ? 151.887 -23.612 285.491 1.00 91.75  ?  35  THR C O   1 
ATOM   7538  C CB  . THR C 1 41  ? 153.196 -21.146 286.312 1.00 85.19  ?  35  THR C CB  1 
ATOM   7539  O OG1 . THR C 1 41  ? 152.077 -20.930 285.444 1.00 90.20  ?  35  THR C OG1 1 
ATOM   7540  C CG2 . THR C 1 41  ? 154.127 -19.944 286.238 1.00 83.32  ?  35  THR C CG2 1 
ATOM   7541  N N   . VAL C 1 42  ? 153.537 -24.717 286.560 1.00 82.97  ?  36  VAL C N   1 
ATOM   7542  C CA  . VAL C 1 42  ? 152.825 -25.986 286.605 1.00 75.58  ?  36  VAL C CA  1 
ATOM   7543  C C   . VAL C 1 42  ? 151.535 -25.909 287.413 1.00 85.84  ?  36  VAL C C   1 
ATOM   7544  O O   . VAL C 1 42  ? 150.735 -26.846 287.381 1.00 89.16  ?  36  VAL C O   1 
ATOM   7545  C CB  . VAL C 1 42  ? 153.762 -27.084 287.158 1.00 82.24  ?  36  VAL C CB  1 
ATOM   7546  C CG1 . VAL C 1 42  ? 153.244 -28.472 286.807 1.00 85.77  ?  36  VAL C CG1 1 
ATOM   7547  C CG2 . VAL C 1 42  ? 155.170 -26.895 286.617 1.00 76.91  ?  36  VAL C CG2 1 
ATOM   7548  N N   . SER C 1 43  ? 151.303 -24.809 288.132 1.00 92.28  ?  37  SER C N   1 
ATOM   7549  C CA  . SER C 1 43  ? 150.039 -24.653 288.842 1.00 93.84  ?  37  SER C CA  1 
ATOM   7550  C C   . SER C 1 43  ? 148.856 -24.514 287.892 1.00 92.00  ?  37  SER C C   1 
ATOM   7551  O O   . SER C 1 43  ? 147.713 -24.713 288.315 1.00 91.48  ?  37  SER C O   1 
ATOM   7552  C CB  . SER C 1 43  ? 150.097 -23.438 289.768 1.00 94.24  ?  37  SER C CB  1 
ATOM   7553  O OG  . SER C 1 43  ? 150.107 -22.232 289.024 1.00 94.69  ?  37  SER C OG  1 
ATOM   7554  N N   . LYS C 1 44  ? 149.103 -24.188 286.622 1.00 92.85  ?  38  LYS C N   1 
ATOM   7555  C CA  . LYS C 1 44  ? 148.025 -23.927 285.679 1.00 94.99  ?  38  LYS C CA  1 
ATOM   7556  C C   . LYS C 1 44  ? 147.629 -25.142 284.849 1.00 93.72  ?  38  LYS C C   1 
ATOM   7557  O O   . LYS C 1 44  ? 146.556 -25.124 284.236 1.00 89.59  ?  38  LYS C O   1 
ATOM   7558  C CB  . LYS C 1 44  ? 148.411 -22.783 284.733 1.00 91.61  ?  38  LYS C CB  1 
ATOM   7559  C CG  . LYS C 1 44  ? 148.705 -21.457 285.423 1.00 91.86  ?  38  LYS C CG  1 
ATOM   7560  C CD  . LYS C 1 44  ? 148.922 -20.346 284.402 1.00 96.33  ?  38  LYS C CD  1 
ATOM   7561  C CE  . LYS C 1 44  ? 149.415 -19.064 285.055 1.00 91.78  ?  38  LYS C CE  1 
ATOM   7562  N NZ  . LYS C 1 44  ? 148.413 -18.486 285.990 1.00 91.55  1  38  LYS C NZ  1 
ATOM   7563  N N   . VAL C 1 45  ? 148.454 -26.192 284.806 1.00 88.95  ?  39  VAL C N   1 
ATOM   7564  C CA  . VAL C 1 45  ? 148.123 -27.339 283.964 1.00 90.43  ?  39  VAL C CA  1 
ATOM   7565  C C   . VAL C 1 45  ? 147.011 -28.168 284.600 1.00 100.05 ?  39  VAL C C   1 
ATOM   7566  O O   . VAL C 1 45  ? 146.004 -28.478 283.953 1.00 100.22 ?  39  VAL C O   1 
ATOM   7567  C CB  . VAL C 1 45  ? 149.376 -28.184 283.657 1.00 85.08  ?  39  VAL C CB  1 
ATOM   7568  C CG1 . VAL C 1 45  ? 150.098 -28.604 284.925 1.00 93.29  ?  39  VAL C CG1 1 
ATOM   7569  C CG2 . VAL C 1 45  ? 149.001 -29.402 282.823 1.00 78.81  ?  39  VAL C CG2 1 
ATOM   7570  N N   . ASP C 1 46  ? 147.160 -28.521 285.880 1.00 104.69 ?  40  ASP C N   1 
ATOM   7571  C CA  . ASP C 1 46  ? 146.090 -29.236 286.565 1.00 103.27 ?  40  ASP C CA  1 
ATOM   7572  C C   . ASP C 1 46  ? 144.843 -28.378 286.717 1.00 100.32 ?  40  ASP C C   1 
ATOM   7573  O O   . ASP C 1 46  ? 143.742 -28.922 286.853 1.00 102.16 ?  40  ASP C O   1 
ATOM   7574  C CB  . ASP C 1 46  ? 146.566 -29.730 287.933 1.00 105.37 ?  40  ASP C CB  1 
ATOM   7575  C CG  . ASP C 1 46  ? 147.561 -28.790 288.580 1.00 108.09 ?  40  ASP C CG  1 
ATOM   7576  O OD1 . ASP C 1 46  ? 148.512 -28.371 287.890 1.00 99.97  ?  40  ASP C OD1 1 
ATOM   7577  O OD2 . ASP C 1 46  ? 147.391 -28.470 289.775 1.00 112.15 -1 40  ASP C OD2 1 
ATOM   7578  N N   . ASP C 1 47  ? 144.990 -27.050 286.693 1.00 100.95 ?  41  ASP C N   1 
ATOM   7579  C CA  . ASP C 1 47  ? 143.818 -26.182 286.659 1.00 101.69 ?  41  ASP C CA  1 
ATOM   7580  C C   . ASP C 1 47  ? 143.082 -26.307 285.331 1.00 99.61  ?  41  ASP C C   1 
ATOM   7581  O O   . ASP C 1 47  ? 141.847 -26.353 285.302 1.00 99.60  ?  41  ASP C O   1 
ATOM   7582  C CB  . ASP C 1 47  ? 144.228 -24.729 286.907 1.00 99.50  ?  41  ASP C CB  1 
ATOM   7583  C CG  . ASP C 1 47  ? 144.641 -24.475 288.343 1.00 95.82  ?  41  ASP C CG  1 
ATOM   7584  O OD1 . ASP C 1 47  ? 144.704 -25.444 289.128 1.00 94.24  ?  41  ASP C OD1 1 
ATOM   7585  O OD2 . ASP C 1 47  ? 144.898 -23.302 288.688 1.00 101.21 -1 41  ASP C OD2 1 
ATOM   7586  N N   . PHE C 1 48  ? 143.822 -26.367 284.221 1.00 96.25  ?  42  PHE C N   1 
ATOM   7587  C CA  . PHE C 1 48  ? 143.184 -26.469 282.913 1.00 97.49  ?  42  PHE C CA  1 
ATOM   7588  C C   . PHE C 1 48  ? 142.461 -27.800 282.748 1.00 96.00  ?  42  PHE C C   1 
ATOM   7589  O O   . PHE C 1 48  ? 141.341 -27.844 282.226 1.00 95.54  ?  42  PHE C O   1 
ATOM   7590  C CB  . PHE C 1 48  ? 144.222 -26.280 281.807 1.00 90.94  ?  42  PHE C CB  1 
ATOM   7591  C CG  . PHE C 1 48  ? 143.680 -26.505 280.425 1.00 90.41  ?  42  PHE C CG  1 
ATOM   7592  C CD1 . PHE C 1 48  ? 142.695 -25.681 279.911 1.00 86.57  ?  42  PHE C CD1 1 
ATOM   7593  C CD2 . PHE C 1 48  ? 144.162 -27.537 279.635 1.00 86.27  ?  42  PHE C CD2 1 
ATOM   7594  C CE1 . PHE C 1 48  ? 142.191 -25.885 278.641 1.00 75.90  ?  42  PHE C CE1 1 
ATOM   7595  C CE2 . PHE C 1 48  ? 143.664 -27.744 278.362 1.00 77.60  ?  42  PHE C CE2 1 
ATOM   7596  C CZ  . PHE C 1 48  ? 142.678 -26.916 277.865 1.00 75.01  ?  42  PHE C CZ  1 
ATOM   7597  N N   . LEU C 1 49  ? 143.083 -28.896 283.190 1.00 92.29  ?  43  LEU C N   1 
ATOM   7598  C CA  . LEU C 1 49  ? 142.456 -30.207 283.068 1.00 94.41  ?  43  LEU C CA  1 
ATOM   7599  C C   . LEU C 1 49  ? 141.272 -30.381 284.011 1.00 102.06 ?  43  LEU C C   1 
ATOM   7600  O O   . LEU C 1 49  ? 140.479 -31.309 283.821 1.00 98.17  ?  43  LEU C O   1 
ATOM   7601  C CB  . LEU C 1 49  ? 143.480 -31.313 283.329 1.00 87.33  ?  43  LEU C CB  1 
ATOM   7602  C CG  . LEU C 1 49  ? 144.375 -31.778 282.177 1.00 82.63  ?  43  LEU C CG  1 
ATOM   7603  C CD1 . LEU C 1 49  ? 145.457 -30.760 281.851 1.00 84.68  ?  43  LEU C CD1 1 
ATOM   7604  C CD2 . LEU C 1 49  ? 144.987 -33.130 282.504 1.00 85.49  ?  43  LEU C CD2 1 
ATOM   7605  N N   . ALA C 1 50  ? 141.129 -29.514 285.013 1.00 106.38 ?  44  ALA C N   1 
ATOM   7606  C CA  . ALA C 1 50  ? 140.102 -29.698 286.032 1.00 106.70 ?  44  ALA C CA  1 
ATOM   7607  C C   . ALA C 1 50  ? 138.800 -28.973 285.709 1.00 109.95 ?  44  ALA C C   1 
ATOM   7608  O O   . ALA C 1 50  ? 137.718 -29.524 285.936 1.00 109.84 ?  44  ALA C O   1 
ATOM   7609  C CB  . ALA C 1 50  ? 140.622 -29.235 287.395 1.00 97.69  ?  44  ALA C CB  1 
ATOM   7610  N N   . ASN C 1 51  ? 138.873 -27.749 285.189 1.00 106.26 ?  45  ASN C N   1 
ATOM   7611  C CA  . ASN C 1 51  ? 137.682 -26.929 285.002 1.00 105.52 ?  45  ASN C CA  1 
ATOM   7612  C C   . ASN C 1 51  ? 137.455 -26.512 283.558 1.00 102.63 ?  45  ASN C C   1 
ATOM   7613  O O   . ASN C 1 51  ? 136.329 -26.629 283.059 1.00 101.62 ?  45  ASN C O   1 
ATOM   7614  C CB  . ASN C 1 51  ? 137.757 -25.684 285.903 1.00 104.00 ?  45  ASN C CB  1 
ATOM   7615  C CG  . ASN C 1 51  ? 139.181 -25.222 286.144 1.00 105.90 ?  45  ASN C CG  1 
ATOM   7616  O OD1 . ASN C 1 51  ? 139.823 -25.634 287.111 1.00 105.04 ?  45  ASN C OD1 1 
ATOM   7617  N ND2 . ASN C 1 51  ? 139.683 -24.361 285.266 1.00 105.34 ?  45  ASN C ND2 1 
ATOM   7618  N N   . GLU C 1 52  ? 138.487 -26.022 282.869 1.00 101.68 ?  46  GLU C N   1 
ATOM   7619  C CA  . GLU C 1 52  ? 138.299 -25.512 281.513 1.00 101.12 ?  46  GLU C CA  1 
ATOM   7620  C C   . GLU C 1 52  ? 137.920 -26.631 280.548 1.00 101.32 ?  46  GLU C C   1 
ATOM   7621  O O   . GLU C 1 52  ? 136.876 -26.572 279.887 1.00 93.50  ?  46  GLU C O   1 
ATOM   7622  C CB  . GLU C 1 52  ? 139.565 -24.794 281.042 1.00 88.10  ?  46  GLU C CB  1 
ATOM   7623  C CG  . GLU C 1 52  ? 139.843 -23.486 281.766 1.00 90.58  ?  46  GLU C CG  1 
ATOM   7624  C CD  . GLU C 1 52  ? 138.808 -22.419 281.461 1.00 81.51  ?  46  GLU C CD  1 
ATOM   7625  O OE1 . GLU C 1 52  ? 138.259 -22.424 280.339 1.00 75.56  ?  46  GLU C OE1 1 
ATOM   7626  O OE2 . GLU C 1 52  ? 138.542 -21.579 282.345 1.00 77.86  -1 46  GLU C OE2 1 
ATOM   7627  N N   . ALA C 1 53  ? 138.757 -27.659 280.453 1.00 97.56  ?  47  ALA C N   1 
ATOM   7628  C CA  . ALA C 1 53  ? 138.519 -28.800 279.573 1.00 97.70  ?  47  ALA C CA  1 
ATOM   7629  C C   . ALA C 1 53  ? 138.130 -29.992 280.442 1.00 111.60 ?  47  ALA C C   1 
ATOM   7630  O O   . ALA C 1 53  ? 138.988 -30.622 281.067 1.00 107.86 ?  47  ALA C O   1 
ATOM   7631  C CB  . ALA C 1 53  ? 139.751 -29.099 278.724 1.00 95.85  ?  47  ALA C CB  1 
ATOM   7632  N N   . LYS C 1 54  ? 136.835 -30.298 280.478 1.00 108.62 ?  48  LYS C N   1 
ATOM   7633  C CA  . LYS C 1 54  ? 136.301 -31.386 281.287 1.00 101.28 ?  48  LYS C CA  1 
ATOM   7634  C C   . LYS C 1 54  ? 135.623 -32.399 280.377 1.00 94.64  ?  48  LYS C C   1 
ATOM   7635  O O   . LYS C 1 54  ? 134.771 -32.034 279.560 1.00 93.82  ?  48  LYS C O   1 
ATOM   7636  C CB  . LYS C 1 54  ? 135.311 -30.860 282.332 1.00 101.60 ?  48  LYS C CB  1 
ATOM   7637  C CG  . LYS C 1 54  ? 135.443 -31.505 283.708 1.00 100.07 ?  48  LYS C CG  1 
ATOM   7638  C CD  . LYS C 1 54  ? 135.100 -32.987 283.680 1.00 94.33  ?  48  LYS C CD  1 
ATOM   7639  C CE  . LYS C 1 54  ? 133.617 -33.213 283.428 1.00 94.11  ?  48  LYS C CE  1 
ATOM   7640  N NZ  . LYS C 1 54  ? 132.781 -32.718 284.556 1.00 100.06 1  48  LYS C NZ  1 
ATOM   7641  N N   . GLY C 1 55  ? 136.000 -33.667 280.523 1.00 91.05  ?  49  GLY C N   1 
ATOM   7642  C CA  . GLY C 1 55  ? 135.399 -34.721 279.730 1.00 92.13  ?  49  GLY C CA  1 
ATOM   7643  C C   . GLY C 1 55  ? 135.960 -34.863 278.334 1.00 94.48  ?  49  GLY C C   1 
ATOM   7644  O O   . GLY C 1 55  ? 135.233 -35.266 277.421 1.00 86.76  ?  49  GLY C O   1 
ATOM   7645  N N   . THR C 1 56  ? 137.235 -34.545 278.140 1.00 99.33  ?  50  THR C N   1 
ATOM   7646  C CA  . THR C 1 56  ? 137.883 -34.619 276.840 1.00 90.95  ?  50  THR C CA  1 
ATOM   7647  C C   . THR C 1 56  ? 139.081 -35.559 276.906 1.00 80.29  ?  50  THR C C   1 
ATOM   7648  O O   . THR C 1 56  ? 139.464 -36.048 277.972 1.00 70.04  ?  50  THR C O   1 
ATOM   7649  C CB  . THR C 1 56  ? 138.323 -33.230 276.361 1.00 86.08  ?  50  THR C CB  1 
ATOM   7650  O OG1 . THR C 1 56  ? 139.597 -33.326 275.710 1.00 82.01  ?  50  THR C OG1 1 
ATOM   7651  C CG2 . THR C 1 56  ? 138.422 -32.267 277.533 1.00 88.35  ?  50  THR C CG2 1 
ATOM   7652  N N   . LYS C 1 57  ? 139.675 -35.805 275.740 1.00 73.30  ?  51  LYS C N   1 
ATOM   7653  C CA  . LYS C 1 57  ? 140.800 -36.719 275.610 1.00 67.57  ?  51  LYS C CA  1 
ATOM   7654  C C   . LYS C 1 57  ? 142.142 -36.052 275.894 1.00 82.39  ?  51  LYS C C   1 
ATOM   7655  O O   . LYS C 1 57  ? 143.187 -36.667 275.659 1.00 81.81  ?  51  LYS C O   1 
ATOM   7656  C CB  . LYS C 1 57  ? 140.813 -37.338 274.210 1.00 68.07  ?  51  LYS C CB  1 
ATOM   7657  C CG  . LYS C 1 57  ? 141.123 -38.826 274.193 1.00 79.31  ?  51  LYS C CG  1 
ATOM   7658  C CD  . LYS C 1 57  ? 139.997 -39.626 274.831 1.00 80.70  ?  51  LYS C CD  1 
ATOM   7659  C CE  . LYS C 1 57  ? 140.358 -41.097 274.950 1.00 67.16  ?  51  LYS C CE  1 
ATOM   7660  N NZ  . LYS C 1 57  ? 141.507 -41.309 275.873 1.00 75.95  1  51  LYS C NZ  1 
ATOM   7661  N N   . VAL C 1 58  ? 142.137 -34.814 276.392 1.00 82.69  ?  52  VAL C N   1 
ATOM   7662  C CA  . VAL C 1 58  ? 143.382 -34.121 276.701 1.00 72.24  ?  52  VAL C CA  1 
ATOM   7663  C C   . VAL C 1 58  ? 144.062 -34.787 277.888 1.00 66.42  ?  52  VAL C C   1 
ATOM   7664  O O   . VAL C 1 58  ? 143.414 -35.144 278.882 1.00 78.07  ?  52  VAL C O   1 
ATOM   7665  C CB  . VAL C 1 58  ? 143.113 -32.632 276.982 1.00 66.58  ?  52  VAL C CB  1 
ATOM   7666  C CG1 . VAL C 1 58  ? 144.368 -31.945 277.501 1.00 67.69  ?  52  VAL C CG1 1 
ATOM   7667  C CG2 . VAL C 1 58  ? 142.621 -31.941 275.733 1.00 66.71  ?  52  VAL C CG2 1 
ATOM   7668  N N   . VAL C 1 59  ? 145.375 -34.965 277.787 1.00 69.02  ?  53  VAL C N   1 
ATOM   7669  C CA  . VAL C 1 59  ? 146.178 -35.459 278.894 1.00 81.28  ?  53  VAL C CA  1 
ATOM   7670  C C   . VAL C 1 59  ? 147.065 -34.321 279.387 1.00 80.19  ?  53  VAL C C   1 
ATOM   7671  O O   . VAL C 1 59  ? 147.336 -33.350 278.674 1.00 80.14  ?  53  VAL C O   1 
ATOM   7672  C CB  . VAL C 1 59  ? 147.017 -36.696 278.500 1.00 75.81  ?  53  VAL C CB  1 
ATOM   7673  C CG1 . VAL C 1 59  ? 148.423 -36.292 278.070 1.00 70.47  ?  53  VAL C CG1 1 
ATOM   7674  C CG2 . VAL C 1 59  ? 147.057 -37.700 279.643 1.00 76.92  ?  53  VAL C CG2 1 
ATOM   7675  N N   . GLY C 1 60  ? 147.505 -34.440 280.636 1.00 80.92  ?  54  GLY C N   1 
ATOM   7676  C CA  . GLY C 1 60  ? 148.350 -33.422 281.228 1.00 81.17  ?  54  GLY C CA  1 
ATOM   7677  C C   . GLY C 1 60  ? 149.681 -33.958 281.710 1.00 85.10  ?  54  GLY C C   1 
ATOM   7678  O O   . GLY C 1 60  ? 149.834 -35.166 281.915 1.00 88.78  ?  54  GLY C O   1 
ATOM   7679  N N   . ALA C 1 61  ? 150.653 -33.068 281.894 1.00 81.66  ?  55  ALA C N   1 
ATOM   7680  C CA  . ALA C 1 61  ? 151.977 -33.452 282.357 1.00 84.89  ?  55  ALA C CA  1 
ATOM   7681  C C   . ALA C 1 61  ? 152.460 -32.452 283.395 1.00 83.57  ?  55  ALA C C   1 
ATOM   7682  O O   . ALA C 1 61  ? 152.247 -31.245 283.252 1.00 75.18  ?  55  ALA C O   1 
ATOM   7683  C CB  . ALA C 1 61  ? 152.977 -33.532 281.198 1.00 77.73  ?  55  ALA C CB  1 
ATOM   7684  N N   . GLN C 1 62  ? 153.109 -32.964 284.438 1.00 91.91  ?  56  GLN C N   1 
ATOM   7685  C CA  . GLN C 1 62  ? 153.644 -32.143 285.514 1.00 91.30  ?  56  GLN C CA  1 
ATOM   7686  C C   . GLN C 1 62  ? 155.143 -31.910 285.378 1.00 85.22  ?  56  GLN C C   1 
ATOM   7687  O O   . GLN C 1 62  ? 155.775 -31.428 286.323 1.00 85.65  ?  56  GLN C O   1 
ATOM   7688  C CB  . GLN C 1 62  ? 153.331 -32.789 286.867 1.00 86.84  ?  56  GLN C CB  1 
ATOM   7689  C CG  . GLN C 1 62  ? 152.667 -31.863 287.881 1.00 87.42  ?  56  GLN C CG  1 
ATOM   7690  C CD  . GLN C 1 62  ? 151.211 -31.560 287.554 1.00 100.27 ?  56  GLN C CD  1 
ATOM   7691  O OE1 . GLN C 1 62  ? 150.698 -31.950 286.504 1.00 99.98  ?  56  GLN C OE1 1 
ATOM   7692  N NE2 . GLN C 1 62  ? 150.538 -30.863 288.462 1.00 101.73 ?  56  GLN C NE2 1 
ATOM   7693  N N   . SER C 1 63  ? 155.724 -32.238 284.226 1.00 80.04  ?  57  SER C N   1 
ATOM   7694  C CA  . SER C 1 63  ? 157.153 -32.078 284.012 1.00 78.32  ?  57  SER C CA  1 
ATOM   7695  C C   . SER C 1 63  ? 157.421 -31.922 282.523 1.00 81.35  ?  57  SER C C   1 
ATOM   7696  O O   . SER C 1 63  ? 156.599 -32.291 281.680 1.00 75.04  ?  57  SER C O   1 
ATOM   7697  C CB  . SER C 1 63  ? 157.943 -33.266 284.576 1.00 73.67  ?  57  SER C CB  1 
ATOM   7698  O OG  . SER C 1 63  ? 159.316 -33.175 284.238 1.00 70.25  ?  57  SER C OG  1 
ATOM   7699  N N   . LEU C 1 64  ? 158.590 -31.359 282.209 1.00 82.16  ?  58  LEU C N   1 
ATOM   7700  C CA  . LEU C 1 64  ? 158.990 -31.206 280.815 1.00 74.55  ?  58  LEU C CA  1 
ATOM   7701  C C   . LEU C 1 64  ? 159.451 -32.535 280.227 1.00 68.28  ?  58  LEU C C   1 
ATOM   7702  O O   . LEU C 1 64  ? 159.149 -32.843 279.069 1.00 66.23  ?  58  LEU C O   1 
ATOM   7703  C CB  . LEU C 1 64  ? 160.092 -30.151 280.701 1.00 78.94  ?  58  LEU C CB  1 
ATOM   7704  C CG  . LEU C 1 64  ? 160.179 -29.305 279.425 1.00 68.71  ?  58  LEU C CG  1 
ATOM   7705  C CD1 . LEU C 1 64  ? 161.504 -29.533 278.713 1.00 53.93  ?  58  LEU C CD1 1 
ATOM   7706  C CD2 . LEU C 1 64  ? 159.006 -29.570 278.488 1.00 67.18  ?  58  LEU C CD2 1 
ATOM   7707  N N   . LYS C 1 65  ? 160.182 -33.331 281.012 1.00 72.08  ?  59  LYS C N   1 
ATOM   7708  C CA  . LYS C 1 65  ? 160.551 -34.672 280.573 1.00 74.20  ?  59  LYS C CA  1 
ATOM   7709  C C   . LYS C 1 65  ? 159.332 -35.581 280.481 1.00 73.61  ?  59  LYS C C   1 
ATOM   7710  O O   . LYS C 1 65  ? 159.295 -36.487 279.640 1.00 66.59  ?  59  LYS C O   1 
ATOM   7711  C CB  . LYS C 1 65  ? 161.589 -35.265 281.528 1.00 67.64  ?  59  LYS C CB  1 
ATOM   7712  C CG  . LYS C 1 65  ? 162.081 -36.654 281.154 1.00 63.22  ?  59  LYS C CG  1 
ATOM   7713  C CD  . LYS C 1 65  ? 162.974 -37.228 282.244 1.00 55.37  ?  59  LYS C CD  1 
ATOM   7714  C CE  . LYS C 1 65  ? 163.502 -38.602 281.865 1.00 59.62  ?  59  LYS C CE  1 
ATOM   7715  N NZ  . LYS C 1 65  ? 164.357 -38.550 280.647 1.00 67.55  1  59  LYS C NZ  1 
ATOM   7716  N N   . GLU C 1 66  ? 158.327 -35.351 281.329 1.00 73.80  ?  60  GLU C N   1 
ATOM   7717  C CA  . GLU C 1 66  ? 157.118 -36.166 281.291 1.00 74.43  ?  60  GLU C CA  1 
ATOM   7718  C C   . GLU C 1 66  ? 156.234 -35.809 280.101 1.00 79.74  ?  60  GLU C C   1 
ATOM   7719  O O   . GLU C 1 66  ? 155.576 -36.690 279.536 1.00 85.96  ?  60  GLU C O   1 
ATOM   7720  C CB  . GLU C 1 66  ? 156.345 -36.009 282.602 1.00 80.98  ?  60  GLU C CB  1 
ATOM   7721  C CG  . GLU C 1 66  ? 155.039 -36.783 282.662 1.00 84.00  ?  60  GLU C CG  1 
ATOM   7722  C CD  . GLU C 1 66  ? 154.288 -36.555 283.960 1.00 91.68  ?  60  GLU C CD  1 
ATOM   7723  O OE1 . GLU C 1 66  ? 154.922 -36.132 284.950 1.00 90.99  ?  60  GLU C OE1 1 
ATOM   7724  O OE2 . GLU C 1 66  ? 153.062 -36.795 283.987 1.00 91.99  -1 60  GLU C OE2 1 
ATOM   7725  N N   . MET C 1 67  ? 156.207 -34.533 279.705 1.00 76.61  ?  61  MET C N   1 
ATOM   7726  C CA  . MET C 1 67  ? 155.406 -34.133 278.552 1.00 69.35  ?  61  MET C CA  1 
ATOM   7727  C C   . MET C 1 67  ? 155.909 -34.795 277.275 1.00 65.44  ?  61  MET C C   1 
ATOM   7728  O O   . MET C 1 67  ? 155.115 -35.308 276.478 1.00 71.00  ?  61  MET C O   1 
ATOM   7729  C CB  . MET C 1 67  ? 155.419 -32.613 278.400 1.00 71.31  ?  61  MET C CB  1 
ATOM   7730  C CG  . MET C 1 67  ? 154.583 -32.115 277.235 1.00 77.00  ?  61  MET C CG  1 
ATOM   7731  S SD  . MET C 1 67  ? 155.124 -30.518 276.601 1.00 74.29  ?  61  MET C SD  1 
ATOM   7732  C CE  . MET C 1 67  ? 156.732 -30.947 275.944 1.00 58.76  ?  61  MET C CE  1 
ATOM   7733  N N   . VAL C 1 68  ? 157.227 -34.792 277.066 1.00 69.32  ?  62  VAL C N   1 
ATOM   7734  C CA  . VAL C 1 68  ? 157.816 -35.443 275.903 1.00 69.68  ?  62  VAL C CA  1 
ATOM   7735  C C   . VAL C 1 68  ? 157.708 -36.962 275.991 1.00 68.03  ?  62  VAL C C   1 
ATOM   7736  O O   . VAL C 1 68  ? 157.629 -37.636 274.958 1.00 67.99  ?  62  VAL C O   1 
ATOM   7737  C CB  . VAL C 1 68  ? 159.275 -34.972 275.753 1.00 68.47  ?  62  VAL C CB  1 
ATOM   7738  C CG1 . VAL C 1 68  ? 159.991 -35.722 274.642 1.00 63.98  ?  62  VAL C CG1 1 
ATOM   7739  C CG2 . VAL C 1 68  ? 159.299 -33.480 275.475 1.00 63.05  ?  62  VAL C CG2 1 
ATOM   7740  N N   . SER C 1 69  ? 157.665 -37.523 277.203 1.00 76.87  ?  63  SER C N   1 
ATOM   7741  C CA  . SER C 1 69  ? 157.472 -38.954 277.408 1.00 74.74  ?  63  SER C CA  1 
ATOM   7742  C C   . SER C 1 69  ? 156.030 -39.404 277.166 1.00 73.72  ?  63  SER C C   1 
ATOM   7743  O O   . SER C 1 69  ? 155.618 -40.437 277.712 1.00 85.55  ?  63  SER C O   1 
ATOM   7744  C CB  . SER C 1 69  ? 157.911 -39.343 278.821 1.00 75.81  ?  63  SER C CB  1 
ATOM   7745  O OG  . SER C 1 69  ? 159.258 -38.967 279.051 1.00 81.49  ?  63  SER C OG  1 
ATOM   7746  N N   . LYS C 1 70  ? 155.251 -38.650 276.381 1.00 59.91  ?  64  LYS C N   1 
ATOM   7747  C CA  . LYS C 1 70  ? 153.884 -39.028 276.049 1.00 55.40  ?  64  LYS C CA  1 
ATOM   7748  C C   . LYS C 1 70  ? 153.547 -38.837 274.578 1.00 60.09  ?  64  LYS C C   1 
ATOM   7749  O O   . LYS C 1 70  ? 152.434 -39.183 274.172 1.00 62.86  ?  64  LYS C O   1 
ATOM   7750  C CB  . LYS C 1 70  ? 152.881 -38.228 276.899 1.00 63.09  ?  64  LYS C CB  1 
ATOM   7751  C CG  . LYS C 1 70  ? 152.972 -38.483 278.394 1.00 70.83  ?  64  LYS C CG  1 
ATOM   7752  C CD  . LYS C 1 70  ? 151.918 -37.695 279.153 1.00 78.59  ?  64  LYS C CD  1 
ATOM   7753  C CE  . LYS C 1 70  ? 151.979 -37.984 280.644 1.00 83.72  ?  64  LYS C CE  1 
ATOM   7754  N NZ  . LYS C 1 70  ? 150.914 -37.257 281.389 1.00 82.74  1  64  LYS C NZ  1 
ATOM   7755  N N   . LEU C 1 71  ? 154.461 -38.310 273.771 1.00 59.41  ?  65  LEU C N   1 
ATOM   7756  C CA  . LEU C 1 71  ? 154.197 -38.000 272.375 1.00 60.94  ?  65  LEU C CA  1 
ATOM   7757  C C   . LEU C 1 71  ? 154.666 -39.137 271.478 1.00 58.83  ?  65  LEU C C   1 
ATOM   7758  O O   . LEU C 1 71  ? 155.722 -39.733 271.710 1.00 58.20  ?  65  LEU C O   1 
ATOM   7759  C CB  . LEU C 1 71  ? 154.896 -36.702 271.971 1.00 58.82  ?  65  LEU C CB  1 
ATOM   7760  C CG  . LEU C 1 71  ? 154.611 -35.485 272.849 1.00 61.32  ?  65  LEU C CG  1 
ATOM   7761  C CD1 . LEU C 1 71  ? 155.457 -34.304 272.407 1.00 59.95  ?  65  LEU C CD1 1 
ATOM   7762  C CD2 . LEU C 1 71  ? 153.132 -35.142 272.809 1.00 57.76  ?  65  LEU C CD2 1 
ATOM   7763  N N   . LYS C 1 72  ? 153.875 -39.427 270.449 1.00 52.06  ?  66  LYS C N   1 
ATOM   7764  C CA  . LYS C 1 72  ? 154.245 -40.434 269.467 1.00 57.26  ?  66  LYS C CA  1 
ATOM   7765  C C   . LYS C 1 72  ? 155.273 -39.868 268.496 1.00 53.47  ?  66  LYS C C   1 
ATOM   7766  O O   . LYS C 1 72  ? 155.191 -38.707 268.085 1.00 52.78  ?  66  LYS C O   1 
ATOM   7767  C CB  . LYS C 1 72  ? 153.011 -40.922 268.709 1.00 60.49  ?  66  LYS C CB  1 
ATOM   7768  C CG  . LYS C 1 72  ? 152.016 -41.675 269.579 1.00 65.19  ?  66  LYS C CG  1 
ATOM   7769  C CD  . LYS C 1 72  ? 150.807 -42.141 268.784 1.00 60.47  ?  66  LYS C CD  1 
ATOM   7770  C CE  . LYS C 1 72  ? 150.041 -40.964 268.206 1.00 66.50  ?  66  LYS C CE  1 
ATOM   7771  N NZ  . LYS C 1 72  ? 148.769 -41.391 267.557 1.00 59.64  1  66  LYS C NZ  1 
ATOM   7772  N N   . LYS C 1 73  ? 156.247 -40.700 268.132 1.00 52.27  ?  67  LYS C N   1 
ATOM   7773  C CA  . LYS C 1 73  ? 157.344 -40.251 267.286 1.00 49.85  ?  67  LYS C CA  1 
ATOM   7774  C C   . LYS C 1 73  ? 156.914 -40.225 265.819 1.00 55.30  ?  67  LYS C C   1 
ATOM   7775  O O   . LYS C 1 73  ? 156.206 -41.128 265.364 1.00 59.97  ?  67  LYS C O   1 
ATOM   7776  C CB  . LYS C 1 73  ? 158.559 -41.159 267.460 1.00 49.54  ?  67  LYS C CB  1 
ATOM   7777  C CG  . LYS C 1 73  ? 159.190 -41.074 268.841 1.00 53.09  ?  67  LYS C CG  1 
ATOM   7778  C CD  . LYS C 1 73  ? 160.361 -42.030 268.980 1.00 52.48  ?  67  LYS C CD  1 
ATOM   7779  C CE  . LYS C 1 73  ? 161.386 -41.811 267.879 1.00 62.66  ?  67  LYS C CE  1 
ATOM   7780  N NZ  . LYS C 1 73  ? 161.868 -40.402 267.838 1.00 65.46  1  67  LYS C NZ  1 
ATOM   7781  N N   . PRO C 1 74  ? 157.325 -39.199 265.053 1.00 54.73  ?  68  PRO C N   1 
ATOM   7782  C CA  . PRO C 1 74  ? 158.161 -38.078 265.502 1.00 51.07  ?  68  PRO C CA  1 
ATOM   7783  C C   . PRO C 1 74  ? 157.415 -37.092 266.401 1.00 50.15  ?  68  PRO C C   1 
ATOM   7784  O O   . PRO C 1 74  ? 156.327 -36.632 266.056 1.00 60.42  ?  68  PRO C O   1 
ATOM   7785  C CB  . PRO C 1 74  ? 158.578 -37.410 264.191 1.00 50.50  ?  68  PRO C CB  1 
ATOM   7786  C CG  . PRO C 1 74  ? 157.472 -37.721 263.252 1.00 50.48  ?  68  PRO C CG  1 
ATOM   7787  C CD  . PRO C 1 74  ? 157.001 -39.100 263.619 1.00 57.27  ?  68  PRO C CD  1 
ATOM   7788  N N   . ARG C 1 75  ? 158.008 -36.784 267.550 1.00 47.00  ?  69  ARG C N   1 
ATOM   7789  C CA  . ARG C 1 75  ? 157.345 -35.950 268.543 1.00 48.02  ?  69  ARG C CA  1 
ATOM   7790  C C   . ARG C 1 75  ? 157.256 -34.508 268.061 1.00 49.45  ?  69  ARG C C   1 
ATOM   7791  O O   . ARG C 1 75  ? 158.250 -33.926 267.615 1.00 54.31  ?  69  ARG C O   1 
ATOM   7792  C CB  . ARG C 1 75  ? 158.092 -36.029 269.872 1.00 50.92  ?  69  ARG C CB  1 
ATOM   7793  C CG  . ARG C 1 75  ? 158.040 -37.409 270.506 1.00 61.13  ?  69  ARG C CG  1 
ATOM   7794  C CD  . ARG C 1 75  ? 158.861 -37.480 271.776 1.00 58.76  ?  69  ARG C CD  1 
ATOM   7795  N NE  . ARG C 1 75  ? 160.268 -37.751 271.501 1.00 65.83  ?  69  ARG C NE  1 
ATOM   7796  C CZ  . ARG C 1 75  ? 160.793 -38.970 271.446 1.00 66.05  ?  69  ARG C CZ  1 
ATOM   7797  N NH1 . ARG C 1 75  ? 160.026 -40.033 271.650 1.00 65.25  1  69  ARG C NH1 1 
ATOM   7798  N NH2 . ARG C 1 75  ? 162.084 -39.129 271.189 1.00 66.97  ?  69  ARG C NH2 1 
ATOM   7799  N N   . ARG C 1 76  ? 156.059 -33.933 268.152 1.00 46.48  ?  70  ARG C N   1 
ATOM   7800  C CA  . ARG C 1 76  ? 155.796 -32.575 267.697 1.00 44.80  ?  70  ARG C CA  1 
ATOM   7801  C C   . ARG C 1 76  ? 155.193 -31.774 268.842 1.00 48.76  ?  70  ARG C C   1 
ATOM   7802  O O   . ARG C 1 76  ? 154.238 -32.222 269.484 1.00 44.43  ?  70  ARG C O   1 
ATOM   7803  C CB  . ARG C 1 76  ? 154.866 -32.577 266.478 1.00 45.32  ?  70  ARG C CB  1 
ATOM   7804  C CG  . ARG C 1 76  ? 153.604 -33.404 266.655 1.00 49.63  ?  70  ARG C CG  1 
ATOM   7805  C CD  . ARG C 1 76  ? 152.932 -33.682 265.323 1.00 54.15  ?  70  ARG C CD  1 
ATOM   7806  N NE  . ARG C 1 76  ? 153.432 -34.910 264.712 1.00 55.06  ?  70  ARG C NE  1 
ATOM   7807  C CZ  . ARG C 1 76  ? 152.821 -36.087 264.800 1.00 59.29  ?  70  ARG C CZ  1 
ATOM   7808  N NH1 . ARG C 1 76  ? 151.681 -36.197 265.468 1.00 50.52  1  70  ARG C NH1 1 
ATOM   7809  N NH2 . ARG C 1 76  ? 153.347 -37.155 264.215 1.00 57.06  ?  70  ARG C NH2 1 
ATOM   7810  N N   . ILE C 1 77  ? 155.762 -30.598 269.103 1.00 55.11  ?  71  ILE C N   1 
ATOM   7811  C CA  . ILE C 1 77  ? 155.374 -29.759 270.232 1.00 50.37  ?  71  ILE C CA  1 
ATOM   7812  C C   . ILE C 1 77  ? 155.060 -28.362 269.715 1.00 48.50  ?  71  ILE C C   1 
ATOM   7813  O O   . ILE C 1 77  ? 155.814 -27.809 268.907 1.00 51.55  ?  71  ILE C O   1 
ATOM   7814  C CB  . ILE C 1 77  ? 156.480 -29.703 271.304 1.00 50.10  ?  71  ILE C CB  1 
ATOM   7815  C CG1 . ILE C 1 77  ? 156.982 -31.113 271.623 1.00 47.86  ?  71  ILE C CG1 1 
ATOM   7816  C CG2 . ILE C 1 77  ? 155.968 -29.019 272.563 1.00 49.65  ?  71  ILE C CG2 1 
ATOM   7817  C CD1 . ILE C 1 77  ? 158.163 -31.152 272.561 1.00 46.79  ?  71  ILE C CD1 1 
ATOM   7818  N N   . ILE C 1 78  ? 153.951 -27.793 270.183 1.00 45.56  ?  72  ILE C N   1 
ATOM   7819  C CA  . ILE C 1 78  ? 153.525 -26.451 269.799 1.00 47.33  ?  72  ILE C CA  1 
ATOM   7820  C C   . ILE C 1 78  ? 153.912 -25.482 270.907 1.00 53.60  ?  72  ILE C C   1 
ATOM   7821  O O   . ILE C 1 78  ? 153.703 -25.768 272.093 1.00 57.32  ?  72  ILE C O   1 
ATOM   7822  C CB  . ILE C 1 78  ? 152.011 -26.401 269.530 1.00 45.40  ?  72  ILE C CB  1 
ATOM   7823  C CG1 . ILE C 1 78  ? 151.634 -27.352 268.394 1.00 48.63  ?  72  ILE C CG1 1 
ATOM   7824  C CG2 . ILE C 1 78  ? 151.569 -24.984 269.195 1.00 42.96  ?  72  ILE C CG2 1 
ATOM   7825  C CD1 . ILE C 1 78  ? 150.168 -27.294 268.018 1.00 49.65  ?  72  ILE C CD1 1 
ATOM   7826  N N   . LEU C 1 79  ? 154.475 -24.339 270.525 1.00 52.66  ?  73  LEU C N   1 
ATOM   7827  C CA  . LEU C 1 79  ? 154.839 -23.286 271.462 1.00 51.60  ?  73  LEU C CA  1 
ATOM   7828  C C   . LEU C 1 79  ? 153.891 -22.107 271.293 1.00 52.17  ?  73  LEU C C   1 
ATOM   7829  O O   . LEU C 1 79  ? 153.708 -21.606 270.178 1.00 53.16  ?  73  LEU C O   1 
ATOM   7830  C CB  . LEU C 1 79  ? 156.286 -22.834 271.252 1.00 48.88  ?  73  LEU C CB  1 
ATOM   7831  C CG  . LEU C 1 79  ? 157.379 -23.853 271.580 1.00 51.72  ?  73  LEU C CG  1 
ATOM   7832  C CD1 . LEU C 1 79  ? 158.757 -23.254 271.344 1.00 48.84  ?  73  LEU C CD1 1 
ATOM   7833  C CD2 . LEU C 1 79  ? 157.241 -24.345 273.012 1.00 53.77  ?  73  LEU C CD2 1 
ATOM   7834  N N   . LEU C 1 80  ? 153.287 -21.668 272.405 1.00 50.72  ?  74  LEU C N   1 
ATOM   7835  C CA  . LEU C 1 80  ? 152.389 -20.519 272.429 1.00 55.96  ?  74  LEU C CA  1 
ATOM   7836  C C   . LEU C 1 80  ? 152.685 -19.712 273.696 1.00 54.92  ?  74  LEU C C   1 
ATOM   7837  O O   . LEU C 1 80  ? 151.869 -19.598 274.609 1.00 59.91  ?  74  LEU C O   1 
ATOM   7838  C CB  . LEU C 1 80  ? 150.923 -20.949 272.367 1.00 53.55  ?  74  LEU C CB  1 
ATOM   7839  C CG  . LEU C 1 80  ? 150.345 -21.147 270.967 1.00 54.98  ?  74  LEU C CG  1 
ATOM   7840  C CD1 . LEU C 1 80  ? 149.069 -21.959 271.042 1.00 70.00  ?  74  LEU C CD1 1 
ATOM   7841  C CD2 . LEU C 1 80  ? 150.085 -19.801 270.309 1.00 50.21  ?  74  LEU C CD2 1 
ATOM   7842  N N   . VAL C 1 81  ? 153.886 -19.138 273.750 1.00 53.33  ?  75  VAL C N   1 
ATOM   7843  C CA  . VAL C 1 81  ? 154.318 -18.356 274.901 1.00 55.44  ?  75  VAL C CA  1 
ATOM   7844  C C   . VAL C 1 81  ? 154.539 -16.911 274.478 1.00 59.73  ?  75  VAL C C   1 
ATOM   7845  O O   . VAL C 1 81  ? 154.079 -16.485 273.413 1.00 61.62  ?  75  VAL C O   1 
ATOM   7846  C CB  . VAL C 1 81  ? 155.590 -18.950 275.530 1.00 50.88  ?  75  VAL C CB  1 
ATOM   7847  C CG1 . VAL C 1 81  ? 155.287 -20.301 276.156 1.00 46.41  ?  75  VAL C CG1 1 
ATOM   7848  C CG2 . VAL C 1 81  ? 156.687 -19.079 274.483 1.00 50.25  ?  75  VAL C CG2 1 
ATOM   7849  N N   . LYS C 1 82  ? 155.243 -16.149 275.311 1.00 64.11  ?  76  LYS C N   1 
ATOM   7850  C CA  . LYS C 1 82  ? 155.513 -14.753 275.000 1.00 62.69  ?  76  LYS C CA  1 
ATOM   7851  C C   . LYS C 1 82  ? 156.555 -14.651 273.892 1.00 57.03  ?  76  LYS C C   1 
ATOM   7852  O O   . LYS C 1 82  ? 157.540 -15.394 273.871 1.00 58.57  ?  76  LYS C O   1 
ATOM   7853  C CB  . LYS C 1 82  ? 155.994 -14.018 276.250 1.00 56.33  ?  76  LYS C CB  1 
ATOM   7854  C CG  . LYS C 1 82  ? 156.036 -12.506 276.113 1.00 61.77  ?  76  LYS C CG  1 
ATOM   7855  C CD  . LYS C 1 82  ? 156.500 -11.854 277.406 1.00 65.92  ?  76  LYS C CD  1 
ATOM   7856  C CE  . LYS C 1 82  ? 156.380 -10.341 277.339 1.00 54.50  ?  76  LYS C CE  1 
ATOM   7857  N NZ  . LYS C 1 82  ? 154.966 -9.910  277.168 1.00 62.43  1  76  LYS C NZ  1 
ATOM   7858  N N   . ALA C 1 83  ? 156.329 -13.726 272.963 1.00 52.16  ?  77  ALA C N   1 
ATOM   7859  C CA  . ALA C 1 83  ? 157.250 -13.543 271.850 1.00 50.39  ?  77  ALA C CA  1 
ATOM   7860  C C   . ALA C 1 83  ? 158.554 -12.926 272.340 1.00 45.41  ?  77  ALA C C   1 
ATOM   7861  O O   . ALA C 1 83  ? 158.546 -11.934 273.076 1.00 55.23  ?  77  ALA C O   1 
ATOM   7862  C CB  . ALA C 1 83  ? 156.616 -12.664 270.774 1.00 47.28  ?  77  ALA C CB  1 
ATOM   7863  N N   . GLY C 1 84  ? 159.674 -13.517 271.934 1.00 39.04  ?  78  GLY C N   1 
ATOM   7864  C CA  . GLY C 1 84  ? 160.975 -13.009 272.319 1.00 43.12  ?  78  GLY C CA  1 
ATOM   7865  C C   . GLY C 1 84  ? 161.886 -14.062 272.914 1.00 46.76  ?  78  GLY C C   1 
ATOM   7866  O O   . GLY C 1 84  ? 162.075 -15.134 272.330 1.00 46.81  ?  78  GLY C O   1 
ATOM   7867  N N   . GLN C 1 85  ? 162.458 -13.764 274.083 1.00 50.41  ?  79  GLN C N   1 
ATOM   7868  C CA  . GLN C 1 85  ? 163.369 -14.706 274.723 1.00 50.40  ?  79  GLN C CA  1 
ATOM   7869  C C   . GLN C 1 85  ? 162.635 -15.930 275.258 1.00 51.98  ?  79  GLN C C   1 
ATOM   7870  O O   . GLN C 1 85  ? 163.238 -17.001 275.390 1.00 49.76  ?  79  GLN C O   1 
ATOM   7871  C CB  . GLN C 1 85  ? 164.133 -14.008 275.852 1.00 49.41  ?  79  GLN C CB  1 
ATOM   7872  C CG  . GLN C 1 85  ? 165.288 -14.815 276.428 1.00 49.27  ?  79  GLN C CG  1 
ATOM   7873  C CD  . GLN C 1 85  ? 166.424 -14.998 275.440 1.00 57.73  ?  79  GLN C CD  1 
ATOM   7874  O OE1 . GLN C 1 85  ? 166.697 -14.120 274.622 1.00 63.32  ?  79  GLN C OE1 1 
ATOM   7875  N NE2 . GLN C 1 85  ? 167.088 -16.146 275.508 1.00 51.88  ?  79  GLN C NE2 1 
ATOM   7876  N N   . ALA C 1 86  ? 161.340 -15.796 275.561 1.00 49.62  ?  80  ALA C N   1 
ATOM   7877  C CA  . ALA C 1 86  ? 160.588 -16.914 276.125 1.00 49.03  ?  80  ALA C CA  1 
ATOM   7878  C C   . ALA C 1 86  ? 160.538 -18.093 275.161 1.00 54.78  ?  80  ALA C C   1 
ATOM   7879  O O   . ALA C 1 86  ? 160.566 -19.254 275.588 1.00 52.38  ?  80  ALA C O   1 
ATOM   7880  C CB  . ALA C 1 86  ? 159.175 -16.463 276.496 1.00 41.64  ?  80  ALA C CB  1 
ATOM   7881  N N   . VAL C 1 87  ? 160.462 -17.818 273.858 1.00 52.35  ?  81  VAL C N   1 
ATOM   7882  C CA  . VAL C 1 87  ? 160.491 -18.892 272.871 1.00 45.74  ?  81  VAL C CA  1 
ATOM   7883  C C   . VAL C 1 87  ? 161.850 -19.580 272.879 1.00 46.22  ?  81  VAL C C   1 
ATOM   7884  O O   . VAL C 1 87  ? 161.941 -20.812 272.918 1.00 43.64  ?  81  VAL C O   1 
ATOM   7885  C CB  . VAL C 1 87  ? 160.141 -18.350 271.474 1.00 44.21  ?  81  VAL C CB  1 
ATOM   7886  C CG1 . VAL C 1 87  ? 160.249 -19.455 270.432 1.00 37.24  ?  81  VAL C CG1 1 
ATOM   7887  C CG2 . VAL C 1 87  ? 158.746 -17.745 271.475 1.00 41.99  ?  81  VAL C CG2 1 
ATOM   7888  N N   . ASP C 1 88  ? 162.927 -18.790 272.853 1.00 50.22  ?  82  ASP C N   1 
ATOM   7889  C CA  . ASP C 1 88  ? 164.269 -19.364 272.870 1.00 49.29  ?  82  ASP C CA  1 
ATOM   7890  C C   . ASP C 1 88  ? 164.554 -20.092 274.176 1.00 50.19  ?  82  ASP C C   1 
ATOM   7891  O O   . ASP C 1 88  ? 165.314 -21.066 274.187 1.00 47.10  ?  82  ASP C O   1 
ATOM   7892  C CB  . ASP C 1 88  ? 165.309 -18.268 272.634 1.00 50.43  ?  82  ASP C CB  1 
ATOM   7893  C CG  . ASP C 1 88  ? 165.233 -17.684 271.237 1.00 59.56  ?  82  ASP C CG  1 
ATOM   7894  O OD1 . ASP C 1 88  ? 165.250 -18.465 270.263 1.00 60.68  ?  82  ASP C OD1 1 
ATOM   7895  O OD2 . ASP C 1 88  ? 165.149 -16.444 271.114 1.00 63.05  -1 82  ASP C OD2 1 
ATOM   7896  N N   . ASP C 1 89  ? 163.956 -19.640 275.281 1.00 55.09  ?  83  ASP C N   1 
ATOM   7897  C CA  . ASP C 1 89  ? 164.159 -20.310 276.563 1.00 54.05  ?  83  ASP C CA  1 
ATOM   7898  C C   . ASP C 1 89  ? 163.646 -21.743 276.520 1.00 50.41  ?  83  ASP C C   1 
ATOM   7899  O O   . ASP C 1 89  ? 164.368 -22.684 276.868 1.00 50.61  ?  83  ASP C O   1 
ATOM   7900  C CB  . ASP C 1 89  ? 163.471 -19.527 277.682 1.00 58.90  ?  83  ASP C CB  1 
ATOM   7901  C CG  . ASP C 1 89  ? 164.174 -18.223 278.000 1.00 60.42  ?  83  ASP C CG  1 
ATOM   7902  O OD1 . ASP C 1 89  ? 165.228 -17.951 277.389 1.00 63.63  ?  83  ASP C OD1 1 
ATOM   7903  O OD2 . ASP C 1 89  ? 163.671 -17.471 278.861 1.00 57.76  -1 83  ASP C OD2 1 
ATOM   7904  N N   . PHE C 1 90  ? 162.396 -21.928 276.089 1.00 47.91  ?  84  PHE C N   1 
ATOM   7905  C CA  . PHE C 1 90  ? 161.830 -23.272 276.028 1.00 52.97  ?  84  PHE C CA  1 
ATOM   7906  C C   . PHE C 1 90  ? 162.569 -24.141 275.019 1.00 49.49  ?  84  PHE C C   1 
ATOM   7907  O O   . PHE C 1 90  ? 162.768 -25.337 275.253 1.00 47.15  ?  84  PHE C O   1 
ATOM   7908  C CB  . PHE C 1 90  ? 160.339 -23.203 275.697 1.00 48.81  ?  84  PHE C CB  1 
ATOM   7909  C CG  . PHE C 1 90  ? 159.452 -23.177 276.910 1.00 56.01  ?  84  PHE C CG  1 
ATOM   7910  C CD1 . PHE C 1 90  ? 158.308 -22.397 276.935 1.00 58.04  ?  84  PHE C CD1 1 
ATOM   7911  C CD2 . PHE C 1 90  ? 159.761 -23.941 278.024 1.00 53.46  ?  84  PHE C CD2 1 
ATOM   7912  C CE1 . PHE C 1 90  ? 157.494 -22.374 278.052 1.00 58.19  ?  84  PHE C CE1 1 
ATOM   7913  C CE2 . PHE C 1 90  ? 158.950 -23.923 279.142 1.00 53.51  ?  84  PHE C CE2 1 
ATOM   7914  C CZ  . PHE C 1 90  ? 157.814 -23.139 279.157 1.00 56.84  ?  84  PHE C CZ  1 
ATOM   7915  N N   . ILE C 1 91  ? 162.997 -23.557 273.898 1.00 47.23  ?  85  ILE C N   1 
ATOM   7916  C CA  . ILE C 1 91  ? 163.678 -24.340 272.869 1.00 42.02  ?  85  ILE C CA  1 
ATOM   7917  C C   . ILE C 1 91  ? 165.003 -24.882 273.394 1.00 50.36  ?  85  ILE C C   1 
ATOM   7918  O O   . ILE C 1 91  ? 165.344 -26.049 273.167 1.00 56.06  ?  85  ILE C O   1 
ATOM   7919  C CB  . ILE C 1 91  ? 163.872 -23.497 271.595 1.00 45.49  ?  85  ILE C CB  1 
ATOM   7920  C CG1 . ILE C 1 91  ? 162.520 -23.213 270.939 1.00 46.58  ?  85  ILE C CG1 1 
ATOM   7921  C CG2 . ILE C 1 91  ? 164.798 -24.204 270.616 1.00 40.97  ?  85  ILE C CG2 1 
ATOM   7922  C CD1 . ILE C 1 91  ? 162.613 -22.365 269.695 1.00 41.66  ?  85  ILE C CD1 1 
ATOM   7923  N N   . GLU C 1 92  ? 165.764 -24.052 274.113 1.00 56.24  ?  86  GLU C N   1 
ATOM   7924  C CA  . GLU C 1 92  ? 167.070 -24.487 274.601 1.00 60.27  ?  86  GLU C CA  1 
ATOM   7925  C C   . GLU C 1 92  ? 166.941 -25.609 275.625 1.00 54.00  ?  86  GLU C C   1 
ATOM   7926  O O   . GLU C 1 92  ? 167.761 -26.535 275.646 1.00 51.63  ?  86  GLU C O   1 
ATOM   7927  C CB  . GLU C 1 92  ? 167.833 -23.303 275.195 1.00 61.53  ?  86  GLU C CB  1 
ATOM   7928  C CG  . GLU C 1 92  ? 168.241 -22.252 274.176 1.00 66.08  ?  86  GLU C CG  1 
ATOM   7929  C CD  . GLU C 1 92  ? 169.063 -21.135 274.789 1.00 74.74  ?  86  GLU C CD  1 
ATOM   7930  O OE1 . GLU C 1 92  ? 169.811 -21.406 275.751 1.00 75.66  ?  86  GLU C OE1 1 
ATOM   7931  O OE2 . GLU C 1 92  ? 168.957 -19.985 274.312 1.00 67.89  -1 86  GLU C OE2 1 
ATOM   7932  N N   . LYS C 1 93  ? 165.921 -25.548 276.481 1.00 51.35  ?  87  LYS C N   1 
ATOM   7933  C CA  . LYS C 1 93  ? 165.714 -26.578 277.491 1.00 53.39  ?  87  LYS C CA  1 
ATOM   7934  C C   . LYS C 1 93  ? 164.961 -27.792 276.958 1.00 56.57  ?  87  LYS C C   1 
ATOM   7935  O O   . LYS C 1 93  ? 164.849 -28.792 277.674 1.00 54.80  ?  87  LYS C O   1 
ATOM   7936  C CB  . LYS C 1 93  ? 164.961 -25.990 278.689 1.00 52.44  ?  87  LYS C CB  1 
ATOM   7937  C CG  . LYS C 1 93  ? 163.540 -25.560 278.368 1.00 53.51  ?  87  LYS C CG  1 
ATOM   7938  C CD  . LYS C 1 93  ? 163.082 -24.407 279.249 1.00 52.63  ?  87  LYS C CD  1 
ATOM   7939  C CE  . LYS C 1 93  ? 162.924 -24.822 280.698 1.00 53.34  ?  87  LYS C CE  1 
ATOM   7940  N NZ  . LYS C 1 93  ? 162.386 -23.700 281.518 1.00 61.21  1  87  LYS C NZ  1 
ATOM   7941  N N   . LEU C 1 94  ? 164.455 -27.732 275.723 1.00 57.24  ?  88  LEU C N   1 
ATOM   7942  C CA  . LEU C 1 94  ? 163.665 -28.810 275.146 1.00 50.24  ?  88  LEU C CA  1 
ATOM   7943  C C   . LEU C 1 94  ? 164.403 -29.614 274.086 1.00 53.08  ?  88  LEU C C   1 
ATOM   7944  O O   . LEU C 1 94  ? 164.034 -30.765 273.842 1.00 59.43  ?  88  LEU C O   1 
ATOM   7945  C CB  . LEU C 1 94  ? 162.376 -28.244 274.530 1.00 48.16  ?  88  LEU C CB  1 
ATOM   7946  C CG  . LEU C 1 94  ? 161.278 -29.159 273.992 1.00 55.74  ?  88  LEU C CG  1 
ATOM   7947  C CD1 . LEU C 1 94  ? 160.606 -29.922 275.119 1.00 54.87  ?  88  LEU C CD1 1 
ATOM   7948  C CD2 . LEU C 1 94  ? 160.265 -28.329 273.222 1.00 61.85  ?  88  LEU C CD2 1 
ATOM   7949  N N   . VAL C 1 95  ? 165.427 -29.046 273.457 1.00 54.92  ?  89  VAL C N   1 
ATOM   7950  C CA  . VAL C 1 95  ? 166.167 -29.726 272.394 1.00 61.72  ?  89  VAL C CA  1 
ATOM   7951  C C   . VAL C 1 95  ? 166.924 -30.948 272.915 1.00 62.01  ?  89  VAL C C   1 
ATOM   7952  O O   . VAL C 1 95  ? 166.823 -32.020 272.299 1.00 56.16  ?  89  VAL C O   1 
ATOM   7953  C CB  . VAL C 1 95  ? 167.119 -28.753 271.678 1.00 58.67  ?  89  VAL C CB  1 
ATOM   7954  C CG1 . VAL C 1 95  ? 168.167 -29.516 270.883 1.00 47.08  ?  89  VAL C CG1 1 
ATOM   7955  C CG2 . VAL C 1 95  ? 166.333 -27.835 270.762 1.00 58.31  ?  89  VAL C CG2 1 
ATOM   7956  N N   . PRO C 1 96  ? 167.688 -30.861 274.016 1.00 68.29  ?  90  PRO C N   1 
ATOM   7957  C CA  . PRO C 1 96  ? 168.502 -32.025 274.414 1.00 72.20  ?  90  PRO C CA  1 
ATOM   7958  C C   . PRO C 1 96  ? 167.702 -33.288 274.689 1.00 76.93  ?  90  PRO C C   1 
ATOM   7959  O O   . PRO C 1 96  ? 168.212 -34.388 274.445 1.00 75.16  ?  90  PRO C O   1 
ATOM   7960  C CB  . PRO C 1 96  ? 169.222 -31.532 275.677 1.00 73.04  ?  90  PRO C CB  1 
ATOM   7961  C CG  . PRO C 1 96  ? 169.263 -30.062 275.531 1.00 74.55  ?  90  PRO C CG  1 
ATOM   7962  C CD  . PRO C 1 96  ? 167.959 -29.705 274.892 1.00 66.22  ?  90  PRO C CD  1 
ATOM   7963  N N   . LEU C 1 97  ? 166.472 -33.180 275.185 1.00 72.52  ?  91  LEU C N   1 
ATOM   7964  C CA  . LEU C 1 97  ? 165.674 -34.367 275.464 1.00 69.11  ?  91  LEU C CA  1 
ATOM   7965  C C   . LEU C 1 97  ? 164.898 -34.863 274.250 1.00 63.81  ?  91  LEU C C   1 
ATOM   7966  O O   . LEU C 1 97  ? 164.175 -35.859 274.360 1.00 61.32  ?  91  LEU C O   1 
ATOM   7967  C CB  . LEU C 1 97  ? 164.716 -34.105 276.635 1.00 61.34  ?  91  LEU C CB  1 
ATOM   7968  C CG  . LEU C 1 97  ? 163.877 -32.826 276.690 1.00 57.61  ?  91  LEU C CG  1 
ATOM   7969  C CD1 . LEU C 1 97  ? 162.727 -32.874 275.708 1.00 59.18  ?  91  LEU C CD1 1 
ATOM   7970  C CD2 . LEU C 1 97  ? 163.357 -32.606 278.101 1.00 52.43  ?  91  LEU C CD2 1 
ATOM   7971  N N   . LEU C 1 98  ? 165.025 -34.200 273.106 1.00 61.29  ?  92  LEU C N   1 
ATOM   7972  C CA  . LEU C 1 98  ? 164.400 -34.641 271.868 1.00 60.27  ?  92  LEU C CA  1 
ATOM   7973  C C   . LEU C 1 98  ? 165.396 -35.425 271.022 1.00 57.47  ?  92  LEU C C   1 
ATOM   7974  O O   . LEU C 1 98  ? 166.607 -35.389 271.249 1.00 62.99  ?  92  LEU C O   1 
ATOM   7975  C CB  . LEU C 1 98  ? 163.861 -33.448 271.072 1.00 57.17  ?  92  LEU C CB  1 
ATOM   7976  C CG  . LEU C 1 98  ? 162.668 -32.698 271.667 1.00 57.48  ?  92  LEU C CG  1 
ATOM   7977  C CD1 . LEU C 1 98  ? 162.259 -31.542 270.767 1.00 55.01  ?  92  LEU C CD1 1 
ATOM   7978  C CD2 . LEU C 1 98  ? 161.497 -33.640 271.902 1.00 52.46  ?  92  LEU C CD2 1 
ATOM   7979  N N   . ASP C 1 99  ? 164.865 -36.138 270.035 1.00 59.30  ?  93  ASP C N   1 
ATOM   7980  C CA  . ASP C 1 99  ? 165.663 -36.937 269.118 1.00 62.12  ?  93  ASP C CA  1 
ATOM   7981  C C   . ASP C 1 99  ? 165.628 -36.328 267.722 1.00 54.49  ?  93  ASP C C   1 
ATOM   7982  O O   . ASP C 1 99  ? 164.806 -35.462 267.413 1.00 50.19  ?  93  ASP C O   1 
ATOM   7983  C CB  . ASP C 1 99  ? 165.166 -38.387 269.081 1.00 58.02  ?  93  ASP C CB  1 
ATOM   7984  C CG  . ASP C 1 99  ? 165.940 -39.291 270.020 1.00 65.49  ?  93  ASP C CG  1 
ATOM   7985  O OD1 . ASP C 1 99  ? 167.188 -39.267 269.973 1.00 69.92  ?  93  ASP C OD1 1 
ATOM   7986  O OD2 . ASP C 1 99  ? 165.302 -40.020 270.809 1.00 77.93  -1 93  ASP C OD2 1 
ATOM   7987  N N   . THR C 1 100 ? 166.546 -36.796 266.879 1.00 51.11  ?  94  THR C N   1 
ATOM   7988  C CA  . THR C 1 100 ? 166.606 -36.332 265.499 1.00 47.83  ?  94  THR C CA  1 
ATOM   7989  C C   . THR C 1 100 ? 165.333 -36.723 264.762 1.00 50.03  ?  94  THR C C   1 
ATOM   7990  O O   . THR C 1 100 ? 164.981 -37.905 264.694 1.00 61.78  ?  94  THR C O   1 
ATOM   7991  C CB  . THR C 1 100 ? 167.833 -36.915 264.799 1.00 44.19  ?  94  THR C CB  1 
ATOM   7992  O OG1 . THR C 1 100 ? 169.022 -36.441 265.442 1.00 50.67  ?  94  THR C OG1 1 
ATOM   7993  C CG2 . THR C 1 100 ? 167.856 -36.504 263.333 1.00 39.25  ?  94  THR C CG2 1 
ATOM   7994  N N   . GLY C 1 101 ? 164.642 -35.727 264.216 1.00 47.87  ?  95  GLY C N   1 
ATOM   7995  C CA  . GLY C 1 101 ? 163.374 -35.931 263.546 1.00 49.51  ?  95  GLY C CA  1 
ATOM   7996  C C   . GLY C 1 101 ? 162.185 -35.346 264.273 1.00 45.96  ?  95  GLY C C   1 
ATOM   7997  O O   . GLY C 1 101 ? 161.111 -35.224 263.669 1.00 44.12  ?  95  GLY C O   1 
ATOM   7998  N N   . ASP C 1 102 ? 162.333 -34.985 265.545 1.00 42.29  ?  96  ASP C N   1 
ATOM   7999  C CA  . ASP C 1 102 ? 161.242 -34.364 266.277 1.00 47.91  ?  96  ASP C CA  1 
ATOM   8000  C C   . ASP C 1 102 ? 160.972 -32.961 265.740 1.00 49.64  ?  96  ASP C C   1 
ATOM   8001  O O   . ASP C 1 102 ? 161.796 -32.362 265.043 1.00 47.14  ?  96  ASP C O   1 
ATOM   8002  C CB  . ASP C 1 102 ? 161.556 -34.313 267.773 1.00 54.58  ?  96  ASP C CB  1 
ATOM   8003  C CG  . ASP C 1 102 ? 161.615 -35.692 268.404 1.00 61.45  ?  96  ASP C CG  1 
ATOM   8004  O OD1 . ASP C 1 102 ? 160.990 -36.626 267.856 1.00 57.36  ?  96  ASP C OD1 1 
ATOM   8005  O OD2 . ASP C 1 102 ? 162.284 -35.844 269.448 1.00 58.54  -1 96  ASP C OD2 1 
ATOM   8006  N N   . ILE C 1 103 ? 159.795 -32.438 266.073 1.00 44.17  ?  97  ILE C N   1 
ATOM   8007  C CA  . ILE C 1 103 ? 159.302 -31.190 265.505 1.00 37.46  ?  97  ILE C CA  1 
ATOM   8008  C C   . ILE C 1 103 ? 158.938 -30.235 266.634 1.00 45.39  ?  97  ILE C C   1 
ATOM   8009  O O   . ILE C 1 103 ? 158.348 -30.642 267.640 1.00 44.96  ?  97  ILE C O   1 
ATOM   8010  C CB  . ILE C 1 103 ? 158.087 -31.429 264.580 1.00 39.51  ?  97  ILE C CB  1 
ATOM   8011  C CG1 . ILE C 1 103 ? 158.443 -32.404 263.455 1.00 42.43  ?  97  ILE C CG1 1 
ATOM   8012  C CG2 . ILE C 1 103 ? 157.599 -30.122 263.985 1.00 40.59  ?  97  ILE C CG2 1 
ATOM   8013  C CD1 . ILE C 1 103 ? 158.085 -33.845 263.744 1.00 49.71  ?  97  ILE C CD1 1 
ATOM   8014  N N   . ILE C 1 104 ? 159.298 -28.965 266.465 1.00 49.72  ?  98  ILE C N   1 
ATOM   8015  C CA  . ILE C 1 104 ? 158.921 -27.896 267.384 1.00 44.68  ?  98  ILE C CA  1 
ATOM   8016  C C   . ILE C 1 104 ? 158.143 -26.857 266.590 1.00 43.93  ?  98  ILE C C   1 
ATOM   8017  O O   . ILE C 1 104 ? 158.642 -26.336 265.584 1.00 43.96  ?  98  ILE C O   1 
ATOM   8018  C CB  . ILE C 1 104 ? 160.145 -27.264 268.066 1.00 36.80  ?  98  ILE C CB  1 
ATOM   8019  C CG1 . ILE C 1 104 ? 160.840 -28.285 268.970 1.00 40.43  ?  98  ILE C CG1 1 
ATOM   8020  C CG2 . ILE C 1 104 ? 159.737 -26.034 268.864 1.00 34.04  ?  98  ILE C CG2 1 
ATOM   8021  C CD1 . ILE C 1 104 ? 162.018 -27.720 269.732 1.00 44.71  ?  98  ILE C CD1 1 
ATOM   8022  N N   . ILE C 1 105 ? 156.925 -26.559 267.036 1.00 40.44  ?  99  ILE C N   1 
ATOM   8023  C CA  . ILE C 1 105 ? 156.040 -25.611 266.368 1.00 39.39  ?  99  ILE C CA  1 
ATOM   8024  C C   . ILE C 1 105 ? 156.000 -24.329 267.185 1.00 44.82  ?  99  ILE C C   1 
ATOM   8025  O O   . ILE C 1 105 ? 155.842 -24.373 268.411 1.00 47.85  ?  99  ILE C O   1 
ATOM   8026  C CB  . ILE C 1 105 ? 154.622 -26.184 266.194 1.00 45.02  ?  99  ILE C CB  1 
ATOM   8027  C CG1 . ILE C 1 105 ? 154.674 -27.606 265.634 1.00 44.03  ?  99  ILE C CG1 1 
ATOM   8028  C CG2 . ILE C 1 105 ? 153.797 -25.282 265.289 1.00 41.26  ?  99  ILE C CG2 1 
ATOM   8029  C CD1 . ILE C 1 105 ? 154.990 -27.671 264.164 1.00 48.29  ?  99  ILE C CD1 1 
ATOM   8030  N N   . ASP C 1 106 ? 156.138 -23.191 266.509 1.00 43.47  ?  100 ASP C N   1 
ATOM   8031  C CA  . ASP C 1 106 ? 156.006 -21.877 267.129 1.00 43.72  ?  100 ASP C CA  1 
ATOM   8032  C C   . ASP C 1 106 ? 154.741 -21.228 266.582 1.00 41.55  ?  100 ASP C C   1 
ATOM   8033  O O   . ASP C 1 106 ? 154.664 -20.913 265.389 1.00 44.01  ?  100 ASP C O   1 
ATOM   8034  C CB  . ASP C 1 106 ? 157.232 -21.008 266.856 1.00 48.99  ?  100 ASP C CB  1 
ATOM   8035  C CG  . ASP C 1 106 ? 157.130 -19.633 267.498 1.00 53.09  ?  100 ASP C CG  1 
ATOM   8036  O OD1 . ASP C 1 106 ? 156.289 -19.453 268.405 1.00 48.09  ?  100 ASP C OD1 1 
ATOM   8037  O OD2 . ASP C 1 106 ? 157.891 -18.730 267.091 1.00 55.94  -1 100 ASP C OD2 1 
ATOM   8038  N N   . GLY C 1 107 ? 153.755 -21.029 267.450 1.00 44.79  ?  101 GLY C N   1 
ATOM   8039  C CA  . GLY C 1 107 ? 152.500 -20.423 267.071 1.00 49.36  ?  101 GLY C CA  1 
ATOM   8040  C C   . GLY C 1 107 ? 152.330 -18.974 267.464 1.00 50.89  ?  101 GLY C C   1 
ATOM   8041  O O   . GLY C 1 107 ? 151.267 -18.401 267.209 1.00 51.58  ?  101 GLY C O   1 
ATOM   8042  N N   . GLY C 1 108 ? 153.342 -18.361 268.075 1.00 52.85  ?  102 GLY C N   1 
ATOM   8043  C CA  . GLY C 1 108 ? 153.245 -16.985 268.508 1.00 51.32  ?  102 GLY C CA  1 
ATOM   8044  C C   . GLY C 1 108 ? 153.555 -15.996 267.400 1.00 45.37  ?  102 GLY C C   1 
ATOM   8045  O O   . GLY C 1 108 ? 153.931 -16.351 266.283 1.00 46.67  ?  102 GLY C O   1 
ATOM   8046  N N   . ASN C 1 109 ? 153.389 -14.715 267.733 1.00 47.95  ?  103 ASN C N   1 
ATOM   8047  C CA  . ASN C 1 109 ? 153.652 -13.621 266.796 1.00 48.32  ?  103 ASN C CA  1 
ATOM   8048  C C   . ASN C 1 109 ? 155.141 -13.270 266.825 1.00 45.95  ?  103 ASN C C   1 
ATOM   8049  O O   . ASN C 1 109 ? 155.559 -12.184 267.230 1.00 48.08  ?  103 ASN C O   1 
ATOM   8050  C CB  . ASN C 1 109 ? 152.787 -12.414 267.129 1.00 52.71  ?  103 ASN C CB  1 
ATOM   8051  C CG  . ASN C 1 109 ? 151.609 -12.264 266.188 1.00 59.00  ?  103 ASN C CG  1 
ATOM   8052  O OD1 . ASN C 1 109 ? 151.708 -11.605 265.152 1.00 58.69  ?  103 ASN C OD1 1 
ATOM   8053  N ND2 . ASN C 1 109 ? 150.484 -12.873 266.544 1.00 50.26  ?  103 ASN C ND2 1 
ATOM   8054  N N   . SER C 1 110 ? 155.948 -14.225 266.375 1.00 42.61  ?  104 SER C N   1 
ATOM   8055  C CA  . SER C 1 110 ? 157.389 -14.035 266.334 1.00 43.56  ?  104 SER C CA  1 
ATOM   8056  C C   . SER C 1 110 ? 157.794 -13.254 265.089 1.00 44.87  ?  104 SER C C   1 
ATOM   8057  O O   . SER C 1 110 ? 157.180 -13.374 264.025 1.00 48.29  ?  104 SER C O   1 
ATOM   8058  C CB  . SER C 1 110 ? 158.110 -15.383 266.356 1.00 44.49  ?  104 SER C CB  1 
ATOM   8059  O OG  . SER C 1 110 ? 157.803 -16.108 267.534 1.00 55.75  ?  104 SER C OG  1 
ATOM   8060  N N   . GLU C 1 111 ? 158.835 -12.441 265.236 1.00 44.59  ?  105 GLU C N   1 
ATOM   8061  C CA  . GLU C 1 111 ? 159.393 -11.739 264.090 1.00 42.79  ?  105 GLU C CA  1 
ATOM   8062  C C   . GLU C 1 111 ? 160.104 -12.733 263.180 1.00 38.41  ?  105 GLU C C   1 
ATOM   8063  O O   . GLU C 1 111 ? 160.790 -13.645 263.649 1.00 38.97  ?  105 GLU C O   1 
ATOM   8064  C CB  . GLU C 1 111 ? 160.354 -10.646 264.554 1.00 46.88  ?  105 GLU C CB  1 
ATOM   8065  C CG  . GLU C 1 111 ? 159.790 -9.778  265.672 1.00 51.71  ?  105 GLU C CG  1 
ATOM   8066  C CD  . GLU C 1 111 ? 160.696 -8.617  266.034 1.00 70.49  ?  105 GLU C CD  1 
ATOM   8067  O OE1 . GLU C 1 111 ? 160.865 -7.707  265.195 1.00 81.59  ?  105 GLU C OE1 1 
ATOM   8068  O OE2 . GLU C 1 111 ? 161.241 -8.617  267.158 1.00 74.35  -1 105 GLU C OE2 1 
ATOM   8069  N N   . TYR C 1 112 ? 159.930 -12.557 261.866 1.00 30.10  ?  106 TYR C N   1 
ATOM   8070  C CA  . TYR C 1 112 ? 160.385 -13.570 260.918 1.00 32.87  ?  106 TYR C CA  1 
ATOM   8071  C C   . TYR C 1 112 ? 161.893 -13.776 260.975 1.00 38.95  ?  106 TYR C C   1 
ATOM   8072  O O   . TYR C 1 112 ? 162.377 -14.879 260.695 1.00 42.50  ?  106 TYR C O   1 
ATOM   8073  C CB  . TYR C 1 112 ? 159.950 -13.200 259.498 1.00 30.85  ?  106 TYR C CB  1 
ATOM   8074  C CG  . TYR C 1 112 ? 160.560 -11.924 258.963 1.00 35.58  ?  106 TYR C CG  1 
ATOM   8075  C CD1 . TYR C 1 112 ? 159.941 -10.697 259.167 1.00 36.64  ?  106 TYR C CD1 1 
ATOM   8076  C CD2 . TYR C 1 112 ? 161.746 -11.947 258.239 1.00 37.87  ?  106 TYR C CD2 1 
ATOM   8077  C CE1 . TYR C 1 112 ? 160.492 -9.529  258.674 1.00 37.59  ?  106 TYR C CE1 1 
ATOM   8078  C CE2 . TYR C 1 112 ? 162.304 -10.785 257.743 1.00 37.11  ?  106 TYR C CE2 1 
ATOM   8079  C CZ  . TYR C 1 112 ? 161.673 -9.579  257.963 1.00 38.42  ?  106 TYR C CZ  1 
ATOM   8080  O OH  . TYR C 1 112 ? 162.225 -8.418  257.470 1.00 41.91  ?  106 TYR C OH  1 
ATOM   8081  N N   . ARG C 1 113 ? 162.653 -12.738 261.332 1.00 43.25  ?  107 ARG C N   1 
ATOM   8082  C CA  . ARG C 1 113 ? 164.098 -12.901 261.453 1.00 35.78  ?  107 ARG C CA  1 
ATOM   8083  C C   . ARG C 1 113 ? 164.452 -13.843 262.596 1.00 35.99  ?  107 ARG C C   1 
ATOM   8084  O O   . ARG C 1 113 ? 165.415 -14.613 262.499 1.00 38.08  ?  107 ARG C O   1 
ATOM   8085  C CB  . ARG C 1 113 ? 164.771 -11.543 261.645 1.00 35.17  ?  107 ARG C CB  1 
ATOM   8086  C CG  . ARG C 1 113 ? 164.567 -10.586 260.487 1.00 30.66  ?  107 ARG C CG  1 
ATOM   8087  C CD  . ARG C 1 113 ? 165.462 -9.366  260.616 1.00 25.61  ?  107 ARG C CD  1 
ATOM   8088  N NE  . ARG C 1 113 ? 165.212 -8.398  259.553 1.00 23.81  ?  107 ARG C NE  1 
ATOM   8089  C CZ  . ARG C 1 113 ? 164.335 -7.405  259.644 1.00 29.60  ?  107 ARG C CZ  1 
ATOM   8090  N NH1 . ARG C 1 113 ? 163.623 -7.245  260.751 1.00 35.05  1  107 ARG C NH1 1 
ATOM   8091  N NH2 . ARG C 1 113 ? 164.169 -6.569  258.628 1.00 44.41  ?  107 ARG C NH2 1 
ATOM   8092  N N   . ASP C 1 114 ? 163.686 -13.795 263.690 1.00 37.85  ?  108 ASP C N   1 
ATOM   8093  C CA  . ASP C 1 114 ? 163.894 -14.744 264.778 1.00 37.61  ?  108 ASP C CA  1 
ATOM   8094  C C   . ASP C 1 114 ? 163.581 -16.166 264.332 1.00 40.42  ?  108 ASP C C   1 
ATOM   8095  O O   . ASP C 1 114 ? 164.308 -17.105 264.677 1.00 36.91  ?  108 ASP C O   1 
ATOM   8096  C CB  . ASP C 1 114 ? 163.035 -14.363 265.985 1.00 41.04  ?  108 ASP C CB  1 
ATOM   8097  C CG  . ASP C 1 114 ? 163.563 -13.147 266.719 1.00 46.15  ?  108 ASP C CG  1 
ATOM   8098  O OD1 . ASP C 1 114 ? 163.491 -12.033 266.160 1.00 55.78  ?  108 ASP C OD1 1 
ATOM   8099  O OD2 . ASP C 1 114 ? 164.047 -13.306 267.860 1.00 46.45  -1 108 ASP C OD2 1 
ATOM   8100  N N   . THR C 1 115 ? 162.506 -16.343 263.561 1.00 41.33  ?  109 THR C N   1 
ATOM   8101  C CA  . THR C 1 115 ? 162.139 -17.676 263.097 1.00 40.53  ?  109 THR C CA  1 
ATOM   8102  C C   . THR C 1 115 ? 163.173 -18.226 262.122 1.00 36.19  ?  109 THR C C   1 
ATOM   8103  O O   . THR C 1 115 ? 163.485 -19.422 262.150 1.00 33.69  ?  109 THR C O   1 
ATOM   8104  C CB  . THR C 1 115 ? 160.754 -17.644 262.451 1.00 44.15  ?  109 THR C CB  1 
ATOM   8105  O OG1 . THR C 1 115 ? 159.847 -16.930 263.300 1.00 48.70  ?  109 THR C OG1 1 
ATOM   8106  C CG2 . THR C 1 115 ? 160.233 -19.054 262.252 1.00 43.54  ?  109 THR C CG2 1 
ATOM   8107  N N   . THR C 1 116 ? 163.715 -17.368 261.254 1.00 38.60  ?  110 THR C N   1 
ATOM   8108  C CA  . THR C 1 116 ? 164.757 -17.809 260.332 1.00 41.01  ?  110 THR C CA  1 
ATOM   8109  C C   . THR C 1 116 ? 165.999 -18.265 261.088 1.00 42.26  ?  110 THR C C   1 
ATOM   8110  O O   . THR C 1 116 ? 166.655 -19.236 260.693 1.00 42.81  ?  110 THR C O   1 
ATOM   8111  C CB  . THR C 1 116 ? 165.105 -16.686 259.354 1.00 44.93  ?  110 THR C CB  1 
ATOM   8112  O OG1 . THR C 1 116 ? 163.909 -16.214 258.719 1.00 47.30  ?  110 THR C OG1 1 
ATOM   8113  C CG2 . THR C 1 116 ? 166.069 -17.183 258.287 1.00 54.36  ?  110 THR C CG2 1 
ATOM   8114  N N   . ARG C 1 117 ? 166.333 -17.578 262.183 1.00 41.71  ?  111 ARG C N   1 
ATOM   8115  C CA  . ARG C 1 117 ? 167.455 -18.007 263.011 1.00 41.00  ?  111 ARG C CA  1 
ATOM   8116  C C   . ARG C 1 117 ? 167.173 -19.358 263.655 1.00 42.63  ?  111 ARG C C   1 
ATOM   8117  O O   . ARG C 1 117 ? 167.985 -20.285 263.562 1.00 43.43  ?  111 ARG C O   1 
ATOM   8118  C CB  . ARG C 1 117 ? 167.753 -16.957 264.082 1.00 35.48  ?  111 ARG C CB  1 
ATOM   8119  C CG  . ARG C 1 117 ? 168.911 -17.334 264.993 1.00 34.59  ?  111 ARG C CG  1 
ATOM   8120  C CD  . ARG C 1 117 ? 169.011 -16.413 266.199 1.00 34.86  ?  111 ARG C CD  1 
ATOM   8121  N NE  . ARG C 1 117 ? 167.912 -16.609 267.141 1.00 24.63  ?  111 ARG C NE  1 
ATOM   8122  C CZ  . ARG C 1 117 ? 166.858 -15.805 267.238 1.00 40.73  ?  111 ARG C CZ  1 
ATOM   8123  N NH1 . ARG C 1 117 ? 166.757 -14.743 266.450 1.00 46.74  1  111 ARG C NH1 1 
ATOM   8124  N NH2 . ARG C 1 117 ? 165.906 -16.061 268.126 1.00 39.17  ?  111 ARG C NH2 1 
ATOM   8125  N N   . ARG C 1 118 ? 166.017 -19.487 264.313 1.00 42.01  ?  112 ARG C N   1 
ATOM   8126  C CA  . ARG C 1 118 ? 165.682 -20.738 264.986 1.00 41.32  ?  112 ARG C CA  1 
ATOM   8127  C C   . ARG C 1 118 ? 165.617 -21.898 264.000 1.00 41.91  ?  112 ARG C C   1 
ATOM   8128  O O   . ARG C 1 118 ? 165.993 -23.026 264.334 1.00 38.66  ?  112 ARG C O   1 
ATOM   8129  C CB  . ARG C 1 118 ? 164.354 -20.599 265.731 1.00 34.58  ?  112 ARG C CB  1 
ATOM   8130  C CG  . ARG C 1 118 ? 164.310 -19.458 266.734 1.00 35.57  ?  112 ARG C CG  1 
ATOM   8131  C CD  . ARG C 1 118 ? 163.023 -19.495 267.540 1.00 44.66  ?  112 ARG C CD  1 
ATOM   8132  N NE  . ARG C 1 118 ? 162.812 -18.277 268.317 1.00 41.80  ?  112 ARG C NE  1 
ATOM   8133  C CZ  . ARG C 1 118 ? 161.928 -17.336 268.001 1.00 48.67  ?  112 ARG C CZ  1 
ATOM   8134  N NH1 . ARG C 1 118 ? 161.166 -17.473 266.923 1.00 47.21  1  112 ARG C NH1 1 
ATOM   8135  N NH2 . ARG C 1 118 ? 161.800 -16.259 268.765 1.00 49.14  ?  112 ARG C NH2 1 
ATOM   8136  N N   . CYS C 1 119 ? 165.151 -21.637 262.777 1.00 43.27  ?  113 CYS C N   1 
ATOM   8137  C CA  . CYS C 1 119 ? 165.030 -22.705 261.791 1.00 42.01  ?  113 CYS C CA  1 
ATOM   8138  C C   . CYS C 1 119 ? 166.399 -23.239 261.385 1.00 45.19  ?  113 CYS C C   1 
ATOM   8139  O O   . CYS C 1 119 ? 166.617 -24.456 261.356 1.00 43.69  ?  113 CYS C O   1 
ATOM   8140  C CB  . CYS C 1 119 ? 164.260 -22.205 260.568 1.00 42.67  ?  113 CYS C CB  1 
ATOM   8141  S SG  . CYS C 1 119 ? 163.929 -23.477 259.329 1.00 32.74  ?  113 CYS C SG  1 
ATOM   8142  N N   . ARG C 1 120 ? 167.338 -22.343 261.070 1.00 42.21  ?  114 ARG C N   1 
ATOM   8143  C CA  . ARG C 1 120 ? 168.664 -22.783 260.647 1.00 45.47  ?  114 ARG C CA  1 
ATOM   8144  C C   . ARG C 1 120 ? 169.418 -23.448 261.792 1.00 44.73  ?  114 ARG C C   1 
ATOM   8145  O O   . ARG C 1 120 ? 170.007 -24.522 261.620 1.00 40.80  ?  114 ARG C O   1 
ATOM   8146  C CB  . ARG C 1 120 ? 169.467 -21.601 260.099 1.00 50.45  ?  114 ARG C CB  1 
ATOM   8147  C CG  . ARG C 1 120 ? 168.920 -20.990 258.821 1.00 52.77  ?  114 ARG C CG  1 
ATOM   8148  C CD  . ARG C 1 120 ? 170.026 -20.272 258.060 1.00 53.42  ?  114 ARG C CD  1 
ATOM   8149  N NE  . ARG C 1 120 ? 169.513 -19.463 256.958 1.00 63.23  ?  114 ARG C NE  1 
ATOM   8150  C CZ  . ARG C 1 120 ? 169.378 -18.142 257.003 1.00 68.33  ?  114 ARG C CZ  1 
ATOM   8151  N NH1 . ARG C 1 120 ? 169.723 -17.475 258.097 1.00 67.17  1  114 ARG C NH1 1 
ATOM   8152  N NH2 . ARG C 1 120 ? 168.903 -17.485 255.954 1.00 65.66  ?  114 ARG C NH2 1 
ATOM   8153  N N   . ASP C 1 121 ? 169.411 -22.824 262.972 1.00 47.53  ?  115 ASP C N   1 
ATOM   8154  C CA  . ASP C 1 121 ? 170.201 -23.333 264.087 1.00 44.95  ?  115 ASP C CA  1 
ATOM   8155  C C   . ASP C 1 121 ? 169.646 -24.633 264.656 1.00 49.91  ?  115 ASP C C   1 
ATOM   8156  O O   . ASP C 1 121 ? 170.405 -25.401 265.256 1.00 55.34  ?  115 ASP C O   1 
ATOM   8157  C CB  . ASP C 1 121 ? 170.301 -22.274 265.188 1.00 55.47  ?  115 ASP C CB  1 
ATOM   8158  C CG  . ASP C 1 121 ? 171.174 -21.095 264.786 1.00 66.12  ?  115 ASP C CG  1 
ATOM   8159  O OD1 . ASP C 1 121 ? 170.652 -20.142 264.171 1.00 53.00  ?  115 ASP C OD1 1 
ATOM   8160  O OD2 . ASP C 1 121 ? 172.388 -21.125 265.079 1.00 80.30  -1 115 ASP C OD2 1 
ATOM   8161  N N   . LEU C 1 122 ? 168.351 -24.903 264.485 1.00 52.47  ?  116 LEU C N   1 
ATOM   8162  C CA  . LEU C 1 122 ? 167.789 -26.178 264.915 1.00 45.71  ?  116 LEU C CA  1 
ATOM   8163  C C   . LEU C 1 122 ? 167.893 -27.254 263.844 1.00 42.57  ?  116 LEU C C   1 
ATOM   8164  O O   . LEU C 1 122 ? 167.999 -28.440 264.178 1.00 39.98  ?  116 LEU C O   1 
ATOM   8165  C CB  . LEU C 1 122 ? 166.324 -26.007 265.328 1.00 40.56  ?  116 LEU C CB  1 
ATOM   8166  C CG  . LEU C 1 122 ? 166.080 -25.234 266.625 1.00 50.02  ?  116 LEU C CG  1 
ATOM   8167  C CD1 . LEU C 1 122 ? 164.594 -25.148 266.934 1.00 36.30  ?  116 LEU C CD1 1 
ATOM   8168  C CD2 . LEU C 1 122 ? 166.834 -25.874 267.776 1.00 54.59  ?  116 LEU C CD2 1 
ATOM   8169  N N   . LYS C 1 123 ? 167.858 -26.868 262.566 1.00 46.93  ?  117 LYS C N   1 
ATOM   8170  C CA  . LYS C 1 123 ? 168.048 -27.837 261.492 1.00 43.67  ?  117 LYS C CA  1 
ATOM   8171  C C   . LYS C 1 123 ? 169.430 -28.471 261.556 1.00 47.39  ?  117 LYS C C   1 
ATOM   8172  O O   . LYS C 1 123 ? 169.590 -29.652 261.226 1.00 51.19  ?  117 LYS C O   1 
ATOM   8173  C CB  . LYS C 1 123 ? 167.832 -27.159 260.138 1.00 47.68  ?  117 LYS C CB  1 
ATOM   8174  C CG  . LYS C 1 123 ? 168.041 -28.058 258.931 1.00 44.12  ?  117 LYS C CG  1 
ATOM   8175  C CD  . LYS C 1 123 ? 167.826 -27.285 257.640 1.00 42.63  ?  117 LYS C CD  1 
ATOM   8176  C CE  . LYS C 1 123 ? 168.018 -28.168 256.420 1.00 48.98  ?  117 LYS C CE  1 
ATOM   8177  N NZ  . LYS C 1 123 ? 167.772 -27.418 255.156 1.00 48.85  1  117 LYS C NZ  1 
ATOM   8178  N N   . ALA C 1 124 ? 170.437 -27.707 261.986 1.00 48.66  ?  118 ALA C N   1 
ATOM   8179  C CA  . ALA C 1 124 ? 171.779 -28.256 262.127 1.00 49.56  ?  118 ALA C CA  1 
ATOM   8180  C C   . ALA C 1 124 ? 171.864 -29.247 263.280 1.00 47.68  ?  118 ALA C C   1 
ATOM   8181  O O   . ALA C 1 124 ? 172.710 -30.149 263.259 1.00 54.79  ?  118 ALA C O   1 
ATOM   8182  C CB  . ALA C 1 124 ? 172.786 -27.124 262.324 1.00 49.49  ?  118 ALA C CB  1 
ATOM   8183  N N   . LYS C 1 125 ? 171.004 -29.101 264.284 1.00 44.31  ?  119 LYS C N   1 
ATOM   8184  C CA  . LYS C 1 125 ? 170.999 -29.974 265.449 1.00 44.21  ?  119 LYS C CA  1 
ATOM   8185  C C   . LYS C 1 125 ? 170.008 -31.127 265.320 1.00 48.49  ?  119 LYS C C   1 
ATOM   8186  O O   . LYS C 1 125 ? 169.784 -31.847 266.298 1.00 54.30  ?  119 LYS C O   1 
ATOM   8187  C CB  . LYS C 1 125 ? 170.700 -29.156 266.709 1.00 39.48  ?  119 LYS C CB  1 
ATOM   8188  C CG  . LYS C 1 125 ? 171.775 -28.124 267.025 1.00 42.31  ?  119 LYS C CG  1 
ATOM   8189  C CD  . LYS C 1 125 ? 171.249 -26.994 267.898 1.00 56.26  ?  119 LYS C CD  1 
ATOM   8190  C CE  . LYS C 1 125 ? 170.824 -27.484 269.270 1.00 67.39  ?  119 LYS C CE  1 
ATOM   8191  N NZ  . LYS C 1 125 ? 170.345 -26.359 270.122 1.00 57.34  1  119 LYS C NZ  1 
ATOM   8192  N N   . GLY C 1 126 ? 169.415 -31.316 264.143 1.00 44.67  ?  120 GLY C N   1 
ATOM   8193  C CA  . GLY C 1 126 ? 168.524 -32.431 263.899 1.00 47.79  ?  120 GLY C CA  1 
ATOM   8194  C C   . GLY C 1 126 ? 167.080 -32.220 264.295 1.00 46.43  ?  120 GLY C C   1 
ATOM   8195  O O   . GLY C 1 126 ? 166.316 -33.192 264.321 1.00 40.56  ?  120 GLY C O   1 
ATOM   8196  N N   . ILE C 1 127 ? 166.676 -30.989 264.597 1.00 47.73  ?  121 ILE C N   1 
ATOM   8197  C CA  . ILE C 1 127 ? 165.317 -30.679 265.025 1.00 38.29  ?  121 ILE C CA  1 
ATOM   8198  C C   . ILE C 1 127 ? 164.611 -29.939 263.898 1.00 37.45  ?  121 ILE C C   1 
ATOM   8199  O O   . ILE C 1 127 ? 165.177 -29.016 263.300 1.00 48.62  ?  121 ILE C O   1 
ATOM   8200  C CB  . ILE C 1 127 ? 165.312 -29.848 266.320 1.00 39.37  ?  121 ILE C CB  1 
ATOM   8201  C CG1 . ILE C 1 127 ? 166.026 -30.608 267.440 1.00 39.79  ?  121 ILE C CG1 1 
ATOM   8202  C CG2 . ILE C 1 127 ? 163.890 -29.497 266.731 1.00 39.82  ?  121 ILE C CG2 1 
ATOM   8203  C CD1 . ILE C 1 127 ? 165.425 -31.962 267.738 1.00 41.25  ?  121 ILE C CD1 1 
ATOM   8204  N N   . LEU C 1 128 ? 163.376 -30.344 263.609 1.00 39.22  ?  122 LEU C N   1 
ATOM   8205  C CA  . LEU C 1 128 ? 162.569 -29.713 262.570 1.00 40.02  ?  122 LEU C CA  1 
ATOM   8206  C C   . LEU C 1 128 ? 161.751 -28.593 263.203 1.00 39.47  ?  122 LEU C C   1 
ATOM   8207  O O   . LEU C 1 128 ? 160.830 -28.853 263.984 1.00 38.09  ?  122 LEU C O   1 
ATOM   8208  C CB  . LEU C 1 128 ? 161.664 -30.740 261.895 1.00 41.72  ?  122 LEU C CB  1 
ATOM   8209  C CG  . LEU C 1 128 ? 162.319 -32.037 261.417 1.00 46.17  ?  122 LEU C CG  1 
ATOM   8210  C CD1 . LEU C 1 128 ? 161.290 -32.941 260.753 1.00 54.35  ?  122 LEU C CD1 1 
ATOM   8211  C CD2 . LEU C 1 128 ? 163.474 -31.750 260.472 1.00 41.85  ?  122 LEU C CD2 1 
ATOM   8212  N N   . PHE C 1 129 ? 162.082 -27.351 262.869 1.00 39.03  ?  123 PHE C N   1 
ATOM   8213  C CA  . PHE C 1 129 ? 161.395 -26.190 263.415 1.00 38.16  ?  123 PHE C CA  1 
ATOM   8214  C C   . PHE C 1 129 ? 160.392 -25.655 262.402 1.00 39.61  ?  123 PHE C C   1 
ATOM   8215  O O   . PHE C 1 129 ? 160.664 -25.625 261.198 1.00 37.63  ?  123 PHE C O   1 
ATOM   8216  C CB  . PHE C 1 129 ? 162.392 -25.094 263.797 1.00 36.86  ?  123 PHE C CB  1 
ATOM   8217  C CG  . PHE C 1 129 ? 161.764 -23.917 264.489 1.00 35.08  ?  123 PHE C CG  1 
ATOM   8218  C CD1 . PHE C 1 129 ? 161.411 -23.989 265.826 1.00 36.71  ?  123 PHE C CD1 1 
ATOM   8219  C CD2 . PHE C 1 129 ? 161.533 -22.735 263.805 1.00 36.65  ?  123 PHE C CD2 1 
ATOM   8220  C CE1 . PHE C 1 129 ? 160.835 -22.908 266.467 1.00 34.22  ?  123 PHE C CE1 1 
ATOM   8221  C CE2 . PHE C 1 129 ? 160.958 -21.652 264.441 1.00 38.10  ?  123 PHE C CE2 1 
ATOM   8222  C CZ  . PHE C 1 129 ? 160.609 -21.738 265.773 1.00 36.71  ?  123 PHE C CZ  1 
ATOM   8223  N N   . VAL C 1 130 ? 159.228 -25.239 262.896 1.00 40.57  ?  124 VAL C N   1 
ATOM   8224  C CA  . VAL C 1 130 ? 158.157 -24.711 262.059 1.00 40.86  ?  124 VAL C CA  1 
ATOM   8225  C C   . VAL C 1 130 ? 157.660 -23.413 262.678 1.00 40.77  ?  124 VAL C C   1 
ATOM   8226  O O   . VAL C 1 130 ? 157.182 -23.408 263.819 1.00 38.27  ?  124 VAL C O   1 
ATOM   8227  C CB  . VAL C 1 130 ? 156.997 -25.708 261.901 1.00 40.92  ?  124 VAL C CB  1 
ATOM   8228  C CG1 . VAL C 1 130 ? 155.823 -25.046 261.194 1.00 34.18  ?  124 VAL C CG1 1 
ATOM   8229  C CG2 . VAL C 1 130 ? 157.454 -26.943 261.140 1.00 46.71  ?  124 VAL C CG2 1 
ATOM   8230  N N   . GLY C 1 131 ? 157.775 -22.319 261.930 1.00 43.17  ?  125 GLY C N   1 
ATOM   8231  C CA  . GLY C 1 131 ? 157.213 -21.052 262.348 1.00 40.85  ?  125 GLY C CA  1 
ATOM   8232  C C   . GLY C 1 131 ? 155.892 -20.783 261.659 1.00 46.05  ?  125 GLY C C   1 
ATOM   8233  O O   . GLY C 1 131 ? 155.860 -20.442 260.472 1.00 49.95  ?  125 GLY C O   1 
ATOM   8234  N N   . SER C 1 132 ? 154.794 -20.935 262.391 1.00 48.16  ?  126 SER C N   1 
ATOM   8235  C CA  . SER C 1 132 ? 153.453 -20.856 261.829 1.00 43.34  ?  126 SER C CA  1 
ATOM   8236  C C   . SER C 1 132 ? 152.724 -19.642 262.385 1.00 42.67  ?  126 SER C C   1 
ATOM   8237  O O   . SER C 1 132 ? 152.748 -19.397 263.596 1.00 41.57  ?  126 SER C O   1 
ATOM   8238  C CB  . SER C 1 132 ? 152.660 -22.129 262.132 1.00 41.42  ?  126 SER C CB  1 
ATOM   8239  O OG  . SER C 1 132 ? 151.360 -22.062 261.573 1.00 51.90  ?  126 SER C OG  1 
ATOM   8240  N N   . GLY C 1 133 ? 152.077 -18.890 261.499 1.00 45.53  ?  127 GLY C N   1 
ATOM   8241  C CA  . GLY C 1 133 ? 151.231 -17.786 261.913 1.00 40.21  ?  127 GLY C CA  1 
ATOM   8242  C C   . GLY C 1 133 ? 149.812 -18.265 262.171 1.00 43.25  ?  127 GLY C C   1 
ATOM   8243  O O   . GLY C 1 133 ? 149.272 -19.084 261.430 1.00 46.18  ?  127 GLY C O   1 
ATOM   8244  N N   . VAL C 1 134 ? 149.220 -17.749 263.244 1.00 46.92  ?  128 VAL C N   1 
ATOM   8245  C CA  . VAL C 1 134 ? 147.865 -18.106 263.653 1.00 46.57  ?  128 VAL C CA  1 
ATOM   8246  C C   . VAL C 1 134 ? 147.057 -16.816 263.669 1.00 50.18  ?  128 VAL C C   1 
ATOM   8247  O O   . VAL C 1 134 ? 147.148 -16.024 264.615 1.00 46.26  ?  128 VAL C O   1 
ATOM   8248  C CB  . VAL C 1 134 ? 147.833 -18.800 265.019 1.00 48.24  ?  128 VAL C CB  1 
ATOM   8249  C CG1 . VAL C 1 134 ? 146.412 -19.212 265.370 1.00 44.70  ?  128 VAL C CG1 1 
ATOM   8250  C CG2 . VAL C 1 134 ? 148.761 -20.006 265.021 1.00 54.36  ?  128 VAL C CG2 1 
ATOM   8251  N N   . SER C 1 135 ? 146.262 -16.598 262.628 1.00 55.68  ?  129 SER C N   1 
ATOM   8252  C CA  . SER C 1 135 ? 145.490 -15.375 262.487 1.00 60.63  ?  129 SER C CA  1 
ATOM   8253  C C   . SER C 1 135 ? 144.056 -15.585 262.955 1.00 57.92  ?  129 SER C C   1 
ATOM   8254  O O   . SER C 1 135 ? 143.502 -16.683 262.856 1.00 58.53  ?  129 SER C O   1 
ATOM   8255  C CB  . SER C 1 135 ? 145.495 -14.888 261.038 1.00 64.70  ?  129 SER C CB  1 
ATOM   8256  O OG  . SER C 1 135 ? 144.888 -13.613 260.945 1.00 69.59  ?  129 SER C OG  1 
ATOM   8257  N N   . GLY C 1 136 ? 143.463 -14.518 263.458 1.00 65.30  ?  130 GLY C N   1 
ATOM   8258  C CA  . GLY C 1 136 ? 142.131 -14.553 264.018 1.00 83.62  ?  130 GLY C CA  1 
ATOM   8259  C C   . GLY C 1 136 ? 142.162 -14.390 265.528 1.00 92.19  ?  130 GLY C C   1 
ATOM   8260  O O   . GLY C 1 136 ? 143.144 -14.732 266.200 1.00 82.15  ?  130 GLY C O   1 
ATOM   8261  N N   . GLY C 1 137 ? 141.074 -13.849 266.070 1.00 92.82  ?  131 GLY C N   1 
ATOM   8262  C CA  . GLY C 1 137 ? 140.968 -13.659 267.502 1.00 90.25  ?  131 GLY C CA  1 
ATOM   8263  C C   . GLY C 1 137 ? 140.779 -14.965 268.243 1.00 91.04  ?  131 GLY C C   1 
ATOM   8264  O O   . GLY C 1 137 ? 141.741 -15.705 268.470 1.00 82.03  ?  131 GLY C O   1 
ATOM   8265  N N   . GLU C 1 138 ? 139.537 -15.258 268.630 1.00 96.87  ?  132 GLU C N   1 
ATOM   8266  C CA  . GLU C 1 138 ? 139.195 -16.527 269.252 1.00 87.89  ?  132 GLU C CA  1 
ATOM   8267  C C   . GLU C 1 138 ? 138.113 -17.294 268.513 1.00 85.05  ?  132 GLU C C   1 
ATOM   8268  O O   . GLU C 1 138 ? 137.969 -18.499 268.749 1.00 89.05  ?  132 GLU C O   1 
ATOM   8269  C CB  . GLU C 1 138 ? 138.741 -16.312 270.706 1.00 83.14  ?  132 GLU C CB  1 
ATOM   8270  C CG  . GLU C 1 138 ? 139.784 -15.643 271.584 1.00 88.26  ?  132 GLU C CG  1 
ATOM   8271  C CD  . GLU C 1 138 ? 141.058 -16.456 271.702 1.00 83.06  ?  132 GLU C CD  1 
ATOM   8272  O OE1 . GLU C 1 138 ? 140.964 -17.686 271.902 1.00 85.38  ?  132 GLU C OE1 1 
ATOM   8273  O OE2 . GLU C 1 138 ? 142.153 -15.867 271.586 1.00 78.85  -1 132 GLU C OE2 1 
ATOM   8274  N N   . GLU C 1 139 ? 137.353 -16.638 267.631 1.00 87.61  ?  133 GLU C N   1 
ATOM   8275  C CA  . GLU C 1 139 ? 136.321 -17.338 266.874 1.00 97.76  ?  133 GLU C CA  1 
ATOM   8276  C C   . GLU C 1 139 ? 136.930 -18.416 265.989 1.00 98.74  ?  133 GLU C C   1 
ATOM   8277  O O   . GLU C 1 139 ? 136.368 -19.509 265.848 1.00 94.84  ?  133 GLU C O   1 
ATOM   8278  C CB  . GLU C 1 139 ? 135.521 -16.342 266.035 1.00 96.88  ?  133 GLU C CB  1 
ATOM   8279  C CG  . GLU C 1 139 ? 134.057 -16.709 265.866 1.00 100.46 ?  133 GLU C CG  1 
ATOM   8280  C CD  . GLU C 1 139 ? 133.242 -16.445 267.118 1.00 108.12 ?  133 GLU C CD  1 
ATOM   8281  O OE1 . GLU C 1 139 ? 132.060 -16.061 266.990 1.00 106.24 ?  133 GLU C OE1 1 
ATOM   8282  O OE2 . GLU C 1 139 ? 133.786 -16.613 268.231 1.00 112.42 -1 133 GLU C OE2 1 
ATOM   8283  N N   . GLY C 1 140 ? 138.078 -18.126 265.384 1.00 96.59  ?  134 GLY C N   1 
ATOM   8284  C CA  . GLY C 1 140 ? 138.800 -19.122 264.624 1.00 87.23  ?  134 GLY C CA  1 
ATOM   8285  C C   . GLY C 1 140 ? 139.735 -19.928 265.499 1.00 85.47  ?  134 GLY C C   1 
ATOM   8286  O O   . GLY C 1 140 ? 139.864 -21.142 265.326 1.00 82.46  ?  134 GLY C O   1 
ATOM   8287  N N   . ALA C 1 141 ? 140.373 -19.261 266.466 1.00 81.98  ?  135 ALA C N   1 
ATOM   8288  C CA  . ALA C 1 141 ? 141.378 -19.919 267.295 1.00 80.96  ?  135 ALA C CA  1 
ATOM   8289  C C   . ALA C 1 141 ? 140.832 -21.161 267.989 1.00 86.15  ?  135 ALA C C   1 
ATOM   8290  O O   . ALA C 1 141 ? 141.577 -22.122 268.211 1.00 85.90  ?  135 ALA C O   1 
ATOM   8291  C CB  . ALA C 1 141 ? 141.929 -18.937 268.328 1.00 87.92  ?  135 ALA C CB  1 
ATOM   8292  N N   . ARG C 1 142 ? 139.544 -21.171 268.333 1.00 85.59  ?  136 ARG C N   1 
ATOM   8293  C CA  . ARG C 1 142 ? 138.959 -22.319 269.012 1.00 81.72  ?  136 ARG C CA  1 
ATOM   8294  C C   . ARG C 1 142 ? 138.178 -23.242 268.085 1.00 83.14  ?  136 ARG C C   1 
ATOM   8295  O O   . ARG C 1 142 ? 137.941 -24.399 268.449 1.00 81.01  ?  136 ARG C O   1 
ATOM   8296  C CB  . ARG C 1 142 ? 138.035 -21.859 270.149 1.00 79.36  ?  136 ARG C CB  1 
ATOM   8297  C CG  . ARG C 1 142 ? 137.735 -22.955 271.165 1.00 80.33  ?  136 ARG C CG  1 
ATOM   8298  C CD  . ARG C 1 142 ? 136.713 -22.530 272.204 1.00 83.47  ?  136 ARG C CD  1 
ATOM   8299  N NE  . ARG C 1 142 ? 136.391 -23.639 273.098 1.00 89.97  ?  136 ARG C NE  1 
ATOM   8300  C CZ  . ARG C 1 142 ? 135.466 -23.598 274.051 1.00 94.95  ?  136 ARG C CZ  1 
ATOM   8301  N NH1 . ARG C 1 142 ? 134.756 -22.496 274.246 1.00 86.20  1  136 ARG C NH1 1 
ATOM   8302  N NH2 . ARG C 1 142 ? 135.250 -24.665 274.809 1.00 100.33 ?  136 ARG C NH2 1 
ATOM   8303  N N   . TYR C 1 143 ? 137.783 -22.776 266.898 1.00 82.21  ?  137 TYR C N   1 
ATOM   8304  C CA  . TYR C 1 143 ? 136.913 -23.562 266.036 1.00 77.51  ?  137 TYR C CA  1 
ATOM   8305  C C   . TYR C 1 143 ? 137.371 -23.648 264.585 1.00 84.05  ?  137 TYR C C   1 
ATOM   8306  O O   . TYR C 1 143 ? 136.735 -24.360 263.800 1.00 81.83  ?  137 TYR C O   1 
ATOM   8307  C CB  . TYR C 1 143 ? 135.482 -23.006 266.085 1.00 87.10  ?  137 TYR C CB  1 
ATOM   8308  C CG  . TYR C 1 143 ? 134.946 -22.851 267.492 1.00 90.31  ?  137 TYR C CG  1 
ATOM   8309  C CD1 . TYR C 1 143 ? 134.488 -23.951 268.206 1.00 91.69  ?  137 TYR C CD1 1 
ATOM   8310  C CD2 . TYR C 1 143 ? 134.904 -21.607 268.108 1.00 88.52  ?  137 TYR C CD2 1 
ATOM   8311  C CE1 . TYR C 1 143 ? 134.001 -23.817 269.493 1.00 85.25  ?  137 TYR C CE1 1 
ATOM   8312  C CE2 . TYR C 1 143 ? 134.418 -21.463 269.395 1.00 87.88  ?  137 TYR C CE2 1 
ATOM   8313  C CZ  . TYR C 1 143 ? 133.968 -22.570 270.082 1.00 86.80  ?  137 TYR C CZ  1 
ATOM   8314  O OH  . TYR C 1 143 ? 133.484 -22.429 271.363 1.00 75.95  ?  137 TYR C OH  1 
ATOM   8315  N N   . GLY C 1 144 ? 138.446 -22.961 264.205 1.00 88.33  ?  138 GLY C N   1 
ATOM   8316  C CA  . GLY C 1 144 ? 138.941 -23.021 262.849 1.00 78.50  ?  138 GLY C CA  1 
ATOM   8317  C C   . GLY C 1 144 ? 139.819 -21.836 262.502 1.00 72.97  ?  138 GLY C C   1 
ATOM   8318  O O   . GLY C 1 144 ? 139.366 -20.846 261.918 1.00 68.72  ?  138 GLY C O   1 
ATOM   8319  N N   . PRO C 1 145 ? 141.095 -21.910 262.867 1.00 75.85  ?  139 PRO C N   1 
ATOM   8320  C CA  . PRO C 1 145 ? 142.001 -20.780 262.657 1.00 67.99  ?  139 PRO C CA  1 
ATOM   8321  C C   . PRO C 1 145 ? 142.738 -20.863 261.328 1.00 66.53  ?  139 PRO C C   1 
ATOM   8322  O O   . PRO C 1 145 ? 142.847 -21.919 260.702 1.00 71.99  ?  139 PRO C O   1 
ATOM   8323  C CB  . PRO C 1 145 ? 142.981 -20.918 263.829 1.00 63.26  ?  139 PRO C CB  1 
ATOM   8324  C CG  . PRO C 1 145 ? 143.090 -22.403 264.012 1.00 65.11  ?  139 PRO C CG  1 
ATOM   8325  C CD  . PRO C 1 145 ? 141.743 -22.994 263.628 1.00 73.00  ?  139 PRO C CD  1 
ATOM   8326  N N   . SER C 1 146 ? 143.248 -19.710 260.905 1.00 60.74  ?  140 SER C N   1 
ATOM   8327  C CA  . SER C 1 146 ? 144.102 -19.624 259.729 1.00 51.99  ?  140 SER C CA  1 
ATOM   8328  C C   . SER C 1 146 ? 145.535 -19.924 260.146 1.00 46.17  ?  140 SER C C   1 
ATOM   8329  O O   . SER C 1 146 ? 146.111 -19.203 260.968 1.00 51.30  ?  140 SER C O   1 
ATOM   8330  C CB  . SER C 1 146 ? 144.004 -18.245 259.080 1.00 62.10  ?  140 SER C CB  1 
ATOM   8331  O OG  . SER C 1 146 ? 142.696 -17.999 258.598 1.00 72.25  ?  140 SER C OG  1 
ATOM   8332  N N   . LEU C 1 147 ? 146.104 -20.987 259.588 1.00 51.52  ?  141 LEU C N   1 
ATOM   8333  C CA  . LEU C 1 147 ? 147.451 -21.428 259.920 1.00 49.18  ?  141 LEU C CA  1 
ATOM   8334  C C   . LEU C 1 147 ? 148.361 -21.221 258.718 1.00 47.84  ?  141 LEU C C   1 
ATOM   8335  O O   . LEU C 1 147 ? 148.026 -21.633 257.602 1.00 50.07  ?  141 LEU C O   1 
ATOM   8336  C CB  . LEU C 1 147 ? 147.451 -22.896 260.350 1.00 46.13  ?  141 LEU C CB  1 
ATOM   8337  C CG  . LEU C 1 147 ? 146.555 -23.212 261.550 1.00 52.54  ?  141 LEU C CG  1 
ATOM   8338  C CD1 . LEU C 1 147 ? 146.469 -24.711 261.788 1.00 56.69  ?  141 LEU C CD1 1 
ATOM   8339  C CD2 . LEU C 1 147 ? 147.060 -22.496 262.793 1.00 48.23  ?  141 LEU C CD2 1 
ATOM   8340  N N   . MET C 1 148 ? 149.507 -20.580 258.949 1.00 36.60  ?  142 MET C N   1 
ATOM   8341  C CA  . MET C 1 148 ? 150.464 -20.243 257.898 1.00 41.91  ?  142 MET C CA  1 
ATOM   8342  C C   . MET C 1 148 ? 151.821 -20.839 258.259 1.00 44.83  ?  142 MET C C   1 
ATOM   8343  O O   . MET C 1 148 ? 152.740 -20.120 258.677 1.00 44.06  ?  142 MET C O   1 
ATOM   8344  C CB  . MET C 1 148 ? 150.551 -18.730 257.712 1.00 39.36  ?  142 MET C CB  1 
ATOM   8345  C CG  . MET C 1 148 ? 149.187 -18.052 257.674 1.00 46.78  ?  142 MET C CG  1 
ATOM   8346  S SD  . MET C 1 148 ? 149.251 -16.252 257.719 1.00 46.83  ?  142 MET C SD  1 
ATOM   8347  C CE  . MET C 1 148 ? 147.530 -15.868 258.032 1.00 37.54  ?  142 MET C CE  1 
ATOM   8348  N N   . PRO C 1 149 ? 151.982 -22.152 258.106 1.00 44.43  ?  143 PRO C N   1 
ATOM   8349  C CA  . PRO C 1 149 ? 153.212 -22.804 258.567 1.00 46.73  ?  143 PRO C CA  1 
ATOM   8350  C C   . PRO C 1 149 ? 154.376 -22.589 257.613 1.00 45.88  ?  143 PRO C C   1 
ATOM   8351  O O   . PRO C 1 149 ? 154.243 -22.701 256.391 1.00 39.93  ?  143 PRO C O   1 
ATOM   8352  C CB  . PRO C 1 149 ? 152.817 -24.284 258.632 1.00 36.44  ?  143 PRO C CB  1 
ATOM   8353  C CG  . PRO C 1 149 ? 151.783 -24.424 257.571 1.00 42.44  ?  143 PRO C CG  1 
ATOM   8354  C CD  . PRO C 1 149 ? 151.023 -23.119 257.541 1.00 45.64  ?  143 PRO C CD  1 
ATOM   8355  N N   . GLY C 1 150 ? 155.534 -22.279 258.195 1.00 47.56  ?  144 GLY C N   1 
ATOM   8356  C CA  . GLY C 1 150 ? 156.759 -22.126 257.438 1.00 42.92  ?  144 GLY C CA  1 
ATOM   8357  C C   . GLY C 1 150 ? 157.939 -22.555 258.282 1.00 41.76  ?  144 GLY C C   1 
ATOM   8358  O O   . GLY C 1 150 ? 157.835 -22.714 259.500 1.00 41.41  ?  144 GLY C O   1 
ATOM   8359  N N   . GLY C 1 151 ? 159.072 -22.747 257.614 1.00 44.02  ?  145 GLY C N   1 
ATOM   8360  C CA  . GLY C 1 151 ? 160.278 -23.155 258.306 1.00 42.46  ?  145 GLY C CA  1 
ATOM   8361  C C   . GLY C 1 151 ? 160.957 -24.354 257.680 1.00 43.47  ?  145 GLY C C   1 
ATOM   8362  O O   . GLY C 1 151 ? 161.722 -24.211 256.723 1.00 47.85  ?  145 GLY C O   1 
ATOM   8363  N N   . ASN C 1 152 ? 160.687 -25.542 258.209 1.00 35.84  ?  146 ASN C N   1 
ATOM   8364  C CA  . ASN C 1 152 ? 161.303 -26.776 257.734 1.00 37.73  ?  146 ASN C CA  1 
ATOM   8365  C C   . ASN C 1 152 ? 160.236 -27.606 257.031 1.00 51.00  ?  146 ASN C C   1 
ATOM   8366  O O   . ASN C 1 152 ? 159.324 -28.131 257.678 1.00 51.90  ?  146 ASN C O   1 
ATOM   8367  C CB  . ASN C 1 152 ? 161.936 -27.547 258.889 1.00 38.24  ?  146 ASN C CB  1 
ATOM   8368  C CG  . ASN C 1 152 ? 162.981 -28.538 258.422 1.00 39.99  ?  146 ASN C CG  1 
ATOM   8369  O OD1 . ASN C 1 152 ? 162.851 -29.140 257.358 1.00 47.01  ?  146 ASN C OD1 1 
ATOM   8370  N ND2 . ASN C 1 152 ? 164.032 -28.706 259.216 1.00 48.92  ?  146 ASN C ND2 1 
ATOM   8371  N N   . LYS C 1 153 ? 160.355 -27.723 255.706 1.00 50.80  ?  147 LYS C N   1 
ATOM   8372  C CA  . LYS C 1 153 ? 159.389 -28.490 254.928 1.00 43.39  ?  147 LYS C CA  1 
ATOM   8373  C C   . LYS C 1 153 ? 159.443 -29.978 255.247 1.00 50.49  ?  147 LYS C C   1 
ATOM   8374  O O   . LYS C 1 153 ? 158.488 -30.700 254.944 1.00 56.60  ?  147 LYS C O   1 
ATOM   8375  C CB  . LYS C 1 153 ? 159.627 -28.259 253.434 1.00 45.11  ?  147 LYS C CB  1 
ATOM   8376  C CG  . LYS C 1 153 ? 158.439 -28.587 252.542 1.00 40.33  ?  147 LYS C CG  1 
ATOM   8377  C CD  . LYS C 1 153 ? 158.726 -28.211 251.096 1.00 47.70  ?  147 LYS C CD  1 
ATOM   8378  C CE  . LYS C 1 153 ? 157.509 -28.423 250.211 1.00 56.79  ?  147 LYS C CE  1 
ATOM   8379  N NZ  . LYS C 1 153 ? 157.779 -28.033 248.798 1.00 52.57  1  147 LYS C NZ  1 
ATOM   8380  N N   . GLU C 1 154 ? 160.534 -30.449 255.857 1.00 49.20  ?  148 GLU C N   1 
ATOM   8381  C CA  . GLU C 1 154 ? 160.639 -31.853 256.233 1.00 52.01  ?  148 GLU C CA  1 
ATOM   8382  C C   . GLU C 1 154 ? 159.655 -32.229 257.334 1.00 48.12  ?  148 GLU C C   1 
ATOM   8383  O O   . GLU C 1 154 ? 159.391 -33.420 257.532 1.00 54.08  ?  148 GLU C O   1 
ATOM   8384  C CB  . GLU C 1 154 ? 162.071 -32.164 256.677 1.00 51.95  ?  148 GLU C CB  1 
ATOM   8385  C CG  . GLU C 1 154 ? 162.471 -33.625 256.558 1.00 69.17  ?  148 GLU C CG  1 
ATOM   8386  C CD  . GLU C 1 154 ? 163.935 -33.853 256.886 1.00 80.97  ?  148 GLU C CD  1 
ATOM   8387  O OE1 . GLU C 1 154 ? 164.226 -34.640 257.811 1.00 80.07  ?  148 GLU C OE1 1 
ATOM   8388  O OE2 . GLU C 1 154 ? 164.796 -33.236 256.222 1.00 80.72  -1 148 GLU C OE2 1 
ATOM   8389  N N   . ALA C 1 155 ? 159.106 -31.245 258.047 1.00 42.90  ?  149 ALA C N   1 
ATOM   8390  C CA  . ALA C 1 155 ? 158.144 -31.492 259.111 1.00 45.14  ?  149 ALA C CA  1 
ATOM   8391  C C   . ALA C 1 155 ? 156.697 -31.343 258.661 1.00 46.97  ?  149 ALA C C   1 
ATOM   8392  O O   . ALA C 1 155 ? 155.789 -31.640 259.444 1.00 43.11  ?  149 ALA C O   1 
ATOM   8393  C CB  . ALA C 1 155 ? 158.405 -30.545 260.289 1.00 37.18  ?  149 ALA C CB  1 
ATOM   8394  N N   . TRP C 1 156 ? 156.462 -30.896 257.430 1.00 47.33  ?  150 TRP C N   1 
ATOM   8395  C CA  . TRP C 1 156 ? 155.112 -30.688 256.916 1.00 44.67  ?  150 TRP C CA  1 
ATOM   8396  C C   . TRP C 1 156 ? 154.320 -31.989 256.774 1.00 43.63  ?  150 TRP C C   1 
ATOM   8397  O O   . TRP C 1 156 ? 153.137 -32.011 257.139 1.00 44.51  ?  150 TRP C O   1 
ATOM   8398  C CB  . TRP C 1 156 ? 155.163 -29.945 255.577 1.00 38.42  ?  150 TRP C CB  1 
ATOM   8399  C CG  . TRP C 1 156 ? 153.816 -29.724 254.948 1.00 42.59  ?  150 TRP C CG  1 
ATOM   8400  C CD1 . TRP C 1 156 ? 153.422 -30.108 253.699 1.00 43.53  ?  150 TRP C CD1 1 
ATOM   8401  C CD2 . TRP C 1 156 ? 152.683 -29.074 255.542 1.00 36.90  ?  150 TRP C CD2 1 
ATOM   8402  N NE1 . TRP C 1 156 ? 152.119 -29.734 253.476 1.00 36.51  ?  150 TRP C NE1 1 
ATOM   8403  C CE2 . TRP C 1 156 ? 151.642 -29.099 254.592 1.00 33.77  ?  150 TRP C CE2 1 
ATOM   8404  C CE3 . TRP C 1 156 ? 152.448 -28.473 256.783 1.00 33.29  ?  150 TRP C CE3 1 
ATOM   8405  C CZ2 . TRP C 1 156 ? 150.388 -28.547 254.844 1.00 34.79  ?  150 TRP C CZ2 1 
ATOM   8406  C CZ3 . TRP C 1 156 ? 151.202 -27.927 257.031 1.00 36.78  ?  150 TRP C CZ3 1 
ATOM   8407  C CH2 . TRP C 1 156 ? 150.188 -27.967 256.066 1.00 35.20  ?  150 TRP C CH2 1 
ATOM   8408  N N   . PRO C 1 157 ? 154.896 -33.083 256.255 1.00 39.43  ?  151 PRO C N   1 
ATOM   8409  C CA  . PRO C 1 157 ? 154.108 -34.324 256.140 1.00 40.36  ?  151 PRO C CA  1 
ATOM   8410  C C   . PRO C 1 157 ? 153.599 -34.867 257.465 1.00 44.37  ?  151 PRO C C   1 
ATOM   8411  O O   . PRO C 1 157 ? 152.643 -35.653 257.463 1.00 50.25  ?  151 PRO C O   1 
ATOM   8412  C CB  . PRO C 1 157 ? 155.090 -35.304 255.482 1.00 42.08  ?  151 PRO C CB  1 
ATOM   8413  C CG  . PRO C 1 157 ? 156.024 -34.442 254.734 1.00 41.20  ?  151 PRO C CG  1 
ATOM   8414  C CD  . PRO C 1 157 ? 156.204 -33.225 255.587 1.00 42.39  ?  151 PRO C CD  1 
ATOM   8415  N N   . HIS C 1 158 ? 154.193 -34.478 258.592 1.00 42.79  ?  152 HIS C N   1 
ATOM   8416  C CA  . HIS C 1 158 ? 153.794 -35.026 259.882 1.00 45.09  ?  152 HIS C CA  1 
ATOM   8417  C C   . HIS C 1 158 ? 152.737 -34.187 260.588 1.00 49.57  ?  152 HIS C C   1 
ATOM   8418  O O   . HIS C 1 158 ? 151.914 -34.738 261.327 1.00 55.85  ?  152 HIS C O   1 
ATOM   8419  C CB  . HIS C 1 158 ? 155.017 -35.175 260.790 1.00 50.27  ?  152 HIS C CB  1 
ATOM   8420  C CG  . HIS C 1 158 ? 156.119 -35.987 260.186 1.00 50.66  ?  152 HIS C CG  1 
ATOM   8421  N ND1 . HIS C 1 158 ? 156.127 -37.365 260.207 1.00 47.25  ?  152 HIS C ND1 1 
ATOM   8422  C CD2 . HIS C 1 158 ? 157.250 -35.615 259.540 1.00 50.01  ?  152 HIS C CD2 1 
ATOM   8423  C CE1 . HIS C 1 158 ? 157.215 -37.807 259.602 1.00 51.48  ?  152 HIS C CE1 1 
ATOM   8424  N NE2 . HIS C 1 158 ? 157.913 -36.765 259.188 1.00 56.33  ?  152 HIS C NE2 1 
ATOM   8425  N N   . ILE C 1 159 ? 152.738 -32.867 260.380 1.00 45.50  ?  153 ILE C N   1 
ATOM   8426  C CA  . ILE C 1 159 ? 151.779 -31.983 261.032 1.00 43.65  ?  153 ILE C CA  1 
ATOM   8427  C C   . ILE C 1 159 ? 150.641 -31.574 260.111 1.00 44.83  ?  153 ILE C C   1 
ATOM   8428  O O   . ILE C 1 159 ? 149.732 -30.854 260.547 1.00 48.74  ?  153 ILE C O   1 
ATOM   8429  C CB  . ILE C 1 159 ? 152.476 -30.726 261.589 1.00 43.91  ?  153 ILE C CB  1 
ATOM   8430  C CG1 . ILE C 1 159 ? 153.055 -29.894 260.444 1.00 48.52  ?  153 ILE C CG1 1 
ATOM   8431  C CG2 . ILE C 1 159 ? 153.562 -31.114 262.580 1.00 42.58  ?  153 ILE C CG2 1 
ATOM   8432  C CD1 . ILE C 1 159 ? 153.634 -28.569 260.882 1.00 40.91  ?  153 ILE C CD1 1 
ATOM   8433  N N   . LYS C 1 160 ? 150.659 -32.012 258.849 1.00 42.07  ?  154 LYS C N   1 
ATOM   8434  C CA  . LYS C 1 160 ? 149.639 -31.584 257.897 1.00 36.97  ?  154 LYS C CA  1 
ATOM   8435  C C   . LYS C 1 160 ? 148.255 -32.080 258.297 1.00 44.60  ?  154 LYS C C   1 
ATOM   8436  O O   . LYS C 1 160 ? 147.265 -31.351 258.167 1.00 44.25  ?  154 LYS C O   1 
ATOM   8437  C CB  . LYS C 1 160 ? 149.998 -32.073 256.493 1.00 40.27  ?  154 LYS C CB  1 
ATOM   8438  C CG  . LYS C 1 160 ? 148.908 -31.858 255.457 1.00 40.71  ?  154 LYS C CG  1 
ATOM   8439  C CD  . LYS C 1 160 ? 149.368 -32.293 254.076 1.00 50.77  ?  154 LYS C CD  1 
ATOM   8440  C CE  . LYS C 1 160 ? 149.820 -33.744 254.074 1.00 55.57  ?  154 LYS C CE  1 
ATOM   8441  N NZ  . LYS C 1 160 ? 150.318 -34.167 252.736 1.00 58.35  1  154 LYS C NZ  1 
ATOM   8442  N N   . THR C 1 161 ? 148.165 -33.319 258.788 1.00 49.69  ?  155 THR C N   1 
ATOM   8443  C CA  . THR C 1 161 ? 146.866 -33.876 259.153 1.00 45.88  ?  155 THR C CA  1 
ATOM   8444  C C   . THR C 1 161 ? 146.225 -33.090 260.290 1.00 47.80  ?  155 THR C C   1 
ATOM   8445  O O   . THR C 1 161 ? 145.029 -32.781 260.245 1.00 50.55  ?  155 THR C O   1 
ATOM   8446  C CB  . THR C 1 161 ? 147.015 -35.349 259.536 1.00 43.59  ?  155 THR C CB  1 
ATOM   8447  O OG1 . THR C 1 161 ? 147.565 -36.080 258.433 1.00 46.64  ?  155 THR C OG1 1 
ATOM   8448  C CG2 . THR C 1 161 ? 145.665 -35.945 259.908 1.00 35.32  ?  155 THR C CG2 1 
ATOM   8449  N N   . ILE C 1 162 ? 147.008 -32.748 261.315 1.00 49.74  ?  156 ILE C N   1 
ATOM   8450  C CA  . ILE C 1 162 ? 146.455 -32.035 262.461 1.00 48.23  ?  156 ILE C CA  1 
ATOM   8451  C C   . ILE C 1 162 ? 146.172 -30.582 262.102 1.00 47.50  ?  156 ILE C C   1 
ATOM   8452  O O   . ILE C 1 162 ? 145.110 -30.043 262.437 1.00 48.00  ?  156 ILE C O   1 
ATOM   8453  C CB  . ILE C 1 162 ? 147.400 -32.144 263.673 1.00 48.24  ?  156 ILE C CB  1 
ATOM   8454  C CG1 . ILE C 1 162 ? 147.570 -33.605 264.106 1.00 47.84  ?  156 ILE C CG1 1 
ATOM   8455  C CG2 . ILE C 1 162 ? 146.880 -31.307 264.832 1.00 46.03  ?  156 ILE C CG2 1 
ATOM   8456  C CD1 . ILE C 1 162 ? 148.767 -34.308 263.487 1.00 46.84  ?  156 ILE C CD1 1 
ATOM   8457  N N   . PHE C 1 163 ? 147.107 -29.927 261.411 1.00 47.45  ?  157 PHE C N   1 
ATOM   8458  C CA  . PHE C 1 163 ? 146.949 -28.512 261.086 1.00 47.96  ?  157 PHE C CA  1 
ATOM   8459  C C   . PHE C 1 163 ? 145.788 -28.289 260.122 1.00 49.40  ?  157 PHE C C   1 
ATOM   8460  O O   . PHE C 1 163 ? 144.875 -27.504 260.402 1.00 43.85  ?  157 PHE C O   1 
ATOM   8461  C CB  . PHE C 1 163 ? 148.253 -27.960 260.508 1.00 45.90  ?  157 PHE C CB  1 
ATOM   8462  C CG  . PHE C 1 163 ? 149.198 -27.425 261.547 1.00 50.76  ?  157 PHE C CG  1 
ATOM   8463  C CD1 . PHE C 1 163 ? 149.641 -28.232 262.582 1.00 50.55  ?  157 PHE C CD1 1 
ATOM   8464  C CD2 . PHE C 1 163 ? 149.651 -26.118 261.483 1.00 49.55  ?  157 PHE C CD2 1 
ATOM   8465  C CE1 . PHE C 1 163 ? 150.510 -27.742 263.538 1.00 45.16  ?  157 PHE C CE1 1 
ATOM   8466  C CE2 . PHE C 1 163 ? 150.519 -25.622 262.435 1.00 44.44  ?  157 PHE C CE2 1 
ATOM   8467  C CZ  . PHE C 1 163 ? 150.950 -26.436 263.463 1.00 45.01  ?  157 PHE C CZ  1 
ATOM   8468  N N   . GLN C 1 164 ? 145.809 -28.971 258.973 1.00 48.11  ?  158 GLN C N   1 
ATOM   8469  C CA  . GLN C 1 164 ? 144.722 -28.815 258.010 1.00 48.07  ?  158 GLN C CA  1 
ATOM   8470  C C   . GLN C 1 164 ? 143.401 -29.337 258.559 1.00 53.95  ?  158 GLN C C   1 
ATOM   8471  O O   . GLN C 1 164 ? 142.338 -28.811 258.210 1.00 61.22  ?  158 GLN C O   1 
ATOM   8472  C CB  . GLN C 1 164 ? 145.062 -29.530 256.702 1.00 39.30  ?  158 GLN C CB  1 
ATOM   8473  C CG  . GLN C 1 164 ? 146.174 -28.877 255.904 1.00 44.41  ?  158 GLN C CG  1 
ATOM   8474  C CD  . GLN C 1 164 ? 146.440 -29.587 254.592 1.00 43.83  ?  158 GLN C CD  1 
ATOM   8475  O OE1 . GLN C 1 164 ? 146.021 -30.727 254.393 1.00 44.83  ?  158 GLN C OE1 1 
ATOM   8476  N NE2 . GLN C 1 164 ? 147.140 -28.913 253.686 1.00 43.10  ?  158 GLN C NE2 1 
ATOM   8477  N N   . GLY C 1 165 ? 143.444 -30.363 259.410 1.00 50.77  ?  159 GLY C N   1 
ATOM   8478  C CA  . GLY C 1 165 ? 142.213 -30.889 259.975 1.00 53.58  ?  159 GLY C CA  1 
ATOM   8479  C C   . GLY C 1 165 ? 141.496 -29.882 260.852 1.00 48.30  ?  159 GLY C C   1 
ATOM   8480  O O   . GLY C 1 165 ? 140.269 -29.774 260.814 1.00 61.77  ?  159 GLY C O   1 
ATOM   8481  N N   . ILE C 1 166 ? 142.254 -29.122 261.649 1.00 52.89  ?  160 ILE C N   1 
ATOM   8482  C CA  . ILE C 1 166 ? 141.661 -28.128 262.538 1.00 53.50  ?  160 ILE C CA  1 
ATOM   8483  C C   . ILE C 1 166 ? 141.545 -26.754 261.898 1.00 52.71  ?  160 ILE C C   1 
ATOM   8484  O O   . ILE C 1 166 ? 140.883 -25.872 262.467 1.00 56.70  ?  160 ILE C O   1 
ATOM   8485  C CB  . ILE C 1 166 ? 142.469 -28.000 263.845 1.00 54.88  ?  160 ILE C CB  1 
ATOM   8486  C CG1 . ILE C 1 166 ? 143.840 -27.378 263.569 1.00 54.35  ?  160 ILE C CG1 1 
ATOM   8487  C CG2 . ILE C 1 166 ? 142.605 -29.354 264.525 1.00 60.56  ?  160 ILE C CG2 1 
ATOM   8488  C CD1 . ILE C 1 166 ? 144.691 -27.204 264.808 1.00 57.11  ?  160 ILE C CD1 1 
ATOM   8489  N N   . ALA C 1 167 ? 142.163 -26.540 260.740 1.00 52.54  ?  161 ALA C N   1 
ATOM   8490  C CA  . ALA C 1 167 ? 142.118 -25.240 260.093 1.00 59.83  ?  161 ALA C CA  1 
ATOM   8491  C C   . ALA C 1 167 ? 140.707 -24.921 259.610 1.00 63.76  ?  161 ALA C C   1 
ATOM   8492  O O   . ALA C 1 167 ? 139.862 -25.804 259.435 1.00 66.21  ?  161 ALA C O   1 
ATOM   8493  C CB  . ALA C 1 167 ? 143.093 -25.190 258.917 1.00 58.87  ?  161 ALA C CB  1 
ATOM   8494  N N   . ALA C 1 168 ? 140.459 -23.631 259.396 1.00 65.64  ?  162 ALA C N   1 
ATOM   8495  C CA  . ALA C 1 168 ? 139.174 -23.199 258.867 1.00 67.39  ?  162 ALA C CA  1 
ATOM   8496  C C   . ALA C 1 168 ? 138.981 -23.728 257.452 1.00 62.63  ?  162 ALA C C   1 
ATOM   8497  O O   . ALA C 1 168 ? 139.901 -23.705 256.630 1.00 55.12  ?  162 ALA C O   1 
ATOM   8498  C CB  . ALA C 1 168 ? 139.078 -21.674 258.875 1.00 56.50  ?  162 ALA C CB  1 
ATOM   8499  N N   . LYS C 1 169 ? 137.779 -24.218 257.175 1.00 72.21  ?  163 LYS C N   1 
ATOM   8500  C CA  . LYS C 1 169 ? 137.424 -24.722 255.857 1.00 72.49  ?  163 LYS C CA  1 
ATOM   8501  C C   . LYS C 1 169 ? 136.618 -23.661 255.120 1.00 68.62  ?  163 LYS C C   1 
ATOM   8502  O O   . LYS C 1 169 ? 135.689 -23.077 255.688 1.00 72.05  ?  163 LYS C O   1 
ATOM   8503  C CB  . LYS C 1 169 ? 136.620 -26.019 255.965 1.00 70.31  ?  163 LYS C CB  1 
ATOM   8504  C CG  . LYS C 1 169 ? 137.195 -27.033 256.942 1.00 62.71  ?  163 LYS C CG  1 
ATOM   8505  C CD  . LYS C 1 169 ? 138.586 -27.486 256.531 1.00 64.06  ?  163 LYS C CD  1 
ATOM   8506  C CE  . LYS C 1 169 ? 139.138 -28.509 257.512 1.00 56.14  ?  163 LYS C CE  1 
ATOM   8507  N NZ  . LYS C 1 169 ? 140.491 -28.988 257.120 1.00 55.71  1  163 LYS C NZ  1 
ATOM   8508  N N   . VAL C 1 170 ? 136.977 -23.410 253.863 1.00 61.51  ?  164 VAL C N   1 
ATOM   8509  C CA  . VAL C 1 170 ? 136.239 -22.458 253.041 1.00 75.40  ?  164 VAL C CA  1 
ATOM   8510  C C   . VAL C 1 170 ? 134.913 -23.086 252.634 1.00 81.47  ?  164 VAL C C   1 
ATOM   8511  O O   . VAL C 1 170 ? 134.662 -24.266 252.907 1.00 75.17  ?  164 VAL C O   1 
ATOM   8512  C CB  . VAL C 1 170 ? 137.047 -22.026 251.804 1.00 73.14  ?  164 VAL C CB  1 
ATOM   8513  C CG1 . VAL C 1 170 ? 138.368 -21.405 252.219 1.00 61.72  ?  164 VAL C CG1 1 
ATOM   8514  C CG2 . VAL C 1 170 ? 137.273 -23.208 250.878 1.00 74.18  ?  164 VAL C CG2 1 
ATOM   8515  N N   . GLY C 1 171 ? 134.057 -22.302 251.977 1.00 79.84  ?  165 GLY C N   1 
ATOM   8516  C CA  . GLY C 1 171 ? 132.773 -22.825 251.545 1.00 77.21  ?  165 GLY C CA  1 
ATOM   8517  C C   . GLY C 1 171 ? 132.895 -23.927 250.511 1.00 82.85  ?  165 GLY C C   1 
ATOM   8518  O O   . GLY C 1 171 ? 132.059 -24.834 250.464 1.00 93.55  ?  165 GLY C O   1 
ATOM   8519  N N   . THR C 1 172 ? 133.936 -23.871 249.676 1.00 73.07  ?  166 THR C N   1 
ATOM   8520  C CA  . THR C 1 172 ? 134.136 -24.898 248.660 1.00 75.29  ?  166 THR C CA  1 
ATOM   8521  C C   . THR C 1 172 ? 134.678 -26.196 249.254 1.00 70.46  ?  166 THR C C   1 
ATOM   8522  O O   . THR C 1 172 ? 134.318 -27.282 248.785 1.00 61.11  ?  166 THR C O   1 
ATOM   8523  C CB  . THR C 1 172 ? 135.074 -24.378 247.567 1.00 80.99  ?  166 THR C CB  1 
ATOM   8524  O OG1 . THR C 1 172 ? 134.566 -23.146 247.042 1.00 85.16  ?  166 THR C OG1 1 
ATOM   8525  C CG2 . THR C 1 172 ? 135.195 -25.389 246.433 1.00 76.43  ?  166 THR C CG2 1 
ATOM   8526  N N   . GLY C 1 173 ? 135.527 -26.114 250.276 1.00 72.96  ?  167 GLY C N   1 
ATOM   8527  C CA  . GLY C 1 173 ? 135.997 -27.313 250.947 1.00 77.17  ?  167 GLY C CA  1 
ATOM   8528  C C   . GLY C 1 173 ? 137.493 -27.377 251.174 1.00 75.80  ?  167 GLY C C   1 
ATOM   8529  O O   . GLY C 1 173 ? 137.992 -28.319 251.796 1.00 75.09  ?  167 GLY C O   1 
ATOM   8530  N N   . GLU C 1 174 ? 138.219 -26.385 250.677 1.00 75.69  ?  168 GLU C N   1 
ATOM   8531  C CA  . GLU C 1 174 ? 139.663 -26.369 250.837 1.00 61.55  ?  168 GLU C CA  1 
ATOM   8532  C C   . GLU C 1 174 ? 140.047 -25.890 252.237 1.00 62.96  ?  168 GLU C C   1 
ATOM   8533  O O   . GLU C 1 174 ? 139.356 -25.056 252.829 1.00 61.89  ?  168 GLU C O   1 
ATOM   8534  C CB  . GLU C 1 174 ? 140.306 -25.463 249.790 1.00 58.79  ?  168 GLU C CB  1 
ATOM   8535  C CG  . GLU C 1 174 ? 140.206 -25.965 248.349 1.00 73.93  ?  168 GLU C CG  1 
ATOM   8536  C CD  . GLU C 1 174 ? 138.839 -25.736 247.726 1.00 76.07  ?  168 GLU C CD  1 
ATOM   8537  O OE1 . GLU C 1 174 ? 137.901 -25.367 248.460 1.00 69.46  ?  168 GLU C OE1 1 
ATOM   8538  O OE2 . GLU C 1 174 ? 138.702 -25.923 246.497 1.00 79.34  -1 168 GLU C OE2 1 
ATOM   8539  N N   . PRO C 1 175 ? 141.145 -26.407 252.785 1.00 65.59  ?  169 PRO C N   1 
ATOM   8540  C CA  . PRO C 1 175 ? 141.601 -25.951 254.103 1.00 56.50  ?  169 PRO C CA  1 
ATOM   8541  C C   . PRO C 1 175 ? 142.405 -24.662 254.008 1.00 56.15  ?  169 PRO C C   1 
ATOM   8542  O O   . PRO C 1 175 ? 143.181 -24.455 253.072 1.00 47.60  ?  169 PRO C O   1 
ATOM   8543  C CB  . PRO C 1 175 ? 142.477 -27.111 254.587 1.00 53.20  ?  169 PRO C CB  1 
ATOM   8544  C CG  . PRO C 1 175 ? 143.039 -27.683 253.318 1.00 49.40  ?  169 PRO C CG  1 
ATOM   8545  C CD  . PRO C 1 175 ? 141.981 -27.499 252.255 1.00 53.01  ?  169 PRO C CD  1 
ATOM   8546  N N   . CYS C 1 176 ? 142.217 -23.799 255.004 1.00 57.18  ?  170 CYS C N   1 
ATOM   8547  C CA  . CYS C 1 176 ? 142.946 -22.534 255.107 1.00 55.07  ?  170 CYS C CA  1 
ATOM   8548  C C   . CYS C 1 176 ? 144.296 -22.720 255.797 1.00 49.68  ?  170 CYS C C   1 
ATOM   8549  O O   . CYS C 1 176 ? 144.667 -21.976 256.705 1.00 47.48  ?  170 CYS C O   1 
ATOM   8550  C CB  . CYS C 1 176 ? 142.094 -21.502 255.837 1.00 55.52  ?  170 CYS C CB  1 
ATOM   8551  S SG  . CYS C 1 176 ? 140.569 -21.070 254.958 1.00 65.30  ?  170 CYS C SG  1 
ATOM   8552  N N   . CYS C 1 177 ? 145.050 -23.725 255.352 1.00 45.95  ?  171 CYS C N   1 
ATOM   8553  C CA  . CYS C 1 177 ? 146.368 -24.003 255.921 1.00 43.95  ?  171 CYS C CA  1 
ATOM   8554  C C   . CYS C 1 177 ? 147.155 -24.834 254.919 1.00 39.99  ?  171 CYS C C   1 
ATOM   8555  O O   . CYS C 1 177 ? 146.814 -25.994 254.673 1.00 42.66  ?  171 CYS C O   1 
ATOM   8556  C CB  . CYS C 1 177 ? 146.243 -24.728 257.254 1.00 53.98  ?  171 CYS C CB  1 
ATOM   8557  S SG  . CYS C 1 177 ? 147.801 -25.406 257.880 1.00 55.74  ?  171 CYS C SG  1 
ATOM   8558  N N   . ASP C 1 178 ? 148.203 -24.244 254.352 1.00 40.00  ?  172 ASP C N   1 
ATOM   8559  C CA  . ASP C 1 178 ? 149.093 -24.947 253.445 1.00 39.45  ?  172 ASP C CA  1 
ATOM   8560  C C   . ASP C 1 178 ? 150.507 -24.433 253.668 1.00 46.13  ?  172 ASP C C   1 
ATOM   8561  O O   . ASP C 1 178 ? 150.712 -23.338 254.199 1.00 47.76  ?  172 ASP C O   1 
ATOM   8562  C CB  . ASP C 1 178 ? 148.667 -24.764 251.981 1.00 43.28  ?  172 ASP C CB  1 
ATOM   8563  C CG  . ASP C 1 178 ? 149.312 -25.775 251.052 1.00 56.20  ?  172 ASP C CG  1 
ATOM   8564  O OD1 . ASP C 1 178 ? 150.092 -26.621 251.539 1.00 51.27  ?  172 ASP C OD1 1 
ATOM   8565  O OD2 . ASP C 1 178 ? 149.035 -25.725 249.835 1.00 64.48  -1 172 ASP C OD2 1 
ATOM   8566  N N   . TRP C 1 179 ? 151.486 -25.242 253.271 1.00 46.51  ?  173 TRP C N   1 
ATOM   8567  C CA  . TRP C 1 179 ? 152.882 -24.858 253.439 1.00 40.47  ?  173 TRP C CA  1 
ATOM   8568  C C   . TRP C 1 179 ? 153.183 -23.601 252.634 1.00 41.98  ?  173 TRP C C   1 
ATOM   8569  O O   . TRP C 1 179 ? 152.881 -23.528 251.439 1.00 43.25  ?  173 TRP C O   1 
ATOM   8570  C CB  . TRP C 1 179 ? 153.799 -26.000 253.007 1.00 41.40  ?  173 TRP C CB  1 
ATOM   8571  C CG  . TRP C 1 179 ? 155.224 -25.755 253.356 1.00 43.09  ?  173 TRP C CG  1 
ATOM   8572  C CD1 . TRP C 1 179 ? 156.242 -25.463 252.497 1.00 41.74  ?  173 TRP C CD1 1 
ATOM   8573  C CD2 . TRP C 1 179 ? 155.793 -25.757 254.669 1.00 41.22  ?  173 TRP C CD2 1 
ATOM   8574  N NE1 . TRP C 1 179 ? 157.414 -25.294 253.194 1.00 43.84  ?  173 TRP C NE1 1 
ATOM   8575  C CE2 . TRP C 1 179 ? 157.164 -25.469 254.530 1.00 41.48  ?  173 TRP C CE2 1 
ATOM   8576  C CE3 . TRP C 1 179 ? 155.277 -25.981 255.949 1.00 41.85  ?  173 TRP C CE3 1 
ATOM   8577  C CZ2 . TRP C 1 179 ? 158.025 -25.397 255.622 1.00 40.33  ?  173 TRP C CZ2 1 
ATOM   8578  C CZ3 . TRP C 1 179 ? 156.133 -25.910 257.031 1.00 41.46  ?  173 TRP C CZ3 1 
ATOM   8579  C CH2 . TRP C 1 179 ? 157.491 -25.621 256.861 1.00 41.91  ?  173 TRP C CH2 1 
ATOM   8580  N N   . VAL C 1 180 ? 153.784 -22.608 253.290 1.00 39.31  ?  174 VAL C N   1 
ATOM   8581  C CA  . VAL C 1 180 ? 153.947 -21.296 252.672 1.00 42.34  ?  174 VAL C CA  1 
ATOM   8582  C C   . VAL C 1 180 ? 155.362 -21.120 252.130 1.00 40.01  ?  174 VAL C C   1 
ATOM   8583  O O   . VAL C 1 180 ? 155.556 -20.465 251.100 1.00 46.82  ?  174 VAL C O   1 
ATOM   8584  C CB  . VAL C 1 180 ? 153.575 -20.165 253.655 1.00 38.06  ?  174 VAL C CB  1 
ATOM   8585  C CG1 . VAL C 1 180 ? 152.524 -20.641 254.647 1.00 40.29  ?  174 VAL C CG1 1 
ATOM   8586  C CG2 . VAL C 1 180 ? 154.796 -19.621 254.378 1.00 42.06  ?  174 VAL C CG2 1 
ATOM   8587  N N   . GLY C 1 181 ? 156.356 -21.705 252.790 1.00 34.59  ?  175 GLY C N   1 
ATOM   8588  C CA  . GLY C 1 181 ? 157.724 -21.515 252.344 1.00 29.50  ?  175 GLY C CA  1 
ATOM   8589  C C   . GLY C 1 181 ? 158.722 -21.909 253.421 1.00 35.39  ?  175 GLY C C   1 
ATOM   8590  O O   . GLY C 1 181 ? 158.378 -22.571 254.397 1.00 40.05  ?  175 GLY C O   1 
ATOM   8591  N N   . ASP C 1 182 ? 159.958 -21.462 253.216 1.00 38.65  ?  176 ASP C N   1 
ATOM   8592  C CA  . ASP C 1 182 ? 161.121 -21.918 253.962 1.00 40.45  ?  176 ASP C CA  1 
ATOM   8593  C C   . ASP C 1 182 ? 161.567 -20.873 254.980 1.00 44.77  ?  176 ASP C C   1 
ATOM   8594  O O   . ASP C 1 182 ? 161.316 -19.675 254.821 1.00 46.90  ?  176 ASP C O   1 
ATOM   8595  C CB  . ASP C 1 182 ? 162.266 -22.232 252.991 1.00 44.15  ?  176 ASP C CB  1 
ATOM   8596  C CG  . ASP C 1 182 ? 163.470 -22.871 253.669 1.00 53.98  ?  176 ASP C CG  1 
ATOM   8597  O OD1 . ASP C 1 182 ? 163.415 -23.148 254.885 1.00 47.32  ?  176 ASP C OD1 1 
ATOM   8598  O OD2 . ASP C 1 182 ? 164.482 -23.098 252.973 1.00 51.02  -1 176 ASP C OD2 1 
ATOM   8599  N N   . GLU C 1 183 ? 162.229 -21.353 256.037 1.00 46.79  ?  177 GLU C N   1 
ATOM   8600  C CA  . GLU C 1 183 ? 162.911 -20.507 257.022 1.00 49.58  ?  177 GLU C CA  1 
ATOM   8601  C C   . GLU C 1 183 ? 161.967 -19.480 257.647 1.00 49.15  ?  177 GLU C C   1 
ATOM   8602  O O   . GLU C 1 183 ? 162.275 -18.290 257.739 1.00 50.90  ?  177 GLU C O   1 
ATOM   8603  C CB  . GLU C 1 183 ? 164.130 -19.821 256.402 1.00 48.77  ?  177 GLU C CB  1 
ATOM   8604  C CG  . GLU C 1 183 ? 165.307 -20.750 256.157 1.00 54.05  ?  177 GLU C CG  1 
ATOM   8605  C CD  . GLU C 1 183 ? 166.534 -20.015 255.657 1.00 59.90  ?  177 GLU C CD  1 
ATOM   8606  O OE1 . GLU C 1 183 ? 166.400 -18.839 255.256 1.00 57.39  ?  177 GLU C OE1 1 
ATOM   8607  O OE2 . GLU C 1 183 ? 167.632 -20.610 255.669 1.00 60.40  -1 177 GLU C OE2 1 
ATOM   8608  N N   . GLY C 1 184 ? 160.810 -19.955 258.094 1.00 45.87  ?  178 GLY C N   1 
ATOM   8609  C CA  . GLY C 1 184 ? 159.861 -19.079 258.755 1.00 51.58  ?  178 GLY C CA  1 
ATOM   8610  C C   . GLY C 1 184 ? 159.258 -18.023 257.857 1.00 51.42  ?  178 GLY C C   1 
ATOM   8611  O O   . GLY C 1 184 ? 159.062 -16.881 258.294 1.00 47.68  ?  178 GLY C O   1 
ATOM   8612  N N   . ALA C 1 185 ? 158.966 -18.372 256.604 1.00 49.95  ?  179 ALA C N   1 
ATOM   8613  C CA  . ALA C 1 185 ? 158.265 -17.448 255.723 1.00 43.88  ?  179 ALA C CA  1 
ATOM   8614  C C   . ALA C 1 185 ? 156.826 -17.218 256.162 1.00 40.21  ?  179 ALA C C   1 
ATOM   8615  O O   . ALA C 1 185 ? 156.212 -16.233 255.739 1.00 36.43  ?  179 ALA C O   1 
ATOM   8616  C CB  . ALA C 1 185 ? 158.298 -17.969 254.287 1.00 40.18  ?  179 ALA C CB  1 
ATOM   8617  N N   . GLY C 1 186 ? 156.278 -18.100 257.001 1.00 36.65  ?  180 GLY C N   1 
ATOM   8618  C CA  . GLY C 1 186 ? 154.914 -17.916 257.467 1.00 37.24  ?  180 GLY C CA  1 
ATOM   8619  C C   . GLY C 1 186 ? 154.761 -16.707 258.368 1.00 38.40  ?  180 GLY C C   1 
ATOM   8620  O O   . GLY C 1 186 ? 153.793 -15.951 258.248 1.00 44.94  ?  180 GLY C O   1 
ATOM   8621  N N   . HIS C 1 187 ? 155.712 -16.507 259.284 1.00 37.54  ?  181 HIS C N   1 
ATOM   8622  C CA  . HIS C 1 187 ? 155.661 -15.336 260.152 1.00 37.31  ?  181 HIS C CA  1 
ATOM   8623  C C   . HIS C 1 187 ? 155.820 -14.047 259.358 1.00 35.86  ?  181 HIS C C   1 
ATOM   8624  O O   . HIS C 1 187 ? 155.248 -13.015 259.730 1.00 34.95  ?  181 HIS C O   1 
ATOM   8625  C CB  . HIS C 1 187 ? 156.731 -15.438 261.236 1.00 39.55  ?  181 HIS C CB  1 
ATOM   8626  C CG  . HIS C 1 187 ? 156.361 -16.354 262.361 1.00 35.10  ?  181 HIS C CG  1 
ATOM   8627  N ND1 . HIS C 1 187 ? 157.191 -17.359 262.808 1.00 39.18  ?  181 HIS C ND1 1 
ATOM   8628  C CD2 . HIS C 1 187 ? 155.250 -16.413 263.132 1.00 34.56  ?  181 HIS C CD2 1 
ATOM   8629  C CE1 . HIS C 1 187 ? 156.606 -18.000 263.804 1.00 41.94  ?  181 HIS C CE1 1 
ATOM   8630  N NE2 . HIS C 1 187 ? 155.427 -17.445 264.020 1.00 41.82  ?  181 HIS C NE2 1 
ATOM   8631  N N   . PHE C 1 188 ? 156.587 -14.082 258.266 1.00 30.48  ?  182 PHE C N   1 
ATOM   8632  C CA  . PHE C 1 188 ? 156.647 -12.923 257.383 1.00 31.88  ?  182 PHE C CA  1 
ATOM   8633  C C   . PHE C 1 188 ? 155.311 -12.701 256.687 1.00 35.51  ?  182 PHE C C   1 
ATOM   8634  O O   . PHE C 1 188 ? 154.849 -11.560 256.567 1.00 37.68  ?  182 PHE C O   1 
ATOM   8635  C CB  . PHE C 1 188 ? 157.767 -13.094 256.355 1.00 35.87  ?  182 PHE C CB  1 
ATOM   8636  C CG  . PHE C 1 188 ? 157.977 -11.887 255.486 1.00 32.72  ?  182 PHE C CG  1 
ATOM   8637  C CD1 . PHE C 1 188 ? 157.275 -11.736 254.300 1.00 33.93  ?  182 PHE C CD1 1 
ATOM   8638  C CD2 . PHE C 1 188 ? 158.873 -10.900 255.859 1.00 28.91  ?  182 PHE C CD2 1 
ATOM   8639  C CE1 . PHE C 1 188 ? 157.463 -10.624 253.504 1.00 32.70  ?  182 PHE C CE1 1 
ATOM   8640  C CE2 . PHE C 1 188 ? 159.068 -9.787  255.065 1.00 35.62  ?  182 PHE C CE2 1 
ATOM   8641  C CZ  . PHE C 1 188 ? 158.359 -9.647  253.889 1.00 35.70  ?  182 PHE C CZ  1 
ATOM   8642  N N   . VAL C 1 189 ? 154.680 -13.780 256.219 1.00 36.16  ?  183 VAL C N   1 
ATOM   8643  C CA  . VAL C 1 189 ? 153.370 -13.665 255.583 1.00 34.89  ?  183 VAL C CA  1 
ATOM   8644  C C   . VAL C 1 189 ? 152.331 -13.183 256.588 1.00 35.68  ?  183 VAL C C   1 
ATOM   8645  O O   . VAL C 1 189 ? 151.462 -12.366 256.262 1.00 39.51  ?  183 VAL C O   1 
ATOM   8646  C CB  . VAL C 1 189 ? 152.969 -15.010 254.947 1.00 38.84  ?  183 VAL C CB  1 
ATOM   8647  C CG1 . VAL C 1 189 ? 151.504 -14.999 254.544 1.00 49.70  ?  183 VAL C CG1 1 
ATOM   8648  C CG2 . VAL C 1 189 ? 153.849 -15.307 253.743 1.00 33.36  ?  183 VAL C CG2 1 
ATOM   8649  N N   . LYS C 1 190 ? 152.408 -13.677 257.827 1.00 35.19  ?  184 LYS C N   1 
ATOM   8650  C CA  . LYS C 1 190 ? 151.506 -13.202 258.870 1.00 37.78  ?  184 LYS C CA  1 
ATOM   8651  C C   . LYS C 1 190 ? 151.707 -11.714 259.128 1.00 43.88  ?  184 LYS C C   1 
ATOM   8652  O O   . LYS C 1 190 ? 150.746 -10.987 259.405 1.00 50.06  ?  184 LYS C O   1 
ATOM   8653  C CB  . LYS C 1 190 ? 151.719 -14.012 260.151 1.00 35.12  ?  184 LYS C CB  1 
ATOM   8654  C CG  . LYS C 1 190 ? 150.545 -14.001 261.126 1.00 44.96  ?  184 LYS C CG  1 
ATOM   8655  C CD  . LYS C 1 190 ? 150.580 -12.802 262.064 1.00 47.37  ?  184 LYS C CD  1 
ATOM   8656  C CE  . LYS C 1 190 ? 149.494 -12.899 263.123 1.00 55.20  ?  184 LYS C CE  1 
ATOM   8657  N NZ  . LYS C 1 190 ? 148.139 -13.040 262.523 1.00 55.01  1  184 LYS C NZ  1 
ATOM   8658  N N   . MET C 1 191 ? 152.953 -11.243 259.037 1.00 44.01  ?  185 MET C N   1 
ATOM   8659  C CA  . MET C 1 191 ? 153.217 -9.817  259.198 1.00 43.80  ?  185 MET C CA  1 
ATOM   8660  C C   . MET C 1 191 ? 152.569 -9.010  258.080 1.00 43.06  ?  185 MET C C   1 
ATOM   8661  O O   . MET C 1 191 ? 151.963 -7.962  258.331 1.00 50.26  ?  185 MET C O   1 
ATOM   8662  C CB  . MET C 1 191 ? 154.723 -9.567  259.236 1.00 38.04  ?  185 MET C CB  1 
ATOM   8663  C CG  . MET C 1 191 ? 155.105 -8.108  259.390 1.00 42.95  ?  185 MET C CG  1 
ATOM   8664  S SD  . MET C 1 191 ? 156.808 -7.812  258.890 1.00 41.64  ?  185 MET C SD  1 
ATOM   8665  C CE  . MET C 1 191 ? 156.728 -8.295  257.168 1.00 34.55  ?  185 MET C CE  1 
ATOM   8666  N N   . VAL C 1 192 ? 152.685 -9.484  256.837 1.00 35.06  ?  186 VAL C N   1 
ATOM   8667  C CA  . VAL C 1 192 ? 152.048 -8.801  255.716 1.00 40.59  ?  186 VAL C CA  1 
ATOM   8668  C C   . VAL C 1 192 ? 150.533 -8.846  255.853 1.00 45.03  ?  186 VAL C C   1 
ATOM   8669  O O   . VAL C 1 192 ? 149.833 -7.917  255.430 1.00 40.73  ?  186 VAL C O   1 
ATOM   8670  C CB  . VAL C 1 192 ? 152.522 -9.418  254.384 1.00 38.52  ?  186 VAL C CB  1 
ATOM   8671  C CG1 . VAL C 1 192 ? 151.858 -8.730  253.199 1.00 37.16  ?  186 VAL C CG1 1 
ATOM   8672  C CG2 . VAL C 1 192 ? 154.035 -9.328  254.275 1.00 38.20  ?  186 VAL C CG2 1 
ATOM   8673  N N   . HIS C 1 193 ? 150.002 -9.915  256.452 1.00 48.73  ?  187 HIS C N   1 
ATOM   8674  C CA  . HIS C 1 193 ? 148.564 -9.998  256.690 1.00 48.28  ?  187 HIS C CA  1 
ATOM   8675  C C   . HIS C 1 193 ? 148.084 -8.844  257.560 1.00 45.51  ?  187 HIS C C   1 
ATOM   8676  O O   . HIS C 1 193 ? 147.083 -8.189  257.248 1.00 42.50  ?  187 HIS C O   1 
ATOM   8677  C CB  . HIS C 1 193 ? 148.215 -11.337 257.340 1.00 49.05  ?  187 HIS C CB  1 
ATOM   8678  C CG  . HIS C 1 193 ? 147.011 -11.276 258.227 1.00 59.70  ?  187 HIS C CG  1 
ATOM   8679  N ND1 . HIS C 1 193 ? 147.092 -10.971 259.569 1.00 54.66  ?  187 HIS C ND1 1 
ATOM   8680  C CD2 . HIS C 1 193 ? 145.697 -11.469 257.964 1.00 59.98  ?  187 HIS C CD2 1 
ATOM   8681  C CE1 . HIS C 1 193 ? 145.880 -10.979 260.094 1.00 61.97  ?  187 HIS C CE1 1 
ATOM   8682  N NE2 . HIS C 1 193 ? 145.016 -11.281 259.142 1.00 68.63  ?  187 HIS C NE2 1 
ATOM   8683  N N   . ASN C 1 194 ? 148.789 -8.582  258.664 1.00 41.13  ?  188 ASN C N   1 
ATOM   8684  C CA  . ASN C 1 194 ? 148.406 -7.478  259.537 1.00 40.73  ?  188 ASN C CA  1 
ATOM   8685  C C   . ASN C 1 194 ? 148.592 -6.131  258.851 1.00 43.78  ?  188 ASN C C   1 
ATOM   8686  O O   . ASN C 1 194 ? 147.852 -5.185  259.139 1.00 44.31  ?  188 ASN C O   1 
ATOM   8687  C CB  . ASN C 1 194 ? 149.207 -7.529  260.836 1.00 45.79  ?  188 ASN C CB  1 
ATOM   8688  C CG  . ASN C 1 194 ? 148.987 -8.817  261.605 1.00 60.75  ?  188 ASN C CG  1 
ATOM   8689  O OD1 . ASN C 1 194 ? 149.934 -9.547  261.900 1.00 60.36  ?  188 ASN C OD1 1 
ATOM   8690  N ND2 . ASN C 1 194 ? 147.732 -9.105  261.932 1.00 58.24  ?  188 ASN C ND2 1 
ATOM   8691  N N   . GLY C 1 195 ? 149.567 -6.024  257.947 1.00 42.08  ?  189 GLY C N   1 
ATOM   8692  C CA  . GLY C 1 195 ? 149.713 -4.797  257.181 1.00 39.77  ?  189 GLY C CA  1 
ATOM   8693  C C   . GLY C 1 195 ? 148.542 -4.568  256.244 1.00 36.28  ?  189 GLY C C   1 
ATOM   8694  O O   . GLY C 1 195 ? 147.988 -3.467  256.177 1.00 30.59  ?  189 GLY C O   1 
ATOM   8695  N N   . ILE C 1 196 ? 148.153 -5.610  255.503 1.00 37.63  ?  190 ILE C N   1 
ATOM   8696  C CA  . ILE C 1 196 ? 146.955 -5.537  254.671 1.00 44.97  ?  190 ILE C CA  1 
ATOM   8697  C C   . ILE C 1 196 ? 145.727 -5.252  255.525 1.00 47.18  ?  190 ILE C C   1 
ATOM   8698  O O   . ILE C 1 196 ? 144.800 -4.557  255.089 1.00 41.14  ?  190 ILE C O   1 
ATOM   8699  C CB  . ILE C 1 196 ? 146.798 -6.841  253.861 1.00 38.74  ?  190 ILE C CB  1 
ATOM   8700  C CG1 . ILE C 1 196 ? 147.920 -6.973  252.830 1.00 39.92  ?  190 ILE C CG1 1 
ATOM   8701  C CG2 . ILE C 1 196 ? 145.447 -6.894  253.173 1.00 45.40  ?  190 ILE C CG2 1 
ATOM   8702  C CD1 . ILE C 1 196 ? 147.825 -5.977  251.694 1.00 40.00  ?  190 ILE C CD1 1 
ATOM   8703  N N   . GLU C 1 197 ? 145.707 -5.767  256.758 1.00 39.59  ?  191 GLU C N   1 
ATOM   8704  C CA  . GLU C 1 197 ? 144.588 -5.508  257.658 1.00 37.48  ?  191 GLU C CA  1 
ATOM   8705  C C   . GLU C 1 197 ? 144.473 -4.025  257.986 1.00 42.78  ?  191 GLU C C   1 
ATOM   8706  O O   . GLU C 1 197 ? 143.365 -3.478  258.038 1.00 44.83  ?  191 GLU C O   1 
ATOM   8707  C CB  . GLU C 1 197 ? 144.748 -6.334  258.934 1.00 39.85  ?  191 GLU C CB  1 
ATOM   8708  C CG  . GLU C 1 197 ? 143.639 -6.147  259.954 1.00 38.72  ?  191 GLU C CG  1 
ATOM   8709  C CD  . GLU C 1 197 ? 143.766 -7.100  261.126 1.00 50.72  ?  191 GLU C CD  1 
ATOM   8710  O OE1 . GLU C 1 197 ? 144.435 -8.144  260.973 1.00 48.29  ?  191 GLU C OE1 1 
ATOM   8711  O OE2 . GLU C 1 197 ? 143.203 -6.807  262.202 1.00 60.59  -1 191 GLU C OE2 1 
ATOM   8712  N N   . TYR C 1 198 ? 145.607 -3.356  258.206 1.00 39.01  ?  192 TYR C N   1 
ATOM   8713  C CA  . TYR C 1 198 ? 145.582 -1.920  258.463 1.00 38.15  ?  192 TYR C CA  1 
ATOM   8714  C C   . TYR C 1 198 ? 144.997 -1.158  257.281 1.00 37.88  ?  192 TYR C C   1 
ATOM   8715  O O   . TYR C 1 198 ? 144.279 -0.168  257.465 1.00 40.20  ?  192 TYR C O   1 
ATOM   8716  C CB  . TYR C 1 198 ? 146.992 -1.418  258.774 1.00 43.25  ?  192 TYR C CB  1 
ATOM   8717  C CG  . TYR C 1 198 ? 147.411 -1.571  260.219 1.00 45.74  ?  192 TYR C CG  1 
ATOM   8718  C CD1 . TYR C 1 198 ? 147.274 -2.784  260.880 1.00 43.37  ?  192 TYR C CD1 1 
ATOM   8719  C CD2 . TYR C 1 198 ? 147.961 -0.504  260.917 1.00 47.45  ?  192 TYR C CD2 1 
ATOM   8720  C CE1 . TYR C 1 198 ? 147.661 -2.928  262.198 1.00 52.97  ?  192 TYR C CE1 1 
ATOM   8721  C CE2 . TYR C 1 198 ? 148.353 -0.639  262.235 1.00 49.04  ?  192 TYR C CE2 1 
ATOM   8722  C CZ  . TYR C 1 198 ? 148.200 -1.852  262.871 1.00 59.47  ?  192 TYR C CZ  1 
ATOM   8723  O OH  . TYR C 1 198 ? 148.588 -1.990  264.184 1.00 67.87  ?  192 TYR C OH  1 
ATOM   8724  N N   . GLY C 1 199 ? 145.287 -1.609  256.061 1.00 41.64  ?  193 GLY C N   1 
ATOM   8725  C CA  . GLY C 1 199 ? 144.814 -0.891  254.888 1.00 43.61  ?  193 GLY C CA  1 
ATOM   8726  C C   . GLY C 1 199 ? 143.315 -1.012  254.692 1.00 47.24  ?  193 GLY C C   1 
ATOM   8727  O O   . GLY C 1 199 ? 142.627 -0.017  254.444 1.00 36.52  ?  193 GLY C O   1 
ATOM   8728  N N   . ASP C 1 200 ? 142.787 -2.235  254.799 1.00 50.47  ?  194 ASP C N   1 
ATOM   8729  C CA  . ASP C 1 200 ? 141.356 -2.440  254.598 1.00 43.89  ?  194 ASP C CA  1 
ATOM   8730  C C   . ASP C 1 200 ? 140.538 -1.711  255.656 1.00 41.85  ?  194 ASP C C   1 
ATOM   8731  O O   . ASP C 1 200 ? 139.481 -1.146  255.352 1.00 42.75  ?  194 ASP C O   1 
ATOM   8732  C CB  . ASP C 1 200 ? 141.031 -3.934  254.603 1.00 47.49  ?  194 ASP C CB  1 
ATOM   8733  C CG  . ASP C 1 200 ? 141.638 -4.669  253.423 1.00 53.46  ?  194 ASP C CG  1 
ATOM   8734  O OD1 . ASP C 1 200 ? 142.361 -4.032  252.628 1.00 55.43  ?  194 ASP C OD1 1 
ATOM   8735  O OD2 . ASP C 1 200 ? 141.388 -5.886  253.289 1.00 50.21  -1 194 ASP C OD2 1 
ATOM   8736  N N   . MET C 1 201 ? 141.011 -1.710  256.904 1.00 40.74  ?  195 MET C N   1 
ATOM   8737  C CA  . MET C 1 201 ? 140.282 -1.026  257.968 1.00 35.23  ?  195 MET C CA  1 
ATOM   8738  C C   . MET C 1 201 ? 140.302 0.485   257.771 1.00 37.65  ?  195 MET C C   1 
ATOM   8739  O O   . MET C 1 201 ? 139.285 1.156   257.984 1.00 37.35  ?  195 MET C O   1 
ATOM   8740  C CB  . MET C 1 201 ? 140.867 -1.399  259.329 1.00 36.20  ?  195 MET C CB  1 
ATOM   8741  C CG  . MET C 1 201 ? 140.729 -2.871  259.679 1.00 34.34  ?  195 MET C CG  1 
ATOM   8742  S SD  . MET C 1 201 ? 141.551 -3.298  261.226 1.00 41.61  ?  195 MET C SD  1 
ATOM   8743  C CE  . MET C 1 201 ? 140.628 -2.297  262.390 1.00 40.17  ?  195 MET C CE  1 
ATOM   8744  N N   . GLN C 1 202 ? 141.448 1.040   257.366 1.00 36.82  ?  196 GLN C N   1 
ATOM   8745  C CA  . GLN C 1 202 ? 141.517 2.473   257.105 1.00 37.98  ?  196 GLN C CA  1 
ATOM   8746  C C   . GLN C 1 202 ? 140.710 2.855   255.870 1.00 40.76  ?  196 GLN C C   1 
ATOM   8747  O O   . GLN C 1 202 ? 140.122 3.941   255.827 1.00 37.77  ?  196 GLN C O   1 
ATOM   8748  C CB  . GLN C 1 202 ? 142.973 2.912   256.949 1.00 34.15  ?  196 GLN C CB  1 
ATOM   8749  C CG  . GLN C 1 202 ? 143.153 4.397   256.670 1.00 34.74  ?  196 GLN C CG  1 
ATOM   8750  C CD  . GLN C 1 202 ? 142.600 5.275   257.777 1.00 39.15  ?  196 GLN C CD  1 
ATOM   8751  O OE1 . GLN C 1 202 ? 141.964 6.297   257.515 1.00 35.46  ?  196 GLN C OE1 1 
ATOM   8752  N NE2 . GLN C 1 202 ? 142.848 4.886   259.023 1.00 29.83  ?  196 GLN C NE2 1 
ATOM   8753  N N   . LEU C 1 203 ? 140.667 1.976   254.865 1.00 42.36  ?  197 LEU C N   1 
ATOM   8754  C CA  . LEU C 1 203 ? 139.865 2.245   253.675 1.00 38.69  ?  197 LEU C CA  1 
ATOM   8755  C C   . LEU C 1 203 ? 138.381 2.323   254.013 1.00 45.40  ?  197 LEU C C   1 
ATOM   8756  O O   . LEU C 1 203 ? 137.659 3.174   253.481 1.00 47.60  ?  197 LEU C O   1 
ATOM   8757  C CB  . LEU C 1 203 ? 140.120 1.169   252.621 1.00 33.75  ?  197 LEU C CB  1 
ATOM   8758  C CG  . LEU C 1 203 ? 141.395 1.291   251.787 1.00 40.12  ?  197 LEU C CG  1 
ATOM   8759  C CD1 . LEU C 1 203 ? 141.575 0.066   250.907 1.00 43.10  ?  197 LEU C CD1 1 
ATOM   8760  C CD2 . LEU C 1 203 ? 141.349 2.550   250.946 1.00 37.42  ?  197 LEU C CD2 1 
ATOM   8761  N N   . ILE C 1 204 ? 137.906 1.437   254.893 1.00 39.91  ?  198 ILE C N   1 
ATOM   8762  C CA  . ILE C 1 204 ? 136.506 1.477   255.311 1.00 37.48  ?  198 ILE C CA  1 
ATOM   8763  C C   . ILE C 1 204 ? 136.207 2.779   256.042 1.00 40.03  ?  198 ILE C C   1 
ATOM   8764  O O   . ILE C 1 204 ? 135.141 3.381   255.863 1.00 40.35  ?  198 ILE C O   1 
ATOM   8765  C CB  . ILE C 1 204 ? 136.174 0.248   256.179 1.00 37.96  ?  198 ILE C CB  1 
ATOM   8766  C CG1 . ILE C 1 204 ? 136.303 -1.036  255.358 1.00 45.37  ?  198 ILE C CG1 1 
ATOM   8767  C CG2 . ILE C 1 204 ? 134.777 0.364   256.771 1.00 34.11  ?  198 ILE C CG2 1 
ATOM   8768  C CD1 . ILE C 1 204 ? 136.073 -2.298  256.158 1.00 32.91  ?  198 ILE C CD1 1 
ATOM   8769  N N   . CYS C 1 205 ? 137.148 3.241   256.868 1.00 41.52  ?  199 CYS C N   1 
ATOM   8770  C CA  . CYS C 1 205 ? 136.940 4.478   257.614 1.00 39.29  ?  199 CYS C CA  1 
ATOM   8771  C C   . CYS C 1 205 ? 136.890 5.686   256.687 1.00 39.71  ?  199 CYS C C   1 
ATOM   8772  O O   . CYS C 1 205 ? 136.110 6.618   256.917 1.00 37.81  ?  199 CYS C O   1 
ATOM   8773  C CB  . CYS C 1 205 ? 138.041 4.647   258.658 1.00 40.70  ?  199 CYS C CB  1 
ATOM   8774  S SG  . CYS C 1 205 ? 138.024 3.386   259.943 1.00 54.57  ?  199 CYS C SG  1 
ATOM   8775  N N   . GLU C 1 206 ? 137.715 5.692   255.637 1.00 38.88  ?  200 GLU C N   1 
ATOM   8776  C CA  . GLU C 1 206 ? 137.695 6.805   254.695 1.00 41.28  ?  200 GLU C CA  1 
ATOM   8777  C C   . GLU C 1 206 ? 136.393 6.848   253.908 1.00 43.10  ?  200 GLU C C   1 
ATOM   8778  O O   . GLU C 1 206 ? 135.902 7.936   253.584 1.00 41.50  ?  200 GLU C O   1 
ATOM   8779  C CB  . GLU C 1 206 ? 138.894 6.713   253.751 1.00 37.98  ?  200 GLU C CB  1 
ATOM   8780  C CG  . GLU C 1 206 ? 140.233 6.867   254.456 1.00 44.05  ?  200 GLU C CG  1 
ATOM   8781  C CD  . GLU C 1 206 ? 141.413 6.681   253.526 1.00 41.47  ?  200 GLU C CD  1 
ATOM   8782  O OE1 . GLU C 1 206 ? 141.201 6.607   252.297 1.00 44.54  ?  200 GLU C OE1 1 
ATOM   8783  O OE2 . GLU C 1 206 ? 142.555 6.606   254.026 1.00 38.53  -1 200 GLU C OE2 1 
ATOM   8784  N N   . ALA C 1 207 ? 135.820 5.685   253.593 1.00 46.09  ?  201 ALA C N   1 
ATOM   8785  C CA  . ALA C 1 207 ? 134.497 5.660   252.978 1.00 42.64  ?  201 ALA C CA  1 
ATOM   8786  C C   . ALA C 1 207 ? 133.426 6.082   253.974 1.00 44.67  ?  201 ALA C C   1 
ATOM   8787  O O   . ALA C 1 207 ? 132.477 6.789   253.614 1.00 42.87  ?  201 ALA C O   1 
ATOM   8788  C CB  . ALA C 1 207 ? 134.201 4.267   252.425 1.00 42.40  ?  201 ALA C CB  1 
ATOM   8789  N N   . TYR C 1 208 ? 133.565 5.657   255.232 1.00 43.69  ?  202 TYR C N   1 
ATOM   8790  C CA  . TYR C 1 208 ? 132.625 6.064   256.272 1.00 43.06  ?  202 TYR C CA  1 
ATOM   8791  C C   . TYR C 1 208 ? 132.637 7.575   256.468 1.00 47.06  ?  202 TYR C C   1 
ATOM   8792  O O   . TYR C 1 208 ? 131.592 8.184   256.722 1.00 45.30  ?  202 TYR C O   1 
ATOM   8793  C CB  . TYR C 1 208 ? 132.963 5.341   257.578 1.00 47.92  ?  202 TYR C CB  1 
ATOM   8794  C CG  . TYR C 1 208 ? 132.353 5.945   258.826 1.00 46.81  ?  202 TYR C CG  1 
ATOM   8795  C CD1 . TYR C 1 208 ? 131.083 5.579   259.250 1.00 48.00  ?  202 TYR C CD1 1 
ATOM   8796  C CD2 . TYR C 1 208 ? 133.058 6.866   259.592 1.00 46.74  ?  202 TYR C CD2 1 
ATOM   8797  C CE1 . TYR C 1 208 ? 130.528 6.123   260.392 1.00 52.73  ?  202 TYR C CE1 1 
ATOM   8798  C CE2 . TYR C 1 208 ? 132.509 7.416   260.734 1.00 49.77  ?  202 TYR C CE2 1 
ATOM   8799  C CZ  . TYR C 1 208 ? 131.245 7.041   261.130 1.00 50.26  ?  202 TYR C CZ  1 
ATOM   8800  O OH  . TYR C 1 208 ? 130.694 7.584   262.269 1.00 46.39  ?  202 TYR C OH  1 
ATOM   8801  N N   . HIS C 1 209 ? 133.813 8.197   256.349 1.00 52.60  ?  203 HIS C N   1 
ATOM   8802  C CA  . HIS C 1 209 ? 133.914 9.637   256.566 1.00 43.09  ?  203 HIS C CA  1 
ATOM   8803  C C   . HIS C 1 209 ? 133.202 10.414  255.467 1.00 46.66  ?  203 HIS C C   1 
ATOM   8804  O O   . HIS C 1 209 ? 132.602 11.463  255.730 1.00 49.43  ?  203 HIS C O   1 
ATOM   8805  C CB  . HIS C 1 209 ? 135.381 10.053  256.649 1.00 42.37  ?  203 HIS C CB  1 
ATOM   8806  C CG  . HIS C 1 209 ? 135.609 11.314  257.423 1.00 45.30  ?  203 HIS C CG  1 
ATOM   8807  N ND1 . HIS C 1 209 ? 136.863 11.848  257.624 1.00 41.97  ?  203 HIS C ND1 1 
ATOM   8808  C CD2 . HIS C 1 209 ? 134.742 12.143  258.050 1.00 48.82  ?  203 HIS C CD2 1 
ATOM   8809  C CE1 . HIS C 1 209 ? 136.759 12.953  258.340 1.00 37.50  ?  203 HIS C CE1 1 
ATOM   8810  N NE2 . HIS C 1 209 ? 135.483 13.155  258.612 1.00 46.37  ?  203 HIS C NE2 1 
ATOM   8811  N N   . LEU C 1 210 ? 133.263 9.922   254.228 1.00 49.19  ?  204 LEU C N   1 
ATOM   8812  C CA  . LEU C 1 210 ? 132.565 10.592  253.136 1.00 52.11  ?  204 LEU C CA  1 
ATOM   8813  C C   . LEU C 1 210 ? 131.055 10.465  253.287 1.00 57.42  ?  204 LEU C C   1 
ATOM   8814  O O   . LEU C 1 210 ? 130.316 11.420  253.023 1.00 53.60  ?  204 LEU C O   1 
ATOM   8815  C CB  . LEU C 1 210 ? 133.019 10.024  251.791 1.00 44.38  ?  204 LEU C CB  1 
ATOM   8816  C CG  . LEU C 1 210 ? 134.465 10.288  251.374 1.00 44.74  ?  204 LEU C CG  1 
ATOM   8817  C CD1 . LEU C 1 210 ? 134.735 9.709   249.994 1.00 45.71  ?  204 LEU C CD1 1 
ATOM   8818  C CD2 . LEU C 1 210 ? 134.765 11.776  251.399 1.00 46.61  ?  204 LEU C CD2 1 
ATOM   8819  N N   . MET C 1 211 ? 130.576 9.294   253.715 1.00 55.81  ?  205 MET C N   1 
ATOM   8820  C CA  . MET C 1 211 ? 129.140 9.101   253.877 1.00 51.96  ?  205 MET C CA  1 
ATOM   8821  C C   . MET C 1 211 ? 128.573 9.970   254.992 1.00 54.28  ?  205 MET C C   1 
ATOM   8822  O O   . MET C 1 211 ? 127.391 10.330  254.954 1.00 61.58  ?  205 MET C O   1 
ATOM   8823  C CB  . MET C 1 211 ? 128.837 7.625   254.137 1.00 45.60  ?  205 MET C CB  1 
ATOM   8824  C CG  . MET C 1 211 ? 128.728 6.795   252.867 1.00 57.66  ?  205 MET C CG  1 
ATOM   8825  S SD  . MET C 1 211 ? 129.197 5.066   253.073 1.00 64.14  ?  205 MET C SD  1 
ATOM   8826  C CE  . MET C 1 211 ? 128.135 4.570   254.421 1.00 39.77  ?  205 MET C CE  1 
ATOM   8827  N N   . LYS C 1 212 ? 129.392 10.331  255.978 1.00 48.78  ?  206 LYS C N   1 
ATOM   8828  C CA  . LYS C 1 212 ? 128.920 11.129  257.102 1.00 45.96  ?  206 LYS C CA  1 
ATOM   8829  C C   . LYS C 1 212 ? 129.057 12.628  256.859 1.00 50.79  ?  206 LYS C C   1 
ATOM   8830  O O   . LYS C 1 212 ? 128.156 13.396  257.215 1.00 59.94  ?  206 LYS C O   1 
ATOM   8831  C CB  . LYS C 1 212 ? 129.673 10.738  258.378 1.00 41.30  ?  206 LYS C CB  1 
ATOM   8832  C CG  . LYS C 1 212 ? 129.387 11.639  259.569 1.00 50.03  ?  206 LYS C CG  1 
ATOM   8833  C CD  . LYS C 1 212 ? 130.142 11.190  260.809 1.00 53.37  ?  206 LYS C CD  1 
ATOM   8834  C CE  . LYS C 1 212 ? 130.058 12.236  261.911 1.00 68.19  ?  206 LYS C CE  1 
ATOM   8835  N NZ  . LYS C 1 212 ? 128.650 12.609  262.229 1.00 58.64  1  206 LYS C NZ  1 
ATOM   8836  N N   . ASP C 1 213 ? 130.161 13.066  256.251 1.00 52.12  ?  207 ASP C N   1 
ATOM   8837  C CA  . ASP C 1 213 ? 130.451 14.490  256.139 1.00 52.03  ?  207 ASP C CA  1 
ATOM   8838  C C   . ASP C 1 213 ? 130.199 15.069  254.752 1.00 53.06  ?  207 ASP C C   1 
ATOM   8839  O O   . ASP C 1 213 ? 130.070 16.292  254.630 1.00 54.09  ?  207 ASP C O   1 
ATOM   8840  C CB  . ASP C 1 213 ? 131.905 14.766  256.539 1.00 55.00  ?  207 ASP C CB  1 
ATOM   8841  C CG  . ASP C 1 213 ? 132.150 14.555  258.020 1.00 54.75  ?  207 ASP C CG  1 
ATOM   8842  O OD1 . ASP C 1 213 ? 131.188 14.216  258.741 1.00 54.10  ?  207 ASP C OD1 1 
ATOM   8843  O OD2 . ASP C 1 213 ? 133.305 14.731  258.464 1.00 57.80  -1 207 ASP C OD2 1 
ATOM   8844  N N   . VAL C 1 214 ? 130.134 14.244  253.713 1.00 52.49  ?  208 VAL C N   1 
ATOM   8845  C CA  . VAL C 1 214 ? 129.839 14.714  252.362 1.00 58.33  ?  208 VAL C CA  1 
ATOM   8846  C C   . VAL C 1 214 ? 128.371 14.513  252.012 1.00 64.55  ?  208 VAL C C   1 
ATOM   8847  O O   . VAL C 1 214 ? 127.708 15.431  251.529 1.00 69.17  ?  208 VAL C O   1 
ATOM   8848  C CB  . VAL C 1 214 ? 130.761 14.021  251.333 1.00 55.27  ?  208 VAL C CB  1 
ATOM   8849  C CG1 . VAL C 1 214 ? 130.346 14.387  249.916 1.00 51.52  ?  208 VAL C CG1 1 
ATOM   8850  C CG2 . VAL C 1 214 ? 132.209 14.403  251.582 1.00 56.12  ?  208 VAL C CG2 1 
ATOM   8851  N N   . LEU C 1 215 ? 127.845 13.315  252.253 1.00 60.91  ?  209 LEU C N   1 
ATOM   8852  C CA  . LEU C 1 215 ? 126.442 13.025  251.996 1.00 50.47  ?  209 LEU C CA  1 
ATOM   8853  C C   . LEU C 1 215 ? 125.550 13.286  253.202 1.00 56.63  ?  209 LEU C C   1 
ATOM   8854  O O   . LEU C 1 215 ? 124.322 13.258  253.060 1.00 62.63  ?  209 LEU C O   1 
ATOM   8855  C CB  . LEU C 1 215 ? 126.278 11.570  251.545 1.00 55.93  ?  209 LEU C CB  1 
ATOM   8856  C CG  . LEU C 1 215 ? 126.980 11.201  250.237 1.00 48.87  ?  209 LEU C CG  1 
ATOM   8857  C CD1 . LEU C 1 215 ? 126.724 9.746   249.877 1.00 58.01  ?  209 LEU C CD1 1 
ATOM   8858  C CD2 . LEU C 1 215 ? 126.528 12.122  249.116 1.00 57.90  ?  209 LEU C CD2 1 
ATOM   8859  N N   . GLY C 1 216 ? 126.129 13.537  254.375 1.00 60.14  ?  210 GLY C N   1 
ATOM   8860  C CA  . GLY C 1 216 ? 125.338 13.810  255.560 1.00 65.40  ?  210 GLY C CA  1 
ATOM   8861  C C   . GLY C 1 216 ? 124.454 12.670  256.005 1.00 58.71  ?  210 GLY C C   1 
ATOM   8862  O O   . GLY C 1 216 ? 123.453 12.904  256.688 1.00 66.08  ?  210 GLY C O   1 
ATOM   8863  N N   . MET C 1 217 ? 124.794 11.438  255.639 1.00 54.38  ?  211 MET C N   1 
ATOM   8864  C CA  . MET C 1 217 ? 123.971 10.290  255.985 1.00 58.95  ?  211 MET C CA  1 
ATOM   8865  C C   . MET C 1 217 ? 124.016 10.022  257.487 1.00 66.86  ?  211 MET C C   1 
ATOM   8866  O O   . MET C 1 217 ? 124.897 10.496  258.209 1.00 65.41  ?  211 MET C O   1 
ATOM   8867  C CB  . MET C 1 217 ? 124.433 9.053   255.217 1.00 50.13  ?  211 MET C CB  1 
ATOM   8868  C CG  . MET C 1 217 ? 124.257 9.162   253.714 1.00 52.98  ?  211 MET C CG  1 
ATOM   8869  S SD  . MET C 1 217 ? 125.189 7.905   252.821 1.00 67.95  ?  211 MET C SD  1 
ATOM   8870  C CE  . MET C 1 217 ? 124.720 6.430   253.721 1.00 53.88  ?  211 MET C CE  1 
ATOM   8871  N N   . ALA C 1 218 ? 123.043 9.246   257.954 1.00 66.64  ?  212 ALA C N   1 
ATOM   8872  C CA  . ALA C 1 218 ? 122.921 8.901   259.361 1.00 65.23  ?  212 ALA C CA  1 
ATOM   8873  C C   . ALA C 1 218 ? 123.526 7.528   259.632 1.00 65.48  ?  212 ALA C C   1 
ATOM   8874  O O   . ALA C 1 218 ? 123.840 6.764   258.716 1.00 63.74  ?  212 ALA C O   1 
ATOM   8875  C CB  . ALA C 1 218 ? 121.456 8.937   259.799 1.00 65.29  ?  212 ALA C CB  1 
ATOM   8876  N N   . GLN C 1 219 ? 123.674 7.219   260.923 1.00 63.27  ?  213 GLN C N   1 
ATOM   8877  C CA  . GLN C 1 219 ? 124.339 5.984   261.331 1.00 60.43  ?  213 GLN C CA  1 
ATOM   8878  C C   . GLN C 1 219 ? 123.616 4.756   260.792 1.00 69.67  ?  213 GLN C C   1 
ATOM   8879  O O   . GLN C 1 219 ? 124.242 3.847   260.235 1.00 61.99  ?  213 GLN C O   1 
ATOM   8880  C CB  . GLN C 1 219 ? 124.435 5.927   262.856 1.00 65.34  ?  213 GLN C CB  1 
ATOM   8881  C CG  . GLN C 1 219 ? 125.323 7.001   263.464 1.00 74.10  ?  213 GLN C CG  1 
ATOM   8882  C CD  . GLN C 1 219 ? 126.796 6.755   263.202 1.00 67.31  ?  213 GLN C CD  1 
ATOM   8883  O OE1 . GLN C 1 219 ? 127.249 5.611   263.165 1.00 67.46  ?  213 GLN C OE1 1 
ATOM   8884  N NE2 . GLN C 1 219 ? 127.551 7.831   263.014 1.00 51.85  ?  213 GLN C NE2 1 
ATOM   8885  N N   . ASP C 1 220 ? 122.292 4.711   260.950 1.00 73.69  ?  214 ASP C N   1 
ATOM   8886  C CA  . ASP C 1 220 ? 121.535 3.549   260.496 1.00 61.96  ?  214 ASP C CA  1 
ATOM   8887  C C   . ASP C 1 220 ? 121.542 3.440   258.976 1.00 62.40  ?  214 ASP C C   1 
ATOM   8888  O O   . ASP C 1 220 ? 121.636 2.335   258.430 1.00 68.30  ?  214 ASP C O   1 
ATOM   8889  C CB  . ASP C 1 220 ? 120.106 3.618   261.031 1.00 70.23  ?  214 ASP C CB  1 
ATOM   8890  C CG  . ASP C 1 220 ? 120.041 3.453   262.537 1.00 79.85  ?  214 ASP C CG  1 
ATOM   8891  O OD1 . ASP C 1 220 ? 120.560 2.437   263.047 1.00 73.23  ?  214 ASP C OD1 1 
ATOM   8892  O OD2 . ASP C 1 220 ? 119.483 4.344   263.211 1.00 89.98  -1 214 ASP C OD2 1 
ATOM   8893  N N   . GLU C 1 221 ? 121.447 4.573   258.277 1.00 61.41  ?  215 GLU C N   1 
ATOM   8894  C CA  . GLU C 1 221 ? 121.525 4.542   256.820 1.00 64.85  ?  215 GLU C CA  1 
ATOM   8895  C C   . GLU C 1 221 ? 122.910 4.112   256.354 1.00 66.64  ?  215 GLU C C   1 
ATOM   8896  O O   . GLU C 1 221 ? 123.040 3.384   255.362 1.00 60.68  ?  215 GLU C O   1 
ATOM   8897  C CB  . GLU C 1 221 ? 121.167 5.911   256.241 1.00 55.20  ?  215 GLU C CB  1 
ATOM   8898  C CG  . GLU C 1 221 ? 121.208 5.963   254.722 1.00 52.85  ?  215 GLU C CG  1 
ATOM   8899  C CD  . GLU C 1 221 ? 121.035 7.367   254.181 1.00 62.05  ?  215 GLU C CD  1 
ATOM   8900  O OE1 . GLU C 1 221 ? 120.891 8.305   254.993 1.00 59.87  ?  215 GLU C OE1 1 
ATOM   8901  O OE2 . GLU C 1 221 ? 121.045 7.532   252.942 1.00 55.23  -1 215 GLU C OE2 1 
ATOM   8902  N N   . MET C 1 222 ? 123.956 4.550   257.059 1.00 62.88  ?  216 MET C N   1 
ATOM   8903  C CA  . MET C 1 222 ? 125.309 4.131   256.711 1.00 52.55  ?  216 MET C CA  1 
ATOM   8904  C C   . MET C 1 222 ? 125.513 2.639   256.944 1.00 57.44  ?  216 MET C C   1 
ATOM   8905  O O   . MET C 1 222 ? 126.260 1.995   256.200 1.00 52.87  ?  216 MET C O   1 
ATOM   8906  C CB  . MET C 1 222 ? 126.333 4.943   257.506 1.00 57.55  ?  216 MET C CB  1 
ATOM   8907  C CG  . MET C 1 222 ? 126.465 6.390   257.047 1.00 62.61  ?  216 MET C CG  1 
ATOM   8908  S SD  . MET C 1 222 ? 127.811 7.281   257.853 1.00 57.14  ?  216 MET C SD  1 
ATOM   8909  C CE  . MET C 1 222 ? 127.296 7.200   259.566 1.00 56.28  ?  216 MET C CE  1 
ATOM   8910  N N   . ALA C 1 223 ? 124.859 2.074   257.962 1.00 57.95  ?  217 ALA C N   1 
ATOM   8911  C CA  . ALA C 1 223 ? 124.949 0.635   258.186 1.00 56.79  ?  217 ALA C CA  1 
ATOM   8912  C C   . ALA C 1 223 ? 124.269 -0.141  257.066 1.00 63.06  ?  217 ALA C C   1 
ATOM   8913  O O   . ALA C 1 223 ? 124.726 -1.226  256.688 1.00 61.36  ?  217 ALA C O   1 
ATOM   8914  C CB  . ALA C 1 223 ? 124.337 0.272   259.539 1.00 62.60  ?  217 ALA C CB  1 
ATOM   8915  N N   . GLN C 1 224 ? 123.173 0.398   256.525 1.00 62.76  ?  218 GLN C N   1 
ATOM   8916  C CA  . GLN C 1 224 ? 122.500 -0.260  255.410 1.00 67.59  ?  218 GLN C CA  1 
ATOM   8917  C C   . GLN C 1 224 ? 123.351 -0.216  254.148 1.00 64.34  ?  218 GLN C C   1 
ATOM   8918  O O   . GLN C 1 224 ? 123.336 -1.159  253.348 1.00 62.43  ?  218 GLN C O   1 
ATOM   8919  C CB  . GLN C 1 224 ? 121.140 0.390   255.158 1.00 74.77  ?  218 GLN C CB  1 
ATOM   8920  C CG  . GLN C 1 224 ? 120.152 0.251   256.305 1.00 82.94  ?  218 GLN C CG  1 
ATOM   8921  C CD  . GLN C 1 224 ? 118.826 0.928   256.012 1.00 88.77  ?  218 GLN C CD  1 
ATOM   8922  O OE1 . GLN C 1 224 ? 118.696 1.670   255.038 1.00 82.90  ?  218 GLN C OE1 1 
ATOM   8923  N NE2 . GLN C 1 224 ? 117.832 0.675   256.857 1.00 82.75  ?  218 GLN C NE2 1 
ATOM   8924  N N   . ALA C 1 225 ? 124.099 0.873   253.952 1.00 65.30  ?  219 ALA C N   1 
ATOM   8925  C CA  . ALA C 1 225 ? 124.918 1.002   252.751 1.00 57.33  ?  219 ALA C CA  1 
ATOM   8926  C C   . ALA C 1 225 ? 126.017 -0.051  252.714 1.00 59.37  ?  219 ALA C C   1 
ATOM   8927  O O   . ALA C 1 225 ? 126.295 -0.632  251.658 1.00 59.57  ?  219 ALA C O   1 
ATOM   8928  C CB  . ALA C 1 225 ? 125.515 2.407   252.671 1.00 53.22  ?  219 ALA C CB  1 
ATOM   8929  N N   . PHE C 1 226 ? 126.655 -0.312  253.858 1.00 60.00  ?  220 PHE C N   1 
ATOM   8930  C CA  . PHE C 1 226 ? 127.688 -1.342  253.900 1.00 59.99  ?  220 PHE C CA  1 
ATOM   8931  C C   . PHE C 1 226 ? 127.090 -2.731  253.715 1.00 61.16  ?  220 PHE C C   1 
ATOM   8932  O O   . PHE C 1 226 ? 127.686 -3.583  253.044 1.00 58.46  ?  220 PHE C O   1 
ATOM   8933  C CB  . PHE C 1 226 ? 128.467 -1.258  255.213 1.00 60.39  ?  220 PHE C CB  1 
ATOM   8934  C CG  . PHE C 1 226 ? 129.476 -0.144  255.250 1.00 56.41  ?  220 PHE C CG  1 
ATOM   8935  C CD1 . PHE C 1 226 ? 130.692 -0.274  254.599 1.00 59.51  ?  220 PHE C CD1 1 
ATOM   8936  C CD2 . PHE C 1 226 ? 129.212 1.027   255.938 1.00 52.06  ?  220 PHE C CD2 1 
ATOM   8937  C CE1 . PHE C 1 226 ? 131.624 0.747   254.631 1.00 52.33  ?  220 PHE C CE1 1 
ATOM   8938  C CE2 . PHE C 1 226 ? 130.141 2.051   255.975 1.00 51.28  ?  220 PHE C CE2 1 
ATOM   8939  C CZ  . PHE C 1 226 ? 131.348 1.911   255.320 1.00 50.86  ?  220 PHE C CZ  1 
ATOM   8940  N N   . GLU C 1 227 ? 125.914 -2.979  254.297 1.00 60.34  ?  221 GLU C N   1 
ATOM   8941  C CA  . GLU C 1 227 ? 125.243 -4.258  254.081 1.00 57.58  ?  221 GLU C CA  1 
ATOM   8942  C C   . GLU C 1 227 ? 124.900 -4.455  252.610 1.00 58.94  ?  221 GLU C C   1 
ATOM   8943  O O   . GLU C 1 227 ? 124.974 -5.575  252.092 1.00 61.16  ?  221 GLU C O   1 
ATOM   8944  C CB  . GLU C 1 227 ? 123.985 -4.347  254.945 1.00 61.34  ?  221 GLU C CB  1 
ATOM   8945  C CG  . GLU C 1 227 ? 124.265 -4.532  256.426 1.00 61.67  ?  221 GLU C CG  1 
ATOM   8946  C CD  . GLU C 1 227 ? 123.005 -4.526  257.268 1.00 72.23  ?  221 GLU C CD  1 
ATOM   8947  O OE1 . GLU C 1 227 ? 121.913 -4.291  256.709 1.00 71.73  ?  221 GLU C OE1 1 
ATOM   8948  O OE2 . GLU C 1 227 ? 123.107 -4.757  258.492 1.00 68.90  -1 221 GLU C OE2 1 
ATOM   8949  N N   . ASP C 1 228 ? 124.524 -3.375  251.920 1.00 57.37  ?  222 ASP C N   1 
ATOM   8950  C CA  . ASP C 1 228 ? 124.300 -3.461  250.480 1.00 63.53  ?  222 ASP C CA  1 
ATOM   8951  C C   . ASP C 1 228 ? 125.592 -3.786  249.743 1.00 60.24  ?  222 ASP C C   1 
ATOM   8952  O O   . ASP C 1 228 ? 125.600 -4.613  248.823 1.00 61.80  ?  222 ASP C O   1 
ATOM   8953  C CB  . ASP C 1 228 ? 123.704 -2.153  249.960 1.00 65.12  ?  222 ASP C CB  1 
ATOM   8954  C CG  . ASP C 1 228 ? 122.209 -2.244  249.728 1.00 72.09  ?  222 ASP C CG  1 
ATOM   8955  O OD1 . ASP C 1 228 ? 121.716 -3.358  249.448 1.00 78.85  ?  222 ASP C OD1 1 
ATOM   8956  O OD2 . ASP C 1 228 ? 121.528 -1.201  249.818 1.00 62.05  -1 222 ASP C OD2 1 
ATOM   8957  N N   . TRP C 1 229 ? 126.697 -3.146  250.135 1.00 58.69  ?  223 TRP C N   1 
ATOM   8958  C CA  . TRP C 1 229 ? 127.976 -3.404  249.483 1.00 55.19  ?  223 TRP C CA  1 
ATOM   8959  C C   . TRP C 1 229 ? 128.445 -4.835  249.706 1.00 56.99  ?  223 TRP C C   1 
ATOM   8960  O O   . TRP C 1 229 ? 129.124 -5.406  248.845 1.00 59.11  ?  223 TRP C O   1 
ATOM   8961  C CB  . TRP C 1 229 ? 129.032 -2.422  249.990 1.00 60.72  ?  223 TRP C CB  1 
ATOM   8962  C CG  . TRP C 1 229 ? 128.770 -0.996  249.621 1.00 60.87  ?  223 TRP C CG  1 
ATOM   8963  C CD1 . TRP C 1 229 ? 127.842 -0.534  248.735 1.00 60.29  ?  223 TRP C CD1 1 
ATOM   8964  C CD2 . TRP C 1 229 ? 129.446 0.159   250.134 1.00 59.23  ?  223 TRP C CD2 1 
ATOM   8965  N NE1 . TRP C 1 229 ? 127.899 0.837   248.661 1.00 62.15  ?  223 TRP C NE1 1 
ATOM   8966  C CE2 . TRP C 1 229 ? 128.875 1.286   249.511 1.00 59.28  ?  223 TRP C CE2 1 
ATOM   8967  C CE3 . TRP C 1 229 ? 130.477 0.348   251.058 1.00 56.14  ?  223 TRP C CE3 1 
ATOM   8968  C CZ2 . TRP C 1 229 ? 129.302 2.584   249.783 1.00 61.77  ?  223 TRP C CZ2 1 
ATOM   8969  C CZ3 . TRP C 1 229 ? 130.900 1.637   251.326 1.00 58.41  ?  223 TRP C CZ3 1 
ATOM   8970  C CH2 . TRP C 1 229 ? 130.313 2.738   250.691 1.00 59.88  ?  223 TRP C CH2 1 
ATOM   8971  N N   . ASN C 1 230 ? 128.090 -5.431  250.844 1.00 52.24  ?  224 ASN C N   1 
ATOM   8972  C CA  . ASN C 1 230 ? 128.541 -6.772  251.213 1.00 56.19  ?  224 ASN C CA  1 
ATOM   8973  C C   . ASN C 1 230 ? 127.919 -7.874  250.359 1.00 61.36  ?  224 ASN C C   1 
ATOM   8974  O O   . ASN C 1 230 ? 128.127 -9.058  250.654 1.00 63.83  ?  224 ASN C O   1 
ATOM   8975  C CB  . ASN C 1 230 ? 128.244 -7.029  252.690 1.00 62.03  ?  224 ASN C CB  1 
ATOM   8976  C CG  . ASN C 1 230 ? 129.247 -7.967  253.334 1.00 63.26  ?  224 ASN C CG  1 
ATOM   8977  O OD1 . ASN C 1 230 ? 129.984 -8.676  252.651 1.00 61.49  ?  224 ASN C OD1 1 
ATOM   8978  N ND2 . ASN C 1 230 ? 129.277 -7.976  254.658 1.00 58.93  ?  224 ASN C ND2 1 
ATOM   8979  N N   . LYS C 1 231 ? 127.160 -7.541  249.317 1.00 61.63  ?  225 LYS C N   1 
ATOM   8980  C CA  . LYS C 1 231 ? 126.585 -8.534  248.424 1.00 55.81  ?  225 LYS C CA  1 
ATOM   8981  C C   . LYS C 1 231 ? 127.154 -8.459  247.015 1.00 58.68  ?  225 LYS C C   1 
ATOM   8982  O O   . LYS C 1 231 ? 126.694 -9.194  246.135 1.00 64.29  ?  225 LYS C O   1 
ATOM   8983  C CB  . LYS C 1 231 ? 125.061 -8.381  248.382 1.00 54.90  ?  225 LYS C CB  1 
ATOM   8984  C CG  . LYS C 1 231 ? 124.394 -8.663  249.716 1.00 59.07  ?  225 LYS C CG  1 
ATOM   8985  C CD  . LYS C 1 231 ? 122.941 -8.235  249.715 1.00 56.40  ?  225 LYS C CD  1 
ATOM   8986  C CE  . LYS C 1 231 ? 122.260 -8.615  251.016 1.00 67.59  ?  225 LYS C CE  1 
ATOM   8987  N NZ  . LYS C 1 231 ? 122.181 -10.093 251.186 1.00 62.74  1  225 LYS C NZ  1 
ATOM   8988  N N   . THR C 1 232 ? 128.143 -7.596  246.780 1.00 59.60  ?  226 THR C N   1 
ATOM   8989  C CA  . THR C 1 232 ? 128.765 -7.474  245.468 1.00 56.86  ?  226 THR C CA  1 
ATOM   8990  C C   . THR C 1 232 ? 130.215 -7.941  245.530 1.00 57.24  ?  226 THR C C   1 
ATOM   8991  O O   . THR C 1 232 ? 130.531 -8.911  246.227 1.00 54.54  ?  226 THR C O   1 
ATOM   8992  C CB  . THR C 1 232 ? 128.686 -6.030  244.963 1.00 56.70  ?  226 THR C CB  1 
ATOM   8993  O OG1 . THR C 1 232 ? 129.952 -5.384  245.143 1.00 51.41  ?  226 THR C OG1 1 
ATOM   8994  C CG2 . THR C 1 232 ? 127.623 -5.252  245.728 1.00 48.68  ?  226 THR C CG2 1 
ATOM   8995  N N   . GLU C 1 233 ? 131.105 -7.256  244.809 1.00 57.76  ?  227 GLU C N   1 
ATOM   8996  C CA  . GLU C 1 233 ? 132.519 -7.609  244.812 1.00 53.47  ?  227 GLU C CA  1 
ATOM   8997  C C   . GLU C 1 233 ? 133.194 -7.345  246.153 1.00 50.55  ?  227 GLU C C   1 
ATOM   8998  O O   . GLU C 1 233 ? 134.309 -7.831  246.369 1.00 53.71  ?  227 GLU C O   1 
ATOM   8999  C CB  . GLU C 1 233 ? 133.258 -6.843  243.712 1.00 53.00  ?  227 GLU C CB  1 
ATOM   9000  C CG  . GLU C 1 233 ? 132.700 -7.038  242.309 1.00 56.81  ?  227 GLU C CG  1 
ATOM   9001  C CD  . GLU C 1 233 ? 131.581 -6.066  241.980 1.00 66.79  ?  227 GLU C CD  1 
ATOM   9002  O OE1 . GLU C 1 233 ? 131.105 -5.368  242.899 1.00 59.59  ?  227 GLU C OE1 1 
ATOM   9003  O OE2 . GLU C 1 233 ? 131.180 -5.997  240.799 1.00 73.98  -1 227 GLU C OE2 1 
ATOM   9004  N N   . LEU C 1 234 ? 132.554 -6.595  247.050 1.00 50.76  ?  228 LEU C N   1 
ATOM   9005  C CA  . LEU C 1 234 ? 133.123 -6.255  248.348 1.00 48.81  ?  228 LEU C CA  1 
ATOM   9006  C C   . LEU C 1 234 ? 132.649 -7.184  249.461 1.00 51.66  ?  228 LEU C C   1 
ATOM   9007  O O   . LEU C 1 234 ? 132.648 -6.785  250.630 1.00 51.41  ?  228 LEU C O   1 
ATOM   9008  C CB  . LEU C 1 234 ? 132.794 -4.804  248.702 1.00 45.46  ?  228 LEU C CB  1 
ATOM   9009  C CG  . LEU C 1 234 ? 133.487 -3.713  247.887 1.00 51.17  ?  228 LEU C CG  1 
ATOM   9010  C CD1 . LEU C 1 234 ? 132.963 -2.343  248.285 1.00 52.22  ?  228 LEU C CD1 1 
ATOM   9011  C CD2 . LEU C 1 234 ? 134.993 -3.786  248.076 1.00 48.44  ?  228 LEU C CD2 1 
ATOM   9012  N N   . ASP C 1 235 ? 132.242 -8.407  249.124 1.00 57.14  ?  229 ASP C N   1 
ATOM   9013  C CA  . ASP C 1 235 ? 131.801 -9.368  250.129 1.00 59.21  ?  229 ASP C CA  1 
ATOM   9014  C C   . ASP C 1 235 ? 132.953 -9.703  251.069 1.00 56.72  ?  229 ASP C C   1 
ATOM   9015  O O   . ASP C 1 235 ? 133.852 -10.469 250.708 1.00 53.81  ?  229 ASP C O   1 
ATOM   9016  C CB  . ASP C 1 235 ? 131.260 -10.634 249.458 1.00 61.81  ?  229 ASP C CB  1 
ATOM   9017  C CG  . ASP C 1 235 ? 130.476 -11.521 250.412 1.00 61.07  ?  229 ASP C CG  1 
ATOM   9018  O OD1 . ASP C 1 235 ? 130.663 -11.410 251.642 1.00 69.07  ?  229 ASP C OD1 1 
ATOM   9019  O OD2 . ASP C 1 235 ? 129.669 -12.341 249.924 1.00 68.11  -1 229 ASP C OD2 1 
ATOM   9020  N N   . SER C 1 236 ? 132.933 -9.137  252.275 1.00 56.22  ?  230 SER C N   1 
ATOM   9021  C CA  . SER C 1 236 ? 134.036 -9.301  253.210 1.00 53.88  ?  230 SER C CA  1 
ATOM   9022  C C   . SER C 1 236 ? 133.499 -9.367  254.632 1.00 54.93  ?  230 SER C C   1 
ATOM   9023  O O   . SER C 1 236 ? 132.360 -8.981  254.909 1.00 56.74  ?  230 SER C O   1 
ATOM   9024  C CB  . SER C 1 236 ? 135.052 -8.160  253.086 1.00 47.05  ?  230 SER C CB  1 
ATOM   9025  O OG  . SER C 1 236 ? 134.469 -6.919  253.437 1.00 44.58  ?  230 SER C OG  1 
ATOM   9026  N N   . PHE C 1 237 ? 134.349 -9.861  255.536 1.00 57.35  ?  231 PHE C N   1 
ATOM   9027  C CA  . PHE C 1 237 ? 133.981 -9.925  256.946 1.00 53.68  ?  231 PHE C CA  1 
ATOM   9028  C C   . PHE C 1 237 ? 133.993 -8.540  257.582 1.00 49.77  ?  231 PHE C C   1 
ATOM   9029  O O   . PHE C 1 237 ? 133.115 -8.214  258.389 1.00 53.39  ?  231 PHE C O   1 
ATOM   9030  C CB  . PHE C 1 237 ? 134.930 -10.865 257.690 1.00 57.50  ?  231 PHE C CB  1 
ATOM   9031  C CG  . PHE C 1 237 ? 134.523 -11.149 259.111 1.00 64.41  ?  231 PHE C CG  1 
ATOM   9032  C CD1 . PHE C 1 237 ? 133.186 -11.203 259.469 1.00 63.09  ?  231 PHE C CD1 1 
ATOM   9033  C CD2 . PHE C 1 237 ? 135.481 -11.359 260.090 1.00 64.46  ?  231 PHE C CD2 1 
ATOM   9034  C CE1 . PHE C 1 237 ? 132.813 -11.465 260.776 1.00 58.86  ?  231 PHE C CE1 1 
ATOM   9035  C CE2 . PHE C 1 237 ? 135.114 -11.621 261.398 1.00 58.99  ?  231 PHE C CE2 1 
ATOM   9036  C CZ  . PHE C 1 237 ? 133.778 -11.674 261.740 1.00 54.37  ?  231 PHE C CZ  1 
ATOM   9037  N N   . LEU C 1 238 ? 134.979 -7.711  257.226 1.00 49.52  ?  232 LEU C N   1 
ATOM   9038  C CA  . LEU C 1 238 ? 135.106 -6.395  257.846 1.00 50.36  ?  232 LEU C CA  1 
ATOM   9039  C C   . LEU C 1 238 ? 133.910 -5.507  257.530 1.00 48.18  ?  232 LEU C C   1 
ATOM   9040  O O   . LEU C 1 238 ? 133.480 -4.711  258.373 1.00 43.14  ?  232 LEU C O   1 
ATOM   9041  C CB  . LEU C 1 238 ? 136.403 -5.725  257.393 1.00 46.10  ?  232 LEU C CB  1 
ATOM   9042  C CG  . LEU C 1 238 ? 137.682 -6.158  258.109 1.00 41.73  ?  232 LEU C CG  1 
ATOM   9043  C CD1 . LEU C 1 238 ? 138.894 -5.481  257.491 1.00 43.83  ?  232 LEU C CD1 1 
ATOM   9044  C CD2 . LEU C 1 238 ? 137.587 -5.838  259.591 1.00 43.74  ?  232 LEU C CD2 1 
ATOM   9045  N N   . ILE C 1 239 ? 133.360 -5.623  256.320 1.00 52.79  ?  233 ILE C N   1 
ATOM   9046  C CA  . ILE C 1 239 ? 132.197 -4.817  255.962 1.00 54.51  ?  233 ILE C CA  1 
ATOM   9047  C C   . ILE C 1 239 ? 130.970 -5.277  256.741 1.00 55.06  ?  233 ILE C C   1 
ATOM   9048  O O   . ILE C 1 239 ? 130.158 -4.456  257.186 1.00 55.59  ?  233 ILE C O   1 
ATOM   9049  C CB  . ILE C 1 239 ? 131.970 -4.859  254.440 1.00 50.72  ?  233 ILE C CB  1 
ATOM   9050  C CG1 . ILE C 1 239 ? 133.076 -4.078  253.727 1.00 46.92  ?  233 ILE C CG1 1 
ATOM   9051  C CG2 . ILE C 1 239 ? 130.609 -4.292  254.082 1.00 54.07  ?  233 ILE C CG2 1 
ATOM   9052  C CD1 . ILE C 1 239 ? 132.883 -3.966  252.234 1.00 48.95  ?  233 ILE C CD1 1 
ATOM   9053  N N   . GLU C 1 240 ? 130.820 -6.591  256.930 1.00 50.51  ?  234 GLU C N   1 
ATOM   9054  C CA  . GLU C 1 240 ? 129.768 -7.094  257.807 1.00 49.60  ?  234 GLU C CA  1 
ATOM   9055  C C   . GLU C 1 240 ? 129.969 -6.606  259.235 1.00 52.27  ?  234 GLU C C   1 
ATOM   9056  O O   . GLU C 1 240 ? 129.012 -6.188  259.899 1.00 52.59  ?  234 GLU C O   1 
ATOM   9057  C CB  . GLU C 1 240 ? 129.735 -8.622  257.769 1.00 54.14  ?  234 GLU C CB  1 
ATOM   9058  C CG  . GLU C 1 240 ? 128.794 -9.247  258.787 1.00 58.94  ?  234 GLU C CG  1 
ATOM   9059  C CD  . GLU C 1 240 ? 128.936 -10.755 258.863 1.00 59.12  ?  234 GLU C CD  1 
ATOM   9060  O OE1 . GLU C 1 240 ? 129.671 -11.327 258.030 1.00 53.70  ?  234 GLU C OE1 1 
ATOM   9061  O OE2 . GLU C 1 240 ? 128.315 -11.366 259.758 1.00 55.57  -1 234 GLU C OE2 1 
ATOM   9062  N N   . ILE C 1 241 ? 131.211 -6.656  259.722 1.00 56.37  ?  235 ILE C N   1 
ATOM   9063  C CA  . ILE C 1 241 ? 131.517 -6.168  261.065 1.00 51.77  ?  235 ILE C CA  1 
ATOM   9064  C C   . ILE C 1 241 ? 131.181 -4.687  261.179 1.00 52.72  ?  235 ILE C C   1 
ATOM   9065  O O   . ILE C 1 241 ? 130.515 -4.254  262.127 1.00 58.11  ?  235 ILE C O   1 
ATOM   9066  C CB  . ILE C 1 241 ? 132.994 -6.433  261.405 1.00 60.87  ?  235 ILE C CB  1 
ATOM   9067  C CG1 . ILE C 1 241 ? 133.261 -7.930  261.546 1.00 60.59  ?  235 ILE C CG1 1 
ATOM   9068  C CG2 . ILE C 1 241 ? 133.392 -5.700  262.672 1.00 59.50  ?  235 ILE C CG2 1 
ATOM   9069  C CD1 . ILE C 1 241 ? 134.709 -8.243  261.823 1.00 64.97  ?  235 ILE C CD1 1 
ATOM   9070  N N   . THR C 1 242 ? 131.642 -3.890  260.212 1.00 53.71  ?  236 THR C N   1 
ATOM   9071  C CA  . THR C 1 242 ? 131.406 -2.450  260.255 1.00 49.87  ?  236 THR C CA  1 
ATOM   9072  C C   . THR C 1 242 ? 129.916 -2.133  260.265 1.00 54.75  ?  236 THR C C   1 
ATOM   9073  O O   . THR C 1 242 ? 129.471 -1.229  260.981 1.00 54.92  ?  236 THR C O   1 
ATOM   9074  C CB  . THR C 1 242 ? 132.090 -1.772  259.067 1.00 44.60  ?  236 THR C CB  1 
ATOM   9075  O OG1 . THR C 1 242 ? 133.494 -2.059  259.096 1.00 50.69  ?  236 THR C OG1 1 
ATOM   9076  C CG2 . THR C 1 242 ? 131.885 -0.264  259.120 1.00 46.85  ?  236 THR C CG2 1 
ATOM   9077  N N   . ALA C 1 243 ? 129.126 -2.879  259.489 1.00 54.51  ?  237 ALA C N   1 
ATOM   9078  C CA  . ALA C 1 243 ? 127.690 -2.624  259.432 1.00 54.41  ?  237 ALA C CA  1 
ATOM   9079  C C   . ALA C 1 243 ? 127.025 -2.880  260.780 1.00 60.00  ?  237 ALA C C   1 
ATOM   9080  O O   . ALA C 1 243 ? 126.199 -2.079  261.234 1.00 58.15  ?  237 ALA C O   1 
ATOM   9081  C CB  . ALA C 1 243 ? 127.052 -3.484  258.344 1.00 50.32  ?  237 ALA C CB  1 
ATOM   9082  N N   . ASN C 1 244 ? 127.373 -3.990  261.436 1.00 52.75  ?  238 ASN C N   1 
ATOM   9083  C CA  . ASN C 1 244 ? 126.808 -4.276  262.752 1.00 55.07  ?  238 ASN C CA  1 
ATOM   9084  C C   . ASN C 1 244 ? 127.244 -3.236  263.776 1.00 66.09  ?  238 ASN C C   1 
ATOM   9085  O O   . ASN C 1 244 ? 126.469 -2.867  264.666 1.00 73.08  ?  238 ASN C O   1 
ATOM   9086  C CB  . ASN C 1 244 ? 127.213 -5.678  263.207 1.00 56.47  ?  238 ASN C CB  1 
ATOM   9087  C CG  . ASN C 1 244 ? 126.557 -6.771  262.386 1.00 63.53  ?  238 ASN C CG  1 
ATOM   9088  O OD1 . ASN C 1 244 ? 125.395 -6.657  261.996 1.00 73.42  ?  238 ASN C OD1 1 
ATOM   9089  N ND2 . ASN C 1 244 ? 127.301 -7.838  262.117 1.00 48.66  ?  238 ASN C ND2 1 
ATOM   9090  N N   . ILE C 1 245 ? 128.483 -2.752  263.666 1.00 65.57  ?  239 ILE C N   1 
ATOM   9091  C CA  . ILE C 1 245 ? 128.976 -1.746  264.600 1.00 63.35  ?  239 ILE C CA  1 
ATOM   9092  C C   . ILE C 1 245 ? 128.266 -0.415  264.393 1.00 65.95  ?  239 ILE C C   1 
ATOM   9093  O O   . ILE C 1 245 ? 128.002 0.313   265.359 1.00 65.81  ?  239 ILE C O   1 
ATOM   9094  C CB  . ILE C 1 245 ? 130.503 -1.603  264.457 1.00 52.03  ?  239 ILE C CB  1 
ATOM   9095  C CG1 . ILE C 1 245 ? 131.199 -2.888  264.903 1.00 61.30  ?  239 ILE C CG1 1 
ATOM   9096  C CG2 . ILE C 1 245 ? 131.017 -0.418  265.257 1.00 58.49  ?  239 ILE C CG2 1 
ATOM   9097  C CD1 . ILE C 1 245 ? 132.694 -2.840  264.757 1.00 56.32  ?  239 ILE C CD1 1 
ATOM   9098  N N   . LEU C 1 246 ? 127.929 -0.078  263.147 1.00 62.46  ?  240 LEU C N   1 
ATOM   9099  C CA  . LEU C 1 246 ? 127.330 1.223   262.866 1.00 70.13  ?  240 LEU C CA  1 
ATOM   9100  C C   . LEU C 1 246 ? 125.941 1.342   263.482 1.00 77.06  ?  240 LEU C C   1 
ATOM   9101  O O   . LEU C 1 246 ? 125.638 2.330   264.162 1.00 80.68  ?  240 LEU C O   1 
ATOM   9102  C CB  . LEU C 1 246 ? 127.277 1.462   261.357 1.00 64.25  ?  240 LEU C CB  1 
ATOM   9103  C CG  . LEU C 1 246 ? 128.617 1.796   260.702 1.00 56.66  ?  240 LEU C CG  1 
ATOM   9104  C CD1 . LEU C 1 246 ? 128.449 2.020   259.212 1.00 62.94  ?  240 LEU C CD1 1 
ATOM   9105  C CD2 . LEU C 1 246 ? 129.236 3.013   261.363 1.00 50.90  ?  240 LEU C CD2 1 
ATOM   9106  N N   . LYS C 1 247 ? 125.081 0.351   263.258 1.00 69.83  ?  241 LYS C N   1 
ATOM   9107  C CA  . LYS C 1 247 ? 123.726 0.379   263.791 1.00 73.44  ?  241 LYS C CA  1 
ATOM   9108  C C   . LYS C 1 247 ? 123.625 -0.220  265.189 1.00 74.44  ?  241 LYS C C   1 
ATOM   9109  O O   . LYS C 1 247 ? 122.513 -0.500  265.650 1.00 74.19  ?  241 LYS C O   1 
ATOM   9110  C CB  . LYS C 1 247 ? 122.763 -0.345  262.846 1.00 67.78  ?  241 LYS C CB  1 
ATOM   9111  C CG  . LYS C 1 247 ? 123.062 -1.820  262.632 1.00 69.64  ?  241 LYS C CG  1 
ATOM   9112  C CD  . LYS C 1 247 ? 121.852 -2.532  262.043 1.00 62.41  ?  241 LYS C CD  1 
ATOM   9113  C CE  . LYS C 1 247 ? 122.187 -3.948  261.605 1.00 62.54  ?  241 LYS C CE  1 
ATOM   9114  N NZ  . LYS C 1 247 ? 123.044 -3.961  260.388 1.00 61.04  1  241 LYS C NZ  1 
ATOM   9115  N N   . PHE C 1 248 ? 124.750 -0.419  265.871 1.00 76.48  ?  242 PHE C N   1 
ATOM   9116  C CA  . PHE C 1 248 ? 124.717 -0.958  267.224 1.00 76.32  ?  242 PHE C CA  1 
ATOM   9117  C C   . PHE C 1 248 ? 124.198 0.094   268.196 1.00 78.92  ?  242 PHE C C   1 
ATOM   9118  O O   . PHE C 1 248 ? 124.616 1.255   268.155 1.00 77.20  ?  242 PHE C O   1 
ATOM   9119  C CB  . PHE C 1 248 ? 126.109 -1.428  267.642 1.00 70.62  ?  242 PHE C CB  1 
ATOM   9120  C CG  . PHE C 1 248 ? 126.140 -2.121  268.975 1.00 69.20  ?  242 PHE C CG  1 
ATOM   9121  C CD1 . PHE C 1 248 ? 125.801 -3.459  269.082 1.00 74.22  ?  242 PHE C CD1 1 
ATOM   9122  C CD2 . PHE C 1 248 ? 126.517 -1.436  270.119 1.00 69.23  ?  242 PHE C CD2 1 
ATOM   9123  C CE1 . PHE C 1 248 ? 125.831 -4.101  270.305 1.00 74.55  ?  242 PHE C CE1 1 
ATOM   9124  C CE2 . PHE C 1 248 ? 126.550 -2.074  271.345 1.00 71.67  ?  242 PHE C CE2 1 
ATOM   9125  C CZ  . PHE C 1 248 ? 126.207 -3.408  271.438 1.00 74.73  ?  242 PHE C CZ  1 
ATOM   9126  N N   . GLN C 1 249 ? 123.285 -0.316  269.070 1.00 87.27  ?  243 GLN C N   1 
ATOM   9127  C CA  . GLN C 1 249 ? 122.661 0.578   270.033 1.00 85.20  ?  243 GLN C CA  1 
ATOM   9128  C C   . GLN C 1 249 ? 123.306 0.415   271.404 1.00 81.39  ?  243 GLN C C   1 
ATOM   9129  O O   . GLN C 1 249 ? 123.743 -0.676  271.780 1.00 77.66  ?  243 GLN C O   1 
ATOM   9130  C CB  . GLN C 1 249 ? 121.158 0.304   270.132 1.00 87.56  ?  243 GLN C CB  1 
ATOM   9131  C CG  . GLN C 1 249 ? 120.297 1.550   270.281 1.00 88.20  ?  243 GLN C CG  1 
ATOM   9132  C CD  . GLN C 1 249 ? 119.998 2.215   268.951 1.00 87.01  ?  243 GLN C CD  1 
ATOM   9133  O OE1 . GLN C 1 249 ? 120.327 1.684   267.890 1.00 86.65  ?  243 GLN C OE1 1 
ATOM   9134  N NE2 . GLN C 1 249 ? 119.365 3.382   269.002 1.00 82.59  ?  243 GLN C NE2 1 
ATOM   9135  N N   . ASP C 1 250 ? 123.361 1.513   272.148 1.00 78.89  ?  244 ASP C N   1 
ATOM   9136  C CA  . ASP C 1 250 ? 123.895 1.516   273.501 1.00 84.58  ?  244 ASP C CA  1 
ATOM   9137  C C   . ASP C 1 250 ? 122.753 1.442   274.512 1.00 87.55  ?  244 ASP C C   1 
ATOM   9138  O O   . ASP C 1 250 ? 121.572 1.493   274.163 1.00 83.30  ?  244 ASP C O   1 
ATOM   9139  C CB  . ASP C 1 250 ? 124.753 2.764   273.738 1.00 82.90  ?  244 ASP C CB  1 
ATOM   9140  C CG  . ASP C 1 250 ? 125.725 2.600   274.895 1.00 79.50  ?  244 ASP C CG  1 
ATOM   9141  O OD1 . ASP C 1 250 ? 125.800 1.488   275.458 1.00 80.32  ?  244 ASP C OD1 1 
ATOM   9142  O OD2 . ASP C 1 250 ? 126.412 3.585   275.241 1.00 68.24  -1 244 ASP C OD2 1 
ATOM   9143  N N   . THR C 1 251 ? 123.125 1.316   275.789 1.00 92.44  ?  245 THR C N   1 
ATOM   9144  C CA  . THR C 1 251 ? 122.133 1.238   276.854 1.00 89.07  ?  245 THR C CA  1 
ATOM   9145  C C   . THR C 1 251 ? 121.336 2.527   277.003 1.00 94.46  ?  245 THR C C   1 
ATOM   9146  O O   . THR C 1 251 ? 120.238 2.501   277.570 1.00 96.74  ?  245 THR C O   1 
ATOM   9147  C CB  . THR C 1 251 ? 122.809 0.894   278.183 1.00 86.45  ?  245 THR C CB  1 
ATOM   9148  O OG1 . THR C 1 251 ? 123.840 1.851   278.461 1.00 79.10  ?  245 THR C OG1 1 
ATOM   9149  C CG2 . THR C 1 251 ? 123.416 -0.500  278.127 1.00 83.59  ?  245 THR C CG2 1 
ATOM   9150  N N   . ASP C 1 252 ? 121.859 3.647   276.510 1.00 91.83  ?  246 ASP C N   1 
ATOM   9151  C CA  . ASP C 1 252 ? 121.175 4.929   276.592 1.00 87.84  ?  246 ASP C CA  1 
ATOM   9152  C C   . ASP C 1 252 ? 120.339 5.240   275.357 1.00 86.17  ?  246 ASP C C   1 
ATOM   9153  O O   . ASP C 1 252 ? 119.886 6.379   275.203 1.00 79.39  ?  246 ASP C O   1 
ATOM   9154  C CB  . ASP C 1 252 ? 122.191 6.052   276.821 1.00 84.93  ?  246 ASP C CB  1 
ATOM   9155  C CG  . ASP C 1 252 ? 123.050 5.818   278.048 1.00 92.43  ?  246 ASP C CG  1 
ATOM   9156  O OD1 . ASP C 1 252 ? 122.936 4.734   278.658 1.00 93.81  ?  246 ASP C OD1 1 
ATOM   9157  O OD2 . ASP C 1 252 ? 123.838 6.721   278.404 1.00 92.14  -1 246 ASP C OD2 1 
ATOM   9158  N N   . GLY C 1 253 ? 120.125 4.267   274.476 1.00 82.85  ?  247 GLY C N   1 
ATOM   9159  C CA  . GLY C 1 253 ? 119.287 4.492   273.312 1.00 77.97  ?  247 GLY C CA  1 
ATOM   9160  C C   . GLY C 1 253 ? 120.053 5.034   272.124 1.00 80.53  ?  247 GLY C C   1 
ATOM   9161  O O   . GLY C 1 253 ? 119.722 4.727   270.976 1.00 73.19  ?  247 GLY C O   1 
ATOM   9162  N N   . LYS C 1 254 ? 121.082 5.835   272.388 1.00 88.82  ?  248 LYS C N   1 
ATOM   9163  C CA  . LYS C 1 254 ? 121.887 6.420   271.329 1.00 84.23  ?  248 LYS C CA  1 
ATOM   9164  C C   . LYS C 1 254 ? 122.957 5.434   270.861 1.00 81.55  ?  248 LYS C C   1 
ATOM   9165  O O   . LYS C 1 254 ? 123.229 4.415   271.502 1.00 76.96  ?  248 LYS C O   1 
ATOM   9166  C CB  . LYS C 1 254 ? 122.524 7.725   271.803 1.00 72.09  ?  248 LYS C CB  1 
ATOM   9167  C CG  . LYS C 1 254 ? 121.510 8.776   272.236 1.00 73.43  ?  248 LYS C CG  1 
ATOM   9168  C CD  . LYS C 1 254 ? 121.698 9.172   273.694 1.00 84.64  ?  248 LYS C CD  1 
ATOM   9169  C CE  . LYS C 1 254 ? 122.946 10.017  273.887 1.00 83.56  ?  248 LYS C CE  1 
ATOM   9170  N NZ  . LYS C 1 254 ? 122.838 11.329  273.189 1.00 77.11  1  248 LYS C NZ  1 
ATOM   9171  N N   . HIS C 1 255 ? 123.565 5.751   269.721 1.00 76.78  ?  249 HIS C N   1 
ATOM   9172  C CA  . HIS C 1 255 ? 124.565 4.874   269.133 1.00 70.88  ?  249 HIS C CA  1 
ATOM   9173  C C   . HIS C 1 255 ? 125.849 4.898   269.952 1.00 75.97  ?  249 HIS C C   1 
ATOM   9174  O O   . HIS C 1 255 ? 126.173 5.884   270.617 1.00 76.41  ?  249 HIS C O   1 
ATOM   9175  C CB  . HIS C 1 255 ? 124.855 5.283   267.690 1.00 73.44  ?  249 HIS C CB  1 
ATOM   9176  C CG  . HIS C 1 255 ? 123.685 5.131   266.768 1.00 82.75  ?  249 HIS C CG  1 
ATOM   9177  N ND1 . HIS C 1 255 ? 123.381 3.942   266.140 1.00 80.17  ?  249 HIS C ND1 1 
ATOM   9178  C CD2 . HIS C 1 255 ? 122.749 6.021   266.361 1.00 81.42  ?  249 HIS C CD2 1 
ATOM   9179  C CE1 . HIS C 1 255 ? 122.307 4.105   265.388 1.00 77.67  ?  249 HIS C CE1 1 
ATOM   9180  N NE2 . HIS C 1 255 ? 121.904 5.358   265.505 1.00 79.73  ?  249 HIS C NE2 1 
ATOM   9181  N N   . LEU C 1 256 ? 126.588 3.791   269.892 1.00 77.57  ?  250 LEU C N   1 
ATOM   9182  C CA  . LEU C 1 256 ? 127.773 3.644   270.728 1.00 70.93  ?  250 LEU C CA  1 
ATOM   9183  C C   . LEU C 1 256 ? 129.009 4.238   270.063 1.00 66.28  ?  250 LEU C C   1 
ATOM   9184  O O   . LEU C 1 256 ? 129.871 4.805   270.745 1.00 67.21  ?  250 LEU C O   1 
ATOM   9185  C CB  . LEU C 1 256 ? 127.995 2.167   271.057 1.00 68.07  ?  250 LEU C CB  1 
ATOM   9186  C CG  . LEU C 1 256 ? 129.327 1.789   271.710 1.00 60.84  ?  250 LEU C CG  1 
ATOM   9187  C CD1 . LEU C 1 256 ? 129.413 2.355   273.118 1.00 57.83  ?  250 LEU C CD1 1 
ATOM   9188  C CD2 . LEU C 1 256 ? 129.538 0.278   271.714 1.00 67.17  ?  250 LEU C CD2 1 
ATOM   9189  N N   . LEU C 1 257 ? 129.104 4.122   268.739 1.00 63.81  ?  251 LEU C N   1 
ATOM   9190  C CA  . LEU C 1 257 ? 130.311 4.557   268.041 1.00 59.50  ?  251 LEU C CA  1 
ATOM   9191  C C   . LEU C 1 257 ? 130.646 6.033   268.243 1.00 59.45  ?  251 LEU C C   1 
ATOM   9192  O O   . LEU C 1 257 ? 131.836 6.339   268.436 1.00 57.17  ?  251 LEU C O   1 
ATOM   9193  C CB  . LEU C 1 257 ? 130.187 4.223   266.548 1.00 56.36  ?  251 LEU C CB  1 
ATOM   9194  C CG  . LEU C 1 257 ? 131.409 4.565   265.692 1.00 53.12  ?  251 LEU C CG  1 
ATOM   9195  C CD1 . LEU C 1 257 ? 132.654 3.872   266.227 1.00 57.19  ?  251 LEU C CD1 1 
ATOM   9196  C CD2 . LEU C 1 257 ? 131.171 4.197   264.238 1.00 52.63  ?  251 LEU C CD2 1 
ATOM   9197  N N   . PRO C 1 258 ? 129.699 6.980   268.219 1.00 54.81  ?  252 PRO C N   1 
ATOM   9198  C CA  . PRO C 1 258 ? 130.070 8.382   268.479 1.00 49.07  ?  252 PRO C CA  1 
ATOM   9199  C C   . PRO C 1 258 ? 130.612 8.633   269.879 1.00 54.39  ?  252 PRO C C   1 
ATOM   9200  O O   . PRO C 1 258 ? 131.115 9.734   270.132 1.00 63.93  ?  252 PRO C O   1 
ATOM   9201  C CB  . PRO C 1 258 ? 128.758 9.144   268.250 1.00 44.24  ?  252 PRO C CB  1 
ATOM   9202  C CG  . PRO C 1 258 ? 127.978 8.278   267.336 1.00 58.67  ?  252 PRO C CG  1 
ATOM   9203  C CD  . PRO C 1 258 ? 128.300 6.877   267.761 1.00 57.52  ?  252 PRO C CD  1 
ATOM   9204  N N   . LYS C 1 259 ? 130.526 7.664   270.790 1.00 51.15  ?  253 LYS C N   1 
ATOM   9205  C CA  . LYS C 1 259 ? 131.067 7.819   272.133 1.00 59.34  ?  253 LYS C CA  1 
ATOM   9206  C C   . LYS C 1 259 ? 132.486 7.282   272.272 1.00 64.71  ?  253 LYS C C   1 
ATOM   9207  O O   . LYS C 1 259 ? 133.096 7.457   273.333 1.00 65.21  ?  253 LYS C O   1 
ATOM   9208  C CB  . LYS C 1 259 ? 130.161 7.121   273.154 1.00 66.92  ?  253 LYS C CB  1 
ATOM   9209  C CG  . LYS C 1 259 ? 128.762 7.708   273.254 1.00 73.51  ?  253 LYS C CG  1 
ATOM   9210  C CD  . LYS C 1 259 ? 127.940 6.991   274.315 1.00 80.82  ?  253 LYS C CD  1 
ATOM   9211  C CE  . LYS C 1 259 ? 126.547 7.590   274.438 1.00 84.24  ?  253 LYS C CE  1 
ATOM   9212  N NZ  . LYS C 1 259 ? 126.591 9.028   274.825 1.00 73.13  1  253 LYS C NZ  1 
ATOM   9213  N N   . ILE C 1 260 ? 133.022 6.642   271.237 1.00 61.86  ?  254 ILE C N   1 
ATOM   9214  C CA  . ILE C 1 260 ? 134.350 6.040   271.278 1.00 59.25  ?  254 ILE C CA  1 
ATOM   9215  C C   . ILE C 1 260 ? 135.387 7.087   270.895 1.00 59.85  ?  254 ILE C C   1 
ATOM   9216  O O   . ILE C 1 260 ? 135.175 7.885   269.975 1.00 53.42  ?  254 ILE C O   1 
ATOM   9217  C CB  . ILE C 1 260 ? 134.418 4.815   270.348 1.00 55.71  ?  254 ILE C CB  1 
ATOM   9218  C CG1 . ILE C 1 260 ? 133.336 3.802   270.728 1.00 58.98  ?  254 ILE C CG1 1 
ATOM   9219  C CG2 . ILE C 1 260 ? 135.799 4.176   270.392 1.00 53.15  ?  254 ILE C CG2 1 
ATOM   9220  C CD1 . ILE C 1 260 ? 133.374 2.527   269.917 1.00 60.30  ?  254 ILE C CD1 1 
ATOM   9221  N N   . ARG C 1 261 ? 136.514 7.086   271.604 1.00 64.05  ?  255 ARG C N   1 
ATOM   9222  C CA  . ARG C 1 261 ? 137.571 8.050   271.330 1.00 56.85  ?  255 ARG C CA  1 
ATOM   9223  C C   . ARG C 1 261 ? 138.264 7.711   270.016 1.00 56.30  ?  255 ARG C C   1 
ATOM   9224  O O   . ARG C 1 261 ? 138.600 6.551   269.758 1.00 52.78  ?  255 ARG C O   1 
ATOM   9225  C CB  . ARG C 1 261 ? 138.580 8.072   272.478 1.00 58.99  ?  255 ARG C CB  1 
ATOM   9226  C CG  . ARG C 1 261 ? 139.267 9.418   272.668 1.00 66.92  ?  255 ARG C CG  1 
ATOM   9227  C CD  . ARG C 1 261 ? 140.072 9.462   273.960 1.00 58.75  ?  255 ARG C CD  1 
ATOM   9228  N NE  . ARG C 1 261 ? 141.462 9.062   273.764 1.00 57.79  ?  255 ARG C NE  1 
ATOM   9229  C CZ  . ARG C 1 261 ? 142.468 9.917   273.604 1.00 54.39  ?  255 ARG C CZ  1 
ATOM   9230  N NH1 . ARG C 1 261 ? 142.240 11.223  273.620 1.00 44.13  1  255 ARG C NH1 1 
ATOM   9231  N NH2 . ARG C 1 261 ? 143.703 9.466   273.432 1.00 52.10  ?  255 ARG C NH2 1 
ATOM   9232  N N   . ASP C 1 262 ? 138.475 8.730   269.183 1.00 58.85  ?  256 ASP C N   1 
ATOM   9233  C CA  . ASP C 1 262 ? 139.062 8.543   267.854 1.00 53.21  ?  256 ASP C CA  1 
ATOM   9234  C C   . ASP C 1 262 ? 140.588 8.564   267.954 1.00 52.24  ?  256 ASP C C   1 
ATOM   9235  O O   . ASP C 1 262 ? 141.276 9.456   267.454 1.00 56.32  ?  256 ASP C O   1 
ATOM   9236  C CB  . ASP C 1 262 ? 138.545 9.606   266.893 1.00 48.33  ?  256 ASP C CB  1 
ATOM   9237  C CG  . ASP C 1 262 ? 138.693 11.010  267.443 1.00 52.65  ?  256 ASP C CG  1 
ATOM   9238  O OD1 . ASP C 1 262 ? 138.650 11.169  268.680 1.00 58.93  ?  256 ASP C OD1 1 
ATOM   9239  O OD2 . ASP C 1 262 ? 138.853 11.953  266.640 1.00 55.08  -1 256 ASP C OD2 1 
ATOM   9240  N N   . SER C 1 263 ? 141.115 7.537   268.617 1.00 51.92  ?  257 SER C N   1 
ATOM   9241  C CA  . SER C 1 263 ? 142.554 7.374   268.790 1.00 47.02  ?  257 SER C CA  1 
ATOM   9242  C C   . SER C 1 263 ? 142.902 5.910   268.586 1.00 51.92  ?  257 SER C C   1 
ATOM   9243  O O   . SER C 1 263 ? 142.483 5.057   269.375 1.00 57.92  ?  257 SER C O   1 
ATOM   9244  C CB  . SER C 1 263 ? 143.005 7.849   270.174 1.00 48.24  ?  257 SER C CB  1 
ATOM   9245  O OG  . SER C 1 263 ? 144.398 7.657   270.348 1.00 57.73  ?  257 SER C OG  1 
ATOM   9246  N N   . ALA C 1 264 ? 143.666 5.621   267.537 1.00 53.58  ?  258 ALA C N   1 
ATOM   9247  C CA  . ALA C 1 264 ? 144.053 4.254   267.219 1.00 55.20  ?  258 ALA C CA  1 
ATOM   9248  C C   . ALA C 1 264 ? 145.309 3.866   267.987 1.00 57.04  ?  258 ALA C C   1 
ATOM   9249  O O   . ALA C 1 264 ? 146.254 4.652   268.100 1.00 59.51  ?  258 ALA C O   1 
ATOM   9250  C CB  . ALA C 1 264 ? 144.287 4.094   265.717 1.00 54.85  ?  258 ALA C CB  1 
ATOM   9251  N N   . GLY C 1 265 ? 145.312 2.645   268.514 1.00 68.49  ?  259 GLY C N   1 
ATOM   9252  C CA  . GLY C 1 265 ? 146.431 2.163   269.298 1.00 77.45  ?  259 GLY C CA  1 
ATOM   9253  C C   . GLY C 1 265 ? 147.038 0.884   268.763 1.00 82.24  ?  259 GLY C C   1 
ATOM   9254  O O   . GLY C 1 265 ? 146.784 0.500   267.616 1.00 68.34  ?  259 GLY C O   1 
ATOM   9255  N N   . GLN C 1 266 ? 147.840 0.218   269.597 1.00 87.89  ?  260 GLN C N   1 
ATOM   9256  C CA  . GLN C 1 266 ? 148.538 -1.010  269.232 1.00 87.89  ?  260 GLN C CA  1 
ATOM   9257  C C   . GLN C 1 266 ? 149.368 -0.806  267.971 1.00 83.65  ?  260 GLN C C   1 
ATOM   9258  O O   . GLN C 1 266 ? 148.964 -1.223  266.880 1.00 77.97  ?  260 GLN C O   1 
ATOM   9259  C CB  . GLN C 1 266 ? 147.548 -2.164  269.043 1.00 89.44  ?  260 GLN C CB  1 
ATOM   9260  C CG  . GLN C 1 266 ? 147.964 -3.479  269.698 1.00 90.13  ?  260 GLN C CG  1 
ATOM   9261  C CD  . GLN C 1 266 ? 149.175 -4.119  269.043 1.00 88.17  ?  260 GLN C CD  1 
ATOM   9262  O OE1 . GLN C 1 266 ? 150.303 -3.652  269.205 1.00 85.47  ?  260 GLN C OE1 1 
ATOM   9263  N NE2 . GLN C 1 266 ? 148.947 -5.200  268.306 1.00 79.08  ?  260 GLN C NE2 1 
ATOM   9264  N N   . LYS C 1 267 ? 150.522 -0.147  268.113 1.00 85.84  ?  261 LYS C N   1 
ATOM   9265  C CA  . LYS C 1 267 ? 151.416 0.049   266.976 1.00 81.92  ?  261 LYS C CA  1 
ATOM   9266  C C   . LYS C 1 267 ? 151.784 -1.288  266.344 1.00 78.51  ?  261 LYS C C   1 
ATOM   9267  O O   . LYS C 1 267 ? 151.626 -1.481  265.133 1.00 68.65  ?  261 LYS C O   1 
ATOM   9268  C CB  . LYS C 1 267 ? 152.668 0.804   267.423 1.00 69.92  ?  261 LYS C CB  1 
ATOM   9269  C CG  . LYS C 1 267 ? 152.393 2.022   268.299 1.00 67.06  ?  261 LYS C CG  1 
ATOM   9270  C CD  . LYS C 1 267 ? 151.793 3.176   267.506 1.00 70.09  ?  261 LYS C CD  1 
ATOM   9271  C CE  . LYS C 1 267 ? 151.582 4.396   268.393 1.00 60.49  ?  261 LYS C CE  1 
ATOM   9272  N NZ  . LYS C 1 267 ? 151.168 5.597   267.617 1.00 42.22  1  261 LYS C NZ  1 
ATOM   9273  N N   . GLY C 1 268 ? 152.281 -2.219  267.160 1.00 80.27  ?  262 GLY C N   1 
ATOM   9274  C CA  . GLY C 1 268 ? 152.463 -3.618  266.810 1.00 73.00  ?  262 GLY C CA  1 
ATOM   9275  C C   . GLY C 1 268 ? 152.915 -3.953  265.404 1.00 67.20  ?  262 GLY C C   1 
ATOM   9276  O O   . GLY C 1 268 ? 153.909 -3.414  264.909 1.00 77.04  ?  262 GLY C O   1 
ATOM   9277  N N   . THR C 1 269 ? 152.173 -4.846  264.749 1.00 58.95  ?  263 THR C N   1 
ATOM   9278  C CA  . THR C 1 269 ? 152.559 -5.387  263.452 1.00 64.04  ?  263 THR C CA  1 
ATOM   9279  C C   . THR C 1 269 ? 152.303 -4.427  262.298 1.00 57.64  ?  263 THR C C   1 
ATOM   9280  O O   . THR C 1 269 ? 152.765 -4.690  261.182 1.00 54.45  ?  263 THR C O   1 
ATOM   9281  C CB  . THR C 1 269 ? 151.813 -6.701  263.197 1.00 73.37  ?  263 THR C CB  1 
ATOM   9282  O OG1 . THR C 1 269 ? 151.543 -7.350  264.446 1.00 75.26  ?  263 THR C OG1 1 
ATOM   9283  C CG2 . THR C 1 269 ? 152.647 -7.631  262.327 1.00 61.71  ?  263 THR C CG2 1 
ATOM   9284  N N   . GLY C 1 270 ? 151.583 -3.329  262.530 1.00 49.18  ?  264 GLY C N   1 
ATOM   9285  C CA  . GLY C 1 270 ? 151.297 -2.408  261.441 1.00 50.97  ?  264 GLY C CA  1 
ATOM   9286  C C   . GLY C 1 270 ? 152.541 -1.711  260.924 1.00 51.10  ?  264 GLY C C   1 
ATOM   9287  O O   . GLY C 1 270 ? 152.772 -1.641  259.713 1.00 42.87  ?  264 GLY C O   1 
ATOM   9288  N N   . LYS C 1 271 ? 153.365 -1.192  261.837 1.00 47.47  ?  265 LYS C N   1 
ATOM   9289  C CA  . LYS C 1 271 ? 154.548 -0.445  261.424 1.00 40.59  ?  265 LYS C CA  1 
ATOM   9290  C C   . LYS C 1 271 ? 155.561 -1.342  260.723 1.00 41.18  ?  265 LYS C C   1 
ATOM   9291  O O   . LYS C 1 271 ? 156.206 -0.919  259.757 1.00 39.65  ?  265 LYS C O   1 
ATOM   9292  C CB  . LYS C 1 271 ? 155.187 0.242   262.633 1.00 44.18  ?  265 LYS C CB  1 
ATOM   9293  C CG  . LYS C 1 271 ? 155.558 -0.703  263.770 1.00 54.56  ?  265 LYS C CG  1 
ATOM   9294  C CD  . LYS C 1 271 ? 156.541 -0.070  264.748 1.00 46.26  ?  265 LYS C CD  1 
ATOM   9295  C CE  . LYS C 1 271 ? 155.890 1.012   265.599 1.00 40.75  ?  265 LYS C CE  1 
ATOM   9296  N NZ  . LYS C 1 271 ? 155.524 2.222   264.812 1.00 47.15  1  265 LYS C NZ  1 
ATOM   9297  N N   . TRP C 1 272 ? 155.708 -2.588  261.185 1.00 37.40  ?  266 TRP C N   1 
ATOM   9298  C CA  . TRP C 1 272 ? 156.753 -3.455  260.653 1.00 36.45  ?  266 TRP C CA  1 
ATOM   9299  C C   . TRP C 1 272 ? 156.497 -3.861  259.209 1.00 35.87  ?  266 TRP C C   1 
ATOM   9300  O O   . TRP C 1 272 ? 157.449 -4.192  258.495 1.00 37.13  ?  266 TRP C O   1 
ATOM   9301  C CB  . TRP C 1 272 ? 156.906 -4.698  261.529 1.00 40.19  ?  266 TRP C CB  1 
ATOM   9302  C CG  . TRP C 1 272 ? 157.262 -4.377  262.949 1.00 52.22  ?  266 TRP C CG  1 
ATOM   9303  C CD1 . TRP C 1 272 ? 156.518 -4.647  264.060 1.00 57.58  ?  266 TRP C CD1 1 
ATOM   9304  C CD2 . TRP C 1 272 ? 158.444 -3.710  263.410 1.00 63.31  ?  266 TRP C CD2 1 
ATOM   9305  N NE1 . TRP C 1 272 ? 157.166 -4.197  265.185 1.00 62.20  ?  266 TRP C NE1 1 
ATOM   9306  C CE2 . TRP C 1 272 ? 158.351 -3.617  264.813 1.00 70.09  ?  266 TRP C CE2 1 
ATOM   9307  C CE3 . TRP C 1 272 ? 159.574 -3.186  262.773 1.00 59.96  ?  266 TRP C CE3 1 
ATOM   9308  C CZ2 . TRP C 1 272 ? 159.343 -3.021  265.590 1.00 74.83  ?  266 TRP C CZ2 1 
ATOM   9309  C CZ3 . TRP C 1 272 ? 160.558 -2.594  263.547 1.00 56.08  ?  266 TRP C CZ3 1 
ATOM   9310  C CH2 . TRP C 1 272 ? 160.436 -2.517  264.939 1.00 67.91  ?  266 TRP C CH2 1 
ATOM   9311  N N   . THR C 1 273 ? 155.240 -3.841  258.761 1.00 38.70  ?  267 THR C N   1 
ATOM   9312  C CA  . THR C 1 273 ? 154.961 -4.128  257.358 1.00 37.75  ?  267 THR C CA  1 
ATOM   9313  C C   . THR C 1 273 ? 155.437 -2.991  256.463 1.00 37.08  ?  267 THR C C   1 
ATOM   9314  O O   . THR C 1 273 ? 155.987 -3.231  255.382 1.00 39.15  ?  267 THR C O   1 
ATOM   9315  C CB  . THR C 1 273 ? 153.467 -4.382  257.158 1.00 45.52  ?  267 THR C CB  1 
ATOM   9316  O OG1 . THR C 1 273 ? 153.020 -5.371  258.094 1.00 50.53  ?  267 THR C OG1 1 
ATOM   9317  C CG2 . THR C 1 273 ? 153.198 -4.877  255.745 1.00 34.92  ?  267 THR C CG2 1 
ATOM   9318  N N   . ALA C 1 274 ? 155.239 -1.745  256.900 1.00 35.75  ?  268 ALA C N   1 
ATOM   9319  C CA  . ALA C 1 274 ? 155.713 -0.600  256.131 1.00 31.52  ?  268 ALA C CA  1 
ATOM   9320  C C   . ALA C 1 274 ? 157.222 -0.425  256.258 1.00 29.55  ?  268 ALA C C   1 
ATOM   9321  O O   . ALA C 1 274 ? 157.885 -0.034  255.291 1.00 32.30  ?  268 ALA C O   1 
ATOM   9322  C CB  . ALA C 1 274 ? 154.988 0.669   256.579 1.00 27.10  ?  268 ALA C CB  1 
ATOM   9323  N N   . ILE C 1 275 ? 157.778 -0.704  257.440 1.00 30.66  ?  269 ILE C N   1 
ATOM   9324  C CA  . ILE C 1 275 ? 159.227 -0.639  257.616 1.00 33.35  ?  269 ILE C CA  1 
ATOM   9325  C C   . ILE C 1 275 ? 159.914 -1.659  256.718 1.00 30.61  ?  269 ILE C C   1 
ATOM   9326  O O   . ILE C 1 275 ? 160.954 -1.376  256.111 1.00 26.27  ?  269 ILE C O   1 
ATOM   9327  C CB  . ILE C 1 275 ? 159.600 -0.844  259.097 1.00 27.55  ?  269 ILE C CB  1 
ATOM   9328  C CG1 . ILE C 1 275 ? 159.126 0.342   259.937 1.00 29.34  ?  269 ILE C CG1 1 
ATOM   9329  C CG2 . ILE C 1 275 ? 161.101 -1.039  259.255 1.00 27.85  ?  269 ILE C CG2 1 
ATOM   9330  C CD1 . ILE C 1 275 ? 159.413 0.193   261.413 1.00 37.26  ?  269 ILE C CD1 1 
ATOM   9331  N N   . SER C 1 276 ? 159.341 -2.861  256.617 1.00 33.71  ?  270 SER C N   1 
ATOM   9332  C CA  . SER C 1 276 ? 159.893 -3.867  255.717 1.00 32.63  ?  270 SER C CA  1 
ATOM   9333  C C   . SER C 1 276 ? 159.854 -3.388  254.272 1.00 30.80  ?  270 SER C C   1 
ATOM   9334  O O   . SER C 1 276 ? 160.833 -3.542  253.534 1.00 29.69  ?  270 SER C O   1 
ATOM   9335  C CB  . SER C 1 276 ? 159.131 -5.183  255.872 1.00 30.19  ?  270 SER C CB  1 
ATOM   9336  O OG  . SER C 1 276 ? 159.773 -6.233  255.171 1.00 31.90  ?  270 SER C OG  1 
ATOM   9337  N N   . ALA C 1 277 ? 158.736 -2.787  253.856 1.00 29.15  ?  271 ALA C N   1 
ATOM   9338  C CA  . ALA C 1 277 ? 158.627 -2.278  252.493 1.00 28.18  ?  271 ALA C CA  1 
ATOM   9339  C C   . ALA C 1 277 ? 159.708 -1.245  252.197 1.00 31.01  ?  271 ALA C C   1 
ATOM   9340  O O   . ALA C 1 277 ? 160.282 -1.231  251.102 1.00 28.27  ?  271 ALA C O   1 
ATOM   9341  C CB  . ALA C 1 277 ? 157.240 -1.679  252.268 1.00 30.42  ?  271 ALA C CB  1 
ATOM   9342  N N   . LEU C 1 278 ? 160.001 -0.373  253.165 1.00 28.88  ?  272 LEU C N   1 
ATOM   9343  C CA  . LEU C 1 278 ? 161.043 0.626   252.965 1.00 27.83  ?  272 LEU C CA  1 
ATOM   9344  C C   . LEU C 1 278 ? 162.427 -0.008  252.900 1.00 30.01  ?  272 LEU C C   1 
ATOM   9345  O O   . LEU C 1 278 ? 163.297 0.486   252.174 1.00 34.90  ?  272 LEU C O   1 
ATOM   9346  C CB  . LEU C 1 278 ? 160.983 1.672   254.077 1.00 26.89  ?  272 LEU C CB  1 
ATOM   9347  C CG  . LEU C 1 278 ? 159.839 2.681   253.971 1.00 24.10  ?  272 LEU C CG  1 
ATOM   9348  C CD1 . LEU C 1 278 ? 159.625 3.398   255.291 1.00 29.51  ?  272 LEU C CD1 1 
ATOM   9349  C CD2 . LEU C 1 278 ? 160.125 3.681   252.864 1.00 22.76  ?  272 LEU C CD2 1 
ATOM   9350  N N   . GLU C 1 279 ? 162.647 -1.097  253.640 1.00 30.98  ?  273 GLU C N   1 
ATOM   9351  C CA  . GLU C 1 279 ? 163.943 -1.768  253.606 1.00 25.59  ?  273 GLU C CA  1 
ATOM   9352  C C   . GLU C 1 279 ? 164.204 -2.392  252.240 1.00 28.67  ?  273 GLU C C   1 
ATOM   9353  O O   . GLU C 1 279 ? 165.296 -2.247  251.679 1.00 37.69  ?  273 GLU C O   1 
ATOM   9354  C CB  . GLU C 1 279 ? 164.014 -2.826  254.707 1.00 30.12  ?  273 GLU C CB  1 
ATOM   9355  C CG  . GLU C 1 279 ? 164.043 -2.254  256.115 1.00 36.29  ?  273 GLU C CG  1 
ATOM   9356  C CD  . GLU C 1 279 ? 163.926 -3.324  257.183 1.00 35.58  ?  273 GLU C CD  1 
ATOM   9357  O OE1 . GLU C 1 279 ? 163.678 -4.495  256.827 1.00 31.71  ?  273 GLU C OE1 1 
ATOM   9358  O OE2 . GLU C 1 279 ? 164.080 -2.992  258.378 1.00 39.53  -1 273 GLU C OE2 1 
ATOM   9359  N N   . TYR C 1 280 ? 163.212 -3.090  251.687 1.00 34.63  ?  274 TYR C N   1 
ATOM   9360  C CA  . TYR C 1 280 ? 163.345 -3.711  250.376 1.00 35.48  ?  274 TYR C CA  1 
ATOM   9361  C C   . TYR C 1 280 ? 163.024 -2.760  249.231 1.00 37.58  ?  274 TYR C C   1 
ATOM   9362  O O   . TYR C 1 280 ? 163.206 -3.135  248.067 1.00 40.89  ?  274 TYR C O   1 
ATOM   9363  C CB  . TYR C 1 280 ? 162.447 -4.951  250.285 1.00 36.61  ?  274 TYR C CB  1 
ATOM   9364  C CG  . TYR C 1 280 ? 162.760 -5.997  251.331 1.00 42.55  ?  274 TYR C CG  1 
ATOM   9365  C CD1 . TYR C 1 280 ? 163.705 -6.986  251.096 1.00 47.64  ?  274 TYR C CD1 1 
ATOM   9366  C CD2 . TYR C 1 280 ? 162.117 -5.987  252.560 1.00 36.53  ?  274 TYR C CD2 1 
ATOM   9367  C CE1 . TYR C 1 280 ? 163.996 -7.937  252.057 1.00 48.47  ?  274 TYR C CE1 1 
ATOM   9368  C CE2 . TYR C 1 280 ? 162.400 -6.928  253.523 1.00 42.07  ?  274 TYR C CE2 1 
ATOM   9369  C CZ  . TYR C 1 280 ? 163.338 -7.901  253.269 1.00 51.79  ?  274 TYR C CZ  1 
ATOM   9370  O OH  . TYR C 1 280 ? 163.614 -8.835  254.237 1.00 55.70  ?  274 TYR C OH  1 
ATOM   9371  N N   . GLY C 1 281 ? 162.558 -1.551  249.526 1.00 33.36  ?  275 GLY C N   1 
ATOM   9372  C CA  . GLY C 1 281 ? 162.283 -0.571  248.489 1.00 31.11  ?  275 GLY C CA  1 
ATOM   9373  C C   . GLY C 1 281 ? 161.078 -0.885  247.630 1.00 33.62  ?  275 GLY C C   1 
ATOM   9374  O O   . GLY C 1 281 ? 161.105 -0.636  246.418 1.00 35.51  ?  275 GLY C O   1 
ATOM   9375  N N   . VAL C 1 282 ? 160.023 -1.421  248.224 1.00 34.29  ?  276 VAL C N   1 
ATOM   9376  C CA  . VAL C 1 282 ? 158.797 -1.772  247.510 1.00 27.94  ?  276 VAL C CA  1 
ATOM   9377  C C   . VAL C 1 282 ? 157.750 -0.706  247.811 1.00 29.58  ?  276 VAL C C   1 
ATOM   9378  O O   . VAL C 1 282 ? 157.522 -0.397  248.989 1.00 26.98  ?  276 VAL C O   1 
ATOM   9379  C CB  . VAL C 1 282 ? 158.288 -3.167  247.912 1.00 31.13  ?  276 VAL C CB  1 
ATOM   9380  C CG1 . VAL C 1 282 ? 157.014 -3.511  247.155 1.00 31.53  ?  276 VAL C CG1 1 
ATOM   9381  C CG2 . VAL C 1 282 ? 159.363 -4.212  247.663 1.00 31.61  ?  276 VAL C CG2 1 
ATOM   9382  N N   . PRO C 1 283 ? 157.100 -0.128  246.798 1.00 25.15  ?  277 PRO C N   1 
ATOM   9383  C CA  . PRO C 1 283 ? 156.132 0.946   247.059 1.00 26.48  ?  277 PRO C CA  1 
ATOM   9384  C C   . PRO C 1 283 ? 154.822 0.449   247.649 1.00 30.28  ?  277 PRO C C   1 
ATOM   9385  O O   . PRO C 1 283 ? 153.790 0.444   246.969 1.00 30.62  ?  277 PRO C O   1 
ATOM   9386  C CB  . PRO C 1 283 ? 155.920 1.563   245.671 1.00 29.54  ?  277 PRO C CB  1 
ATOM   9387  C CG  . PRO C 1 283 ? 156.189 0.443   244.727 1.00 24.80  ?  277 PRO C CG  1 
ATOM   9388  C CD  . PRO C 1 283 ? 157.286 -0.370  245.357 1.00 25.04  ?  277 PRO C CD  1 
ATOM   9389  N N   . VAL C 1 284 ? 154.847 0.028   248.912 1.00 28.54  ?  278 VAL C N   1 
ATOM   9390  C CA  . VAL C 1 284 ? 153.623 -0.311  249.628 1.00 26.76  ?  278 VAL C CA  1 
ATOM   9391  C C   . VAL C 1 284 ? 153.099 0.970   250.265 1.00 28.92  ?  278 VAL C C   1 
ATOM   9392  O O   . VAL C 1 284 ? 153.189 1.161   251.484 1.00 33.08  ?  278 VAL C O   1 
ATOM   9393  C CB  . VAL C 1 284 ? 153.864 -1.417  250.673 1.00 27.16  ?  278 VAL C CB  1 
ATOM   9394  C CG1 . VAL C 1 284 ? 152.547 -1.877  251.278 1.00 30.99  ?  278 VAL C CG1 1 
ATOM   9395  C CG2 . VAL C 1 284 ? 154.592 -2.591  250.035 1.00 28.34  ?  278 VAL C CG2 1 
ATOM   9396  N N   . THR C 1 285 ? 152.556 1.862   249.435 1.00 27.21  ?  279 THR C N   1 
ATOM   9397  C CA  . THR C 1 285 ? 152.207 3.202   249.892 1.00 28.27  ?  279 THR C CA  1 
ATOM   9398  C C   . THR C 1 285 ? 150.926 3.209   250.716 1.00 31.11  ?  279 THR C C   1 
ATOM   9399  O O   . THR C 1 285 ? 150.802 3.993   251.664 1.00 33.36  ?  279 THR C O   1 
ATOM   9400  C CB  . THR C 1 285 ? 152.065 4.140   248.694 1.00 27.02  ?  279 THR C CB  1 
ATOM   9401  O OG1 . THR C 1 285 ? 150.894 3.788   247.947 1.00 31.61  ?  279 THR C OG1 1 
ATOM   9402  C CG2 . THR C 1 285 ? 153.279 4.030   247.788 1.00 22.74  ?  279 THR C CG2 1 
ATOM   9403  N N   . LEU C 1 286 ? 149.965 2.350   250.371 1.00 30.95  ?  280 LEU C N   1 
ATOM   9404  C CA  . LEU C 1 286 ? 148.671 2.378   251.046 1.00 32.99  ?  280 LEU C CA  1 
ATOM   9405  C C   . LEU C 1 286 ? 148.800 1.951   252.503 1.00 31.17  ?  280 LEU C C   1 
ATOM   9406  O O   . LEU C 1 286 ? 148.285 2.623   253.405 1.00 28.74  ?  280 LEU C O   1 
ATOM   9407  C CB  . LEU C 1 286 ? 147.674 1.489   250.300 1.00 28.37  ?  280 LEU C CB  1 
ATOM   9408  C CG  . LEU C 1 286 ? 146.199 1.598   250.695 1.00 29.01  ?  280 LEU C CG  1 
ATOM   9409  C CD1 . LEU C 1 286 ? 145.310 1.402   249.479 1.00 36.04  ?  280 LEU C CD1 1 
ATOM   9410  C CD2 . LEU C 1 286 ? 145.846 0.587   251.772 1.00 31.00  ?  280 LEU C CD2 1 
ATOM   9411  N N   . ILE C 1 287 ? 149.484 0.833   252.753 1.00 33.66  ?  281 ILE C N   1 
ATOM   9412  C CA  . ILE C 1 287 ? 149.646 0.355   254.123 1.00 30.89  ?  281 ILE C CA  1 
ATOM   9413  C C   . ILE C 1 287 ? 150.470 1.343   254.939 1.00 31.36  ?  281 ILE C C   1 
ATOM   9414  O O   . ILE C 1 287 ? 150.164 1.615   256.106 1.00 31.65  ?  281 ILE C O   1 
ATOM   9415  C CB  . ILE C 1 287 ? 150.274 -1.051  254.125 1.00 30.01  ?  281 ILE C CB  1 
ATOM   9416  C CG1 . ILE C 1 287 ? 149.340 -2.045  253.431 1.00 30.13  ?  281 ILE C CG1 1 
ATOM   9417  C CG2 . ILE C 1 287 ? 150.581 -1.501  255.546 1.00 29.36  ?  281 ILE C CG2 1 
ATOM   9418  C CD1 . ILE C 1 287 ? 149.910 -3.439  253.312 1.00 30.11  ?  281 ILE C CD1 1 
ATOM   9419  N N   . GLY C 1 288 ? 151.524 1.900   254.337 1.00 28.45  ?  282 GLY C N   1 
ATOM   9420  C CA  . GLY C 1 288 ? 152.319 2.894   255.038 1.00 30.83  ?  282 GLY C CA  1 
ATOM   9421  C C   . GLY C 1 288 ? 151.509 4.112   255.437 1.00 31.21  ?  282 GLY C C   1 
ATOM   9422  O O   . GLY C 1 288 ? 151.716 4.685   256.510 1.00 28.01  ?  282 GLY C O   1 
ATOM   9423  N N   . GLU C 1 289 ? 150.569 4.520   254.582 1.00 34.56  ?  283 GLU C N   1 
ATOM   9424  C CA  . GLU C 1 289 ? 149.703 5.641   254.925 1.00 32.25  ?  283 GLU C CA  1 
ATOM   9425  C C   . GLU C 1 289 ? 148.692 5.257   255.997 1.00 32.98  ?  283 GLU C C   1 
ATOM   9426  O O   . GLU C 1 289 ? 148.320 6.096   256.825 1.00 29.98  ?  283 GLU C O   1 
ATOM   9427  C CB  . GLU C 1 289 ? 148.987 6.153   253.678 1.00 26.00  ?  283 GLU C CB  1 
ATOM   9428  C CG  . GLU C 1 289 ? 148.728 7.644   253.697 1.00 32.86  ?  283 GLU C CG  1 
ATOM   9429  C CD  . GLU C 1 289 ? 149.925 8.447   253.237 1.00 41.27  ?  283 GLU C CD  1 
ATOM   9430  O OE1 . GLU C 1 289 ? 149.732 9.388   252.441 1.00 41.12  ?  283 GLU C OE1 1 
ATOM   9431  O OE2 . GLU C 1 289 ? 151.059 8.133   253.658 1.00 44.57  -1 283 GLU C OE2 1 
ATOM   9432  N N   . ALA C 1 290 ? 148.235 4.000   255.996 1.00 34.23  ?  284 ALA C N   1 
ATOM   9433  C CA  . ALA C 1 290 ? 147.322 3.542   257.038 1.00 30.72  ?  284 ALA C CA  1 
ATOM   9434  C C   . ALA C 1 290 ? 147.988 3.536   258.408 1.00 37.92  ?  284 ALA C C   1 
ATOM   9435  O O   . ALA C 1 290 ? 147.328 3.811   259.416 1.00 35.43  ?  284 ALA C O   1 
ATOM   9436  C CB  . ALA C 1 290 ? 146.796 2.147   256.699 1.00 27.27  ?  284 ALA C CB  1 
ATOM   9437  N N   . VAL C 1 291 ? 149.285 3.226   258.465 1.00 36.00  ?  285 VAL C N   1 
ATOM   9438  C CA  . VAL C 1 291 ? 150.011 3.296   259.729 1.00 31.04  ?  285 VAL C CA  1 
ATOM   9439  C C   . VAL C 1 291 ? 150.200 4.746   260.152 1.00 33.66  ?  285 VAL C C   1 
ATOM   9440  O O   . VAL C 1 291 ? 150.008 5.097   261.322 1.00 32.12  ?  285 VAL C O   1 
ATOM   9441  C CB  . VAL C 1 291 ? 151.357 2.557   259.613 1.00 28.08  ?  285 VAL C CB  1 
ATOM   9442  C CG1 . VAL C 1 291 ? 152.124 2.633   260.925 1.00 31.36  ?  285 VAL C CG1 1 
ATOM   9443  C CG2 . VAL C 1 291 ? 151.132 1.113   259.205 1.00 33.97  ?  285 VAL C CG2 1 
ATOM   9444  N N   . PHE C 1 292 ? 150.579 5.613   259.208 1.00 30.36  ?  286 PHE C N   1 
ATOM   9445  C CA  . PHE C 1 292 ? 150.689 7.036   259.508 1.00 31.03  ?  286 PHE C CA  1 
ATOM   9446  C C   . PHE C 1 292 ? 149.345 7.629   259.909 1.00 35.60  ?  286 PHE C C   1 
ATOM   9447  O O   . PHE C 1 292 ? 149.297 8.588   260.688 1.00 35.87  ?  286 PHE C O   1 
ATOM   9448  C CB  . PHE C 1 292 ? 151.258 7.788   258.303 1.00 32.42  ?  286 PHE C CB  1 
ATOM   9449  C CG  . PHE C 1 292 ? 152.740 7.619   258.121 1.00 27.68  ?  286 PHE C CG  1 
ATOM   9450  C CD1 . PHE C 1 292 ? 153.582 7.527   259.217 1.00 35.42  ?  286 PHE C CD1 1 
ATOM   9451  C CD2 . PHE C 1 292 ? 153.292 7.557   256.852 1.00 29.10  ?  286 PHE C CD2 1 
ATOM   9452  C CE1 . PHE C 1 292 ? 154.948 7.376   259.051 1.00 28.67  ?  286 PHE C CE1 1 
ATOM   9453  C CE2 . PHE C 1 292 ? 154.656 7.404   256.679 1.00 29.66  ?  286 PHE C CE2 1 
ATOM   9454  C CZ  . PHE C 1 292 ? 155.484 7.313   257.780 1.00 26.95  ?  286 PHE C CZ  1 
ATOM   9455  N N   . ALA C 1 293 ? 148.246 7.078   259.387 1.00 38.09  ?  287 ALA C N   1 
ATOM   9456  C CA  . ALA C 1 293 ? 146.924 7.578   259.749 1.00 36.35  ?  287 ALA C CA  1 
ATOM   9457  C C   . ALA C 1 293 ? 146.596 7.267   261.204 1.00 38.03  ?  287 ALA C C   1 
ATOM   9458  O O   . ALA C 1 293 ? 146.001 8.097   261.902 1.00 39.90  ?  287 ALA C O   1 
ATOM   9459  C CB  . ALA C 1 293 ? 145.865 6.987   258.819 1.00 30.66  ?  287 ALA C CB  1 
ATOM   9460  N N   . ARG C 1 294 ? 146.971 6.076   261.679 1.00 34.38  ?  288 ARG C N   1 
ATOM   9461  C CA  . ARG C 1 294 ? 146.764 5.748   263.086 1.00 35.78  ?  288 ARG C CA  1 
ATOM   9462  C C   . ARG C 1 294 ? 147.605 6.643   263.987 1.00 41.74  ?  288 ARG C C   1 
ATOM   9463  O O   . ARG C 1 294 ? 147.146 7.069   265.054 1.00 43.64  ?  288 ARG C O   1 
ATOM   9464  C CB  . ARG C 1 294 ? 147.090 4.277   263.343 1.00 37.84  ?  288 ARG C CB  1 
ATOM   9465  C CG  . ARG C 1 294 ? 146.124 3.292   262.709 1.00 37.89  ?  288 ARG C CG  1 
ATOM   9466  C CD  . ARG C 1 294 ? 146.256 1.922   263.356 1.00 33.75  ?  288 ARG C CD  1 
ATOM   9467  N NE  . ARG C 1 294 ? 145.315 0.952   262.803 1.00 51.73  ?  288 ARG C NE  1 
ATOM   9468  C CZ  . ARG C 1 294 ? 145.174 -0.290  263.255 1.00 53.37  ?  288 ARG C CZ  1 
ATOM   9469  N NH1 . ARG C 1 294 ? 145.913 -0.715  264.271 1.00 59.74  1  288 ARG C NH1 1 
ATOM   9470  N NH2 . ARG C 1 294 ? 144.294 -1.107  262.694 1.00 48.56  ?  288 ARG C NH2 1 
ATOM   9471  N N   . CYS C 1 295 ? 148.842 6.936   263.575 1.00 40.60  ?  289 CYS C N   1 
ATOM   9472  C CA  . CYS C 1 295 ? 149.696 7.816   264.366 1.00 35.30  ?  289 CYS C CA  1 
ATOM   9473  C C   . CYS C 1 295 ? 149.108 9.218   264.454 1.00 42.33  ?  289 CYS C C   1 
ATOM   9474  O O   . CYS C 1 295 ? 149.144 9.849   265.517 1.00 50.76  ?  289 CYS C O   1 
ATOM   9475  C CB  . CYS C 1 295 ? 151.102 7.860   263.768 1.00 34.11  ?  289 CYS C CB  1 
ATOM   9476  S SG  . CYS C 1 295 ? 151.937 6.259   263.691 1.00 45.09  ?  289 CYS C SG  1 
ATOM   9477  N N   . LEU C 1 296 ? 148.562 9.723   263.346 1.00 37.32  ?  290 LEU C N   1 
ATOM   9478  C CA  . LEU C 1 296 ? 147.907 11.025  263.375 1.00 36.11  ?  290 LEU C CA  1 
ATOM   9479  C C   . LEU C 1 296 ? 146.668 11.003  264.261 1.00 42.11  ?  290 LEU C C   1 
ATOM   9480  O O   . LEU C 1 296 ? 146.348 12.008  264.906 1.00 49.29  ?  290 LEU C O   1 
ATOM   9481  C CB  . LEU C 1 296 ? 147.541 11.459  261.955 1.00 33.45  ?  290 LEU C CB  1 
ATOM   9482  C CG  . LEU C 1 296 ? 146.822 12.802  261.812 1.00 32.41  ?  290 LEU C CG  1 
ATOM   9483  C CD1 . LEU C 1 296 ? 147.681 13.932  262.358 1.00 36.36  ?  290 LEU C CD1 1 
ATOM   9484  C CD2 . LEU C 1 296 ? 146.451 13.057  260.362 1.00 33.69  ?  290 LEU C CD2 1 
ATOM   9485  N N   . SER C 1 297 ? 145.967 9.869   264.313 1.00 43.07  ?  291 SER C N   1 
ATOM   9486  C CA  . SER C 1 297 ? 144.770 9.774   265.142 1.00 43.12  ?  291 SER C CA  1 
ATOM   9487  C C   . SER C 1 297 ? 145.108 9.800   266.626 1.00 50.92  ?  291 SER C C   1 
ATOM   9488  O O   . SER C 1 297 ? 144.339 10.349  267.425 1.00 47.10  ?  291 SER C O   1 
ATOM   9489  C CB  . SER C 1 297 ? 143.998 8.503   264.803 1.00 42.14  ?  291 SER C CB  1 
ATOM   9490  O OG  . SER C 1 297 ? 144.728 7.349   265.184 1.00 39.32  ?  291 SER C OG  1 
ATOM   9491  N N   . SER C 1 298 ? 146.242 9.211   267.015 1.00 49.50  ?  292 SER C N   1 
ATOM   9492  C CA  . SER C 1 298 ? 146.646 9.228   268.416 1.00 43.18  ?  292 SER C CA  1 
ATOM   9493  C C   . SER C 1 298 ? 146.951 10.636  268.906 1.00 44.39  ?  292 SER C C   1 
ATOM   9494  O O   . SER C 1 298 ? 146.988 10.864  270.120 1.00 47.58  ?  292 SER C O   1 
ATOM   9495  C CB  . SER C 1 298 ? 147.864 8.328   268.625 1.00 44.05  ?  292 SER C CB  1 
ATOM   9496  O OG  . SER C 1 298 ? 148.988 8.815   267.912 1.00 56.06  ?  292 SER C OG  1 
ATOM   9497  N N   . LEU C 1 299 ? 147.167 11.581  267.992 1.00 37.90  ?  293 LEU C N   1 
ATOM   9498  C CA  . LEU C 1 299 ? 147.385 12.976  268.355 1.00 42.95  ?  293 LEU C CA  1 
ATOM   9499  C C   . LEU C 1 299 ? 146.050 13.676  268.571 1.00 46.68  ?  293 LEU C C   1 
ATOM   9500  O O   . LEU C 1 299 ? 145.804 14.745  268.003 1.00 50.37  ?  293 LEU C O   1 
ATOM   9501  C CB  . LEU C 1 299 ? 148.198 13.693  267.274 1.00 42.73  ?  293 LEU C CB  1 
ATOM   9502  C CG  . LEU C 1 299 ? 149.730 13.647  267.339 1.00 48.57  ?  293 LEU C CG  1 
ATOM   9503  C CD1 . LEU C 1 299 ? 150.262 12.225  267.444 1.00 43.68  ?  293 LEU C CD1 1 
ATOM   9504  C CD2 . LEU C 1 299 ? 150.324 14.347  266.126 1.00 44.54  ?  293 LEU C CD2 1 
ATOM   9505  N N   . LYS C 1 300 ? 145.183 13.077  269.392 1.00 48.87  ?  294 LYS C N   1 
ATOM   9506  C CA  . LYS C 1 300 ? 143.848 13.627  269.609 1.00 50.05  ?  294 LYS C CA  1 
ATOM   9507  C C   . LYS C 1 300 ? 143.917 15.023  270.214 1.00 52.35  ?  294 LYS C C   1 
ATOM   9508  O O   . LYS C 1 300 ? 143.316 15.969  269.692 1.00 52.40  ?  294 LYS C O   1 
ATOM   9509  C CB  . LYS C 1 300 ? 143.038 12.689  270.506 1.00 57.98  ?  294 LYS C CB  1 
ATOM   9510  C CG  . LYS C 1 300 ? 141.689 13.242  270.939 1.00 53.93  ?  294 LYS C CG  1 
ATOM   9511  C CD  . LYS C 1 300 ? 140.750 13.420  269.759 1.00 46.21  ?  294 LYS C CD  1 
ATOM   9512  C CE  . LYS C 1 300 ? 139.393 13.936  270.212 1.00 53.52  ?  294 LYS C CE  1 
ATOM   9513  N NZ  . LYS C 1 300 ? 138.426 14.024  269.083 1.00 53.32  1  294 LYS C NZ  1 
ATOM   9514  N N   . ASP C 1 301 ? 144.651 15.169  271.321 1.00 54.09  ?  295 ASP C N   1 
ATOM   9515  C CA  . ASP C 1 301 ? 144.763 16.471  271.973 1.00 60.43  ?  295 ASP C CA  1 
ATOM   9516  C C   . ASP C 1 301 ? 145.359 17.512  271.034 1.00 56.80  ?  295 ASP C C   1 
ATOM   9517  O O   . ASP C 1 301 ? 144.893 18.656  270.986 1.00 59.39  ?  295 ASP C O   1 
ATOM   9518  C CB  . ASP C 1 301 ? 145.607 16.349  273.241 1.00 61.89  ?  295 ASP C CB  1 
ATOM   9519  C CG  . ASP C 1 301 ? 144.949 15.485  274.298 1.00 69.29  ?  295 ASP C CG  1 
ATOM   9520  O OD1 . ASP C 1 301 ? 143.780 15.756  274.646 1.00 70.92  ?  295 ASP C OD1 1 
ATOM   9521  O OD2 . ASP C 1 301 ? 145.598 14.531  274.776 1.00 69.78  -1 295 ASP C OD2 1 
ATOM   9522  N N   . GLU C 1 302 ? 146.386 17.130  270.272 1.00 53.36  ?  296 GLU C N   1 
ATOM   9523  C CA  . GLU C 1 302 ? 147.010 18.073  269.351 1.00 51.42  ?  296 GLU C CA  1 
ATOM   9524  C C   . GLU C 1 302 ? 146.076 18.440  268.203 1.00 53.74  ?  296 GLU C C   1 
ATOM   9525  O O   . GLU C 1 302 ? 146.155 19.555  267.674 1.00 54.81  ?  296 GLU C O   1 
ATOM   9526  C CB  . GLU C 1 302 ? 148.319 17.491  268.817 1.00 45.27  ?  296 GLU C CB  1 
ATOM   9527  C CG  . GLU C 1 302 ? 149.182 18.487  268.064 1.00 53.24  ?  296 GLU C CG  1 
ATOM   9528  C CD  . GLU C 1 302 ? 150.531 17.915  267.672 1.00 62.55  ?  296 GLU C CD  1 
ATOM   9529  O OE1 . GLU C 1 302 ? 150.911 16.855  268.213 1.00 58.25  ?  296 GLU C OE1 1 
ATOM   9530  O OE2 . GLU C 1 302 ? 151.213 18.527  266.822 1.00 58.86  -1 296 GLU C OE2 1 
ATOM   9531  N N   . ARG C 1 303 ? 145.183 17.527  267.811 1.00 52.40  ?  297 ARG C N   1 
ATOM   9532  C CA  . ARG C 1 303 ? 144.231 17.830  266.748 1.00 52.49  ?  297 ARG C CA  1 
ATOM   9533  C C   . ARG C 1 303 ? 143.087 18.710  267.234 1.00 54.77  ?  297 ARG C C   1 
ATOM   9534  O O   . ARG C 1 303 ? 142.516 19.467  266.440 1.00 52.13  ?  297 ARG C O   1 
ATOM   9535  C CB  . ARG C 1 303 ? 143.680 16.536  266.144 1.00 45.21  ?  297 ARG C CB  1 
ATOM   9536  C CG  . ARG C 1 303 ? 144.654 15.829  265.215 1.00 42.86  ?  297 ARG C CG  1 
ATOM   9537  C CD  . ARG C 1 303 ? 144.035 14.599  264.564 1.00 45.51  ?  297 ARG C CD  1 
ATOM   9538  N NE  . ARG C 1 303 ? 143.738 13.543  265.527 1.00 42.11  ?  297 ARG C NE  1 
ATOM   9539  C CZ  . ARG C 1 303 ? 142.515 13.232  265.946 1.00 45.07  ?  297 ARG C CZ  1 
ATOM   9540  N NH1 . ARG C 1 303 ? 141.465 13.895  265.482 1.00 44.88  1  297 ARG C NH1 1 
ATOM   9541  N NH2 . ARG C 1 303 ? 142.343 12.254  266.824 1.00 47.51  ?  297 ARG C NH2 1 
ATOM   9542  N N   . ILE C 1 304 ? 142.737 18.627  268.519 1.00 52.78  ?  298 ILE C N   1 
ATOM   9543  C CA  . ILE C 1 304 ? 141.694 19.495  269.057 1.00 57.99  ?  298 ILE C CA  1 
ATOM   9544  C C   . ILE C 1 304 ? 142.139 20.952  269.012 1.00 62.81  ?  298 ILE C C   1 
ATOM   9545  O O   . ILE C 1 304 ? 141.372 21.837  268.614 1.00 61.62  ?  298 ILE C O   1 
ATOM   9546  C CB  . ILE C 1 304 ? 141.319 19.062  270.486 1.00 62.25  ?  298 ILE C CB  1 
ATOM   9547  C CG1 . ILE C 1 304 ? 140.743 17.645  270.483 1.00 61.46  ?  298 ILE C CG1 1 
ATOM   9548  C CG2 . ILE C 1 304 ? 140.324 20.037  271.095 1.00 64.22  ?  298 ILE C CG2 1 
ATOM   9549  C CD1 . ILE C 1 304 ? 140.451 17.104  271.865 1.00 53.05  ?  298 ILE C CD1 1 
ATOM   9550  N N   . GLN C 1 305 ? 143.383 21.223  269.413 1.00 66.17  ?  299 GLN C N   1 
ATOM   9551  C CA  . GLN C 1 305 ? 143.894 22.588  269.361 1.00 67.02  ?  299 GLN C CA  1 
ATOM   9552  C C   . GLN C 1 305 ? 144.032 23.080  267.927 1.00 63.99  ?  299 GLN C C   1 
ATOM   9553  O O   . GLN C 1 305 ? 143.828 24.269  267.658 1.00 64.43  ?  299 GLN C O   1 
ATOM   9554  C CB  . GLN C 1 305 ? 145.238 22.672  270.085 1.00 67.36  ?  299 GLN C CB  1 
ATOM   9555  C CG  . GLN C 1 305 ? 145.223 22.059  271.474 1.00 68.30  ?  299 GLN C CG  1 
ATOM   9556  C CD  . GLN C 1 305 ? 144.123 22.628  272.348 1.00 77.23  ?  299 GLN C CD  1 
ATOM   9557  O OE1 . GLN C 1 305 ? 143.241 21.903  272.807 1.00 66.50  ?  299 GLN C OE1 1 
ATOM   9558  N NE2 . GLN C 1 305 ? 144.172 23.935  272.585 1.00 79.25  ?  299 GLN C NE2 1 
ATOM   9559  N N   . ALA C 1 306 ? 144.372 22.185  266.997 1.00 61.52  ?  300 ALA C N   1 
ATOM   9560  C CA  . ALA C 1 306 ? 144.463 22.577  265.596 1.00 57.50  ?  300 ALA C CA  1 
ATOM   9561  C C   . ALA C 1 306 ? 143.087 22.793  264.982 1.00 59.50  ?  300 ALA C C   1 
ATOM   9562  O O   . ALA C 1 306 ? 142.944 23.594  264.051 1.00 57.78  ?  300 ALA C O   1 
ATOM   9563  C CB  . ALA C 1 306 ? 145.238 21.524  264.805 1.00 45.03  ?  300 ALA C CB  1 
ATOM   9564  N N   . SER C 1 307 ? 142.066 22.094  265.486 1.00 59.36  ?  301 SER C N   1 
ATOM   9565  C CA  . SER C 1 307 ? 140.717 22.270  264.961 1.00 53.29  ?  301 SER C CA  1 
ATOM   9566  C C   . SER C 1 307 ? 140.184 23.669  265.238 1.00 57.20  ?  301 SER C C   1 
ATOM   9567  O O   . SER C 1 307 ? 139.313 24.155  264.507 1.00 54.38  ?  301 SER C O   1 
ATOM   9568  C CB  . SER C 1 307 ? 139.779 21.217  265.554 1.00 53.92  ?  301 SER C CB  1 
ATOM   9569  O OG  . SER C 1 307 ? 139.740 21.305  266.968 1.00 56.50  ?  301 SER C OG  1 
ATOM   9570  N N   . LYS C 1 308 ? 140.693 24.329  266.279 1.00 60.19  ?  302 LYS C N   1 
ATOM   9571  C CA  . LYS C 1 308 ? 140.260 25.686  266.588 1.00 65.32  ?  302 LYS C CA  1 
ATOM   9572  C C   . LYS C 1 308 ? 140.948 26.722  265.707 1.00 64.18  ?  302 LYS C C   1 
ATOM   9573  O O   . LYS C 1 308 ? 140.344 27.751  265.383 1.00 55.69  ?  302 LYS C O   1 
ATOM   9574  C CB  . LYS C 1 308 ? 140.529 26.001  268.061 1.00 64.52  ?  302 LYS C CB  1 
ATOM   9575  C CG  . LYS C 1 308 ? 139.976 24.976  269.037 1.00 66.53  ?  302 LYS C CG  1 
ATOM   9576  C CD  . LYS C 1 308 ? 140.399 25.298  270.463 1.00 68.31  ?  302 LYS C CD  1 
ATOM   9577  C CE  . LYS C 1 308 ? 139.912 24.241  271.441 1.00 75.42  ?  302 LYS C CE  1 
ATOM   9578  N NZ  . LYS C 1 308 ? 140.374 24.517  272.830 1.00 76.32  1  302 LYS C NZ  1 
ATOM   9579  N N   . LYS C 1 309 ? 142.194 26.470  265.308 1.00 62.30  ?  303 LYS C N   1 
ATOM   9580  C CA  . LYS C 1 309 ? 142.996 27.456  264.596 1.00 57.15  ?  303 LYS C CA  1 
ATOM   9581  C C   . LYS C 1 309 ? 143.052 27.230  263.092 1.00 55.99  ?  303 LYS C C   1 
ATOM   9582  O O   . LYS C 1 309 ? 143.178 28.201  262.338 1.00 57.80  ?  303 LYS C O   1 
ATOM   9583  C CB  . LYS C 1 309 ? 144.425 27.470  265.151 1.00 67.71  ?  303 LYS C CB  1 
ATOM   9584  C CG  . LYS C 1 309 ? 144.506 27.735  266.648 1.00 63.34  ?  303 LYS C CG  1 
ATOM   9585  C CD  . LYS C 1 309 ? 143.978 29.118  266.995 1.00 64.38  ?  303 LYS C CD  1 
ATOM   9586  C CE  . LYS C 1 309 ? 144.802 30.206  266.324 1.00 74.85  ?  303 LYS C CE  1 
ATOM   9587  N NZ  . LYS C 1 309 ? 144.295 31.568  266.647 1.00 76.16  1  303 LYS C NZ  1 
ATOM   9588  N N   . LEU C 1 310 ? 142.968 25.985  262.634 1.00 58.36  ?  304 LEU C N   1 
ATOM   9589  C CA  . LEU C 1 310 ? 143.036 25.667  261.214 1.00 60.42  ?  304 LEU C CA  1 
ATOM   9590  C C   . LEU C 1 310 ? 141.633 25.487  260.649 1.00 59.80  ?  304 LEU C C   1 
ATOM   9591  O O   . LEU C 1 310 ? 140.789 24.822  261.256 1.00 65.00  ?  304 LEU C O   1 
ATOM   9592  C CB  . LEU C 1 310 ? 143.862 24.402  260.979 1.00 55.78  ?  304 LEU C CB  1 
ATOM   9593  C CG  . LEU C 1 310 ? 145.326 24.460  261.419 1.00 50.07  ?  304 LEU C CG  1 
ATOM   9594  C CD1 . LEU C 1 310 ? 145.992 23.104  261.255 1.00 43.35  ?  304 LEU C CD1 1 
ATOM   9595  C CD2 . LEU C 1 310 ? 146.076 25.528  260.638 1.00 53.16  ?  304 LEU C CD2 1 
ATOM   9596  N N   . LYS C 1 311 ? 141.391 26.078  259.483 1.00 52.17  ?  305 LYS C N   1 
ATOM   9597  C CA  . LYS C 1 311 ? 140.094 26.015  258.830 1.00 57.75  ?  305 LYS C CA  1 
ATOM   9598  C C   . LYS C 1 311 ? 140.167 25.129  257.592 1.00 59.76  ?  305 LYS C C   1 
ATOM   9599  O O   . LYS C 1 311 ? 141.239 24.893  257.028 1.00 56.84  ?  305 LYS C O   1 
ATOM   9600  C CB  . LYS C 1 311 ? 139.598 27.420  258.454 1.00 64.89  ?  305 LYS C CB  1 
ATOM   9601  C CG  . LYS C 1 311 ? 139.794 27.814  256.992 1.00 73.45  ?  305 LYS C CG  1 
ATOM   9602  C CD  . LYS C 1 311 ? 141.238 28.166  256.668 1.00 75.78  ?  305 LYS C CD  1 
ATOM   9603  C CE  . LYS C 1 311 ? 141.411 28.408  255.175 1.00 71.99  ?  305 LYS C CE  1 
ATOM   9604  N NZ  . LYS C 1 311 ? 140.584 29.549  254.691 1.00 72.27  1  305 LYS C NZ  1 
ATOM   9605  N N   . GLY C 1 312 ? 139.003 24.633  257.179 1.00 57.18  ?  306 GLY C N   1 
ATOM   9606  C CA  . GLY C 1 312 ? 138.902 23.810  255.998 1.00 51.23  ?  306 GLY C CA  1 
ATOM   9607  C C   . GLY C 1 312 ? 138.442 24.600  254.792 1.00 54.75  ?  306 GLY C C   1 
ATOM   9608  O O   . GLY C 1 312 ? 138.558 25.829  254.746 1.00 61.98  ?  306 GLY C O   1 
ATOM   9609  N N   . PRO C 1 313 ? 137.918 23.906  253.782 1.00 49.63  ?  307 PRO C N   1 
ATOM   9610  C CA  . PRO C 1 313 ? 137.413 24.605  252.593 1.00 51.23  ?  307 PRO C CA  1 
ATOM   9611  C C   . PRO C 1 313 ? 136.287 25.560  252.964 1.00 68.11  ?  307 PRO C C   1 
ATOM   9612  O O   . PRO C 1 313 ? 135.364 25.205  253.700 1.00 70.85  ?  307 PRO C O   1 
ATOM   9613  C CB  . PRO C 1 313 ? 136.925 23.466  251.690 1.00 52.03  ?  307 PRO C CB  1 
ATOM   9614  C CG  . PRO C 1 313 ? 136.701 22.310  252.613 1.00 52.83  ?  307 PRO C CG  1 
ATOM   9615  C CD  . PRO C 1 313 ? 137.733 22.449  253.690 1.00 51.76  ?  307 PRO C CD  1 
ATOM   9616  N N   . GLN C 1 314 ? 136.380 26.788  252.449 1.00 73.63  ?  308 GLN C N   1 
ATOM   9617  C CA  . GLN C 1 314 ? 135.456 27.845  252.847 1.00 80.42  ?  308 GLN C CA  1 
ATOM   9618  C C   . GLN C 1 314 ? 134.020 27.502  252.467 1.00 89.08  ?  308 GLN C C   1 
ATOM   9619  O O   . GLN C 1 314 ? 133.150 27.361  253.333 1.00 83.37  ?  308 GLN C O   1 
ATOM   9620  C CB  . GLN C 1 314 ? 135.883 29.172  252.215 1.00 82.04  ?  308 GLN C CB  1 
ATOM   9621  C CG  . GLN C 1 314 ? 137.082 29.823  252.882 1.00 84.70  ?  308 GLN C CG  1 
ATOM   9622  C CD  . GLN C 1 314 ? 136.735 30.442  254.222 1.00 89.00  ?  308 GLN C CD  1 
ATOM   9623  O OE1 . GLN C 1 314 ? 137.087 29.911  255.275 1.00 87.21  ?  308 GLN C OE1 1 
ATOM   9624  N NE2 . GLN C 1 314 ? 136.043 31.575  254.187 1.00 86.83  ?  308 GLN C NE2 1 
ATOM   9625  N N   . LYS C 1 315 ? 133.753 27.366  251.171 1.00 97.60  ?  309 LYS C N   1 
ATOM   9626  C CA  . LYS C 1 315 ? 132.404 27.145  250.666 1.00 92.76  ?  309 LYS C CA  1 
ATOM   9627  C C   . LYS C 1 315 ? 132.369 25.850  249.866 1.00 84.93  ?  309 LYS C C   1 
ATOM   9628  O O   . LYS C 1 315 ? 133.057 25.724  248.847 1.00 77.97  ?  309 LYS C O   1 
ATOM   9629  C CB  . LYS C 1 315 ? 131.942 28.332  249.814 1.00 91.73  ?  309 LYS C CB  1 
ATOM   9630  C CG  . LYS C 1 315 ? 132.951 28.787  248.765 1.00 93.49  ?  309 LYS C CG  1 
ATOM   9631  C CD  . LYS C 1 315 ? 133.057 30.302  248.706 1.00 92.74  ?  309 LYS C CD  1 
ATOM   9632  C CE  . LYS C 1 315 ? 133.612 30.862  250.006 1.00 92.82  ?  309 LYS C CE  1 
ATOM   9633  N NZ  . LYS C 1 315 ? 133.914 32.316  249.907 1.00 95.56  1  309 LYS C NZ  1 
ATOM   9634  N N   . PHE C 1 316 ? 131.577 24.888  250.334 1.00 83.47  ?  310 PHE C N   1 
ATOM   9635  C CA  . PHE C 1 316 ? 131.368 23.643  249.602 1.00 76.66  ?  310 PHE C CA  1 
ATOM   9636  C C   . PHE C 1 316 ? 129.950 23.160  249.853 1.00 77.04  ?  310 PHE C C   1 
ATOM   9637  O O   . PHE C 1 316 ? 129.565 22.934  251.005 1.00 73.12  ?  310 PHE C O   1 
ATOM   9638  C CB  . PHE C 1 316 ? 132.377 22.568  250.010 1.00 60.48  ?  310 PHE C CB  1 
ATOM   9639  C CG  . PHE C 1 316 ? 132.154 21.247  249.327 1.00 53.95  ?  310 PHE C CG  1 
ATOM   9640  C CD1 . PHE C 1 316 ? 132.589 21.042  248.028 1.00 55.45  ?  310 PHE C CD1 1 
ATOM   9641  C CD2 . PHE C 1 316 ? 131.500 20.213  249.979 1.00 53.93  ?  310 PHE C CD2 1 
ATOM   9642  C CE1 . PHE C 1 316 ? 132.381 19.832  247.393 1.00 52.38  ?  310 PHE C CE1 1 
ATOM   9643  C CE2 . PHE C 1 316 ? 131.288 19.001  249.349 1.00 54.70  ?  310 PHE C CE2 1 
ATOM   9644  C CZ  . PHE C 1 316 ? 131.731 18.810  248.054 1.00 50.72  ?  310 PHE C CZ  1 
ATOM   9645  N N   . GLN C 1 317 ? 129.184 23.002  248.778 1.00 77.63  ?  311 GLN C N   1 
ATOM   9646  C CA  . GLN C 1 317 ? 127.845 22.436  248.832 1.00 85.07  ?  311 GLN C CA  1 
ATOM   9647  C C   . GLN C 1 317 ? 127.753 21.332  247.792 1.00 81.10  ?  311 GLN C C   1 
ATOM   9648  O O   . GLN C 1 317 ? 128.158 21.526  246.641 1.00 85.55  ?  311 GLN C O   1 
ATOM   9649  C CB  . GLN C 1 317 ? 126.776 23.505  248.583 1.00 87.93  ?  311 GLN C CB  1 
ATOM   9650  C CG  . GLN C 1 317 ? 125.351 22.978  248.603 1.00 86.47  ?  311 GLN C CG  1 
ATOM   9651  C CD  . GLN C 1 317 ? 124.321 24.083  248.484 1.00 94.93  ?  311 GLN C CD  1 
ATOM   9652  O OE1 . GLN C 1 317 ? 124.600 25.243  248.786 1.00 100.60 ?  311 GLN C OE1 1 
ATOM   9653  N NE2 . GLN C 1 317 ? 123.121 23.728  248.037 1.00 92.69  ?  311 GLN C NE2 1 
ATOM   9654  N N   . PHE C 1 318 ? 127.233 20.177  248.199 1.00 73.40  ?  312 PHE C N   1 
ATOM   9655  C CA  . PHE C 1 318 ? 127.164 19.017  247.315 1.00 79.06  ?  312 PHE C CA  1 
ATOM   9656  C C   . PHE C 1 318 ? 126.168 19.285  246.194 1.00 89.96  ?  312 PHE C C   1 
ATOM   9657  O O   . PHE C 1 318 ? 124.959 19.372  246.432 1.00 89.74  ?  312 PHE C O   1 
ATOM   9658  C CB  . PHE C 1 318 ? 126.781 17.775  248.112 1.00 80.39  ?  312 PHE C CB  1 
ATOM   9659  C CG  . PHE C 1 318 ? 126.779 16.513  247.302 1.00 80.45  ?  312 PHE C CG  1 
ATOM   9660  C CD1 . PHE C 1 318 ? 127.868 16.180  246.514 1.00 76.01  ?  312 PHE C CD1 1 
ATOM   9661  C CD2 . PHE C 1 318 ? 125.694 15.653  247.337 1.00 78.28  ?  312 PHE C CD2 1 
ATOM   9662  C CE1 . PHE C 1 318 ? 127.871 15.018  245.768 1.00 72.68  ?  312 PHE C CE1 1 
ATOM   9663  C CE2 . PHE C 1 318 ? 125.692 14.489  246.595 1.00 75.78  ?  312 PHE C CE2 1 
ATOM   9664  C CZ  . PHE C 1 318 ? 126.782 14.170  245.809 1.00 75.73  ?  312 PHE C CZ  1 
ATOM   9665  N N   . ASP C 1 319 ? 126.676 19.415  244.966 1.00 89.78  ?  313 ASP C N   1 
ATOM   9666  C CA  . ASP C 1 319 ? 125.821 19.723  243.824 1.00 92.83  ?  313 ASP C CA  1 
ATOM   9667  C C   . ASP C 1 319 ? 125.024 18.504  243.373 1.00 97.44  ?  313 ASP C C   1 
ATOM   9668  O O   . ASP C 1 319 ? 123.817 18.600  243.126 1.00 97.36  ?  313 ASP C O   1 
ATOM   9669  C CB  . ASP C 1 319 ? 126.666 20.268  242.670 1.00 93.39  ?  313 ASP C CB  1 
ATOM   9670  C CG  . ASP C 1 319 ? 126.429 21.745  242.421 1.00 93.04  ?  313 ASP C CG  1 
ATOM   9671  O OD1 . ASP C 1 319 ? 126.638 22.549  243.353 1.00 88.90  ?  313 ASP C OD1 1 
ATOM   9672  O OD2 . ASP C 1 319 ? 126.038 22.101  241.289 1.00 90.34  -1 313 ASP C OD2 1 
ATOM   9673  N N   . GLY C 1 320 ? 125.681 17.354  243.259 1.00 94.09  ?  314 GLY C N   1 
ATOM   9674  C CA  . GLY C 1 320 ? 125.020 16.145  242.825 1.00 87.11  ?  314 GLY C CA  1 
ATOM   9675  C C   . GLY C 1 320 ? 124.056 15.612  243.872 1.00 77.06  ?  314 GLY C C   1 
ATOM   9676  O O   . GLY C 1 320 ? 123.699 16.274  244.848 1.00 69.03  ?  314 GLY C O   1 
ATOM   9677  N N   . ASP C 1 321 ? 123.629 14.371  243.652 1.00 74.24  ?  315 ASP C N   1 
ATOM   9678  C CA  . ASP C 1 321 ? 122.699 13.701  244.546 1.00 81.40  ?  315 ASP C CA  1 
ATOM   9679  C C   . ASP C 1 321 ? 123.372 12.505  245.208 1.00 76.47  ?  315 ASP C C   1 
ATOM   9680  O O   . ASP C 1 321 ? 124.398 11.999  244.744 1.00 72.01  ?  315 ASP C O   1 
ATOM   9681  C CB  . ASP C 1 321 ? 121.431 13.252  243.804 1.00 89.25  ?  315 ASP C CB  1 
ATOM   9682  C CG  . ASP C 1 321 ? 121.714 12.218  242.734 1.00 91.23  ?  315 ASP C CG  1 
ATOM   9683  O OD1 . ASP C 1 321 ? 122.815 12.251  242.146 1.00 79.37  ?  315 ASP C OD1 1 
ATOM   9684  O OD2 . ASP C 1 321 ? 120.831 11.371  242.481 1.00 92.16  -1 315 ASP C OD2 1 
ATOM   9685  N N   . LYS C 1 322 ? 122.767 12.057  246.310 1.00 73.87  ?  316 LYS C N   1 
ATOM   9686  C CA  . LYS C 1 322 ? 123.349 10.990  247.119 1.00 69.50  ?  316 LYS C CA  1 
ATOM   9687  C C   . LYS C 1 322 ? 123.347 9.649   246.392 1.00 72.72  ?  316 LYS C C   1 
ATOM   9688  O O   . LYS C 1 322 ? 124.206 8.801   246.661 1.00 68.94  ?  316 LYS C O   1 
ATOM   9689  C CB  . LYS C 1 322 ? 122.585 10.881  248.441 1.00 59.43  ?  316 LYS C CB  1 
ATOM   9690  C CG  . LYS C 1 322 ? 122.985 9.712   249.328 1.00 68.18  ?  316 LYS C CG  1 
ATOM   9691  C CD  . LYS C 1 322 ? 121.999 9.531   250.472 1.00 60.73  ?  316 LYS C CD  1 
ATOM   9692  C CE  . LYS C 1 322 ? 121.894 10.793  251.312 1.00 68.61  ?  316 LYS C CE  1 
ATOM   9693  N NZ  . LYS C 1 322 ? 120.933 10.635  252.438 1.00 62.61  1  316 LYS C NZ  1 
ATOM   9694  N N   . LYS C 1 323 ? 122.412 9.450   245.461 1.00 80.94  ?  317 LYS C N   1 
ATOM   9695  C CA  . LYS C 1 323 ? 122.174 8.119   244.907 1.00 83.58  ?  317 LYS C CA  1 
ATOM   9696  C C   . LYS C 1 323 ? 123.403 7.584   244.179 1.00 76.64  ?  317 LYS C C   1 
ATOM   9697  O O   . LYS C 1 323 ? 123.885 6.485   244.478 1.00 70.74  ?  317 LYS C O   1 
ATOM   9698  C CB  . LYS C 1 323 ? 120.964 8.158   243.972 1.00 94.47  ?  317 LYS C CB  1 
ATOM   9699  C CG  . LYS C 1 323 ? 120.337 6.799   243.709 1.00 95.61  ?  317 LYS C CG  1 
ATOM   9700  C CD  . LYS C 1 323 ? 119.044 6.935   242.921 1.00 99.17  ?  317 LYS C CD  1 
ATOM   9701  C CE  . LYS C 1 323 ? 118.331 5.598   242.795 1.00 94.21  ?  317 LYS C CE  1 
ATOM   9702  N NZ  . LYS C 1 323 ? 117.070 5.709   242.012 1.00 82.15  1  317 LYS C NZ  1 
ATOM   9703  N N   . SER C 1 324 ? 123.929 8.348   243.222 1.00 73.21  ?  318 SER C N   1 
ATOM   9704  C CA  . SER C 1 324 ? 125.040 7.865   242.411 1.00 68.21  ?  318 SER C CA  1 
ATOM   9705  C C   . SER C 1 324 ? 126.396 8.065   243.074 1.00 67.45  ?  318 SER C C   1 
ATOM   9706  O O   . SER C 1 324 ? 127.348 7.358   242.724 1.00 58.09  ?  318 SER C O   1 
ATOM   9707  C CB  . SER C 1 324 ? 125.034 8.554   241.045 1.00 73.86  ?  318 SER C CB  1 
ATOM   9708  O OG  . SER C 1 324 ? 123.858 8.239   240.320 1.00 79.81  ?  318 SER C OG  1 
ATOM   9709  N N   . PHE C 1 325 ? 126.510 9.001   244.019 1.00 69.32  ?  319 PHE C N   1 
ATOM   9710  C CA  . PHE C 1 325 ? 127.815 9.284   244.608 1.00 63.16  ?  319 PHE C CA  1 
ATOM   9711  C C   . PHE C 1 325 ? 128.250 8.178   245.562 1.00 62.65  ?  319 PHE C C   1 
ATOM   9712  O O   . PHE C 1 325 ? 129.442 7.857   245.645 1.00 61.19  ?  319 PHE C O   1 
ATOM   9713  C CB  . PHE C 1 325 ? 127.794 10.632  245.325 1.00 56.66  ?  319 PHE C CB  1 
ATOM   9714  C CG  . PHE C 1 325 ? 129.131 11.042  245.872 1.00 55.36  ?  319 PHE C CG  1 
ATOM   9715  C CD1 . PHE C 1 325 ? 130.149 11.435  245.019 1.00 58.38  ?  319 PHE C CD1 1 
ATOM   9716  C CD2 . PHE C 1 325 ? 129.372 11.032  247.235 1.00 52.13  ?  319 PHE C CD2 1 
ATOM   9717  C CE1 . PHE C 1 325 ? 131.382 11.810  245.516 1.00 53.34  ?  319 PHE C CE1 1 
ATOM   9718  C CE2 . PHE C 1 325 ? 130.603 11.407  247.739 1.00 48.18  ?  319 PHE C CE2 1 
ATOM   9719  C CZ  . PHE C 1 325 ? 131.610 11.797  246.878 1.00 42.72  ?  319 PHE C CZ  1 
ATOM   9720  N N   . LEU C 1 326 ? 127.304 7.587   246.297 1.00 55.74  ?  320 LEU C N   1 
ATOM   9721  C CA  . LEU C 1 326 ? 127.653 6.479   247.179 1.00 53.49  ?  320 LEU C CA  1 
ATOM   9722  C C   . LEU C 1 326 ? 128.159 5.280   246.388 1.00 57.10  ?  320 LEU C C   1 
ATOM   9723  O O   . LEU C 1 326 ? 129.010 4.527   246.875 1.00 57.83  ?  320 LEU C O   1 
ATOM   9724  C CB  . LEU C 1 326 ? 126.452 6.087   248.040 1.00 62.02  ?  320 LEU C CB  1 
ATOM   9725  C CG  . LEU C 1 326 ? 126.703 4.994   249.081 1.00 59.71  ?  320 LEU C CG  1 
ATOM   9726  C CD1 . LEU C 1 326 ? 126.262 5.455   250.458 1.00 63.44  ?  320 LEU C CD1 1 
ATOM   9727  C CD2 . LEU C 1 326 ? 125.994 3.705   248.694 1.00 59.15  ?  320 LEU C CD2 1 
ATOM   9728  N N   . GLU C 1 327 ? 127.652 5.087   245.168 1.00 55.96  ?  321 GLU C N   1 
ATOM   9729  C CA  . GLU C 1 327 ? 128.194 4.047   244.303 1.00 51.72  ?  321 GLU C CA  1 
ATOM   9730  C C   . GLU C 1 327 ? 129.601 4.393   243.834 1.00 52.77  ?  321 GLU C C   1 
ATOM   9731  O O   . GLU C 1 327 ? 130.407 3.491   243.576 1.00 52.23  ?  321 GLU C O   1 
ATOM   9732  C CB  . GLU C 1 327 ? 127.268 3.819   243.109 1.00 47.78  ?  321 GLU C CB  1 
ATOM   9733  C CG  . GLU C 1 327 ? 126.562 2.474   243.130 1.00 58.80  ?  321 GLU C CG  1 
ATOM   9734  C CD  . GLU C 1 327 ? 127.503 1.324   242.839 1.00 55.83  ?  321 GLU C CD  1 
ATOM   9735  O OE1 . GLU C 1 327 ? 128.306 1.442   241.891 1.00 51.02  ?  321 GLU C OE1 1 
ATOM   9736  O OE2 . GLU C 1 327 ? 127.447 0.305   243.559 1.00 59.87  -1 321 GLU C OE2 1 
ATOM   9737  N N   . ASP C 1 328 ? 129.914 5.686   243.715 1.00 51.22  ?  322 ASP C N   1 
ATOM   9738  C CA  . ASP C 1 328 ? 131.283 6.085   243.413 1.00 50.45  ?  322 ASP C CA  1 
ATOM   9739  C C   . ASP C 1 328 ? 132.210 5.817   244.590 1.00 50.05  ?  322 ASP C C   1 
ATOM   9740  O O   . ASP C 1 328 ? 133.385 5.488   244.392 1.00 46.35  ?  322 ASP C O   1 
ATOM   9741  C CB  . ASP C 1 328 ? 131.330 7.562   243.023 1.00 56.29  ?  322 ASP C CB  1 
ATOM   9742  C CG  . ASP C 1 328 ? 130.535 7.858   241.765 1.00 62.02  ?  322 ASP C CG  1 
ATOM   9743  O OD1 . ASP C 1 328 ? 130.000 6.905   241.161 1.00 58.20  ?  322 ASP C OD1 1 
ATOM   9744  O OD2 . ASP C 1 328 ? 130.446 9.043   241.382 1.00 57.85  -1 322 ASP C OD2 1 
ATOM   9745  N N   . ILE C 1 329 ? 131.700 5.952   245.816 1.00 45.62  ?  323 ILE C N   1 
ATOM   9746  C CA  . ILE C 1 329 ? 132.476 5.575   246.991 1.00 45.14  ?  323 ILE C CA  1 
ATOM   9747  C C   . ILE C 1 329 ? 132.711 4.070   247.016 1.00 50.29  ?  323 ILE C C   1 
ATOM   9748  O O   . ILE C 1 329 ? 133.777 3.607   247.444 1.00 48.41  ?  323 ILE C O   1 
ATOM   9749  C CB  . ILE C 1 329 ? 131.766 6.066   248.266 1.00 41.58  ?  323 ILE C CB  1 
ATOM   9750  C CG1 . ILE C 1 329 ? 131.650 7.591   248.255 1.00 39.20  ?  323 ILE C CG1 1 
ATOM   9751  C CG2 . ILE C 1 329 ? 132.502 5.603   249.511 1.00 46.34  ?  323 ILE C CG2 1 
ATOM   9752  C CD1 . ILE C 1 329 ? 130.924 8.152   249.454 1.00 49.05  ?  323 ILE C CD1 1 
ATOM   9753  N N   . ARG C 1 330 ? 131.738 3.284   246.551 1.00 50.86  ?  324 ARG C N   1 
ATOM   9754  C CA  . ARG C 1 330 ? 131.905 1.835   246.510 1.00 49.37  ?  324 ARG C CA  1 
ATOM   9755  C C   . ARG C 1 330 ? 132.976 1.434   245.502 1.00 49.17  ?  324 ARG C C   1 
ATOM   9756  O O   . ARG C 1 330 ? 133.842 0.603   245.798 1.00 45.87  ?  324 ARG C O   1 
ATOM   9757  C CB  . ARG C 1 330 ? 130.573 1.163   246.175 1.00 52.33  ?  324 ARG C CB  1 
ATOM   9758  C CG  . ARG C 1 330 ? 130.578 -0.347  246.338 1.00 52.31  ?  324 ARG C CG  1 
ATOM   9759  C CD  . ARG C 1 330 ? 129.358 -0.977  245.687 1.00 49.45  ?  324 ARG C CD  1 
ATOM   9760  N NE  . ARG C 1 330 ? 129.431 -0.931  244.230 1.00 43.56  ?  324 ARG C NE  1 
ATOM   9761  C CZ  . ARG C 1 330 ? 130.013 -1.865  243.485 1.00 54.05  ?  324 ARG C CZ  1 
ATOM   9762  N NH1 . ARG C 1 330 ? 130.575 -2.918  244.062 1.00 56.74  1  324 ARG C NH1 1 
ATOM   9763  N NH2 . ARG C 1 330 ? 130.035 -1.747  242.165 1.00 53.30  ?  324 ARG C NH2 1 
ATOM   9764  N N   . LYS C 1 331 ? 132.925 2.012   244.298 1.00 51.97  ?  325 LYS C N   1 
ATOM   9765  C CA  . LYS C 1 331 ? 133.952 1.734   243.298 1.00 52.82  ?  325 LYS C CA  1 
ATOM   9766  C C   . LYS C 1 331 ? 135.330 2.156   243.790 1.00 49.84  ?  325 LYS C C   1 
ATOM   9767  O O   . LYS C 1 331 ? 136.323 1.459   243.551 1.00 51.44  ?  325 LYS C O   1 
ATOM   9768  C CB  . LYS C 1 331 ? 133.619 2.444   241.986 1.00 58.47  ?  325 LYS C CB  1 
ATOM   9769  C CG  . LYS C 1 331 ? 132.944 1.573   240.937 1.00 58.22  ?  325 LYS C CG  1 
ATOM   9770  C CD  . LYS C 1 331 ? 131.462 1.398   241.195 1.00 52.70  ?  325 LYS C CD  1 
ATOM   9771  C CE  . LYS C 1 331 ? 130.801 0.680   240.028 1.00 64.11  ?  325 LYS C CE  1 
ATOM   9772  N NZ  . LYS C 1 331 ? 131.040 1.384   238.737 1.00 62.92  1  325 LYS C NZ  1 
ATOM   9773  N N   . ALA C 1 332 ? 135.409 3.297   244.479 1.00 46.73  ?  326 ALA C N   1 
ATOM   9774  C CA  . ALA C 1 332 ? 136.690 3.760   245.003 1.00 43.03  ?  326 ALA C CA  1 
ATOM   9775  C C   . ALA C 1 332 ? 137.220 2.819   246.076 1.00 44.27  ?  326 ALA C C   1 
ATOM   9776  O O   . ALA C 1 332 ? 138.417 2.507   246.100 1.00 40.78  ?  326 ALA C O   1 
ATOM   9777  C CB  . ALA C 1 332 ? 136.548 5.179   245.554 1.00 41.66  ?  326 ALA C CB  1 
ATOM   9778  N N   . LEU C 1 333 ? 136.344 2.357   246.972 1.00 44.81  ?  327 LEU C N   1 
ATOM   9779  C CA  . LEU C 1 333 ? 136.766 1.425   248.012 1.00 36.29  ?  327 LEU C CA  1 
ATOM   9780  C C   . LEU C 1 333 ? 137.230 0.104   247.411 1.00 41.93  ?  327 LEU C C   1 
ATOM   9781  O O   . LEU C 1 333 ? 138.185 -0.509  247.902 1.00 50.67  ?  327 LEU C O   1 
ATOM   9782  C CB  . LEU C 1 333 ? 135.620 1.193   248.997 1.00 42.73  ?  327 LEU C CB  1 
ATOM   9783  C CG  . LEU C 1 333 ? 135.902 0.268   250.182 1.00 38.63  ?  327 LEU C CG  1 
ATOM   9784  C CD1 . LEU C 1 333 ? 136.972 0.868   251.067 1.00 38.07  ?  327 LEU C CD1 1 
ATOM   9785  C CD2 . LEU C 1 333 ? 134.633 0.005   250.978 1.00 44.66  ?  327 LEU C CD2 1 
ATOM   9786  N N   . TYR C 1 334 ? 136.568 -0.348  246.345 1.00 45.10  ?  328 TYR C N   1 
ATOM   9787  C CA  . TYR C 1 334 ? 136.953 -1.606  245.715 1.00 43.76  ?  328 TYR C CA  1 
ATOM   9788  C C   . TYR C 1 334 ? 138.264 -1.463  244.951 1.00 44.46  ?  328 TYR C C   1 
ATOM   9789  O O   . TYR C 1 334 ? 139.124 -2.350  245.013 1.00 45.39  ?  328 TYR C O   1 
ATOM   9790  C CB  . TYR C 1 334 ? 135.833 -2.086  244.791 1.00 44.72  ?  328 TYR C CB  1 
ATOM   9791  C CG  . TYR C 1 334 ? 136.093 -3.426  244.137 1.00 49.62  ?  328 TYR C CG  1 
ATOM   9792  C CD1 . TYR C 1 334 ? 136.313 -4.563  244.903 1.00 51.87  ?  328 TYR C CD1 1 
ATOM   9793  C CD2 . TYR C 1 334 ? 136.099 -3.555  242.754 1.00 51.49  ?  328 TYR C CD2 1 
ATOM   9794  C CE1 . TYR C 1 334 ? 136.546 -5.789  244.310 1.00 53.64  ?  328 TYR C CE1 1 
ATOM   9795  C CE2 . TYR C 1 334 ? 136.329 -4.779  242.152 1.00 56.36  ?  328 TYR C CE2 1 
ATOM   9796  C CZ  . TYR C 1 334 ? 136.551 -5.892  242.935 1.00 57.59  ?  328 TYR C CZ  1 
ATOM   9797  O OH  . TYR C 1 334 ? 136.780 -7.112  242.341 1.00 56.65  ?  328 TYR C OH  1 
ATOM   9798  N N   . ALA C 1 335 ? 138.439 -0.352  244.231 1.00 47.00  ?  329 ALA C N   1 
ATOM   9799  C CA  . ALA C 1 335 ? 139.660 -0.160  243.455 1.00 43.87  ?  329 ALA C CA  1 
ATOM   9800  C C   . ALA C 1 335 ? 140.870 0.035   244.360 1.00 44.74  ?  329 ALA C C   1 
ATOM   9801  O O   . ALA C 1 335 ? 141.941 -0.527  244.102 1.00 48.74  ?  329 ALA C O   1 
ATOM   9802  C CB  . ALA C 1 335 ? 139.500 1.030   242.510 1.00 41.20  ?  329 ALA C CB  1 
ATOM   9803  N N   . SER C 1 336 ? 140.721 0.829   245.424 1.00 44.76  ?  330 SER C N   1 
ATOM   9804  C CA  . SER C 1 336 ? 141.834 1.043   246.343 1.00 38.47  ?  330 SER C CA  1 
ATOM   9805  C C   . SER C 1 336 ? 142.217 -0.241  247.066 1.00 39.49  ?  330 SER C C   1 
ATOM   9806  O O   . SER C 1 336 ? 143.397 -0.451  247.373 1.00 38.40  ?  330 SER C O   1 
ATOM   9807  C CB  . SER C 1 336 ? 141.480 2.136   247.351 1.00 30.97  ?  330 SER C CB  1 
ATOM   9808  O OG  . SER C 1 336 ? 141.206 3.361   246.695 1.00 35.63  ?  330 SER C OG  1 
ATOM   9809  N N   . LYS C 1 337 ? 141.241 -1.107  247.349 1.00 39.90  ?  331 LYS C N   1 
ATOM   9810  C CA  . LYS C 1 337 ? 141.555 -2.392  247.962 1.00 39.52  ?  331 LYS C CA  1 
ATOM   9811  C C   . LYS C 1 337 ? 142.358 -3.277  247.017 1.00 43.42  ?  331 LYS C C   1 
ATOM   9812  O O   . LYS C 1 337 ? 143.221 -4.039  247.467 1.00 45.70  ?  331 LYS C O   1 
ATOM   9813  C CB  . LYS C 1 337 ? 140.269 -3.094  248.399 1.00 45.92  ?  331 LYS C CB  1 
ATOM   9814  C CG  . LYS C 1 337 ? 140.492 -4.351  249.226 1.00 50.65  ?  331 LYS C CG  1 
ATOM   9815  C CD  . LYS C 1 337 ? 139.183 -4.886  249.788 1.00 54.04  ?  331 LYS C CD  1 
ATOM   9816  C CE  . LYS C 1 337 ? 139.416 -6.095  250.682 1.00 52.88  ?  331 LYS C CE  1 
ATOM   9817  N NZ  . LYS C 1 337 ? 138.155 -6.578  251.310 1.00 49.79  1  331 LYS C NZ  1 
ATOM   9818  N N   . ILE C 1 338 ? 142.095 -3.188  245.711 1.00 40.84  ?  332 ILE C N   1 
ATOM   9819  C CA  . ILE C 1 338 ? 142.901 -3.923  244.740 1.00 40.63  ?  332 ILE C CA  1 
ATOM   9820  C C   . ILE C 1 338 ? 144.334 -3.407  244.746 1.00 36.81  ?  332 ILE C C   1 
ATOM   9821  O O   . ILE C 1 338 ? 145.293 -4.188  244.708 1.00 39.74  ?  332 ILE C O   1 
ATOM   9822  C CB  . ILE C 1 338 ? 142.272 -3.826  243.338 1.00 43.93  ?  332 ILE C CB  1 
ATOM   9823  C CG1 . ILE C 1 338 ? 140.882 -4.464  243.328 1.00 46.24  ?  332 ILE C CG1 1 
ATOM   9824  C CG2 . ILE C 1 338 ? 143.171 -4.481  242.299 1.00 40.53  ?  332 ILE C CG2 1 
ATOM   9825  C CD1 . ILE C 1 338 ? 140.168 -4.346  242.000 1.00 45.30  ?  332 ILE C CD1 1 
ATOM   9826  N N   . ILE C 1 339 ? 144.500 -2.083  244.796 1.00 40.69  ?  333 ILE C N   1 
ATOM   9827  C CA  . ILE C 1 339 ? 145.836 -1.494  244.824 1.00 43.18  ?  333 ILE C CA  1 
ATOM   9828  C C   . ILE C 1 339 ? 146.585 -1.928  246.078 1.00 38.71  ?  333 ILE C C   1 
ATOM   9829  O O   . ILE C 1 339 ? 147.794 -2.186  246.039 1.00 40.60  ?  333 ILE C O   1 
ATOM   9830  C CB  . ILE C 1 339 ? 145.739 0.040   244.720 1.00 41.56  ?  333 ILE C CB  1 
ATOM   9831  C CG1 . ILE C 1 339 ? 145.113 0.448   243.383 1.00 37.90  ?  333 ILE C CG1 1 
ATOM   9832  C CG2 . ILE C 1 339 ? 147.106 0.682   244.896 1.00 35.57  ?  333 ILE C CG2 1 
ATOM   9833  C CD1 . ILE C 1 339 ? 145.902 -0.003  242.173 1.00 32.51  ?  333 ILE C CD1 1 
ATOM   9834  N N   . SER C 1 340 ? 145.876 -2.028  247.205 1.00 36.59  ?  334 SER C N   1 
ATOM   9835  C CA  . SER C 1 340 ? 146.514 -2.428  248.457 1.00 34.75  ?  334 SER C CA  1 
ATOM   9836  C C   . SER C 1 340 ? 147.066 -3.845  248.367 1.00 37.15  ?  334 SER C C   1 
ATOM   9837  O O   . SER C 1 340 ? 148.236 -4.090  248.684 1.00 38.14  ?  334 SER C O   1 
ATOM   9838  C CB  . SER C 1 340 ? 145.518 -2.311  249.610 1.00 35.53  ?  334 SER C CB  1 
ATOM   9839  O OG  . SER C 1 340 ? 146.090 -2.755  250.828 1.00 30.19  ?  334 SER C OG  1 
ATOM   9840  N N   . TYR C 1 341 ? 146.232 -4.795  247.937 1.00 42.48  ?  335 TYR C N   1 
ATOM   9841  C CA  . TYR C 1 341 ? 146.679 -6.181  247.840 1.00 44.47  ?  335 TYR C CA  1 
ATOM   9842  C C   . TYR C 1 341 ? 147.758 -6.353  246.780 1.00 36.77  ?  335 TYR C C   1 
ATOM   9843  O O   . TYR C 1 341 ? 148.636 -7.210  246.927 1.00 40.05  ?  335 TYR C O   1 
ATOM   9844  C CB  . TYR C 1 341 ? 145.491 -7.097  247.548 1.00 44.34  ?  335 TYR C CB  1 
ATOM   9845  C CG  . TYR C 1 341 ? 144.639 -7.388  248.763 1.00 46.72  ?  335 TYR C CG  1 
ATOM   9846  C CD1 . TYR C 1 341 ? 143.791 -6.423  249.288 1.00 40.25  ?  335 TYR C CD1 1 
ATOM   9847  C CD2 . TYR C 1 341 ? 144.684 -8.628  249.383 1.00 47.51  ?  335 TYR C CD2 1 
ATOM   9848  C CE1 . TYR C 1 341 ? 143.012 -6.683  250.398 1.00 44.40  ?  335 TYR C CE1 1 
ATOM   9849  C CE2 . TYR C 1 341 ? 143.908 -8.898  250.494 1.00 48.48  ?  335 TYR C CE2 1 
ATOM   9850  C CZ  . TYR C 1 341 ? 143.073 -7.923  250.995 1.00 41.83  ?  335 TYR C CZ  1 
ATOM   9851  O OH  . TYR C 1 341 ? 142.300 -8.190  252.102 1.00 44.81  ?  335 TYR C OH  1 
ATOM   9852  N N   . ALA C 1 342 ? 147.712 -5.555  245.711 1.00 35.92  ?  336 ALA C N   1 
ATOM   9853  C CA  . ALA C 1 342 ? 148.775 -5.601  244.713 1.00 38.32  ?  336 ALA C CA  1 
ATOM   9854  C C   . ALA C 1 342 ? 150.110 -5.200  245.326 1.00 36.41  ?  336 ALA C C   1 
ATOM   9855  O O   . ALA C 1 342 ? 151.131 -5.862  245.110 1.00 35.27  ?  336 ALA C O   1 
ATOM   9856  C CB  . ALA C 1 342 ? 148.425 -4.697  243.533 1.00 37.59  ?  336 ALA C CB  1 
ATOM   9857  N N   . GLN C 1 343 ? 150.116 -4.116  246.107 1.00 36.09  ?  337 GLN C N   1 
ATOM   9858  C CA  . GLN C 1 343 ? 151.336 -3.703  246.794 1.00 32.27  ?  337 GLN C CA  1 
ATOM   9859  C C   . GLN C 1 343 ? 151.767 -4.739  247.824 1.00 36.19  ?  337 GLN C C   1 
ATOM   9860  O O   . GLN C 1 343 ? 152.966 -4.973  248.017 1.00 38.62  ?  337 GLN C O   1 
ATOM   9861  C CB  . GLN C 1 343 ? 151.127 -2.345  247.463 1.00 29.53  ?  337 GLN C CB  1 
ATOM   9862  C CG  . GLN C 1 343 ? 150.859 -1.200  246.502 1.00 32.50  ?  337 GLN C CG  1 
ATOM   9863  C CD  . GLN C 1 343 ? 150.486 0.083   247.220 1.00 31.63  ?  337 GLN C CD  1 
ATOM   9864  O OE1 . GLN C 1 343 ? 150.153 0.069   248.406 1.00 33.24  ?  337 GLN C OE1 1 
ATOM   9865  N NE2 . GLN C 1 343 ? 150.542 1.200   246.505 1.00 27.09  ?  337 GLN C NE2 1 
ATOM   9866  N N   . GLY C 1 344 ? 150.802 -5.370  248.497 1.00 35.32  ?  338 GLY C N   1 
ATOM   9867  C CA  . GLY C 1 344 ? 151.142 -6.348  249.516 1.00 27.80  ?  338 GLY C CA  1 
ATOM   9868  C C   . GLY C 1 344 ? 151.862 -7.559  248.954 1.00 29.19  ?  338 GLY C C   1 
ATOM   9869  O O   . GLY C 1 344 ? 152.856 -8.020  249.519 1.00 27.72  ?  338 GLY C O   1 
ATOM   9870  N N   . PHE C 1 345 ? 151.371 -8.090  247.832 1.00 30.34  ?  339 PHE C N   1 
ATOM   9871  C CA  . PHE C 1 345 ? 152.021 -9.242  247.219 1.00 29.99  ?  339 PHE C CA  1 
ATOM   9872  C C   . PHE C 1 345 ? 153.326 -8.871  246.528 1.00 30.85  ?  339 PHE C C   1 
ATOM   9873  O O   . PHE C 1 345 ? 154.175 -9.746  246.329 1.00 37.25  ?  339 PHE C O   1 
ATOM   9874  C CB  . PHE C 1 345 ? 151.072 -9.922  246.233 1.00 38.22  ?  339 PHE C CB  1 
ATOM   9875  C CG  . PHE C 1 345 ? 150.045 -10.798 246.893 1.00 35.76  ?  339 PHE C CG  1 
ATOM   9876  C CD1 . PHE C 1 345 ? 148.841 -10.271 247.327 1.00 37.12  ?  339 PHE C CD1 1 
ATOM   9877  C CD2 . PHE C 1 345 ? 150.289 -12.147 247.087 1.00 38.12  ?  339 PHE C CD2 1 
ATOM   9878  C CE1 . PHE C 1 345 ? 147.896 -11.074 247.938 1.00 42.15  ?  339 PHE C CE1 1 
ATOM   9879  C CE2 . PHE C 1 345 ? 149.349 -12.956 247.697 1.00 40.39  ?  339 PHE C CE2 1 
ATOM   9880  C CZ  . PHE C 1 345 ? 148.151 -12.418 248.123 1.00 39.08  ?  339 PHE C CZ  1 
ATOM   9881  N N   . MET C 1 346 ? 153.506 -7.600  246.155 1.00 28.53  ?  340 MET C N   1 
ATOM   9882  C CA  . MET C 1 346 ? 154.814 -7.156  245.684 1.00 28.15  ?  340 MET C CA  1 
ATOM   9883  C C   . MET C 1 346 ? 155.857 -7.287  246.785 1.00 31.71  ?  340 MET C C   1 
ATOM   9884  O O   . MET C 1 346 ? 157.007 -7.658  246.523 1.00 31.15  ?  340 MET C O   1 
ATOM   9885  C CB  . MET C 1 346 ? 154.737 -5.712  245.189 1.00 30.28  ?  340 MET C CB  1 
ATOM   9886  C CG  . MET C 1 346 ? 153.974 -5.529  243.890 1.00 36.79  ?  340 MET C CG  1 
ATOM   9887  S SD  . MET C 1 346 ? 153.751 -3.790  243.470 1.00 35.15  ?  340 MET C SD  1 
ATOM   9888  C CE  . MET C 1 346 ? 155.456 -3.272  243.294 1.00 32.73  ?  340 MET C CE  1 
ATOM   9889  N N   . LEU C 1 347 ? 155.468 -6.988  248.028 1.00 32.46  ?  341 LEU C N   1 
ATOM   9890  C CA  . LEU C 1 347 ? 156.378 -7.154  249.156 1.00 30.25  ?  341 LEU C CA  1 
ATOM   9891  C C   . LEU C 1 347 ? 156.704 -8.624  249.389 1.00 33.63  ?  341 LEU C C   1 
ATOM   9892  O O   . LEU C 1 347 ? 157.853 -8.971  249.685 1.00 41.14  ?  341 LEU C O   1 
ATOM   9893  C CB  . LEU C 1 347 ? 155.767 -6.532  250.411 1.00 25.13  ?  341 LEU C CB  1 
ATOM   9894  C CG  . LEU C 1 347 ? 156.561 -6.665  251.712 1.00 26.98  ?  341 LEU C CG  1 
ATOM   9895  C CD1 . LEU C 1 347 ? 157.909 -5.972  251.596 1.00 22.62  ?  341 LEU C CD1 1 
ATOM   9896  C CD2 . LEU C 1 347 ? 155.764 -6.106  252.879 1.00 29.47  ?  341 LEU C CD2 1 
ATOM   9897  N N   . LEU C 1 348 ? 155.704 -9.500  249.262 1.00 35.38  ?  342 LEU C N   1 
ATOM   9898  C CA  . LEU C 1 348 ? 155.943 -10.929 249.436 1.00 35.64  ?  342 LEU C CA  1 
ATOM   9899  C C   . LEU C 1 348 ? 156.899 -11.463 248.379 1.00 39.51  ?  342 LEU C C   1 
ATOM   9900  O O   . LEU C 1 348 ? 157.811 -12.239 248.691 1.00 42.94  ?  342 LEU C O   1 
ATOM   9901  C CB  . LEU C 1 348 ? 154.618 -11.691 249.392 1.00 34.37  ?  342 LEU C CB  1 
ATOM   9902  C CG  . LEU C 1 348 ? 153.667 -11.486 250.571 1.00 36.40  ?  342 LEU C CG  1 
ATOM   9903  C CD1 . LEU C 1 348 ? 152.332 -12.161 250.303 1.00 37.69  ?  342 LEU C CD1 1 
ATOM   9904  C CD2 . LEU C 1 348 ? 154.290 -12.021 251.849 1.00 39.48  ?  342 LEU C CD2 1 
ATOM   9905  N N   . ARG C 1 349 ? 156.710 -11.058 247.121 1.00 35.12  ?  343 ARG C N   1 
ATOM   9906  C CA  . ARG C 1 349 ? 157.580 -11.540 246.053 1.00 41.87  ?  343 ARG C CA  1 
ATOM   9907  C C   . ARG C 1 349 ? 159.004 -11.022 246.220 1.00 39.72  ?  343 ARG C C   1 
ATOM   9908  O O   . ARG C 1 349 ? 159.970 -11.753 245.968 1.00 37.83  ?  343 ARG C O   1 
ATOM   9909  C CB  . ARG C 1 349 ? 157.013 -11.136 244.691 1.00 36.04  ?  343 ARG C CB  1 
ATOM   9910  C CG  . ARG C 1 349 ? 157.985 -11.317 243.534 1.00 39.62  ?  343 ARG C CG  1 
ATOM   9911  C CD  . ARG C 1 349 ? 157.309 -11.105 242.189 1.00 52.40  ?  343 ARG C CD  1 
ATOM   9912  N NE  . ARG C 1 349 ? 156.973 -12.371 241.543 1.00 66.05  ?  343 ARG C NE  1 
ATOM   9913  C CZ  . ARG C 1 349 ? 155.805 -12.991 241.673 1.00 65.69  ?  343 ARG C CZ  1 
ATOM   9914  N NH1 . ARG C 1 349 ? 154.850 -12.464 242.427 1.00 62.94  1  343 ARG C NH1 1 
ATOM   9915  N NH2 . ARG C 1 349 ? 155.591 -14.141 241.048 1.00 62.42  ?  343 ARG C NH2 1 
ATOM   9916  N N   . GLN C 1 350 ? 159.157 -9.770  246.655 1.00 40.83  ?  344 GLN C N   1 
ATOM   9917  C CA  . GLN C 1 350 ? 160.493 -9.199  246.793 1.00 40.67  ?  344 GLN C CA  1 
ATOM   9918  C C   . GLN C 1 350 ? 161.270 -9.868  247.920 1.00 40.43  ?  344 GLN C C   1 
ATOM   9919  O O   . GLN C 1 350 ? 162.466 -10.144 247.777 1.00 44.48  ?  344 GLN C O   1 
ATOM   9920  C CB  . GLN C 1 350 ? 160.398 -7.691  247.024 1.00 39.24  ?  344 GLN C CB  1 
ATOM   9921  C CG  . GLN C 1 350 ? 161.739 -6.974  246.979 1.00 43.56  ?  344 GLN C CG  1 
ATOM   9922  C CD  . GLN C 1 350 ? 162.392 -7.039  245.610 1.00 47.90  ?  344 GLN C CD  1 
ATOM   9923  O OE1 . GLN C 1 350 ? 161.720 -7.231  244.596 1.00 58.15  ?  344 GLN C OE1 1 
ATOM   9924  N NE2 . GLN C 1 350 ? 163.709 -6.879  245.575 1.00 44.51  ?  344 GLN C NE2 1 
ATOM   9925  N N   . ALA C 1 351 ? 160.610 -10.139 249.048 1.00 40.25  ?  345 ALA C N   1 
ATOM   9926  C CA  . ALA C 1 351 ? 161.292 -10.803 250.152 1.00 41.57  ?  345 ALA C CA  1 
ATOM   9927  C C   . ALA C 1 351 ? 161.559 -12.270 249.848 1.00 41.13  ?  345 ALA C C   1 
ATOM   9928  O O   . ALA C 1 351 ? 162.569 -12.821 250.300 1.00 42.83  ?  345 ALA C O   1 
ATOM   9929  C CB  . ALA C 1 351 ? 160.476 -10.671 251.435 1.00 45.16  ?  345 ALA C CB  1 
ATOM   9930  N N   . ALA C 1 352 ? 160.666 -12.920 249.096 1.00 41.29  ?  346 ALA C N   1 
ATOM   9931  C CA  . ALA C 1 352 ? 160.912 -14.299 248.692 1.00 43.25  ?  346 ALA C CA  1 
ATOM   9932  C C   . ALA C 1 352 ? 162.126 -14.390 247.778 1.00 42.65  ?  346 ALA C C   1 
ATOM   9933  O O   . ALA C 1 352 ? 162.897 -15.354 247.848 1.00 45.76  ?  346 ALA C O   1 
ATOM   9934  C CB  . ALA C 1 352 ? 159.675 -14.877 248.006 1.00 42.87  ?  346 ALA C CB  1 
ATOM   9935  N N   . THR C 1 353 ? 162.314 -13.390 246.915 1.00 41.02  ?  347 THR C N   1 
ATOM   9936  C CA  . THR C 1 353 ? 163.486 -13.372 246.047 1.00 41.60  ?  347 THR C CA  1 
ATOM   9937  C C   . THR C 1 353 ? 164.748 -13.038 246.833 1.00 48.58  ?  347 THR C C   1 
ATOM   9938  O O   . THR C 1 353 ? 165.822 -13.586 246.557 1.00 53.52  ?  347 THR C O   1 
ATOM   9939  C CB  . THR C 1 353 ? 163.277 -12.369 244.911 1.00 40.51  ?  347 THR C CB  1 
ATOM   9940  O OG1 . THR C 1 353 ? 162.080 -12.701 244.195 1.00 46.25  ?  347 THR C OG1 1 
ATOM   9941  C CG2 . THR C 1 353 ? 164.455 -12.389 243.949 1.00 45.74  ?  347 THR C CG2 1 
ATOM   9942  N N   . GLU C 1 354 ? 164.635 -12.151 247.824 1.00 46.89  ?  348 GLU C N   1 
ATOM   9943  C CA  . GLU C 1 354 ? 165.799 -11.755 248.611 1.00 39.96  ?  348 GLU C CA  1 
ATOM   9944  C C   . GLU C 1 354 ? 166.328 -12.925 249.432 1.00 42.68  ?  348 GLU C C   1 
ATOM   9945  O O   . GLU C 1 354 ? 167.481 -13.343 249.273 1.00 51.65  ?  348 GLU C O   1 
ATOM   9946  C CB  . GLU C 1 354 ? 165.437 -10.576 249.518 1.00 49.89  ?  348 GLU C CB  1 
ATOM   9947  C CG  . GLU C 1 354 ? 166.620 -9.715  249.933 1.00 60.78  ?  348 GLU C CG  1 
ATOM   9948  C CD  . GLU C 1 354 ? 166.772 -8.477  249.067 1.00 72.79  ?  348 GLU C CD  1 
ATOM   9949  O OE1 . GLU C 1 354 ? 165.750 -8.000  248.528 1.00 64.10  ?  348 GLU C OE1 1 
ATOM   9950  O OE2 . GLU C 1 354 ? 167.910 -7.981  248.926 1.00 82.78  -1 348 GLU C OE2 1 
ATOM   9951  N N   . PHE C 1 355 ? 165.493 -13.472 250.320 1.00 46.68  ?  349 PHE C N   1 
ATOM   9952  C CA  . PHE C 1 355 ? 165.919 -14.585 251.160 1.00 46.82  ?  349 PHE C CA  1 
ATOM   9953  C C   . PHE C 1 355 ? 166.082 -15.883 250.381 1.00 46.22  ?  349 PHE C C   1 
ATOM   9954  O O   . PHE C 1 355 ? 166.816 -16.770 250.829 1.00 46.70  ?  349 PHE C O   1 
ATOM   9955  C CB  . PHE C 1 355 ? 164.923 -14.807 252.298 1.00 42.39  ?  349 PHE C CB  1 
ATOM   9956  C CG  . PHE C 1 355 ? 164.888 -13.695 253.303 1.00 44.50  ?  349 PHE C CG  1 
ATOM   9957  C CD1 . PHE C 1 355 ? 165.930 -13.521 254.199 1.00 45.06  ?  349 PHE C CD1 1 
ATOM   9958  C CD2 . PHE C 1 355 ? 163.806 -12.836 253.364 1.00 44.52  ?  349 PHE C CD2 1 
ATOM   9959  C CE1 . PHE C 1 355 ? 165.898 -12.502 255.130 1.00 46.73  ?  349 PHE C CE1 1 
ATOM   9960  C CE2 . PHE C 1 355 ? 163.767 -11.818 254.294 1.00 46.93  ?  349 PHE C CE2 1 
ATOM   9961  C CZ  . PHE C 1 355 ? 164.815 -11.649 255.177 1.00 46.57  ?  349 PHE C CZ  1 
ATOM   9962  N N   . GLY C 1 356 ? 165.416 -16.018 249.239 1.00 46.57  ?  350 GLY C N   1 
ATOM   9963  C CA  . GLY C 1 356 ? 165.459 -17.252 248.483 1.00 45.33  ?  350 GLY C CA  1 
ATOM   9964  C C   . GLY C 1 356 ? 164.327 -18.211 248.763 1.00 44.62  ?  350 GLY C C   1 
ATOM   9965  O O   . GLY C 1 356 ? 164.455 -19.403 248.461 1.00 49.83  ?  350 GLY C O   1 
ATOM   9966  N N   . TRP C 1 357 ? 163.224 -17.734 249.333 1.00 43.42  ?  351 TRP C N   1 
ATOM   9967  C CA  . TRP C 1 357 ? 162.083 -18.586 249.620 1.00 40.79  ?  351 TRP C CA  1 
ATOM   9968  C C   . TRP C 1 357 ? 161.255 -18.818 248.359 1.00 48.53  ?  351 TRP C C   1 
ATOM   9969  O O   . TRP C 1 357 ? 161.371 -18.099 247.363 1.00 46.49  ?  351 TRP C O   1 
ATOM   9970  C CB  . TRP C 1 357 ? 161.209 -17.962 250.708 1.00 37.77  ?  351 TRP C CB  1 
ATOM   9971  C CG  . TRP C 1 357 ? 161.946 -17.647 251.972 1.00 41.71  ?  351 TRP C CG  1 
ATOM   9972  C CD1 . TRP C 1 357 ? 163.065 -18.266 252.448 1.00 41.64  ?  351 TRP C CD1 1 
ATOM   9973  C CD2 . TRP C 1 357 ? 161.621 -16.622 252.919 1.00 44.74  ?  351 TRP C CD2 1 
ATOM   9974  N NE1 . TRP C 1 357 ? 163.453 -17.694 253.637 1.00 43.11  ?  351 TRP C NE1 1 
ATOM   9975  C CE2 . TRP C 1 357 ? 162.582 -16.683 253.947 1.00 43.69  ?  351 TRP C CE2 1 
ATOM   9976  C CE3 . TRP C 1 357 ? 160.609 -15.660 252.998 1.00 37.94  ?  351 TRP C CE3 1 
ATOM   9977  C CZ2 . TRP C 1 357 ? 162.562 -15.819 255.040 1.00 43.22  ?  351 TRP C CZ2 1 
ATOM   9978  C CZ3 . TRP C 1 357 ? 160.589 -14.804 254.084 1.00 37.70  ?  351 TRP C CZ3 1 
ATOM   9979  C CH2 . TRP C 1 357 ? 161.560 -14.889 255.090 1.00 42.64  ?  351 TRP C CH2 1 
ATOM   9980  N N   . THR C 1 358 ? 160.407 -19.842 248.415 1.00 54.36  ?  352 THR C N   1 
ATOM   9981  C CA  . THR C 1 358 ? 159.486 -20.179 247.332 1.00 49.51  ?  352 THR C CA  1 
ATOM   9982  C C   . THR C 1 358 ? 158.075 -20.122 247.910 1.00 45.29  ?  352 THR C C   1 
ATOM   9983  O O   . THR C 1 358 ? 157.557 -21.118 248.422 1.00 47.15  ?  352 THR C O   1 
ATOM   9984  C CB  . THR C 1 358 ? 159.801 -21.554 246.731 1.00 49.62  ?  352 THR C CB  1 
ATOM   9985  O OG1 . THR C 1 358 ? 161.161 -21.578 246.279 1.00 53.22  ?  352 THR C OG1 1 
ATOM   9986  C CG2 . THR C 1 358 ? 158.880 -21.846 245.554 1.00 39.09  ?  352 THR C CG2 1 
ATOM   9987  N N   . LEU C 1 359 ? 157.458 -18.947 247.832 1.00 41.84  ?  353 LEU C N   1 
ATOM   9988  C CA  . LEU C 1 359 ? 156.123 -18.735 248.369 1.00 43.92  ?  353 LEU C CA  1 
ATOM   9989  C C   . LEU C 1 359 ? 155.067 -19.109 247.339 1.00 53.59  ?  353 LEU C C   1 
ATOM   9990  O O   . LEU C 1 359 ? 155.212 -18.817 246.148 1.00 51.38  ?  353 LEU C O   1 
ATOM   9991  C CB  . LEU C 1 359 ? 155.936 -17.276 248.791 1.00 44.53  ?  353 LEU C CB  1 
ATOM   9992  C CG  . LEU C 1 359 ? 156.852 -16.717 249.880 1.00 41.30  ?  353 LEU C CG  1 
ATOM   9993  C CD1 . LEU C 1 359 ? 156.568 -15.242 250.111 1.00 30.10  ?  353 LEU C CD1 1 
ATOM   9994  C CD2 . LEU C 1 359 ? 156.677 -17.498 251.164 1.00 36.56  ?  353 LEU C CD2 1 
ATOM   9995  N N   . ASN C 1 360 ? 154.003 -19.760 247.806 1.00 54.51  ?  354 ASN C N   1 
ATOM   9996  C CA  . ASN C 1 360 ? 152.841 -20.053 246.967 1.00 61.28  ?  354 ASN C CA  1 
ATOM   9997  C C   . ASN C 1 360 ? 151.842 -18.919 247.166 1.00 60.22  ?  354 ASN C C   1 
ATOM   9998  O O   . ASN C 1 360 ? 151.019 -18.934 248.082 1.00 61.02  ?  354 ASN C O   1 
ATOM   9999  C CB  . ASN C 1 360 ? 152.250 -21.417 247.306 1.00 61.51  ?  354 ASN C CB  1 
ATOM   10000 C CG  . ASN C 1 360 ? 151.991 -21.595 248.792 1.00 63.54  ?  354 ASN C CG  1 
ATOM   10001 O OD1 . ASN C 1 360 ? 152.616 -20.940 249.626 1.00 59.08  ?  354 ASN C OD1 1 
ATOM   10002 N ND2 . ASN C 1 360 ? 151.063 -22.485 249.128 1.00 46.51  ?  354 ASN C ND2 1 
ATOM   10003 N N   . TYR C 1 361 ? 151.928 -17.912 246.292 1.00 56.41  ?  355 TYR C N   1 
ATOM   10004 C CA  . TYR C 1 361 ? 151.098 -16.720 246.444 1.00 61.05  ?  355 TYR C CA  1 
ATOM   10005 C C   . TYR C 1 361 ? 149.616 -17.060 246.357 1.00 60.76  ?  355 TYR C C   1 
ATOM   10006 O O   . TYR C 1 361 ? 148.791 -16.452 247.048 1.00 58.54  ?  355 TYR C O   1 
ATOM   10007 C CB  . TYR C 1 361 ? 151.484 -15.683 245.390 1.00 58.50  ?  355 TYR C CB  1 
ATOM   10008 C CG  . TYR C 1 361 ? 152.964 -15.380 245.371 1.00 52.43  ?  355 TYR C CG  1 
ATOM   10009 C CD1 . TYR C 1 361 ? 153.649 -15.098 246.546 1.00 46.62  ?  355 TYR C CD1 1 
ATOM   10010 C CD2 . TYR C 1 361 ? 153.682 -15.400 244.184 1.00 54.50  ?  355 TYR C CD2 1 
ATOM   10011 C CE1 . TYR C 1 361 ? 155.002 -14.827 246.536 1.00 46.42  ?  355 TYR C CE1 1 
ATOM   10012 C CE2 . TYR C 1 361 ? 155.037 -15.133 244.164 1.00 48.96  ?  355 TYR C CE2 1 
ATOM   10013 C CZ  . TYR C 1 361 ? 155.692 -14.848 245.343 1.00 49.56  ?  355 TYR C CZ  1 
ATOM   10014 O OH  . TYR C 1 361 ? 157.041 -14.583 245.328 1.00 50.06  ?  355 TYR C OH  1 
ATOM   10015 N N   . GLY C 1 362 ? 149.260 -18.031 245.514 1.00 62.99  ?  356 GLY C N   1 
ATOM   10016 C CA  . GLY C 1 362 ? 147.884 -18.495 245.485 1.00 61.46  ?  356 GLY C CA  1 
ATOM   10017 C C   . GLY C 1 362 ? 147.472 -19.160 246.785 1.00 63.14  ?  356 GLY C C   1 
ATOM   10018 O O   . GLY C 1 362 ? 146.340 -18.992 247.246 1.00 56.83  ?  356 GLY C O   1 
ATOM   10019 N N   . GLY C 1 363 ? 148.383 -19.921 247.394 1.00 61.34  ?  357 GLY C N   1 
ATOM   10020 C CA  . GLY C 1 363 ? 148.078 -20.537 248.674 1.00 58.90  ?  357 GLY C CA  1 
ATOM   10021 C C   . GLY C 1 363 ? 147.974 -19.519 249.792 1.00 58.63  ?  357 GLY C C   1 
ATOM   10022 O O   . GLY C 1 363 ? 147.169 -19.676 250.714 1.00 59.68  ?  357 GLY C O   1 
ATOM   10023 N N   . ILE C 1 364 ? 148.786 -18.460 249.725 1.00 58.06  ?  358 ILE C N   1 
ATOM   10024 C CA  . ILE C 1 364 ? 148.713 -17.396 250.721 1.00 55.34  ?  358 ILE C CA  1 
ATOM   10025 C C   . ILE C 1 364 ? 147.338 -16.742 250.699 1.00 55.04  ?  358 ILE C C   1 
ATOM   10026 O O   . ILE C 1 364 ? 146.775 -16.406 251.749 1.00 51.26  ?  358 ILE C O   1 
ATOM   10027 C CB  . ILE C 1 364 ? 149.836 -16.368 250.484 1.00 50.28  ?  358 ILE C CB  1 
ATOM   10028 C CG1 . ILE C 1 364 ? 151.207 -17.012 250.698 1.00 44.25  ?  358 ILE C CG1 1 
ATOM   10029 C CG2 . ILE C 1 364 ? 149.663 -15.166 251.394 1.00 42.45  ?  358 ILE C CG2 1 
ATOM   10030 C CD1 . ILE C 1 364 ? 152.366 -16.087 250.395 1.00 37.81  ?  358 ILE C CD1 1 
ATOM   10031 N N   . ALA C 1 365 ? 146.770 -16.562 249.504 1.00 58.49  ?  359 ALA C N   1 
ATOM   10032 C CA  . ALA C 1 365 ? 145.439 -15.974 249.396 1.00 49.03  ?  359 ALA C CA  1 
ATOM   10033 C C   . ALA C 1 365 ? 144.381 -16.880 250.011 1.00 54.20  ?  359 ALA C C   1 
ATOM   10034 O O   . ALA C 1 365 ? 143.438 -16.397 250.650 1.00 56.35  ?  359 ALA C O   1 
ATOM   10035 C CB  . ALA C 1 365 ? 145.111 -15.683 247.932 1.00 53.01  ?  359 ALA C CB  1 
ATOM   10036 N N   . LEU C 1 366 ? 144.520 -18.196 249.831 1.00 56.70  ?  360 LEU C N   1 
ATOM   10037 C CA  . LEU C 1 366 ? 143.564 -19.131 250.417 1.00 60.11  ?  360 LEU C CA  1 
ATOM   10038 C C   . LEU C 1 366 ? 143.619 -19.088 251.939 1.00 61.81  ?  360 LEU C C   1 
ATOM   10039 O O   . LEU C 1 366 ? 142.581 -19.041 252.609 1.00 66.23  ?  360 LEU C O   1 
ATOM   10040 C CB  . LEU C 1 366 ? 143.836 -20.548 249.911 1.00 61.33  ?  360 LEU C CB  1 
ATOM   10041 C CG  . LEU C 1 366 ? 142.985 -21.650 250.546 1.00 63.99  ?  360 LEU C CG  1 
ATOM   10042 C CD1 . LEU C 1 366 ? 141.509 -21.429 250.252 1.00 62.77  ?  360 LEU C CD1 1 
ATOM   10043 C CD2 . LEU C 1 366 ? 143.434 -23.023 250.070 1.00 67.99  ?  360 LEU C CD2 1 
ATOM   10044 N N   . MET C 1 367 ? 144.829 -19.101 252.503 1.00 62.05  ?  361 MET C N   1 
ATOM   10045 C CA  . MET C 1 367 ? 144.979 -19.016 253.951 1.00 62.18  ?  361 MET C CA  1 
ATOM   10046 C C   . MET C 1 367 ? 144.490 -17.684 254.502 1.00 61.64  ?  361 MET C C   1 
ATOM   10047 O O   . MET C 1 367 ? 144.227 -17.581 255.705 1.00 62.80  ?  361 MET C O   1 
ATOM   10048 C CB  . MET C 1 367 ? 146.441 -19.246 254.336 1.00 59.81  ?  361 MET C CB  1 
ATOM   10049 C CG  . MET C 1 367 ? 146.916 -20.673 254.110 1.00 57.14  ?  361 MET C CG  1 
ATOM   10050 S SD  . MET C 1 367 ? 148.675 -20.906 254.430 1.00 54.38  ?  361 MET C SD  1 
ATOM   10051 C CE  . MET C 1 367 ? 149.386 -20.363 252.880 1.00 40.79  ?  361 MET C CE  1 
ATOM   10052 N N   . TRP C 1 368 ? 144.360 -16.666 253.652 1.00 63.45  ?  362 TRP C N   1 
ATOM   10053 C CA  . TRP C 1 368 ? 143.827 -15.378 254.070 1.00 65.29  ?  362 TRP C CA  1 
ATOM   10054 C C   . TRP C 1 368 ? 142.334 -15.236 253.813 1.00 70.69  ?  362 TRP C C   1 
ATOM   10055 O O   . TRP C 1 368 ? 141.690 -14.390 254.443 1.00 71.43  ?  362 TRP C O   1 
ATOM   10056 C CB  . TRP C 1 368 ? 144.563 -14.240 253.354 1.00 61.05  ?  362 TRP C CB  1 
ATOM   10057 C CG  . TRP C 1 368 ? 145.930 -13.959 253.893 1.00 49.60  ?  362 TRP C CG  1 
ATOM   10058 C CD1 . TRP C 1 368 ? 146.506 -14.510 254.999 1.00 48.03  ?  362 TRP C CD1 1 
ATOM   10059 C CD2 . TRP C 1 368 ? 146.895 -13.051 253.347 1.00 47.14  ?  362 TRP C CD2 1 
ATOM   10060 N NE1 . TRP C 1 368 ? 147.771 -14.002 255.177 1.00 48.45  ?  362 TRP C NE1 1 
ATOM   10061 C CE2 . TRP C 1 368 ? 148.033 -13.105 254.176 1.00 47.73  ?  362 TRP C CE2 1 
ATOM   10062 C CE3 . TRP C 1 368 ? 146.908 -12.200 252.238 1.00 44.68  ?  362 TRP C CE3 1 
ATOM   10063 C CZ2 . TRP C 1 368 ? 149.172 -12.340 253.931 1.00 41.72  ?  362 TRP C CZ2 1 
ATOM   10064 C CZ3 . TRP C 1 368 ? 148.038 -11.441 251.997 1.00 45.42  ?  362 TRP C CZ3 1 
ATOM   10065 C CH2 . TRP C 1 368 ? 149.155 -11.516 252.839 1.00 38.40  ?  362 TRP C CH2 1 
ATOM   10066 N N   . ARG C 1 369 ? 141.765 -16.030 252.909 1.00 71.14  ?  363 ARG C N   1 
ATOM   10067 C CA  . ARG C 1 369 ? 140.361 -15.864 252.556 1.00 68.53  ?  363 ARG C CA  1 
ATOM   10068 C C   . ARG C 1 369 ? 139.414 -16.553 253.532 1.00 72.37  ?  363 ARG C C   1 
ATOM   10069 O O   . ARG C 1 369 ? 138.194 -16.480 253.342 1.00 75.55  ?  363 ARG C O   1 
ATOM   10070 C CB  . ARG C 1 369 ? 140.113 -16.366 251.128 1.00 59.11  ?  363 ARG C CB  1 
ATOM   10071 C CG  . ARG C 1 369 ? 139.689 -17.818 251.007 1.00 64.64  ?  363 ARG C CG  1 
ATOM   10072 C CD  . ARG C 1 369 ? 138.413 -17.915 250.184 1.00 78.20  ?  363 ARG C CD  1 
ATOM   10073 N NE  . ARG C 1 369 ? 137.344 -17.099 250.755 1.00 77.05  ?  363 ARG C NE  1 
ATOM   10074 C CZ  . ARG C 1 369 ? 136.188 -16.842 250.150 1.00 73.06  ?  363 ARG C CZ  1 
ATOM   10075 N NH1 . ARG C 1 369 ? 135.944 -17.335 248.943 1.00 68.32  1  363 ARG C NH1 1 
ATOM   10076 N NH2 . ARG C 1 369 ? 135.277 -16.089 250.751 1.00 66.54  ?  363 ARG C NH2 1 
ATOM   10077 N N   . GLY C 1 370 ? 139.933 -17.192 254.578 1.00 64.07  ?  364 GLY C N   1 
ATOM   10078 C CA  . GLY C 1 370 ? 139.081 -17.832 255.560 1.00 58.04  ?  364 GLY C CA  1 
ATOM   10079 C C   . GLY C 1 370 ? 139.736 -18.010 256.914 1.00 63.21  ?  364 GLY C C   1 
ATOM   10080 O O   . GLY C 1 370 ? 140.828 -18.578 257.014 1.00 76.33  ?  364 GLY C O   1 
ATOM   10081 N N   . GLY C 1 371 ? 139.079 -17.526 257.965 1.00 60.76  ?  365 GLY C N   1 
ATOM   10082 C CA  . GLY C 1 371 ? 139.576 -17.708 259.315 1.00 57.49  ?  365 GLY C CA  1 
ATOM   10083 C C   . GLY C 1 371 ? 140.169 -16.458 259.932 1.00 65.57  ?  365 GLY C C   1 
ATOM   10084 O O   . GLY C 1 371 ? 140.032 -16.232 261.138 1.00 69.97  ?  365 GLY C O   1 
ATOM   10085 N N   . CYS C 1 372 ? 140.830 -15.640 259.121 1.00 70.31  ?  366 CYS C N   1 
ATOM   10086 C CA  . CYS C 1 372 ? 141.465 -14.426 259.611 1.00 68.12  ?  366 CYS C CA  1 
ATOM   10087 C C   . CYS C 1 372 ? 140.456 -13.276 259.563 1.00 69.95  ?  366 CYS C C   1 
ATOM   10088 O O   . CYS C 1 372 ? 139.247 -13.497 259.450 1.00 75.61  ?  366 CYS C O   1 
ATOM   10089 C CB  . CYS C 1 372 ? 142.732 -14.138 258.803 1.00 62.05  ?  366 CYS C CB  1 
ATOM   10090 S SG  . CYS C 1 372 ? 142.438 -13.407 257.190 1.00 86.48  ?  366 CYS C SG  1 
ATOM   10091 N N   . ILE C 1 373 ? 140.938 -12.038 259.640 1.00 60.92  ?  367 ILE C N   1 
ATOM   10092 C CA  . ILE C 1 373 ? 140.041 -10.889 259.688 1.00 57.79  ?  367 ILE C CA  1 
ATOM   10093 C C   . ILE C 1 373 ? 139.808 -10.281 258.305 1.00 56.07  ?  367 ILE C C   1 
ATOM   10094 O O   . ILE C 1 373 ? 138.718 -9.768  258.032 1.00 53.75  ?  367 ILE C O   1 
ATOM   10095 C CB  . ILE C 1 373 ? 140.590 -9.842  260.673 1.00 57.58  ?  367 ILE C CB  1 
ATOM   10096 C CG1 . ILE C 1 373 ? 140.799 -10.474 262.051 1.00 63.38  ?  367 ILE C CG1 1 
ATOM   10097 C CG2 . ILE C 1 373 ? 139.653 -8.650  260.783 1.00 53.99  ?  367 ILE C CG2 1 
ATOM   10098 C CD1 . ILE C 1 373 ? 139.573 -11.184 262.590 1.00 65.73  ?  367 ILE C CD1 1 
ATOM   10099 N N   . ILE C 1 374 ? 140.797 -10.347 257.415 1.00 63.20  ?  368 ILE C N   1 
ATOM   10100 C CA  . ILE C 1 374 ? 140.691 -9.722  256.101 1.00 59.49  ?  368 ILE C CA  1 
ATOM   10101 C C   . ILE C 1 374 ? 140.055 -10.683 255.105 1.00 54.24  ?  368 ILE C C   1 
ATOM   10102 O O   . ILE C 1 374 ? 140.142 -10.475 253.889 1.00 57.68  ?  368 ILE C O   1 
ATOM   10103 C CB  . ILE C 1 374 ? 142.069 -9.254  255.599 1.00 49.11  ?  368 ILE C CB  1 
ATOM   10104 C CG1 . ILE C 1 374 ? 142.986 -10.454 255.357 1.00 49.19  ?  368 ILE C CG1 1 
ATOM   10105 C CG2 . ILE C 1 374 ? 142.696 -8.308  256.597 1.00 45.11  ?  368 ILE C CG2 1 
ATOM   10106 C CD1 . ILE C 1 374 ? 144.367 -10.083 254.864 1.00 55.23  ?  368 ILE C CD1 1 
ATOM   10107 N N   . ARG C 1 375 ? 139.408 -11.732 255.606 1.00 57.04  ?  369 ARG C N   1 
ATOM   10108 C CA  . ARG C 1 375 ? 138.831 -12.736 254.723 1.00 61.59  ?  369 ARG C CA  1 
ATOM   10109 C C   . ARG C 1 375 ? 137.678 -12.150 253.915 1.00 56.65  ?  369 ARG C C   1 
ATOM   10110 O O   . ARG C 1 375 ? 136.856 -11.386 254.429 1.00 41.93  ?  369 ARG C O   1 
ATOM   10111 C CB  . ARG C 1 375 ? 138.362 -13.955 255.519 1.00 61.96  ?  369 ARG C CB  1 
ATOM   10112 C CG  . ARG C 1 375 ? 137.252 -13.713 256.525 1.00 61.62  ?  369 ARG C CG  1 
ATOM   10113 C CD  . ARG C 1 375 ? 136.790 -15.043 257.096 1.00 60.55  ?  369 ARG C CD  1 
ATOM   10114 N NE  . ARG C 1 375 ? 135.838 -14.892 258.190 1.00 66.40  ?  369 ARG C NE  1 
ATOM   10115 C CZ  . ARG C 1 375 ? 136.187 -14.655 259.448 1.00 62.30  ?  369 ARG C CZ  1 
ATOM   10116 N NH1 . ARG C 1 375 ? 137.468 -14.528 259.769 1.00 64.21  1  369 ARG C NH1 1 
ATOM   10117 N NH2 . ARG C 1 375 ? 135.257 -14.541 260.385 1.00 53.51  ?  369 ARG C NH2 1 
ATOM   10118 N N   . SER C 1 376 ? 137.632 -12.512 252.636 1.00 59.06  ?  370 SER C N   1 
ATOM   10119 C CA  . SER C 1 376 ? 136.660 -11.970 251.699 1.00 59.01  ?  370 SER C CA  1 
ATOM   10120 C C   . SER C 1 376 ? 136.658 -12.832 250.449 1.00 62.57  ?  370 SER C C   1 
ATOM   10121 O O   . SER C 1 376 ? 137.668 -13.458 250.114 1.00 61.31  ?  370 SER C O   1 
ATOM   10122 C CB  . SER C 1 376 ? 136.987 -10.516 251.338 1.00 56.21  ?  370 SER C CB  1 
ATOM   10123 O OG  . SER C 1 376 ? 138.299 -10.403 250.817 1.00 60.14  ?  370 SER C OG  1 
ATOM   10124 N N   . VAL C 1 377 ? 135.513 -12.856 249.759 1.00 64.91  ?  371 VAL C N   1 
ATOM   10125 C CA  . VAL C 1 377 ? 135.447 -13.559 248.483 1.00 66.91  ?  371 VAL C CA  1 
ATOM   10126 C C   . VAL C 1 377 ? 136.327 -12.879 247.444 1.00 62.29  ?  371 VAL C C   1 
ATOM   10127 O O   . VAL C 1 377 ? 136.699 -13.504 246.443 1.00 54.18  ?  371 VAL C O   1 
ATOM   10128 C CB  . VAL C 1 377 ? 133.990 -13.666 247.991 1.00 61.77  ?  371 VAL C CB  1 
ATOM   10129 C CG1 . VAL C 1 377 ? 133.547 -12.370 247.332 1.00 58.75  ?  371 VAL C CG1 1 
ATOM   10130 C CG2 . VAL C 1 377 ? 133.832 -14.845 247.038 1.00 65.65  ?  371 VAL C CG2 1 
ATOM   10131 N N   . PHE C 1 378 ? 136.672 -11.607 247.661 1.00 62.86  ?  372 PHE C N   1 
ATOM   10132 C CA  . PHE C 1 378 ? 137.657 -10.943 246.816 1.00 60.83  ?  372 PHE C CA  1 
ATOM   10133 C C   . PHE C 1 378 ? 139.004 -11.651 246.877 1.00 58.45  ?  372 PHE C C   1 
ATOM   10134 O O   . PHE C 1 378 ? 139.721 -11.712 245.871 1.00 55.92  ?  372 PHE C O   1 
ATOM   10135 C CB  . PHE C 1 378 ? 137.794 -9.479  247.237 1.00 50.32  ?  372 PHE C CB  1 
ATOM   10136 C CG  . PHE C 1 378 ? 138.962 -8.770  246.612 1.00 51.84  ?  372 PHE C CG  1 
ATOM   10137 C CD1 . PHE C 1 378 ? 138.884 -8.287  245.317 1.00 53.48  ?  372 PHE C CD1 1 
ATOM   10138 C CD2 . PHE C 1 378 ? 140.133 -8.573  247.327 1.00 49.41  ?  372 PHE C CD2 1 
ATOM   10139 C CE1 . PHE C 1 378 ? 139.955 -7.631  244.743 1.00 47.25  ?  372 PHE C CE1 1 
ATOM   10140 C CE2 . PHE C 1 378 ? 141.207 -7.919  246.758 1.00 50.86  ?  372 PHE C CE2 1 
ATOM   10141 C CZ  . PHE C 1 378 ? 141.118 -7.446  245.464 1.00 55.38  ?  372 PHE C CZ  1 
ATOM   10142 N N   . LEU C 1 379 ? 139.362 -12.194 248.044 1.00 49.34  ?  373 LEU C N   1 
ATOM   10143 C CA  . LEU C 1 379 ? 140.596 -12.962 248.157 1.00 52.47  ?  373 LEU C CA  1 
ATOM   10144 C C   . LEU C 1 379 ? 140.525 -14.261 247.367 1.00 61.58  ?  373 LEU C C   1 
ATOM   10145 O O   . LEU C 1 379 ? 141.555 -14.752 246.891 1.00 59.66  ?  373 LEU C O   1 
ATOM   10146 C CB  . LEU C 1 379 ? 140.904 -13.248 249.625 1.00 55.95  ?  373 LEU C CB  1 
ATOM   10147 C CG  . LEU C 1 379 ? 141.746 -12.200 250.350 1.00 50.99  ?  373 LEU C CG  1 
ATOM   10148 C CD1 . LEU C 1 379 ? 141.695 -12.423 251.846 1.00 48.83  ?  373 LEU C CD1 1 
ATOM   10149 C CD2 . LEU C 1 379 ? 143.180 -12.259 249.851 1.00 52.48  ?  373 LEU C CD2 1 
ATOM   10150 N N   . GLY C 1 380 ? 139.330 -14.838 247.224 1.00 67.70  ?  374 GLY C N   1 
ATOM   10151 C CA  . GLY C 1 380 ? 139.181 -15.993 246.358 1.00 60.88  ?  374 GLY C CA  1 
ATOM   10152 C C   . GLY C 1 380 ? 139.522 -15.684 244.916 1.00 56.18  ?  374 GLY C C   1 
ATOM   10153 O O   . GLY C 1 380 ? 140.054 -16.538 244.202 1.00 55.54  ?  374 GLY C O   1 
ATOM   10154 N N   . LYS C 1 381 ? 139.230 -14.461 244.470 1.00 61.59  ?  375 LYS C N   1 
ATOM   10155 C CA  . LYS C 1 381 ? 139.616 -14.030 243.134 1.00 62.80  ?  375 LYS C CA  1 
ATOM   10156 C C   . LYS C 1 381 ? 141.101 -13.710 243.039 1.00 62.99  ?  375 LYS C C   1 
ATOM   10157 O O   . LYS C 1 381 ? 141.632 -13.615 241.927 1.00 59.70  ?  375 LYS C O   1 
ATOM   10158 C CB  . LYS C 1 381 ? 138.787 -12.815 242.706 1.00 63.25  ?  375 LYS C CB  1 
ATOM   10159 C CG  . LYS C 1 381 ? 137.410 -13.159 242.137 1.00 70.46  ?  375 LYS C CG  1 
ATOM   10160 C CD  . LYS C 1 381 ? 136.463 -13.697 243.202 1.00 72.49  ?  375 LYS C CD  1 
ATOM   10161 C CE  . LYS C 1 381 ? 135.151 -14.172 242.599 1.00 71.22  ?  375 LYS C CE  1 
ATOM   10162 N NZ  . LYS C 1 381 ? 134.254 -14.762 243.632 1.00 69.68  1  375 LYS C NZ  1 
ATOM   10163 N N   . ILE C 1 382 ? 141.778 -13.542 244.177 1.00 61.10  ?  376 ILE C N   1 
ATOM   10164 C CA  . ILE C 1 382 ? 143.230 -13.395 244.164 1.00 57.96  ?  376 ILE C CA  1 
ATOM   10165 C C   . ILE C 1 382 ? 143.893 -14.728 243.843 1.00 61.58  ?  376 ILE C C   1 
ATOM   10166 O O   . ILE C 1 382 ? 144.881 -14.784 243.101 1.00 59.34  ?  376 ILE C O   1 
ATOM   10167 C CB  . ILE C 1 382 ? 143.721 -12.834 245.512 1.00 57.80  ?  376 ILE C CB  1 
ATOM   10168 C CG1 . ILE C 1 382 ? 143.003 -11.527 245.857 1.00 52.68  ?  376 ILE C CG1 1 
ATOM   10169 C CG2 . ILE C 1 382 ? 145.230 -12.632 245.492 1.00 56.58  ?  376 ILE C CG2 1 
ATOM   10170 C CD1 . ILE C 1 382 ? 143.582 -10.306 245.186 1.00 50.02  ?  376 ILE C CD1 1 
ATOM   10171 N N   . LYS C 1 383 ? 143.352 -15.822 244.384 1.00 67.27  ?  377 LYS C N   1 
ATOM   10172 C CA  . LYS C 1 383 ? 143.976 -17.133 244.228 1.00 65.69  ?  377 LYS C CA  1 
ATOM   10173 C C   . LYS C 1 383 ? 143.942 -17.597 242.777 1.00 72.53  ?  377 LYS C C   1 
ATOM   10174 O O   . LYS C 1 383 ? 144.981 -17.926 242.192 1.00 73.57  ?  377 LYS C O   1 
ATOM   10175 C CB  . LYS C 1 383 ? 143.282 -18.152 245.135 1.00 58.95  ?  377 LYS C CB  1 
ATOM   10176 C CG  . LYS C 1 383 ? 143.900 -19.539 245.089 1.00 70.54  ?  377 LYS C CG  1 
ATOM   10177 C CD  . LYS C 1 383 ? 143.071 -20.544 245.873 1.00 69.10  ?  377 LYS C CD  1 
ATOM   10178 C CE  . LYS C 1 383 ? 143.763 -21.897 245.932 1.00 75.58  ?  377 LYS C CE  1 
ATOM   10179 N NZ  . LYS C 1 383 ? 144.112 -22.401 244.575 1.00 82.68  1  377 LYS C NZ  1 
ATOM   10180 N N   . ASP C 1 384 ? 142.749 -17.637 242.176 1.00 70.95  ?  378 ASP C N   1 
ATOM   10181 C CA  . ASP C 1 384 ? 142.631 -18.086 240.794 1.00 77.47  ?  378 ASP C CA  1 
ATOM   10182 C C   . ASP C 1 384 ? 143.343 -17.152 239.824 1.00 75.45  ?  378 ASP C C   1 
ATOM   10183 O O   . ASP C 1 384 ? 143.656 -17.564 238.702 1.00 75.86  ?  378 ASP C O   1 
ATOM   10184 C CB  . ASP C 1 384 ? 141.156 -18.226 240.410 1.00 81.48  ?  378 ASP C CB  1 
ATOM   10185 C CG  . ASP C 1 384 ? 140.405 -16.915 240.494 1.00 84.93  ?  378 ASP C CG  1 
ATOM   10186 O OD1 . ASP C 1 384 ? 139.991 -16.390 239.439 1.00 93.48  ?  378 ASP C OD1 1 
ATOM   10187 O OD2 . ASP C 1 384 ? 140.243 -16.403 241.620 1.00 72.89  -1 378 ASP C OD2 1 
ATOM   10188 N N   . ALA C 1 385 ? 143.605 -15.908 240.229 1.00 67.47  ?  379 ALA C N   1 
ATOM   10189 C CA  . ALA C 1 385 ? 144.430 -15.029 239.409 1.00 69.53  ?  379 ALA C CA  1 
ATOM   10190 C C   . ALA C 1 385 ? 145.865 -15.536 239.340 1.00 64.63  ?  379 ALA C C   1 
ATOM   10191 O O   . ALA C 1 385 ? 146.496 -15.488 238.278 1.00 60.53  ?  379 ALA C O   1 
ATOM   10192 C CB  . ALA C 1 385 ? 144.388 -13.603 239.957 1.00 67.55  ?  379 ALA C CB  1 
ATOM   10193 N N   . PHE C 1 386 ? 146.394 -16.032 240.462 1.00 77.81  ?  380 PHE C N   1 
ATOM   10194 C CA  . PHE C 1 386 ? 147.736 -16.600 240.481 1.00 80.23  ?  380 PHE C CA  1 
ATOM   10195 C C   . PHE C 1 386 ? 147.801 -17.979 239.840 1.00 77.79  ?  380 PHE C C   1 
ATOM   10196 O O   . PHE C 1 386 ? 148.879 -18.389 239.397 1.00 67.27  ?  380 PHE C O   1 
ATOM   10197 C CB  . PHE C 1 386 ? 148.261 -16.686 241.917 1.00 71.54  ?  380 PHE C CB  1 
ATOM   10198 C CG  . PHE C 1 386 ? 148.691 -15.365 242.490 1.00 71.84  ?  380 PHE C CG  1 
ATOM   10199 C CD1 . PHE C 1 386 ? 149.867 -14.764 242.071 1.00 62.44  ?  380 PHE C CD1 1 
ATOM   10200 C CD2 . PHE C 1 386 ? 147.930 -14.732 243.458 1.00 65.80  ?  380 PHE C CD2 1 
ATOM   10201 C CE1 . PHE C 1 386 ? 150.268 -13.552 242.598 1.00 56.40  ?  380 PHE C CE1 1 
ATOM   10202 C CE2 . PHE C 1 386 ? 148.327 -13.519 243.989 1.00 56.50  ?  380 PHE C CE2 1 
ATOM   10203 C CZ  . PHE C 1 386 ? 149.497 -12.929 243.558 1.00 56.11  ?  380 PHE C CZ  1 
ATOM   10204 N N   . ASP C 1 387 ? 146.683 -18.705 239.787 1.00 79.40  ?  381 ASP C N   1 
ATOM   10205 C CA  . ASP C 1 387 ? 146.695 -20.033 239.181 1.00 71.51  ?  381 ASP C CA  1 
ATOM   10206 C C   . ASP C 1 387 ? 146.905 -19.951 237.674 1.00 69.10  ?  381 ASP C C   1 
ATOM   10207 O O   . ASP C 1 387 ? 147.584 -20.803 237.089 1.00 68.21  ?  381 ASP C O   1 
ATOM   10208 C CB  . ASP C 1 387 ? 145.396 -20.769 239.506 1.00 75.40  ?  381 ASP C CB  1 
ATOM   10209 C CG  . ASP C 1 387 ? 145.319 -21.203 240.956 1.00 80.29  ?  381 ASP C CG  1 
ATOM   10210 O OD1 . ASP C 1 387 ? 146.324 -21.739 241.470 1.00 79.54  ?  381 ASP C OD1 1 
ATOM   10211 O OD2 . ASP C 1 387 ? 144.258 -21.004 241.584 1.00 95.46  -1 381 ASP C OD2 1 
ATOM   10212 N N   . ARG C 1 388 ? 146.332 -18.931 237.030 1.00 72.50  ?  382 ARG C N   1 
ATOM   10213 C CA  . ARG C 1 388 ? 146.521 -18.764 235.593 1.00 75.28  ?  382 ARG C CA  1 
ATOM   10214 C C   . ARG C 1 388 ? 147.955 -18.371 235.257 1.00 77.68  ?  382 ARG C C   1 
ATOM   10215 O O   . ARG C 1 388 ? 148.432 -18.656 234.153 1.00 77.68  ?  382 ARG C O   1 
ATOM   10216 C CB  . ARG C 1 388 ? 145.540 -17.721 235.054 1.00 69.94  ?  382 ARG C CB  1 
ATOM   10217 C CG  . ARG C 1 388 ? 145.487 -17.639 233.536 1.00 74.04  ?  382 ARG C CG  1 
ATOM   10218 C CD  . ARG C 1 388 ? 144.464 -16.617 233.067 1.00 76.47  ?  382 ARG C CD  1 
ATOM   10219 N NE  . ARG C 1 388 ? 143.118 -16.938 233.531 1.00 87.50  ?  382 ARG C NE  1 
ATOM   10220 C CZ  . ARG C 1 388 ? 142.035 -16.227 233.232 1.00 96.43  ?  382 ARG C CZ  1 
ATOM   10221 N NH1 . ARG C 1 388 ? 142.137 -15.151 232.464 1.00 91.63  1  382 ARG C NH1 1 
ATOM   10222 N NH2 . ARG C 1 388 ? 140.849 -16.592 233.700 1.00 90.24  ?  382 ARG C NH2 1 
ATOM   10223 N N   . ASN C 1 389 ? 148.654 -17.726 236.189 1.00 78.75  ?  383 ASN C N   1 
ATOM   10224 C CA  . ASN C 1 389 ? 150.045 -17.326 235.978 1.00 74.44  ?  383 ASN C CA  1 
ATOM   10225 C C   . ASN C 1 389 ? 150.740 -17.274 237.328 1.00 75.70  ?  383 ASN C C   1 
ATOM   10226 O O   . ASN C 1 389 ? 150.690 -16.257 238.033 1.00 71.68  ?  383 ASN C O   1 
ATOM   10227 C CB  . ASN C 1 389 ? 150.144 -15.979 235.263 1.00 70.44  ?  383 ASN C CB  1 
ATOM   10228 C CG  . ASN C 1 389 ? 151.571 -15.615 234.900 1.00 68.62  ?  383 ASN C CG  1 
ATOM   10229 O OD1 . ASN C 1 389 ? 152.442 -16.480 234.819 1.00 64.83  ?  383 ASN C OD1 1 
ATOM   10230 N ND2 . ASN C 1 389 ? 151.817 -14.328 234.676 1.00 61.20  ?  383 ASN C ND2 1 
ATOM   10231 N N   . PRO C 1 390 ? 151.395 -18.367 237.733 1.00 82.50  ?  384 PRO C N   1 
ATOM   10232 C CA  . PRO C 1 390 ? 152.076 -18.368 239.039 1.00 80.52  ?  384 PRO C CA  1 
ATOM   10233 C C   . PRO C 1 390 ? 153.168 -17.320 239.162 1.00 69.35  ?  384 PRO C C   1 
ATOM   10234 O O   . PRO C 1 390 ? 153.469 -16.885 240.281 1.00 68.28  ?  384 PRO C O   1 
ATOM   10235 C CB  . PRO C 1 390 ? 152.644 -19.790 239.134 1.00 77.15  ?  384 PRO C CB  1 
ATOM   10236 C CG  . PRO C 1 390 ? 151.767 -20.606 238.245 1.00 78.61  ?  384 PRO C CG  1 
ATOM   10237 C CD  . PRO C 1 390 ? 151.399 -19.699 237.106 1.00 78.16  ?  384 PRO C CD  1 
ATOM   10238 N N   . GLU C 1 391 ? 153.775 -16.903 238.053 1.00 63.31  ?  385 GLU C N   1 
ATOM   10239 C CA  . GLU C 1 391 ? 154.792 -15.854 238.061 1.00 60.96  ?  385 GLU C CA  1 
ATOM   10240 C C   . GLU C 1 391 ? 154.202 -14.493 237.711 1.00 62.01  ?  385 GLU C C   1 
ATOM   10241 O O   . GLU C 1 391 ? 154.834 -13.688 237.020 1.00 62.72  ?  385 GLU C O   1 
ATOM   10242 C CB  . GLU C 1 391 ? 155.935 -16.208 237.113 1.00 69.04  ?  385 GLU C CB  1 
ATOM   10243 C CG  . GLU C 1 391 ? 155.530 -16.361 235.654 1.00 75.65  ?  385 GLU C CG  1 
ATOM   10244 C CD  . GLU C 1 391 ? 156.625 -15.916 234.701 1.00 90.44  ?  385 GLU C CD  1 
ATOM   10245 O OE1 . GLU C 1 391 ? 157.815 -16.085 235.040 1.00 87.63  ?  385 GLU C OE1 1 
ATOM   10246 O OE2 . GLU C 1 391 ? 156.295 -15.385 233.620 1.00 85.27  -1 385 GLU C OE2 1 
ATOM   10247 N N   . LEU C 1 392 ? 152.989 -14.212 238.181 1.00 57.26  ?  386 LEU C N   1 
ATOM   10248 C CA  . LEU C 1 392 ? 152.348 -12.934 237.898 1.00 51.98  ?  386 LEU C CA  1 
ATOM   10249 C C   . LEU C 1 392 ? 153.149 -11.797 238.518 1.00 52.22  ?  386 LEU C C   1 
ATOM   10250 O O   . LEU C 1 392 ? 153.368 -11.768 239.733 1.00 55.28  ?  386 LEU C O   1 
ATOM   10251 C CB  . LEU C 1 392 ? 150.915 -12.936 238.429 1.00 57.20  ?  386 LEU C CB  1 
ATOM   10252 C CG  . LEU C 1 392 ? 150.079 -11.695 238.113 1.00 55.08  ?  386 LEU C CG  1 
ATOM   10253 C CD1 . LEU C 1 392 ? 150.075 -11.418 236.617 1.00 52.96  ?  386 LEU C CD1 1 
ATOM   10254 C CD2 . LEU C 1 392 ? 148.658 -11.857 238.633 1.00 50.78  ?  386 LEU C CD2 1 
ATOM   10255 N N   . GLN C 1 393 ? 153.592 -10.861 237.674 1.00 53.88  ?  387 GLN C N   1 
ATOM   10256 C CA  . GLN C 1 393 ? 154.453 -9.783  238.148 1.00 57.55  ?  387 GLN C CA  1 
ATOM   10257 C C   . GLN C 1 393 ? 153.701 -8.811  239.049 1.00 57.69  ?  387 GLN C C   1 
ATOM   10258 O O   . GLN C 1 393 ? 154.301 -8.216  239.952 1.00 58.42  ?  387 GLN C O   1 
ATOM   10259 C CB  . GLN C 1 393 ? 155.064 -9.041  236.959 1.00 59.89  ?  387 GLN C CB  1 
ATOM   10260 C CG  . GLN C 1 393 ? 156.262 -8.175  237.314 1.00 64.08  ?  387 GLN C CG  1 
ATOM   10261 C CD  . GLN C 1 393 ? 157.483 -8.996  237.683 1.00 70.52  ?  387 GLN C CD  1 
ATOM   10262 O OE1 . GLN C 1 393 ? 158.016 -8.877  238.786 1.00 61.80  ?  387 GLN C OE1 1 
ATOM   10263 N NE2 . GLN C 1 393 ? 157.935 -9.832  236.755 1.00 68.61  ?  387 GLN C NE2 1 
ATOM   10264 N N   . ASN C 1 394 ? 152.399 -8.640  238.828 1.00 58.10  ?  388 ASN C N   1 
ATOM   10265 C CA  . ASN C 1 394 ? 151.605 -7.699  239.604 1.00 49.77  ?  388 ASN C CA  1 
ATOM   10266 C C   . ASN C 1 394 ? 150.130 -8.013  239.403 1.00 48.55  ?  388 ASN C C   1 
ATOM   10267 O O   . ASN C 1 394 ? 149.724 -8.482  238.337 1.00 53.19  ?  388 ASN C O   1 
ATOM   10268 C CB  . ASN C 1 394 ? 151.903 -6.251  239.198 1.00 49.70  ?  388 ASN C CB  1 
ATOM   10269 C CG  . ASN C 1 394 ? 151.308 -5.245  240.156 1.00 46.41  ?  388 ASN C CG  1 
ATOM   10270 O OD1 . ASN C 1 394 ? 150.098 -5.020  240.165 1.00 50.31  ?  388 ASN C OD1 1 
ATOM   10271 N ND2 . ASN C 1 394 ? 152.157 -4.627  240.968 1.00 48.02  ?  388 ASN C ND2 1 
ATOM   10272 N N   . LEU C 1 395 ? 149.331 -7.740  240.439 1.00 45.01  ?  389 LEU C N   1 
ATOM   10273 C CA  . LEU C 1 395 ? 147.896 -7.992  240.346 1.00 46.73  ?  389 LEU C CA  1 
ATOM   10274 C C   . LEU C 1 395 ? 147.224 -7.083  239.325 1.00 54.81  ?  389 LEU C C   1 
ATOM   10275 O O   . LEU C 1 395 ? 146.188 -7.451  238.759 1.00 55.47  ?  389 LEU C O   1 
ATOM   10276 C CB  . LEU C 1 395 ? 147.237 -7.827  241.714 1.00 45.18  ?  389 LEU C CB  1 
ATOM   10277 C CG  . LEU C 1 395 ? 147.361 -9.017  242.666 1.00 55.74  ?  389 LEU C CG  1 
ATOM   10278 C CD1 . LEU C 1 395 ? 146.672 -8.714  243.986 1.00 55.05  ?  389 LEU C CD1 1 
ATOM   10279 C CD2 . LEU C 1 395 ? 146.781 -10.272 242.030 1.00 49.95  ?  389 LEU C CD2 1 
ATOM   10280 N N   . LEU C 1 396 ? 147.791 -5.902  239.072 1.00 55.54  ?  390 LEU C N   1 
ATOM   10281 C CA  . LEU C 1 396 ? 147.254 -5.020  238.041 1.00 56.42  ?  390 LEU C CA  1 
ATOM   10282 C C   . LEU C 1 396 ? 147.421 -5.580  236.635 1.00 56.23  ?  390 LEU C C   1 
ATOM   10283 O O   . LEU C 1 396 ? 146.917 -4.970  235.685 1.00 64.33  ?  390 LEU C O   1 
ATOM   10284 C CB  . LEU C 1 396 ? 147.912 -3.640  238.121 1.00 58.43  ?  390 LEU C CB  1 
ATOM   10285 C CG  . LEU C 1 396 ? 147.307 -2.610  239.082 1.00 53.33  ?  390 LEU C CG  1 
ATOM   10286 C CD1 . LEU C 1 396 ? 145.791 -2.564  238.941 1.00 53.41  ?  390 LEU C CD1 1 
ATOM   10287 C CD2 . LEU C 1 396 ? 147.711 -2.881  240.519 1.00 46.87  ?  390 LEU C CD2 1 
ATOM   10288 N N   . LEU C 1 397 ? 148.107 -6.710  236.475 1.00 53.24  ?  391 LEU C N   1 
ATOM   10289 C CA  . LEU C 1 397 ? 148.317 -7.327  235.174 1.00 60.07  ?  391 LEU C CA  1 
ATOM   10290 C C   . LEU C 1 397 ? 147.399 -8.517  234.924 1.00 60.78  ?  391 LEU C C   1 
ATOM   10291 O O   . LEU C 1 397 ? 147.508 -9.155  233.873 1.00 66.17  ?  391 LEU C O   1 
ATOM   10292 C CB  . LEU C 1 397 ? 149.779 -7.761  235.029 1.00 58.48  ?  391 LEU C CB  1 
ATOM   10293 C CG  . LEU C 1 397 ? 150.808 -6.636  235.156 1.00 49.45  ?  391 LEU C CG  1 
ATOM   10294 C CD1 . LEU C 1 397 ? 152.224 -7.177  235.041 1.00 49.78  ?  391 LEU C CD1 1 
ATOM   10295 C CD2 . LEU C 1 397 ? 150.552 -5.562  234.110 1.00 49.16  ?  391 LEU C CD2 1 
ATOM   10296 N N   . ASP C 1 398 ? 146.508 -8.832  235.859 1.00 58.05  ?  392 ASP C N   1 
ATOM   10297 C CA  . ASP C 1 398 ? 145.544 -9.906  235.679 1.00 61.10  ?  392 ASP C CA  1 
ATOM   10298 C C   . ASP C 1 398 ? 144.308 -9.380  234.959 1.00 70.50  ?  392 ASP C C   1 
ATOM   10299 O O   . ASP C 1 398 ? 143.971 -8.196  235.049 1.00 74.80  ?  392 ASP C O   1 
ATOM   10300 C CB  . ASP C 1 398 ? 145.153 -10.513 237.028 1.00 66.95  ?  392 ASP C CB  1 
ATOM   10301 C CG  . ASP C 1 398 ? 144.331 -11.779 236.884 1.00 77.55  ?  392 ASP C CG  1 
ATOM   10302 O OD1 . ASP C 1 398 ? 144.873 -12.787 236.385 1.00 84.86  ?  392 ASP C OD1 1 
ATOM   10303 O OD2 . ASP C 1 398 ? 143.143 -11.767 237.273 1.00 75.89  -1 392 ASP C OD2 1 
ATOM   10304 N N   . ASP C 1 399 ? 143.632 -10.278 234.237 1.00 77.83  ?  393 ASP C N   1 
ATOM   10305 C CA  . ASP C 1 399 ? 142.495 -9.864  233.419 1.00 80.66  ?  393 ASP C CA  1 
ATOM   10306 C C   . ASP C 1 399 ? 141.356 -9.320  234.274 1.00 73.23  ?  393 ASP C C   1 
ATOM   10307 O O   . ASP C 1 399 ? 140.711 -8.331  233.905 1.00 67.06  ?  393 ASP C O   1 
ATOM   10308 C CB  . ASP C 1 399 ? 142.006 -11.032 232.562 1.00 90.49  ?  393 ASP C CB  1 
ATOM   10309 C CG  . ASP C 1 399 ? 141.615 -12.242 233.390 1.00 92.85  ?  393 ASP C CG  1 
ATOM   10310 O OD1 . ASP C 1 399 ? 142.509 -12.849 234.017 1.00 92.12  ?  393 ASP C OD1 1 
ATOM   10311 O OD2 . ASP C 1 399 ? 140.412 -12.578 233.424 1.00 87.36  -1 393 ASP C OD2 1 
ATOM   10312 N N   . PHE C 1 400 ? 141.094 -9.950  235.421 1.00 72.12  ?  394 PHE C N   1 
ATOM   10313 C CA  . PHE C 1 400 ? 139.972 -9.528  236.253 1.00 69.42  ?  394 PHE C CA  1 
ATOM   10314 C C   . PHE C 1 400 ? 140.251 -8.185  236.917 1.00 68.49  ?  394 PHE C C   1 
ATOM   10315 O O   . PHE C 1 400 ? 139.403 -7.286  236.899 1.00 64.14  ?  394 PHE C O   1 
ATOM   10316 C CB  . PHE C 1 400 ? 139.663 -10.599 237.301 1.00 59.62  ?  394 PHE C CB  1 
ATOM   10317 C CG  . PHE C 1 400 ? 138.615 -10.190 238.299 1.00 64.48  ?  394 PHE C CG  1 
ATOM   10318 C CD1 . PHE C 1 400 ? 137.428 -9.609  237.882 1.00 74.91  ?  394 PHE C CD1 1 
ATOM   10319 C CD2 . PHE C 1 400 ? 138.810 -10.401 239.655 1.00 59.05  ?  394 PHE C CD2 1 
ATOM   10320 C CE1 . PHE C 1 400 ? 136.462 -9.233  238.798 1.00 75.11  ?  394 PHE C CE1 1 
ATOM   10321 C CE2 . PHE C 1 400 ? 137.847 -10.030 240.575 1.00 56.81  ?  394 PHE C CE2 1 
ATOM   10322 C CZ  . PHE C 1 400 ? 136.672 -9.446  240.146 1.00 62.42  ?  394 PHE C CZ  1 
ATOM   10323 N N   . PHE C 1 401 ? 141.439 -8.027  237.504 1.00 63.23  ?  395 PHE C N   1 
ATOM   10324 C CA  . PHE C 1 401 ? 141.734 -6.803  238.239 1.00 63.39  ?  395 PHE C CA  1 
ATOM   10325 C C   . PHE C 1 401 ? 141.962 -5.621  237.306 1.00 64.32  ?  395 PHE C C   1 
ATOM   10326 O O   . PHE C 1 401 ? 141.691 -4.476  237.685 1.00 58.67  ?  395 PHE C O   1 
ATOM   10327 C CB  . PHE C 1 401 ? 142.940 -7.020  239.149 1.00 59.49  ?  395 PHE C CB  1 
ATOM   10328 C CG  . PHE C 1 401 ? 142.743 -8.125  240.142 1.00 53.36  ?  395 PHE C CG  1 
ATOM   10329 C CD1 . PHE C 1 401 ? 141.988 -7.920  241.283 1.00 51.30  ?  395 PHE C CD1 1 
ATOM   10330 C CD2 . PHE C 1 401 ? 143.300 -9.374  239.927 1.00 57.22  ?  395 PHE C CD2 1 
ATOM   10331 C CE1 . PHE C 1 401 ? 141.798 -8.937  242.196 1.00 52.32  ?  395 PHE C CE1 1 
ATOM   10332 C CE2 . PHE C 1 401 ? 143.114 -10.394 240.837 1.00 59.27  ?  395 PHE C CE2 1 
ATOM   10333 C CZ  . PHE C 1 401 ? 142.361 -10.176 241.971 1.00 53.94  ?  395 PHE C CZ  1 
ATOM   10334 N N   . LYS C 1 402 ? 142.458 -5.869  236.092 1.00 63.32  ?  396 LYS C N   1 
ATOM   10335 C CA  . LYS C 1 402 ? 142.541 -4.799  235.103 1.00 60.81  ?  396 LYS C CA  1 
ATOM   10336 C C   . LYS C 1 402 ? 141.149 -4.311  234.719 1.00 68.75  ?  396 LYS C C   1 
ATOM   10337 O O   . LYS C 1 402 ? 140.884 -3.103  234.701 1.00 70.21  ?  396 LYS C O   1 
ATOM   10338 C CB  . LYS C 1 402 ? 143.311 -5.280  233.871 1.00 59.44  ?  396 LYS C CB  1 
ATOM   10339 C CG  . LYS C 1 402 ? 143.016 -4.500  232.596 1.00 74.27  ?  396 LYS C CG  1 
ATOM   10340 C CD  . LYS C 1 402 ? 143.420 -3.037  232.705 1.00 71.76  ?  396 LYS C CD  1 
ATOM   10341 C CE  . LYS C 1 402 ? 142.727 -2.208  231.637 1.00 71.55  ?  396 LYS C CE  1 
ATOM   10342 N NZ  . LYS C 1 402 ? 141.253 -2.429  231.630 1.00 69.82  1  396 LYS C NZ  1 
ATOM   10343 N N   . SER C 1 403 ? 140.242 -5.242  234.415 1.00 68.00  ?  397 SER C N   1 
ATOM   10344 C CA  . SER C 1 403 ? 138.878 -4.856  234.073 1.00 67.44  ?  397 SER C CA  1 
ATOM   10345 C C   . SER C 1 403 ? 138.152 -4.241  235.262 1.00 65.44  ?  397 SER C C   1 
ATOM   10346 O O   . SER C 1 403 ? 137.318 -3.348  235.081 1.00 72.79  ?  397 SER C O   1 
ATOM   10347 C CB  . SER C 1 403 ? 138.107 -6.067  233.547 1.00 75.62  ?  397 SER C CB  1 
ATOM   10348 O OG  . SER C 1 403 ? 138.747 -6.627  232.413 1.00 70.39  ?  397 SER C OG  1 
ATOM   10349 N N   . ALA C 1 404 ? 138.457 -4.699  236.479 1.00 63.39  ?  398 ALA C N   1 
ATOM   10350 C CA  . ALA C 1 404 ? 137.789 -4.159  237.660 1.00 60.38  ?  398 ALA C CA  1 
ATOM   10351 C C   . ALA C 1 404 ? 138.191 -2.712  237.911 1.00 57.73  ?  398 ALA C C   1 
ATOM   10352 O O   . ALA C 1 404 ? 137.335 -1.865  238.191 1.00 60.38  ?  398 ALA C O   1 
ATOM   10353 C CB  . ALA C 1 404 ? 138.098 -5.024  238.881 1.00 57.60  ?  398 ALA C CB  1 
ATOM   10354 N N   . VAL C 1 405 ? 139.487 -2.407  237.816 1.00 56.51  ?  399 VAL C N   1 
ATOM   10355 C CA  . VAL C 1 405 ? 139.939 -1.034  238.018 1.00 52.47  ?  399 VAL C CA  1 
ATOM   10356 C C   . VAL C 1 405 ? 139.422 -0.133  236.902 1.00 59.43  ?  399 VAL C C   1 
ATOM   10357 O O   . VAL C 1 405 ? 139.038 1.018   237.143 1.00 60.22  ?  399 VAL C O   1 
ATOM   10358 C CB  . VAL C 1 405 ? 141.474 -0.987  238.126 1.00 59.09  ?  399 VAL C CB  1 
ATOM   10359 C CG1 . VAL C 1 405 ? 141.961 0.452   238.180 1.00 47.07  ?  399 VAL C CG1 1 
ATOM   10360 C CG2 . VAL C 1 405 ? 141.939 -1.750  239.355 1.00 55.61  ?  399 VAL C CG2 1 
ATOM   10361 N N   . GLU C 1 406 ? 139.396 -0.641  235.667 1.00 66.13  ?  400 GLU C N   1 
ATOM   10362 C CA  . GLU C 1 406 ? 138.850 0.139   234.561 1.00 67.72  ?  400 GLU C CA  1 
ATOM   10363 C C   . GLU C 1 406 ? 137.367 0.419   234.766 1.00 61.80  ?  400 GLU C C   1 
ATOM   10364 O O   . GLU C 1 406 ? 136.875 1.499   234.420 1.00 55.00  ?  400 GLU C O   1 
ATOM   10365 C CB  . GLU C 1 406 ? 139.083 -0.592  233.238 1.00 64.36  ?  400 GLU C CB  1 
ATOM   10366 C CG  . GLU C 1 406 ? 138.550 0.144   232.019 1.00 74.58  ?  400 GLU C CG  1 
ATOM   10367 C CD  . GLU C 1 406 ? 139.225 1.486   231.803 1.00 81.79  ?  400 GLU C CD  1 
ATOM   10368 O OE1 . GLU C 1 406 ? 140.416 1.621   232.155 1.00 81.95  ?  400 GLU C OE1 1 
ATOM   10369 O OE2 . GLU C 1 406 ? 138.562 2.409   231.282 1.00 81.88  -1 400 GLU C OE2 1 
ATOM   10370 N N   . ASN C 1 407 ? 136.638 -0.543  235.337 1.00 61.43  ?  401 ASN C N   1 
ATOM   10371 C CA  . ASN C 1 407 ? 135.223 -0.344  235.623 1.00 64.86  ?  401 ASN C CA  1 
ATOM   10372 C C   . ASN C 1 407 ? 134.999 0.629   236.774 1.00 66.51  ?  401 ASN C C   1 
ATOM   10373 O O   . ASN C 1 407 ? 133.907 1.196   236.886 1.00 70.44  ?  401 ASN C O   1 
ATOM   10374 C CB  . ASN C 1 407 ? 134.564 -1.691  235.933 1.00 61.76  ?  401 ASN C CB  1 
ATOM   10375 C CG  . ASN C 1 407 ? 133.064 -1.581  236.125 1.00 78.15  ?  401 ASN C CG  1 
ATOM   10376 O OD1 . ASN C 1 407 ? 132.580 -1.413  237.244 1.00 74.01  ?  401 ASN C OD1 1 
ATOM   10377 N ND2 . ASN C 1 407 ? 132.319 -1.676  235.029 1.00 76.71  ?  401 ASN C ND2 1 
ATOM   10378 N N   . CYS C 1 408 ? 136.008 0.846   237.619 1.00 57.65  ?  402 CYS C N   1 
ATOM   10379 C CA  . CYS C 1 408 ? 135.870 1.690   238.795 1.00 59.01  ?  402 CYS C CA  1 
ATOM   10380 C C   . CYS C 1 408 ? 136.541 3.049   238.664 1.00 55.62  ?  402 CYS C C   1 
ATOM   10381 O O   . CYS C 1 408 ? 136.332 3.903   239.532 1.00 51.71  ?  402 CYS C O   1 
ATOM   10382 C CB  . CYS C 1 408 ? 136.445 0.979   240.031 1.00 50.87  ?  402 CYS C CB  1 
ATOM   10383 S SG  . CYS C 1 408 ? 135.651 -0.588  240.457 1.00 74.18  ?  402 CYS C SG  1 
ATOM   10384 N N   . GLN C 1 409 ? 137.321 3.282   237.606 1.00 55.74  ?  403 GLN C N   1 
ATOM   10385 C CA  . GLN C 1 409 ? 138.217 4.435   237.586 1.00 49.22  ?  403 GLN C CA  1 
ATOM   10386 C C   . GLN C 1 409 ? 137.449 5.752   237.562 1.00 44.15  ?  403 GLN C C   1 
ATOM   10387 O O   . GLN C 1 409 ? 137.792 6.691   238.290 1.00 48.27  ?  403 GLN C O   1 
ATOM   10388 C CB  . GLN C 1 409 ? 139.164 4.349   236.389 1.00 45.48  ?  403 GLN C CB  1 
ATOM   10389 C CG  . GLN C 1 409 ? 140.338 5.302   236.504 1.00 53.74  ?  403 GLN C CG  1 
ATOM   10390 C CD  . GLN C 1 409 ? 141.031 5.549   235.184 1.00 60.03  ?  403 GLN C CD  1 
ATOM   10391 O OE1 . GLN C 1 409 ? 141.817 6.486   235.054 1.00 62.61  ?  403 GLN C OE1 1 
ATOM   10392 N NE2 . GLN C 1 409 ? 140.743 4.712   234.194 1.00 64.18  ?  403 GLN C NE2 1 
ATOM   10393 N N   . ASP C 1 410 ? 136.416 5.850   236.723 1.00 50.93  ?  404 ASP C N   1 
ATOM   10394 C CA  . ASP C 1 410 ? 135.684 7.109   236.605 1.00 51.07  ?  404 ASP C CA  1 
ATOM   10395 C C   . ASP C 1 410 ? 135.018 7.479   237.925 1.00 51.00  ?  404 ASP C C   1 
ATOM   10396 O O   . ASP C 1 410 ? 135.091 8.631   238.370 1.00 47.82  ?  404 ASP C O   1 
ATOM   10397 C CB  . ASP C 1 410 ? 134.648 7.014   235.484 1.00 56.97  ?  404 ASP C CB  1 
ATOM   10398 C CG  . ASP C 1 410 ? 134.060 8.365   235.119 1.00 66.95  ?  404 ASP C CG  1 
ATOM   10399 O OD1 . ASP C 1 410 ? 134.607 9.396   235.568 1.00 63.12  ?  404 ASP C OD1 1 
ATOM   10400 O OD2 . ASP C 1 410 ? 133.049 8.396   234.385 1.00 64.37  -1 404 ASP C OD2 1 
ATOM   10401 N N   . SER C 1 411 ? 134.364 6.509   238.568 1.00 53.87  ?  405 SER C N   1 
ATOM   10402 C CA  . SER C 1 411 ? 133.777 6.758   239.879 1.00 52.27  ?  405 SER C CA  1 
ATOM   10403 C C   . SER C 1 411 ? 134.849 6.950   240.944 1.00 48.32  ?  405 SER C C   1 
ATOM   10404 O O   . SER C 1 411 ? 134.623 7.661   241.929 1.00 47.64  ?  405 SER C O   1 
ATOM   10405 C CB  . SER C 1 411 ? 132.847 5.607   240.261 1.00 56.76  ?  405 SER C CB  1 
ATOM   10406 O OG  . SER C 1 411 ? 131.702 5.573   239.425 1.00 57.22  ?  405 SER C OG  1 
ATOM   10407 N N   . TRP C 1 412 ? 136.014 6.326   240.760 1.00 46.01  ?  406 TRP C N   1 
ATOM   10408 C CA  . TRP C 1 412 ? 137.113 6.485   241.707 1.00 40.64  ?  406 TRP C CA  1 
ATOM   10409 C C   . TRP C 1 412 ? 137.576 7.934   241.768 1.00 42.70  ?  406 TRP C C   1 
ATOM   10410 O O   . TRP C 1 412 ? 137.672 8.525   242.850 1.00 46.69  ?  406 TRP C O   1 
ATOM   10411 C CB  . TRP C 1 412 ? 138.268 5.567   241.306 1.00 45.50  ?  406 TRP C CB  1 
ATOM   10412 C CG  . TRP C 1 412 ? 139.335 5.397   242.336 1.00 43.56  ?  406 TRP C CG  1 
ATOM   10413 C CD1 . TRP C 1 412 ? 139.348 5.902   243.603 1.00 43.47  ?  406 TRP C CD1 1 
ATOM   10414 C CD2 . TRP C 1 412 ? 140.551 4.658   242.184 1.00 38.20  ?  406 TRP C CD2 1 
ATOM   10415 N NE1 . TRP C 1 412 ? 140.500 5.523   244.250 1.00 39.14  ?  406 TRP C NE1 1 
ATOM   10416 C CE2 . TRP C 1 412 ? 141.255 4.759   243.399 1.00 40.30  ?  406 TRP C CE2 1 
ATOM   10417 C CE3 . TRP C 1 412 ? 141.112 3.922   241.137 1.00 34.20  ?  406 TRP C CE3 1 
ATOM   10418 C CZ2 . TRP C 1 412 ? 142.491 4.149   243.596 1.00 41.90  ?  406 TRP C CZ2 1 
ATOM   10419 C CZ3 . TRP C 1 412 ? 142.339 3.319   241.334 1.00 38.12  ?  406 TRP C CZ3 1 
ATOM   10420 C CH2 . TRP C 1 412 ? 143.016 3.436   242.554 1.00 40.20  ?  406 TRP C CH2 1 
ATOM   10421 N N   . ARG C 1 413 ? 137.866 8.524   240.607 1.00 42.14  ?  407 ARG C N   1 
ATOM   10422 C CA  . ARG C 1 413 ? 138.344 9.901   240.574 1.00 39.07  ?  407 ARG C CA  1 
ATOM   10423 C C   . ARG C 1 413 ? 137.254 10.886  240.972 1.00 42.74  ?  407 ARG C C   1 
ATOM   10424 O O   . ARG C 1 413 ? 137.555 11.944  241.535 1.00 41.76  ?  407 ARG C O   1 
ATOM   10425 C CB  . ARG C 1 413 ? 138.880 10.229  239.181 1.00 40.33  ?  407 ARG C CB  1 
ATOM   10426 C CG  . ARG C 1 413 ? 139.908 9.228   238.680 1.00 40.60  ?  407 ARG C CG  1 
ATOM   10427 C CD  . ARG C 1 413 ? 140.405 9.572   237.288 1.00 38.19  ?  407 ARG C CD  1 
ATOM   10428 N NE  . ARG C 1 413 ? 141.405 8.615   236.824 1.00 32.95  ?  407 ARG C NE  1 
ATOM   10429 C CZ  . ARG C 1 413 ? 142.695 8.674   237.138 1.00 34.92  ?  407 ARG C CZ  1 
ATOM   10430 N NH1 . ARG C 1 413 ? 143.144 9.645   237.921 1.00 39.53  1  407 ARG C NH1 1 
ATOM   10431 N NH2 . ARG C 1 413 ? 143.536 7.761   236.673 1.00 40.73  ?  407 ARG C NH2 1 
ATOM   10432 N N   . ARG C 1 414 ? 135.990 10.561  240.691 1.00 47.83  ?  408 ARG C N   1 
ATOM   10433 C CA  . ARG C 1 414 ? 134.902 11.457  241.066 1.00 49.54  ?  408 ARG C CA  1 
ATOM   10434 C C   . ARG C 1 414 ? 134.737 11.512  242.580 1.00 48.36  ?  408 ARG C C   1 
ATOM   10435 O O   . ARG C 1 414 ? 134.399 12.563  243.138 1.00 42.38  ?  408 ARG C O   1 
ATOM   10436 C CB  . ARG C 1 414 ? 133.601 11.015  240.396 1.00 55.02  ?  408 ARG C CB  1 
ATOM   10437 C CG  . ARG C 1 414 ? 132.480 12.043  240.475 1.00 62.92  ?  408 ARG C CG  1 
ATOM   10438 C CD  . ARG C 1 414 ? 131.183 11.523  239.864 1.00 56.63  ?  408 ARG C CD  1 
ATOM   10439 N NE  . ARG C 1 414 ? 131.348 11.088  238.479 1.00 52.24  ?  408 ARG C NE  1 
ATOM   10440 C CZ  . ARG C 1 414 ? 131.404 9.816   238.096 1.00 46.45  ?  408 ARG C CZ  1 
ATOM   10441 N NH1 . ARG C 1 414 ? 131.303 8.847   238.995 1.00 42.31  1  408 ARG C NH1 1 
ATOM   10442 N NH2 . ARG C 1 414 ? 131.556 9.513   236.815 1.00 43.82  ?  408 ARG C NH2 1 
ATOM   10443 N N   . ALA C 1 415 ? 134.976 10.389  243.260 1.00 46.72  ?  409 ALA C N   1 
ATOM   10444 C CA  . ALA C 1 415 ? 134.904 10.375  244.716 1.00 43.55  ?  409 ALA C CA  1 
ATOM   10445 C C   . ALA C 1 415 ? 136.106 11.080  245.333 1.00 42.13  ?  409 ALA C C   1 
ATOM   10446 O O   . ALA C 1 415 ? 135.976 11.764  246.355 1.00 38.86  ?  409 ALA C O   1 
ATOM   10447 C CB  . ALA C 1 415 ? 134.803 8.937   245.222 1.00 36.18  ?  409 ALA C CB  1 
ATOM   10448 N N   . VAL C 1 416 ? 137.284 10.927  244.724 1.00 39.57  ?  410 VAL C N   1 
ATOM   10449 C CA  . VAL C 1 416 ? 138.474 11.600  245.233 1.00 40.47  ?  410 VAL C CA  1 
ATOM   10450 C C   . VAL C 1 416 ? 138.360 13.106  245.043 1.00 44.08  ?  410 VAL C C   1 
ATOM   10451 O O   . VAL C 1 416 ? 138.670 13.884  245.953 1.00 48.37  ?  410 VAL C O   1 
ATOM   10452 C CB  . VAL C 1 416 ? 139.737 11.035  244.557 1.00 38.63  ?  410 VAL C CB  1 
ATOM   10453 C CG1 . VAL C 1 416 ? 140.960 11.846  244.953 1.00 35.68  ?  410 VAL C CG1 1 
ATOM   10454 C CG2 . VAL C 1 416 ? 139.924 9.572   244.929 1.00 41.38  ?  410 VAL C CG2 1 
ATOM   10455 N N   . SER C 1 417 ? 137.904 13.542  243.865 1.00 40.75  ?  411 SER C N   1 
ATOM   10456 C CA  . SER C 1 417 ? 137.792 14.973  243.597 1.00 39.77  ?  411 SER C CA  1 
ATOM   10457 C C   . SER C 1 417 ? 136.782 15.635  244.526 1.00 48.44  ?  411 SER C C   1 
ATOM   10458 O O   . SER C 1 417 ? 137.000 16.760  244.992 1.00 50.38  ?  411 SER C O   1 
ATOM   10459 C CB  . SER C 1 417 ? 137.405 15.203  242.136 1.00 43.80  ?  411 SER C CB  1 
ATOM   10460 O OG  . SER C 1 417 ? 138.346 14.611  241.257 1.00 49.80  ?  411 SER C OG  1 
ATOM   10461 N N   . THR C 1 418 ? 135.671 14.951  244.808 1.00 49.53  ?  412 THR C N   1 
ATOM   10462 C CA  . THR C 1 418 ? 134.660 15.521  245.692 1.00 47.42  ?  412 THR C CA  1 
ATOM   10463 C C   . THR C 1 418 ? 135.167 15.610  247.127 1.00 47.92  ?  412 THR C C   1 
ATOM   10464 O O   . THR C 1 418 ? 134.964 16.627  247.801 1.00 47.73  ?  412 THR C O   1 
ATOM   10465 C CB  . THR C 1 418 ? 133.378 14.693  245.627 1.00 42.20  ?  412 THR C CB  1 
ATOM   10466 O OG1 . THR C 1 418 ? 132.933 14.602  244.268 1.00 48.25  ?  412 THR C OG1 1 
ATOM   10467 C CG2 . THR C 1 418 ? 132.284 15.332  246.470 1.00 39.15  ?  412 THR C CG2 1 
ATOM   10468 N N   . GLY C 1 419 ? 135.833 14.558  247.609 1.00 41.71  ?  413 GLY C N   1 
ATOM   10469 C CA  . GLY C 1 419 ? 136.368 14.586  248.959 1.00 40.83  ?  413 GLY C CA  1 
ATOM   10470 C C   . GLY C 1 419 ? 137.460 15.618  249.148 1.00 44.65  ?  413 GLY C C   1 
ATOM   10471 O O   . GLY C 1 419 ? 137.631 16.150  250.249 1.00 42.56  ?  413 GLY C O   1 
ATOM   10472 N N   . VAL C 1 420 ? 138.212 15.915  248.086 1.00 48.42  ?  414 VAL C N   1 
ATOM   10473 C CA  . VAL C 1 420 ? 139.237 16.950  248.165 1.00 45.69  ?  414 VAL C CA  1 
ATOM   10474 C C   . VAL C 1 420 ? 138.597 18.323  248.333 1.00 47.12  ?  414 VAL C C   1 
ATOM   10475 O O   . VAL C 1 420 ? 139.041 19.134  249.155 1.00 47.84  ?  414 VAL C O   1 
ATOM   10476 C CB  . VAL C 1 420 ? 140.148 16.892  246.924 1.00 43.02  ?  414 VAL C CB  1 
ATOM   10477 C CG1 . VAL C 1 420 ? 140.958 18.170  246.793 1.00 39.41  ?  414 VAL C CG1 1 
ATOM   10478 C CG2 . VAL C 1 420 ? 141.073 15.686  247.003 1.00 39.49  ?  414 VAL C CG2 1 
ATOM   10479 N N   . GLN C 1 421 ? 137.541 18.604  247.566 1.00 45.95  ?  415 GLN C N   1 
ATOM   10480 C CA  . GLN C 1 421 ? 136.854 19.884  247.700 1.00 45.38  ?  415 GLN C CA  1 
ATOM   10481 C C   . GLN C 1 421 ? 136.063 19.967  248.999 1.00 52.31  ?  415 GLN C C   1 
ATOM   10482 O O   . GLN C 1 421 ? 135.842 21.067  249.519 1.00 52.78  ?  415 GLN C O   1 
ATOM   10483 C CB  . GLN C 1 421 ? 135.933 20.116  246.502 1.00 43.08  ?  415 GLN C CB  1 
ATOM   10484 C CG  . GLN C 1 421 ? 136.664 20.433  245.208 1.00 49.59  ?  415 GLN C CG  1 
ATOM   10485 C CD  . GLN C 1 421 ? 137.363 21.781  245.245 1.00 57.73  ?  415 GLN C CD  1 
ATOM   10486 O OE1 . GLN C 1 421 ? 137.081 22.620  246.102 1.00 49.32  ?  415 GLN C OE1 1 
ATOM   10487 N NE2 . GLN C 1 421 ? 138.283 21.995  244.311 1.00 59.04  ?  415 GLN C NE2 1 
ATOM   10488 N N   . ALA C 1 422 ? 135.631 18.825  249.536 1.00 46.81  ?  416 ALA C N   1 
ATOM   10489 C CA  . ALA C 1 422 ? 134.901 18.812  250.797 1.00 43.70  ?  416 ALA C CA  1 
ATOM   10490 C C   . ALA C 1 422 ? 135.816 18.932  252.008 1.00 51.00  ?  416 ALA C C   1 
ATOM   10491 O O   . ALA C 1 422 ? 135.332 19.230  253.105 1.00 53.42  ?  416 ALA C O   1 
ATOM   10492 C CB  . ALA C 1 422 ? 134.068 17.535  250.914 1.00 45.91  ?  416 ALA C CB  1 
ATOM   10493 N N   . GLY C 1 423 ? 137.114 18.711  251.837 1.00 46.58  ?  417 GLY C N   1 
ATOM   10494 C CA  . GLY C 1 423 ? 138.035 18.773  252.955 1.00 46.10  ?  417 GLY C CA  1 
ATOM   10495 C C   . GLY C 1 423 ? 138.015 17.549  253.841 1.00 46.16  ?  417 GLY C C   1 
ATOM   10496 O O   . GLY C 1 423 ? 138.171 17.668  255.063 1.00 49.36  ?  417 GLY C O   1 
ATOM   10497 N N   . ILE C 1 424 ? 137.828 16.373  253.261 1.00 41.00  ?  418 ILE C N   1 
ATOM   10498 C CA  . ILE C 1 424 ? 137.764 15.119  254.008 1.00 40.57  ?  418 ILE C CA  1 
ATOM   10499 C C   . ILE C 1 424 ? 139.094 14.394  253.836 1.00 37.84  ?  418 ILE C C   1 
ATOM   10500 O O   . ILE C 1 424 ? 139.540 14.213  252.695 1.00 39.46  ?  418 ILE C O   1 
ATOM   10501 C CB  . ILE C 1 424 ? 136.596 14.237  253.533 1.00 46.81  ?  418 ILE C CB  1 
ATOM   10502 C CG1 . ILE C 1 424 ? 135.296 15.043  253.526 1.00 50.58  ?  418 ILE C CG1 1 
ATOM   10503 C CG2 . ILE C 1 424 ? 136.460 13.009  254.419 1.00 47.51  ?  418 ILE C CG2 1 
ATOM   10504 C CD1 . ILE C 1 424 ? 134.971 15.685  254.857 1.00 45.92  ?  418 ILE C CD1 1 
ATOM   10505 N N   . PRO C 1 425 ? 139.750 13.974  254.919 1.00 33.99  ?  419 PRO C N   1 
ATOM   10506 C CA  . PRO C 1 425 ? 141.032 13.266  254.785 1.00 29.17  ?  419 PRO C CA  1 
ATOM   10507 C C   . PRO C 1 425 ? 140.831 11.898  254.151 1.00 37.03  ?  419 PRO C C   1 
ATOM   10508 O O   . PRO C 1 425 ? 140.116 11.048  254.687 1.00 40.61  ?  419 PRO C O   1 
ATOM   10509 C CB  . PRO C 1 425 ? 141.529 13.155  256.231 1.00 28.55  ?  419 PRO C CB  1 
ATOM   10510 C CG  . PRO C 1 425 ? 140.290 13.231  257.060 1.00 29.66  ?  419 PRO C CG  1 
ATOM   10511 C CD  . PRO C 1 425 ? 139.364 14.160  256.328 1.00 37.59  ?  419 PRO C CD  1 
ATOM   10512 N N   . MET C 1 426 ? 141.465 11.692  252.999 1.00 34.50  ?  420 MET C N   1 
ATOM   10513 C CA  . MET C 1 426 ? 141.423 10.419  252.280 1.00 35.10  ?  420 MET C CA  1 
ATOM   10514 C C   . MET C 1 426 ? 142.850 9.980   251.983 1.00 36.81  ?  420 MET C C   1 
ATOM   10515 O O   . MET C 1 426 ? 143.277 9.946   250.823 1.00 36.20  ?  420 MET C O   1 
ATOM   10516 C CB  . MET C 1 426 ? 140.607 10.547  250.993 1.00 41.01  ?  420 MET C CB  1 
ATOM   10517 C CG  . MET C 1 426 ? 139.174 10.998  251.214 1.00 40.89  ?  420 MET C CG  1 
ATOM   10518 S SD  . MET C 1 426 ? 138.443 11.681  249.716 1.00 42.40  ?  420 MET C SD  1 
ATOM   10519 C CE  . MET C 1 426 ? 138.706 10.330  248.575 1.00 41.72  ?  420 MET C CE  1 
ATOM   10520 N N   . PRO C 1 427 ? 143.620 9.631   253.018 1.00 34.07  ?  421 PRO C N   1 
ATOM   10521 C CA  . PRO C 1 427 ? 145.033 9.301   252.784 1.00 32.69  ?  421 PRO C CA  1 
ATOM   10522 C C   . PRO C 1 427 ? 145.234 8.021   251.994 1.00 32.67  ?  421 PRO C C   1 
ATOM   10523 O O   . PRO C 1 427 ? 146.212 7.923   251.243 1.00 37.35  ?  421 PRO C O   1 
ATOM   10524 C CB  . PRO C 1 427 ? 145.602 9.188   254.204 1.00 31.59  ?  421 PRO C CB  1 
ATOM   10525 C CG  . PRO C 1 427 ? 144.439 8.790   255.035 1.00 33.34  ?  421 PRO C CG  1 
ATOM   10526 C CD  . PRO C 1 427 ? 143.251 9.492   254.438 1.00 36.44  ?  421 PRO C CD  1 
ATOM   10527 N N   . CYS C 1 428 ? 144.342 7.040   252.131 1.00 32.67  ?  422 CYS C N   1 
ATOM   10528 C CA  . CYS C 1 428 ? 144.497 5.779   251.416 1.00 39.10  ?  422 CYS C CA  1 
ATOM   10529 C C   . CYS C 1 428 ? 143.825 5.783   250.050 1.00 39.02  ?  422 CYS C C   1 
ATOM   10530 O O   . CYS C 1 428 ? 144.321 5.127   249.126 1.00 41.32  ?  422 CYS C O   1 
ATOM   10531 C CB  . CYS C 1 428 ? 143.951 4.623   252.257 1.00 42.41  ?  422 CYS C CB  1 
ATOM   10532 S SG  . CYS C 1 428 ? 145.013 4.164   253.644 1.00 39.20  ?  422 CYS C SG  1 
ATOM   10533 N N   . PHE C 1 429 ? 142.706 6.496   249.897 1.00 38.17  ?  423 PHE C N   1 
ATOM   10534 C CA  . PHE C 1 429 ? 142.108 6.640   248.574 1.00 37.33  ?  423 PHE C CA  1 
ATOM   10535 C C   . PHE C 1 429 ? 143.033 7.405   247.638 1.00 37.18  ?  423 PHE C C   1 
ATOM   10536 O O   . PHE C 1 429 ? 143.176 7.048   246.462 1.00 41.72  ?  423 PHE C O   1 
ATOM   10537 C CB  . PHE C 1 429 ? 140.757 7.348   248.675 1.00 39.54  ?  423 PHE C CB  1 
ATOM   10538 C CG  . PHE C 1 429 ? 139.622 6.448   249.071 1.00 40.51  ?  423 PHE C CG  1 
ATOM   10539 C CD1 . PHE C 1 429 ? 139.737 5.074   248.966 1.00 41.10  ?  423 PHE C CD1 1 
ATOM   10540 C CD2 . PHE C 1 429 ? 138.433 6.982   249.539 1.00 40.01  ?  423 PHE C CD2 1 
ATOM   10541 C CE1 . PHE C 1 429 ? 138.688 4.248   249.328 1.00 41.39  ?  423 PHE C CE1 1 
ATOM   10542 C CE2 . PHE C 1 429 ? 137.383 6.163   249.901 1.00 39.60  ?  423 PHE C CE2 1 
ATOM   10543 C CZ  . PHE C 1 429 ? 137.511 4.794   249.796 1.00 37.67  ?  423 PHE C CZ  1 
ATOM   10544 N N   . THR C 1 430 ? 143.674 8.459   248.144 1.00 33.06  ?  424 THR C N   1 
ATOM   10545 C CA  . THR C 1 430 ? 144.529 9.281   247.295 1.00 30.08  ?  424 THR C CA  1 
ATOM   10546 C C   . THR C 1 430 ? 145.834 8.570   246.961 1.00 31.38  ?  424 THR C C   1 
ATOM   10547 O O   . THR C 1 430 ? 146.356 8.713   245.850 1.00 33.91  ?  424 THR C O   1 
ATOM   10548 C CB  . THR C 1 430 ? 144.807 10.622  247.973 1.00 30.33  ?  424 THR C CB  1 
ATOM   10549 O OG1 . THR C 1 430 ? 145.236 10.400  249.322 1.00 33.96  ?  424 THR C OG1 1 
ATOM   10550 C CG2 . THR C 1 430 ? 143.555 11.486  247.976 1.00 31.69  ?  424 THR C CG2 1 
ATOM   10551 N N   . THR C 1 431 ? 146.381 7.801   247.906 1.00 31.75  ?  425 THR C N   1 
ATOM   10552 C CA  . THR C 1 431 ? 147.649 7.130   247.643 1.00 35.45  ?  425 THR C CA  1 
ATOM   10553 C C   . THR C 1 431 ? 147.465 5.929   246.726 1.00 31.47  ?  425 THR C C   1 
ATOM   10554 O O   . THR C 1 431 ? 148.404 5.540   246.022 1.00 35.42  ?  425 THR C O   1 
ATOM   10555 C CB  . THR C 1 431 ? 148.318 6.707   248.954 1.00 35.60  ?  425 THR C CB  1 
ATOM   10556 O OG1 . THR C 1 431 ? 149.669 6.309   248.691 1.00 32.04  ?  425 THR C OG1 1 
ATOM   10557 C CG2 . THR C 1 431 ? 147.578 5.545   249.593 1.00 28.62  ?  425 THR C CG2 1 
ATOM   10558 N N   . ALA C 1 432 ? 146.271 5.334   246.712 1.00 30.40  ?  426 ALA C N   1 
ATOM   10559 C CA  . ALA C 1 432 ? 146.012 4.233   245.794 1.00 31.45  ?  426 ALA C CA  1 
ATOM   10560 C C   . ALA C 1 432 ? 145.799 4.742   244.375 1.00 32.63  ?  426 ALA C C   1 
ATOM   10561 O O   . ALA C 1 432 ? 146.208 4.089   243.409 1.00 35.70  ?  426 ALA C O   1 
ATOM   10562 C CB  . ALA C 1 432 ? 144.803 3.426   246.267 1.00 29.83  ?  426 ALA C CB  1 
ATOM   10563 N N   . LEU C 1 433 ? 145.172 5.912   244.234 1.00 29.10  ?  427 LEU C N   1 
ATOM   10564 C CA  . LEU C 1 433 ? 144.992 6.499   242.912 1.00 31.82  ?  427 LEU C CA  1 
ATOM   10565 C C   . LEU C 1 433 ? 146.299 7.073   242.383 1.00 33.71  ?  427 LEU C C   1 
ATOM   10566 O O   . LEU C 1 433 ? 146.591 6.968   241.186 1.00 35.55  ?  427 LEU C O   1 
ATOM   10567 C CB  . LEU C 1 433 ? 143.909 7.575   242.962 1.00 34.07  ?  427 LEU C CB  1 
ATOM   10568 C CG  . LEU C 1 433 ? 143.525 8.216   241.629 1.00 35.09  ?  427 LEU C CG  1 
ATOM   10569 C CD1 . LEU C 1 433 ? 143.128 7.151   240.620 1.00 34.51  ?  427 LEU C CD1 1 
ATOM   10570 C CD2 . LEU C 1 433 ? 142.395 9.207   241.834 1.00 32.49  ?  427 LEU C CD2 1 
ATOM   10571 N N   . SER C 1 434 ? 147.100 7.684   243.260 1.00 32.96  ?  428 SER C N   1 
ATOM   10572 C CA  . SER C 1 434 ? 148.395 8.204   242.836 1.00 31.94  ?  428 SER C CA  1 
ATOM   10573 C C   . SER C 1 434 ? 149.340 7.074   242.448 1.00 29.84  ?  428 SER C C   1 
ATOM   10574 O O   . SER C 1 434 ? 150.130 7.213   241.506 1.00 29.57  ?  428 SER C O   1 
ATOM   10575 C CB  . SER C 1 434 ? 149.004 9.062   243.944 1.00 37.26  ?  428 SER C CB  1 
ATOM   10576 O OG  . SER C 1 434 ? 148.168 10.165  244.251 1.00 38.32  ?  428 SER C OG  1 
ATOM   10577 N N   . PHE C 1 435 ? 149.276 5.948   243.162 1.00 33.43  ?  429 PHE C N   1 
ATOM   10578 C CA  . PHE C 1 435 ? 150.097 4.798   242.798 1.00 31.61  ?  429 PHE C CA  1 
ATOM   10579 C C   . PHE C 1 435 ? 149.658 4.211   241.464 1.00 35.69  ?  429 PHE C C   1 
ATOM   10580 O O   . PHE C 1 435 ? 150.499 3.833   240.640 1.00 37.28  ?  429 PHE C O   1 
ATOM   10581 C CB  . PHE C 1 435 ? 150.035 3.736   243.897 1.00 30.00  ?  429 PHE C CB  1 
ATOM   10582 C CG  . PHE C 1 435 ? 150.717 2.445   243.534 1.00 30.94  ?  429 PHE C CG  1 
ATOM   10583 C CD1 . PHE C 1 435 ? 152.082 2.293   243.715 1.00 29.02  ?  429 PHE C CD1 1 
ATOM   10584 C CD2 . PHE C 1 435 ? 149.993 1.382   243.019 1.00 31.26  ?  429 PHE C CD2 1 
ATOM   10585 C CE1 . PHE C 1 435 ? 152.711 1.107   243.384 1.00 31.29  ?  429 PHE C CE1 1 
ATOM   10586 C CE2 . PHE C 1 435 ? 150.616 0.194   242.686 1.00 31.58  ?  429 PHE C CE2 1 
ATOM   10587 C CZ  . PHE C 1 435 ? 151.977 0.056   242.870 1.00 31.69  ?  429 PHE C CZ  1 
ATOM   10588 N N   . TYR C 1 436 ? 148.346 4.124   241.235 1.00 38.99  ?  430 TYR C N   1 
ATOM   10589 C CA  . TYR C 1 436 ? 147.848 3.560   239.984 1.00 32.71  ?  430 TYR C CA  1 
ATOM   10590 C C   . TYR C 1 436 ? 148.266 4.414   238.795 1.00 31.33  ?  430 TYR C C   1 
ATOM   10591 O O   . TYR C 1 436 ? 148.742 3.894   237.779 1.00 33.54  ?  430 TYR C O   1 
ATOM   10592 C CB  . TYR C 1 436 ? 146.327 3.416   240.040 1.00 34.05  ?  430 TYR C CB  1 
ATOM   10593 C CG  . TYR C 1 436 ? 145.723 2.903   238.752 1.00 40.52  ?  430 TYR C CG  1 
ATOM   10594 C CD1 . TYR C 1 436 ? 145.856 1.570   238.384 1.00 41.56  ?  430 TYR C CD1 1 
ATOM   10595 C CD2 . TYR C 1 436 ? 145.021 3.751   237.904 1.00 35.83  ?  430 TYR C CD2 1 
ATOM   10596 C CE1 . TYR C 1 436 ? 145.309 1.095   237.208 1.00 39.48  ?  430 TYR C CE1 1 
ATOM   10597 C CE2 . TYR C 1 436 ? 144.470 3.284   236.725 1.00 41.29  ?  430 TYR C CE2 1 
ATOM   10598 C CZ  . TYR C 1 436 ? 144.616 1.956   236.383 1.00 43.37  ?  430 TYR C CZ  1 
ATOM   10599 O OH  . TYR C 1 436 ? 144.070 1.485   235.211 1.00 55.58  ?  430 TYR C OH  1 
ATOM   10600 N N   . ASP C 1 437 ? 148.102 5.735   238.905 1.00 29.09  ?  431 ASP C N   1 
ATOM   10601 C CA  . ASP C 1 437 ? 148.497 6.618   237.814 1.00 32.79  ?  431 ASP C CA  1 
ATOM   10602 C C   . ASP C 1 437 ? 150.010 6.651   237.633 1.00 38.75  ?  431 ASP C C   1 
ATOM   10603 O O   . ASP C 1 437 ? 150.494 6.932   236.531 1.00 43.54  ?  431 ASP C O   1 
ATOM   10604 C CB  . ASP C 1 437 ? 147.958 8.028   238.057 1.00 35.62  ?  431 ASP C CB  1 
ATOM   10605 C CG  . ASP C 1 437 ? 146.443 8.090   238.002 1.00 38.44  ?  431 ASP C CG  1 
ATOM   10606 O OD1 . ASP C 1 437 ? 145.839 7.284   237.264 1.00 38.16  ?  431 ASP C OD1 1 
ATOM   10607 O OD2 . ASP C 1 437 ? 145.856 8.946   238.697 1.00 40.88  -1 431 ASP C OD2 1 
ATOM   10608 N N   . GLY C 1 438 ? 150.768 6.370   238.690 1.00 36.68  ?  432 GLY C N   1 
ATOM   10609 C CA  . GLY C 1 438 ? 152.213 6.340   238.590 1.00 30.87  ?  432 GLY C CA  1 
ATOM   10610 C C   . GLY C 1 438 ? 152.735 5.029   238.041 1.00 37.98  ?  432 GLY C C   1 
ATOM   10611 O O   . GLY C 1 438 ? 153.697 5.008   237.267 1.00 40.38  ?  432 GLY C O   1 
ATOM   10612 N N   . TYR C 1 439 ? 152.102 3.923   238.438 1.00 38.14  ?  433 TYR C N   1 
ATOM   10613 C CA  . TYR C 1 439 ? 152.510 2.610   237.953 1.00 37.16  ?  433 TYR C CA  1 
ATOM   10614 C C   . TYR C 1 439 ? 152.121 2.384   236.499 1.00 41.78  ?  433 TYR C C   1 
ATOM   10615 O O   . TYR C 1 439 ? 152.749 1.563   235.823 1.00 47.17  ?  433 TYR C O   1 
ATOM   10616 C CB  . TYR C 1 439 ? 151.902 1.518   238.838 1.00 35.45  ?  433 TYR C CB  1 
ATOM   10617 C CG  . TYR C 1 439 ? 152.260 0.106   238.430 1.00 39.98  ?  433 TYR C CG  1 
ATOM   10618 C CD1 . TYR C 1 439 ? 153.540 -0.394  238.634 1.00 43.66  ?  433 TYR C CD1 1 
ATOM   10619 C CD2 . TYR C 1 439 ? 151.313 -0.732  237.856 1.00 40.57  ?  433 TYR C CD2 1 
ATOM   10620 C CE1 . TYR C 1 439 ? 153.870 -1.685  238.266 1.00 45.98  ?  433 TYR C CE1 1 
ATOM   10621 C CE2 . TYR C 1 439 ? 151.633 -2.026  237.488 1.00 42.91  ?  433 TYR C CE2 1 
ATOM   10622 C CZ  . TYR C 1 439 ? 152.913 -2.496  237.694 1.00 41.19  ?  433 TYR C CZ  1 
ATOM   10623 O OH  . TYR C 1 439 ? 153.237 -3.783  237.328 1.00 41.85  ?  433 TYR C OH  1 
ATOM   10624 N N   . ARG C 1 440 ? 151.111 3.096   236.001 1.00 42.97  ?  434 ARG C N   1 
ATOM   10625 C CA  . ARG C 1 440 ? 150.654 2.938   234.628 1.00 38.87  ?  434 ARG C CA  1 
ATOM   10626 C C   . ARG C 1 440 ? 151.340 3.885   233.653 1.00 48.73  ?  434 ARG C C   1 
ATOM   10627 O O   . ARG C 1 440 ? 151.199 3.705   232.439 1.00 58.70  ?  434 ARG C O   1 
ATOM   10628 C CB  . ARG C 1 440 ? 149.139 3.151   234.549 1.00 35.80  ?  434 ARG C CB  1 
ATOM   10629 C CG  . ARG C 1 440 ? 148.719 4.600   234.719 1.00 40.45  ?  434 ARG C CG  1 
ATOM   10630 C CD  . ARG C 1 440 ? 147.212 4.757   234.637 1.00 45.99  ?  434 ARG C CD  1 
ATOM   10631 N NE  . ARG C 1 440 ? 146.805 6.151   234.783 1.00 42.23  ?  434 ARG C NE  1 
ATOM   10632 C CZ  . ARG C 1 440 ? 146.866 7.049   233.806 1.00 41.90  ?  434 ARG C CZ  1 
ATOM   10633 N NH1 . ARG C 1 440 ? 147.325 6.700   232.612 1.00 49.37  1  434 ARG C NH1 1 
ATOM   10634 N NH2 . ARG C 1 440 ? 146.474 8.297   234.023 1.00 37.67  ?  434 ARG C NH2 1 
ATOM   10635 N N   . HIS C 1 441 ? 152.067 4.886   234.145 1.00 46.63  ?  435 HIS C N   1 
ATOM   10636 C CA  . HIS C 1 441 ? 152.744 5.838   233.274 1.00 48.07  ?  435 HIS C CA  1 
ATOM   10637 C C   . HIS C 1 441 ? 154.093 5.277   232.842 1.00 49.36  ?  435 HIS C C   1 
ATOM   10638 O O   . HIS C 1 441 ? 154.918 4.908   233.684 1.00 46.13  ?  435 HIS C O   1 
ATOM   10639 C CB  . HIS C 1 441 ? 152.927 7.179   233.982 1.00 42.11  ?  435 HIS C CB  1 
ATOM   10640 C CG  . HIS C 1 441 ? 151.824 8.157   233.724 1.00 43.72  ?  435 HIS C CG  1 
ATOM   10641 N ND1 . HIS C 1 441 ? 150.548 7.988   234.216 1.00 48.83  ?  435 HIS C ND1 1 
ATOM   10642 C CD2 . HIS C 1 441 ? 151.809 9.317   233.027 1.00 47.95  ?  435 HIS C CD2 1 
ATOM   10643 C CE1 . HIS C 1 441 ? 149.793 9.002   233.831 1.00 47.02  ?  435 HIS C CE1 1 
ATOM   10644 N NE2 . HIS C 1 441 ? 150.534 9.823   233.109 1.00 50.55  ?  435 HIS C NE2 1 
ATOM   10645 N N   . GLU C 1 442 ? 154.317 5.214   231.527 1.00 50.92  ?  436 GLU C N   1 
ATOM   10646 C CA  . GLU C 1 442 ? 155.621 4.794   231.026 1.00 55.45  ?  436 GLU C CA  1 
ATOM   10647 C C   . GLU C 1 442 ? 156.691 5.827   231.355 1.00 48.83  ?  436 GLU C C   1 
ATOM   10648 O O   . GLU C 1 442 ? 157.838 5.470   231.649 1.00 48.00  ?  436 GLU C O   1 
ATOM   10649 C CB  . GLU C 1 442 ? 155.552 4.553   229.518 1.00 67.13  ?  436 GLU C CB  1 
ATOM   10650 C CG  . GLU C 1 442 ? 156.857 4.070   228.904 1.00 70.21  ?  436 GLU C CG  1 
ATOM   10651 C CD  . GLU C 1 442 ? 156.781 3.945   227.395 1.00 84.20  ?  436 GLU C CD  1 
ATOM   10652 O OE1 . GLU C 1 442 ? 155.769 4.386   226.811 1.00 97.42  ?  436 GLU C OE1 1 
ATOM   10653 O OE2 . GLU C 1 442 ? 157.733 3.406   226.792 1.00 81.60  -1 436 GLU C OE2 1 
ATOM   10654 N N   . MET C 1 443 ? 156.333 7.108   231.322 1.00 50.74  ?  437 MET C N   1 
ATOM   10655 C CA  . MET C 1 443 ? 157.254 8.202   231.604 1.00 43.82  ?  437 MET C CA  1 
ATOM   10656 C C   . MET C 1 443 ? 156.790 8.926   232.859 1.00 47.58  ?  437 MET C C   1 
ATOM   10657 O O   . MET C 1 443 ? 155.662 9.431   232.907 1.00 46.62  ?  437 MET C O   1 
ATOM   10658 C CB  . MET C 1 443 ? 157.334 9.171   230.422 1.00 46.71  ?  437 MET C CB  1 
ATOM   10659 C CG  . MET C 1 443 ? 157.797 8.529   229.126 1.00 49.33  ?  437 MET C CG  1 
ATOM   10660 S SD  . MET C 1 443 ? 159.472 7.873   229.240 1.00 66.65  ?  437 MET C SD  1 
ATOM   10661 C CE  . MET C 1 443 ? 159.627 7.067   227.648 1.00 67.44  ?  437 MET C CE  1 
ATOM   10662 N N   . LEU C 1 444 ? 157.654 8.974   233.864 1.00 44.39  ?  438 LEU C N   1 
ATOM   10663 C CA  . LEU C 1 444 ? 157.400 9.657   235.120 1.00 40.04  ?  438 LEU C CA  1 
ATOM   10664 C C   . LEU C 1 444 ? 158.394 10.797  235.302 1.00 38.71  ?  438 LEU C C   1 
ATOM   10665 O O   . LEU C 1 444 ? 159.493 10.770  234.735 1.00 38.28  ?  438 LEU C O   1 
ATOM   10666 C CB  . LEU C 1 444 ? 157.496 8.681   236.302 1.00 36.10  ?  438 LEU C CB  1 
ATOM   10667 C CG  . LEU C 1 444 ? 156.287 7.763   236.492 1.00 36.64  ?  438 LEU C CG  1 
ATOM   10668 C CD1 . LEU C 1 444 ? 156.470 6.875   237.710 1.00 35.71  ?  438 LEU C CD1 1 
ATOM   10669 C CD2 . LEU C 1 444 ? 155.013 8.585   236.612 1.00 38.25  ?  438 LEU C CD2 1 
ATOM   10670 N N   . PRO C 1 445 ? 158.041 11.824  236.090 1.00 36.83  ?  439 PRO C N   1 
ATOM   10671 C CA  . PRO C 1 445 ? 158.942 12.977  236.240 1.00 33.56  ?  439 PRO C CA  1 
ATOM   10672 C C   . PRO C 1 445 ? 160.178 12.681  237.076 1.00 37.96  ?  439 PRO C C   1 
ATOM   10673 O O   . PRO C 1 445 ? 160.917 13.602  237.437 1.00 44.47  ?  439 PRO C O   1 
ATOM   10674 C CB  . PRO C 1 445 ? 158.051 14.025  236.918 1.00 32.32  ?  439 PRO C CB  1 
ATOM   10675 C CG  . PRO C 1 445 ? 157.049 13.223  237.669 1.00 31.83  ?  439 PRO C CG  1 
ATOM   10676 C CD  . PRO C 1 445 ? 156.769 12.026  236.806 1.00 39.47  ?  439 PRO C CD  1 
ATOM   10677 N N   . ALA C 1 446 ? 160.420 11.405  237.387 1.00 38.25  ?  440 ALA C N   1 
ATOM   10678 C CA  . ALA C 1 446 ? 161.599 11.042  238.164 1.00 41.34  ?  440 ALA C CA  1 
ATOM   10679 C C   . ALA C 1 446 ? 162.894 11.281  237.401 1.00 42.42  ?  440 ALA C C   1 
ATOM   10680 O O   . ALA C 1 446 ? 163.962 11.328  238.022 1.00 39.39  ?  440 ALA C O   1 
ATOM   10681 C CB  . ALA C 1 446 ? 161.520 9.581   238.595 1.00 36.46  ?  440 ALA C CB  1 
ATOM   10682 N N   . SER C 1 447 ? 162.828 11.421  236.074 1.00 39.74  ?  441 SER C N   1 
ATOM   10683 C CA  . SER C 1 447 ? 164.016 11.789  235.314 1.00 33.88  ?  441 SER C CA  1 
ATOM   10684 C C   . SER C 1 447 ? 164.549 13.146  235.747 1.00 37.83  ?  441 SER C C   1 
ATOM   10685 O O   . SER C 1 447 ? 165.755 13.402  235.648 1.00 42.17  ?  441 SER C O   1 
ATOM   10686 C CB  . SER C 1 447 ? 163.704 11.794  233.818 1.00 40.50  ?  441 SER C CB  1 
ATOM   10687 O OG  . SER C 1 447 ? 162.677 12.722  233.517 1.00 40.92  ?  441 SER C OG  1 
ATOM   10688 N N   . LEU C 1 448 ? 163.669 14.024  236.233 1.00 36.03  ?  442 LEU C N   1 
ATOM   10689 C CA  . LEU C 1 448 ? 164.117 15.314  236.746 1.00 38.26  ?  442 LEU C CA  1 
ATOM   10690 C C   . LEU C 1 448 ? 164.919 15.146  238.030 1.00 40.88  ?  442 LEU C C   1 
ATOM   10691 O O   . LEU C 1 448 ? 165.879 15.888  238.268 1.00 41.48  ?  442 LEU C O   1 
ATOM   10692 C CB  . LEU C 1 448 ? 162.915 16.232  236.970 1.00 37.41  ?  442 LEU C CB  1 
ATOM   10693 C CG  . LEU C 1 448 ? 163.207 17.658  237.439 1.00 36.81  ?  442 LEU C CG  1 
ATOM   10694 C CD1 . LEU C 1 448 ? 164.147 18.357  236.472 1.00 33.46  ?  442 LEU C CD1 1 
ATOM   10695 C CD2 . LEU C 1 448 ? 161.915 18.445  237.596 1.00 34.07  ?  442 LEU C CD2 1 
ATOM   10696 N N   . ILE C 1 449 ? 164.548 14.172  238.868 1.00 38.12  ?  443 ILE C N   1 
ATOM   10697 C CA  . ILE C 1 449 ? 165.303 13.915  240.092 1.00 38.35  ?  443 ILE C CA  1 
ATOM   10698 C C   . ILE C 1 449 ? 166.723 13.472  239.762 1.00 36.71  ?  443 ILE C C   1 
ATOM   10699 O O   . ILE C 1 449 ? 167.693 13.941  240.369 1.00 44.00  ?  443 ILE C O   1 
ATOM   10700 C CB  . ILE C 1 449 ? 164.574 12.878  240.968 1.00 43.91  ?  443 ILE C CB  1 
ATOM   10701 C CG1 . ILE C 1 449 ? 163.471 13.550  241.787 1.00 37.52  ?  443 ILE C CG1 1 
ATOM   10702 C CG2 . ILE C 1 449 ? 165.553 12.160  241.889 1.00 34.49  ?  443 ILE C CG2 1 
ATOM   10703 C CD1 . ILE C 1 449 ? 162.712 12.602  242.688 1.00 42.66  ?  443 ILE C CD1 1 
ATOM   10704 N N   . GLN C 1 450 ? 166.869 12.564  238.794 1.00 38.22  ?  444 GLN C N   1 
ATOM   10705 C CA  . GLN C 1 450 ? 168.203 12.128  2