data_5V09
# 
_entry.id   5V09 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.285 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5V09         
WWPDB D_1000226692 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 5UZV unspecified 
PDB . 5V04 unspecified 
PDB . 5V05 unspecified 
PDB . 5V06 unspecified 
PDB . 5V07 unspecified 
PDB . 5V08 unspecified 
PDB . 5V0A unspecified 
PDB . 5V0B unspecified 
PDB . 5V0C unspecified 
PDB . 5V0D unspecified 
PDB . 5V0E unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5V09 
_pdbx_database_status.recvd_initial_deposition_date   2017-02-28 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Shi, Y.'     1 0000-0002-7218-5337 
'Beese, L.S.' 2 ?                   
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Proc. Natl. Acad. Sci. U.S.A.' 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            114 
_citation.language                  ? 
_citation.page_first                6010 
_citation.page_last                 6015 
_citation.title                     
'Interplay of catalysis, fidelity, threading, and processivity in the exo- and endonucleolytic reactions of human exonuclease I.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1704845114 
_citation.pdbx_database_id_PubMed   28533382 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Shi, Y.'        1 
primary 'Hellinga, H.W.' 2 
primary 'Beese, L.S.'    3 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5V09 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     73.904 
_cell.length_a_esd                 ? 
_cell.length_b                     73.904 
_cell.length_b_esd                 ? 
_cell.length_c                     180.081 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5V09 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Exonuclease 1'                                         40310.754 1  3.1.-.- D225A 'UNP residues 1-352' ? 
2 polymer     syn 
;DNA (5'-D(*CP*GP*CP*TP*AP*GP*TP*CP*GP*TP*CP*AP*T)-3')
;
3942.572  1  ?       ?     ?                    ? 
3 polymer     syn 
;DNA (5'-D(P*AP*CP*GP*AP*CP*TP*AP*GP*CP*G)-3')
;
3054.019  1  ?       ?     ?                    ? 
4 non-polymer syn 'MANGANESE (II) ION'                                    54.938    5  ?       ?     ?                    ? 
5 non-polymer syn 'SODIUM ION'                                            22.990    1  ?       ?     ?                    ? 
6 water       nat water                                                   18.015    99 ?       ?     ?                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'hExo1, Exonuclease I, hExoI' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MGIQGLLQFIKEASEPIHVRKYKGQVVAVDTYCWLHKGAIACAEKLAKGEPTDRYVGFCMKFVNMLLSHGIKPILVFDGC
TLPSKKEVERSRRERRQANLLKGKQLLREGKVSEARECFTRSINITHAMAHKVIKAARSQGVDCLVAPYEADAQLAYLNK
AGIVQAIITEDSDLLAFGCKKVILKMDQFGNGLEIDQARLGMCRQLGDVFTEEKFRYMCILSGCAYLSSLRGIGLAKACK
VLRLANNPDIVKVIKKIGHYLKMNITVPEDYINGFIRANNTFLYQLVFDPIKRKLIPLNAYEDDVDPETLSYAGQYVDDS
IALQIALGNKDINTFEQIDDYNPDTAMPAHSRENLYFQ
;
;MGIQGLLQFIKEASEPIHVRKYKGQVVAVDTYCWLHKGAIACAEKLAKGEPTDRYVGFCMKFVNMLLSHGIKPILVFDGC
TLPSKKEVERSRRERRQANLLKGKQLLREGKVSEARECFTRSINITHAMAHKVIKAARSQGVDCLVAPYEADAQLAYLNK
AGIVQAIITEDSDLLAFGCKKVILKMDQFGNGLEIDQARLGMCRQLGDVFTEEKFRYMCILSGCAYLSSLRGIGLAKACK
VLRLANNPDIVKVIKKIGHYLKMNITVPEDYINGFIRANNTFLYQLVFDPIKRKLIPLNAYEDDVDPETLSYAGQYVDDS
IALQIALGNKDINTFEQIDDYNPDTAMPAHSRENLYFQ
;
Z ? 
2 polydeoxyribonucleotide no no '(DC)(DG)(DC)(DT)(DA)(DG)(DT)(DC)(DG)(DT)(DC)(DA)(DT)' CGCTAGTCGTCAT A ? 
3 polydeoxyribonucleotide no no '(DA)(DC)(DG)(DA)(DC)(DT)(DA)(DG)(DC)(DG)' ACGACTAGCG B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   ILE n 
1 4   GLN n 
1 5   GLY n 
1 6   LEU n 
1 7   LEU n 
1 8   GLN n 
1 9   PHE n 
1 10  ILE n 
1 11  LYS n 
1 12  GLU n 
1 13  ALA n 
1 14  SER n 
1 15  GLU n 
1 16  PRO n 
1 17  ILE n 
1 18  HIS n 
1 19  VAL n 
1 20  ARG n 
1 21  LYS n 
1 22  TYR n 
1 23  LYS n 
1 24  GLY n 
1 25  GLN n 
1 26  VAL n 
1 27  VAL n 
1 28  ALA n 
1 29  VAL n 
1 30  ASP n 
1 31  THR n 
1 32  TYR n 
1 33  CYS n 
1 34  TRP n 
1 35  LEU n 
1 36  HIS n 
1 37  LYS n 
1 38  GLY n 
1 39  ALA n 
1 40  ILE n 
1 41  ALA n 
1 42  CYS n 
1 43  ALA n 
1 44  GLU n 
1 45  LYS n 
1 46  LEU n 
1 47  ALA n 
1 48  LYS n 
1 49  GLY n 
1 50  GLU n 
1 51  PRO n 
1 52  THR n 
1 53  ASP n 
1 54  ARG n 
1 55  TYR n 
1 56  VAL n 
1 57  GLY n 
1 58  PHE n 
1 59  CYS n 
1 60  MET n 
1 61  LYS n 
1 62  PHE n 
1 63  VAL n 
1 64  ASN n 
1 65  MET n 
1 66  LEU n 
1 67  LEU n 
1 68  SER n 
1 69  HIS n 
1 70  GLY n 
1 71  ILE n 
1 72  LYS n 
1 73  PRO n 
1 74  ILE n 
1 75  LEU n 
1 76  VAL n 
1 77  PHE n 
1 78  ASP n 
1 79  GLY n 
1 80  CYS n 
1 81  THR n 
1 82  LEU n 
1 83  PRO n 
1 84  SER n 
1 85  LYS n 
1 86  LYS n 
1 87  GLU n 
1 88  VAL n 
1 89  GLU n 
1 90  ARG n 
1 91  SER n 
1 92  ARG n 
1 93  ARG n 
1 94  GLU n 
1 95  ARG n 
1 96  ARG n 
1 97  GLN n 
1 98  ALA n 
1 99  ASN n 
1 100 LEU n 
1 101 LEU n 
1 102 LYS n 
1 103 GLY n 
1 104 LYS n 
1 105 GLN n 
1 106 LEU n 
1 107 LEU n 
1 108 ARG n 
1 109 GLU n 
1 110 GLY n 
1 111 LYS n 
1 112 VAL n 
1 113 SER n 
1 114 GLU n 
1 115 ALA n 
1 116 ARG n 
1 117 GLU n 
1 118 CYS n 
1 119 PHE n 
1 120 THR n 
1 121 ARG n 
1 122 SER n 
1 123 ILE n 
1 124 ASN n 
1 125 ILE n 
1 126 THR n 
1 127 HIS n 
1 128 ALA n 
1 129 MET n 
1 130 ALA n 
1 131 HIS n 
1 132 LYS n 
1 133 VAL n 
1 134 ILE n 
1 135 LYS n 
1 136 ALA n 
1 137 ALA n 
1 138 ARG n 
1 139 SER n 
1 140 GLN n 
1 141 GLY n 
1 142 VAL n 
1 143 ASP n 
1 144 CYS n 
1 145 LEU n 
1 146 VAL n 
1 147 ALA n 
1 148 PRO n 
1 149 TYR n 
1 150 GLU n 
1 151 ALA n 
1 152 ASP n 
1 153 ALA n 
1 154 GLN n 
1 155 LEU n 
1 156 ALA n 
1 157 TYR n 
1 158 LEU n 
1 159 ASN n 
1 160 LYS n 
1 161 ALA n 
1 162 GLY n 
1 163 ILE n 
1 164 VAL n 
1 165 GLN n 
1 166 ALA n 
1 167 ILE n 
1 168 ILE n 
1 169 THR n 
1 170 GLU n 
1 171 ASP n 
1 172 SER n 
1 173 ASP n 
1 174 LEU n 
1 175 LEU n 
1 176 ALA n 
1 177 PHE n 
1 178 GLY n 
1 179 CYS n 
1 180 LYS n 
1 181 LYS n 
1 182 VAL n 
1 183 ILE n 
1 184 LEU n 
1 185 LYS n 
1 186 MET n 
1 187 ASP n 
1 188 GLN n 
1 189 PHE n 
1 190 GLY n 
1 191 ASN n 
1 192 GLY n 
1 193 LEU n 
1 194 GLU n 
1 195 ILE n 
1 196 ASP n 
1 197 GLN n 
1 198 ALA n 
1 199 ARG n 
1 200 LEU n 
1 201 GLY n 
1 202 MET n 
1 203 CYS n 
1 204 ARG n 
1 205 GLN n 
1 206 LEU n 
1 207 GLY n 
1 208 ASP n 
1 209 VAL n 
1 210 PHE n 
1 211 THR n 
1 212 GLU n 
1 213 GLU n 
1 214 LYS n 
1 215 PHE n 
1 216 ARG n 
1 217 TYR n 
1 218 MET n 
1 219 CYS n 
1 220 ILE n 
1 221 LEU n 
1 222 SER n 
1 223 GLY n 
1 224 CYS n 
1 225 ALA n 
1 226 TYR n 
1 227 LEU n 
1 228 SER n 
1 229 SER n 
1 230 LEU n 
1 231 ARG n 
1 232 GLY n 
1 233 ILE n 
1 234 GLY n 
1 235 LEU n 
1 236 ALA n 
1 237 LYS n 
1 238 ALA n 
1 239 CYS n 
1 240 LYS n 
1 241 VAL n 
1 242 LEU n 
1 243 ARG n 
1 244 LEU n 
1 245 ALA n 
1 246 ASN n 
1 247 ASN n 
1 248 PRO n 
1 249 ASP n 
1 250 ILE n 
1 251 VAL n 
1 252 LYS n 
1 253 VAL n 
1 254 ILE n 
1 255 LYS n 
1 256 LYS n 
1 257 ILE n 
1 258 GLY n 
1 259 HIS n 
1 260 TYR n 
1 261 LEU n 
1 262 LYS n 
1 263 MET n 
1 264 ASN n 
1 265 ILE n 
1 266 THR n 
1 267 VAL n 
1 268 PRO n 
1 269 GLU n 
1 270 ASP n 
1 271 TYR n 
1 272 ILE n 
1 273 ASN n 
1 274 GLY n 
1 275 PHE n 
1 276 ILE n 
1 277 ARG n 
1 278 ALA n 
1 279 ASN n 
1 280 ASN n 
1 281 THR n 
1 282 PHE n 
1 283 LEU n 
1 284 TYR n 
1 285 GLN n 
1 286 LEU n 
1 287 VAL n 
1 288 PHE n 
1 289 ASP n 
1 290 PRO n 
1 291 ILE n 
1 292 LYS n 
1 293 ARG n 
1 294 LYS n 
1 295 LEU n 
1 296 ILE n 
1 297 PRO n 
1 298 LEU n 
1 299 ASN n 
1 300 ALA n 
1 301 TYR n 
1 302 GLU n 
1 303 ASP n 
1 304 ASP n 
1 305 VAL n 
1 306 ASP n 
1 307 PRO n 
1 308 GLU n 
1 309 THR n 
1 310 LEU n 
1 311 SER n 
1 312 TYR n 
1 313 ALA n 
1 314 GLY n 
1 315 GLN n 
1 316 TYR n 
1 317 VAL n 
1 318 ASP n 
1 319 ASP n 
1 320 SER n 
1 321 ILE n 
1 322 ALA n 
1 323 LEU n 
1 324 GLN n 
1 325 ILE n 
1 326 ALA n 
1 327 LEU n 
1 328 GLY n 
1 329 ASN n 
1 330 LYS n 
1 331 ASP n 
1 332 ILE n 
1 333 ASN n 
1 334 THR n 
1 335 PHE n 
1 336 GLU n 
1 337 GLN n 
1 338 ILE n 
1 339 ASP n 
1 340 ASP n 
1 341 TYR n 
1 342 ASN n 
1 343 PRO n 
1 344 ASP n 
1 345 THR n 
1 346 ALA n 
1 347 MET n 
1 348 PRO n 
1 349 ALA n 
1 350 HIS n 
1 351 SER n 
1 352 ARG n 
1 353 GLU n 
1 354 ASN n 
1 355 LEU n 
1 356 TYR n 
1 357 PHE n 
1 358 GLN n 
2 1   DC  n 
2 2   DG  n 
2 3   DC  n 
2 4   DT  n 
2 5   DA  n 
2 6   DG  n 
2 7   DT  n 
2 8   DC  n 
2 9   DG  n 
2 10  DT  n 
2 11  DC  n 
2 12  DA  n 
2 13  DT  n 
3 1   DA  n 
3 2   DC  n 
3 3   DG  n 
3 4   DA  n 
3 5   DC  n 
3 6   DT  n 
3 7   DA  n 
3 8   DG  n 
3 9   DC  n 
3 10  DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   358 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'EXO1, EXOI, HEX1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 13 'synthetic construct' ? 32630 ? 
3 1 sample 1 10 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP EXO1_HUMAN Q9UQ84 ? 1 
;MGIQGLLQFIKEASEPIHVRKYKGQVVAVDTYCWLHKGAIACAEKLAKGEPTDRYVGFCMKFVNMLLSHGIKPILVFDGC
TLPSKKEVERSRRERRQANLLKGKQLLREGKVSEARECFTRSINITHAMAHKVIKAARSQGVDCLVAPYEADAQLAYLNK
AGIVQAIITEDSDLLAFGCKKVILKMDQFGNGLEIDQARLGMCRQLGDVFTEEKFRYMCILSGCDYLSSLRGIGLAKACK
VLRLANNPDIVKVIKKIGHYLKMNITVPEDYINGFIRANNTFLYQLVFDPIKRKLIPLNAYEDDVDPETLSYAGQYVDDS
IALQIALGNKDINTFEQIDDYNPDTAMPAHSR
;
1 
2 PDB 5V09       5V09   ? 2 ? 1 
3 PDB 5V09       5V09   ? 3 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5V09 Z 1 ? 352 ? Q9UQ84 1 ? 352 ? 1 352 
2 2 5V09 A 1 ? 13  ? 5V09   1 ? 13  ? 1 13  
3 3 5V09 B 1 ? 10  ? 5V09   1 ? 10  ? 1 10  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5V09 ALA Z 225 ? UNP Q9UQ84 ASP 225 'engineered mutation' 225 1 
1 5V09 GLU Z 353 ? UNP Q9UQ84 ?   ?   'expression tag'      353 2 
1 5V09 ASN Z 354 ? UNP Q9UQ84 ?   ?   'expression tag'      354 3 
1 5V09 LEU Z 355 ? UNP Q9UQ84 ?   ?   'expression tag'      355 4 
1 5V09 TYR Z 356 ? UNP Q9UQ84 ?   ?   'expression tag'      356 5 
1 5V09 PHE Z 357 ? UNP Q9UQ84 ?   ?   'expression tag'      357 6 
1 5V09 GLN Z 358 ? UNP Q9UQ84 ?   ?   'expression tag'      358 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                 ? 'Mn 2'            54.938  
NA  non-polymer         . 'SODIUM ION'                         ? 'Na 1'            22.990  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5V09 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.60 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         52.67 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '100 mM sodium acetate, pH 7.0, 10 mM potassium chloride, 2-4% PEG4000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-11-11 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'double crystal Si(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ALS BEAMLINE 12.3.1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   12.3.1 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5V09 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.75 
_reflns.d_resolution_low                 50.00 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       13545 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.3 
_reflns.pdbx_Rmerge_I_obs                0.052 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            36.46 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.056 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.858 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.75 
_reflns_shell.d_res_low                   2.80 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         3.27 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           642 
_reflns_shell.percent_possible_all        99.7 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.688 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             6.5 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             0.750 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5V09 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.750 
_refine.ls_d_res_low                             46.594 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     13529 
_refine.ls_number_reflns_R_free                  1101 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.03 
_refine.ls_percent_reflns_R_free                 8.14 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2211 
_refine.ls_R_factor_R_free                       0.2541 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2181 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 3QEA' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 27.29 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.36 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2731 
_refine_hist.pdbx_number_atoms_nucleic_acid   468 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.number_atoms_solvent             99 
_refine_hist.number_atoms_total               3304 
_refine_hist.d_res_high                       2.750 
_refine_hist.d_res_low                        46.594 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.007  ? 3306 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.752  ? 4554 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 17.295 ? 1278 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.042  ? 513  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.006  ? 505  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.7499 2.8751  . . 131 1505 100.00 . . . 0.3609 . 0.3006 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8751 3.0266  . . 136 1516 100.00 . . . 0.3345 . 0.3101 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0266 3.2162  . . 137 1549 100.00 . . . 0.3194 . 0.2587 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2162 3.4645  . . 137 1520 99.00  . . . 0.2733 . 0.2234 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4645 3.8130  . . 134 1547 99.00  . . . 0.2675 . 0.2275 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8130 4.3644  . . 139 1562 99.00  . . . 0.2454 . 0.2023 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3644 5.4972  . . 139 1562 98.00  . . . 0.2032 . 0.1934 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.4972 46.6006 . . 148 1667 97.00  . . . 0.2441 . 0.2036 . . . . . . . . . . 
# 
_struct.entry_id                     5V09 
_struct.title                        
;Crystal structure of human exonuclease 1 Exo1 (D225A) in complex with 5' recessed-end DNA (rVII)
;
_struct.pdbx_descriptor              'Exonuclease 1/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5V09 
_struct_keywords.text            'exonuclease, endonuclease, HYDROLASE-DNA complex' 
_struct_keywords.pdbx_keywords   HYDROLASE/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 6 ? 
K N N 6 ? 
L N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 5   ? ILE A 10  ? GLY Z 5   ILE Z 10  1 ? 6  
HELX_P HELX_P2  AA2 ARG A 20  ? LYS A 23  ? ARG Z 20  LYS Z 23  5 ? 4  
HELX_P HELX_P3  AA3 THR A 31  ? CYS A 42  ? THR Z 31  CYS Z 42  1 ? 12 
HELX_P HELX_P4  AA4 CYS A 42  ? GLY A 49  ? CYS Z 42  GLY Z 49  1 ? 8  
HELX_P HELX_P5  AA5 ASP A 53  ? HIS A 69  ? ASP Z 53  HIS Z 69  1 ? 17 
HELX_P HELX_P6  AA6 LEU A 82  ? GLU A 109 ? LEU Z 82  GLU Z 109 1 ? 28 
HELX_P HELX_P7  AA7 VAL A 112 ? THR A 120 ? VAL Z 112 THR Z 120 1 ? 9  
HELX_P HELX_P8  AA8 THR A 126 ? SER A 139 ? THR Z 126 SER Z 139 1 ? 14 
HELX_P HELX_P9  AA9 GLU A 150 ? ALA A 161 ? GLU Z 150 ALA Z 161 1 ? 12 
HELX_P HELX_P10 AB1 SER A 172 ? PHE A 177 ? SER Z 172 PHE Z 177 1 ? 6  
HELX_P HELX_P11 AB2 ALA A 198 ? GLY A 207 ? ALA Z 198 GLY Z 207 5 ? 10 
HELX_P HELX_P12 AB3 THR A 211 ? GLY A 223 ? THR Z 211 GLY Z 223 1 ? 13 
HELX_P HELX_P13 AB4 GLY A 234 ? ALA A 245 ? GLY Z 234 ALA Z 245 1 ? 12 
HELX_P HELX_P14 AB5 ASP A 249 ? LYS A 256 ? ASP Z 249 LYS Z 256 1 ? 8  
HELX_P HELX_P15 AB6 LYS A 256 ? LYS A 262 ? LYS Z 256 LYS Z 262 1 ? 7  
HELX_P HELX_P16 AB7 PRO A 268 ? GLN A 285 ? PRO Z 268 GLN Z 285 1 ? 18 
HELX_P HELX_P17 AB8 ASP A 306 ? LEU A 310 ? ASP Z 306 LEU Z 310 5 ? 5  
HELX_P HELX_P18 AB9 ASP A 318 ? LEU A 327 ? ASP Z 318 LEU Z 327 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A CYS 80  SG    ? ? ? 1_555 E MN  .  MN ? ? Z CYS 80  Z MN  402 1_555 ? ? ? ? ? ? ?            2.657 ? 
metalc2  metalc ? ? A ASP 152 OD1   ? ? ? 1_555 H MN  .  MN ? ? Z ASP 152 B MN  101 1_555 ? ? ? ? ? ? ?            2.185 ? 
metalc3  metalc ? ? A ASP 152 OD2   ? ? ? 1_555 D MN  .  MN ? ? Z ASP 152 Z MN  401 1_555 ? ? ? ? ? ? ?            2.129 ? 
metalc4  metalc ? ? A ASP 171 OD2   ? ? ? 1_555 D MN  .  MN ? ? Z ASP 171 Z MN  401 1_555 ? ? ? ? ? ? ?            2.143 ? 
metalc5  metalc ? ? A ASP 173 OD2   ? ? ? 1_555 D MN  .  MN ? ? Z ASP 173 Z MN  401 1_555 ? ? ? ? ? ? ?            2.109 ? 
metalc6  metalc ? ? A SER 222 O     ? ? ? 1_555 F NA  .  NA ? ? Z SER 222 Z NA  403 1_555 ? ? ? ? ? ? ?            2.463 ? 
metalc7  metalc ? ? A SER 229 OG    ? ? ? 1_555 F NA  .  NA ? ? Z SER 229 Z NA  403 1_555 ? ? ? ? ? ? ?            2.505 ? 
metalc8  metalc ? ? A ILE 233 O     ? ? ? 1_555 F NA  .  NA ? ? Z ILE 233 Z NA  403 1_555 ? ? ? ? ? ? ?            2.358 ? 
metalc9  metalc ? ? B DA  5   OP2   ? ? ? 1_555 F NA  .  NA ? ? A DA  5   Z NA  403 1_555 ? ? ? ? ? ? ?            2.540 ? 
metalc10 metalc ? ? B DC  11  O2    ? ? ? 1_555 G MN  .  MN ? ? A DC  11  A MN  101 1_555 ? ? ? ? ? ? ?            2.306 ? 
metalc11 metalc ? ? C DA  1   OP1   ? ? ? 1_555 I MN  .  MN ? ? B DA  1   B MN  102 1_555 ? ? ? ? ? ? ?            2.178 ? 
metalc12 metalc ? ? C DA  1   "O3'" ? ? ? 1_555 H MN  .  MN ? ? B DA  1   B MN  101 1_555 ? ? ? ? ? ? ?            2.306 ? 
metalc13 metalc ? ? C DC  2   OP1   ? ? ? 1_555 D MN  .  MN ? ? B DC  2   Z MN  401 1_555 ? ? ? ? ? ? ?            2.041 ? 
metalc14 metalc ? ? C DC  2   OP1   ? ? ? 1_555 H MN  .  MN ? ? B DC  2   B MN  101 1_555 ? ? ? ? ? ? ?            2.447 ? 
metalc15 metalc ? ? D MN  .   MN    ? ? ? 1_555 J HOH .  O  ? ? Z MN  401 Z HOH 510 1_555 ? ? ? ? ? ? ?            2.298 ? 
metalc16 metalc ? ? E MN  .   MN    ? ? ? 1_555 J HOH .  O  ? ? Z MN  402 Z HOH 578 1_555 ? ? ? ? ? ? ?            2.419 ? 
metalc17 metalc ? ? F NA  .   NA    ? ? ? 1_555 K HOH .  O  ? ? Z NA  403 A HOH 205 1_555 ? ? ? ? ? ? ?            2.358 ? 
metalc18 metalc ? ? F NA  .   NA    ? ? ? 1_555 J HOH .  O  ? ? Z NA  403 Z HOH 545 1_555 ? ? ? ? ? ? ?            2.340 ? 
metalc19 metalc ? ? H MN  .   MN    ? ? ? 1_555 J HOH .  O  ? ? B MN  101 Z HOH 513 1_555 ? ? ? ? ? ? ?            2.148 ? 
metalc20 metalc ? ? H MN  .   MN    ? ? ? 1_555 J HOH .  O  ? ? B MN  101 Z HOH 532 1_555 ? ? ? ? ? ? ?            2.144 ? 
metalc21 metalc ? ? H MN  .   MN    ? ? ? 1_555 J HOH .  O  ? ? B MN  101 Z HOH 519 1_555 ? ? ? ? ? ? ?            2.163 ? 
hydrog1  hydrog ? ? B DC  1   N3    ? ? ? 1_555 C DG  10 N1 ? ? A DC  1   B DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DC  1   N4    ? ? ? 1_555 C DG  10 O6 ? ? A DC  1   B DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DC  1   O2    ? ? ? 1_555 C DG  10 N2 ? ? A DC  1   B DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DG  2   N1    ? ? ? 1_555 C DC  9  N3 ? ? A DG  2   B DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  2   N2    ? ? ? 1_555 C DC  9  O2 ? ? A DG  2   B DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  2   O6    ? ? ? 1_555 C DC  9  N4 ? ? A DG  2   B DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DC  3   N3    ? ? ? 1_555 C DG  8  N1 ? ? A DC  3   B DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DC  3   N4    ? ? ? 1_555 C DG  8  O6 ? ? A DC  3   B DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DC  3   O2    ? ? ? 1_555 C DG  8  N2 ? ? A DC  3   B DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DT  4   N3    ? ? ? 1_555 C DA  7  N1 ? ? A DT  4   B DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DT  4   O4    ? ? ? 1_555 C DA  7  N6 ? ? A DT  4   B DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DA  5   N1    ? ? ? 1_555 C DT  6  N3 ? ? A DA  5   B DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DA  5   N6    ? ? ? 1_555 C DT  6  O4 ? ? A DA  5   B DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG  6   N1    ? ? ? 1_555 C DC  5  N3 ? ? A DG  6   B DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  6   N2    ? ? ? 1_555 C DC  5  O2 ? ? A DG  6   B DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DG  6   O6    ? ? ? 1_555 C DC  5  N4 ? ? A DG  6   B DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DT  7   N3    ? ? ? 1_555 C DA  4  N1 ? ? A DT  7   B DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DT  7   O4    ? ? ? 1_555 C DA  4  N6 ? ? A DT  7   B DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DC  8   N3    ? ? ? 1_555 C DG  3  N1 ? ? A DC  8   B DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DC  8   N4    ? ? ? 1_555 C DG  3  O6 ? ? A DC  8   B DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DC  8   O2    ? ? ? 1_555 C DG  3  N2 ? ? A DC  8   B DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DG  9   N1    ? ? ? 1_555 C DC  2  N3 ? ? A DG  9   B DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DG  9   N2    ? ? ? 1_555 C DC  2  O2 ? ? A DG  9   B DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DG  9   O6    ? ? ? 1_555 C DC  2  N4 ? ? A DG  9   B DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DT  10  N3    ? ? ? 1_555 C DA  1  N1 ? ? A DT  10  B DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DT  10  O4    ? ? ? 1_555 C DA  1  N6 ? ? A DT  10  B DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ASN 
_struct_mon_prot_cis.label_seq_id           247 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ASN 
_struct_mon_prot_cis.auth_seq_id            247 
_struct_mon_prot_cis.auth_asym_id           Z 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    248 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     248 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    Z 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -15.42 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 7 ? 
AA2 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA1 6 7 ? parallel      
AA2 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 SER A 14  ? HIS A 18  ? SER Z 14  HIS Z 18  
AA1 2 ASN A 191 ? ASP A 196 ? ASN Z 191 ASP Z 196 
AA1 3 LYS A 181 ? LEU A 184 ? LYS Z 181 LEU Z 184 
AA1 4 ALA A 166 ? ILE A 168 ? ALA Z 166 ILE Z 168 
AA1 5 VAL A 26  ? ASP A 30  ? VAL Z 26  ASP Z 30  
AA1 6 LYS A 72  ? PHE A 77  ? LYS Z 72  PHE Z 77  
AA1 7 CYS A 144 ? VAL A 146 ? CYS Z 144 VAL Z 146 
AA2 1 LEU A 286 ? ASP A 289 ? LEU Z 286 ASP Z 289 
AA2 2 LYS A 294 ? PRO A 297 ? LYS Z 294 PRO Z 297 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 15  ? N GLU Z 15  O GLU A 194 ? O GLU Z 194 
AA1 2 3 O LEU A 193 ? O LEU Z 193 N LEU A 184 ? N LEU Z 184 
AA1 3 4 O ILE A 183 ? O ILE Z 183 N ILE A 167 ? N ILE Z 167 
AA1 4 5 O ILE A 168 ? O ILE Z 168 N ASP A 30  ? N ASP Z 30  
AA1 5 6 N VAL A 29  ? N VAL Z 29  O ILE A 74  ? O ILE Z 74  
AA1 6 7 N LEU A 75  ? N LEU Z 75  O LEU A 145 ? O LEU Z 145 
AA2 1 2 N VAL A 287 ? N VAL Z 287 O ILE A 296 ? O ILE Z 296 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software Z MN 401 ? 5 'binding site for residue MN Z 401' 
AC2 Software Z MN 402 ? 2 'binding site for residue MN Z 402' 
AC3 Software Z NA 403 ? 7 'binding site for residue NA Z 403' 
AC4 Software A MN 101 ? 1 'binding site for residue MN A 101' 
AC5 Software B MN 101 ? 6 'binding site for residue MN B 101' 
AC6 Software B MN 102 ? 1 'binding site for residue MN B 102' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 DC  C 2   ? DC  B 2   . ? 1_555 ? 
2  AC1 5 ASP A 152 ? ASP Z 152 . ? 1_555 ? 
3  AC1 5 ASP A 171 ? ASP Z 171 . ? 1_555 ? 
4  AC1 5 ASP A 173 ? ASP Z 173 . ? 1_555 ? 
5  AC1 5 HOH J .   ? HOH Z 510 . ? 1_555 ? 
6  AC2 2 CYS A 80  ? CYS Z 80  . ? 1_555 ? 
7  AC2 2 HOH J .   ? HOH Z 578 . ? 1_555 ? 
8  AC3 7 DA  B 5   ? DA  A 5   . ? 1_555 ? 
9  AC3 7 HOH K .   ? HOH A 205 . ? 1_555 ? 
10 AC3 7 SER A 222 ? SER Z 222 . ? 1_555 ? 
11 AC3 7 SER A 229 ? SER Z 229 . ? 1_555 ? 
12 AC3 7 ILE A 233 ? ILE Z 233 . ? 1_555 ? 
13 AC3 7 GLY A 234 ? GLY Z 234 . ? 1_555 ? 
14 AC3 7 HOH J .   ? HOH Z 545 . ? 1_555 ? 
15 AC4 1 DC  B 11  ? DC  A 11  . ? 1_555 ? 
16 AC5 6 DA  C 1   ? DA  B 1   . ? 1_555 ? 
17 AC5 6 DC  C 2   ? DC  B 2   . ? 1_555 ? 
18 AC5 6 ASP A 152 ? ASP Z 152 . ? 1_555 ? 
19 AC5 6 HOH J .   ? HOH Z 513 . ? 1_555 ? 
20 AC5 6 HOH J .   ? HOH Z 519 . ? 1_555 ? 
21 AC5 6 HOH J .   ? HOH Z 532 . ? 1_555 ? 
22 AC6 1 DA  C 1   ? DA  B 1   . ? 1_555 ? 
# 
_atom_sites.entry_id                    5V09 
_atom_sites.fract_transf_matrix[1][1]   0.013531 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013531 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005553 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 2   ? -12.513 40.038 -7.134  1.00 66.13  ? 2   GLY Z N     1 
ATOM   2    C  CA    . GLY A 1 2   ? -12.807 39.586 -8.480  1.00 68.49  ? 2   GLY Z CA    1 
ATOM   3    C  C     . GLY A 1 2   ? -13.167 40.727 -9.415  1.00 79.07  ? 2   GLY Z C     1 
ATOM   4    O  O     . GLY A 1 2   ? -13.792 41.709 -9.007  1.00 87.35  ? 2   GLY Z O     1 
ATOM   5    N  N     . ILE A 1 3   ? -12.765 40.602 -10.676 1.00 84.81  ? 3   ILE Z N     1 
ATOM   6    C  CA    . ILE A 1 3   ? -13.108 41.582 -11.702 1.00 78.14  ? 3   ILE Z CA    1 
ATOM   7    C  C     . ILE A 1 3   ? -14.318 41.096 -12.493 1.00 81.44  ? 3   ILE Z C     1 
ATOM   8    O  O     . ILE A 1 3   ? -14.190 40.232 -13.361 1.00 82.78  ? 3   ILE Z O     1 
ATOM   9    C  CB    . ILE A 1 3   ? -11.937 41.827 -12.665 1.00 67.47  ? 3   ILE Z CB    1 
ATOM   10   C  CG1   . ILE A 1 3   ? -10.615 41.918 -11.897 1.00 64.24  ? 3   ILE Z CG1   1 
ATOM   11   C  CG2   . ILE A 1 3   ? -12.184 43.079 -13.479 1.00 56.61  ? 3   ILE Z CG2   1 
ATOM   12   C  CD1   . ILE A 1 3   ? -10.559 43.068 -10.933 1.00 63.26  ? 3   ILE Z CD1   1 
ATOM   13   N  N     . GLN A 1 4   ? -15.489 41.646 -12.192 1.00 82.10  ? 4   GLN Z N     1 
ATOM   14   C  CA    . GLN A 1 4   ? -16.743 41.116 -12.732 1.00 88.43  ? 4   GLN Z CA    1 
ATOM   15   C  C     . GLN A 1 4   ? -16.771 41.136 -14.261 1.00 77.30  ? 4   GLN Z C     1 
ATOM   16   O  O     . GLN A 1 4   ? -16.692 42.196 -14.871 1.00 76.69  ? 4   GLN Z O     1 
ATOM   17   C  CB    . GLN A 1 4   ? -17.938 41.906 -12.164 1.00 101.86 ? 4   GLN Z CB    1 
ATOM   18   C  CG    . GLN A 1 4   ? -19.336 41.361 -12.537 1.00 112.66 ? 4   GLN Z CG    1 
ATOM   19   C  CD    . GLN A 1 4   ? -20.487 42.074 -11.815 1.00 118.61 ? 4   GLN Z CD    1 
ATOM   20   O  OE1   . GLN A 1 4   ? -20.264 42.928 -10.951 1.00 116.82 ? 4   GLN Z OE1   1 
ATOM   21   N  NE2   . GLN A 1 4   ? -21.720 41.719 -12.173 1.00 123.21 ? 4   GLN Z NE2   1 
ATOM   22   N  N     . GLY A 1 5   ? -16.871 39.963 -14.878 1.00 71.94  ? 5   GLY Z N     1 
ATOM   23   C  CA    . GLY A 1 5   ? -16.983 39.890 -16.323 1.00 68.28  ? 5   GLY Z CA    1 
ATOM   24   C  C     . GLY A 1 5   ? -15.660 39.912 -17.066 1.00 66.55  ? 5   GLY Z C     1 
ATOM   25   O  O     . GLY A 1 5   ? -15.632 40.140 -18.274 1.00 66.68  ? 5   GLY Z O     1 
ATOM   26   N  N     . LEU A 1 6   ? -14.561 39.669 -16.357 1.00 65.96  ? 6   LEU Z N     1 
ATOM   27   C  CA    . LEU A 1 6   ? -13.236 39.743 -16.971 1.00 58.06  ? 6   LEU Z CA    1 
ATOM   28   C  C     . LEU A 1 6   ? -12.981 38.544 -17.860 1.00 60.01  ? 6   LEU Z C     1 
ATOM   29   O  O     . LEU A 1 6   ? -12.433 38.677 -18.952 1.00 64.33  ? 6   LEU Z O     1 
ATOM   30   C  CB    . LEU A 1 6   ? -12.144 39.838 -15.907 1.00 57.01  ? 6   LEU Z CB    1 
ATOM   31   C  CG    . LEU A 1 6   ? -10.701 39.917 -16.409 1.00 56.34  ? 6   LEU Z CG    1 
ATOM   32   C  CD1   . LEU A 1 6   ? -10.465 41.216 -17.143 1.00 52.84  ? 6   LEU Z CD1   1 
ATOM   33   C  CD2   . LEU A 1 6   ? -9.725  39.774 -15.261 1.00 53.04  ? 6   LEU Z CD2   1 
ATOM   34   N  N     . LEU A 1 7   ? -13.387 37.372 -17.387 1.00 58.41  ? 7   LEU Z N     1 
ATOM   35   C  CA    . LEU A 1 7   ? -13.139 36.141 -18.118 1.00 56.68  ? 7   LEU Z CA    1 
ATOM   36   C  C     . LEU A 1 7   ? -13.822 36.165 -19.470 1.00 55.41  ? 7   LEU Z C     1 
ATOM   37   O  O     . LEU A 1 7   ? -13.231 35.784 -20.475 1.00 65.43  ? 7   LEU Z O     1 
ATOM   38   C  CB    . LEU A 1 7   ? -13.610 34.935 -17.315 1.00 62.82  ? 7   LEU Z CB    1 
ATOM   39   C  CG    . LEU A 1 7   ? -12.957 34.785 -15.944 1.00 77.54  ? 7   LEU Z CG    1 
ATOM   40   C  CD1   . LEU A 1 7   ? -13.377 33.469 -15.306 1.00 85.98  ? 7   LEU Z CD1   1 
ATOM   41   C  CD2   . LEU A 1 7   ? -11.439 34.888 -16.032 1.00 76.22  ? 7   LEU Z CD2   1 
ATOM   42   N  N     . GLN A 1 8   ? -15.065 36.625 -19.500 1.00 55.73  ? 8   GLN Z N     1 
ATOM   43   C  CA    . GLN A 1 8   ? -15.787 36.700 -20.759 1.00 62.34  ? 8   GLN Z CA    1 
ATOM   44   C  C     . GLN A 1 8   ? -15.206 37.803 -21.632 1.00 61.03  ? 8   GLN Z C     1 
ATOM   45   O  O     . GLN A 1 8   ? -15.311 37.761 -22.855 1.00 64.70  ? 8   GLN Z O     1 
ATOM   46   C  CB    . GLN A 1 8   ? -17.278 36.931 -20.514 1.00 66.81  ? 8   GLN Z CB    1 
ATOM   47   C  CG    . GLN A 1 8   ? -17.951 35.800 -19.756 1.00 76.35  ? 8   GLN Z CG    1 
ATOM   48   C  CD    . GLN A 1 8   ? -17.832 34.468 -20.475 1.00 85.64  ? 8   GLN Z CD    1 
ATOM   49   O  OE1   . GLN A 1 8   ? -17.898 34.403 -21.706 1.00 89.71  ? 8   GLN Z OE1   1 
ATOM   50   N  NE2   . GLN A 1 8   ? -17.646 33.397 -19.708 1.00 86.50  ? 8   GLN Z NE2   1 
ATOM   51   N  N     . PHE A 1 9   ? -14.573 38.777 -20.990 1.00 58.26  ? 9   PHE Z N     1 
ATOM   52   C  CA    . PHE A 1 9   ? -14.005 39.920 -21.693 1.00 63.07  ? 9   PHE Z CA    1 
ATOM   53   C  C     . PHE A 1 9   ? -12.733 39.528 -22.435 1.00 62.31  ? 9   PHE Z C     1 
ATOM   54   O  O     . PHE A 1 9   ? -12.479 39.993 -23.545 1.00 67.04  ? 9   PHE Z O     1 
ATOM   55   C  CB    . PHE A 1 9   ? -13.724 41.056 -20.707 1.00 71.08  ? 9   PHE Z CB    1 
ATOM   56   C  CG    . PHE A 1 9   ? -13.336 42.350 -21.361 1.00 70.43  ? 9   PHE Z CG    1 
ATOM   57   C  CD1   . PHE A 1 9   ? -14.303 43.224 -21.828 1.00 70.82  ? 9   PHE Z CD1   1 
ATOM   58   C  CD2   . PHE A 1 9   ? -12.004 42.704 -21.490 1.00 67.71  ? 9   PHE Z CD2   1 
ATOM   59   C  CE1   . PHE A 1 9   ? -13.949 44.419 -22.421 1.00 66.93  ? 9   PHE Z CE1   1 
ATOM   60   C  CE2   . PHE A 1 9   ? -11.644 43.899 -22.084 1.00 65.17  ? 9   PHE Z CE2   1 
ATOM   61   C  CZ    . PHE A 1 9   ? -12.617 44.757 -22.549 1.00 66.01  ? 9   PHE Z CZ    1 
ATOM   62   N  N     . ILE A 1 10  ? -11.937 38.666 -21.817 1.00 58.33  ? 10  ILE Z N     1 
ATOM   63   C  CA    . ILE A 1 10  ? -10.712 38.201 -22.446 1.00 56.28  ? 10  ILE Z CA    1 
ATOM   64   C  C     . ILE A 1 10  ? -10.807 36.733 -22.821 1.00 60.91  ? 10  ILE Z C     1 
ATOM   65   O  O     . ILE A 1 10  ? -9.815  36.005 -22.773 1.00 52.52  ? 10  ILE Z O     1 
ATOM   66   C  CB    . ILE A 1 10  ? -9.509  38.405 -21.537 1.00 49.37  ? 10  ILE Z CB    1 
ATOM   67   C  CG1   . ILE A 1 10  ? -9.723  37.690 -20.207 1.00 44.29  ? 10  ILE Z CG1   1 
ATOM   68   C  CG2   . ILE A 1 10  ? -9.289  39.874 -21.310 1.00 55.54  ? 10  ILE Z CG2   1 
ATOM   69   C  CD1   . ILE A 1 10  ? -8.513  37.704 -19.328 1.00 41.35  ? 10  ILE Z CD1   1 
ATOM   70   N  N     . LYS A 1 11  ? -11.962 36.305 -23.279 1.00 62.63  ? 11  LYS Z N     1 
ATOM   71   C  CA    . LYS A 1 11  ? -12.206 34.913 -23.550 1.00 66.71  ? 11  LYS Z CA    1 
ATOM   72   C  C     . LYS A 1 11  ? -11.243 34.407 -24.583 1.00 68.80  ? 11  LYS Z C     1 
ATOM   73   O  O     . LYS A 1 11  ? -10.848 33.267 -24.560 1.00 64.18  ? 11  LYS Z O     1 
ATOM   74   C  CB    . LYS A 1 11  ? -13.616 34.730 -24.065 1.00 74.69  ? 11  LYS Z CB    1 
ATOM   75   C  CG    . LYS A 1 11  ? -14.009 33.290 -24.290 1.00 88.46  ? 11  LYS Z CG    1 
ATOM   76   C  CD    . LYS A 1 11  ? -15.382 33.172 -24.918 1.00 100.68 ? 11  LYS Z CD    1 
ATOM   77   C  CE    . LYS A 1 11  ? -15.895 31.747 -24.849 1.00 108.38 ? 11  LYS Z CE    1 
ATOM   78   N  NZ    . LYS A 1 11  ? -15.004 30.778 -25.535 1.00 111.49 ? 11  LYS Z NZ    1 
ATOM   79   N  N     . GLU A 1 12  ? -10.911 35.255 -25.528 1.00 67.35  ? 12  GLU Z N     1 
ATOM   80   C  CA    . GLU A 1 12  ? -10.103 34.846 -26.674 1.00 68.47  ? 12  GLU Z CA    1 
ATOM   81   C  C     . GLU A 1 12  ? -8.683  34.426 -26.301 1.00 61.32  ? 12  GLU Z C     1 
ATOM   82   O  O     . GLU A 1 12  ? -7.967  33.853 -27.124 1.00 61.72  ? 12  GLU Z O     1 
ATOM   83   C  CB    . GLU A 1 12  ? -10.054 35.977 -27.699 1.00 75.19  ? 12  GLU Z CB    1 
ATOM   84   C  CG    . GLU A 1 12  ? -11.427 36.397 -28.188 1.00 81.02  ? 12  GLU Z CG    1 
ATOM   85   C  CD    . GLU A 1 12  ? -11.369 37.533 -29.185 1.00 88.86  ? 12  GLU Z CD    1 
ATOM   86   O  OE1   . GLU A 1 12  ? -12.376 37.759 -29.891 1.00 92.41  ? 12  GLU Z OE1   1 
ATOM   87   O  OE2   . GLU A 1 12  ? -10.318 38.203 -29.264 1.00 90.52  ? 12  GLU Z OE2   1 
ATOM   88   N  N     . ALA A 1 13  ? -8.277  34.715 -25.069 1.00 62.78  ? 13  ALA Z N     1 
ATOM   89   C  CA    . ALA A 1 13  ? -6.949  34.342 -24.599 1.00 60.20  ? 13  ALA Z CA    1 
ATOM   90   C  C     . ALA A 1 13  ? -7.017  33.061 -23.796 1.00 56.70  ? 13  ALA Z C     1 
ATOM   91   O  O     . ALA A 1 13  ? -6.008  32.571 -23.297 1.00 57.98  ? 13  ALA Z O     1 
ATOM   92   C  CB    . ALA A 1 13  ? -6.343  35.453 -23.769 1.00 61.42  ? 13  ALA Z CB    1 
ATOM   93   N  N     . SER A 1 14  ? -8.220  32.521 -23.671 1.00 55.40  ? 14  SER Z N     1 
ATOM   94   C  CA    . SER A 1 14  ? -8.415  31.303 -22.907 1.00 56.86  ? 14  SER Z CA    1 
ATOM   95   C  C     . SER A 1 14  ? -8.263  30.086 -23.798 1.00 64.26  ? 14  SER Z C     1 
ATOM   96   O  O     . SER A 1 14  ? -8.535  30.140 -24.990 1.00 65.70  ? 14  SER Z O     1 
ATOM   97   C  CB    . SER A 1 14  ? -9.785  31.300 -22.234 1.00 51.67  ? 14  SER Z CB    1 
ATOM   98   O  OG    . SER A 1 14  ? -10.824 31.294 -23.192 1.00 59.12  ? 14  SER Z OG    1 
ATOM   99   N  N     . GLU A 1 15  ? -7.831  28.984 -23.207 1.00 62.35  ? 15  GLU Z N     1 
ATOM   100  C  CA    . GLU A 1 15  ? -7.573  27.770 -23.959 1.00 61.94  ? 15  GLU Z CA    1 
ATOM   101  C  C     . GLU A 1 15  ? -7.967  26.549 -23.142 1.00 59.38  ? 15  GLU Z C     1 
ATOM   102  O  O     . GLU A 1 15  ? -7.500  26.371 -22.026 1.00 52.87  ? 15  GLU Z O     1 
ATOM   103  C  CB    . GLU A 1 15  ? -6.096  27.705 -24.359 1.00 60.56  ? 15  GLU Z CB    1 
ATOM   104  C  CG    . GLU A 1 15  ? -5.627  26.349 -24.879 1.00 83.08  ? 15  GLU Z CG    1 
ATOM   105  C  CD    . GLU A 1 15  ? -4.136  26.329 -25.215 1.00 99.47  ? 15  GLU Z CD    1 
ATOM   106  O  OE1   . GLU A 1 15  ? -3.555  27.417 -25.444 1.00 102.81 ? 15  GLU Z OE1   1 
ATOM   107  O  OE2   . GLU A 1 15  ? -3.545  25.224 -25.248 1.00 107.16 ? 15  GLU Z OE2   1 
ATOM   108  N  N     . PRO A 1 16  ? -8.852  25.711 -23.687 1.00 63.37  ? 16  PRO Z N     1 
ATOM   109  C  CA    . PRO A 1 16  ? -9.235  24.473 -23.007 1.00 59.02  ? 16  PRO Z CA    1 
ATOM   110  C  C     . PRO A 1 16  ? -8.052  23.529 -22.895 1.00 61.81  ? 16  PRO Z C     1 
ATOM   111  O  O     . PRO A 1 16  ? -7.463  23.185 -23.913 1.00 67.00  ? 16  PRO Z O     1 
ATOM   112  C  CB    . PRO A 1 16  ? -10.316 23.892 -23.916 1.00 51.01  ? 16  PRO Z CB    1 
ATOM   113  C  CG    . PRO A 1 16  ? -10.816 25.058 -24.703 1.00 60.46  ? 16  PRO Z CG    1 
ATOM   114  C  CD    . PRO A 1 16  ? -9.631  25.933 -24.913 1.00 65.95  ? 16  PRO Z CD    1 
ATOM   115  N  N     . ILE A 1 17  ? -7.696  23.132 -21.680 1.00 58.60  ? 17  ILE Z N     1 
ATOM   116  C  CA    . ILE A 1 17  ? -6.555  22.248 -21.482 1.00 59.26  ? 17  ILE Z CA    1 
ATOM   117  C  C     . ILE A 1 17  ? -6.880  21.109 -20.534 1.00 62.66  ? 17  ILE Z C     1 
ATOM   118  O  O     . ILE A 1 17  ? -8.004  20.978 -20.052 1.00 68.18  ? 17  ILE Z O     1 
ATOM   119  C  CB    . ILE A 1 17  ? -5.324  22.997 -20.911 1.00 60.74  ? 17  ILE Z CB    1 
ATOM   120  C  CG1   . ILE A 1 17  ? -5.598  23.462 -19.477 1.00 59.08  ? 17  ILE Z CG1   1 
ATOM   121  C  CG2   . ILE A 1 17  ? -4.912  24.155 -21.817 1.00 55.14  ? 17  ILE Z CG2   1 
ATOM   122  C  CD1   . ILE A 1 17  ? -4.352  23.804 -18.690 1.00 59.82  ? 17  ILE Z CD1   1 
ATOM   123  N  N     . HIS A 1 18  ? -5.873  20.288 -20.278 1.00 70.05  ? 18  HIS Z N     1 
ATOM   124  C  CA    . HIS A 1 18  ? -5.937  19.302 -19.221 1.00 71.47  ? 18  HIS Z CA    1 
ATOM   125  C  C     . HIS A 1 18  ? -4.684  19.435 -18.364 1.00 74.93  ? 18  HIS Z C     1 
ATOM   126  O  O     . HIS A 1 18  ? -3.662  19.920 -18.841 1.00 80.66  ? 18  HIS Z O     1 
ATOM   127  C  CB    . HIS A 1 18  ? -6.059  17.904 -19.794 1.00 70.33  ? 18  HIS Z CB    1 
ATOM   128  C  CG    . HIS A 1 18  ? -6.449  16.883 -18.780 1.00 70.95  ? 18  HIS Z CG    1 
ATOM   129  N  ND1   . HIS A 1 18  ? -5.527  16.219 -18.001 1.00 69.14  ? 18  HIS Z ND1   1 
ATOM   130  C  CD2   . HIS A 1 18  ? -7.664  16.427 -18.402 1.00 66.51  ? 18  HIS Z CD2   1 
ATOM   131  C  CE1   . HIS A 1 18  ? -6.158  15.386 -17.194 1.00 70.48  ? 18  HIS Z CE1   1 
ATOM   132  N  NE2   . HIS A 1 18  ? -7.455  15.494 -17.415 1.00 63.94  ? 18  HIS Z NE2   1 
ATOM   133  N  N     . VAL A 1 19  ? -4.755  19.009 -17.107 1.00 72.86  ? 19  VAL Z N     1 
ATOM   134  C  CA    . VAL A 1 19  ? -3.655  19.237 -16.169 1.00 76.68  ? 19  VAL Z CA    1 
ATOM   135  C  C     . VAL A 1 19  ? -2.370  18.498 -16.542 1.00 72.31  ? 19  VAL Z C     1 
ATOM   136  O  O     . VAL A 1 19  ? -1.293  18.833 -16.041 1.00 73.60  ? 19  VAL Z O     1 
ATOM   137  C  CB    . VAL A 1 19  ? -4.043  18.837 -14.726 1.00 85.65  ? 19  VAL Z CB    1 
ATOM   138  C  CG1   . VAL A 1 19  ? -4.337  17.360 -14.646 1.00 91.35  ? 19  VAL Z CG1   1 
ATOM   139  C  CG2   . VAL A 1 19  ? -2.948  19.214 -13.750 1.00 92.20  ? 19  VAL Z CG2   1 
ATOM   140  N  N     . ARG A 1 20  ? -2.481  17.503 -17.420 1.00 74.87  ? 20  ARG Z N     1 
ATOM   141  C  CA    . ARG A 1 20  ? -1.314  16.775 -17.906 1.00 73.20  ? 20  ARG Z CA    1 
ATOM   142  C  C     . ARG A 1 20  ? -0.302  17.728 -18.513 1.00 70.04  ? 20  ARG Z C     1 
ATOM   143  O  O     . ARG A 1 20  ? 0.886   17.430 -18.556 1.00 70.30  ? 20  ARG Z O     1 
ATOM   144  C  CB    . ARG A 1 20  ? -1.711  15.731 -18.944 1.00 78.05  ? 20  ARG Z CB    1 
ATOM   145  C  CG    . ARG A 1 20  ? -2.647  14.651 -18.445 1.00 79.85  ? 20  ARG Z CG    1 
ATOM   146  C  CD    . ARG A 1 20  ? -2.914  13.606 -19.530 1.00 81.91  ? 20  ARG Z CD    1 
ATOM   147  N  NE    . ARG A 1 20  ? -3.457  14.189 -20.756 1.00 82.31  ? 20  ARG Z NE    1 
ATOM   148  C  CZ    . ARG A 1 20  ? -2.729  14.477 -21.834 1.00 83.89  ? 20  ARG Z CZ    1 
ATOM   149  N  NH1   . ARG A 1 20  ? -1.424  14.236 -21.835 1.00 87.13  ? 20  ARG Z NH1   1 
ATOM   150  N  NH2   . ARG A 1 20  ? -3.303  15.007 -22.908 1.00 79.35  ? 20  ARG Z NH2   1 
ATOM   151  N  N     . LYS A 1 21  ? -0.792  18.872 -18.984 1.00 60.99  ? 21  LYS Z N     1 
ATOM   152  C  CA    . LYS A 1 21  ? 0.046   19.926 -19.545 1.00 66.67  ? 21  LYS Z CA    1 
ATOM   153  C  C     . LYS A 1 21  ? 1.203   20.242 -18.613 1.00 74.63  ? 21  LYS Z C     1 
ATOM   154  O  O     . LYS A 1 21  ? 2.308   20.541 -19.059 1.00 81.28  ? 21  LYS Z O     1 
ATOM   155  C  CB    . LYS A 1 21  ? -0.784  21.190 -19.803 1.00 62.76  ? 21  LYS Z CB    1 
ATOM   156  C  CG    . LYS A 1 21  ? -0.074  22.296 -20.580 1.00 67.33  ? 21  LYS Z CG    1 
ATOM   157  C  CD    . LYS A 1 21  ? -1.022  23.469 -20.806 1.00 75.64  ? 21  LYS Z CD    1 
ATOM   158  C  CE    . LYS A 1 21  ? -0.546  24.399 -21.909 1.00 82.79  ? 21  LYS Z CE    1 
ATOM   159  N  NZ    . LYS A 1 21  ? 0.680   25.140 -21.513 1.00 85.31  ? 21  LYS Z NZ    1 
ATOM   160  N  N     . TYR A 1 22  ? 0.942   20.157 -17.315 1.00 70.17  ? 22  TYR Z N     1 
ATOM   161  C  CA    . TYR A 1 22  ? 1.945   20.471 -16.313 1.00 71.76  ? 22  TYR Z CA    1 
ATOM   162  C  C     . TYR A 1 22  ? 2.404   19.218 -15.593 1.00 72.53  ? 22  TYR Z C     1 
ATOM   163  O  O     . TYR A 1 22  ? 2.737   19.264 -14.415 1.00 70.06  ? 22  TYR Z O     1 
ATOM   164  C  CB    . TYR A 1 22  ? 1.392   21.487 -15.317 1.00 67.15  ? 22  TYR Z CB    1 
ATOM   165  C  CG    . TYR A 1 22  ? 0.959   22.773 -15.975 1.00 62.97  ? 22  TYR Z CG    1 
ATOM   166  C  CD1   . TYR A 1 22  ? 1.856   23.821 -16.155 1.00 63.04  ? 22  TYR Z CD1   1 
ATOM   167  C  CD2   . TYR A 1 22  ? -0.338  22.934 -16.436 1.00 59.93  ? 22  TYR Z CD2   1 
ATOM   168  C  CE1   . TYR A 1 22  ? 1.470   24.999 -16.768 1.00 63.73  ? 22  TYR Z CE1   1 
ATOM   169  C  CE2   . TYR A 1 22  ? -0.734  24.108 -17.050 1.00 60.89  ? 22  TYR Z CE2   1 
ATOM   170  C  CZ    . TYR A 1 22  ? 0.175   25.138 -17.214 1.00 66.82  ? 22  TYR Z CZ    1 
ATOM   171  O  OH    . TYR A 1 22  ? -0.206  26.311 -17.826 1.00 74.93  ? 22  TYR Z OH    1 
ATOM   172  N  N     . LYS A 1 23  ? 2.421   18.097 -16.307 1.00 77.07  ? 23  LYS Z N     1 
ATOM   173  C  CA    . LYS A 1 23  ? 2.870   16.834 -15.735 1.00 75.88  ? 23  LYS Z CA    1 
ATOM   174  C  C     . LYS A 1 23  ? 4.339   16.910 -15.330 1.00 76.52  ? 23  LYS Z C     1 
ATOM   175  O  O     . LYS A 1 23  ? 5.208   17.170 -16.163 1.00 76.78  ? 23  LYS Z O     1 
ATOM   176  C  CB    . LYS A 1 23  ? 2.654   15.694 -16.729 1.00 79.77  ? 23  LYS Z CB    1 
ATOM   177  C  CG    . LYS A 1 23  ? 3.021   14.310 -16.214 1.00 84.78  ? 23  LYS Z CG    1 
ATOM   178  C  CD    . LYS A 1 23  ? 2.720   13.245 -17.267 1.00 91.79  ? 23  LYS Z CD    1 
ATOM   179  C  CE    . LYS A 1 23  ? 3.100   11.855 -16.788 1.00 96.02  ? 23  LYS Z CE    1 
ATOM   180  N  NZ    . LYS A 1 23  ? 2.808   10.817 -17.813 1.00 97.97  ? 23  LYS Z NZ    1 
ATOM   181  N  N     . GLY A 1 24  ? 4.607   16.687 -14.046 1.00 78.78  ? 24  GLY Z N     1 
ATOM   182  C  CA    . GLY A 1 24  ? 5.964   16.728 -13.532 1.00 77.41  ? 24  GLY Z CA    1 
ATOM   183  C  C     . GLY A 1 24  ? 6.381   18.118 -13.098 1.00 76.94  ? 24  GLY Z C     1 
ATOM   184  O  O     . GLY A 1 24  ? 7.520   18.344 -12.684 1.00 75.51  ? 24  GLY Z O     1 
ATOM   185  N  N     . GLN A 1 25  ? 5.448   19.056 -13.196 1.00 74.80  ? 25  GLN Z N     1 
ATOM   186  C  CA    . GLN A 1 25  ? 5.699   20.429 -12.778 1.00 73.92  ? 25  GLN Z CA    1 
ATOM   187  C  C     . GLN A 1 25  ? 4.948   20.761 -11.487 1.00 71.71  ? 25  GLN Z C     1 
ATOM   188  O  O     . GLN A 1 25  ? 4.232   19.917 -10.938 1.00 67.74  ? 25  GLN Z O     1 
ATOM   189  C  CB    . GLN A 1 25  ? 5.309   21.398 -13.893 1.00 75.98  ? 25  GLN Z CB    1 
ATOM   190  C  CG    . GLN A 1 25  ? 6.070   21.156 -15.180 1.00 79.93  ? 25  GLN Z CG    1 
ATOM   191  C  CD    . GLN A 1 25  ? 5.618   22.063 -16.303 1.00 80.56  ? 25  GLN Z CD    1 
ATOM   192  O  OE1   . GLN A 1 25  ? 5.610   23.286 -16.164 1.00 83.71  ? 25  GLN Z OE1   1 
ATOM   193  N  NE2   . GLN A 1 25  ? 5.234   21.469 -17.423 1.00 77.41  ? 25  GLN Z NE2   1 
ATOM   194  N  N     . VAL A 1 26  ? 5.117   21.989 -11.002 1.00 71.70  ? 26  VAL Z N     1 
ATOM   195  C  CA    . VAL A 1 26  ? 4.506   22.399 -9.741  1.00 67.69  ? 26  VAL Z CA    1 
ATOM   196  C  C     . VAL A 1 26  ? 3.358   23.391 -9.956  1.00 64.14  ? 26  VAL Z C     1 
ATOM   197  O  O     . VAL A 1 26  ? 3.482   24.346 -10.727 1.00 58.88  ? 26  VAL Z O     1 
ATOM   198  C  CB    . VAL A 1 26  ? 5.552   23.021 -8.796  1.00 65.84  ? 26  VAL Z CB    1 
ATOM   199  C  CG1   . VAL A 1 26  ? 4.949   23.255 -7.423  1.00 68.53  ? 26  VAL Z CG1   1 
ATOM   200  C  CG2   . VAL A 1 26  ? 6.773   22.120 -8.693  1.00 58.23  ? 26  VAL Z CG2   1 
ATOM   201  N  N     . VAL A 1 27  ? 2.242   23.154 -9.271  1.00 65.01  ? 27  VAL Z N     1 
ATOM   202  C  CA    . VAL A 1 27  ? 1.055   23.992 -9.404  1.00 60.32  ? 27  VAL Z CA    1 
ATOM   203  C  C     . VAL A 1 27  ? 0.500   24.382 -8.042  1.00 60.52  ? 27  VAL Z C     1 
ATOM   204  O  O     . VAL A 1 27  ? 0.239   23.515 -7.214  1.00 67.12  ? 27  VAL Z O     1 
ATOM   205  C  CB    . VAL A 1 27  ? -0.053  23.276 -10.193 1.00 55.00  ? 27  VAL Z CB    1 
ATOM   206  C  CG1   . VAL A 1 27  ? -1.339  24.066 -10.128 1.00 55.82  ? 27  VAL Z CG1   1 
ATOM   207  C  CG2   . VAL A 1 27  ? 0.366   23.076 -11.628 1.00 52.88  ? 27  VAL Z CG2   1 
ATOM   208  N  N     . ALA A 1 28  ? 0.315   25.681 -7.817  1.00 56.19  ? 28  ALA Z N     1 
ATOM   209  C  CA    . ALA A 1 28  ? -0.278  26.177 -6.573  1.00 50.16  ? 28  ALA Z CA    1 
ATOM   210  C  C     . ALA A 1 28  ? -1.797  26.302 -6.691  1.00 52.92  ? 28  ALA Z C     1 
ATOM   211  O  O     . ALA A 1 28  ? -2.324  26.567 -7.765  1.00 62.18  ? 28  ALA Z O     1 
ATOM   212  C  CB    . ALA A 1 28  ? 0.334   27.508 -6.196  1.00 42.34  ? 28  ALA Z CB    1 
ATOM   213  N  N     . VAL A 1 29  ? -2.503  26.117 -5.585  1.00 47.85  ? 29  VAL Z N     1 
ATOM   214  C  CA    . VAL A 1 29  ? -3.953  26.047 -5.634  1.00 50.32  ? 29  VAL Z CA    1 
ATOM   215  C  C     . VAL A 1 29  ? -4.617  27.071 -4.728  1.00 57.65  ? 29  VAL Z C     1 
ATOM   216  O  O     . VAL A 1 29  ? -4.262  27.192 -3.559  1.00 60.41  ? 29  VAL Z O     1 
ATOM   217  C  CB    . VAL A 1 29  ? -4.448  24.643 -5.235  1.00 50.97  ? 29  VAL Z CB    1 
ATOM   218  C  CG1   . VAL A 1 29  ? -5.961  24.595 -5.220  1.00 51.03  ? 29  VAL Z CG1   1 
ATOM   219  C  CG2   . VAL A 1 29  ? -3.904  23.599 -6.180  1.00 55.32  ? 29  VAL Z CG2   1 
ATOM   220  N  N     . ASP A 1 30  ? -5.583  27.805 -5.267  1.00 56.36  ? 30  ASP Z N     1 
ATOM   221  C  CA    . ASP A 1 30  ? -6.450  28.648 -4.452  1.00 44.68  ? 30  ASP Z CA    1 
ATOM   222  C  C     . ASP A 1 30  ? -7.477  27.764 -3.743  1.00 46.45  ? 30  ASP Z C     1 
ATOM   223  O  O     . ASP A 1 30  ? -8.617  27.647 -4.190  1.00 47.52  ? 30  ASP Z O     1 
ATOM   224  C  CB    . ASP A 1 30  ? -7.144  29.697 -5.320  1.00 44.05  ? 30  ASP Z CB    1 
ATOM   225  C  CG    . ASP A 1 30  ? -7.676  30.867 -4.520  1.00 55.90  ? 30  ASP Z CG    1 
ATOM   226  O  OD1   . ASP A 1 30  ? -7.865  30.726 -3.296  1.00 60.16  ? 30  ASP Z OD1   1 
ATOM   227  O  OD2   . ASP A 1 30  ? -7.913  31.932 -5.126  1.00 49.27  ? 30  ASP Z OD2   1 
ATOM   228  N  N     . THR A 1 31  ? -7.065  27.155 -2.632  1.00 51.65  ? 31  THR Z N     1 
ATOM   229  C  CA    . THR A 1 31  ? -7.829  26.085 -1.987  1.00 52.15  ? 31  THR Z CA    1 
ATOM   230  C  C     . THR A 1 31  ? -9.200  26.512 -1.446  1.00 53.16  ? 31  THR Z C     1 
ATOM   231  O  O     . THR A 1 31  ? -10.100 25.688 -1.326  1.00 52.75  ? 31  THR Z O     1 
ATOM   232  C  CB    . THR A 1 31  ? -7.019  25.457 -0.830  1.00 50.31  ? 31  THR Z CB    1 
ATOM   233  O  OG1   . THR A 1 31  ? -5.810  24.889 -1.345  1.00 52.25  ? 31  THR Z OG1   1 
ATOM   234  C  CG2   . THR A 1 31  ? -7.814  24.369 -0.147  1.00 50.65  ? 31  THR Z CG2   1 
ATOM   235  N  N     . TYR A 1 32  ? -9.368  27.792 -1.132  1.00 60.62  ? 32  TYR Z N     1 
ATOM   236  C  CA    . TYR A 1 32  ? -10.617 28.258 -0.531  1.00 64.24  ? 32  TYR Z CA    1 
ATOM   237  C  C     . TYR A 1 32  ? -11.815 28.092 -1.467  1.00 66.71  ? 32  TYR Z C     1 
ATOM   238  O  O     . TYR A 1 32  ? -12.961 28.067 -1.015  1.00 66.35  ? 32  TYR Z O     1 
ATOM   239  C  CB    . TYR A 1 32  ? -10.494 29.722 -0.089  1.00 62.65  ? 32  TYR Z CB    1 
ATOM   240  C  CG    . TYR A 1 32  ? -10.200 29.890 1.390   1.00 70.11  ? 32  TYR Z CG    1 
ATOM   241  C  CD1   . TYR A 1 32  ? -8.969  29.520 1.924   1.00 68.03  ? 32  TYR Z CD1   1 
ATOM   242  C  CD2   . TYR A 1 32  ? -11.151 30.418 2.255   1.00 73.97  ? 32  TYR Z CD2   1 
ATOM   243  C  CE1   . TYR A 1 32  ? -8.694  29.667 3.284   1.00 66.21  ? 32  TYR Z CE1   1 
ATOM   244  C  CE2   . TYR A 1 32  ? -10.882 30.571 3.617   1.00 70.28  ? 32  TYR Z CE2   1 
ATOM   245  C  CZ    . TYR A 1 32  ? -9.653  30.192 4.122   1.00 66.58  ? 32  TYR Z CZ    1 
ATOM   246  O  OH    . TYR A 1 32  ? -9.378  30.340 5.463   1.00 55.27  ? 32  TYR Z OH    1 
ATOM   247  N  N     . CYS A 1 33  ? -11.551 27.974 -2.766  1.00 64.15  ? 33  CYS Z N     1 
ATOM   248  C  CA    . CYS A 1 33  ? -12.615 27.748 -3.741  1.00 66.88  ? 33  CYS Z CA    1 
ATOM   249  C  C     . CYS A 1 33  ? -13.160 26.350 -3.570  1.00 63.01  ? 33  CYS Z C     1 
ATOM   250  O  O     . CYS A 1 33  ? -14.375 26.133 -3.488  1.00 72.63  ? 33  CYS Z O     1 
ATOM   251  C  CB    . CYS A 1 33  ? -12.105 27.935 -5.167  1.00 71.58  ? 33  CYS Z CB    1 
ATOM   252  S  SG    . CYS A 1 33  ? -11.452 29.570 -5.518  1.00 73.98  ? 33  CYS Z SG    1 
ATOM   253  N  N     . TRP A 1 34  ? -12.238 25.400 -3.521  1.00 56.76  ? 34  TRP Z N     1 
ATOM   254  C  CA    . TRP A 1 34  ? -12.588 24.018 -3.261  1.00 66.46  ? 34  TRP Z CA    1 
ATOM   255  C  C     . TRP A 1 34  ? -13.227 23.884 -1.884  1.00 66.44  ? 34  TRP Z C     1 
ATOM   256  O  O     . TRP A 1 34  ? -14.091 23.038 -1.681  1.00 70.53  ? 34  TRP Z O     1 
ATOM   257  C  CB    . TRP A 1 34  ? -11.357 23.118 -3.361  1.00 65.42  ? 34  TRP Z CB    1 
ATOM   258  C  CG    . TRP A 1 34  ? -10.760 23.037 -4.733  1.00 64.54  ? 34  TRP Z CG    1 
ATOM   259  C  CD1   . TRP A 1 34  ? -11.296 23.510 -5.896  1.00 67.06  ? 34  TRP Z CD1   1 
ATOM   260  C  CD2   . TRP A 1 34  ? -9.505  22.445 -5.084  1.00 63.26  ? 34  TRP Z CD2   1 
ATOM   261  N  NE1   . TRP A 1 34  ? -10.452 23.249 -6.947  1.00 63.23  ? 34  TRP Z NE1   1 
ATOM   262  C  CE2   . TRP A 1 34  ? -9.346  22.597 -6.475  1.00 65.98  ? 34  TRP Z CE2   1 
ATOM   263  C  CE3   . TRP A 1 34  ? -8.501  21.799 -4.356  1.00 62.51  ? 34  TRP Z CE3   1 
ATOM   264  C  CZ2   . TRP A 1 34  ? -8.224  22.129 -7.149  1.00 69.62  ? 34  TRP Z CZ2   1 
ATOM   265  C  CZ3   . TRP A 1 34  ? -7.388  21.336 -5.029  1.00 66.32  ? 34  TRP Z CZ3   1 
ATOM   266  C  CH2   . TRP A 1 34  ? -7.258  21.504 -6.411  1.00 71.68  ? 34  TRP Z CH2   1 
ATOM   267  N  N     . LEU A 1 35  ? -12.797 24.719 -0.941  1.00 66.17  ? 35  LEU Z N     1 
ATOM   268  C  CA    . LEU A 1 35  ? -13.335 24.692 0.416   1.00 62.94  ? 35  LEU Z CA    1 
ATOM   269  C  C     . LEU A 1 35  ? -14.782 25.164 0.444   1.00 62.48  ? 35  LEU Z C     1 
ATOM   270  O  O     . LEU A 1 35  ? -15.608 24.595 1.151   1.00 66.47  ? 35  LEU Z O     1 
ATOM   271  C  CB    . LEU A 1 35  ? -12.482 25.547 1.353   1.00 61.58  ? 35  LEU Z CB    1 
ATOM   272  C  CG    . LEU A 1 35  ? -11.440 24.767 2.150   1.00 64.84  ? 35  LEU Z CG    1 
ATOM   273  C  CD1   . LEU A 1 35  ? -10.565 25.705 2.939   1.00 68.83  ? 35  LEU Z CD1   1 
ATOM   274  C  CD2   . LEU A 1 35  ? -12.135 23.796 3.074   1.00 59.12  ? 35  LEU Z CD2   1 
ATOM   275  N  N     . HIS A 1 36  ? -15.085 26.204 -0.328  1.00 59.31  ? 36  HIS Z N     1 
ATOM   276  C  CA    . HIS A 1 36  ? -16.452 26.703 -0.412  1.00 66.42  ? 36  HIS Z CA    1 
ATOM   277  C  C     . HIS A 1 36  ? -17.344 25.695 -1.117  1.00 68.40  ? 36  HIS Z C     1 
ATOM   278  O  O     . HIS A 1 36  ? -18.393 25.287 -0.584  1.00 76.19  ? 36  HIS Z O     1 
ATOM   279  C  CB    . HIS A 1 36  ? -16.501 28.048 -1.137  1.00 71.99  ? 36  HIS Z CB    1 
ATOM   280  C  CG    . HIS A 1 36  ? -16.286 29.227 -0.237  1.00 81.74  ? 36  HIS Z CG    1 
ATOM   281  N  ND1   . HIS A 1 36  ? -17.304 29.790 0.506   1.00 88.13  ? 36  HIS Z ND1   1 
ATOM   282  C  CD2   . HIS A 1 36  ? -15.173 29.944 0.044   1.00 84.09  ? 36  HIS Z CD2   1 
ATOM   283  C  CE1   . HIS A 1 36  ? -16.825 30.805 1.204   1.00 83.38  ? 36  HIS Z CE1   1 
ATOM   284  N  NE2   . HIS A 1 36  ? -15.535 30.921 0.944   1.00 80.17  ? 36  HIS Z NE2   1 
ATOM   285  N  N     . LYS A 1 37  ? -16.917 25.282 -2.307  1.00 64.44  ? 37  LYS Z N     1 
ATOM   286  C  CA    . LYS A 1 37  ? -17.706 24.341 -3.092  1.00 70.67  ? 37  LYS Z CA    1 
ATOM   287  C  C     . LYS A 1 37  ? -17.938 23.047 -2.312  1.00 73.22  ? 37  LYS Z C     1 
ATOM   288  O  O     . LYS A 1 37  ? -19.013 22.458 -2.381  1.00 86.94  ? 37  LYS Z O     1 
ATOM   289  C  CB    . LYS A 1 37  ? -17.030 24.056 -4.438  1.00 74.33  ? 37  LYS Z CB    1 
ATOM   290  C  CG    . LYS A 1 37  ? -16.960 25.278 -5.364  1.00 81.41  ? 37  LYS Z CG    1 
ATOM   291  C  CD    . LYS A 1 37  ? -16.735 24.890 -6.824  1.00 90.09  ? 37  LYS Z CD    1 
ATOM   292  C  CE    . LYS A 1 37  ? -15.454 24.093 -6.999  1.00 95.07  ? 37  LYS Z CE    1 
ATOM   293  N  NZ    . LYS A 1 37  ? -15.231 23.701 -8.416  1.00 99.37  ? 37  LYS Z NZ    1 
ATOM   294  N  N     . GLY A 1 38  ? -16.943 22.631 -1.538  1.00 69.58  ? 38  GLY Z N     1 
ATOM   295  C  CA    . GLY A 1 38  ? -17.054 21.427 -0.734  1.00 70.74  ? 38  GLY Z CA    1 
ATOM   296  C  C     . GLY A 1 38  ? -17.929 21.597 0.492   1.00 75.73  ? 38  GLY Z C     1 
ATOM   297  O  O     . GLY A 1 38  ? -18.632 20.670 0.899   1.00 78.47  ? 38  GLY Z O     1 
ATOM   298  N  N     . ALA A 1 39  ? -17.880 22.786 1.085   1.00 75.12  ? 39  ALA Z N     1 
ATOM   299  C  CA    . ALA A 1 39  ? -18.659 23.073 2.281   1.00 72.05  ? 39  ALA Z CA    1 
ATOM   300  C  C     . ALA A 1 39  ? -20.129 23.227 1.936   1.00 75.87  ? 39  ALA Z C     1 
ATOM   301  O  O     . ALA A 1 39  ? -20.995 23.063 2.799   1.00 81.01  ? 39  ALA Z O     1 
ATOM   302  C  CB    . ALA A 1 39  ? -18.145 24.324 2.973   1.00 69.92  ? 39  ALA Z CB    1 
ATOM   303  N  N     . ILE A 1 40  ? -20.413 23.548 0.678   1.00 73.62  ? 40  ILE Z N     1 
ATOM   304  C  CA    . ILE A 1 40  ? -21.802 23.646 0.243   1.00 80.28  ? 40  ILE Z CA    1 
ATOM   305  C  C     . ILE A 1 40  ? -22.522 22.300 0.367   1.00 82.77  ? 40  ILE Z C     1 
ATOM   306  O  O     . ILE A 1 40  ? -23.696 22.245 0.750   1.00 89.72  ? 40  ILE Z O     1 
ATOM   307  C  CB    . ILE A 1 40  ? -21.888 24.165 -1.199  1.00 75.57  ? 40  ILE Z CB    1 
ATOM   308  C  CG1   . ILE A 1 40  ? -21.470 25.631 -1.229  1.00 73.27  ? 40  ILE Z CG1   1 
ATOM   309  C  CG2   . ILE A 1 40  ? -23.297 24.026 -1.754  1.00 79.58  ? 40  ILE Z CG2   1 
ATOM   310  C  CD1   . ILE A 1 40  ? -21.169 26.141 -2.597  1.00 78.10  ? 40  ILE Z CD1   1 
ATOM   311  N  N     . ALA A 1 41  ? -21.800 21.220 0.074   1.00 84.27  ? 41  ALA Z N     1 
ATOM   312  C  CA    . ALA A 1 41  ? -22.352 19.868 0.138   1.00 80.62  ? 41  ALA Z CA    1 
ATOM   313  C  C     . ALA A 1 41  ? -22.934 19.548 1.508   1.00 87.30  ? 41  ALA Z C     1 
ATOM   314  O  O     . ALA A 1 41  ? -23.943 18.850 1.612   1.00 88.97  ? 41  ALA Z O     1 
ATOM   315  C  CB    . ALA A 1 41  ? -21.285 18.842 -0.225  1.00 78.60  ? 41  ALA Z CB    1 
ATOM   316  N  N     . CYS A 1 42  ? -22.296 20.062 2.556   1.00 83.26  ? 42  CYS Z N     1 
ATOM   317  C  CA    . CYS A 1 42  ? -22.743 19.824 3.926   1.00 88.61  ? 42  CYS Z CA    1 
ATOM   318  C  C     . CYS A 1 42  ? -23.089 21.132 4.640   1.00 86.53  ? 42  CYS Z C     1 
ATOM   319  O  O     . CYS A 1 42  ? -22.673 21.372 5.775   1.00 88.47  ? 42  CYS Z O     1 
ATOM   320  C  CB    . CYS A 1 42  ? -21.673 19.053 4.709   1.00 94.10  ? 42  CYS Z CB    1 
ATOM   321  S  SG    . CYS A 1 42  ? -19.989 19.718 4.565   1.00 94.34  ? 42  CYS Z SG    1 
ATOM   322  N  N     . ALA A 1 43  ? -23.865 21.969 3.964   1.00 88.52  ? 43  ALA Z N     1 
ATOM   323  C  CA    . ALA A 1 43  ? -24.186 23.291 4.476   1.00 83.84  ? 43  ALA Z CA    1 
ATOM   324  C  C     . ALA A 1 43  ? -25.046 23.222 5.725   1.00 86.90  ? 43  ALA Z C     1 
ATOM   325  O  O     . ALA A 1 43  ? -24.837 23.979 6.668   1.00 89.43  ? 43  ALA Z O     1 
ATOM   326  C  CB    . ALA A 1 43  ? -24.884 24.112 3.408   1.00 76.53  ? 43  ALA Z CB    1 
ATOM   327  N  N     . GLU A 1 44  ? -26.008 22.325 5.740   1.00 83.75  ? 44  GLU Z N     1 
ATOM   328  C  CA    . GLU A 1 44  ? -26.934 22.221 6.847   1.00 87.75  ? 44  GLU Z CA    1 
ATOM   329  C  C     . GLU A 1 44  ? -26.224 21.845 8.121   1.00 88.63  ? 44  GLU Z C     1 
ATOM   330  O  O     . GLU A 1 44  ? -26.514 22.352 9.175   1.00 88.13  ? 44  GLU Z O     1 
ATOM   331  C  CB    . GLU A 1 44  ? -27.970 21.179 6.509   1.00 94.51  ? 44  GLU Z CB    1 
ATOM   332  C  CG    . GLU A 1 44  ? -27.376 19.804 6.296   1.00 106.99 ? 44  GLU Z CG    1 
ATOM   333  C  CD    . GLU A 1 44  ? -26.825 19.593 4.905   1.00 114.33 ? 44  GLU Z CD    1 
ATOM   334  O  OE1   . GLU A 1 44  ? -27.556 19.810 3.924   1.00 114.69 ? 44  GLU Z OE1   1 
ATOM   335  O  OE2   . GLU A 1 44  ? -25.660 19.189 4.802   1.00 117.53 ? 44  GLU Z OE2   1 
ATOM   336  N  N     . LYS A 1 45  ? -25.276 20.947 8.016   1.00 91.10  ? 45  LYS Z N     1 
ATOM   337  C  CA    . LYS A 1 45  ? -24.518 20.505 9.182   1.00 89.64  ? 45  LYS Z CA    1 
ATOM   338  C  C     . LYS A 1 45  ? -23.690 21.648 9.763   1.00 83.62  ? 45  LYS Z C     1 
ATOM   339  O  O     . LYS A 1 45  ? -23.656 21.855 10.978  1.00 86.90  ? 45  LYS Z O     1 
ATOM   340  C  CB    . LYS A 1 45  ? -23.609 19.327 8.812   1.00 91.47  ? 45  LYS Z CB    1 
ATOM   341  C  CG    . LYS A 1 45  ? -24.124 17.943 9.232   1.00 94.97  ? 45  LYS Z CG    1 
ATOM   342  C  CD    . LYS A 1 45  ? -25.463 17.593 8.580   1.00 94.35  ? 45  LYS Z CD    1 
ATOM   343  C  CE    . LYS A 1 45  ? -25.838 16.133 8.813   1.00 94.01  ? 45  LYS Z CE    1 
ATOM   344  N  NZ    . LYS A 1 45  ? -25.798 15.773 10.256  1.00 93.93  ? 45  LYS Z NZ    1 
ATOM   345  N  N     . LEU A 1 46  ? -23.023 22.390 8.886   1.00 83.01  ? 46  LEU Z N     1 
ATOM   346  C  CA    . LEU A 1 46  ? -22.193 23.508 9.311   1.00 84.56  ? 46  LEU Z CA    1 
ATOM   347  C  C     . LEU A 1 46  ? -23.047 24.621 9.913   1.00 89.09  ? 46  LEU Z C     1 
ATOM   348  O  O     . LEU A 1 46  ? -22.615 25.328 10.826  1.00 89.73  ? 46  LEU Z O     1 
ATOM   349  C  CB    . LEU A 1 46  ? -21.373 24.030 8.133   1.00 80.78  ? 46  LEU Z CB    1 
ATOM   350  C  CG    . LEU A 1 46  ? -20.336 23.045 7.592   1.00 75.45  ? 46  LEU Z CG    1 
ATOM   351  C  CD1   . LEU A 1 46  ? -19.682 23.601 6.340   1.00 77.38  ? 46  LEU Z CD1   1 
ATOM   352  C  CD2   . LEU A 1 46  ? -19.291 22.719 8.655   1.00 76.36  ? 46  LEU Z CD2   1 
ATOM   353  N  N     . ALA A 1 47  ? -24.265 24.758 9.398   1.00 93.38  ? 47  ALA Z N     1 
ATOM   354  C  CA    . ALA A 1 47  ? -25.207 25.754 9.893   1.00 88.93  ? 47  ALA Z CA    1 
ATOM   355  C  C     . ALA A 1 47  ? -25.768 25.341 11.252  1.00 93.45  ? 47  ALA Z C     1 
ATOM   356  O  O     . ALA A 1 47  ? -25.917 26.174 12.152  1.00 95.78  ? 47  ALA Z O     1 
ATOM   357  C  CB    . ALA A 1 47  ? -26.335 25.965 8.890   1.00 82.47  ? 47  ALA Z CB    1 
ATOM   358  N  N     . LYS A 1 48  ? -26.076 24.055 11.405  1.00 92.82  ? 48  LYS Z N     1 
ATOM   359  C  CA    . LYS A 1 48  ? -26.618 23.557 12.665  1.00 92.04  ? 48  LYS Z CA    1 
ATOM   360  C  C     . LYS A 1 48  ? -25.553 23.553 13.758  1.00 98.08  ? 48  LYS Z C     1 
ATOM   361  O  O     . LYS A 1 48  ? -25.863 23.687 14.941  1.00 100.66 ? 48  LYS Z O     1 
ATOM   362  C  CB    . LYS A 1 48  ? -27.195 22.148 12.493  1.00 85.11  ? 48  LYS Z CB    1 
ATOM   363  C  CG    . LYS A 1 48  ? -28.556 22.080 11.798  1.00 79.97  ? 48  LYS Z CG    1 
ATOM   364  C  CD    . LYS A 1 48  ? -29.051 20.633 11.737  1.00 90.33  ? 48  LYS Z CD    1 
ATOM   365  C  CE    . LYS A 1 48  ? -30.438 20.517 11.119  1.00 91.92  ? 48  LYS Z CE    1 
ATOM   366  N  NZ    . LYS A 1 48  ? -30.909 19.099 11.116  1.00 88.62  ? 48  LYS Z NZ    1 
ATOM   367  N  N     . GLY A 1 49  ? -24.297 23.399 13.353  1.00 92.12  ? 49  GLY Z N     1 
ATOM   368  C  CA    . GLY A 1 49  ? -23.201 23.290 14.299  1.00 93.58  ? 49  GLY Z CA    1 
ATOM   369  C  C     . GLY A 1 49  ? -22.726 21.856 14.428  1.00 92.55  ? 49  GLY Z C     1 
ATOM   370  O  O     . GLY A 1 49  ? -21.743 21.568 15.113  1.00 91.37  ? 49  GLY Z O     1 
ATOM   371  N  N     . GLU A 1 50  ? -23.435 20.952 13.761  1.00 88.25  ? 50  GLU Z N     1 
ATOM   372  C  CA    . GLU A 1 50  ? -23.086 19.542 13.768  1.00 89.36  ? 50  GLU Z CA    1 
ATOM   373  C  C     . GLU A 1 50  ? -21.752 19.329 13.061  1.00 92.89  ? 50  GLU Z C     1 
ATOM   374  O  O     . GLU A 1 50  ? -21.473 19.969 12.048  1.00 96.30  ? 50  GLU Z O     1 
ATOM   375  C  CB    . GLU A 1 50  ? -24.195 18.721 13.108  1.00 89.99  ? 50  GLU Z CB    1 
ATOM   376  C  CG    . GLU A 1 50  ? -25.563 18.906 13.764  1.00 95.19  ? 50  GLU Z CG    1 
ATOM   377  C  CD    . GLU A 1 50  ? -26.672 18.163 13.045  1.00 101.12 ? 50  GLU Z CD    1 
ATOM   378  O  OE1   . GLU A 1 50  ? -27.816 18.165 13.544  1.00 102.08 ? 50  GLU Z OE1   1 
ATOM   379  O  OE2   . GLU A 1 50  ? -26.403 17.578 11.979  1.00 104.93 ? 50  GLU Z OE2   1 
ATOM   380  N  N     . PRO A 1 51  ? -20.916 18.438 13.606  1.00 92.71  ? 51  PRO Z N     1 
ATOM   381  C  CA    . PRO A 1 51  ? -19.575 18.182 13.069  1.00 94.65  ? 51  PRO Z CA    1 
ATOM   382  C  C     . PRO A 1 51  ? -19.611 17.531 11.682  1.00 97.79  ? 51  PRO Z C     1 
ATOM   383  O  O     . PRO A 1 51  ? -20.490 16.713 11.403  1.00 92.91  ? 51  PRO Z O     1 
ATOM   384  C  CB    . PRO A 1 51  ? -18.960 17.240 14.110  1.00 91.86  ? 51  PRO Z CB    1 
ATOM   385  C  CG    . PRO A 1 51  ? -20.131 16.554 14.726  1.00 92.05  ? 51  PRO Z CG    1 
ATOM   386  C  CD    . PRO A 1 51  ? -21.216 17.587 14.770  1.00 91.49  ? 51  PRO Z CD    1 
ATOM   387  N  N     . THR A 1 52  ? -18.664 17.900 10.829  1.00 96.59  ? 52  THR Z N     1 
ATOM   388  C  CA    . THR A 1 52  ? -18.554 17.372 9.478   1.00 93.61  ? 52  THR Z CA    1 
ATOM   389  C  C     . THR A 1 52  ? -17.115 17.292 9.014   1.00 93.52  ? 52  THR Z C     1 
ATOM   390  O  O     . THR A 1 52  ? -16.234 17.849 9.621   1.00 92.81  ? 52  THR Z O     1 
ATOM   391  C  CB    . THR A 1 52  ? -19.322 18.211 8.474   1.00 93.49  ? 52  THR Z CB    1 
ATOM   392  O  OG1   . THR A 1 52  ? -19.354 17.541 7.219   1.00 96.07  ? 52  THR Z OG1   1 
ATOM   393  C  CG2   . THR A 1 52  ? -18.621 19.480 8.293   1.00 92.81  ? 52  THR Z CG2   1 
ATOM   394  N  N     . ASP A 1 53  ? -16.876 16.556 7.949   1.00 92.86  ? 53  ASP Z N     1 
ATOM   395  C  CA    . ASP A 1 53  ? -15.559 16.529 7.319   1.00 89.53  ? 53  ASP Z CA    1 
ATOM   396  C  C     . ASP A 1 53  ? -15.674 16.152 5.848   1.00 85.73  ? 53  ASP Z C     1 
ATOM   397  O  O     . ASP A 1 53  ? -14.747 15.579 5.282   1.00 94.10  ? 53  ASP Z O     1 
ATOM   398  C  CB    . ASP A 1 53  ? -14.621 15.552 8.044   1.00 95.93  ? 53  ASP Z CB    1 
ATOM   399  C  CG    . ASP A 1 53  ? -15.123 14.112 8.006   1.00 103.69 ? 53  ASP Z CG    1 
ATOM   400  O  OD1   . ASP A 1 53  ? -16.329 13.881 8.270   1.00 104.10 ? 53  ASP Z OD1   1 
ATOM   401  O  OD2   . ASP A 1 53  ? -14.304 13.209 7.719   1.00 108.08 ? 53  ASP Z OD2   1 
ATOM   402  N  N     . ARG A 1 54  ? -16.811 16.478 5.236   1.00 80.96  ? 54  ARG Z N     1 
ATOM   403  C  CA    . ARG A 1 54  ? -17.068 16.104 3.848   1.00 82.71  ? 54  ARG Z CA    1 
ATOM   404  C  C     . ARG A 1 54  ? -16.256 16.955 2.866   1.00 86.03  ? 54  ARG Z C     1 
ATOM   405  O  O     . ARG A 1 54  ? -15.768 16.456 1.839   1.00 89.96  ? 54  ARG Z O     1 
ATOM   406  C  CB    . ARG A 1 54  ? -18.560 16.219 3.532   1.00 80.83  ? 54  ARG Z CB    1 
ATOM   407  C  CG    . ARG A 1 54  ? -18.948 15.588 2.203   1.00 83.81  ? 54  ARG Z CG    1 
ATOM   408  C  CD    . ARG A 1 54  ? -20.458 15.546 2.023   1.00 88.32  ? 54  ARG Z CD    1 
ATOM   409  N  NE    . ARG A 1 54  ? -20.863 14.729 0.880   1.00 93.41  ? 54  ARG Z NE    1 
ATOM   410  C  CZ    . ARG A 1 54  ? -22.126 14.430 0.589   1.00 97.46  ? 54  ARG Z CZ    1 
ATOM   411  N  NH1   . ARG A 1 54  ? -23.112 14.880 1.355   1.00 92.60  ? 54  ARG Z NH1   1 
ATOM   412  N  NH2   . ARG A 1 54  ? -22.407 13.677 -0.465  1.00 102.53 ? 54  ARG Z NH2   1 
ATOM   413  N  N     . TYR A 1 55  ? -16.109 18.237 3.191   1.00 69.14  ? 55  TYR Z N     1 
ATOM   414  C  CA    . TYR A 1 55  ? -15.334 19.157 2.366   1.00 72.66  ? 55  TYR Z CA    1 
ATOM   415  C  C     . TYR A 1 55  ? -13.874 18.711 2.266   1.00 74.87  ? 55  TYR Z C     1 
ATOM   416  O  O     . TYR A 1 55  ? -13.204 18.943 1.253   1.00 79.43  ? 55  TYR Z O     1 
ATOM   417  C  CB    . TYR A 1 55  ? -15.427 20.584 2.925   1.00 74.88  ? 55  TYR Z CB    1 
ATOM   418  C  CG    . TYR A 1 55  ? -15.140 20.711 4.410   1.00 75.89  ? 55  TYR Z CG    1 
ATOM   419  C  CD1   . TYR A 1 55  ? -13.840 20.866 4.878   1.00 77.23  ? 55  TYR Z CD1   1 
ATOM   420  C  CD2   . TYR A 1 55  ? -16.172 20.693 5.342   1.00 74.91  ? 55  TYR Z CD2   1 
ATOM   421  C  CE1   . TYR A 1 55  ? -13.573 20.989 6.237   1.00 76.67  ? 55  TYR Z CE1   1 
ATOM   422  C  CE2   . TYR A 1 55  ? -15.916 20.814 6.705   1.00 73.03  ? 55  TYR Z CE2   1 
ATOM   423  C  CZ    . TYR A 1 55  ? -14.615 20.962 7.148   1.00 77.04  ? 55  TYR Z CZ    1 
ATOM   424  O  OH    . TYR A 1 55  ? -14.363 21.083 8.504   1.00 81.18  ? 55  TYR Z OH    1 
ATOM   425  N  N     . VAL A 1 56  ? -13.394 18.060 3.320   1.00 71.39  ? 56  VAL Z N     1 
ATOM   426  C  CA    . VAL A 1 56  ? -12.048 17.515 3.327   1.00 65.97  ? 56  VAL Z CA    1 
ATOM   427  C  C     . VAL A 1 56  ? -11.887 16.552 2.159   1.00 70.13  ? 56  VAL Z C     1 
ATOM   428  O  O     . VAL A 1 56  ? -10.984 16.699 1.337   1.00 74.97  ? 56  VAL Z O     1 
ATOM   429  C  CB    . VAL A 1 56  ? -11.733 16.789 4.650   1.00 63.71  ? 56  VAL Z CB    1 
ATOM   430  C  CG1   . VAL A 1 56  ? -10.325 16.228 4.620   1.00 64.86  ? 56  VAL Z CG1   1 
ATOM   431  C  CG2   . VAL A 1 56  ? -11.916 17.727 5.835   1.00 63.37  ? 56  VAL Z CG2   1 
ATOM   432  N  N     . GLY A 1 57  ? -12.789 15.581 2.077   1.00 70.99  ? 57  GLY Z N     1 
ATOM   433  C  CA    . GLY A 1 57  ? -12.749 14.598 1.016   1.00 73.59  ? 57  GLY Z CA    1 
ATOM   434  C  C     . GLY A 1 57  ? -12.963 15.256 -0.327  1.00 72.57  ? 57  GLY Z C     1 
ATOM   435  O  O     . GLY A 1 57  ? -12.344 14.870 -1.322  1.00 69.74  ? 57  GLY Z O     1 
ATOM   436  N  N     . PHE A 1 58  ? -13.838 16.258 -0.353  1.00 72.72  ? 58  PHE Z N     1 
ATOM   437  C  CA    . PHE A 1 58  ? -14.126 16.963 -1.594  1.00 70.72  ? 58  PHE Z CA    1 
ATOM   438  C  C     . PHE A 1 58  ? -12.849 17.558 -2.171  1.00 72.99  ? 58  PHE Z C     1 
ATOM   439  O  O     . PHE A 1 58  ? -12.588 17.448 -3.369  1.00 81.78  ? 58  PHE Z O     1 
ATOM   440  C  CB    . PHE A 1 58  ? -15.170 18.055 -1.367  1.00 67.20  ? 58  PHE Z CB    1 
ATOM   441  C  CG    . PHE A 1 58  ? -15.651 18.710 -2.632  1.00 70.32  ? 58  PHE Z CG    1 
ATOM   442  C  CD1   . PHE A 1 58  ? -16.708 18.172 -3.345  1.00 79.77  ? 58  PHE Z CD1   1 
ATOM   443  C  CD2   . PHE A 1 58  ? -15.054 19.869 -3.103  1.00 71.17  ? 58  PHE Z CD2   1 
ATOM   444  C  CE1   . PHE A 1 58  ? -17.159 18.774 -4.505  1.00 84.92  ? 58  PHE Z CE1   1 
ATOM   445  C  CE2   . PHE A 1 58  ? -15.500 20.474 -4.256  1.00 76.28  ? 58  PHE Z CE2   1 
ATOM   446  C  CZ    . PHE A 1 58  ? -16.554 19.926 -4.958  1.00 80.20  ? 58  PHE Z CZ    1 
ATOM   447  N  N     . CYS A 1 59  ? -12.051 18.177 -1.309  1.00 63.82  ? 59  CYS Z N     1 
ATOM   448  C  CA    . CYS A 1 59  ? -10.778 18.742 -1.734  1.00 68.99  ? 59  CYS Z CA    1 
ATOM   449  C  C     . CYS A 1 59  ? -9.803  17.631 -2.102  1.00 77.13  ? 59  CYS Z C     1 
ATOM   450  O  O     . CYS A 1 59  ? -9.011  17.749 -3.053  1.00 80.00  ? 59  CYS Z O     1 
ATOM   451  C  CB    . CYS A 1 59  ? -10.185 19.623 -0.632  1.00 67.30  ? 59  CYS Z CB    1 
ATOM   452  S  SG    . CYS A 1 59  ? -11.252 20.978 -0.098  1.00 67.04  ? 59  CYS Z SG    1 
ATOM   453  N  N     . MET A 1 60  ? -9.874  16.543 -1.345  1.00 78.79  ? 60  MET Z N     1 
ATOM   454  C  CA    . MET A 1 60  ? -8.930  15.450 -1.512  1.00 77.93  ? 60  MET Z CA    1 
ATOM   455  C  C     . MET A 1 60  ? -9.121  14.726 -2.840  1.00 73.63  ? 60  MET Z C     1 
ATOM   456  O  O     . MET A 1 60  ? -8.187  14.117 -3.352  1.00 65.59  ? 60  MET Z O     1 
ATOM   457  C  CB    . MET A 1 60  ? -9.038  14.470 -0.344  1.00 81.32  ? 60  MET Z CB    1 
ATOM   458  C  CG    . MET A 1 60  ? -8.287  14.944 0.886   1.00 81.33  ? 60  MET Z CG    1 
ATOM   459  S  SD    . MET A 1 60  ? -6.584  15.387 0.473   1.00 79.57  ? 60  MET Z SD    1 
ATOM   460  C  CE    . MET A 1 60  ? -6.417  16.923 1.378   1.00 73.42  ? 60  MET Z CE    1 
ATOM   461  N  N     . LYS A 1 61  ? -10.324 14.799 -3.399  1.00 72.81  ? 61  LYS Z N     1 
ATOM   462  C  CA    . LYS A 1 61  ? -10.552 14.256 -4.730  1.00 72.47  ? 61  LYS Z CA    1 
ATOM   463  C  C     . LYS A 1 61  ? -9.652  14.969 -5.733  1.00 71.41  ? 61  LYS Z C     1 
ATOM   464  O  O     . LYS A 1 61  ? -8.921  14.334 -6.499  1.00 74.96  ? 61  LYS Z O     1 
ATOM   465  C  CB    . LYS A 1 61  ? -12.018 14.397 -5.140  1.00 75.32  ? 61  LYS Z CB    1 
ATOM   466  C  CG    . LYS A 1 61  ? -13.004 13.697 -4.220  1.00 83.13  ? 61  LYS Z CG    1 
ATOM   467  C  CD    . LYS A 1 61  ? -14.363 13.551 -4.891  1.00 91.79  ? 61  LYS Z CD    1 
ATOM   468  C  CE    . LYS A 1 61  ? -14.824 14.867 -5.504  1.00 94.93  ? 61  LYS Z CE    1 
ATOM   469  N  NZ    . LYS A 1 61  ? -16.049 14.709 -6.344  1.00 95.58  ? 61  LYS Z NZ    1 
ATOM   470  N  N     . PHE A 1 62  ? -9.707  16.296 -5.705  1.00 69.44  ? 62  PHE Z N     1 
ATOM   471  C  CA    . PHE A 1 62  ? -8.901  17.135 -6.581  1.00 68.18  ? 62  PHE Z CA    1 
ATOM   472  C  C     . PHE A 1 62  ? -7.407  16.947 -6.323  1.00 69.88  ? 62  PHE Z C     1 
ATOM   473  O  O     . PHE A 1 62  ? -6.617  16.816 -7.264  1.00 73.59  ? 62  PHE Z O     1 
ATOM   474  C  CB    . PHE A 1 62  ? -9.283  18.608 -6.404  1.00 62.44  ? 62  PHE Z CB    1 
ATOM   475  C  CG    . PHE A 1 62  ? -10.648 18.952 -6.932  1.00 62.38  ? 62  PHE Z CG    1 
ATOM   476  C  CD1   . PHE A 1 62  ? -11.791 18.617 -6.225  1.00 64.84  ? 62  PHE Z CD1   1 
ATOM   477  C  CD2   . PHE A 1 62  ? -10.787 19.624 -8.128  1.00 61.47  ? 62  PHE Z CD2   1 
ATOM   478  C  CE1   . PHE A 1 62  ? -13.046 18.938 -6.711  1.00 60.72  ? 62  PHE Z CE1   1 
ATOM   479  C  CE2   . PHE A 1 62  ? -12.040 19.948 -8.616  1.00 67.14  ? 62  PHE Z CE2   1 
ATOM   480  C  CZ    . PHE A 1 62  ? -13.170 19.604 -7.907  1.00 60.55  ? 62  PHE Z CZ    1 
ATOM   481  N  N     . VAL A 1 63  ? -7.022  16.932 -5.050  1.00 63.78  ? 63  VAL Z N     1 
ATOM   482  C  CA    . VAL A 1 63  ? -5.613  16.748 -4.707  1.00 64.76  ? 63  VAL Z CA    1 
ATOM   483  C  C     . VAL A 1 63  ? -5.076  15.419 -5.238  1.00 78.95  ? 63  VAL Z C     1 
ATOM   484  O  O     . VAL A 1 63  ? -4.027  15.375 -5.890  1.00 79.83  ? 63  VAL Z O     1 
ATOM   485  C  CB    . VAL A 1 63  ? -5.391  16.814 -3.190  1.00 70.94  ? 63  VAL Z CB    1 
ATOM   486  C  CG1   . VAL A 1 63  ? -3.945  16.475 -2.845  1.00 74.44  ? 63  VAL Z CG1   1 
ATOM   487  C  CG2   . VAL A 1 63  ? -5.751  18.188 -2.678  1.00 63.67  ? 63  VAL Z CG2   1 
ATOM   488  N  N     . ASN A 1 64  ? -5.807  14.344 -4.961  1.00 74.22  ? 64  ASN Z N     1 
ATOM   489  C  CA    . ASN A 1 64  ? -5.439  13.013 -5.428  1.00 75.39  ? 64  ASN Z CA    1 
ATOM   490  C  C     . ASN A 1 64  ? -5.392  12.933 -6.951  1.00 75.23  ? 64  ASN Z C     1 
ATOM   491  O  O     . ASN A 1 64  ? -4.511  12.284 -7.526  1.00 79.04  ? 64  ASN Z O     1 
ATOM   492  C  CB    . ASN A 1 64  ? -6.415  11.968 -4.885  1.00 73.27  ? 64  ASN Z CB    1 
ATOM   493  C  CG    . ASN A 1 64  ? -6.229  11.707 -3.404  1.00 75.32  ? 64  ASN Z CG    1 
ATOM   494  O  OD1   . ASN A 1 64  ? -5.142  11.901 -2.859  1.00 74.48  ? 64  ASN Z OD1   1 
ATOM   495  N  ND2   . ASN A 1 64  ? -7.290  11.254 -2.746  1.00 68.81  ? 64  ASN Z ND2   1 
ATOM   496  N  N     . MET A 1 65  ? -6.341  13.594 -7.603  1.00 77.90  ? 65  MET Z N     1 
ATOM   497  C  CA    . MET A 1 65  ? -6.362  13.621 -9.058  1.00 77.28  ? 65  MET Z CA    1 
ATOM   498  C  C     . MET A 1 65  ? -5.119  14.315 -9.603  1.00 76.15  ? 65  MET Z C     1 
ATOM   499  O  O     . MET A 1 65  ? -4.544  13.886 -10.600 1.00 69.44  ? 65  MET Z O     1 
ATOM   500  C  CB    . MET A 1 65  ? -7.617  14.318 -9.571  1.00 73.97  ? 65  MET Z CB    1 
ATOM   501  C  CG    . MET A 1 65  ? -7.785  14.224 -11.073 1.00 73.64  ? 65  MET Z CG    1 
ATOM   502  S  SD    . MET A 1 65  ? -8.132  15.814 -11.840 1.00 83.87  ? 65  MET Z SD    1 
ATOM   503  C  CE    . MET A 1 65  ? -6.599  16.686 -11.526 1.00 81.59  ? 65  MET Z CE    1 
ATOM   504  N  N     . LEU A 1 66  ? -4.712  15.395 -8.948  1.00 73.43  ? 66  LEU Z N     1 
ATOM   505  C  CA    . LEU A 1 66  ? -3.489  16.086 -9.332  1.00 73.31  ? 66  LEU Z CA    1 
ATOM   506  C  C     . LEU A 1 66  ? -2.268  15.198 -9.133  1.00 81.89  ? 66  LEU Z C     1 
ATOM   507  O  O     . LEU A 1 66  ? -1.378  15.154 -9.979  1.00 84.95  ? 66  LEU Z O     1 
ATOM   508  C  CB    . LEU A 1 66  ? -3.328  17.377 -8.534  1.00 72.15  ? 66  LEU Z CB    1 
ATOM   509  C  CG    . LEU A 1 66  ? -4.273  18.523 -8.896  1.00 67.39  ? 66  LEU Z CG    1 
ATOM   510  C  CD1   . LEU A 1 66  ? -4.118  19.650 -7.892  1.00 65.03  ? 66  LEU Z CD1   1 
ATOM   511  C  CD2   . LEU A 1 66  ? -4.005  19.018 -10.313 1.00 65.96  ? 66  LEU Z CD2   1 
ATOM   512  N  N     . LEU A 1 67  ? -2.231  14.491 -8.009  1.00 81.74  ? 67  LEU Z N     1 
ATOM   513  C  CA    . LEU A 1 67  ? -1.118  13.591 -7.712  1.00 81.33  ? 67  LEU Z CA    1 
ATOM   514  C  C     . LEU A 1 67  ? -1.003  12.435 -8.718  1.00 80.43  ? 67  LEU Z C     1 
ATOM   515  O  O     . LEU A 1 67  ? 0.104   12.011 -9.062  1.00 81.33  ? 67  LEU Z O     1 
ATOM   516  C  CB    . LEU A 1 67  ? -1.255  13.037 -6.291  1.00 81.37  ? 67  LEU Z CB    1 
ATOM   517  C  CG    . LEU A 1 67  ? -0.972  14.013 -5.149  1.00 78.78  ? 67  LEU Z CG    1 
ATOM   518  C  CD1   . LEU A 1 67  ? -1.207  13.341 -3.803  1.00 71.54  ? 67  LEU Z CD1   1 
ATOM   519  C  CD2   . LEU A 1 67  ? 0.453   14.546 -5.259  1.00 79.49  ? 67  LEU Z CD2   1 
ATOM   520  N  N     . SER A 1 68  ? -2.143  11.932 -9.191  1.00 78.03  ? 68  SER Z N     1 
ATOM   521  C  CA    . SER A 1 68  ? -2.152  10.809 -10.134 1.00 79.70  ? 68  SER Z CA    1 
ATOM   522  C  C     . SER A 1 68  ? -1.617  11.207 -11.516 1.00 85.45  ? 68  SER Z C     1 
ATOM   523  O  O     . SER A 1 68  ? -1.048  10.383 -12.235 1.00 85.80  ? 68  SER Z O     1 
ATOM   524  C  CB    . SER A 1 68  ? -3.568  10.219 -10.260 1.00 73.34  ? 68  SER Z CB    1 
ATOM   525  O  OG    . SER A 1 68  ? -4.465  11.116 -10.895 1.00 77.42  ? 68  SER Z OG    1 
ATOM   526  N  N     . HIS A 1 69  ? -1.724  12.470 -11.851 1.00 86.41  ? 69  HIS Z N     1 
ATOM   527  C  CA    . HIS A 1 69  ? -1.291  12.928 -13.145 1.00 86.54  ? 69  HIS Z CA    1 
ATOM   528  C  C     . HIS A 1 69  ? 0.127   13.408 -13.082 1.00 84.98  ? 69  HIS Z C     1 
ATOM   529  O  O     . HIS A 1 69  ? 0.620   13.994 -14.015 1.00 83.48  ? 69  HIS Z O     1 
ATOM   530  C  CB    . HIS A 1 69  ? -2.205  14.012 -13.678 1.00 85.82  ? 69  HIS Z CB    1 
ATOM   531  C  CG    . HIS A 1 69  ? -3.527  13.506 -14.157 1.00 85.51  ? 69  HIS Z CG    1 
ATOM   532  N  ND1   . HIS A 1 69  ? -3.772  13.198 -15.472 1.00 86.66  ? 69  HIS Z ND1   1 
ATOM   533  C  CD2   . HIS A 1 69  ? -4.683  13.280 -13.499 1.00 84.43  ? 69  HIS Z CD2   1 
ATOM   534  C  CE1   . HIS A 1 69  ? -5.020  12.792 -15.602 1.00 85.41  ? 69  HIS Z CE1   1 
ATOM   535  N  NE2   . HIS A 1 69  ? -5.596  12.836 -14.419 1.00 83.92  ? 69  HIS Z NE2   1 
ATOM   536  N  N     . GLY A 1 70  ? 0.772   13.183 -11.954 1.00 81.82  ? 70  GLY Z N     1 
ATOM   537  C  CA    . GLY A 1 70  ? 2.163   13.546 -11.779 1.00 78.10  ? 70  GLY Z CA    1 
ATOM   538  C  C     . GLY A 1 70  ? 2.383   14.985 -11.365 1.00 78.54  ? 70  GLY Z C     1 
ATOM   539  O  O     . GLY A 1 70  ? 3.517   15.455 -11.337 1.00 79.02  ? 70  GLY Z O     1 
ATOM   540  N  N     . ILE A 1 71  ? 1.302   15.686 -11.038 1.00 71.67  ? 71  ILE Z N     1 
ATOM   541  C  CA    . ILE A 1 71  ? 1.392   17.084 -10.636 1.00 79.69  ? 71  ILE Z CA    1 
ATOM   542  C  C     . ILE A 1 71  ? 1.779   17.194 -9.166  1.00 77.27  ? 71  ILE Z C     1 
ATOM   543  O  O     . ILE A 1 71  ? 1.354   16.385 -8.340  1.00 80.09  ? 71  ILE Z O     1 
ATOM   544  C  CB    . ILE A 1 71  ? 0.058   17.835 -10.860 1.00 74.46  ? 71  ILE Z CB    1 
ATOM   545  C  CG1   . ILE A 1 71  ? -0.617  17.387 -12.162 1.00 74.24  ? 71  ILE Z CG1   1 
ATOM   546  C  CG2   . ILE A 1 71  ? 0.275   19.338 -10.835 1.00 73.05  ? 71  ILE Z CG2   1 
ATOM   547  C  CD1   . ILE A 1 71  ? 0.139   17.743 -13.413 1.00 76.38  ? 71  ILE Z CD1   1 
ATOM   548  N  N     . LYS A 1 72  ? 2.595   18.189 -8.845  1.00 70.50  ? 72  LYS Z N     1 
ATOM   549  C  CA    . LYS A 1 72  ? 2.913   18.478 -7.456  1.00 72.25  ? 72  LYS Z CA    1 
ATOM   550  C  C     . LYS A 1 72  ? 2.123   19.698 -7.013  1.00 71.85  ? 72  LYS Z C     1 
ATOM   551  O  O     . LYS A 1 72  ? 2.490   20.827 -7.338  1.00 73.37  ? 72  LYS Z O     1 
ATOM   552  C  CB    . LYS A 1 72  ? 4.413   18.712 -7.266  1.00 75.38  ? 72  LYS Z CB    1 
ATOM   553  C  CG    . LYS A 1 72  ? 4.798   19.014 -5.823  1.00 72.04  ? 72  LYS Z CG    1 
ATOM   554  C  CD    . LYS A 1 72  ? 6.281   19.355 -5.674  1.00 82.29  ? 72  LYS Z CD    1 
ATOM   555  C  CE    . LYS A 1 72  ? 6.612   19.781 -4.238  1.00 84.41  ? 72  LYS Z CE    1 
ATOM   556  N  NZ    . LYS A 1 72  ? 8.060   20.099 -4.038  1.00 89.86  ? 72  LYS Z NZ    1 
ATOM   557  N  N     . PRO A 1 73  ? 1.020   19.476 -6.285  1.00 66.52  ? 73  PRO Z N     1 
ATOM   558  C  CA    . PRO A 1 73  ? 0.163   20.574 -5.835  1.00 65.61  ? 73  PRO Z CA    1 
ATOM   559  C  C     . PRO A 1 73  ? 0.652   21.228 -4.546  1.00 71.04  ? 73  PRO Z C     1 
ATOM   560  O  O     . PRO A 1 73  ? 1.133   20.538 -3.652  1.00 75.59  ? 73  PRO Z O     1 
ATOM   561  C  CB    . PRO A 1 73  ? -1.184  19.885 -5.613  1.00 63.51  ? 73  PRO Z CB    1 
ATOM   562  C  CG    . PRO A 1 73  ? -0.816  18.513 -5.193  1.00 66.66  ? 73  PRO Z CG    1 
ATOM   563  C  CD    . PRO A 1 73  ? 0.451   18.162 -5.938  1.00 69.07  ? 73  PRO Z CD    1 
ATOM   564  N  N     . ILE A 1 74  ? 0.529   22.550 -4.468  1.00 67.26  ? 74  ILE Z N     1 
ATOM   565  C  CA    . ILE A 1 74  ? 0.811   23.290 -3.246  1.00 64.81  ? 74  ILE Z CA    1 
ATOM   566  C  C     . ILE A 1 74  ? -0.440  24.034 -2.814  1.00 65.59  ? 74  ILE Z C     1 
ATOM   567  O  O     . ILE A 1 74  ? -0.789  25.060 -3.387  1.00 74.17  ? 74  ILE Z O     1 
ATOM   568  C  CB    . ILE A 1 74  ? 1.958   24.293 -3.427  1.00 64.00  ? 74  ILE Z CB    1 
ATOM   569  C  CG1   . ILE A 1 74  ? 3.252   23.565 -3.786  1.00 61.78  ? 74  ILE Z CG1   1 
ATOM   570  C  CG2   . ILE A 1 74  ? 2.147   25.109 -2.164  1.00 66.03  ? 74  ILE Z CG2   1 
ATOM   571  C  CD1   . ILE A 1 74  ? 4.438   24.485 -3.944  1.00 57.80  ? 74  ILE Z CD1   1 
ATOM   572  N  N     . LEU A 1 75  ? -1.122  23.507 -1.807  1.00 65.44  ? 75  LEU Z N     1 
ATOM   573  C  CA    . LEU A 1 75  ? -2.374  24.099 -1.364  1.00 60.20  ? 75  LEU Z CA    1 
ATOM   574  C  C     . LEU A 1 75  ? -2.131  25.381 -0.590  1.00 62.37  ? 75  LEU Z C     1 
ATOM   575  O  O     . LEU A 1 75  ? -1.519  25.361 0.479   1.00 74.36  ? 75  LEU Z O     1 
ATOM   576  C  CB    . LEU A 1 75  ? -3.156  23.116 -0.501  1.00 59.03  ? 75  LEU Z CB    1 
ATOM   577  C  CG    . LEU A 1 75  ? -3.409  21.747 -1.120  1.00 56.00  ? 75  LEU Z CG    1 
ATOM   578  C  CD1   . LEU A 1 75  ? -4.350  20.956 -0.242  1.00 59.75  ? 75  LEU Z CD1   1 
ATOM   579  C  CD2   . LEU A 1 75  ? -3.977  21.905 -2.507  1.00 52.66  ? 75  LEU Z CD2   1 
ATOM   580  N  N     . VAL A 1 76  ? -2.618  26.493 -1.131  1.00 55.02  ? 76  VAL Z N     1 
ATOM   581  C  CA    . VAL A 1 76  ? -2.449  27.793 -0.500  1.00 53.40  ? 76  VAL Z CA    1 
ATOM   582  C  C     . VAL A 1 76  ? -3.770  28.234 0.116   1.00 54.83  ? 76  VAL Z C     1 
ATOM   583  O  O     . VAL A 1 76  ? -4.824  28.037 -0.486  1.00 56.95  ? 76  VAL Z O     1 
ATOM   584  C  CB    . VAL A 1 76  ? -1.944  28.843 -1.511  1.00 43.74  ? 76  VAL Z CB    1 
ATOM   585  C  CG1   . VAL A 1 76  ? -1.869  30.217 -0.874  1.00 43.81  ? 76  VAL Z CG1   1 
ATOM   586  C  CG2   . VAL A 1 76  ? -0.582  28.437 -2.056  1.00 48.44  ? 76  VAL Z CG2   1 
ATOM   587  N  N     . PHE A 1 77  ? -3.712  28.811 1.316   1.00 54.17  ? 77  PHE Z N     1 
ATOM   588  C  CA    . PHE A 1 77  ? -4.917  29.231 2.030   1.00 51.59  ? 77  PHE Z CA    1 
ATOM   589  C  C     . PHE A 1 77  ? -4.916  30.715 2.409   1.00 44.62  ? 77  PHE Z C     1 
ATOM   590  O  O     . PHE A 1 77  ? -3.862  31.311 2.607   1.00 45.15  ? 77  PHE Z O     1 
ATOM   591  C  CB    . PHE A 1 77  ? -5.093  28.391 3.291   1.00 45.43  ? 77  PHE Z CB    1 
ATOM   592  C  CG    . PHE A 1 77  ? -5.185  26.922 3.030   1.00 47.83  ? 77  PHE Z CG    1 
ATOM   593  C  CD1   . PHE A 1 77  ? -4.044  26.170 2.821   1.00 49.72  ? 77  PHE Z CD1   1 
ATOM   594  C  CD2   . PHE A 1 77  ? -6.413  26.290 3.007   1.00 52.73  ? 77  PHE Z CD2   1 
ATOM   595  C  CE1   . PHE A 1 77  ? -4.128  24.819 2.583   1.00 56.88  ? 77  PHE Z CE1   1 
ATOM   596  C  CE2   . PHE A 1 77  ? -6.504  24.939 2.773   1.00 60.74  ? 77  PHE Z CE2   1 
ATOM   597  C  CZ    . PHE A 1 77  ? -5.360  24.202 2.559   1.00 64.70  ? 77  PHE Z CZ    1 
ATOM   598  N  N     . ASP A 1 78  ? -6.106  31.300 2.512   1.00 42.65  ? 78  ASP Z N     1 
ATOM   599  C  CA    . ASP A 1 78  ? -6.249  32.689 2.929   1.00 54.47  ? 78  ASP Z CA    1 
ATOM   600  C  C     . ASP A 1 78  ? -5.954  32.824 4.415   1.00 57.41  ? 78  ASP Z C     1 
ATOM   601  O  O     . ASP A 1 78  ? -6.372  31.985 5.209   1.00 58.47  ? 78  ASP Z O     1 
ATOM   602  C  CB    . ASP A 1 78  ? -7.657  33.209 2.631   1.00 55.00  ? 78  ASP Z CB    1 
ATOM   603  C  CG    . ASP A 1 78  ? -7.872  33.528 1.162   1.00 60.24  ? 78  ASP Z CG    1 
ATOM   604  O  OD1   . ASP A 1 78  ? -7.599  34.673 0.751   1.00 60.81  ? 78  ASP Z OD1   1 
ATOM   605  O  OD2   . ASP A 1 78  ? -8.335  32.639 0.421   1.00 68.90  ? 78  ASP Z OD2   1 
ATOM   606  N  N     . GLY A 1 79  ? -5.245  33.885 4.788   1.00 58.28  ? 79  GLY Z N     1 
ATOM   607  C  CA    . GLY A 1 79  ? -4.845  34.088 6.168   1.00 52.25  ? 79  GLY Z CA    1 
ATOM   608  C  C     . GLY A 1 79  ? -5.605  35.197 6.867   1.00 53.58  ? 79  GLY Z C     1 
ATOM   609  O  O     . GLY A 1 79  ? -6.818  35.113 7.049   1.00 59.59  ? 79  GLY Z O     1 
ATOM   610  N  N     . CYS A 1 80  ? -4.886  36.243 7.253   1.00 57.78  ? 80  CYS Z N     1 
ATOM   611  C  CA    . CYS A 1 80  ? -5.475  37.341 7.999   1.00 64.17  ? 80  CYS Z CA    1 
ATOM   612  C  C     . CYS A 1 80  ? -6.279  38.277 7.107   1.00 63.29  ? 80  CYS Z C     1 
ATOM   613  O  O     . CYS A 1 80  ? -5.993  38.428 5.924   1.00 62.82  ? 80  CYS Z O     1 
ATOM   614  C  CB    . CYS A 1 80  ? -4.383  38.121 8.728   1.00 65.27  ? 80  CYS Z CB    1 
ATOM   615  S  SG    . CYS A 1 80  ? -3.418  37.123 9.899   1.00 64.59  ? 80  CYS Z SG    1 
ATOM   616  N  N     . THR A 1 81  ? -7.294  38.899 7.690   1.00 69.83  ? 81  THR Z N     1 
ATOM   617  C  CA    . THR A 1 81  ? -8.118  39.844 6.965   1.00 71.23  ? 81  THR Z CA    1 
ATOM   618  C  C     . THR A 1 81  ? -7.293  41.045 6.543   1.00 66.93  ? 81  THR Z C     1 
ATOM   619  O  O     . THR A 1 81  ? -6.516  41.585 7.326   1.00 72.96  ? 81  THR Z O     1 
ATOM   620  C  CB    . THR A 1 81  ? -9.305  40.307 7.810   1.00 80.83  ? 81  THR Z CB    1 
ATOM   621  O  OG1   . THR A 1 81  ? -10.083 39.168 8.189   1.00 88.03  ? 81  THR Z OG1   1 
ATOM   622  C  CG2   . THR A 1 81  ? -10.176 41.271 7.031   1.00 83.72  ? 81  THR Z CG2   1 
ATOM   623  N  N     . LEU A 1 82  ? -7.456  41.447 5.292   1.00 68.86  ? 82  LEU Z N     1 
ATOM   624  C  CA    . LEU A 1 82  ? -6.785  42.625 4.779   1.00 64.50  ? 82  LEU Z CA    1 
ATOM   625  C  C     . LEU A 1 82  ? -7.664  43.852 4.988   1.00 65.59  ? 82  LEU Z C     1 
ATOM   626  O  O     . LEU A 1 82  ? -8.864  43.803 4.738   1.00 65.03  ? 82  LEU Z O     1 
ATOM   627  C  CB    . LEU A 1 82  ? -6.466  42.440 3.304   1.00 64.88  ? 82  LEU Z CB    1 
ATOM   628  C  CG    . LEU A 1 82  ? -5.482  43.416 2.679   1.00 64.11  ? 82  LEU Z CG    1 
ATOM   629  C  CD1   . LEU A 1 82  ? -4.102  43.177 3.245   1.00 59.49  ? 82  LEU Z CD1   1 
ATOM   630  C  CD2   . LEU A 1 82  ? -5.484  43.245 1.178   1.00 59.89  ? 82  LEU Z CD2   1 
ATOM   631  N  N     . PRO A 1 83  ? -7.075  44.954 5.471   1.00 61.89  ? 83  PRO Z N     1 
ATOM   632  C  CA    . PRO A 1 83  ? -7.820  46.202 5.676   1.00 68.89  ? 83  PRO Z CA    1 
ATOM   633  C  C     . PRO A 1 83  ? -8.491  46.706 4.403   1.00 71.96  ? 83  PRO Z C     1 
ATOM   634  O  O     . PRO A 1 83  ? -9.680  47.031 4.419   1.00 72.70  ? 83  PRO Z O     1 
ATOM   635  C  CB    . PRO A 1 83  ? -6.738  47.175 6.139   1.00 60.80  ? 83  PRO Z CB    1 
ATOM   636  C  CG    . PRO A 1 83  ? -5.725  46.308 6.796   1.00 59.55  ? 83  PRO Z CG    1 
ATOM   637  C  CD    . PRO A 1 83  ? -5.702  45.040 5.998   1.00 56.93  ? 83  PRO Z CD    1 
ATOM   638  N  N     . SER A 1 84  ? -7.730  46.755 3.313   1.00 67.62  ? 84  SER Z N     1 
ATOM   639  C  CA    . SER A 1 84  ? -8.235  47.214 2.020   1.00 78.62  ? 84  SER Z CA    1 
ATOM   640  C  C     . SER A 1 84  ? -9.487  46.461 1.575   1.00 84.18  ? 84  SER Z C     1 
ATOM   641  O  O     . SER A 1 84  ? -10.272 46.958 0.771   1.00 92.70  ? 84  SER Z O     1 
ATOM   642  C  CB    . SER A 1 84  ? -7.152  47.077 0.943   1.00 79.46  ? 84  SER Z CB    1 
ATOM   643  O  OG    . SER A 1 84  ? -6.127  48.045 1.100   1.00 81.37  ? 84  SER Z OG    1 
ATOM   644  N  N     . LYS A 1 85  ? -9.668  45.259 2.104   1.00 90.52  ? 85  LYS Z N     1 
ATOM   645  C  CA    . LYS A 1 85  ? -10.766 44.405 1.686   1.00 84.10  ? 85  LYS Z CA    1 
ATOM   646  C  C     . LYS A 1 85  ? -11.791 44.262 2.803   1.00 90.43  ? 85  LYS Z C     1 
ATOM   647  O  O     . LYS A 1 85  ? -12.863 43.690 2.592   1.00 95.29  ? 85  LYS Z O     1 
ATOM   648  C  CB    . LYS A 1 85  ? -10.232 43.030 1.263   1.00 70.01  ? 85  LYS Z CB    1 
ATOM   649  C  CG    . LYS A 1 85  ? -11.176 42.208 0.402   1.00 66.37  ? 85  LYS Z CG    1 
ATOM   650  C  CD    . LYS A 1 85  ? -10.578 40.848 0.072   1.00 59.95  ? 85  LYS Z CD    1 
ATOM   651  C  CE    . LYS A 1 85  ? -11.547 40.007 -0.737  1.00 62.70  ? 85  LYS Z CE    1 
ATOM   652  N  NZ    . LYS A 1 85  ? -11.030 38.636 -0.955  1.00 51.98  ? 85  LYS Z NZ    1 
ATOM   653  N  N     . LYS A 1 86  ? -11.472 44.799 3.982   1.00 91.10  ? 86  LYS Z N     1 
ATOM   654  C  CA    . LYS A 1 86  ? -12.299 44.574 5.171   1.00 89.66  ? 86  LYS Z CA    1 
ATOM   655  C  C     . LYS A 1 86  ? -13.739 45.022 4.941   1.00 91.78  ? 86  LYS Z C     1 
ATOM   656  O  O     . LYS A 1 86  ? -14.679 44.391 5.437   1.00 101.05 ? 86  LYS Z O     1 
ATOM   657  C  CB    . LYS A 1 86  ? -11.716 45.277 6.396   1.00 87.96  ? 86  LYS Z CB    1 
ATOM   658  C  CG    . LYS A 1 86  ? -12.441 44.913 7.687   1.00 88.58  ? 86  LYS Z CG    1 
ATOM   659  C  CD    . LYS A 1 86  ? -11.655 45.319 8.926   1.00 91.62  ? 86  LYS Z CD    1 
ATOM   660  C  CE    . LYS A 1 86  ? -10.362 44.530 9.058   1.00 90.39  ? 86  LYS Z CE    1 
ATOM   661  N  NZ    . LYS A 1 86  ? -9.632  44.864 10.317  1.00 94.07  ? 86  LYS Z NZ    1 
ATOM   662  N  N     . GLU A 1 87  ? -13.908 46.075 4.146   1.00 108.64 ? 87  GLU Z N     1 
ATOM   663  C  CA    . GLU A 1 87  ? -15.239 46.524 3.743   1.00 105.04 ? 87  GLU Z CA    1 
ATOM   664  C  C     . GLU A 1 87  ? -16.080 45.381 3.181   1.00 99.85  ? 87  GLU Z C     1 
ATOM   665  O  O     . GLU A 1 87  ? -17.162 45.082 3.697   1.00 100.72 ? 87  GLU Z O     1 
ATOM   666  C  CB    . GLU A 1 87  ? -15.134 47.650 2.712   1.00 110.33 ? 87  GLU Z CB    1 
ATOM   667  C  CG    . GLU A 1 87  ? -14.541 48.938 3.275   1.00 122.19 ? 87  GLU Z CG    1 
ATOM   668  C  CD    . GLU A 1 87  ? -14.373 50.033 2.220   1.00 131.71 ? 87  GLU Z CD    1 
ATOM   669  O  OE1   . GLU A 1 87  ? -14.538 49.737 1.015   1.00 134.61 ? 87  GLU Z OE1   1 
ATOM   670  O  OE2   . GLU A 1 87  ? -14.074 51.190 2.594   1.00 135.72 ? 87  GLU Z OE2   1 
ATOM   671  N  N     . VAL A 1 88  ? -15.564 44.726 2.147   1.00 101.57 ? 88  VAL Z N     1 
ATOM   672  C  CA    . VAL A 1 88  ? -16.264 43.607 1.538   1.00 103.60 ? 88  VAL Z CA    1 
ATOM   673  C  C     . VAL A 1 88  ? -16.459 42.507 2.600   1.00 107.55 ? 88  VAL Z C     1 
ATOM   674  O  O     . VAL A 1 88  ? -17.526 41.880 2.648   1.00 107.49 ? 88  VAL Z O     1 
ATOM   675  C  CB    . VAL A 1 88  ? -15.491 43.086 0.288   1.00 102.75 ? 88  VAL Z CB    1 
ATOM   676  C  CG1   . VAL A 1 88  ? -16.268 42.016 -0.466  1.00 100.94 ? 88  VAL Z CG1   1 
ATOM   677  C  CG2   . VAL A 1 88  ? -15.143 44.252 -0.659  1.00 101.33 ? 88  VAL Z CG2   1 
ATOM   678  N  N     . GLU A 1 89  ? -15.464 42.324 3.482   1.00 103.67 ? 89  GLU Z N     1 
ATOM   679  C  CA    . GLU A 1 89  ? -15.525 41.289 4.526   1.00 102.68 ? 89  GLU Z CA    1 
ATOM   680  C  C     . GLU A 1 89  ? -16.679 41.567 5.481   1.00 102.47 ? 89  GLU Z C     1 
ATOM   681  O  O     . GLU A 1 89  ? -17.236 40.661 6.097   1.00 99.20  ? 89  GLU Z O     1 
ATOM   682  C  CB    . GLU A 1 89  ? -14.207 41.219 5.311   1.00 104.19 ? 89  GLU Z CB    1 
ATOM   683  C  CG    . GLU A 1 89  ? -12.969 40.915 4.467   1.00 105.21 ? 89  GLU Z CG    1 
ATOM   684  C  CD    . GLU A 1 89  ? -12.532 39.465 4.563   1.00 106.97 ? 89  GLU Z CD    1 
ATOM   685  O  OE1   . GLU A 1 89  ? -12.999 38.756 5.487   1.00 108.06 ? 89  GLU Z OE1   1 
ATOM   686  O  OE2   . GLU A 1 89  ? -11.717 39.040 3.716   1.00 107.55 ? 89  GLU Z OE2   1 
ATOM   687  N  N     . ARG A 1 90  ? -17.030 42.841 5.604   1.00 109.58 ? 90  ARG Z N     1 
ATOM   688  C  CA    . ARG A 1 90  ? -18.126 43.224 6.476   1.00 112.09 ? 90  ARG Z CA    1 
ATOM   689  C  C     . ARG A 1 90  ? -19.462 42.962 5.775   1.00 111.94 ? 90  ARG Z C     1 
ATOM   690  O  O     . ARG A 1 90  ? -20.489 42.758 6.437   1.00 108.13 ? 90  ARG Z O     1 
ATOM   691  C  CB    . ARG A 1 90  ? -18.003 44.698 6.879   1.00 111.77 ? 90  ARG Z CB    1 
ATOM   692  C  CG    . ARG A 1 90  ? -18.828 45.117 8.091   1.00 108.33 ? 90  ARG Z CG    1 
ATOM   693  C  CD    . ARG A 1 90  ? -19.778 46.259 7.744   1.00 106.78 ? 90  ARG Z CD    1 
ATOM   694  N  NE    . ARG A 1 90  ? -19.081 47.461 7.296   1.00 106.44 ? 90  ARG Z NE    1 
ATOM   695  C  CZ    . ARG A 1 90  ? -19.049 47.877 6.034   1.00 102.54 ? 90  ARG Z CZ    1 
ATOM   696  N  NH1   . ARG A 1 90  ? -19.678 47.189 5.091   1.00 99.29  ? 90  ARG Z NH1   1 
ATOM   697  N  NH2   . ARG A 1 90  ? -18.391 48.984 5.715   1.00 101.88 ? 90  ARG Z NH2   1 
ATOM   698  N  N     . SER A 1 91  ? -19.465 42.970 4.446   1.00 108.70 ? 91  SER Z N     1 
ATOM   699  C  CA    . SER A 1 91  ? -20.727 42.857 3.737   1.00 109.86 ? 91  SER Z CA    1 
ATOM   700  C  C     . SER A 1 91  ? -21.123 41.399 3.617   1.00 102.12 ? 91  SER Z C     1 
ATOM   701  O  O     . SER A 1 91  ? -22.223 41.008 4.019   1.00 106.27 ? 91  SER Z O     1 
ATOM   702  C  CB    . SER A 1 91  ? -20.641 43.520 2.363   1.00 115.46 ? 91  SER Z CB    1 
ATOM   703  O  OG    . SER A 1 91  ? -19.646 42.931 1.528   1.00 119.38 ? 91  SER Z OG    1 
ATOM   704  N  N     . ARG A 1 92  ? -20.177 40.594 3.151   1.00 103.00 ? 92  ARG Z N     1 
ATOM   705  C  CA    . ARG A 1 92  ? -20.388 39.178 2.982   1.00 91.94  ? 92  ARG Z CA    1 
ATOM   706  C  C     . ARG A 1 92  ? -20.714 38.511 4.308   1.00 92.90  ? 92  ARG Z C     1 
ATOM   707  O  O     . ARG A 1 92  ? -21.628 37.721 4.385   1.00 94.29  ? 92  ARG Z O     1 
ATOM   708  C  CB    . ARG A 1 92  ? -19.121 38.533 2.435   1.00 87.69  ? 92  ARG Z CB    1 
ATOM   709  C  CG    . ARG A 1 92  ? -18.627 39.007 1.083   1.00 85.31  ? 92  ARG Z CG    1 
ATOM   710  C  CD    . ARG A 1 92  ? -17.412 38.194 0.663   1.00 85.16  ? 92  ARG Z CD    1 
ATOM   711  N  NE    . ARG A 1 92  ? -16.992 38.440 -0.708  1.00 86.21  ? 92  ARG Z NE    1 
ATOM   712  C  CZ    . ARG A 1 92  ? -15.815 38.089 -1.208  1.00 87.85  ? 92  ARG Z CZ    1 
ATOM   713  N  NH1   . ARG A 1 92  ? -14.929 37.477 -0.462  1.00 86.83  ? 92  ARG Z NH1   1 
ATOM   714  N  NH2   . ARG A 1 92  ? -15.521 38.354 -2.460  1.00 89.54  ? 92  ARG Z NH2   1 
ATOM   715  N  N     . ARG A 1 93  ? -19.977 38.848 5.353   1.00 94.17  ? 93  ARG Z N     1 
ATOM   716  C  CA    . ARG A 1 93  ? -20.240 38.369 6.710   1.00 97.59  ? 93  ARG Z CA    1 
ATOM   717  C  C     . ARG A 1 93  ? -21.633 38.759 7.178   1.00 96.33  ? 93  ARG Z C     1 
ATOM   718  O  O     . ARG A 1 93  ? -22.278 38.016 7.920   1.00 95.79  ? 93  ARG Z O     1 
ATOM   719  C  CB    . ARG A 1 93  ? -19.195 38.915 7.683   1.00 101.54 ? 93  ARG Z CB    1 
ATOM   720  C  CG    . ARG A 1 93  ? -19.416 38.521 9.124   1.00 104.87 ? 93  ARG Z CG    1 
ATOM   721  C  CD    . ARG A 1 93  ? -18.950 39.630 10.037  1.00 111.57 ? 93  ARG Z CD    1 
ATOM   722  N  NE    . ARG A 1 93  ? -19.134 39.301 11.446  1.00 117.46 ? 93  ARG Z NE    1 
ATOM   723  C  CZ    . ARG A 1 93  ? -19.125 40.202 12.424  1.00 122.87 ? 93  ARG Z CZ    1 
ATOM   724  N  NH1   . ARG A 1 93  ? -18.952 41.488 12.135  1.00 124.92 ? 93  ARG Z NH1   1 
ATOM   725  N  NH2   . ARG A 1 93  ? -19.295 39.824 13.689  1.00 124.67 ? 93  ARG Z NH2   1 
ATOM   726  N  N     . GLU A 1 94  ? -22.101 39.919 6.729   1.00 95.24  ? 94  GLU Z N     1 
ATOM   727  C  CA    . GLU A 1 94  ? -23.439 40.362 7.080   1.00 100.85 ? 94  GLU Z CA    1 
ATOM   728  C  C     . GLU A 1 94  ? -24.474 39.490 6.381   1.00 101.87 ? 94  GLU Z C     1 
ATOM   729  O  O     . GLU A 1 94  ? -25.387 38.959 7.027   1.00 100.94 ? 94  GLU Z O     1 
ATOM   730  C  CB    . GLU A 1 94  ? -23.644 41.830 6.709   1.00 107.64 ? 94  GLU Z CB    1 
ATOM   731  C  CG    . GLU A 1 94  ? -24.791 42.493 7.456   1.00 115.74 ? 94  GLU Z CG    1 
ATOM   732  C  CD    . GLU A 1 94  ? -24.537 42.593 8.958   1.00 120.47 ? 94  GLU Z CD    1 
ATOM   733  O  OE1   . GLU A 1 94  ? -25.486 42.353 9.739   1.00 121.89 ? 94  GLU Z OE1   1 
ATOM   734  O  OE2   . GLU A 1 94  ? -23.394 42.922 9.356   1.00 122.51 ? 94  GLU Z OE2   1 
ATOM   735  N  N     . ARG A 1 95  ? -24.311 39.332 5.068   1.00 100.52 ? 95  ARG Z N     1 
ATOM   736  C  CA    . ARG A 1 95  ? -25.236 38.543 4.255   1.00 100.64 ? 95  ARG Z CA    1 
ATOM   737  C  C     . ARG A 1 95  ? -25.450 37.158 4.862   1.00 94.96  ? 95  ARG Z C     1 
ATOM   738  O  O     . ARG A 1 95  ? -26.592 36.776 5.147   1.00 99.07  ? 95  ARG Z O     1 
ATOM   739  C  CB    . ARG A 1 95  ? -24.727 38.421 2.813   1.00 102.96 ? 95  ARG Z CB    1 
ATOM   740  C  CG    . ARG A 1 95  ? -25.741 37.814 1.842   1.00 105.78 ? 95  ARG Z CG    1 
ATOM   741  C  CD    . ARG A 1 95  ? -25.393 38.098 0.377   1.00 108.71 ? 95  ARG Z CD    1 
ATOM   742  N  NE    . ARG A 1 95  ? -24.593 37.046 -0.257  1.00 110.73 ? 95  ARG Z NE    1 
ATOM   743  C  CZ    . ARG A 1 95  ? -25.086 36.106 -1.063  1.00 110.50 ? 95  ARG Z CZ    1 
ATOM   744  N  NH1   . ARG A 1 95  ? -24.283 35.195 -1.604  1.00 106.11 ? 95  ARG Z NH1   1 
ATOM   745  N  NH2   . ARG A 1 95  ? -26.386 36.075 -1.334  1.00 113.98 ? 95  ARG Z NH2   1 
ATOM   746  N  N     . ARG A 1 96  ? -24.347 36.434 5.078   1.00 95.34  ? 96  ARG Z N     1 
ATOM   747  C  CA    . ARG A 1 96  ? -24.363 35.141 5.764   1.00 88.90  ? 96  ARG Z CA    1 
ATOM   748  C  C     . ARG A 1 96  ? -25.263 35.183 6.989   1.00 88.60  ? 96  ARG Z C     1 
ATOM   749  O  O     . ARG A 1 96  ? -26.176 34.361 7.127   1.00 89.09  ? 96  ARG Z O     1 
ATOM   750  C  CB    . ARG A 1 96  ? -22.952 34.724 6.192   1.00 87.08  ? 96  ARG Z CB    1 
ATOM   751  C  CG    . ARG A 1 96  ? -21.889 34.839 5.111   1.00 85.99  ? 96  ARG Z CG    1 
ATOM   752  C  CD    . ARG A 1 96  ? -20.543 34.339 5.626   1.00 86.46  ? 96  ARG Z CD    1 
ATOM   753  N  NE    . ARG A 1 96  ? -19.413 35.013 4.987   1.00 93.47  ? 96  ARG Z NE    1 
ATOM   754  C  CZ    . ARG A 1 96  ? -18.961 34.730 3.768   1.00 99.73  ? 96  ARG Z CZ    1 
ATOM   755  N  NH1   . ARG A 1 96  ? -19.548 33.787 3.041   1.00 98.47  ? 96  ARG Z NH1   1 
ATOM   756  N  NH2   . ARG A 1 96  ? -17.924 35.393 3.270   1.00 85.46  ? 96  ARG Z NH2   1 
ATOM   757  N  N     . GLN A 1 97  ? -25.017 36.167 7.855   1.00 89.85  ? 97  GLN Z N     1 
ATOM   758  C  CA    . GLN A 1 97  ? -25.783 36.313 9.086   1.00 96.60  ? 97  GLN Z CA    1 
ATOM   759  C  C     . GLN A 1 97  ? -27.278 36.290 8.776   1.00 102.94 ? 97  GLN Z C     1 
ATOM   760  O  O     . GLN A 1 97  ? -28.031 35.494 9.349   1.00 103.96 ? 97  GLN Z O     1 
ATOM   761  C  CB    . GLN A 1 97  ? -25.394 37.607 9.819   1.00 98.56  ? 97  GLN Z CB    1 
ATOM   762  C  CG    . GLN A 1 97  ? -26.218 37.907 11.086  1.00 102.36 ? 97  GLN Z CG    1 
ATOM   763  C  CD    . GLN A 1 97  ? -25.815 39.211 11.796  1.00 103.21 ? 97  GLN Z CD    1 
ATOM   764  O  OE1   . GLN A 1 97  ? -24.632 39.570 11.853  1.00 105.47 ? 97  GLN Z OE1   1 
ATOM   765  N  NE2   . GLN A 1 97  ? -26.805 39.919 12.343  1.00 100.77 ? 97  GLN Z NE2   1 
ATOM   766  N  N     . ALA A 1 98  ? -27.695 37.129 7.832   1.00 99.95  ? 98  ALA Z N     1 
ATOM   767  C  CA    . ALA A 1 98  ? -29.099 37.177 7.445   1.00 104.24 ? 98  ALA Z CA    1 
ATOM   768  C  C     . ALA A 1 98  ? -29.577 35.794 6.995   1.00 103.82 ? 98  ALA Z C     1 
ATOM   769  O  O     . ALA A 1 98  ? -30.596 35.290 7.476   1.00 108.70 ? 98  ALA Z O     1 
ATOM   770  C  CB    . ALA A 1 98  ? -29.315 38.207 6.347   1.00 104.32 ? 98  ALA Z CB    1 
ATOM   771  N  N     . ASN A 1 99  ? -28.813 35.165 6.108   1.00 106.40 ? 99  ASN Z N     1 
ATOM   772  C  CA    . ASN A 1 99  ? -29.192 33.860 5.586   1.00 100.95 ? 99  ASN Z CA    1 
ATOM   773  C  C     . ASN A 1 99  ? -29.168 32.793 6.682   1.00 99.10  ? 99  ASN Z C     1 
ATOM   774  O  O     . ASN A 1 99  ? -29.791 31.738 6.546   1.00 91.66  ? 99  ASN Z O     1 
ATOM   775  C  CB    . ASN A 1 99  ? -28.270 33.463 4.429   1.00 96.76  ? 99  ASN Z CB    1 
ATOM   776  C  CG    . ASN A 1 99  ? -28.418 34.376 3.222   1.00 92.97  ? 99  ASN Z CG    1 
ATOM   777  O  OD1   . ASN A 1 99  ? -29.187 34.091 2.301   1.00 95.85  ? 99  ASN Z OD1   1 
ATOM   778  N  ND2   . ASN A 1 99  ? -27.681 35.481 3.221   1.00 88.05  ? 99  ASN Z ND2   1 
ATOM   779  N  N     . LEU A 1 100 ? -28.455 33.068 7.770   1.00 98.39  ? 100 LEU Z N     1 
ATOM   780  C  CA    . LEU A 1 100 ? -28.410 32.118 8.867   1.00 99.02  ? 100 LEU Z CA    1 
ATOM   781  C  C     . LEU A 1 100 ? -29.684 32.265 9.688   1.00 100.48 ? 100 LEU Z C     1 
ATOM   782  O  O     . LEU A 1 100 ? -30.176 31.297 10.266  1.00 99.25  ? 100 LEU Z O     1 
ATOM   783  C  CB    . LEU A 1 100 ? -27.170 32.333 9.735   1.00 100.79 ? 100 LEU Z CB    1 
ATOM   784  C  CG    . LEU A 1 100 ? -26.971 31.329 10.875  1.00 102.20 ? 100 LEU Z CG    1 
ATOM   785  C  CD1   . LEU A 1 100 ? -26.916 29.913 10.317  1.00 101.54 ? 100 LEU Z CD1   1 
ATOM   786  C  CD2   . LEU A 1 100 ? -25.719 31.647 11.695  1.00 101.64 ? 100 LEU Z CD2   1 
ATOM   787  N  N     . LEU A 1 101 ? -30.219 33.482 9.725   1.00 99.80  ? 101 LEU Z N     1 
ATOM   788  C  CA    . LEU A 1 101 ? -31.457 33.744 10.449  1.00 103.19 ? 101 LEU Z CA    1 
ATOM   789  C  C     . LEU A 1 101 ? -32.628 33.201 9.648   1.00 110.25 ? 101 LEU Z C     1 
ATOM   790  O  O     . LEU A 1 101 ? -33.349 32.316 10.111  1.00 118.15 ? 101 LEU Z O     1 
ATOM   791  C  CB    . LEU A 1 101 ? -31.635 35.244 10.710  1.00 99.12  ? 101 LEU Z CB    1 
ATOM   792  C  CG    . LEU A 1 101 ? -32.902 35.661 11.462  1.00 100.35 ? 101 LEU Z CG    1 
ATOM   793  C  CD1   . LEU A 1 101 ? -32.858 35.063 12.846  1.00 102.13 ? 101 LEU Z CD1   1 
ATOM   794  C  CD2   . LEU A 1 101 ? -33.043 37.180 11.540  1.00 100.75 ? 101 LEU Z CD2   1 
ATOM   795  N  N     . LYS A 1 102 ? -32.789 33.740 8.441   1.00 109.92 ? 102 LYS Z N     1 
ATOM   796  C  CA    . LYS A 1 102 ? -33.858 33.362 7.520   1.00 112.94 ? 102 LYS Z CA    1 
ATOM   797  C  C     . LYS A 1 102 ? -34.006 31.849 7.427   1.00 114.87 ? 102 LYS Z C     1 
ATOM   798  O  O     . LYS A 1 102 ? -35.093 31.308 7.636   1.00 117.91 ? 102 LYS Z O     1 
ATOM   799  C  CB    . LYS A 1 102 ? -33.592 33.943 6.130   1.00 111.50 ? 102 LYS Z CB    1 
ATOM   800  C  CG    . LYS A 1 102 ? -34.769 33.842 5.171   1.00 115.27 ? 102 LYS Z CG    1 
ATOM   801  C  CD    . LYS A 1 102 ? -35.717 35.024 5.325   1.00 120.20 ? 102 LYS Z CD    1 
ATOM   802  C  CE    . LYS A 1 102 ? -35.033 36.338 4.954   1.00 121.21 ? 102 LYS Z CE    1 
ATOM   803  N  NZ    . LYS A 1 102 ? -35.937 37.521 5.074   1.00 122.80 ? 102 LYS Z NZ    1 
ATOM   804  N  N     . GLY A 1 103 ? -32.900 31.174 7.132   1.00 109.36 ? 103 GLY Z N     1 
ATOM   805  C  CA    . GLY A 1 103 ? -32.877 29.724 7.105   1.00 111.29 ? 103 GLY Z CA    1 
ATOM   806  C  C     . GLY A 1 103 ? -33.491 29.102 8.349   1.00 114.86 ? 103 GLY Z C     1 
ATOM   807  O  O     . GLY A 1 103 ? -34.406 28.285 8.238   1.00 116.76 ? 103 GLY Z O     1 
ATOM   808  N  N     . LYS A 1 104 ? -33.007 29.491 9.529   1.00 112.69 ? 104 LYS Z N     1 
ATOM   809  C  CA    . LYS A 1 104 ? -33.561 28.986 10.786  1.00 110.59 ? 104 LYS Z CA    1 
ATOM   810  C  C     . LYS A 1 104 ? -35.034 29.374 10.913  1.00 112.80 ? 104 LYS Z C     1 
ATOM   811  O  O     . LYS A 1 104 ? -35.860 28.580 11.382  1.00 121.27 ? 104 LYS Z O     1 
ATOM   812  C  CB    . LYS A 1 104 ? -32.763 29.507 11.983  1.00 106.47 ? 104 LYS Z CB    1 
ATOM   813  C  CG    . LYS A 1 104 ? -31.369 28.905 12.099  1.00 102.85 ? 104 LYS Z CG    1 
ATOM   814  C  CD    . LYS A 1 104 ? -30.551 29.585 13.194  1.00 101.08 ? 104 LYS Z CD    1 
ATOM   815  C  CE    . LYS A 1 104 ? -29.126 29.037 13.252  1.00 99.85  ? 104 LYS Z CE    1 
ATOM   816  N  NZ    . LYS A 1 104 ? -28.265 29.760 14.235  1.00 100.14 ? 104 LYS Z NZ    1 
ATOM   817  N  N     . GLN A 1 105 ? -35.355 30.586 10.461  1.00 113.12 ? 105 GLN Z N     1 
ATOM   818  C  CA    . GLN A 1 105 ? -36.732 31.073 10.452  1.00 118.19 ? 105 GLN Z CA    1 
ATOM   819  C  C     . GLN A 1 105 ? -37.588 30.200 9.560   1.00 119.45 ? 105 GLN Z C     1 
ATOM   820  O  O     . GLN A 1 105 ? -38.790 30.055 9.782   1.00 125.68 ? 105 GLN Z O     1 
ATOM   821  C  CB    . GLN A 1 105 ? -36.804 32.525 9.964   1.00 119.94 ? 105 GLN Z CB    1 
ATOM   822  C  CG    . GLN A 1 105 ? -38.206 33.160 9.962   1.00 127.00 ? 105 GLN Z CG    1 
ATOM   823  C  CD    . GLN A 1 105 ? -38.913 33.111 11.318  1.00 135.88 ? 105 GLN Z CD    1 
ATOM   824  O  OE1   . GLN A 1 105 ? -38.280 33.165 12.375  1.00 140.24 ? 105 GLN Z OE1   1 
ATOM   825  N  NE2   . GLN A 1 105 ? -40.240 33.009 11.283  1.00 138.49 ? 105 GLN Z NE2   1 
ATOM   826  N  N     . LEU A 1 106 ? -36.966 29.632 8.535   1.00 120.22 ? 106 LEU Z N     1 
ATOM   827  C  CA    . LEU A 1 106 ? -37.679 28.762 7.619   1.00 123.40 ? 106 LEU Z CA    1 
ATOM   828  C  C     . LEU A 1 106 ? -37.791 27.351 8.197   1.00 125.98 ? 106 LEU Z C     1 
ATOM   829  O  O     . LEU A 1 106 ? -38.660 26.581 7.787   1.00 127.39 ? 106 LEU Z O     1 
ATOM   830  C  CB    . LEU A 1 106 ? -36.987 28.744 6.255   1.00 120.31 ? 106 LEU Z CB    1 
ATOM   831  C  CG    . LEU A 1 106 ? -37.056 30.067 5.490   1.00 119.08 ? 106 LEU Z CG    1 
ATOM   832  C  CD1   . LEU A 1 106 ? -36.043 30.086 4.368   1.00 118.29 ? 106 LEU Z CD1   1 
ATOM   833  C  CD2   . LEU A 1 106 ? -38.460 30.309 4.949   1.00 121.26 ? 106 LEU Z CD2   1 
ATOM   834  N  N     . LEU A 1 107 ? -36.924 27.018 9.156   1.00 121.17 ? 107 LEU Z N     1 
ATOM   835  C  CA    . LEU A 1 107 ? -36.984 25.711 9.818   1.00 123.15 ? 107 LEU Z CA    1 
ATOM   836  C  C     . LEU A 1 107 ? -38.127 25.660 10.819  1.00 133.05 ? 107 LEU Z C     1 
ATOM   837  O  O     . LEU A 1 107 ? -38.697 24.599 11.087  1.00 132.77 ? 107 LEU Z O     1 
ATOM   838  C  CB    . LEU A 1 107 ? -35.672 25.389 10.532  1.00 117.17 ? 107 LEU Z CB    1 
ATOM   839  C  CG    . LEU A 1 107 ? -34.523 24.910 9.648   1.00 111.85 ? 107 LEU Z CG    1 
ATOM   840  C  CD1   . LEU A 1 107 ? -33.331 24.489 10.509  1.00 114.47 ? 107 LEU Z CD1   1 
ATOM   841  C  CD2   . LEU A 1 107 ? -34.983 23.778 8.728   1.00 108.91 ? 107 LEU Z CD2   1 
ATOM   842  N  N     . ARG A 1 108 ? -38.446 26.818 11.380  1.00 123.47 ? 108 ARG Z N     1 
ATOM   843  C  CA    . ARG A 1 108 ? -39.566 26.941 12.293  1.00 130.42 ? 108 ARG Z CA    1 
ATOM   844  C  C     . ARG A 1 108 ? -40.895 26.951 11.541  1.00 140.17 ? 108 ARG Z C     1 
ATOM   845  O  O     . ARG A 1 108 ? -41.913 26.496 12.059  1.00 143.21 ? 108 ARG Z O     1 
ATOM   846  C  CB    . ARG A 1 108 ? -39.405 28.204 13.128  1.00 125.71 ? 108 ARG Z CB    1 
ATOM   847  C  CG    . ARG A 1 108 ? -38.175 28.154 14.002  1.00 118.75 ? 108 ARG Z CG    1 
ATOM   848  C  CD    . ARG A 1 108 ? -37.643 29.534 14.293  1.00 118.07 ? 108 ARG Z CD    1 
ATOM   849  N  NE    . ARG A 1 108 ? -36.463 29.475 15.147  1.00 119.21 ? 108 ARG Z NE    1 
ATOM   850  C  CZ    . ARG A 1 108 ? -35.619 30.485 15.326  1.00 121.14 ? 108 ARG Z CZ    1 
ATOM   851  N  NH1   . ARG A 1 108 ? -35.819 31.638 14.702  1.00 121.78 ? 108 ARG Z NH1   1 
ATOM   852  N  NH2   . ARG A 1 108 ? -34.569 30.341 16.125  1.00 122.75 ? 108 ARG Z NH2   1 
ATOM   853  N  N     . GLU A 1 109 ? -40.879 27.458 10.312  1.00 131.89 ? 109 GLU Z N     1 
ATOM   854  C  CA    . GLU A 1 109 ? -42.098 27.542 9.514   1.00 137.35 ? 109 GLU Z CA    1 
ATOM   855  C  C     . GLU A 1 109 ? -42.342 26.251 8.738   1.00 137.55 ? 109 GLU Z C     1 
ATOM   856  O  O     . GLU A 1 109 ? -43.350 26.127 8.035   1.00 143.37 ? 109 GLU Z O     1 
ATOM   857  C  CB    . GLU A 1 109 ? -42.040 28.732 8.548   1.00 139.63 ? 109 GLU Z CB    1 
ATOM   858  C  CG    . GLU A 1 109 ? -42.044 30.097 9.232   1.00 142.18 ? 109 GLU Z CG    1 
ATOM   859  C  CD    . GLU A 1 109 ? -42.111 31.253 8.240   1.00 142.73 ? 109 GLU Z CD    1 
ATOM   860  O  OE1   . GLU A 1 109 ? -42.155 30.990 7.013   1.00 144.25 ? 109 GLU Z OE1   1 
ATOM   861  O  OE2   . GLU A 1 109 ? -42.122 32.423 8.691   1.00 141.29 ? 109 GLU Z OE2   1 
ATOM   862  N  N     . GLY A 1 110 ? -41.416 25.300 8.862   1.00 138.31 ? 110 GLY Z N     1 
ATOM   863  C  CA    . GLY A 1 110 ? -41.547 24.005 8.214   1.00 135.68 ? 110 GLY Z CA    1 
ATOM   864  C  C     . GLY A 1 110 ? -41.000 23.936 6.796   1.00 130.83 ? 110 GLY Z C     1 
ATOM   865  O  O     . GLY A 1 110 ? -40.822 22.843 6.252   1.00 127.75 ? 110 GLY Z O     1 
ATOM   866  N  N     . LYS A 1 111 ? -40.741 25.095 6.192   1.00 134.21 ? 111 LYS Z N     1 
ATOM   867  C  CA    . LYS A 1 111 ? -40.181 25.158 4.838   1.00 139.28 ? 111 LYS Z CA    1 
ATOM   868  C  C     . LYS A 1 111 ? -38.742 24.621 4.813   1.00 132.94 ? 111 LYS Z C     1 
ATOM   869  O  O     . LYS A 1 111 ? -37.838 25.191 5.441   1.00 134.17 ? 111 LYS Z O     1 
ATOM   870  C  CB    . LYS A 1 111 ? -40.226 26.597 4.300   1.00 142.53 ? 111 LYS Z CB    1 
ATOM   871  C  CG    . LYS A 1 111 ? -41.625 27.217 4.288   1.00 146.98 ? 111 LYS Z CG    1 
ATOM   872  C  CD    . LYS A 1 111 ? -41.592 28.690 3.890   1.00 148.23 ? 111 LYS Z CD    1 
ATOM   873  C  CE    . LYS A 1 111 ? -42.989 29.301 3.899   1.00 148.73 ? 111 LYS Z CE    1 
ATOM   874  N  NZ    . LYS A 1 111 ? -43.890 28.644 2.906   1.00 150.20 ? 111 LYS Z NZ    1 
ATOM   875  N  N     . VAL A 1 112 ? -38.535 23.491 4.150   1.00 138.18 ? 112 VAL Z N     1 
ATOM   876  C  CA    . VAL A 1 112 ? -37.220 22.863 4.138   1.00 130.06 ? 112 VAL Z CA    1 
ATOM   877  C  C     . VAL A 1 112 ? -36.339 23.187 2.949   1.00 130.97 ? 112 VAL Z C     1 
ATOM   878  O  O     . VAL A 1 112 ? -35.128 23.266 3.081   1.00 128.84 ? 112 VAL Z O     1 
ATOM   879  C  CB    . VAL A 1 112 ? -37.302 21.340 4.234   1.00 120.63 ? 112 VAL Z CB    1 
ATOM   880  C  CG1   . VAL A 1 112 ? -35.921 20.736 4.094   1.00 116.04 ? 112 VAL Z CG1   1 
ATOM   881  C  CG2   . VAL A 1 112 ? -37.986 20.902 5.519   1.00 118.11 ? 112 VAL Z CG2   1 
ATOM   882  N  N     . SER A 1 113 ? -36.940 23.359 1.786   1.00 126.69 ? 113 SER Z N     1 
ATOM   883  C  CA    . SER A 1 113 ? -36.165 23.658 0.579   1.00 130.39 ? 113 SER Z CA    1 
ATOM   884  C  C     . SER A 1 113 ? -35.565 25.064 0.635   1.00 131.53 ? 113 SER Z C     1 
ATOM   885  O  O     . SER A 1 113 ? -34.360 25.258 0.411   1.00 133.44 ? 113 SER Z O     1 
ATOM   886  C  CB    . SER A 1 113 ? -37.039 23.506 -0.671  1.00 133.21 ? 113 SER Z CB    1 
ATOM   887  O  OG    . SER A 1 113 ? -36.274 23.651 -1.858  1.00 131.93 ? 113 SER Z OG    1 
ATOM   888  N  N     . GLU A 1 114 ? -36.419 26.038 0.937   1.00 133.32 ? 114 GLU Z N     1 
ATOM   889  C  CA    . GLU A 1 114 ? -35.988 27.418 1.103   1.00 129.31 ? 114 GLU Z CA    1 
ATOM   890  C  C     . GLU A 1 114 ? -34.920 27.530 2.186   1.00 118.39 ? 114 GLU Z C     1 
ATOM   891  O  O     . GLU A 1 114 ? -33.935 28.256 2.023   1.00 114.88 ? 114 GLU Z O     1 
ATOM   892  C  CB    . GLU A 1 114 ? -37.181 28.310 1.446   1.00 137.68 ? 114 GLU Z CB    1 
ATOM   893  C  CG    . GLU A 1 114 ? -38.328 28.220 0.450   1.00 145.04 ? 114 GLU Z CG    1 
ATOM   894  C  CD    . GLU A 1 114 ? -39.469 29.169 0.791   1.00 149.66 ? 114 GLU Z CD    1 
ATOM   895  O  OE1   . GLU A 1 114 ? -39.273 30.055 1.661   1.00 149.81 ? 114 GLU Z OE1   1 
ATOM   896  O  OE2   . GLU A 1 114 ? -40.561 29.028 0.189   1.00 152.02 ? 114 GLU Z OE2   1 
ATOM   897  N  N     . ALA A 1 115 ? -35.122 26.805 3.285   1.00 120.08 ? 115 ALA Z N     1 
ATOM   898  C  CA    . ALA A 1 115 ? -34.177 26.800 4.399   1.00 114.38 ? 115 ALA Z CA    1 
ATOM   899  C  C     . ALA A 1 115 ? -32.788 26.324 3.964   1.00 115.50 ? 115 ALA Z C     1 
ATOM   900  O  O     . ALA A 1 115 ? -31.766 26.850 4.419   1.00 115.69 ? 115 ALA Z O     1 
ATOM   901  C  CB    . ALA A 1 115 ? -34.702 25.932 5.532   1.00 113.32 ? 115 ALA Z CB    1 
ATOM   902  N  N     . ARG A 1 116 ? -32.752 25.330 3.082   1.00 111.52 ? 116 ARG Z N     1 
ATOM   903  C  CA    . ARG A 1 116 ? -31.485 24.828 2.567   1.00 114.57 ? 116 ARG Z CA    1 
ATOM   904  C  C     . ARG A 1 116 ? -30.887 25.827 1.580   1.00 111.90 ? 116 ARG Z C     1 
ATOM   905  O  O     . ARG A 1 116 ? -29.669 26.007 1.529   1.00 111.35 ? 116 ARG Z O     1 
ATOM   906  C  CB    . ARG A 1 116 ? -31.670 23.455 1.913   1.00 120.68 ? 116 ARG Z CB    1 
ATOM   907  C  CG    . ARG A 1 116 ? -32.081 22.349 2.890   1.00 128.87 ? 116 ARG Z CG    1 
ATOM   908  C  CD    . ARG A 1 116 ? -32.072 20.969 2.224   1.00 136.80 ? 116 ARG Z CD    1 
ATOM   909  N  NE    . ARG A 1 116 ? -32.468 19.904 3.149   1.00 142.13 ? 116 ARG Z NE    1 
ATOM   910  C  CZ    . ARG A 1 116 ? -31.644 19.315 4.016   1.00 142.78 ? 116 ARG Z CZ    1 
ATOM   911  N  NH1   . ARG A 1 116 ? -32.094 18.352 4.819   1.00 142.20 ? 116 ARG Z NH1   1 
ATOM   912  N  NH2   . ARG A 1 116 ? -30.368 19.690 4.088   1.00 142.62 ? 116 ARG Z NH2   1 
ATOM   913  N  N     . GLU A 1 117 ? -31.746 26.487 0.808   1.00 115.04 ? 117 GLU Z N     1 
ATOM   914  C  CA    . GLU A 1 117 ? -31.275 27.529 -0.102  1.00 114.92 ? 117 GLU Z CA    1 
ATOM   915  C  C     . GLU A 1 117 ? -30.725 28.731 0.668   1.00 107.99 ? 117 GLU Z C     1 
ATOM   916  O  O     . GLU A 1 117 ? -29.981 29.543 0.118   1.00 104.65 ? 117 GLU Z O     1 
ATOM   917  C  CB    . GLU A 1 117 ? -32.390 27.984 -1.051  1.00 122.99 ? 117 GLU Z CB    1 
ATOM   918  C  CG    . GLU A 1 117 ? -32.594 27.075 -2.264  1.00 130.92 ? 117 GLU Z CG    1 
ATOM   919  C  CD    . GLU A 1 117 ? -33.282 27.781 -3.435  1.00 134.80 ? 117 GLU Z CD    1 
ATOM   920  O  OE1   . GLU A 1 117 ? -33.439 29.025 -3.393  1.00 133.91 ? 117 GLU Z OE1   1 
ATOM   921  O  OE2   . GLU A 1 117 ? -33.662 27.085 -4.404  1.00 136.43 ? 117 GLU Z OE2   1 
ATOM   922  N  N     . CYS A 1 118 ? -31.097 28.851 1.937   1.00 109.55 ? 118 CYS Z N     1 
ATOM   923  C  CA    . CYS A 1 118 ? -30.570 29.926 2.763   1.00 102.07 ? 118 CYS Z CA    1 
ATOM   924  C  C     . CYS A 1 118 ? -29.308 29.468 3.467   1.00 92.36  ? 118 CYS Z C     1 
ATOM   925  O  O     . CYS A 1 118 ? -28.391 30.259 3.677   1.00 90.90  ? 118 CYS Z O     1 
ATOM   926  C  CB    . CYS A 1 118 ? -31.606 30.402 3.783   1.00 100.89 ? 118 CYS Z CB    1 
ATOM   927  S  SG    . CYS A 1 118 ? -32.894 31.462 3.094   1.00 99.00  ? 118 CYS Z SG    1 
ATOM   928  N  N     . PHE A 1 119 ? -29.261 28.189 3.829   1.00 93.46  ? 119 PHE Z N     1 
ATOM   929  C  CA    . PHE A 1 119 ? -28.090 27.628 4.500   1.00 94.23  ? 119 PHE Z CA    1 
ATOM   930  C  C     . PHE A 1 119 ? -26.904 27.530 3.551   1.00 98.96  ? 119 PHE Z C     1 
ATOM   931  O  O     . PHE A 1 119 ? -25.749 27.635 3.971   1.00 99.46  ? 119 PHE Z O     1 
ATOM   932  C  CB    . PHE A 1 119 ? -28.398 26.246 5.076   1.00 96.44  ? 119 PHE Z CB    1 
ATOM   933  C  CG    . PHE A 1 119 ? -29.263 26.279 6.297   1.00 100.09 ? 119 PHE Z CG    1 
ATOM   934  C  CD1   . PHE A 1 119 ? -29.313 27.410 7.095   1.00 102.99 ? 119 PHE Z CD1   1 
ATOM   935  C  CD2   . PHE A 1 119 ? -30.027 25.178 6.649   1.00 101.12 ? 119 PHE Z CD2   1 
ATOM   936  C  CE1   . PHE A 1 119 ? -30.113 27.445 8.229   1.00 107.11 ? 119 PHE Z CE1   1 
ATOM   937  C  CE2   . PHE A 1 119 ? -30.831 25.203 7.776   1.00 105.42 ? 119 PHE Z CE2   1 
ATOM   938  C  CZ    . PHE A 1 119 ? -30.874 26.338 8.569   1.00 108.59 ? 119 PHE Z CZ    1 
ATOM   939  N  N     . THR A 1 120 ? -27.198 27.326 2.271   1.00 98.74  ? 120 THR Z N     1 
ATOM   940  C  CA    . THR A 1 120 ? -26.156 27.180 1.261   1.00 96.21  ? 120 THR Z CA    1 
ATOM   941  C  C     . THR A 1 120 ? -25.531 28.520 0.889   1.00 95.79  ? 120 THR Z C     1 
ATOM   942  O  O     . THR A 1 120 ? -24.549 28.567 0.147   1.00 103.83 ? 120 THR Z O     1 
ATOM   943  C  CB    . THR A 1 120 ? -26.695 26.519 -0.021  1.00 98.65  ? 120 THR Z CB    1 
ATOM   944  O  OG1   . THR A 1 120 ? -25.605 26.225 -0.903  1.00 104.19 ? 120 THR Z OG1   1 
ATOM   945  C  CG2   . THR A 1 120 ? -27.671 27.443 -0.732  1.00 97.25  ? 120 THR Z CG2   1 
ATOM   946  N  N     . ARG A 1 121 ? -26.107 29.606 1.400   1.00 95.03  ? 121 ARG Z N     1 
ATOM   947  C  CA    . ARG A 1 121 ? -25.592 30.946 1.137   1.00 89.93  ? 121 ARG Z CA    1 
ATOM   948  C  C     . ARG A 1 121 ? -25.159 31.644 2.421   1.00 87.35  ? 121 ARG Z C     1 
ATOM   949  O  O     . ARG A 1 121 ? -25.027 32.869 2.452   1.00 83.82  ? 121 ARG Z O     1 
ATOM   950  C  CB    . ARG A 1 121 ? -26.644 31.789 0.421   1.00 89.92  ? 121 ARG Z CB    1 
ATOM   951  C  CG    . ARG A 1 121 ? -27.173 31.156 -0.851  1.00 96.94  ? 121 ARG Z CG    1 
ATOM   952  C  CD    . ARG A 1 121 ? -28.212 32.035 -1.521  1.00 107.59 ? 121 ARG Z CD    1 
ATOM   953  N  NE    . ARG A 1 121 ? -28.889 31.322 -2.600  1.00 117.10 ? 121 ARG Z NE    1 
ATOM   954  C  CZ    . ARG A 1 121 ? -29.879 31.830 -3.333  1.00 121.39 ? 121 ARG Z CZ    1 
ATOM   955  N  NH1   . ARG A 1 121 ? -30.313 33.069 -3.107  1.00 119.19 ? 121 ARG Z NH1   1 
ATOM   956  N  NH2   . ARG A 1 121 ? -30.440 31.102 -4.298  1.00 124.69 ? 121 ARG Z NH2   1 
ATOM   957  N  N     . SER A 1 122 ? -24.942 30.858 3.473   1.00 88.93  ? 122 SER Z N     1 
ATOM   958  C  CA    . SER A 1 122 ? -24.524 31.383 4.769   1.00 92.13  ? 122 SER Z CA    1 
ATOM   959  C  C     . SER A 1 122 ? -23.317 30.622 5.310   1.00 92.01  ? 122 SER Z C     1 
ATOM   960  O  O     . SER A 1 122 ? -23.140 30.482 6.522   1.00 98.54  ? 122 SER Z O     1 
ATOM   961  C  CB    . SER A 1 122 ? -25.675 31.311 5.771   1.00 95.47  ? 122 SER Z CB    1 
ATOM   962  O  OG    . SER A 1 122 ? -26.068 29.967 5.998   1.00 99.85  ? 122 SER Z OG    1 
ATOM   963  N  N     . ILE A 1 123 ? -22.485 30.134 4.403   1.00 88.03  ? 123 ILE Z N     1 
ATOM   964  C  CA    . ILE A 1 123 ? -21.325 29.347 4.787   1.00 86.16  ? 123 ILE Z CA    1 
ATOM   965  C  C     . ILE A 1 123 ? -20.094 30.223 4.978   1.00 86.49  ? 123 ILE Z C     1 
ATOM   966  O  O     . ILE A 1 123 ? -19.768 31.045 4.126   1.00 91.40  ? 123 ILE Z O     1 
ATOM   967  C  CB    . ILE A 1 123 ? -21.027 28.265 3.734   1.00 81.85  ? 123 ILE Z CB    1 
ATOM   968  C  CG1   . ILE A 1 123 ? -22.237 27.343 3.575   1.00 87.28  ? 123 ILE Z CG1   1 
ATOM   969  C  CG2   . ILE A 1 123 ? -19.797 27.472 4.114   1.00 70.11  ? 123 ILE Z CG2   1 
ATOM   970  C  CD1   . ILE A 1 123 ? -22.680 26.695 4.866   1.00 92.00  ? 123 ILE Z CD1   1 
ATOM   971  N  N     . ASN A 1 124 ? -19.416 30.049 6.106   1.00 80.56  ? 124 ASN Z N     1 
ATOM   972  C  CA    . ASN A 1 124 ? -18.170 30.761 6.349   1.00 80.84  ? 124 ASN Z CA    1 
ATOM   973  C  C     . ASN A 1 124 ? -17.023 29.793 6.618   1.00 82.06  ? 124 ASN Z C     1 
ATOM   974  O  O     . ASN A 1 124 ? -17.103 28.964 7.520   1.00 83.83  ? 124 ASN Z O     1 
ATOM   975  C  CB    . ASN A 1 124 ? -18.326 31.734 7.518   1.00 84.29  ? 124 ASN Z CB    1 
ATOM   976  C  CG    . ASN A 1 124 ? -17.069 32.544 7.770   1.00 88.19  ? 124 ASN Z CG    1 
ATOM   977  O  OD1   . ASN A 1 124 ? -16.294 32.239 8.676   1.00 94.09  ? 124 ASN Z OD1   1 
ATOM   978  N  ND2   . ASN A 1 124 ? -16.856 33.577 6.962   1.00 79.43  ? 124 ASN Z ND2   1 
ATOM   979  N  N     . ILE A 1 125 ? -15.956 29.901 5.833   1.00 67.30  ? 125 ILE Z N     1 
ATOM   980  C  CA    . ILE A 1 125 ? -14.826 28.992 5.961   1.00 75.54  ? 125 ILE Z CA    1 
ATOM   981  C  C     . ILE A 1 125 ? -13.881 29.420 7.065   1.00 77.87  ? 125 ILE Z C     1 
ATOM   982  O  O     . ILE A 1 125 ? -13.133 30.373 6.895   1.00 76.50  ? 125 ILE Z O     1 
ATOM   983  C  CB    . ILE A 1 125 ? -14.026 28.906 4.656   1.00 73.28  ? 125 ILE Z CB    1 
ATOM   984  C  CG1   . ILE A 1 125 ? -14.958 28.647 3.468   1.00 68.26  ? 125 ILE Z CG1   1 
ATOM   985  C  CG2   . ILE A 1 125 ? -12.947 27.836 4.763   1.00 78.41  ? 125 ILE Z CG2   1 
ATOM   986  C  CD1   . ILE A 1 125 ? -15.705 27.339 3.550   1.00 71.91  ? 125 ILE Z CD1   1 
ATOM   987  N  N     . THR A 1 126 ? -13.914 28.713 8.191   1.00 75.08  ? 126 THR Z N     1 
ATOM   988  C  CA    . THR A 1 126 ? -13.020 29.002 9.309   1.00 79.22  ? 126 THR Z CA    1 
ATOM   989  C  C     . THR A 1 126 ? -11.643 28.414 9.041   1.00 76.05  ? 126 THR Z C     1 
ATOM   990  O  O     . THR A 1 126 ? -11.466 27.669 8.083   1.00 71.92  ? 126 THR Z O     1 
ATOM   991  C  CB    . THR A 1 126 ? -13.550 28.432 10.635  1.00 87.49  ? 126 THR Z CB    1 
ATOM   992  O  OG1   . THR A 1 126 ? -13.634 27.006 10.537  1.00 84.93  ? 126 THR Z OG1   1 
ATOM   993  C  CG2   . THR A 1 126 ? -14.934 28.996 10.947  1.00 93.78  ? 126 THR Z CG2   1 
ATOM   994  N  N     . HIS A 1 127 ? -10.671 28.748 9.888   1.00 68.75  ? 127 HIS Z N     1 
ATOM   995  C  CA    . HIS A 1 127 ? -9.318  28.195 9.759   1.00 74.00  ? 127 HIS Z CA    1 
ATOM   996  C  C     . HIS A 1 127 ? -9.276  26.788 10.281  1.00 77.20  ? 127 HIS Z C     1 
ATOM   997  O  O     . HIS A 1 127 ? -8.306  26.079 10.078  1.00 78.38  ? 127 HIS Z O     1 
ATOM   998  C  CB    . HIS A 1 127 ? -8.278  29.013 10.529  1.00 77.35  ? 127 HIS Z CB    1 
ATOM   999  C  CG    . HIS A 1 127 ? -6.856  28.611 10.254  1.00 77.43  ? 127 HIS Z CG    1 
ATOM   1000 N  ND1   . HIS A 1 127 ? -6.349  28.511 8.980   1.00 74.73  ? 127 HIS Z ND1   1 
ATOM   1001 C  CD2   . HIS A 1 127 ? -5.827  28.311 11.089  1.00 81.79  ? 127 HIS Z CD2   1 
ATOM   1002 C  CE1   . HIS A 1 127 ? -5.073  28.168 9.036   1.00 75.43  ? 127 HIS Z CE1   1 
ATOM   1003 N  NE2   . HIS A 1 127 ? -4.734  28.041 10.304  1.00 79.68  ? 127 HIS Z NE2   1 
ATOM   1004 N  N     . ALA A 1 128 ? -10.304 26.411 11.024  1.00 73.21  ? 128 ALA Z N     1 
ATOM   1005 C  CA    . ALA A 1 128 ? -10.344 25.085 11.603  1.00 75.06  ? 128 ALA Z CA    1 
ATOM   1006 C  C     . ALA A 1 128 ? -10.571 24.086 10.480  1.00 74.68  ? 128 ALA Z C     1 
ATOM   1007 O  O     . ALA A 1 128 ? -9.900  23.058 10.396  1.00 85.60  ? 128 ALA Z O     1 
ATOM   1008 C  CB    . ALA A 1 128 ? -11.423 24.994 12.648  1.00 76.66  ? 128 ALA Z CB    1 
ATOM   1009 N  N     . MET A 1 129 ? -11.508 24.417 9.601   1.00 76.80  ? 129 MET Z N     1 
ATOM   1010 C  CA    . MET A 1 129 ? -11.795 23.596 8.437   1.00 73.79  ? 129 MET Z CA    1 
ATOM   1011 C  C     . MET A 1 129 ? -10.570 23.529 7.533   1.00 63.93  ? 129 MET Z C     1 
ATOM   1012 O  O     . MET A 1 129 ? -10.135 22.450 7.092   1.00 72.50  ? 129 MET Z O     1 
ATOM   1013 C  CB    . MET A 1 129 ? -12.994 24.169 7.685   1.00 74.83  ? 129 MET Z CB    1 
ATOM   1014 C  CG    . MET A 1 129 ? -14.190 24.466 8.580   1.00 79.46  ? 129 MET Z CG    1 
ATOM   1015 S  SD    . MET A 1 129 ? -15.408 25.546 7.797   1.00 80.92  ? 129 MET Z SD    1 
ATOM   1016 C  CE    . MET A 1 129 ? -15.883 24.573 6.366   1.00 77.71  ? 129 MET Z CE    1 
ATOM   1017 N  N     . ALA A 1 130 ? -10.009 24.703 7.278   1.00 62.80  ? 130 ALA Z N     1 
ATOM   1018 C  CA    . ALA A 1 130 ? -8.836  24.818 6.437   1.00 58.96  ? 130 ALA Z CA    1 
ATOM   1019 C  C     . ALA A 1 130 ? -7.698  23.997 7.015   1.00 70.86  ? 130 ALA Z C     1 
ATOM   1020 O  O     . ALA A 1 130 ? -6.904  23.416 6.286   1.00 72.29  ? 130 ALA Z O     1 
ATOM   1021 C  CB    . ALA A 1 130 ? -8.431  26.271 6.292   1.00 58.91  ? 130 ALA Z CB    1 
ATOM   1022 N  N     . HIS A 1 131 ? -7.638  23.932 8.336   1.00 66.00  ? 131 HIS Z N     1 
ATOM   1023 C  CA    . HIS A 1 131 ? -6.566  23.214 8.988   1.00 71.54  ? 131 HIS Z CA    1 
ATOM   1024 C  C     . HIS A 1 131 ? -6.850  21.723 8.898   1.00 74.96  ? 131 HIS Z C     1 
ATOM   1025 O  O     . HIS A 1 131 ? -5.922  20.921 8.840   1.00 87.91  ? 131 HIS Z O     1 
ATOM   1026 C  CB    . HIS A 1 131 ? -6.387  23.653 10.446  1.00 71.18  ? 131 HIS Z CB    1 
ATOM   1027 C  CG    . HIS A 1 131 ? -5.177  23.059 11.094  1.00 76.05  ? 131 HIS Z CG    1 
ATOM   1028 N  ND1   . HIS A 1 131 ? -5.233  21.919 11.866  1.00 83.21  ? 131 HIS Z ND1   1 
ATOM   1029 C  CD2   . HIS A 1 131 ? -3.871  23.418 11.046  1.00 76.59  ? 131 HIS Z CD2   1 
ATOM   1030 C  CE1   . HIS A 1 131 ? -4.017  21.611 12.281  1.00 85.70  ? 131 HIS Z CE1   1 
ATOM   1031 N  NE2   . HIS A 1 131 ? -3.173  22.505 11.796  1.00 82.64  ? 131 HIS Z NE2   1 
ATOM   1032 N  N     . LYS A 1 132 ? -8.125  21.347 8.871   1.00 75.40  ? 132 LYS Z N     1 
ATOM   1033 C  CA    . LYS A 1 132 ? -8.472  19.951 8.631   1.00 71.22  ? 132 LYS Z CA    1 
ATOM   1034 C  C     . LYS A 1 132 ? -7.933  19.538 7.264   1.00 67.90  ? 132 LYS Z C     1 
ATOM   1035 O  O     . LYS A 1 132 ? -7.265  18.493 7.121   1.00 72.16  ? 132 LYS Z O     1 
ATOM   1036 C  CB    . LYS A 1 132 ? -9.984  19.732 8.700   1.00 69.56  ? 132 LYS Z CB    1 
ATOM   1037 C  CG    . LYS A 1 132 ? -10.581 19.779 10.099  1.00 72.32  ? 132 LYS Z CG    1 
ATOM   1038 C  CD    . LYS A 1 132 ? -12.057 19.401 10.060  1.00 81.41  ? 132 LYS Z CD    1 
ATOM   1039 C  CE    . LYS A 1 132 ? -12.667 19.349 11.445  1.00 93.71  ? 132 LYS Z CE    1 
ATOM   1040 N  NZ    . LYS A 1 132 ? -14.121 19.042 11.377  1.00 101.72 ? 132 LYS Z NZ    1 
ATOM   1041 N  N     . VAL A 1 133 ? -8.206  20.381 6.268   1.00 67.44  ? 133 VAL Z N     1 
ATOM   1042 C  CA    . VAL A 1 133 ? -7.702  20.135 4.921   1.00 70.94  ? 133 VAL Z CA    1 
ATOM   1043 C  C     . VAL A 1 133 ? -6.179  20.080 4.912   1.00 73.86  ? 133 VAL Z C     1 
ATOM   1044 O  O     . VAL A 1 133 ? -5.579  19.286 4.191   1.00 72.35  ? 133 VAL Z O     1 
ATOM   1045 C  CB    . VAL A 1 133 ? -8.176  21.209 3.936   1.00 68.46  ? 133 VAL Z CB    1 
ATOM   1046 C  CG1   . VAL A 1 133 ? -7.658  20.919 2.546   1.00 62.77  ? 133 VAL Z CG1   1 
ATOM   1047 C  CG2   . VAL A 1 133 ? -9.686  21.272 3.926   1.00 70.58  ? 133 VAL Z CG2   1 
ATOM   1048 N  N     . ILE A 1 134 ? -5.562  20.920 5.735   1.00 75.34  ? 134 ILE Z N     1 
ATOM   1049 C  CA    . ILE A 1 134 ? -4.109  20.992 5.833   1.00 73.76  ? 134 ILE Z CA    1 
ATOM   1050 C  C     . ILE A 1 134 ? -3.507  19.693 6.370   1.00 84.67  ? 134 ILE Z C     1 
ATOM   1051 O  O     . ILE A 1 134 ? -2.523  19.182 5.831   1.00 91.17  ? 134 ILE Z O     1 
ATOM   1052 C  CB    . ILE A 1 134 ? -3.673  22.167 6.733   1.00 67.74  ? 134 ILE Z CB    1 
ATOM   1053 C  CG1   . ILE A 1 134 ? -3.782  23.489 5.972   1.00 62.51  ? 134 ILE Z CG1   1 
ATOM   1054 C  CG2   . ILE A 1 134 ? -2.249  21.970 7.230   1.00 69.42  ? 134 ILE Z CG2   1 
ATOM   1055 C  CD1   . ILE A 1 134 ? -3.411  24.702 6.796   1.00 55.76  ? 134 ILE Z CD1   1 
ATOM   1056 N  N     . LYS A 1 135 ? -4.098  19.161 7.435   1.00 78.90  ? 135 LYS Z N     1 
ATOM   1057 C  CA    . LYS A 1 135 ? -3.630  17.906 8.011   1.00 86.90  ? 135 LYS Z CA    1 
ATOM   1058 C  C     . LYS A 1 135 ? -3.832  16.781 7.015   1.00 87.52  ? 135 LYS Z C     1 
ATOM   1059 O  O     . LYS A 1 135 ? -2.917  15.983 6.776   1.00 89.63  ? 135 LYS Z O     1 
ATOM   1060 C  CB    . LYS A 1 135 ? -4.358  17.595 9.321   1.00 88.06  ? 135 LYS Z CB    1 
ATOM   1061 C  CG    . LYS A 1 135 ? -4.056  18.576 10.455  1.00 95.16  ? 135 LYS Z CG    1 
ATOM   1062 C  CD    . LYS A 1 135 ? -2.676  18.348 11.077  1.00 101.52 ? 135 LYS Z CD    1 
ATOM   1063 C  CE    . LYS A 1 135 ? -2.622  17.034 11.851  1.00 106.89 ? 135 LYS Z CE    1 
ATOM   1064 N  NZ    . LYS A 1 135 ? -1.327  16.842 12.573  1.00 108.37 ? 135 LYS Z NZ    1 
ATOM   1065 N  N     . ALA A 1 136 ? -5.027  16.733 6.425   1.00 91.81  ? 136 ALA Z N     1 
ATOM   1066 C  CA    . ALA A 1 136 ? -5.342  15.719 5.417   1.00 84.43  ? 136 ALA Z CA    1 
ATOM   1067 C  C     . ALA A 1 136 ? -4.342  15.717 4.251   1.00 82.54  ? 136 ALA Z C     1 
ATOM   1068 O  O     . ALA A 1 136 ? -3.926  14.655 3.787   1.00 80.92  ? 136 ALA Z O     1 
ATOM   1069 C  CB    . ALA A 1 136 ? -6.755  15.917 4.895   1.00 74.14  ? 136 ALA Z CB    1 
ATOM   1070 N  N     . ALA A 1 137 ? -3.959  16.903 3.783   1.00 81.84  ? 137 ALA Z N     1 
ATOM   1071 C  CA    . ALA A 1 137 ? -3.006  17.024 2.681   1.00 84.84  ? 137 ALA Z CA    1 
ATOM   1072 C  C     . ALA A 1 137 ? -1.592  16.678 3.132   1.00 84.82  ? 137 ALA Z C     1 
ATOM   1073 O  O     . ALA A 1 137 ? -0.806  16.119 2.366   1.00 88.87  ? 137 ALA Z O     1 
ATOM   1074 C  CB    . ALA A 1 137 ? -3.043  18.429 2.093   1.00 59.67  ? 137 ALA Z CB    1 
ATOM   1075 N  N     . ARG A 1 138 ? -1.286  17.002 4.369   1.00 77.57  ? 138 ARG Z N     1 
ATOM   1076 C  CA    . ARG A 1 138 ? 0.010   16.699 4.925   1.00 89.21  ? 138 ARG Z CA    1 
ATOM   1077 C  C     . ARG A 1 138 ? 0.191   15.209 4.975   1.00 94.14  ? 138 ARG Z C     1 
ATOM   1078 O  O     . ARG A 1 138 ? 1.258   14.687 4.743   1.00 99.20  ? 138 ARG Z O     1 
ATOM   1079 C  CB    . ARG A 1 138 ? 0.105   17.263 6.326   1.00 99.91  ? 138 ARG Z CB    1 
ATOM   1080 C  CG    . ARG A 1 138 ? 0.314   18.761 6.366   1.00 106.10 ? 138 ARG Z CG    1 
ATOM   1081 C  CD    . ARG A 1 138 ? 1.698   19.139 5.884   1.00 110.19 ? 138 ARG Z CD    1 
ATOM   1082 N  NE    . ARG A 1 138 ? 1.882   20.582 5.788   1.00 106.87 ? 138 ARG Z NE    1 
ATOM   1083 C  CZ    . ARG A 1 138 ? 1.695   21.424 6.789   1.00 104.34 ? 138 ARG Z CZ    1 
ATOM   1084 N  NH1   . ARG A 1 138 ? 1.313   20.974 7.971   1.00 106.95 ? 138 ARG Z NH1   1 
ATOM   1085 N  NH2   . ARG A 1 138 ? 1.893   22.711 6.605   1.00 100.23 ? 138 ARG Z NH2   1 
ATOM   1086 N  N     . SER A 1 139 ? -0.875  14.519 5.308   1.00 95.57  ? 139 SER Z N     1 
ATOM   1087 C  CA    . SER A 1 139 ? -0.804  13.074 5.425   1.00 94.84  ? 139 SER Z CA    1 
ATOM   1088 C  C     . SER A 1 139 ? -0.627  12.422 4.049   1.00 92.99  ? 139 SER Z C     1 
ATOM   1089 O  O     . SER A 1 139 ? -0.757  11.206 3.915   1.00 100.23 ? 139 SER Z O     1 
ATOM   1090 C  CB    . SER A 1 139 ? -2.057  12.533 6.116   1.00 91.06  ? 139 SER Z CB    1 
ATOM   1091 O  OG    . SER A 1 139 ? -3.212  12.729 5.320   1.00 93.43  ? 139 SER Z OG    1 
ATOM   1092 N  N     . GLN A 1 140 ? -0.331  13.230 3.032   1.00 91.62  ? 140 GLN Z N     1 
ATOM   1093 C  CA    . GLN A 1 140 ? -0.146  12.732 1.667   1.00 92.38  ? 140 GLN Z CA    1 
ATOM   1094 C  C     . GLN A 1 140 ? 1.184   13.201 1.080   1.00 88.80  ? 140 GLN Z C     1 
ATOM   1095 O  O     . GLN A 1 140 ? 1.546   12.843 -0.045  1.00 95.79  ? 140 GLN Z O     1 
ATOM   1096 C  CB    . GLN A 1 140 ? -1.296  13.188 0.760   1.00 94.57  ? 140 GLN Z CB    1 
ATOM   1097 C  CG    . GLN A 1 140 ? -2.691  12.776 1.214   1.00 97.13  ? 140 GLN Z CG    1 
ATOM   1098 C  CD    . GLN A 1 140 ? -3.045  11.364 0.805   1.00 100.59 ? 140 GLN Z CD    1 
ATOM   1099 O  OE1   . GLN A 1 140 ? -2.167  10.515 0.636   1.00 104.63 ? 140 GLN Z OE1   1 
ATOM   1100 N  NE2   . GLN A 1 140 ? -4.338  11.103 0.630   1.00 100.12 ? 140 GLN Z NE2   1 
ATOM   1101 N  N     . GLY A 1 141 ? 1.908   14.014 1.843   1.00 87.15  ? 141 GLY Z N     1 
ATOM   1102 C  CA    . GLY A 1 141 ? 3.171   14.558 1.380   1.00 84.31  ? 141 GLY Z CA    1 
ATOM   1103 C  C     . GLY A 1 141 ? 2.982   15.825 0.571   1.00 78.89  ? 141 GLY Z C     1 
ATOM   1104 O  O     . GLY A 1 141 ? 3.943   16.380 0.033   1.00 81.79  ? 141 GLY Z O     1 
ATOM   1105 N  N     . VAL A 1 142 ? 1.733   16.278 0.491   1.00 79.27  ? 142 VAL Z N     1 
ATOM   1106 C  CA    . VAL A 1 142 ? 1.383   17.497 -0.223  1.00 76.47  ? 142 VAL Z CA    1 
ATOM   1107 C  C     . VAL A 1 142 ? 1.629   18.729 0.631   1.00 74.97  ? 142 VAL Z C     1 
ATOM   1108 O  O     . VAL A 1 142 ? 1.068   18.858 1.718   1.00 79.16  ? 142 VAL Z O     1 
ATOM   1109 C  CB    . VAL A 1 142 ? -0.085  17.492 -0.655  1.00 73.36  ? 142 VAL Z CB    1 
ATOM   1110 C  CG1   . VAL A 1 142 ? -0.396  18.749 -1.425  1.00 71.72  ? 142 VAL Z CG1   1 
ATOM   1111 C  CG2   . VAL A 1 142 ? -0.384  16.278 -1.501  1.00 74.77  ? 142 VAL Z CG2   1 
ATOM   1112 N  N     . ASP A 1 143 ? 2.457   19.638 0.131   1.00 68.45  ? 143 ASP Z N     1 
ATOM   1113 C  CA    . ASP A 1 143 ? 2.802   20.841 0.878   1.00 71.12  ? 143 ASP Z CA    1 
ATOM   1114 C  C     . ASP A 1 143 ? 1.629   21.814 0.974   1.00 74.21  ? 143 ASP Z C     1 
ATOM   1115 O  O     . ASP A 1 143 ? 0.801   21.895 0.069   1.00 73.57  ? 143 ASP Z O     1 
ATOM   1116 C  CB    . ASP A 1 143 ? 4.004   21.536 0.239   1.00 72.97  ? 143 ASP Z CB    1 
ATOM   1117 C  CG    . ASP A 1 143 ? 5.292   20.752 0.407   1.00 92.68  ? 143 ASP Z CG    1 
ATOM   1118 O  OD1   . ASP A 1 143 ? 6.060   20.663 -0.575  1.00 100.45 ? 143 ASP Z OD1   1 
ATOM   1119 O  OD2   . ASP A 1 143 ? 5.540   20.230 1.516   1.00 98.07  ? 143 ASP Z OD2   1 
ATOM   1120 N  N     . CYS A 1 144 ? 1.569   22.547 2.082   1.00 67.62  ? 144 CYS Z N     1 
ATOM   1121 C  CA    . CYS A 1 144 ? 0.549   23.570 2.282   1.00 65.86  ? 144 CYS Z CA    1 
ATOM   1122 C  C     . CYS A 1 144 ? 1.175   24.878 2.753   1.00 68.99  ? 144 CYS Z C     1 
ATOM   1123 O  O     . CYS A 1 144 ? 2.255   24.881 3.343   1.00 71.92  ? 144 CYS Z O     1 
ATOM   1124 C  CB    . CYS A 1 144 ? -0.495  23.097 3.287   1.00 70.58  ? 144 CYS Z CB    1 
ATOM   1125 S  SG    . CYS A 1 144 ? -1.384  21.619 2.768   1.00 72.83  ? 144 CYS Z SG    1 
ATOM   1126 N  N     . LEU A 1 145 ? 0.494   25.989 2.492   1.00 58.78  ? 145 LEU Z N     1 
ATOM   1127 C  CA    . LEU A 1 145 ? 1.036   27.307 2.801   1.00 54.69  ? 145 LEU Z CA    1 
ATOM   1128 C  C     . LEU A 1 145 ? -0.076  28.313 3.055   1.00 57.59  ? 145 LEU Z C     1 
ATOM   1129 O  O     . LEU A 1 145 ? -0.824  28.665 2.149   1.00 58.23  ? 145 LEU Z O     1 
ATOM   1130 C  CB    . LEU A 1 145 ? 1.931   27.791 1.660   1.00 60.20  ? 145 LEU Z CB    1 
ATOM   1131 C  CG    . LEU A 1 145 ? 2.555   29.178 1.793   1.00 70.87  ? 145 LEU Z CG    1 
ATOM   1132 C  CD1   . LEU A 1 145 ? 3.603   29.165 2.881   1.00 77.68  ? 145 LEU Z CD1   1 
ATOM   1133 C  CD2   . LEU A 1 145 ? 3.163   29.616 0.471   1.00 72.68  ? 145 LEU Z CD2   1 
ATOM   1134 N  N     . VAL A 1 146 ? -0.187  28.774 4.292   1.00 58.55  ? 146 VAL Z N     1 
ATOM   1135 C  CA    . VAL A 1 146 ? -1.190  29.770 4.624   1.00 52.44  ? 146 VAL Z CA    1 
ATOM   1136 C  C     . VAL A 1 146 ? -0.649  31.171 4.384   1.00 54.24  ? 146 VAL Z C     1 
ATOM   1137 O  O     . VAL A 1 146 ? 0.321   31.583 5.013   1.00 57.45  ? 146 VAL Z O     1 
ATOM   1138 C  CB    . VAL A 1 146 ? -1.639  29.642 6.073   1.00 53.44  ? 146 VAL Z CB    1 
ATOM   1139 C  CG1   . VAL A 1 146 ? -2.609  30.744 6.411   1.00 54.52  ? 146 VAL Z CG1   1 
ATOM   1140 C  CG2   . VAL A 1 146 ? -2.269  28.289 6.299   1.00 47.44  ? 146 VAL Z CG2   1 
ATOM   1141 N  N     . ALA A 1 147 ? -1.280  31.895 3.467   1.00 49.04  ? 147 ALA Z N     1 
ATOM   1142 C  CA    . ALA A 1 147 ? -0.844  33.239 3.108   1.00 46.82  ? 147 ALA Z CA    1 
ATOM   1143 C  C     . ALA A 1 147 ? -0.945  34.182 4.300   1.00 50.20  ? 147 ALA Z C     1 
ATOM   1144 O  O     . ALA A 1 147 ? -1.798  33.997 5.164   1.00 55.73  ? 147 ALA Z O     1 
ATOM   1145 C  CB    . ALA A 1 147 ? -1.668  33.770 1.938   1.00 49.69  ? 147 ALA Z CB    1 
ATOM   1146 N  N     . PRO A 1 148 ? -0.061  35.190 4.359   1.00 50.18  ? 148 PRO Z N     1 
ATOM   1147 C  CA    . PRO A 1 148 ? -0.135  36.237 5.381   1.00 46.47  ? 148 PRO Z CA    1 
ATOM   1148 C  C     . PRO A 1 148 ? -1.477  36.936 5.349   1.00 54.06  ? 148 PRO Z C     1 
ATOM   1149 O  O     . PRO A 1 148 ? -2.030  37.273 6.390   1.00 58.93  ? 148 PRO Z O     1 
ATOM   1150 C  CB    . PRO A 1 148 ? 0.981   37.195 4.983   1.00 49.26  ? 148 PRO Z CB    1 
ATOM   1151 C  CG    . PRO A 1 148 ? 1.939   36.355 4.244   1.00 54.44  ? 148 PRO Z CG    1 
ATOM   1152 C  CD    . PRO A 1 148 ? 1.120   35.354 3.498   1.00 51.37  ? 148 PRO Z CD    1 
ATOM   1153 N  N     . TYR A 1 149 ? -1.993  37.154 4.148   1.00 46.39  ? 149 TYR Z N     1 
ATOM   1154 C  CA    . TYR A 1 149 ? -3.314  37.740 3.992   1.00 49.55  ? 149 TYR Z CA    1 
ATOM   1155 C  C     . TYR A 1 149 ? -4.106  37.030 2.897   1.00 53.75  ? 149 TYR Z C     1 
ATOM   1156 O  O     . TYR A 1 149 ? -4.527  35.892 3.084   1.00 58.52  ? 149 TYR Z O     1 
ATOM   1157 C  CB    . TYR A 1 149 ? -3.191  39.229 3.708   1.00 49.21  ? 149 TYR Z CB    1 
ATOM   1158 C  CG    . TYR A 1 149 ? -2.563  39.974 4.856   1.00 59.20  ? 149 TYR Z CG    1 
ATOM   1159 C  CD1   . TYR A 1 149 ? -3.331  40.392 5.935   1.00 65.17  ? 149 TYR Z CD1   1 
ATOM   1160 C  CD2   . TYR A 1 149 ? -1.199  40.239 4.877   1.00 60.91  ? 149 TYR Z CD2   1 
ATOM   1161 C  CE1   . TYR A 1 149 ? -2.762  41.069 6.998   1.00 66.14  ? 149 TYR Z CE1   1 
ATOM   1162 C  CE2   . TYR A 1 149 ? -0.619  40.916 5.936   1.00 64.73  ? 149 TYR Z CE2   1 
ATOM   1163 C  CZ    . TYR A 1 149 ? -1.405  41.328 6.993   1.00 68.02  ? 149 TYR Z CZ    1 
ATOM   1164 O  OH    . TYR A 1 149 ? -0.836  42.000 8.047   1.00 69.56  ? 149 TYR Z OH    1 
ATOM   1165 N  N     . GLU A 1 150 ? -4.316  37.689 1.764   1.00 52.27  ? 150 GLU Z N     1 
ATOM   1166 C  CA    . GLU A 1 150 ? -5.047  37.061 0.668   1.00 47.12  ? 150 GLU Z CA    1 
ATOM   1167 C  C     . GLU A 1 150 ? -4.216  35.985 -0.002  1.00 47.28  ? 150 GLU Z C     1 
ATOM   1168 O  O     . GLU A 1 150 ? -3.013  36.134 -0.180  1.00 50.76  ? 150 GLU Z O     1 
ATOM   1169 C  CB    . GLU A 1 150 ? -5.482  38.091 -0.373  1.00 46.86  ? 150 GLU Z CB    1 
ATOM   1170 C  CG    . GLU A 1 150 ? -6.585  39.008 0.099   1.00 53.51  ? 150 GLU Z CG    1 
ATOM   1171 C  CD    . GLU A 1 150 ? -7.334  39.660 -1.039  1.00 61.64  ? 150 GLU Z CD    1 
ATOM   1172 O  OE1   . GLU A 1 150 ? -6.934  40.761 -1.463  1.00 58.64  ? 150 GLU Z OE1   1 
ATOM   1173 O  OE2   . GLU A 1 150 ? -8.329  39.073 -1.505  1.00 70.23  ? 150 GLU Z OE2   1 
ATOM   1174 N  N     . ALA A 1 151 ? -4.873  34.897 -0.375  1.00 45.31  ? 151 ALA Z N     1 
ATOM   1175 C  CA    . ALA A 1 151 ? -4.215  33.821 -1.099  1.00 46.12  ? 151 ALA Z CA    1 
ATOM   1176 C  C     . ALA A 1 151 ? -3.809  34.284 -2.491  1.00 50.11  ? 151 ALA Z C     1 
ATOM   1177 O  O     . ALA A 1 151 ? -2.849  33.789 -3.066  1.00 52.75  ? 151 ALA Z O     1 
ATOM   1178 C  CB    . ALA A 1 151 ? -5.125  32.612 -1.189  1.00 40.86  ? 151 ALA Z CB    1 
ATOM   1179 N  N     . ASP A 1 152 ? -4.554  35.240 -3.023  1.00 49.03  ? 152 ASP Z N     1 
ATOM   1180 C  CA    . ASP A 1 152 ? -4.294  35.770 -4.348  1.00 46.09  ? 152 ASP Z CA    1 
ATOM   1181 C  C     . ASP A 1 152 ? -2.845  36.227 -4.496  1.00 55.30  ? 152 ASP Z C     1 
ATOM   1182 O  O     . ASP A 1 152 ? -2.131  35.814 -5.414  1.00 62.07  ? 152 ASP Z O     1 
ATOM   1183 C  CB    . ASP A 1 152 ? -5.250  36.925 -4.626  1.00 36.48  ? 152 ASP Z CB    1 
ATOM   1184 C  CG    . ASP A 1 152 ? -6.692  36.595 -4.259  1.00 48.72  ? 152 ASP Z CG    1 
ATOM   1185 O  OD1   . ASP A 1 152 ? -6.927  35.722 -3.387  1.00 51.65  ? 152 ASP Z OD1   1 
ATOM   1186 O  OD2   . ASP A 1 152 ? -7.601  37.219 -4.848  1.00 44.54  ? 152 ASP Z OD2   1 
ATOM   1187 N  N     . ALA A 1 153 ? -2.409  37.061 -3.565  1.00 52.08  ? 153 ALA Z N     1 
ATOM   1188 C  CA    . ALA A 1 153 ? -1.065  37.609 -3.603  1.00 46.31  ? 153 ALA Z CA    1 
ATOM   1189 C  C     . ALA A 1 153 ? -0.010  36.528 -3.458  1.00 48.68  ? 153 ALA Z C     1 
ATOM   1190 O  O     . ALA A 1 153 ? 1.006   36.542 -4.143  1.00 44.36  ? 153 ALA Z O     1 
ATOM   1191 C  CB    . ALA A 1 153 ? -0.903  38.642 -2.519  1.00 42.58  ? 153 ALA Z CB    1 
ATOM   1192 N  N     . GLN A 1 154 ? -0.258  35.590 -2.556  1.00 50.96  ? 154 GLN Z N     1 
ATOM   1193 C  CA    . GLN A 1 154 ? 0.693   34.528 -2.284  1.00 47.96  ? 154 GLN Z CA    1 
ATOM   1194 C  C     . GLN A 1 154 ? 0.885   33.662 -3.519  1.00 55.22  ? 154 GLN Z C     1 
ATOM   1195 O  O     . GLN A 1 154 ? 2.010   33.314 -3.877  1.00 55.60  ? 154 GLN Z O     1 
ATOM   1196 C  CB    . GLN A 1 154 ? 0.220   33.681 -1.103  1.00 39.26  ? 154 GLN Z CB    1 
ATOM   1197 C  CG    . GLN A 1 154 ? 1.227   32.662 -0.628  1.00 45.30  ? 154 GLN Z CG    1 
ATOM   1198 C  CD    . GLN A 1 154 ? 2.517   33.304 -0.175  1.00 55.80  ? 154 GLN Z CD    1 
ATOM   1199 O  OE1   . GLN A 1 154 ? 2.505   34.256 0.601   1.00 58.10  ? 154 GLN Z OE1   1 
ATOM   1200 N  NE2   . GLN A 1 154 ? 3.640   32.795 -0.669  1.00 49.83  ? 154 GLN Z NE2   1 
ATOM   1201 N  N     . LEU A 1 155 ? -0.228  33.328 -4.165  1.00 60.01  ? 155 LEU Z N     1 
ATOM   1202 C  CA    . LEU A 1 155 ? -0.218  32.552 -5.398  1.00 54.68  ? 155 LEU Z CA    1 
ATOM   1203 C  C     . LEU A 1 155 ? 0.541   33.301 -6.479  1.00 49.02  ? 155 LEU Z C     1 
ATOM   1204 O  O     . LEU A 1 155 ? 1.397   32.732 -7.161  1.00 52.63  ? 155 LEU Z O     1 
ATOM   1205 C  CB    . LEU A 1 155 ? -1.643  32.262 -5.864  1.00 50.50  ? 155 LEU Z CB    1 
ATOM   1206 C  CG    . LEU A 1 155 ? -2.525  31.357 -5.008  1.00 47.46  ? 155 LEU Z CG    1 
ATOM   1207 C  CD1   . LEU A 1 155 ? -3.963  31.477 -5.450  1.00 45.39  ? 155 LEU Z CD1   1 
ATOM   1208 C  CD2   . LEU A 1 155 ? -2.073  29.926 -5.117  1.00 46.24  ? 155 LEU Z CD2   1 
ATOM   1209 N  N     . ALA A 1 156 ? 0.223   34.582 -6.626  1.00 46.50  ? 156 ALA Z N     1 
ATOM   1210 C  CA    . ALA A 1 156 ? 0.899   35.420 -7.602  1.00 45.67  ? 156 ALA Z CA    1 
ATOM   1211 C  C     . ALA A 1 156 ? 2.407   35.402 -7.383  1.00 53.10  ? 156 ALA Z C     1 
ATOM   1212 O  O     . ALA A 1 156 ? 3.177   35.336 -8.343  1.00 58.40  ? 156 ALA Z O     1 
ATOM   1213 C  CB    . ALA A 1 156 ? 0.372   36.833 -7.536  1.00 41.39  ? 156 ALA Z CB    1 
ATOM   1214 N  N     . TYR A 1 157 ? 2.826   35.449 -6.118  1.00 53.60  ? 157 TYR Z N     1 
ATOM   1215 C  CA    . TYR A 1 157 ? 4.252   35.422 -5.791  1.00 57.69  ? 157 TYR Z CA    1 
ATOM   1216 C  C     . TYR A 1 157 ? 4.860   34.078 -6.162  1.00 56.61  ? 157 TYR Z C     1 
ATOM   1217 O  O     . TYR A 1 157 ? 5.902   34.028 -6.809  1.00 55.19  ? 157 TYR Z O     1 
ATOM   1218 C  CB    . TYR A 1 157 ? 4.505   35.719 -4.301  1.00 54.77  ? 157 TYR Z CB    1 
ATOM   1219 C  CG    . TYR A 1 157 ? 5.964   35.544 -3.913  1.00 56.00  ? 157 TYR Z CG    1 
ATOM   1220 C  CD1   . TYR A 1 157 ? 6.922   36.476 -4.295  1.00 55.15  ? 157 TYR Z CD1   1 
ATOM   1221 C  CD2   . TYR A 1 157 ? 6.385   34.434 -3.192  1.00 59.22  ? 157 TYR Z CD2   1 
ATOM   1222 C  CE1   . TYR A 1 157 ? 8.253   36.311 -3.961  1.00 57.03  ? 157 TYR Z CE1   1 
ATOM   1223 C  CE2   . TYR A 1 157 ? 7.714   34.260 -2.857  1.00 59.34  ? 157 TYR Z CE2   1 
ATOM   1224 C  CZ    . TYR A 1 157 ? 8.641   35.201 -3.243  1.00 59.37  ? 157 TYR Z CZ    1 
ATOM   1225 O  OH    . TYR A 1 157 ? 9.965   35.034 -2.910  1.00 68.64  ? 157 TYR Z OH    1 
ATOM   1226 N  N     . LEU A 1 158 ? 4.207   32.994 -5.755  1.00 43.28  ? 158 LEU Z N     1 
ATOM   1227 C  CA    . LEU A 1 158 ? 4.702   31.657 -6.056  1.00 57.10  ? 158 LEU Z CA    1 
ATOM   1228 C  C     . LEU A 1 158 ? 4.880   31.471 -7.550  1.00 61.70  ? 158 LEU Z C     1 
ATOM   1229 O  O     . LEU A 1 158 ? 5.805   30.798 -7.996  1.00 63.69  ? 158 LEU Z O     1 
ATOM   1230 C  CB    . LEU A 1 158 ? 3.756   30.590 -5.515  1.00 54.26  ? 158 LEU Z CB    1 
ATOM   1231 C  CG    . LEU A 1 158 ? 3.625   30.492 -3.997  1.00 53.27  ? 158 LEU Z CG    1 
ATOM   1232 C  CD1   . LEU A 1 158 ? 2.764   29.295 -3.623  1.00 54.94  ? 158 LEU Z CD1   1 
ATOM   1233 C  CD2   . LEU A 1 158 ? 4.993   30.406 -3.345  1.00 55.96  ? 158 LEU Z CD2   1 
ATOM   1234 N  N     . ASN A 1 159 ? 3.991   32.084 -8.322  1.00 56.62  ? 159 ASN Z N     1 
ATOM   1235 C  CA    . ASN A 1 159 ? 4.043   31.981 -9.777  1.00 58.96  ? 159 ASN Z CA    1 
ATOM   1236 C  C     . ASN A 1 159 ? 5.137   32.841 -10.400 1.00 57.84  ? 159 ASN Z C     1 
ATOM   1237 O  O     . ASN A 1 159 ? 5.831   32.411 -11.318 1.00 59.32  ? 159 ASN Z O     1 
ATOM   1238 C  CB    . ASN A 1 159 ? 2.686   32.359 -10.371 1.00 62.44  ? 159 ASN Z CB    1 
ATOM   1239 C  CG    . ASN A 1 159 ? 2.604   32.079 -11.850 1.00 69.01  ? 159 ASN Z CG    1 
ATOM   1240 O  OD1   . ASN A 1 159 ? 2.428   32.990 -12.658 1.00 72.51  ? 159 ASN Z OD1   1 
ATOM   1241 N  ND2   . ASN A 1 159 ? 2.742   30.811 -12.217 1.00 71.68  ? 159 ASN Z ND2   1 
ATOM   1242 N  N     . LYS A 1 160 ? 5.282   34.061 -9.899  1.00 56.05  ? 160 LYS Z N     1 
ATOM   1243 C  CA    . LYS A 1 160 ? 6.257   34.988 -10.448 1.00 57.36  ? 160 LYS Z CA    1 
ATOM   1244 C  C     . LYS A 1 160 ? 7.663   34.655 -9.977  1.00 63.34  ? 160 LYS Z C     1 
ATOM   1245 O  O     . LYS A 1 160 ? 8.632   34.989 -10.644 1.00 68.97  ? 160 LYS Z O     1 
ATOM   1246 C  CB    . LYS A 1 160 ? 5.896   36.427 -10.074 1.00 53.79  ? 160 LYS Z CB    1 
ATOM   1247 C  CG    . LYS A 1 160 ? 4.709   36.971 -10.853 1.00 59.71  ? 160 LYS Z CG    1 
ATOM   1248 C  CD    . LYS A 1 160 ? 4.051   38.148 -10.154 1.00 64.69  ? 160 LYS Z CD    1 
ATOM   1249 C  CE    . LYS A 1 160 ? 5.005   39.313 -9.995  1.00 70.87  ? 160 LYS Z CE    1 
ATOM   1250 N  NZ    . LYS A 1 160 ? 4.304   40.513 -9.455  1.00 72.74  ? 160 LYS Z NZ    1 
ATOM   1251 N  N     . ALA A 1 161 ? 7.777   33.988 -8.835  1.00 67.32  ? 161 ALA Z N     1 
ATOM   1252 C  CA    . ALA A 1 161 ? 9.089   33.629 -8.299  1.00 61.49  ? 161 ALA Z CA    1 
ATOM   1253 C  C     . ALA A 1 161 ? 9.671   32.440 -9.043  1.00 65.31  ? 161 ALA Z C     1 
ATOM   1254 O  O     . ALA A 1 161 ? 10.875  32.207 -9.015  1.00 70.80  ? 161 ALA Z O     1 
ATOM   1255 C  CB    . ALA A 1 161 ? 9.003   33.324 -6.810  1.00 52.83  ? 161 ALA Z CB    1 
ATOM   1256 N  N     . GLY A 1 162 ? 8.810   31.684 -9.708  1.00 67.49  ? 162 GLY Z N     1 
ATOM   1257 C  CA    . GLY A 1 162 ? 9.254   30.511 -10.431 1.00 68.66  ? 162 GLY Z CA    1 
ATOM   1258 C  C     . GLY A 1 162 ? 9.046   29.245 -9.632  1.00 67.03  ? 162 GLY Z C     1 
ATOM   1259 O  O     . GLY A 1 162 ? 9.410   28.160 -10.072 1.00 60.78  ? 162 GLY Z O     1 
ATOM   1260 N  N     . ILE A 1 163 ? 8.452   29.388 -8.453  1.00 65.01  ? 163 ILE Z N     1 
ATOM   1261 C  CA    . ILE A 1 163 ? 8.193   28.249 -7.578  1.00 60.39  ? 163 ILE Z CA    1 
ATOM   1262 C  C     . ILE A 1 163 ? 7.099   27.345 -8.143  1.00 60.80  ? 163 ILE Z C     1 
ATOM   1263 O  O     . ILE A 1 163 ? 7.180   26.126 -8.037  1.00 58.39  ? 163 ILE Z O     1 
ATOM   1264 C  CB    . ILE A 1 163 ? 7.796   28.708 -6.164  1.00 57.27  ? 163 ILE Z CB    1 
ATOM   1265 C  CG1   . ILE A 1 163 ? 8.890   29.592 -5.565  1.00 59.15  ? 163 ILE Z CG1   1 
ATOM   1266 C  CG2   . ILE A 1 163 ? 7.542   27.518 -5.270  1.00 56.24  ? 163 ILE Z CG2   1 
ATOM   1267 C  CD1   . ILE A 1 163 ? 8.637   29.980 -4.124  1.00 56.89  ? 163 ILE Z CD1   1 
ATOM   1268 N  N     . VAL A 1 164 ? 6.074   27.944 -8.741  1.00 61.35  ? 164 VAL Z N     1 
ATOM   1269 C  CA    . VAL A 1 164 ? 5.044   27.175 -9.436  1.00 59.90  ? 164 VAL Z CA    1 
ATOM   1270 C  C     . VAL A 1 164 ? 4.886   27.666 -10.876 1.00 62.62  ? 164 VAL Z C     1 
ATOM   1271 O  O     . VAL A 1 164 ? 5.248   28.798 -11.197 1.00 65.36  ? 164 VAL Z O     1 
ATOM   1272 C  CB    . VAL A 1 164 ? 3.687   27.252 -8.717  1.00 59.77  ? 164 VAL Z CB    1 
ATOM   1273 C  CG1   . VAL A 1 164 ? 3.816   26.751 -7.297  1.00 58.77  ? 164 VAL Z CG1   1 
ATOM   1274 C  CG2   . VAL A 1 164 ? 3.165   28.666 -8.727  1.00 46.66  ? 164 VAL Z CG2   1 
ATOM   1275 N  N     . GLN A 1 165 ? 4.345   26.811 -11.741 1.00 63.51  ? 165 GLN Z N     1 
ATOM   1276 C  CA    . GLN A 1 165 ? 4.221   27.134 -13.162 1.00 65.45  ? 165 GLN Z CA    1 
ATOM   1277 C  C     . GLN A 1 165 ? 2.812   27.579 -13.542 1.00 60.85  ? 165 GLN Z C     1 
ATOM   1278 O  O     . GLN A 1 165 ? 2.618   28.252 -14.556 1.00 57.55  ? 165 GLN Z O     1 
ATOM   1279 C  CB    . GLN A 1 165 ? 4.627   25.931 -14.023 1.00 67.81  ? 165 GLN Z CB    1 
ATOM   1280 C  CG    . GLN A 1 165 ? 6.125   25.804 -14.275 1.00 70.49  ? 165 GLN Z CG    1 
ATOM   1281 C  CD    . GLN A 1 165 ? 6.938   25.719 -12.996 1.00 75.26  ? 165 GLN Z CD    1 
ATOM   1282 O  OE1   . GLN A 1 165 ? 6.736   24.825 -12.169 1.00 70.51  ? 165 GLN Z OE1   1 
ATOM   1283 N  NE2   . GLN A 1 165 ? 7.864   26.657 -12.826 1.00 79.57  ? 165 GLN Z NE2   1 
ATOM   1284 N  N     . ALA A 1 166 ? 1.834   27.192 -12.729 1.00 59.62  ? 166 ALA Z N     1 
ATOM   1285 C  CA    . ALA A 1 166 ? 0.441   27.533 -12.985 1.00 53.63  ? 166 ALA Z CA    1 
ATOM   1286 C  C     . ALA A 1 166 ? -0.330  27.668 -11.686 1.00 56.84  ? 166 ALA Z C     1 
ATOM   1287 O  O     . ALA A 1 166 ? 0.043   27.086 -10.674 1.00 59.25  ? 166 ALA Z O     1 
ATOM   1288 C  CB    . ALA A 1 166 ? -0.210  26.488 -13.872 1.00 43.71  ? 166 ALA Z CB    1 
ATOM   1289 N  N     . ILE A 1 167 ? -1.413  28.433 -11.732 1.00 49.28  ? 167 ILE Z N     1 
ATOM   1290 C  CA    . ILE A 1 167 ? -2.269  28.637 -10.575 1.00 50.93  ? 167 ILE Z CA    1 
ATOM   1291 C  C     . ILE A 1 167 ? -3.668  28.100 -10.838 1.00 51.94  ? 167 ILE Z C     1 
ATOM   1292 O  O     . ILE A 1 167 ? -4.317  28.508 -11.795 1.00 51.73  ? 167 ILE Z O     1 
ATOM   1293 C  CB    . ILE A 1 167 ? -2.373  30.123 -10.210 1.00 53.08  ? 167 ILE Z CB    1 
ATOM   1294 C  CG1   . ILE A 1 167 ? -0.987  30.710 -9.972  1.00 55.51  ? 167 ILE Z CG1   1 
ATOM   1295 C  CG2   . ILE A 1 167 ? -3.230  30.304 -8.982  1.00 48.40  ? 167 ILE Z CG2   1 
ATOM   1296 C  CD1   . ILE A 1 167 ? -0.271  30.086 -8.805  1.00 62.85  ? 167 ILE Z CD1   1 
ATOM   1297 N  N     . ILE A 1 168 ? -4.133  27.184 -9.996  1.00 49.55  ? 168 ILE Z N     1 
ATOM   1298 C  CA    . ILE A 1 168 ? -5.502  26.701 -10.102 1.00 48.64  ? 168 ILE Z CA    1 
ATOM   1299 C  C     . ILE A 1 168 ? -6.420  27.527 -9.223  1.00 53.95  ? 168 ILE Z C     1 
ATOM   1300 O  O     . ILE A 1 168 ? -6.274  27.533 -8.008  1.00 59.53  ? 168 ILE Z O     1 
ATOM   1301 C  CB    . ILE A 1 168 ? -5.619  25.236 -9.704  1.00 47.73  ? 168 ILE Z CB    1 
ATOM   1302 C  CG1   . ILE A 1 168 ? -4.871  24.368 -10.709 1.00 51.05  ? 168 ILE Z CG1   1 
ATOM   1303 C  CG2   . ILE A 1 168 ? -7.074  24.830 -9.646  1.00 47.82  ? 168 ILE Z CG2   1 
ATOM   1304 C  CD1   . ILE A 1 168 ? -4.864  22.905 -10.361 1.00 52.76  ? 168 ILE Z CD1   1 
ATOM   1305 N  N     . THR A 1 169 ? -7.360  28.229 -9.842  1.00 51.20  ? 169 THR Z N     1 
ATOM   1306 C  CA    . THR A 1 169 ? -8.288  29.085 -9.115  1.00 44.77  ? 169 THR Z CA    1 
ATOM   1307 C  C     . THR A 1 169 ? -9.537  29.323 -9.935  1.00 43.68  ? 169 THR Z C     1 
ATOM   1308 O  O     . THR A 1 169 ? -9.593  28.957 -11.100 1.00 54.21  ? 169 THR Z O     1 
ATOM   1309 C  CB    . THR A 1 169 ? -7.669  30.449 -8.770  1.00 48.04  ? 169 THR Z CB    1 
ATOM   1310 O  OG1   . THR A 1 169 ? -8.610  31.223 -8.019  1.00 50.18  ? 169 THR Z OG1   1 
ATOM   1311 C  CG2   . THR A 1 169 ? -7.327  31.205 -10.028 1.00 43.19  ? 169 THR Z CG2   1 
ATOM   1312 N  N     . GLU A 1 170 ? -10.539 29.936 -9.320  1.00 39.59  ? 170 GLU Z N     1 
ATOM   1313 C  CA    . GLU A 1 170 ? -11.726 30.363 -10.043 1.00 48.81  ? 170 GLU Z CA    1 
ATOM   1314 C  C     . GLU A 1 170 ? -11.732 31.882 -10.137 1.00 49.79  ? 170 GLU Z C     1 
ATOM   1315 O  O     . GLU A 1 170 ? -12.513 32.469 -10.880 1.00 54.87  ? 170 GLU Z O     1 
ATOM   1316 C  CB    . GLU A 1 170 ? -12.999 29.864 -9.357  1.00 49.71  ? 170 GLU Z CB    1 
ATOM   1317 C  CG    . GLU A 1 170 ? -13.108 28.355 -9.248  1.00 58.23  ? 170 GLU Z CG    1 
ATOM   1318 C  CD    . GLU A 1 170 ? -13.194 27.672 -10.597 1.00 69.52  ? 170 GLU Z CD    1 
ATOM   1319 O  OE1   . GLU A 1 170 ? -13.668 28.306 -11.567 1.00 72.66  ? 170 GLU Z OE1   1 
ATOM   1320 O  OE2   . GLU A 1 170 ? -12.781 26.497 -10.681 1.00 66.79  ? 170 GLU Z OE2   1 
ATOM   1321 N  N     . ASP A 1 171 ? -10.834 32.507 -9.385  1.00 49.21  ? 171 ASP Z N     1 
ATOM   1322 C  CA    . ASP A 1 171 ? -10.781 33.959 -9.264  1.00 51.90  ? 171 ASP Z CA    1 
ATOM   1323 C  C     . ASP A 1 171 ? -9.936  34.586 -10.366 1.00 57.28  ? 171 ASP Z C     1 
ATOM   1324 O  O     . ASP A 1 171 ? -8.836  34.127 -10.649 1.00 64.74  ? 171 ASP Z O     1 
ATOM   1325 C  CB    . ASP A 1 171 ? -10.229 34.344 -7.890  1.00 48.24  ? 171 ASP Z CB    1 
ATOM   1326 C  CG    . ASP A 1 171 ? -10.276 35.831 -7.635  1.00 55.65  ? 171 ASP Z CG    1 
ATOM   1327 O  OD1   . ASP A 1 171 ? -11.038 36.533 -8.322  1.00 55.89  ? 171 ASP Z OD1   1 
ATOM   1328 O  OD2   . ASP A 1 171 ? -9.558  36.298 -6.732  1.00 57.70  ? 171 ASP Z OD2   1 
ATOM   1329 N  N     . SER A 1 172 ? -10.456 35.643 -10.979 1.00 54.89  ? 172 SER Z N     1 
ATOM   1330 C  CA    . SER A 1 172 ? -9.765  36.319 -12.070 1.00 60.11  ? 172 SER Z CA    1 
ATOM   1331 C  C     . SER A 1 172 ? -8.772  37.360 -11.568 1.00 63.04  ? 172 SER Z C     1 
ATOM   1332 O  O     . SER A 1 172 ? -7.917  37.825 -12.322 1.00 63.31  ? 172 SER Z O     1 
ATOM   1333 C  CB    . SER A 1 172 ? -10.771 36.986 -12.996 1.00 62.04  ? 172 SER Z CB    1 
ATOM   1334 O  OG    . SER A 1 172 ? -11.570 37.897 -12.265 1.00 64.63  ? 172 SER Z OG    1 
ATOM   1335 N  N     . ASP A 1 173 ? -8.897  37.727 -10.295 1.00 59.27  ? 173 ASP Z N     1 
ATOM   1336 C  CA    . ASP A 1 173 ? -7.977  38.666 -9.649  1.00 54.21  ? 173 ASP Z CA    1 
ATOM   1337 C  C     . ASP A 1 173 ? -6.524  38.262 -9.843  1.00 50.02  ? 173 ASP Z C     1 
ATOM   1338 O  O     . ASP A 1 173 ? -5.641  39.112 -9.898  1.00 56.25  ? 173 ASP Z O     1 
ATOM   1339 C  CB    . ASP A 1 173 ? -8.268  38.772 -8.146  1.00 56.12  ? 173 ASP Z CB    1 
ATOM   1340 C  CG    . ASP A 1 173 ? -9.398  39.727 -7.833  1.00 64.14  ? 173 ASP Z CG    1 
ATOM   1341 O  OD1   . ASP A 1 173 ? -9.614  40.678 -8.609  1.00 68.70  ? 173 ASP Z OD1   1 
ATOM   1342 O  OD2   . ASP A 1 173 ? -10.069 39.537 -6.803  1.00 69.77  ? 173 ASP Z OD2   1 
ATOM   1343 N  N     . LEU A 1 174 ? -6.285  36.958 -9.935  1.00 49.75  ? 174 LEU Z N     1 
ATOM   1344 C  CA    . LEU A 1 174 ? -4.938  36.429 -10.080 1.00 46.85  ? 174 LEU Z CA    1 
ATOM   1345 C  C     . LEU A 1 174 ? -4.256  37.013 -11.308 1.00 52.04  ? 174 LEU Z C     1 
ATOM   1346 O  O     . LEU A 1 174 ? -3.042  37.192 -11.324 1.00 56.96  ? 174 LEU Z O     1 
ATOM   1347 C  CB    . LEU A 1 174 ? -4.963  34.902 -10.164 1.00 43.61  ? 174 LEU Z CB    1 
ATOM   1348 C  CG    . LEU A 1 174 ? -4.983  34.104 -8.862  1.00 47.52  ? 174 LEU Z CG    1 
ATOM   1349 C  CD1   . LEU A 1 174 ? -3.747  34.407 -8.051  1.00 56.12  ? 174 LEU Z CD1   1 
ATOM   1350 C  CD2   . LEU A 1 174 ? -6.224  34.400 -8.058  1.00 43.98  ? 174 LEU Z CD2   1 
ATOM   1351 N  N     . LEU A 1 175 ? -5.042  37.321 -12.333 1.00 56.04  ? 175 LEU Z N     1 
ATOM   1352 C  CA    . LEU A 1 175 ? -4.486  37.898 -13.547 1.00 49.83  ? 175 LEU Z CA    1 
ATOM   1353 C  C     . LEU A 1 175 ? -4.036  39.334 -13.305 1.00 56.44  ? 175 LEU Z C     1 
ATOM   1354 O  O     . LEU A 1 175 ? -3.016  39.768 -13.834 1.00 71.70  ? 175 LEU Z O     1 
ATOM   1355 C  CB    . LEU A 1 175 ? -5.503  37.842 -14.686 1.00 47.39  ? 175 LEU Z CB    1 
ATOM   1356 C  CG    . LEU A 1 175 ? -5.780  36.451 -15.256 1.00 51.16  ? 175 LEU Z CG    1 
ATOM   1357 C  CD1   . LEU A 1 175 ? -6.910  36.508 -16.269 1.00 54.06  ? 175 LEU Z CD1   1 
ATOM   1358 C  CD2   . LEU A 1 175 ? -4.522  35.873 -15.886 1.00 51.60  ? 175 LEU Z CD2   1 
ATOM   1359 N  N     . ALA A 1 176 ? -4.792  40.063 -12.492 1.00 54.02  ? 176 ALA Z N     1 
ATOM   1360 C  CA    . ALA A 1 176 ? -4.463  41.447 -12.169 1.00 48.59  ? 176 ALA Z CA    1 
ATOM   1361 C  C     . ALA A 1 176 ? -3.250  41.543 -11.239 1.00 52.41  ? 176 ALA Z C     1 
ATOM   1362 O  O     . ALA A 1 176 ? -2.581  42.574 -11.174 1.00 53.33  ? 176 ALA Z O     1 
ATOM   1363 C  CB    . ALA A 1 176 ? -5.663  42.135 -11.548 1.00 43.55  ? 176 ALA Z CB    1 
ATOM   1364 N  N     . PHE A 1 177 ? -2.967  40.462 -10.523 1.00 55.55  ? 177 PHE Z N     1 
ATOM   1365 C  CA    . PHE A 1 177 ? -1.823  40.432 -9.628  1.00 58.70  ? 177 PHE Z CA    1 
ATOM   1366 C  C     . PHE A 1 177 ? -0.549  40.127 -10.399 1.00 61.70  ? 177 PHE Z C     1 
ATOM   1367 O  O     . PHE A 1 177 ? 0.552   40.202 -9.863  1.00 66.00  ? 177 PHE Z O     1 
ATOM   1368 C  CB    . PHE A 1 177 ? -2.037  39.405 -8.514  1.00 45.22  ? 177 PHE Z CB    1 
ATOM   1369 C  CG    . PHE A 1 177 ? -2.835  39.931 -7.344  1.00 49.92  ? 177 PHE Z CG    1 
ATOM   1370 C  CD1   . PHE A 1 177 ? -2.245  40.759 -6.408  1.00 46.24  ? 177 PHE Z CD1   1 
ATOM   1371 C  CD2   . PHE A 1 177 ? -4.167  39.587 -7.175  1.00 47.36  ? 177 PHE Z CD2   1 
ATOM   1372 C  CE1   . PHE A 1 177 ? -2.964  41.239 -5.339  1.00 46.35  ? 177 PHE Z CE1   1 
ATOM   1373 C  CE2   . PHE A 1 177 ? -4.891  40.067 -6.102  1.00 50.71  ? 177 PHE Z CE2   1 
ATOM   1374 C  CZ    . PHE A 1 177 ? -4.287  40.892 -5.185  1.00 45.52  ? 177 PHE Z CZ    1 
ATOM   1375 N  N     . GLY A 1 178 ? -0.710  39.782 -11.668 1.00 62.74  ? 178 GLY Z N     1 
ATOM   1376 C  CA    . GLY A 1 178 ? 0.424   39.538 -12.533 1.00 63.17  ? 178 GLY Z CA    1 
ATOM   1377 C  C     . GLY A 1 178 ? 0.841   38.085 -12.622 1.00 61.87  ? 178 GLY Z C     1 
ATOM   1378 O  O     . GLY A 1 178 ? 2.028   37.784 -12.698 1.00 70.15  ? 178 GLY Z O     1 
ATOM   1379 N  N     . CYS A 1 179 ? -0.128  37.179 -12.615 1.00 52.72  ? 179 CYS Z N     1 
ATOM   1380 C  CA    . CYS A 1 179 ? 0.178   35.769 -12.785 1.00 54.85  ? 179 CYS Z CA    1 
ATOM   1381 C  C     . CYS A 1 179 ? 0.528   35.477 -14.224 1.00 56.83  ? 179 CYS Z C     1 
ATOM   1382 O  O     . CYS A 1 179 ? 0.061   36.165 -15.123 1.00 60.09  ? 179 CYS Z O     1 
ATOM   1383 C  CB    . CYS A 1 179 ? -0.995  34.899 -12.361 1.00 59.66  ? 179 CYS Z CB    1 
ATOM   1384 S  SG    . CYS A 1 179 ? -1.151  34.706 -10.593 1.00 76.18  ? 179 CYS Z SG    1 
ATOM   1385 N  N     . LYS A 1 180 ? 1.340   34.448 -14.436 1.00 47.14  ? 180 LYS Z N     1 
ATOM   1386 C  CA    . LYS A 1 180 ? 1.743   34.048 -15.778 1.00 55.87  ? 180 LYS Z CA    1 
ATOM   1387 C  C     . LYS A 1 180 ? 0.722   33.092 -16.404 1.00 53.72  ? 180 LYS Z C     1 
ATOM   1388 O  O     . LYS A 1 180 ? 0.213   33.339 -17.499 1.00 55.68  ? 180 LYS Z O     1 
ATOM   1389 C  CB    . LYS A 1 180 ? 3.131   33.396 -15.748 1.00 59.56  ? 180 LYS Z CB    1 
ATOM   1390 C  CG    . LYS A 1 180 ? 4.239   34.275 -15.179 1.00 60.56  ? 180 LYS Z CG    1 
ATOM   1391 C  CD    . LYS A 1 180 ? 4.305   35.604 -15.907 1.00 71.54  ? 180 LYS Z CD    1 
ATOM   1392 C  CE    . LYS A 1 180 ? 5.494   36.443 -15.463 1.00 78.67  ? 180 LYS Z CE    1 
ATOM   1393 N  NZ    . LYS A 1 180 ? 6.787   35.920 -15.992 1.00 86.20  ? 180 LYS Z NZ    1 
ATOM   1394 N  N     . LYS A 1 181 ? 0.431   32.001 -15.701 1.00 51.45  ? 181 LYS Z N     1 
ATOM   1395 C  CA    . LYS A 1 181 ? -0.523  31.004 -16.173 1.00 53.04  ? 181 LYS Z CA    1 
ATOM   1396 C  C     . LYS A 1 181 ? -1.571  30.725 -15.103 1.00 53.83  ? 181 LYS Z C     1 
ATOM   1397 O  O     . LYS A 1 181 ? -1.234  30.473 -13.948 1.00 51.83  ? 181 LYS Z O     1 
ATOM   1398 C  CB    . LYS A 1 181 ? 0.192   29.705 -16.557 1.00 56.72  ? 181 LYS Z CB    1 
ATOM   1399 C  CG    . LYS A 1 181 ? 1.199   29.837 -17.690 1.00 61.39  ? 181 LYS Z CG    1 
ATOM   1400 C  CD    . LYS A 1 181 ? 2.098   28.607 -17.769 1.00 68.08  ? 181 LYS Z CD    1 
ATOM   1401 C  CE    . LYS A 1 181 ? 3.174   28.753 -18.837 1.00 73.47  ? 181 LYS Z CE    1 
ATOM   1402 N  NZ    . LYS A 1 181 ? 2.606   28.710 -20.211 1.00 79.35  ? 181 LYS Z NZ    1 
ATOM   1403 N  N     . VAL A 1 182 ? -2.841  30.771 -15.494 1.00 55.45  ? 182 VAL Z N     1 
ATOM   1404 C  CA    . VAL A 1 182 ? -3.950  30.535 -14.571 1.00 56.02  ? 182 VAL Z CA    1 
ATOM   1405 C  C     . VAL A 1 182 ? -4.938  29.515 -15.147 1.00 52.78  ? 182 VAL Z C     1 
ATOM   1406 O  O     . VAL A 1 182 ? -5.337  29.611 -16.305 1.00 61.10  ? 182 VAL Z O     1 
ATOM   1407 C  CB    . VAL A 1 182 ? -4.695  31.847 -14.247 1.00 57.69  ? 182 VAL Z CB    1 
ATOM   1408 C  CG1   . VAL A 1 182 ? -5.859  31.582 -13.334 1.00 61.66  ? 182 VAL Z CG1   1 
ATOM   1409 C  CG2   . VAL A 1 182 ? -3.756  32.847 -13.605 1.00 55.75  ? 182 VAL Z CG2   1 
ATOM   1410 N  N     . ILE A 1 183 ? -5.328  28.537 -14.339 1.00 51.13  ? 183 ILE Z N     1 
ATOM   1411 C  CA    . ILE A 1 183 ? -6.257  27.510 -14.788 1.00 50.12  ? 183 ILE Z CA    1 
ATOM   1412 C  C     . ILE A 1 183 ? -7.626  27.683 -14.143 1.00 50.36  ? 183 ILE Z C     1 
ATOM   1413 O  O     . ILE A 1 183 ? -7.794  27.428 -12.956 1.00 50.97  ? 183 ILE Z O     1 
ATOM   1414 C  CB    . ILE A 1 183 ? -5.716  26.111 -14.474 1.00 51.68  ? 183 ILE Z CB    1 
ATOM   1415 C  CG1   . ILE A 1 183 ? -4.321  25.945 -15.075 1.00 49.87  ? 183 ILE Z CG1   1 
ATOM   1416 C  CG2   . ILE A 1 183 ? -6.657  25.039 -14.994 1.00 54.12  ? 183 ILE Z CG2   1 
ATOM   1417 C  CD1   . ILE A 1 183 ? -3.698  24.612 -14.788 1.00 46.71  ? 183 ILE Z CD1   1 
ATOM   1418 N  N     . LEU A 1 184 ? -8.616  28.052 -14.924 1.00 52.23  ? 184 LEU Z N     1 
ATOM   1419 C  CA    . LEU A 1 184 ? -9.934  28.310 -14.410 1.00 48.92  ? 184 LEU Z CA    1 
ATOM   1420 C  C     . LEU A 1 184 ? -10.898 27.186 -14.637 1.00 52.20  ? 184 LEU Z C     1 
ATOM   1421 O  O     . LEU A 1 184 ? -10.717 26.394 -15.506 1.00 53.79  ? 184 LEU Z O     1 
ATOM   1422 C  CB    . LEU A 1 184 ? -10.496 29.535 -15.089 1.00 54.68  ? 184 LEU Z CB    1 
ATOM   1423 C  CG    . LEU A 1 184 ? -9.874  30.905 -14.898 1.00 65.07  ? 184 LEU Z CG    1 
ATOM   1424 C  CD1   . LEU A 1 184 ? -9.842  31.710 -16.171 1.00 70.97  ? 184 LEU Z CD1   1 
ATOM   1425 C  CD2   . LEU A 1 184 ? -10.645 31.635 -13.832 1.00 68.67  ? 184 LEU Z CD2   1 
ATOM   1426 N  N     . LYS A 1 185 ? -11.942 27.131 -13.840 1.00 53.34  ? 185 LYS Z N     1 
ATOM   1427 C  CA    . LYS A 1 185 ? -13.035 26.189 -14.060 1.00 54.61  ? 185 LYS Z CA    1 
ATOM   1428 C  C     . LYS A 1 185 ? -12.592 24.740 -14.244 1.00 56.34  ? 185 LYS Z C     1 
ATOM   1429 O  O     . LYS A 1 185 ? -13.106 24.039 -15.111 1.00 60.06  ? 185 LYS Z O     1 
ATOM   1430 C  CB    . LYS A 1 185 ? -13.853 26.624 -15.276 1.00 54.24  ? 185 LYS Z CB    1 
ATOM   1431 C  CG    . LYS A 1 185 ? -14.620 27.910 -15.057 1.00 56.14  ? 185 LYS Z CG    1 
ATOM   1432 C  CD    . LYS A 1 185 ? -15.323 28.369 -16.314 1.00 61.29  ? 185 LYS Z CD    1 
ATOM   1433 C  CE    . LYS A 1 185 ? -16.228 29.546 -16.012 1.00 65.54  ? 185 LYS Z CE    1 
ATOM   1434 N  NZ    . LYS A 1 185 ? -15.489 30.636 -15.320 1.00 61.00  ? 185 LYS Z NZ    1 
ATOM   1435 N  N     . MET A 1 186 ? -11.647 24.289 -13.430 1.00 56.89  ? 186 MET Z N     1 
ATOM   1436 C  CA    . MET A 1 186 ? -11.194 22.905 -13.504 1.00 62.96  ? 186 MET Z CA    1 
ATOM   1437 C  C     . MET A 1 186 ? -12.151 21.955 -12.775 1.00 71.48  ? 186 MET Z C     1 
ATOM   1438 O  O     . MET A 1 186 ? -12.495 22.189 -11.620 1.00 77.94  ? 186 MET Z O     1 
ATOM   1439 C  CB    . MET A 1 186 ? -9.790  22.773 -12.925 1.00 59.05  ? 186 MET Z CB    1 
ATOM   1440 C  CG    . MET A 1 186 ? -9.176  21.420 -13.178 1.00 65.45  ? 186 MET Z CG    1 
ATOM   1441 S  SD    . MET A 1 186 ? -7.634  21.188 -12.295 1.00 61.89  ? 186 MET Z SD    1 
ATOM   1442 C  CE    . MET A 1 186 ? -8.217  21.175 -10.598 1.00 75.49  ? 186 MET Z CE    1 
ATOM   1443 N  N     . ASP A 1 187 ? -12.578 20.887 -13.452 1.00 71.38  ? 187 ASP Z N     1 
ATOM   1444 C  CA    . ASP A 1 187 ? -13.489 19.903 -12.859 1.00 64.04  ? 187 ASP Z CA    1 
ATOM   1445 C  C     . ASP A 1 187 ? -12.720 18.800 -12.152 1.00 70.68  ? 187 ASP Z C     1 
ATOM   1446 O  O     . ASP A 1 187 ? -11.493 18.838 -12.082 1.00 70.57  ? 187 ASP Z O     1 
ATOM   1447 C  CB    . ASP A 1 187 ? -14.412 19.292 -13.919 1.00 75.94  ? 187 ASP Z CB    1 
ATOM   1448 C  CG    . ASP A 1 187 ? -13.655 18.767 -15.133 1.00 79.37  ? 187 ASP Z CG    1 
ATOM   1449 O  OD1   . ASP A 1 187 ? -12.493 18.335 -14.988 1.00 78.89  ? 187 ASP Z OD1   1 
ATOM   1450 O  OD2   . ASP A 1 187 ? -14.225 18.789 -16.244 1.00 82.17  ? 187 ASP Z OD2   1 
ATOM   1451 N  N     . GLN A 1 188 ? -13.446 17.805 -11.653 1.00 74.41  ? 188 GLN Z N     1 
ATOM   1452 C  CA    . GLN A 1 188 ? -12.833 16.710 -10.905 1.00 82.23  ? 188 GLN Z CA    1 
ATOM   1453 C  C     . GLN A 1 188 ? -12.008 15.803 -11.811 1.00 89.87  ? 188 GLN Z C     1 
ATOM   1454 O  O     . GLN A 1 188 ? -11.174 15.029 -11.339 1.00 84.85  ? 188 GLN Z O     1 
ATOM   1455 C  CB    . GLN A 1 188 ? -13.906 15.893 -10.181 1.00 87.05  ? 188 GLN Z CB    1 
ATOM   1456 C  CG    . GLN A 1 188 ? -14.975 15.344 -11.110 1.00 91.96  ? 188 GLN Z CG    1 
ATOM   1457 C  CD    . GLN A 1 188 ? -16.073 14.597 -10.371 1.00 96.90  ? 188 GLN Z CD    1 
ATOM   1458 O  OE1   . GLN A 1 188 ? -15.995 14.382 -9.154  1.00 92.99  ? 188 GLN Z OE1   1 
ATOM   1459 N  NE2   . GLN A 1 188 ? -17.110 14.197 -11.108 1.00 101.46 ? 188 GLN Z NE2   1 
ATOM   1460 N  N     . PHE A 1 189 ? -12.246 15.907 -13.114 1.00 89.85  ? 189 PHE Z N     1 
ATOM   1461 C  CA    . PHE A 1 189 ? -11.568 15.060 -14.089 1.00 85.03  ? 189 PHE Z CA    1 
ATOM   1462 C  C     . PHE A 1 189 ? -10.239 15.668 -14.525 1.00 77.33  ? 189 PHE Z C     1 
ATOM   1463 O  O     . PHE A 1 189 ? -9.324  14.945 -14.919 1.00 72.68  ? 189 PHE Z O     1 
ATOM   1464 C  CB    . PHE A 1 189 ? -12.468 14.821 -15.307 1.00 89.89  ? 189 PHE Z CB    1 
ATOM   1465 C  CG    . PHE A 1 189 ? -13.798 14.203 -14.965 1.00 100.40 ? 189 PHE Z CG    1 
ATOM   1466 C  CD1   . PHE A 1 189 ? -13.912 13.310 -13.906 1.00 105.29 ? 189 PHE Z CD1   1 
ATOM   1467 C  CD2   . PHE A 1 189 ? -14.935 14.523 -15.693 1.00 109.42 ? 189 PHE Z CD2   1 
ATOM   1468 C  CE1   . PHE A 1 189 ? -15.130 12.742 -13.582 1.00 111.35 ? 189 PHE Z CE1   1 
ATOM   1469 C  CE2   . PHE A 1 189 ? -16.159 13.959 -15.375 1.00 115.95 ? 189 PHE Z CE2   1 
ATOM   1470 C  CZ    . PHE A 1 189 ? -16.255 13.065 -14.315 1.00 116.06 ? 189 PHE Z CZ    1 
ATOM   1471 N  N     . GLY A 1 190 ? -10.138 16.995 -14.452 1.00 71.52  ? 190 GLY Z N     1 
ATOM   1472 C  CA    . GLY A 1 190 ? -8.907  17.695 -14.780 1.00 67.36  ? 190 GLY Z CA    1 
ATOM   1473 C  C     . GLY A 1 190 ? -9.038  18.670 -15.935 1.00 70.74  ? 190 GLY Z C     1 
ATOM   1474 O  O     . GLY A 1 190 ? -8.048  19.243 -16.390 1.00 70.70  ? 190 GLY Z O     1 
ATOM   1475 N  N     . ASN A 1 191 ? -10.262 18.858 -16.413 1.00 75.02  ? 191 ASN Z N     1 
ATOM   1476 C  CA    . ASN A 1 191 ? -10.508 19.736 -17.548 1.00 68.94  ? 191 ASN Z CA    1 
ATOM   1477 C  C     . ASN A 1 191 ? -10.796 21.155 -17.102 1.00 72.83  ? 191 ASN Z C     1 
ATOM   1478 O  O     . ASN A 1 191 ? -11.703 21.381 -16.309 1.00 69.48  ? 191 ASN Z O     1 
ATOM   1479 C  CB    . ASN A 1 191 ? -11.677 19.216 -18.384 1.00 67.64  ? 191 ASN Z CB    1 
ATOM   1480 C  CG    . ASN A 1 191 ? -11.493 17.780 -18.811 1.00 73.66  ? 191 ASN Z CG    1 
ATOM   1481 O  OD1   . ASN A 1 191 ? -10.758 17.488 -19.758 1.00 73.64  ? 191 ASN Z OD1   1 
ATOM   1482 N  ND2   . ASN A 1 191 ? -12.170 16.869 -18.117 1.00 76.63  ? 191 ASN Z ND2   1 
ATOM   1483 N  N     . GLY A 1 192 ? -10.034 22.112 -17.617 1.00 60.18  ? 192 GLY Z N     1 
ATOM   1484 C  CA    . GLY A 1 192 ? -10.244 23.506 -17.272 1.00 58.05  ? 192 GLY Z CA    1 
ATOM   1485 C  C     . GLY A 1 192 ? -9.886  24.459 -18.395 1.00 62.86  ? 192 GLY Z C     1 
ATOM   1486 O  O     . GLY A 1 192 ? -9.449  24.035 -19.465 1.00 65.75  ? 192 GLY Z O     1 
ATOM   1487 N  N     . LEU A 1 193 ? -10.087 25.751 -18.151 1.00 55.28  ? 193 LEU Z N     1 
ATOM   1488 C  CA    . LEU A 1 193 ? -9.704  26.795 -19.093 1.00 54.36  ? 193 LEU Z CA    1 
ATOM   1489 C  C     . LEU A 1 193 ? -8.433  27.488 -18.626 1.00 53.63  ? 193 LEU Z C     1 
ATOM   1490 O  O     . LEU A 1 193 ? -8.381  28.012 -17.519 1.00 54.42  ? 193 LEU Z O     1 
ATOM   1491 C  CB    . LEU A 1 193 ? -10.823 27.822 -19.255 1.00 54.73  ? 193 LEU Z CB    1 
ATOM   1492 C  CG    . LEU A 1 193 ? -12.055 27.398 -20.053 1.00 62.43  ? 193 LEU Z CG    1 
ATOM   1493 C  CD1   . LEU A 1 193 ? -13.093 28.516 -20.099 1.00 63.38  ? 193 LEU Z CD1   1 
ATOM   1494 C  CD2   . LEU A 1 193 ? -11.660 26.970 -21.461 1.00 64.45  ? 193 LEU Z CD2   1 
ATOM   1495 N  N     . GLU A 1 194 ? -7.409  27.492 -19.472 1.00 54.22  ? 194 GLU Z N     1 
ATOM   1496 C  CA    . GLU A 1 194 ? -6.139  28.130 -19.143 1.00 53.96  ? 194 GLU Z CA    1 
ATOM   1497 C  C     . GLU A 1 194 ? -6.015  29.492 -19.808 1.00 55.51  ? 194 GLU Z C     1 
ATOM   1498 O  O     . GLU A 1 194 ? -6.313  29.652 -20.986 1.00 58.29  ? 194 GLU Z O     1 
ATOM   1499 C  CB    . GLU A 1 194 ? -4.964  27.243 -19.557 1.00 60.63  ? 194 GLU Z CB    1 
ATOM   1500 C  CG    . GLU A 1 194 ? -3.607  27.898 -19.400 1.00 59.01  ? 194 GLU Z CG    1 
ATOM   1501 C  CD    . GLU A 1 194 ? -2.491  27.104 -20.047 1.00 75.92  ? 194 GLU Z CD    1 
ATOM   1502 O  OE1   . GLU A 1 194 ? -2.265  27.272 -21.269 1.00 80.63  ? 194 GLU Z OE1   1 
ATOM   1503 O  OE2   . GLU A 1 194 ? -1.838  26.314 -19.333 1.00 82.75  ? 194 GLU Z OE2   1 
ATOM   1504 N  N     . ILE A 1 195 ? -5.579  30.478 -19.041 1.00 51.88  ? 195 ILE Z N     1 
ATOM   1505 C  CA    . ILE A 1 195 ? -5.329  31.800 -19.577 1.00 54.52  ? 195 ILE Z CA    1 
ATOM   1506 C  C     . ILE A 1 195 ? -3.874  32.157 -19.339 1.00 57.51  ? 195 ILE Z C     1 
ATOM   1507 O  O     . ILE A 1 195 ? -3.429  32.253 -18.201 1.00 58.59  ? 195 ILE Z O     1 
ATOM   1508 C  CB    . ILE A 1 195 ? -6.242  32.857 -18.937 1.00 49.67  ? 195 ILE Z CB    1 
ATOM   1509 C  CG1   . ILE A 1 195 ? -7.706  32.555 -19.253 1.00 50.80  ? 195 ILE Z CG1   1 
ATOM   1510 C  CG2   . ILE A 1 195 ? -5.876  34.244 -19.426 1.00 49.15  ? 195 ILE Z CG2   1 
ATOM   1511 C  CD1   . ILE A 1 195 ? -8.677  33.580 -18.704 1.00 50.79  ? 195 ILE Z CD1   1 
ATOM   1512 N  N     . ASP A 1 196 ? -3.127  32.330 -20.420 1.00 52.57  ? 196 ASP Z N     1 
ATOM   1513 C  CA    . ASP A 1 196 ? -1.723  32.692 -20.322 1.00 53.98  ? 196 ASP Z CA    1 
ATOM   1514 C  C     . ASP A 1 196 ? -1.556  34.200 -20.446 1.00 56.82  ? 196 ASP Z C     1 
ATOM   1515 O  O     . ASP A 1 196 ? -2.281  34.839 -21.200 1.00 60.63  ? 196 ASP Z O     1 
ATOM   1516 C  CB    . ASP A 1 196 ? -0.916  31.979 -21.400 1.00 66.90  ? 196 ASP Z CB    1 
ATOM   1517 C  CG    . ASP A 1 196 ? 0.557   32.001 -21.120 1.00 85.19  ? 196 ASP Z CG    1 
ATOM   1518 O  OD1   . ASP A 1 196 ? 1.163   33.092 -21.207 1.00 87.46  ? 196 ASP Z OD1   1 
ATOM   1519 O  OD2   . ASP A 1 196 ? 1.107   30.924 -20.813 1.00 95.39  ? 196 ASP Z OD2   1 
ATOM   1520 N  N     . GLN A 1 197 ? -0.600  34.764 -19.715 1.00 56.48  ? 197 GLN Z N     1 
ATOM   1521 C  CA    . GLN A 1 197 ? -0.413  36.211 -19.693 1.00 52.44  ? 197 GLN Z CA    1 
ATOM   1522 C  C     . GLN A 1 197 ? 0.119   36.725 -21.018 1.00 64.26  ? 197 GLN Z C     1 
ATOM   1523 O  O     . GLN A 1 197 ? -0.192  37.839 -21.441 1.00 53.00  ? 197 GLN Z O     1 
ATOM   1524 C  CB    . GLN A 1 197 ? 0.541   36.606 -18.573 1.00 54.29  ? 197 GLN Z CB    1 
ATOM   1525 C  CG    . GLN A 1 197 ? 0.648   38.101 -18.335 1.00 58.55  ? 197 GLN Z CG    1 
ATOM   1526 C  CD    . GLN A 1 197 ? 1.756   38.445 -17.358 1.00 68.52  ? 197 GLN Z CD    1 
ATOM   1527 O  OE1   . GLN A 1 197 ? 2.847   37.880 -17.424 1.00 70.52  ? 197 GLN Z OE1   1 
ATOM   1528 N  NE2   . GLN A 1 197 ? 1.479   39.366 -16.438 1.00 71.53  ? 197 GLN Z NE2   1 
ATOM   1529 N  N     . ALA A 1 198 ? 0.926   35.899 -21.670 1.00 62.86  ? 198 ALA Z N     1 
ATOM   1530 C  CA    . ALA A 1 198 ? 1.549   36.274 -22.930 1.00 60.76  ? 198 ALA Z CA    1 
ATOM   1531 C  C     . ALA A 1 198 ? 0.553   36.265 -24.084 1.00 63.88  ? 198 ALA Z C     1 
ATOM   1532 O  O     . ALA A 1 198 ? 0.798   36.867 -25.128 1.00 67.82  ? 198 ALA Z O     1 
ATOM   1533 C  CB    . ALA A 1 198 ? 2.710   35.346 -23.230 1.00 63.32  ? 198 ALA Z CB    1 
ATOM   1534 N  N     . ARG A 1 199 ? -0.572  35.586 -23.888 1.00 63.67  ? 199 ARG Z N     1 
ATOM   1535 C  CA    . ARG A 1 199 ? -1.560  35.427 -24.950 1.00 62.71  ? 199 ARG Z CA    1 
ATOM   1536 C  C     . ARG A 1 199 ? -2.664  36.473 -24.861 1.00 58.53  ? 199 ARG Z C     1 
ATOM   1537 O  O     . ARG A 1 199 ? -3.654  36.403 -25.586 1.00 53.57  ? 199 ARG Z O     1 
ATOM   1538 C  CB    . ARG A 1 199 ? -2.165  34.020 -24.914 1.00 62.20  ? 199 ARG Z CB    1 
ATOM   1539 C  CG    . ARG A 1 199 ? -1.132  32.898 -24.956 1.00 64.29  ? 199 ARG Z CG    1 
ATOM   1540 C  CD    . ARG A 1 199 ? -1.558  31.756 -25.868 1.00 69.71  ? 199 ARG Z CD    1 
ATOM   1541 N  NE    . ARG A 1 199 ? -2.962  31.403 -25.693 1.00 74.43  ? 199 ARG Z NE    1 
ATOM   1542 C  CZ    . ARG A 1 199 ? -3.876  31.498 -26.654 1.00 79.94  ? 199 ARG Z CZ    1 
ATOM   1543 N  NH1   . ARG A 1 199 ? -3.530  31.926 -27.864 1.00 73.63  ? 199 ARG Z NH1   1 
ATOM   1544 N  NH2   . ARG A 1 199 ? -5.135  31.158 -26.408 1.00 81.29  ? 199 ARG Z NH2   1 
ATOM   1545 N  N     . LEU A 1 200 ? -2.481  37.453 -23.981 1.00 55.18  ? 200 LEU Z N     1 
ATOM   1546 C  CA    . LEU A 1 200 ? -3.471  38.510 -23.796 1.00 55.66  ? 200 LEU Z CA    1 
ATOM   1547 C  C     . LEU A 1 200 ? -3.668  39.327 -25.063 1.00 59.45  ? 200 LEU Z C     1 
ATOM   1548 O  O     . LEU A 1 200 ? -4.671  40.022 -25.214 1.00 61.44  ? 200 LEU Z O     1 
ATOM   1549 C  CB    . LEU A 1 200 ? -3.070  39.428 -22.642 1.00 50.71  ? 200 LEU Z CB    1 
ATOM   1550 C  CG    . LEU A 1 200 ? -3.412  38.918 -21.243 1.00 68.57  ? 200 LEU Z CG    1 
ATOM   1551 C  CD1   . LEU A 1 200 ? -2.994  39.942 -20.220 1.00 49.31  ? 200 LEU Z CD1   1 
ATOM   1552 C  CD2   . LEU A 1 200 ? -4.897  38.600 -21.110 1.00 48.66  ? 200 LEU Z CD2   1 
ATOM   1553 N  N     . GLY A 1 201 ? -2.707  39.232 -25.975 1.00 56.55  ? 201 GLY Z N     1 
ATOM   1554 C  CA    . GLY A 1 201 ? -2.797  39.907 -27.255 1.00 64.99  ? 201 GLY Z CA    1 
ATOM   1555 C  C     . GLY A 1 201 ? -3.775  39.269 -28.227 1.00 73.04  ? 201 GLY Z C     1 
ATOM   1556 O  O     . GLY A 1 201 ? -4.093  39.850 -29.268 1.00 79.92  ? 201 GLY Z O     1 
ATOM   1557 N  N     . MET A 1 202 ? -4.251  38.071 -27.892 1.00 70.54  ? 202 MET Z N     1 
ATOM   1558 C  CA    . MET A 1 202 ? -5.266  37.403 -28.704 1.00 69.21  ? 202 MET Z CA    1 
ATOM   1559 C  C     . MET A 1 202 ? -6.601  38.119 -28.586 1.00 67.02  ? 202 MET Z C     1 
ATOM   1560 O  O     . MET A 1 202 ? -7.463  37.988 -29.452 1.00 79.33  ? 202 MET Z O     1 
ATOM   1561 C  CB    . MET A 1 202 ? -5.440  35.943 -28.286 1.00 69.70  ? 202 MET Z CB    1 
ATOM   1562 C  CG    . MET A 1 202 ? -4.201  35.091 -28.466 1.00 71.09  ? 202 MET Z CG    1 
ATOM   1563 S  SD    . MET A 1 202 ? -3.653  35.114 -30.171 1.00 77.82  ? 202 MET Z SD    1 
ATOM   1564 C  CE    . MET A 1 202 ? -5.087  34.421 -30.998 1.00 82.89  ? 202 MET Z CE    1 
ATOM   1565 N  N     A CYS A 1 203 ? -6.772  38.864 -27.499 0.50 66.66  ? 203 CYS Z N     1 
ATOM   1566 N  N     B CYS A 1 203 ? -6.767  38.874 -27.504 0.50 66.64  ? 203 CYS Z N     1 
ATOM   1567 C  CA    A CYS A 1 203 ? -8.003  39.604 -27.264 0.50 64.60  ? 203 CYS Z CA    1 
ATOM   1568 C  CA    B CYS A 1 203 ? -7.995  39.617 -27.265 0.50 64.57  ? 203 CYS Z CA    1 
ATOM   1569 C  C     A CYS A 1 203 ? -7.987  40.934 -28.005 0.50 64.52  ? 203 CYS Z C     1 
ATOM   1570 C  C     B CYS A 1 203 ? -7.972  40.935 -28.026 0.50 64.50  ? 203 CYS Z C     1 
ATOM   1571 O  O     A CYS A 1 203 ? -7.245  41.847 -27.646 0.50 63.19  ? 203 CYS Z O     1 
ATOM   1572 O  O     B CYS A 1 203 ? -7.204  41.840 -27.711 0.50 63.66  ? 203 CYS Z O     1 
ATOM   1573 C  CB    A CYS A 1 203 ? -8.203  39.836 -25.771 0.50 62.06  ? 203 CYS Z CB    1 
ATOM   1574 C  CB    B CYS A 1 203 ? -8.190  39.870 -25.772 0.50 62.17  ? 203 CYS Z CB    1 
ATOM   1575 S  SG    A CYS A 1 203 ? -7.948  38.364 -24.756 0.50 58.39  ? 203 CYS Z SG    1 
ATOM   1576 S  SG    B CYS A 1 203 ? -9.906  40.146 -25.294 0.50 67.77  ? 203 CYS Z SG    1 
ATOM   1577 N  N     . ARG A 1 204 ? -8.791  41.013 -29.054 1.00 61.95  ? 204 ARG Z N     1 
ATOM   1578 C  CA    . ARG A 1 204 ? -8.860  42.197 -29.847 1.00 69.28  ? 204 ARG Z CA    1 
ATOM   1579 C  C     . ARG A 1 204 ? -9.356  43.379 -29.048 1.00 69.36  ? 204 ARG Z C     1 
ATOM   1580 O  O     . ARG A 1 204 ? -8.926  44.485 -29.275 1.00 72.35  ? 204 ARG Z O     1 
ATOM   1581 C  CB    . ARG A 1 204 ? -9.720  41.957 -31.076 1.00 81.05  ? 204 ARG Z CB    1 
ATOM   1582 C  CG    . ARG A 1 204 ? -9.469  42.931 -32.221 1.00 94.47  ? 204 ARG Z CG    1 
ATOM   1583 C  CD    . ARG A 1 204 ? -8.017  43.371 -32.302 1.00 103.48 ? 204 ARG Z CD    1 
ATOM   1584 N  NE    . ARG A 1 204 ? -7.796  44.445 -33.251 1.00 109.69 ? 204 ARG Z NE    1 
ATOM   1585 C  CZ    . ARG A 1 204 ? -6.779  45.288 -33.169 1.00 109.65 ? 204 ARG Z CZ    1 
ATOM   1586 N  NH1   . ARG A 1 204 ? -5.917  45.174 -32.170 1.00 104.97 ? 204 ARG Z NH1   1 
ATOM   1587 N  NH2   . ARG A 1 204 ? -6.627  46.243 -34.075 1.00 113.50 ? 204 ARG Z NH2   1 
ATOM   1588 N  N     . GLN A 1 205 ? -10.295 43.135 -28.146 1.00 69.36  ? 205 GLN Z N     1 
ATOM   1589 C  CA    . GLN A 1 205 ? -10.908 44.184 -27.332 1.00 73.55  ? 205 GLN Z CA    1 
ATOM   1590 C  C     . GLN A 1 205 ? -9.895  44.928 -26.459 1.00 74.88  ? 205 GLN Z C     1 
ATOM   1591 O  O     . GLN A 1 205 ? -10.056 46.120 -26.188 1.00 80.21  ? 205 GLN Z O     1 
ATOM   1592 C  CB    . GLN A 1 205 ? -12.005 43.593 -26.449 1.00 74.41  ? 205 GLN Z CB    1 
ATOM   1593 C  CG    . GLN A 1 205 ? -13.280 43.257 -27.188 1.00 77.51  ? 205 GLN Z CG    1 
ATOM   1594 C  CD    . GLN A 1 205 ? -14.382 42.804 -26.251 1.00 79.92  ? 205 GLN Z CD    1 
ATOM   1595 O  OE1   . GLN A 1 205 ? -15.515 43.278 -26.330 1.00 84.41  ? 205 GLN Z OE1   1 
ATOM   1596 N  NE2   . GLN A 1 205 ? -14.054 41.882 -25.357 1.00 75.38  ? 205 GLN Z NE2   1 
ATOM   1597 N  N     . LEU A 1 206 ? -8.856  44.225 -26.019 1.00 69.94  ? 206 LEU Z N     1 
ATOM   1598 C  CA    . LEU A 1 206 ? -7.855  44.823 -25.147 1.00 63.34  ? 206 LEU Z CA    1 
ATOM   1599 C  C     . LEU A 1 206 ? -7.051  45.914 -25.846 1.00 63.19  ? 206 LEU Z C     1 
ATOM   1600 O  O     . LEU A 1 206 ? -6.694  46.918 -25.233 1.00 66.51  ? 206 LEU Z O     1 
ATOM   1601 C  CB    . LEU A 1 206 ? -6.911  43.752 -24.608 1.00 60.38  ? 206 LEU Z CB    1 
ATOM   1602 C  CG    . LEU A 1 206 ? -7.468  42.884 -23.485 1.00 58.69  ? 206 LEU Z CG    1 
ATOM   1603 C  CD1   . LEU A 1 206 ? -6.402  41.930 -22.994 1.00 60.39  ? 206 LEU Z CD1   1 
ATOM   1604 C  CD2   . LEU A 1 206 ? -7.974  43.752 -22.348 1.00 52.58  ? 206 LEU Z CD2   1 
ATOM   1605 N  N     . GLY A 1 207 ? -6.769  45.723 -27.128 1.00 62.15  ? 207 GLY Z N     1 
ATOM   1606 C  CA    . GLY A 1 207 ? -5.942  46.667 -27.852 1.00 64.72  ? 207 GLY Z CA    1 
ATOM   1607 C  C     . GLY A 1 207 ? -4.511  46.584 -27.359 1.00 69.72  ? 207 GLY Z C     1 
ATOM   1608 O  O     . GLY A 1 207 ? -3.948  45.493 -27.294 1.00 71.22  ? 207 GLY Z O     1 
ATOM   1609 N  N     . ASP A 1 208 ? -3.926  47.728 -27.002 1.00 67.51  ? 208 ASP Z N     1 
ATOM   1610 C  CA    . ASP A 1 208 ? -2.544  47.776 -26.514 1.00 73.53  ? 208 ASP Z CA    1 
ATOM   1611 C  C     . ASP A 1 208 ? -2.466  47.570 -25.004 1.00 71.09  ? 208 ASP Z C     1 
ATOM   1612 O  O     . ASP A 1 208 ? -1.390  47.653 -24.411 1.00 74.76  ? 208 ASP Z O     1 
ATOM   1613 C  CB    . ASP A 1 208 ? -1.878  49.108 -26.886 1.00 83.83  ? 208 ASP Z CB    1 
ATOM   1614 C  CG    . ASP A 1 208 ? -2.451  50.293 -26.116 1.00 94.30  ? 208 ASP Z CG    1 
ATOM   1615 O  OD1   . ASP A 1 208 ? -3.652  50.265 -25.774 1.00 95.00  ? 208 ASP Z OD1   1 
ATOM   1616 O  OD2   . ASP A 1 208 ? -1.701  51.260 -25.859 1.00 101.91 ? 208 ASP Z OD2   1 
ATOM   1617 N  N     . VAL A 1 209 ? -3.615  47.307 -24.389 1.00 73.41  ? 209 VAL Z N     1 
ATOM   1618 C  CA    . VAL A 1 209 ? -3.695  47.114 -22.948 1.00 65.60  ? 209 VAL Z CA    1 
ATOM   1619 C  C     . VAL A 1 209 ? -3.471  45.648 -22.605 1.00 63.12  ? 209 VAL Z C     1 
ATOM   1620 O  O     . VAL A 1 209 ? -4.370  44.970 -22.114 1.00 57.91  ? 209 VAL Z O     1 
ATOM   1621 C  CB    . VAL A 1 209 ? -5.060  47.580 -22.392 1.00 59.84  ? 209 VAL Z CB    1 
ATOM   1622 C  CG1   . VAL A 1 209 ? -5.017  47.704 -20.877 1.00 63.34  ? 209 VAL Z CG1   1 
ATOM   1623 C  CG2   . VAL A 1 209 ? -5.459  48.912 -23.010 1.00 55.81  ? 209 VAL Z CG2   1 
ATOM   1624 N  N     . PHE A 1 210 ? -2.274  45.151 -22.890 1.00 65.76  ? 210 PHE Z N     1 
ATOM   1625 C  CA    . PHE A 1 210 ? -1.933  43.775 -22.554 1.00 59.73  ? 210 PHE Z CA    1 
ATOM   1626 C  C     . PHE A 1 210 ? -0.692  43.741 -21.682 1.00 60.54  ? 210 PHE Z C     1 
ATOM   1627 O  O     . PHE A 1 210 ? -0.270  42.675 -21.240 1.00 57.46  ? 210 PHE Z O     1 
ATOM   1628 C  CB    . PHE A 1 210 ? -1.720  42.933 -23.814 1.00 59.21  ? 210 PHE Z CB    1 
ATOM   1629 C  CG    . PHE A 1 210 ? -0.832  43.579 -24.828 1.00 61.04  ? 210 PHE Z CG    1 
ATOM   1630 C  CD1   . PHE A 1 210 ? 0.543   43.506 -24.711 1.00 55.67  ? 210 PHE Z CD1   1 
ATOM   1631 C  CD2   . PHE A 1 210 ? -1.373  44.264 -25.896 1.00 58.47  ? 210 PHE Z CD2   1 
ATOM   1632 C  CE1   . PHE A 1 210 ? 1.359   44.106 -25.637 1.00 60.14  ? 210 PHE Z CE1   1 
ATOM   1633 C  CE2   . PHE A 1 210 ? -0.564  44.864 -26.824 1.00 59.16  ? 210 PHE Z CE2   1 
ATOM   1634 C  CZ    . PHE A 1 210 ? 0.805   44.786 -26.696 1.00 63.32  ? 210 PHE Z CZ    1 
ATOM   1635 N  N     . THR A 1 211 ? -0.106  44.911 -21.443 1.00 51.09  ? 211 THR Z N     1 
ATOM   1636 C  CA    . THR A 1 211 ? 1.011   45.019 -20.511 1.00 57.35  ? 211 THR Z CA    1 
ATOM   1637 C  C     . THR A 1 211 ? 0.493   44.938 -19.082 1.00 54.82  ? 211 THR Z C     1 
ATOM   1638 O  O     . THR A 1 211 ? -0.651  45.297 -18.819 1.00 65.46  ? 211 THR Z O     1 
ATOM   1639 C  CB    . THR A 1 211 ? 1.795   46.327 -20.690 1.00 62.34  ? 211 THR Z CB    1 
ATOM   1640 O  OG1   . THR A 1 211 ? 1.022   47.430 -20.198 1.00 70.00  ? 211 THR Z OG1   1 
ATOM   1641 C  CG2   . THR A 1 211 ? 2.132   46.544 -22.147 1.00 60.60  ? 211 THR Z CG2   1 
ATOM   1642 N  N     . GLU A 1 212 ? 1.339   44.482 -18.164 1.00 47.05  ? 212 GLU Z N     1 
ATOM   1643 C  CA    . GLU A 1 212 ? 0.911   44.219 -16.793 1.00 52.63  ? 212 GLU Z CA    1 
ATOM   1644 C  C     . GLU A 1 212 ? 0.348   45.463 -16.110 1.00 55.39  ? 212 GLU Z C     1 
ATOM   1645 O  O     . GLU A 1 212 ? -0.730  45.415 -15.513 1.00 59.63  ? 212 GLU Z O     1 
ATOM   1646 C  CB    . GLU A 1 212 ? 2.071   43.650 -15.968 1.00 43.35  ? 212 GLU Z CB    1 
ATOM   1647 C  CG    . GLU A 1 212 ? 1.686   43.264 -14.540 1.00 70.46  ? 212 GLU Z CG    1 
ATOM   1648 C  CD    . GLU A 1 212 ? 2.766   42.465 -13.823 1.00 69.62  ? 212 GLU Z CD    1 
ATOM   1649 O  OE1   . GLU A 1 212 ? 2.632   42.231 -12.600 1.00 62.62  ? 212 GLU Z OE1   1 
ATOM   1650 O  OE2   . GLU A 1 212 ? 3.746   42.064 -14.483 1.00 76.27  ? 212 GLU Z OE2   1 
ATOM   1651 N  N     . GLU A 1 213 ? 1.069   46.574 -16.217 1.00 57.30  ? 213 GLU Z N     1 
ATOM   1652 C  CA    . GLU A 1 213 ? 0.670   47.817 -15.564 1.00 56.83  ? 213 GLU Z CA    1 
ATOM   1653 C  C     . GLU A 1 213 ? -0.683  48.336 -16.073 1.00 54.80  ? 213 GLU Z C     1 
ATOM   1654 O  O     . GLU A 1 213 ? -1.593  48.619 -15.285 1.00 55.92  ? 213 GLU Z O     1 
ATOM   1655 C  CB    . GLU A 1 213 ? 1.752   48.879 -15.764 1.00 54.20  ? 213 GLU Z CB    1 
ATOM   1656 C  CG    . GLU A 1 213 ? 1.593   50.099 -14.874 1.00 59.95  ? 213 GLU Z CG    1 
ATOM   1657 C  CD    . GLU A 1 213 ? 2.509   51.249 -15.265 1.00 64.35  ? 213 GLU Z CD    1 
ATOM   1658 O  OE1   . GLU A 1 213 ? 3.318   51.083 -16.203 1.00 70.27  ? 213 GLU Z OE1   1 
ATOM   1659 O  OE2   . GLU A 1 213 ? 2.416   52.323 -14.635 1.00 66.69  ? 213 GLU Z OE2   1 
ATOM   1660 N  N     . LYS A 1 214 ? -0.818  48.453 -17.391 1.00 55.90  ? 214 LYS Z N     1 
ATOM   1661 C  CA    . LYS A 1 214 ? -2.063  48.928 -17.981 1.00 52.46  ? 214 LYS Z CA    1 
ATOM   1662 C  C     . LYS A 1 214 ? -3.219  47.982 -17.657 1.00 51.86  ? 214 LYS Z C     1 
ATOM   1663 O  O     . LYS A 1 214 ? -4.327  48.428 -17.360 1.00 57.51  ? 214 LYS Z O     1 
ATOM   1664 C  CB    . LYS A 1 214 ? -1.915  49.089 -19.495 1.00 53.02  ? 214 LYS Z CB    1 
ATOM   1665 C  CG    . LYS A 1 214 ? -0.969  50.204 -19.921 1.00 62.16  ? 214 LYS Z CG    1 
ATOM   1666 C  CD    . LYS A 1 214 ? -0.913  50.318 -21.435 1.00 67.84  ? 214 LYS Z CD    1 
ATOM   1667 C  CE    . LYS A 1 214 ? -0.037  51.475 -21.873 1.00 74.52  ? 214 LYS Z CE    1 
ATOM   1668 N  NZ    . LYS A 1 214 ? 0.104   51.523 -23.355 1.00 77.32  ? 214 LYS Z NZ    1 
ATOM   1669 N  N     . PHE A 1 215 ? -2.951  46.679 -17.702 1.00 50.67  ? 215 PHE Z N     1 
ATOM   1670 C  CA    . PHE A 1 215 ? -3.975  45.677 -17.419 1.00 46.72  ? 215 PHE Z CA    1 
ATOM   1671 C  C     . PHE A 1 215 ? -4.474  45.847 -15.992 1.00 52.97  ? 215 PHE Z C     1 
ATOM   1672 O  O     . PHE A 1 215 ? -5.682  45.804 -15.730 1.00 57.92  ? 215 PHE Z O     1 
ATOM   1673 C  CB    . PHE A 1 215 ? -3.428  44.263 -17.635 1.00 42.66  ? 215 PHE Z CB    1 
ATOM   1674 C  CG    . PHE A 1 215 ? -4.490  43.202 -17.709 1.00 49.67  ? 215 PHE Z CG    1 
ATOM   1675 C  CD1   . PHE A 1 215 ? -5.195  42.986 -18.878 1.00 46.68  ? 215 PHE Z CD1   1 
ATOM   1676 C  CD2   . PHE A 1 215 ? -4.771  42.411 -16.612 1.00 47.36  ? 215 PHE Z CD2   1 
ATOM   1677 C  CE1   . PHE A 1 215 ? -6.165  42.011 -18.943 1.00 42.18  ? 215 PHE Z CE1   1 
ATOM   1678 C  CE2   . PHE A 1 215 ? -5.741  41.433 -16.674 1.00 42.00  ? 215 PHE Z CE2   1 
ATOM   1679 C  CZ    . PHE A 1 215 ? -6.439  41.234 -17.837 1.00 41.08  ? 215 PHE Z CZ    1 
ATOM   1680 N  N     . ARG A 1 216 ? -3.532  46.066 -15.080 1.00 42.26  ? 216 ARG Z N     1 
ATOM   1681 C  CA    . ARG A 1 216 ? -3.855  46.286 -13.679 1.00 44.36  ? 216 ARG Z CA    1 
ATOM   1682 C  C     . ARG A 1 216 ? -4.720  47.532 -13.523 1.00 48.58  ? 216 ARG Z C     1 
ATOM   1683 O  O     . ARG A 1 216 ? -5.766  47.498 -12.865 1.00 51.78  ? 216 ARG Z O     1 
ATOM   1684 C  CB    . ARG A 1 216 ? -2.572  46.405 -12.854 1.00 49.11  ? 216 ARG Z CB    1 
ATOM   1685 C  CG    . ARG A 1 216 ? -2.798  46.545 -11.362 1.00 59.35  ? 216 ARG Z CG    1 
ATOM   1686 C  CD    . ARG A 1 216 ? -1.492  46.529 -10.580 1.00 56.75  ? 216 ARG Z CD    1 
ATOM   1687 N  NE    . ARG A 1 216 ? -0.606  47.628 -10.950 1.00 55.10  ? 216 ARG Z NE    1 
ATOM   1688 C  CZ    . ARG A 1 216 ? 0.491   47.482 -11.682 1.00 52.27  ? 216 ARG Z CZ    1 
ATOM   1689 N  NH1   . ARG A 1 216 ? 0.840   46.283 -12.119 1.00 52.10  ? 216 ARG Z NH1   1 
ATOM   1690 N  NH2   . ARG A 1 216 ? 1.243   48.531 -11.971 1.00 54.43  ? 216 ARG Z NH2   1 
ATOM   1691 N  N     . TYR A 1 217 ? -4.295  48.624 -14.150 1.00 51.99  ? 217 TYR Z N     1 
ATOM   1692 C  CA    . TYR A 1 217 ? -5.054  49.869 -14.089 1.00 49.77  ? 217 TYR Z CA    1 
ATOM   1693 C  C     . TYR A 1 217 ? -6.485  49.661 -14.576 1.00 51.66  ? 217 TYR Z C     1 
ATOM   1694 O  O     . TYR A 1 217 ? -7.429  50.185 -13.988 1.00 51.05  ? 217 TYR Z O     1 
ATOM   1695 C  CB    . TYR A 1 217 ? -4.373  50.962 -14.916 1.00 54.04  ? 217 TYR Z CB    1 
ATOM   1696 C  CG    . TYR A 1 217 ? -3.041  51.441 -14.371 1.00 54.07  ? 217 TYR Z CG    1 
ATOM   1697 C  CD1   . TYR A 1 217 ? -2.722  51.291 -13.032 1.00 51.14  ? 217 TYR Z CD1   1 
ATOM   1698 C  CD2   . TYR A 1 217 ? -2.106  52.050 -15.201 1.00 52.72  ? 217 TYR Z CD2   1 
ATOM   1699 C  CE1   . TYR A 1 217 ? -1.516  51.723 -12.540 1.00 49.86  ? 217 TYR Z CE1   1 
ATOM   1700 C  CE2   . TYR A 1 217 ? -0.901  52.487 -14.714 1.00 51.07  ? 217 TYR Z CE2   1 
ATOM   1701 C  CZ    . TYR A 1 217 ? -0.612  52.318 -13.386 1.00 50.58  ? 217 TYR Z CZ    1 
ATOM   1702 O  OH    . TYR A 1 217 ? 0.592   52.752 -12.899 1.00 48.49  ? 217 TYR Z OH    1 
ATOM   1703 N  N     . MET A 1 218 ? -6.634  48.885 -15.646 1.00 48.97  ? 218 MET Z N     1 
ATOM   1704 C  CA    . MET A 1 218 ? -7.947  48.581 -16.203 1.00 51.33  ? 218 MET Z CA    1 
ATOM   1705 C  C     . MET A 1 218 ? -8.797  47.814 -15.208 1.00 51.63  ? 218 MET Z C     1 
ATOM   1706 O  O     . MET A 1 218 ? -9.956  48.151 -14.966 1.00 55.89  ? 218 MET Z O     1 
ATOM   1707 C  CB    . MET A 1 218 ? -7.809  47.775 -17.491 1.00 48.04  ? 218 MET Z CB    1 
ATOM   1708 C  CG    . MET A 1 218 ? -9.131  47.431 -18.143 1.00 52.83  ? 218 MET Z CG    1 
ATOM   1709 S  SD    . MET A 1 218 ? -8.922  46.254 -19.484 1.00 59.17  ? 218 MET Z SD    1 
ATOM   1710 C  CE    . MET A 1 218 ? -8.320  44.852 -18.550 1.00 55.19  ? 218 MET Z CE    1 
ATOM   1711 N  N     . CYS A 1 219 ? -8.212  46.774 -14.630 1.00 47.35  ? 219 CYS Z N     1 
ATOM   1712 C  CA    . CYS A 1 219 ? -8.940  45.956 -13.679 1.00 46.25  ? 219 CYS Z CA    1 
ATOM   1713 C  C     . CYS A 1 219 ? -9.409  46.770 -12.502 1.00 46.21  ? 219 CYS Z C     1 
ATOM   1714 O  O     . CYS A 1 219 ? -10.510 46.567 -12.012 1.00 49.56  ? 219 CYS Z O     1 
ATOM   1715 C  CB    . CYS A 1 219 ? -8.083  44.797 -13.197 1.00 48.75  ? 219 CYS Z CB    1 
ATOM   1716 S  SG    . CYS A 1 219 ? -7.902  43.529 -14.436 1.00 50.57  ? 219 CYS Z SG    1 
ATOM   1717 N  N     . ILE A 1 220 ? -8.574  47.695 -12.050 1.00 46.18  ? 220 ILE Z N     1 
ATOM   1718 C  CA    . ILE A 1 220 ? -8.960  48.550 -10.935 1.00 48.70  ? 220 ILE Z CA    1 
ATOM   1719 C  C     . ILE A 1 220 ? -10.074 49.512 -11.336 1.00 53.95  ? 220 ILE Z C     1 
ATOM   1720 O  O     . ILE A 1 220 ? -11.051 49.682 -10.610 1.00 61.39  ? 220 ILE Z O     1 
ATOM   1721 C  CB    . ILE A 1 220 ? -7.773  49.357 -10.402 1.00 49.09  ? 220 ILE Z CB    1 
ATOM   1722 C  CG1   . ILE A 1 220 ? -6.679  48.417 -9.900  1.00 44.81  ? 220 ILE Z CG1   1 
ATOM   1723 C  CG2   . ILE A 1 220 ? -8.221  50.269 -9.282  1.00 41.44  ? 220 ILE Z CG2   1 
ATOM   1724 C  CD1   . ILE A 1 220 ? -5.400  49.122 -9.517  1.00 44.21  ? 220 ILE Z CD1   1 
ATOM   1725 N  N     . LEU A 1 221 ? -9.926  50.136 -12.499 1.00 52.65  ? 221 LEU Z N     1 
ATOM   1726 C  CA    . LEU A 1 221 ? -10.909 51.101 -12.976 1.00 49.02  ? 221 LEU Z CA    1 
ATOM   1727 C  C     . LEU A 1 221 ? -12.273 50.474 -13.231 1.00 51.85  ? 221 LEU Z C     1 
ATOM   1728 O  O     . LEU A 1 221 ? -13.294 51.144 -13.121 1.00 57.06  ? 221 LEU Z O     1 
ATOM   1729 C  CB    . LEU A 1 221 ? -10.419 51.778 -14.252 1.00 51.32  ? 221 LEU Z CB    1 
ATOM   1730 C  CG    . LEU A 1 221 ? -9.327  52.833 -14.103 1.00 60.01  ? 221 LEU Z CG    1 
ATOM   1731 C  CD1   . LEU A 1 221 ? -8.971  53.398 -15.460 1.00 59.40  ? 221 LEU Z CD1   1 
ATOM   1732 C  CD2   . LEU A 1 221 ? -9.785  53.935 -13.172 1.00 60.70  ? 221 LEU Z CD2   1 
ATOM   1733 N  N     . SER A 1 222 ? -12.292 49.192 -13.577 1.00 58.22  ? 222 SER Z N     1 
ATOM   1734 C  CA    . SER A 1 222 ? -13.552 48.514 -13.862 1.00 61.96  ? 222 SER Z CA    1 
ATOM   1735 C  C     . SER A 1 222 ? -14.360 48.293 -12.596 1.00 63.08  ? 222 SER Z C     1 
ATOM   1736 O  O     . SER A 1 222 ? -15.589 48.278 -12.626 1.00 67.48  ? 222 SER Z O     1 
ATOM   1737 C  CB    . SER A 1 222 ? -13.301 47.176 -14.546 1.00 56.59  ? 222 SER Z CB    1 
ATOM   1738 O  OG    . SER A 1 222 ? -12.605 46.300 -13.680 1.00 59.46  ? 222 SER Z OG    1 
ATOM   1739 N  N     . GLY A 1 223 ? -13.657 48.115 -11.484 1.00 56.79  ? 223 GLY Z N     1 
ATOM   1740 C  CA    . GLY A 1 223 ? -14.290 47.859 -10.203 1.00 56.80  ? 223 GLY Z CA    1 
ATOM   1741 C  C     . GLY A 1 223 ? -13.761 46.590 -9.564  1.00 63.79  ? 223 GLY Z C     1 
ATOM   1742 O  O     . GLY A 1 223 ? -14.093 45.486 -9.993  1.00 74.29  ? 223 GLY Z O     1 
ATOM   1743 N  N     . CYS A 1 224 ? -12.932 46.741 -8.540  1.00 53.77  ? 224 CYS Z N     1 
ATOM   1744 C  CA    . CYS A 1 224 ? -12.337 45.590 -7.881  1.00 50.74  ? 224 CYS Z CA    1 
ATOM   1745 C  C     . CYS A 1 224 ? -12.755 45.537 -6.428  1.00 58.33  ? 224 CYS Z C     1 
ATOM   1746 O  O     . CYS A 1 224 ? -13.555 46.355 -5.978  1.00 64.78  ? 224 CYS Z O     1 
ATOM   1747 C  CB    . CYS A 1 224 ? -10.824 45.648 -7.979  1.00 45.18  ? 224 CYS Z CB    1 
ATOM   1748 S  SG    . CYS A 1 224 ? -10.176 47.168 -7.305  1.00 56.64  ? 224 CYS Z SG    1 
ATOM   1749 N  N     . ALA A 1 225 ? -12.194 44.581 -5.694  1.00 58.04  ? 225 ALA Z N     1 
ATOM   1750 C  CA    . ALA A 1 225 ? -12.527 44.381 -4.284  1.00 59.95  ? 225 ALA Z CA    1 
ATOM   1751 C  C     . ALA A 1 225 ? -12.013 45.515 -3.401  1.00 64.29  ? 225 ALA Z C     1 
ATOM   1752 O  O     . ALA A 1 225 ? -12.585 45.803 -2.346  1.00 77.21  ? 225 ALA Z O     1 
ATOM   1753 C  CB    . ALA A 1 225 ? -11.972 43.049 -3.799  1.00 54.85  ? 225 ALA Z CB    1 
ATOM   1754 N  N     . TYR A 1 226 ? -10.929 46.149 -3.837  1.00 55.36  ? 226 TYR Z N     1 
ATOM   1755 C  CA    . TYR A 1 226 ? -10.273 47.188 -3.055  1.00 50.70  ? 226 TYR Z CA    1 
ATOM   1756 C  C     . TYR A 1 226 ? -10.902 48.553 -3.299  1.00 52.36  ? 226 TYR Z C     1 
ATOM   1757 O  O     . TYR A 1 226 ? -10.758 49.462 -2.485  1.00 57.01  ? 226 TYR Z O     1 
ATOM   1758 C  CB    . TYR A 1 226 ? -8.780  47.237 -3.386  1.00 51.00  ? 226 TYR Z CB    1 
ATOM   1759 C  CG    . TYR A 1 226 ? -8.077  45.905 -3.265  1.00 51.23  ? 226 TYR Z CG    1 
ATOM   1760 C  CD1   . TYR A 1 226 ? -8.357  45.040 -2.217  1.00 48.62  ? 226 TYR Z CD1   1 
ATOM   1761 C  CD2   . TYR A 1 226 ? -7.141  45.511 -4.203  1.00 48.01  ? 226 TYR Z CD2   1 
ATOM   1762 C  CE1   . TYR A 1 226 ? -7.719  43.825 -2.107  1.00 40.78  ? 226 TYR Z CE1   1 
ATOM   1763 C  CE2   . TYR A 1 226 ? -6.498  44.300 -4.102  1.00 46.51  ? 226 TYR Z CE2   1 
ATOM   1764 C  CZ    . TYR A 1 226 ? -6.788  43.462 -3.054  1.00 54.40  ? 226 TYR Z CZ    1 
ATOM   1765 O  OH    . TYR A 1 226 ? -6.142  42.254 -2.959  1.00 53.21  ? 226 TYR Z OH    1 
ATOM   1766 N  N     . LEU A 1 227 ? -11.602 48.689 -4.419  1.00 48.80  ? 227 LEU Z N     1 
ATOM   1767 C  CA    . LEU A 1 227 ? -12.163 49.972 -4.816  1.00 55.50  ? 227 LEU Z CA    1 
ATOM   1768 C  C     . LEU A 1 227 ? -13.309 49.813 -5.812  1.00 66.19  ? 227 LEU Z C     1 
ATOM   1769 O  O     . LEU A 1 227 ? -13.121 49.280 -6.902  1.00 70.61  ? 227 LEU Z O     1 
ATOM   1770 C  CB    . LEU A 1 227 ? -11.070 50.852 -5.420  1.00 55.64  ? 227 LEU Z CB    1 
ATOM   1771 C  CG    . LEU A 1 227 ? -11.493 52.245 -5.872  1.00 63.55  ? 227 LEU Z CG    1 
ATOM   1772 C  CD1   . LEU A 1 227 ? -11.874 53.094 -4.673  1.00 62.30  ? 227 LEU Z CD1   1 
ATOM   1773 C  CD2   . LEU A 1 227 ? -10.373 52.890 -6.653  1.00 68.02  ? 227 LEU Z CD2   1 
ATOM   1774 N  N     . SER A 1 228 ? -14.496 50.274 -5.437  1.00 69.90  ? 228 SER Z N     1 
ATOM   1775 C  CA    . SER A 1 228 ? -15.635 50.258 -6.348  1.00 70.76  ? 228 SER Z CA    1 
ATOM   1776 C  C     . SER A 1 228 ? -15.425 51.268 -7.463  1.00 67.29  ? 228 SER Z C     1 
ATOM   1777 O  O     . SER A 1 228 ? -14.880 52.343 -7.233  1.00 70.05  ? 228 SER Z O     1 
ATOM   1778 C  CB    . SER A 1 228 ? -16.930 50.565 -5.602  1.00 78.07  ? 228 SER Z CB    1 
ATOM   1779 O  OG    . SER A 1 228 ? -17.154 49.612 -4.584  1.00 81.47  ? 228 SER Z OG    1 
ATOM   1780 N  N     . SER A 1 229 ? -15.857 50.927 -8.671  1.00 67.52  ? 229 SER Z N     1 
ATOM   1781 C  CA    . SER A 1 229 ? -15.662 51.815 -9.814  1.00 66.20  ? 229 SER Z CA    1 
ATOM   1782 C  C     . SER A 1 229 ? -16.552 53.044 -9.726  1.00 70.40  ? 229 SER Z C     1 
ATOM   1783 O  O     . SER A 1 229 ? -17.470 53.100 -8.911  1.00 76.77  ? 229 SER Z O     1 
ATOM   1784 C  CB    . SER A 1 229 ? -15.931 51.076 -11.131 1.00 61.49  ? 229 SER Z CB    1 
ATOM   1785 O  OG    . SER A 1 229 ? -17.260 50.581 -11.195 1.00 61.99  ? 229 SER Z OG    1 
ATOM   1786 N  N     . LEU A 1 230 ? -16.273 54.029 -10.569 1.00 68.09  ? 230 LEU Z N     1 
ATOM   1787 C  CA    . LEU A 1 230 ? -17.166 55.165 -10.724 1.00 67.65  ? 230 LEU Z CA    1 
ATOM   1788 C  C     . LEU A 1 230 ? -18.483 54.678 -11.324 1.00 69.92  ? 230 LEU Z C     1 
ATOM   1789 O  O     . LEU A 1 230 ? -18.532 53.612 -11.938 1.00 71.34  ? 230 LEU Z O     1 
ATOM   1790 C  CB    . LEU A 1 230 ? -16.530 56.241 -11.609 1.00 67.79  ? 230 LEU Z CB    1 
ATOM   1791 C  CG    . LEU A 1 230 ? -15.168 56.780 -11.164 1.00 66.94  ? 230 LEU Z CG    1 
ATOM   1792 C  CD1   . LEU A 1 230 ? -14.619 57.756 -12.183 1.00 73.80  ? 230 LEU Z CD1   1 
ATOM   1793 C  CD2   . LEU A 1 230 ? -15.271 57.443 -9.804  1.00 61.91  ? 230 LEU Z CD2   1 
ATOM   1794 N  N     . ARG A 1 231 ? -19.547 55.451 -11.142 1.00 74.88  ? 231 ARG Z N     1 
ATOM   1795 C  CA    . ARG A 1 231 ? -20.857 55.073 -11.655 1.00 76.57  ? 231 ARG Z CA    1 
ATOM   1796 C  C     . ARG A 1 231 ? -20.859 55.003 -13.181 1.00 71.08  ? 231 ARG Z C     1 
ATOM   1797 O  O     . ARG A 1 231 ? -20.524 55.979 -13.851 1.00 79.55  ? 231 ARG Z O     1 
ATOM   1798 C  CB    . ARG A 1 231 ? -21.915 56.065 -11.180 1.00 82.77  ? 231 ARG Z CB    1 
ATOM   1799 C  CG    . ARG A 1 231 ? -23.318 55.560 -11.313 1.00 89.04  ? 231 ARG Z CG    1 
ATOM   1800 C  CD    . ARG A 1 231 ? -23.522 54.394 -10.379 1.00 95.23  ? 231 ARG Z CD    1 
ATOM   1801 N  NE    . ARG A 1 231 ? -24.827 53.788 -10.603 1.00 103.67 ? 231 ARG Z NE    1 
ATOM   1802 C  CZ    . ARG A 1 231 ? -25.266 52.700 -9.983  1.00 106.92 ? 231 ARG Z CZ    1 
ATOM   1803 N  NH1   . ARG A 1 231 ? -26.476 52.229 -10.259 1.00 109.78 ? 231 ARG Z NH1   1 
ATOM   1804 N  NH2   . ARG A 1 231 ? -24.497 52.089 -9.088  1.00 104.62 ? 231 ARG Z NH2   1 
ATOM   1805 N  N     . GLY A 1 232 ? -21.224 53.843 -13.723 1.00 70.45  ? 232 GLY Z N     1 
ATOM   1806 C  CA    . GLY A 1 232 ? -21.343 53.662 -15.162 1.00 81.89  ? 232 GLY Z CA    1 
ATOM   1807 C  C     . GLY A 1 232 ? -20.080 53.162 -15.833 1.00 80.98  ? 232 GLY Z C     1 
ATOM   1808 O  O     . GLY A 1 232 ? -19.999 53.105 -17.059 1.00 85.71  ? 232 GLY Z O     1 
ATOM   1809 N  N     . ILE A 1 233 ? -19.091 52.796 -15.027 1.00 79.70  ? 233 ILE Z N     1 
ATOM   1810 C  CA    . ILE A 1 233 ? -17.808 52.358 -15.554 1.00 72.85  ? 233 ILE Z CA    1 
ATOM   1811 C  C     . ILE A 1 233 ? -17.557 50.894 -15.242 1.00 77.39  ? 233 ILE Z C     1 
ATOM   1812 O  O     . ILE A 1 233 ? -17.666 50.467 -14.094 1.00 79.72  ? 233 ILE Z O     1 
ATOM   1813 C  CB    . ILE A 1 233 ? -16.653 53.187 -14.984 1.00 68.10  ? 233 ILE Z CB    1 
ATOM   1814 C  CG1   . ILE A 1 233 ? -16.947 54.679 -15.122 1.00 74.38  ? 233 ILE Z CG1   1 
ATOM   1815 C  CG2   . ILE A 1 233 ? -15.364 52.835 -15.686 1.00 61.75  ? 233 ILE Z CG2   1 
ATOM   1816 C  CD1   . ILE A 1 233 ? -17.105 55.123 -16.537 1.00 79.49  ? 233 ILE Z CD1   1 
ATOM   1817 N  N     . GLY A 1 234 ? -17.225 50.131 -16.276 1.00 70.51  ? 234 GLY Z N     1 
ATOM   1818 C  CA    . GLY A 1 234 ? -16.868 48.734 -16.126 1.00 65.93  ? 234 GLY Z CA    1 
ATOM   1819 C  C     . GLY A 1 234 ? -15.586 48.447 -16.879 1.00 69.52  ? 234 GLY Z C     1 
ATOM   1820 O  O     . GLY A 1 234 ? -14.691 49.285 -16.934 1.00 74.89  ? 234 GLY Z O     1 
ATOM   1821 N  N     . LEU A 1 235 ? -15.496 47.267 -17.476 1.00 60.37  ? 235 LEU Z N     1 
ATOM   1822 C  CA    . LEU A 1 235 ? -14.286 46.874 -18.191 1.00 61.08  ? 235 LEU Z CA    1 
ATOM   1823 C  C     . LEU A 1 235 ? -14.135 47.564 -19.545 1.00 70.14  ? 235 LEU Z C     1 
ATOM   1824 O  O     . LEU A 1 235 ? -13.042 47.999 -19.916 1.00 75.11  ? 235 LEU Z O     1 
ATOM   1825 C  CB    . LEU A 1 235 ? -14.268 45.363 -18.385 1.00 60.16  ? 235 LEU Z CB    1 
ATOM   1826 C  CG    . LEU A 1 235 ? -13.907 44.545 -17.152 1.00 58.68  ? 235 LEU Z CG    1 
ATOM   1827 C  CD1   . LEU A 1 235 ? -14.340 43.114 -17.361 1.00 59.71  ? 235 LEU Z CD1   1 
ATOM   1828 C  CD2   . LEU A 1 235 ? -12.413 44.622 -16.903 1.00 54.52  ? 235 LEU Z CD2   1 
ATOM   1829 N  N     . ALA A 1 236 ? -15.233 47.649 -20.283 1.00 58.10  ? 236 ALA Z N     1 
ATOM   1830 C  CA    . ALA A 1 236 ? -15.210 48.246 -21.607 1.00 59.77  ? 236 ALA Z CA    1 
ATOM   1831 C  C     . ALA A 1 236 ? -14.725 49.690 -21.543 1.00 68.35  ? 236 ALA Z C     1 
ATOM   1832 O  O     . ALA A 1 236 ? -13.777 50.069 -22.232 1.00 71.88  ? 236 ALA Z O     1 
ATOM   1833 C  CB    . ALA A 1 236 ? -16.586 48.170 -22.237 1.00 61.71  ? 236 ALA Z CB    1 
ATOM   1834 N  N     . LYS A 1 237 ? -15.359 50.505 -20.734 1.00 70.12  ? 237 LYS Z N     1 
ATOM   1835 C  CA    . LYS A 1 237 ? -14.960 51.885 -20.669 1.00 72.42  ? 237 LYS Z CA    1 
ATOM   1836 C  C     . LYS A 1 237 ? -13.543 52.059 -20.169 1.00 71.12  ? 237 LYS Z C     1 
ATOM   1837 O  O     . LYS A 1 237 ? -12.795 52.833 -20.708 1.00 70.90  ? 237 LYS Z O     1 
ATOM   1838 C  CB    . LYS A 1 237 ? -15.932 52.646 -19.801 1.00 73.09  ? 237 LYS Z CB    1 
ATOM   1839 C  CG    . LYS A 1 237 ? -17.372 52.349 -20.131 1.00 71.66  ? 237 LYS Z CG    1 
ATOM   1840 C  CD    . LYS A 1 237 ? -17.866 53.232 -21.252 1.00 81.15  ? 237 LYS Z CD    1 
ATOM   1841 C  CE    . LYS A 1 237 ? -19.373 53.172 -21.394 1.00 84.02  ? 237 LYS Z CE    1 
ATOM   1842 N  NZ    . LYS A 1 237 ? -20.078 53.532 -20.140 1.00 83.22  ? 237 LYS Z NZ    1 
ATOM   1843 N  N     . ALA A 1 238 ? -13.156 51.316 -19.154 1.00 64.04  ? 238 ALA Z N     1 
ATOM   1844 C  CA    . ALA A 1 238 ? -11.796 51.422 -18.626 1.00 60.89  ? 238 ALA Z CA    1 
ATOM   1845 C  C     . ALA A 1 238 ? -10.764 51.107 -19.698 1.00 65.34  ? 238 ALA Z C     1 
ATOM   1846 O  O     . ALA A 1 238 ? -9.777  51.829 -19.885 1.00 70.51  ? 238 ALA Z O     1 
ATOM   1847 C  CB    . ALA A 1 238 ? -11.617 50.496 -17.439 1.00 57.66  ? 238 ALA Z CB    1 
ATOM   1848 N  N     . CYS A 1 239 ? -11.011 50.015 -20.404 1.00 57.82  ? 239 CYS Z N     1 
ATOM   1849 C  CA    . CYS A 1 239 ? -10.132 49.589 -21.468 1.00 60.11  ? 239 CYS Z CA    1 
ATOM   1850 C  C     . CYS A 1 239 ? -10.073 50.649 -22.563 1.00 60.23  ? 239 CYS Z C     1 
ATOM   1851 O  O     . CYS A 1 239 ? -9.019  50.897 -23.147 1.00 68.92  ? 239 CYS Z O     1 
ATOM   1852 C  CB    . CYS A 1 239 ? -10.609 48.255 -22.022 1.00 59.50  ? 239 CYS Z CB    1 
ATOM   1853 S  SG    . CYS A 1 239 ? -9.540  47.581 -23.266 1.00 64.14  ? 239 CYS Z SG    1 
ATOM   1854 N  N     . LYS A 1 240 ? -11.213 51.282 -22.820 1.00 60.10  ? 240 LYS Z N     1 
ATOM   1855 C  CA    . LYS A 1 240 ? -11.298 52.330 -23.829 1.00 68.99  ? 240 LYS Z CA    1 
ATOM   1856 C  C     . LYS A 1 240 ? -10.461 53.526 -23.408 1.00 70.63  ? 240 LYS Z C     1 
ATOM   1857 O  O     . LYS A 1 240 ? -9.736  54.106 -24.211 1.00 75.47  ? 240 LYS Z O     1 
ATOM   1858 C  CB    . LYS A 1 240 ? -12.755 52.752 -24.060 1.00 74.68  ? 240 LYS Z CB    1 
ATOM   1859 C  CG    . LYS A 1 240 ? -12.947 53.773 -25.184 1.00 85.78  ? 240 LYS Z CG    1 
ATOM   1860 C  CD    . LYS A 1 240 ? -14.425 54.103 -25.411 1.00 96.21  ? 240 LYS Z CD    1 
ATOM   1861 C  CE    . LYS A 1 240 ? -14.626 55.138 -26.523 1.00 108.06 ? 240 LYS Z CE    1 
ATOM   1862 N  NZ    . LYS A 1 240 ? -16.066 55.438 -26.798 1.00 114.91 ? 240 LYS Z NZ    1 
ATOM   1863 N  N     . VAL A 1 241 ? -10.565 53.887 -22.138 1.00 73.35  ? 241 VAL Z N     1 
ATOM   1864 C  CA    . VAL A 1 241 ? -9.810  55.006 -21.605 1.00 73.39  ? 241 VAL Z CA    1 
ATOM   1865 C  C     . VAL A 1 241 ? -8.326  54.744 -21.741 1.00 74.75  ? 241 VAL Z C     1 
ATOM   1866 O  O     . VAL A 1 241 ? -7.579  55.581 -22.248 1.00 77.18  ? 241 VAL Z O     1 
ATOM   1867 C  CB    . VAL A 1 241 ? -10.151 55.260 -20.134 1.00 72.22  ? 241 VAL Z CB    1 
ATOM   1868 C  CG1   . VAL A 1 241 ? -9.147  56.213 -19.507 1.00 72.74  ? 241 VAL Z CG1   1 
ATOM   1869 C  CG2   . VAL A 1 241 ? -11.557 55.806 -20.016 1.00 73.35  ? 241 VAL Z CG2   1 
ATOM   1870 N  N     . LEU A 1 242 ? -7.902  53.564 -21.305 1.00 69.76  ? 242 LEU Z N     1 
ATOM   1871 C  CA    . LEU A 1 242 ? -6.487  53.240 -21.338 1.00 73.62  ? 242 LEU Z CA    1 
ATOM   1872 C  C     . LEU A 1 242 ? -5.995  53.092 -22.767 1.00 77.35  ? 242 LEU Z C     1 
ATOM   1873 O  O     . LEU A 1 242 ? -4.802  53.224 -23.046 1.00 75.51  ? 242 LEU Z O     1 
ATOM   1874 C  CB    . LEU A 1 242 ? -6.217  51.968 -20.545 1.00 70.85  ? 242 LEU Z CB    1 
ATOM   1875 C  CG    . LEU A 1 242 ? -6.406  52.143 -19.047 1.00 65.81  ? 242 LEU Z CG    1 
ATOM   1876 C  CD1   . LEU A 1 242 ? -6.046  50.860 -18.364 1.00 66.18  ? 242 LEU Z CD1   1 
ATOM   1877 C  CD2   . LEU A 1 242 ? -5.544  53.283 -18.536 1.00 64.74  ? 242 LEU Z CD2   1 
ATOM   1878 N  N     . ARG A 1 243 ? -6.924  52.819 -23.671 1.00 73.42  ? 243 ARG Z N     1 
ATOM   1879 C  CA    . ARG A 1 243 ? -6.592  52.705 -25.076 1.00 75.75  ? 243 ARG Z CA    1 
ATOM   1880 C  C     . ARG A 1 243 ? -6.335  54.086 -25.670 1.00 78.53  ? 243 ARG Z C     1 
ATOM   1881 O  O     . ARG A 1 243 ? -5.285  54.340 -26.267 1.00 83.31  ? 243 ARG Z O     1 
ATOM   1882 C  CB    . ARG A 1 243 ? -7.716  52.000 -25.833 1.00 75.30  ? 243 ARG Z CB    1 
ATOM   1883 C  CG    . ARG A 1 243 ? -7.515  50.504 -26.043 1.00 80.10  ? 243 ARG Z CG    1 
ATOM   1884 C  CD    . ARG A 1 243 ? -8.648  49.925 -26.889 1.00 89.36  ? 243 ARG Z CD    1 
ATOM   1885 N  NE    . ARG A 1 243 ? -9.296  50.952 -27.711 1.00 98.49  ? 243 ARG Z NE    1 
ATOM   1886 C  CZ    . ARG A 1 243 ? -8.886  51.336 -28.920 1.00 97.96  ? 243 ARG Z CZ    1 
ATOM   1887 N  NH1   . ARG A 1 243 ? -7.812  50.782 -29.477 1.00 88.59  ? 243 ARG Z NH1   1 
ATOM   1888 N  NH2   . ARG A 1 243 ? -9.551  52.283 -29.573 1.00 98.50  ? 243 ARG Z NH2   1 
ATOM   1889 N  N     . LEU A 1 244 ? -7.300  54.980 -25.491 1.00 77.50  ? 244 LEU Z N     1 
ATOM   1890 C  CA    . LEU A 1 244 ? -7.238  56.300 -26.095 1.00 80.42  ? 244 LEU Z CA    1 
ATOM   1891 C  C     . LEU A 1 244 ? -6.144  57.146 -25.468 1.00 94.56  ? 244 LEU Z C     1 
ATOM   1892 O  O     . LEU A 1 244 ? -5.619  58.058 -26.102 1.00 101.56 ? 244 LEU Z O     1 
ATOM   1893 C  CB    . LEU A 1 244 ? -8.585  57.006 -25.969 1.00 72.57  ? 244 LEU Z CB    1 
ATOM   1894 C  CG    . LEU A 1 244 ? -9.741  56.342 -26.717 1.00 71.69  ? 244 LEU Z CG    1 
ATOM   1895 C  CD1   . LEU A 1 244 ? -11.033 57.109 -26.486 1.00 68.17  ? 244 LEU Z CD1   1 
ATOM   1896 C  CD2   . LEU A 1 244 ? -9.432  56.220 -28.209 1.00 71.67  ? 244 LEU Z CD2   1 
ATOM   1897 N  N     . ALA A 1 245 ? -5.797  56.838 -24.225 1.00 85.01  ? 245 ALA Z N     1 
ATOM   1898 C  CA    . ALA A 1 245 ? -4.782  57.607 -23.516 1.00 95.61  ? 245 ALA Z CA    1 
ATOM   1899 C  C     . ALA A 1 245 ? -3.488  56.825 -23.355 1.00 99.90  ? 245 ALA Z C     1 
ATOM   1900 O  O     . ALA A 1 245 ? -3.445  55.788 -22.690 1.00 104.90 ? 245 ALA Z O     1 
ATOM   1901 C  CB    . ALA A 1 245 ? -5.301  58.034 -22.157 1.00 98.82  ? 245 ALA Z CB    1 
ATOM   1902 N  N     . ASN A 1 246 ? -2.413  57.329 -23.901 1.00 108.49 ? 246 ASN Z N     1 
ATOM   1903 C  CA    . ASN A 1 246 ? -1.158  56.685 -23.661 1.00 110.05 ? 246 ASN Z CA    1 
ATOM   1904 C  C     . ASN A 1 246 ? -0.576  57.912 -23.006 1.00 113.85 ? 246 ASN Z C     1 
ATOM   1905 O  O     . ASN A 1 246 ? 0.048   58.732 -23.663 1.00 120.40 ? 246 ASN Z O     1 
ATOM   1906 C  CB    . ASN A 1 246 ? -0.467  56.321 -24.959 1.00 108.59 ? 246 ASN Z CB    1 
ATOM   1907 C  CG    . ASN A 1 246 ? -0.866  54.953 -25.474 1.00 101.50 ? 246 ASN Z CG    1 
ATOM   1908 O  OD1   . ASN A 1 246 ? -0.062  54.035 -25.484 1.00 98.71  ? 246 ASN Z OD1   1 
ATOM   1909 N  ND2   . ASN A 1 246 ? -2.103  54.819 -25.918 1.00 96.70  ? 246 ASN Z ND2   1 
ATOM   1910 N  N     . ASN A 1 247 ? -0.826  58.095 -21.714 1.00 110.69 ? 247 ASN Z N     1 
ATOM   1911 C  CA    . ASN A 1 247 ? -0.320  59.351 -21.128 1.00 108.93 ? 247 ASN Z CA    1 
ATOM   1912 C  C     . ASN A 1 247 ? 1.101   59.603 -20.559 1.00 112.84 ? 247 ASN Z C     1 
ATOM   1913 O  O     . ASN A 1 247 ? 1.624   60.640 -20.878 1.00 119.80 ? 247 ASN Z O     1 
ATOM   1914 C  CB    . ASN A 1 247 ? -1.348  59.940 -20.149 1.00 105.28 ? 247 ASN Z CB    1 
ATOM   1915 C  CG    . ASN A 1 247 ? -0.958  61.321 -19.633 1.00 106.39 ? 247 ASN Z CG    1 
ATOM   1916 O  OD1   . ASN A 1 247 ? 0.029   61.463 -18.915 1.00 99.18  ? 247 ASN Z OD1   1 
ATOM   1917 N  ND2   . ASN A 1 247 ? -1.702  62.331 -20.021 1.00 110.99 ? 247 ASN Z ND2   1 
ATOM   1918 N  N     . PRO A 1 248 ? 1.803   58.736 -19.710 1.00 109.07 ? 248 PRO Z N     1 
ATOM   1919 C  CA    . PRO A 1 248 ? 1.043   57.695 -19.066 1.00 104.11 ? 248 PRO Z CA    1 
ATOM   1920 C  C     . PRO A 1 248 ? 1.044   57.925 -17.548 1.00 93.81  ? 248 PRO Z C     1 
ATOM   1921 O  O     . PRO A 1 248 ? 1.271   56.989 -16.804 1.00 85.84  ? 248 PRO Z O     1 
ATOM   1922 C  CB    . PRO A 1 248 ? 1.879   56.478 -19.384 1.00 107.71 ? 248 PRO Z CB    1 
ATOM   1923 C  CG    . PRO A 1 248 ? 3.244   57.045 -19.465 1.00 110.30 ? 248 PRO Z CG    1 
ATOM   1924 C  CD    . PRO A 1 248 ? 3.118   58.398 -20.115 1.00 111.82 ? 248 PRO Z CD    1 
ATOM   1925 N  N     . ASP A 1 249 ? 0.867   59.156 -17.088 1.00 93.11  ? 249 ASP Z N     1 
ATOM   1926 C  CA    . ASP A 1 249 ? 0.662   59.361 -15.664 1.00 85.98  ? 249 ASP Z CA    1 
ATOM   1927 C  C     . ASP A 1 249 ? -0.783  59.051 -15.459 1.00 78.98  ? 249 ASP Z C     1 
ATOM   1928 O  O     . ASP A 1 249 ? -1.636  59.721 -15.990 1.00 73.67  ? 249 ASP Z O     1 
ATOM   1929 C  CB    . ASP A 1 249 ? 0.906   60.804 -15.267 1.00 88.31  ? 249 ASP Z CB    1 
ATOM   1930 C  CG    . ASP A 1 249 ? 0.705   61.046 -13.787 1.00 93.04  ? 249 ASP Z CG    1 
ATOM   1931 O  OD1   . ASP A 1 249 ? 0.722   60.090 -13.008 1.00 93.11  ? 249 ASP Z OD1   1 
ATOM   1932 O  OD2   . ASP A 1 249 ? 0.537   62.201 -13.391 1.00 97.39  ? 249 ASP Z OD2   1 
ATOM   1933 N  N     . ILE A 1 250 ? -1.066  58.029 -14.676 1.00 75.17  ? 250 ILE Z N     1 
ATOM   1934 C  CA    . ILE A 1 250 ? -2.425  57.507 -14.648 1.00 73.24  ? 250 ILE Z CA    1 
ATOM   1935 C  C     . ILE A 1 250 ? -3.380  58.464 -13.929 1.00 83.80  ? 250 ILE Z C     1 
ATOM   1936 O  O     . ILE A 1 250 ? -4.579  58.497 -14.223 1.00 84.68  ? 250 ILE Z O     1 
ATOM   1937 C  CB    . ILE A 1 250 ? -2.459  56.110 -13.972 1.00 62.46  ? 250 ILE Z CB    1 
ATOM   1938 C  CG1   . ILE A 1 250 ? -3.856  55.494 -14.046 1.00 54.03  ? 250 ILE Z CG1   1 
ATOM   1939 C  CG2   . ILE A 1 250 ? -1.966  56.194 -12.535 1.00 59.05  ? 250 ILE Z CG2   1 
ATOM   1940 C  CD1   . ILE A 1 250 ? -4.332  55.239 -15.448 1.00 53.62  ? 250 ILE Z CD1   1 
ATOM   1941 N  N     . VAL A 1 251 ? -2.848  59.254 -13.002 1.00 79.24  ? 251 VAL Z N     1 
ATOM   1942 C  CA    . VAL A 1 251 ? -3.675  60.173 -12.237 1.00 78.81  ? 251 VAL Z CA    1 
ATOM   1943 C  C     . VAL A 1 251 ? -4.340  61.203 -13.144 1.00 79.28  ? 251 VAL Z C     1 
ATOM   1944 O  O     . VAL A 1 251 ? -5.547  61.437 -13.051 1.00 79.85  ? 251 VAL Z O     1 
ATOM   1945 C  CB    . VAL A 1 251 ? -2.855  60.889 -11.162 1.00 75.07  ? 251 VAL Z CB    1 
ATOM   1946 C  CG1   . VAL A 1 251 ? -3.721  61.887 -10.415 1.00 71.67  ? 251 VAL Z CG1   1 
ATOM   1947 C  CG2   . VAL A 1 251 ? -2.279  59.877 -10.210 1.00 74.57  ? 251 VAL Z CG2   1 
ATOM   1948 N  N     . LYS A 1 252 ? -3.555  61.801 -14.034 1.00 78.78  ? 252 LYS Z N     1 
ATOM   1949 C  CA    . LYS A 1 252 ? -4.077  62.816 -14.940 1.00 79.61  ? 252 LYS Z CA    1 
ATOM   1950 C  C     . LYS A 1 252 ? -5.142  62.226 -15.862 1.00 79.93  ? 252 LYS Z C     1 
ATOM   1951 O  O     . LYS A 1 252 ? -6.172  62.858 -16.131 1.00 82.56  ? 252 LYS Z O     1 
ATOM   1952 C  CB    . LYS A 1 252 ? -2.942  63.434 -15.754 1.00 84.92  ? 252 LYS Z CB    1 
ATOM   1953 C  CG    . LYS A 1 252 ? -1.878  64.105 -14.898 1.00 88.67  ? 252 LYS Z CG    1 
ATOM   1954 C  CD    . LYS A 1 252 ? -0.666  64.513 -15.717 1.00 90.55  ? 252 LYS Z CD    1 
ATOM   1955 C  CE    . LYS A 1 252 ? 0.394   65.162 -14.841 1.00 93.71  ? 252 LYS Z CE    1 
ATOM   1956 N  NZ    . LYS A 1 252 ? 1.657   65.398 -15.593 1.00 95.97  ? 252 LYS Z NZ    1 
ATOM   1957 N  N     . VAL A 1 253 ? -4.891  61.004 -16.327 1.00 77.92  ? 253 VAL Z N     1 
ATOM   1958 C  CA    . VAL A 1 253 ? -5.829  60.288 -17.187 1.00 76.96  ? 253 VAL Z CA    1 
ATOM   1959 C  C     . VAL A 1 253 ? -7.162  60.073 -16.467 1.00 77.08  ? 253 VAL Z C     1 
ATOM   1960 O  O     . VAL A 1 253 ? -8.237  60.366 -17.013 1.00 84.44  ? 253 VAL Z O     1 
ATOM   1961 C  CB    . VAL A 1 253 ? -5.251  58.922 -17.639 1.00 76.02  ? 253 VAL Z CB    1 
ATOM   1962 C  CG1   . VAL A 1 253 ? -6.271  58.144 -18.452 1.00 71.55  ? 253 VAL Z CG1   1 
ATOM   1963 C  CG2   . VAL A 1 253 ? -3.973  59.117 -18.440 1.00 78.37  ? 253 VAL Z CG2   1 
ATOM   1964 N  N     . ILE A 1 254 ? -7.085  59.573 -15.236 1.00 74.85  ? 254 ILE Z N     1 
ATOM   1965 C  CA    . ILE A 1 254 ? -8.276  59.332 -14.431 1.00 69.00  ? 254 ILE Z CA    1 
ATOM   1966 C  C     . ILE A 1 254 ? -9.031  60.640 -14.205 1.00 71.26  ? 254 ILE Z C     1 
ATOM   1967 O  O     . ILE A 1 254 ? -10.260 60.672 -14.204 1.00 76.89  ? 254 ILE Z O     1 
ATOM   1968 C  CB    . ILE A 1 254 ? -7.913  58.674 -13.083 1.00 68.96  ? 254 ILE Z CB    1 
ATOM   1969 C  CG1   . ILE A 1 254 ? -7.297  57.291 -13.320 1.00 66.92  ? 254 ILE Z CG1   1 
ATOM   1970 C  CG2   . ILE A 1 254 ? -9.136  58.556 -12.186 1.00 58.34  ? 254 ILE Z CG2   1 
ATOM   1971 C  CD1   . ILE A 1 254 ? -6.882  56.570 -12.055 1.00 73.31  ? 254 ILE Z CD1   1 
ATOM   1972 N  N     . LYS A 1 255 ? -8.285  61.726 -14.044 1.00 72.87  ? 255 LYS Z N     1 
ATOM   1973 C  CA    . LYS A 1 255 ? -8.903  63.040 -13.885 1.00 79.16  ? 255 LYS Z CA    1 
ATOM   1974 C  C     . LYS A 1 255 ? -9.554  63.513 -15.185 1.00 84.56  ? 255 LYS Z C     1 
ATOM   1975 O  O     . LYS A 1 255 ? -10.459 64.347 -15.159 1.00 90.15  ? 255 LYS Z O     1 
ATOM   1976 C  CB    . LYS A 1 255 ? -7.872  64.071 -13.402 1.00 77.28  ? 255 LYS Z CB    1 
ATOM   1977 C  CG    . LYS A 1 255 ? -7.419  63.887 -11.947 1.00 75.39  ? 255 LYS Z CG    1 
ATOM   1978 C  CD    . LYS A 1 255 ? -6.390  64.938 -11.531 1.00 75.45  ? 255 LYS Z CD    1 
ATOM   1979 C  CE    . LYS A 1 255 ? -6.017  64.802 -10.054 1.00 78.81  ? 255 LYS Z CE    1 
ATOM   1980 N  NZ    . LYS A 1 255 ? -5.066  65.853 -9.581  1.00 81.18  ? 255 LYS Z NZ    1 
ATOM   1981 N  N     . LYS A 1 256 ? -9.094  62.981 -16.318 1.00 81.75  ? 256 LYS Z N     1 
ATOM   1982 C  CA    . LYS A 1 256 ? -9.677  63.330 -17.618 1.00 88.43  ? 256 LYS Z CA    1 
ATOM   1983 C  C     . LYS A 1 256 ? -10.541 62.206 -18.201 1.00 86.09  ? 256 LYS Z C     1 
ATOM   1984 O  O     . LYS A 1 256 ? -10.792 62.173 -19.418 1.00 93.06  ? 256 LYS Z O     1 
ATOM   1985 C  CB    . LYS A 1 256 ? -8.577  63.702 -18.621 1.00 92.59  ? 256 LYS Z CB    1 
ATOM   1986 C  CG    . LYS A 1 256 ? -8.190  65.176 -18.637 1.00 96.46  ? 256 LYS Z CG    1 
ATOM   1987 C  CD    . LYS A 1 256 ? -7.097  65.450 -19.670 1.00 101.42 ? 256 LYS Z CD    1 
ATOM   1988 C  CE    . LYS A 1 256 ? -6.855  66.941 -19.839 1.00 101.48 ? 256 LYS Z CE    1 
ATOM   1989 N  NZ    . LYS A 1 256 ? -8.065  67.627 -20.374 1.00 101.86 ? 256 LYS Z NZ    1 
ATOM   1990 N  N     . ILE A 1 257 ? -10.990 61.289 -17.344 1.00 83.39  ? 257 ILE Z N     1 
ATOM   1991 C  CA    . ILE A 1 257 ? -11.834 60.181 -17.791 1.00 81.00  ? 257 ILE Z CA    1 
ATOM   1992 C  C     . ILE A 1 257 ? -13.088 60.687 -18.519 1.00 88.64  ? 257 ILE Z C     1 
ATOM   1993 O  O     . ILE A 1 257 ? -13.528 60.092 -19.511 1.00 95.64  ? 257 ILE Z O     1 
ATOM   1994 C  CB    . ILE A 1 257 ? -12.244 59.263 -16.614 1.00 77.55  ? 257 ILE Z CB    1 
ATOM   1995 C  CG1   . ILE A 1 257 ? -13.040 58.062 -17.124 1.00 79.62  ? 257 ILE Z CG1   1 
ATOM   1996 C  CG2   . ILE A 1 257 ? -13.047 60.019 -15.577 1.00 80.14  ? 257 ILE Z CG2   1 
ATOM   1997 C  CD1   . ILE A 1 257 ? -13.502 57.122 -16.041 1.00 80.67  ? 257 ILE Z CD1   1 
ATOM   1998 N  N     . GLY A 1 258 ? -13.637 61.806 -18.056 1.00 86.14  ? 258 GLY Z N     1 
ATOM   1999 C  CA    . GLY A 1 258 ? -14.789 62.398 -18.707 1.00 90.06  ? 258 GLY Z CA    1 
ATOM   2000 C  C     . GLY A 1 258 ? -14.442 62.834 -20.116 1.00 91.30  ? 258 GLY Z C     1 
ATOM   2001 O  O     . GLY A 1 258 ? -15.246 62.707 -21.037 1.00 86.89  ? 258 GLY Z O     1 
ATOM   2002 N  N     . HIS A 1 259 ? -13.229 63.344 -20.283 1.00 88.55  ? 259 HIS Z N     1 
ATOM   2003 C  CA    . HIS A 1 259 ? -12.758 63.774 -21.591 1.00 96.61  ? 259 HIS Z CA    1 
ATOM   2004 C  C     . HIS A 1 259 ? -12.577 62.577 -22.520 1.00 96.40  ? 259 HIS Z C     1 
ATOM   2005 O  O     . HIS A 1 259 ? -12.995 62.614 -23.680 1.00 98.07  ? 259 HIS Z O     1 
ATOM   2006 C  CB    . HIS A 1 259 ? -11.446 64.559 -21.460 1.00 100.67 ? 259 HIS Z CB    1 
ATOM   2007 C  CG    . HIS A 1 259 ? -10.750 64.804 -22.764 1.00 105.78 ? 259 HIS Z CG    1 
ATOM   2008 N  ND1   . HIS A 1 259 ? -11.399 65.306 -23.872 1.00 112.05 ? 259 HIS Z ND1   1 
ATOM   2009 C  CD2   . HIS A 1 259 ? -9.460  64.617 -23.132 1.00 104.37 ? 259 HIS Z CD2   1 
ATOM   2010 C  CE1   . HIS A 1 259 ? -10.537 65.413 -24.871 1.00 113.92 ? 259 HIS Z CE1   1 
ATOM   2011 N  NE2   . HIS A 1 259 ? -9.356  65.002 -24.448 1.00 110.24 ? 259 HIS Z NE2   1 
ATOM   2012 N  N     . TYR A 1 260 ? -11.968 61.512 -22.008 1.00 97.19  ? 260 TYR Z N     1 
ATOM   2013 C  CA    . TYR A 1 260 ? -11.671 60.352 -22.845 1.00 93.19  ? 260 TYR Z CA    1 
ATOM   2014 C  C     . TYR A 1 260 ? -12.925 59.557 -23.217 1.00 89.48  ? 260 TYR Z C     1 
ATOM   2015 O  O     . TYR A 1 260 ? -12.966 58.906 -24.262 1.00 84.99  ? 260 TYR Z O     1 
ATOM   2016 C  CB    . TYR A 1 260 ? -10.656 59.439 -22.151 1.00 89.45  ? 260 TYR Z CB    1 
ATOM   2017 C  CG    . TYR A 1 260 ? -9.273  60.041 -22.031 1.00 89.03  ? 260 TYR Z CG    1 
ATOM   2018 C  CD1   . TYR A 1 260 ? -8.494  60.272 -23.159 1.00 90.66  ? 260 TYR Z CD1   1 
ATOM   2019 C  CD2   . TYR A 1 260 ? -8.740  60.367 -20.792 1.00 84.79  ? 260 TYR Z CD2   1 
ATOM   2020 C  CE1   . TYR A 1 260 ? -7.224  60.823 -23.057 1.00 93.21  ? 260 TYR Z CE1   1 
ATOM   2021 C  CE2   . TYR A 1 260 ? -7.471  60.918 -20.677 1.00 86.21  ? 260 TYR Z CE2   1 
ATOM   2022 C  CZ    . TYR A 1 260 ? -6.715  61.146 -21.812 1.00 92.00  ? 260 TYR Z CZ    1 
ATOM   2023 O  OH    . TYR A 1 260 ? -5.450  61.692 -21.701 1.00 94.29  ? 260 TYR Z OH    1 
ATOM   2024 N  N     . LEU A 1 261 ? -13.948 59.609 -22.372 1.00 90.00  ? 261 LEU Z N     1 
ATOM   2025 C  CA    . LEU A 1 261 ? -15.153 58.823 -22.636 1.00 91.15  ? 261 LEU Z CA    1 
ATOM   2026 C  C     . LEU A 1 261 ? -16.281 59.639 -23.258 1.00 96.24  ? 261 LEU Z C     1 
ATOM   2027 O  O     . LEU A 1 261 ? -17.339 59.095 -23.583 1.00 100.33 ? 261 LEU Z O     1 
ATOM   2028 C  CB    . LEU A 1 261 ? -15.659 58.166 -21.348 1.00 85.81  ? 261 LEU Z CB    1 
ATOM   2029 C  CG    . LEU A 1 261 ? -14.914 56.917 -20.874 1.00 76.43  ? 261 LEU Z CG    1 
ATOM   2030 C  CD1   . LEU A 1 261 ? -15.560 56.325 -19.622 1.00 72.85  ? 261 LEU Z CD1   1 
ATOM   2031 C  CD2   . LEU A 1 261 ? -14.844 55.892 -21.999 1.00 70.50  ? 261 LEU Z CD2   1 
ATOM   2032 N  N     . LYS A 1 262 ? -16.073 60.933 -23.409 1.00 95.80  ? 262 LYS Z N     1 
ATOM   2033 C  CA    . LYS A 1 262 ? -17.122 61.795 -23.922 1.00 102.59 ? 262 LYS Z CA    1 
ATOM   2034 C  C     . LYS A 1 262 ? -18.385 61.576 -23.148 1.00 101.91 ? 262 LYS Z C     1 
ATOM   2035 O  O     . LYS A 1 262 ? -19.398 61.227 -23.703 1.00 105.98 ? 262 LYS Z O     1 
ATOM   2036 C  CB    . LYS A 1 262 ? -17.358 61.667 -25.423 1.00 107.66 ? 262 LYS Z CB    1 
ATOM   2037 C  CG    . LYS A 1 262 ? -16.238 62.145 -26.312 1.00 114.74 ? 262 LYS Z CG    1 
ATOM   2038 C  CD    . LYS A 1 262 ? -16.595 61.938 -27.773 1.00 126.55 ? 262 LYS Z CD    1 
ATOM   2039 C  CE    . LYS A 1 262 ? -15.492 62.435 -28.694 1.00 134.83 ? 262 LYS Z CE    1 
ATOM   2040 N  NZ    . LYS A 1 262 ? -15.783 62.233 -30.144 1.00 141.33 ? 262 LYS Z NZ    1 
ATOM   2041 N  N     . MET A 1 263 ? -18.288 61.717 -21.840 1.00 105.64 ? 263 MET Z N     1 
ATOM   2042 C  CA    . MET A 1 263 ? -19.465 61.746 -20.969 1.00 101.06 ? 263 MET Z CA    1 
ATOM   2043 C  C     . MET A 1 263 ? -19.133 62.470 -19.659 1.00 98.97  ? 263 MET Z C     1 
ATOM   2044 O  O     . MET A 1 263 ? -18.007 62.379 -19.159 1.00 89.52  ? 263 MET Z O     1 
ATOM   2045 C  CB    . MET A 1 263 ? -19.986 60.323 -20.690 1.00 95.03  ? 263 MET Z CB    1 
ATOM   2046 C  CG    . MET A 1 263 ? -18.961 59.344 -20.101 1.00 90.87  ? 263 MET Z CG    1 
ATOM   2047 S  SD    . MET A 1 263 ? -19.596 57.680 -19.703 1.00 94.35  ? 263 MET Z SD    1 
ATOM   2048 C  CE    . MET A 1 263 ? -20.820 58.068 -18.458 1.00 100.30 ? 263 MET Z CE    1 
ATOM   2049 N  N     . ASN A 1 264 ? -20.104 63.201 -19.113 1.00 100.50 ? 264 ASN Z N     1 
ATOM   2050 C  CA    . ASN A 1 264 ? -19.888 63.956 -17.880 1.00 103.88 ? 264 ASN Z CA    1 
ATOM   2051 C  C     . ASN A 1 264 ? -19.714 63.033 -16.668 1.00 104.03 ? 264 ASN Z C     1 
ATOM   2052 O  O     . ASN A 1 264 ? -20.656 62.351 -16.251 1.00 103.11 ? 264 ASN Z O     1 
ATOM   2053 C  CB    . ASN A 1 264 ? -21.046 64.934 -17.644 1.00 109.86 ? 264 ASN Z CB    1 
ATOM   2054 C  CG    . ASN A 1 264 ? -20.841 65.812 -16.405 1.00 112.29 ? 264 ASN Z CG    1 
ATOM   2055 O  OD1   . ASN A 1 264 ? -19.725 65.953 -15.901 1.00 111.51 ? 264 ASN Z OD1   1 
ATOM   2056 N  ND2   . ASN A 1 264 ? -21.926 66.409 -15.915 1.00 114.61 ? 264 ASN Z ND2   1 
ATOM   2057 N  N     . ILE A 1 265 ? -18.498 63.020 -16.114 1.00 107.20 ? 265 ILE Z N     1 
ATOM   2058 C  CA    . ILE A 1 265 ? -18.163 62.205 -14.941 1.00 102.78 ? 265 ILE Z CA    1 
ATOM   2059 C  C     . ILE A 1 265 ? -17.461 63.031 -13.862 1.00 105.95 ? 265 ILE Z C     1 
ATOM   2060 O  O     . ILE A 1 265 ? -16.383 63.593 -14.082 1.00 107.11 ? 265 ILE Z O     1 
ATOM   2061 C  CB    . ILE A 1 265 ? -17.255 60.998 -15.313 1.00 89.56  ? 265 ILE Z CB    1 
ATOM   2062 C  CG1   . ILE A 1 265 ? -17.961 60.064 -16.307 1.00 88.48  ? 265 ILE Z CG1   1 
ATOM   2063 C  CG2   . ILE A 1 265 ? -16.828 60.242 -14.054 1.00 79.56  ? 265 ILE Z CG2   1 
ATOM   2064 C  CD1   . ILE A 1 265 ? -17.126 58.874 -16.749 1.00 83.13  ? 265 ILE Z CD1   1 
ATOM   2065 N  N     . THR A 1 266 ? -18.084 63.101 -12.691 1.00 101.86 ? 266 THR Z N     1 
ATOM   2066 C  CA    . THR A 1 266 ? -17.501 63.808 -11.553 1.00 104.49 ? 266 THR Z CA    1 
ATOM   2067 C  C     . THR A 1 266 ? -16.578 62.867 -10.785 1.00 98.35  ? 266 THR Z C     1 
ATOM   2068 O  O     . THR A 1 266 ? -17.018 61.839 -10.265 1.00 99.57  ? 266 THR Z O     1 
ATOM   2069 C  CB    . THR A 1 266 ? -18.595 64.364 -10.597 1.00 114.94 ? 266 THR Z CB    1 
ATOM   2070 O  OG1   . THR A 1 266 ? -19.406 63.283 -10.111 1.00 117.42 ? 266 THR Z OG1   1 
ATOM   2071 C  CG2   . THR A 1 266 ? -19.472 65.407 -11.307 1.00 118.26 ? 266 THR Z CG2   1 
ATOM   2072 N  N     . VAL A 1 267 ? -15.298 63.217 -10.720 1.00 98.60  ? 267 VAL Z N     1 
ATOM   2073 C  CA    . VAL A 1 267 ? -14.316 62.390 -10.030 1.00 90.87  ? 267 VAL Z CA    1 
ATOM   2074 C  C     . VAL A 1 267 ? -13.875 63.021 -8.710  1.00 93.97  ? 267 VAL Z C     1 
ATOM   2075 O  O     . VAL A 1 267 ? -13.148 64.014 -8.707  1.00 95.02  ? 267 VAL Z O     1 
ATOM   2076 C  CB    . VAL A 1 267 ? -13.079 62.152 -10.914 1.00 81.97  ? 267 VAL Z CB    1 
ATOM   2077 C  CG1   . VAL A 1 267 ? -12.079 61.247 -10.205 1.00 68.29  ? 267 VAL Z CG1   1 
ATOM   2078 C  CG2   . VAL A 1 267 ? -13.498 61.570 -12.262 1.00 84.28  ? 267 VAL Z CG2   1 
ATOM   2079 N  N     . PRO A 1 268 ? -14.320 62.447 -7.581  1.00 88.38  ? 268 PRO Z N     1 
ATOM   2080 C  CA    . PRO A 1 268 ? -13.911 62.924 -6.251  1.00 93.26  ? 268 PRO Z CA    1 
ATOM   2081 C  C     . PRO A 1 268 ? -12.404 62.792 -6.011  1.00 93.56  ? 268 PRO Z C     1 
ATOM   2082 O  O     . PRO A 1 268 ? -11.761 61.899 -6.569  1.00 88.96  ? 268 PRO Z O     1 
ATOM   2083 C  CB    . PRO A 1 268 ? -14.690 62.016 -5.291  1.00 91.37  ? 268 PRO Z CB    1 
ATOM   2084 C  CG    . PRO A 1 268 ? -15.826 61.475 -6.104  1.00 87.16  ? 268 PRO Z CG    1 
ATOM   2085 C  CD    . PRO A 1 268 ? -15.303 61.353 -7.501  1.00 83.94  ? 268 PRO Z CD    1 
ATOM   2086 N  N     . GLU A 1 269 ? -11.852 63.677 -5.185  1.00 97.68  ? 269 GLU Z N     1 
ATOM   2087 C  CA    . GLU A 1 269 ? -10.430 63.641 -4.869  1.00 103.06 ? 269 GLU Z CA    1 
ATOM   2088 C  C     . GLU A 1 269 ? -10.112 62.357 -4.114  1.00 95.47  ? 269 GLU Z C     1 
ATOM   2089 O  O     . GLU A 1 269 ? -8.991  61.848 -4.167  1.00 97.35  ? 269 GLU Z O     1 
ATOM   2090 C  CB    . GLU A 1 269 ? -10.022 64.877 -4.053  1.00 113.80 ? 269 GLU Z CB    1 
ATOM   2091 C  CG    . GLU A 1 269 ? -8.610  64.832 -3.457  1.00 118.92 ? 269 GLU Z CG    1 
ATOM   2092 C  CD    . GLU A 1 269 ? -7.519  64.688 -4.508  1.00 118.18 ? 269 GLU Z CD    1 
ATOM   2093 O  OE1   . GLU A 1 269 ? -7.697  65.215 -5.630  1.00 120.16 ? 269 GLU Z OE1   1 
ATOM   2094 O  OE2   . GLU A 1 269 ? -6.484  64.048 -4.211  1.00 114.45 ? 269 GLU Z OE2   1 
ATOM   2095 N  N     . ASP A 1 270 ? -11.120 61.822 -3.434  1.00 97.96  ? 270 ASP Z N     1 
ATOM   2096 C  CA    . ASP A 1 270 ? -10.939 60.622 -2.631  1.00 93.22  ? 270 ASP Z CA    1 
ATOM   2097 C  C     . ASP A 1 270 ? -10.743 59.385 -3.504  1.00 80.12  ? 270 ASP Z C     1 
ATOM   2098 O  O     . ASP A 1 270 ? -10.037 58.451 -3.115  1.00 78.83  ? 270 ASP Z O     1 
ATOM   2099 C  CB    . ASP A 1 270 ? -12.134 60.423 -1.700  1.00 101.05 ? 270 ASP Z CB    1 
ATOM   2100 C  CG    . ASP A 1 270 ? -11.751 59.740 -0.393  1.00 104.88 ? 270 ASP Z CG    1 
ATOM   2101 O  OD1   . ASP A 1 270 ? -10.637 59.996 0.118   1.00 104.95 ? 270 ASP Z OD1   1 
ATOM   2102 O  OD2   . ASP A 1 270 ? -12.569 58.955 0.132   1.00 109.20 ? 270 ASP Z OD2   1 
ATOM   2103 N  N     . TYR A 1 271 ? -11.366 59.379 -4.682  1.00 76.94  ? 271 TYR Z N     1 
ATOM   2104 C  CA    . TYR A 1 271 ? -11.279 58.228 -5.575  1.00 70.36  ? 271 TYR Z CA    1 
ATOM   2105 C  C     . TYR A 1 271 ? -9.878  58.060 -6.139  1.00 70.51  ? 271 TYR Z C     1 
ATOM   2106 O  O     . TYR A 1 271 ? -9.458  56.949 -6.438  1.00 69.82  ? 271 TYR Z O     1 
ATOM   2107 C  CB    . TYR A 1 271 ? -12.281 58.345 -6.721  1.00 68.59  ? 271 TYR Z CB    1 
ATOM   2108 C  CG    . TYR A 1 271 ? -12.230 57.173 -7.678  1.00 68.36  ? 271 TYR Z CG    1 
ATOM   2109 C  CD1   . TYR A 1 271 ? -12.907 55.992 -7.399  1.00 63.04  ? 271 TYR Z CD1   1 
ATOM   2110 C  CD2   . TYR A 1 271 ? -11.502 57.243 -8.861  1.00 66.80  ? 271 TYR Z CD2   1 
ATOM   2111 C  CE1   . TYR A 1 271 ? -12.864 54.913 -8.270  1.00 62.67  ? 271 TYR Z CE1   1 
ATOM   2112 C  CE2   . TYR A 1 271 ? -11.453 56.169 -9.739  1.00 65.17  ? 271 TYR Z CE2   1 
ATOM   2113 C  CZ    . TYR A 1 271 ? -12.137 55.007 -9.435  1.00 64.57  ? 271 TYR Z CZ    1 
ATOM   2114 O  OH    . TYR A 1 271 ? -12.098 53.935 -10.296 1.00 62.33  ? 271 TYR Z OH    1 
ATOM   2115 N  N     . ILE A 1 272 ? -9.164  59.169 -6.294  1.00 68.16  ? 272 ILE Z N     1 
ATOM   2116 C  CA    . ILE A 1 272 ? -7.781  59.128 -6.752  1.00 67.37  ? 272 ILE Z CA    1 
ATOM   2117 C  C     . ILE A 1 272 ? -6.891  58.437 -5.724  1.00 70.10  ? 272 ILE Z C     1 
ATOM   2118 O  O     . ILE A 1 272 ? -6.111  57.538 -6.050  1.00 71.37  ? 272 ILE Z O     1 
ATOM   2119 C  CB    . ILE A 1 272 ? -7.238  60.534 -7.019  1.00 69.28  ? 272 ILE Z CB    1 
ATOM   2120 C  CG1   . ILE A 1 272 ? -8.234  61.334 -7.858  1.00 76.77  ? 272 ILE Z CG1   1 
ATOM   2121 C  CG2   . ILE A 1 272 ? -5.882  60.458 -7.697  1.00 56.80  ? 272 ILE Z CG2   1 
ATOM   2122 C  CD1   . ILE A 1 272 ? -8.463  60.765 -9.233  1.00 79.42  ? 272 ILE Z CD1   1 
ATOM   2123 N  N     . ASN A 1 273 ? -7.016  58.864 -4.474  1.00 68.76  ? 273 ASN Z N     1 
ATOM   2124 C  CA    . ASN A 1 273 ? -6.270  58.251 -3.386  1.00 73.35  ? 273 ASN Z CA    1 
ATOM   2125 C  C     . ASN A 1 273 ? -6.654  56.779 -3.209  1.00 67.87  ? 273 ASN Z C     1 
ATOM   2126 O  O     . ASN A 1 273 ? -5.801  55.934 -2.922  1.00 59.72  ? 273 ASN Z O     1 
ATOM   2127 C  CB    . ASN A 1 273 ? -6.492  59.028 -2.085  1.00 80.82  ? 273 ASN Z CB    1 
ATOM   2128 C  CG    . ASN A 1 273 ? -6.050  60.485 -2.188  1.00 84.16  ? 273 ASN Z CG    1 
ATOM   2129 O  OD1   . ASN A 1 273 ? -5.076  60.815 -2.871  1.00 81.32  ? 273 ASN Z OD1   1 
ATOM   2130 N  ND2   . ASN A 1 273 ? -6.770  61.364 -1.503  1.00 88.93  ? 273 ASN Z ND2   1 
ATOM   2131 N  N     . GLY A 1 274 ? -7.936  56.477 -3.396  1.00 60.53  ? 274 GLY Z N     1 
ATOM   2132 C  CA    . GLY A 1 274 ? -8.407  55.106 -3.331  1.00 61.90  ? 274 GLY Z CA    1 
ATOM   2133 C  C     . GLY A 1 274 ? -7.813  54.258 -4.437  1.00 60.83  ? 274 GLY Z C     1 
ATOM   2134 O  O     . GLY A 1 274 ? -7.515  53.080 -4.243  1.00 64.50  ? 274 GLY Z O     1 
ATOM   2135 N  N     . PHE A 1 275 ? -7.640  54.869 -5.604  1.00 58.17  ? 275 PHE Z N     1 
ATOM   2136 C  CA    . PHE A 1 275 ? -7.025  54.205 -6.741  1.00 55.70  ? 275 PHE Z CA    1 
ATOM   2137 C  C     . PHE A 1 275 ? -5.558  53.921 -6.461  1.00 57.24  ? 275 PHE Z C     1 
ATOM   2138 O  O     . PHE A 1 275 ? -5.064  52.843 -6.776  1.00 54.93  ? 275 PHE Z O     1 
ATOM   2139 C  CB    . PHE A 1 275 ? -7.166  55.052 -8.006  1.00 53.37  ? 275 PHE Z CB    1 
ATOM   2140 C  CG    . PHE A 1 275 ? -6.587  54.407 -9.225  1.00 54.17  ? 275 PHE Z CG    1 
ATOM   2141 C  CD1   . PHE A 1 275 ? -7.367  53.603 -10.021 1.00 49.21  ? 275 PHE Z CD1   1 
ATOM   2142 C  CD2   . PHE A 1 275 ? -5.262  54.595 -9.566  1.00 55.34  ? 275 PHE Z CD2   1 
ATOM   2143 C  CE1   . PHE A 1 275 ? -6.842  53.002 -11.130 1.00 50.24  ? 275 PHE Z CE1   1 
ATOM   2144 C  CE2   . PHE A 1 275 ? -4.732  53.997 -10.674 1.00 57.68  ? 275 PHE Z CE2   1 
ATOM   2145 C  CZ    . PHE A 1 275 ? -5.521  53.199 -11.459 1.00 59.11  ? 275 PHE Z CZ    1 
ATOM   2146 N  N     . ILE A 1 276 ? -4.862  54.897 -5.883  1.00 53.37  ? 276 ILE Z N     1 
ATOM   2147 C  CA    . ILE A 1 276 ? -3.468  54.701 -5.485  1.00 53.39  ? 276 ILE Z CA    1 
ATOM   2148 C  C     . ILE A 1 276 ? -3.351  53.558 -4.485  1.00 59.05  ? 276 ILE Z C     1 
ATOM   2149 O  O     . ILE A 1 276 ? -2.452  52.719 -4.586  1.00 63.17  ? 276 ILE Z O     1 
ATOM   2150 C  CB    . ILE A 1 276 ? -2.870  55.974 -4.864  1.00 51.63  ? 276 ILE Z CB    1 
ATOM   2151 C  CG1   . ILE A 1 276 ? -2.874  57.108 -5.886  1.00 55.70  ? 276 ILE Z CG1   1 
ATOM   2152 C  CG2   . ILE A 1 276 ? -1.460  55.715 -4.355  1.00 46.41  ? 276 ILE Z CG2   1 
ATOM   2153 C  CD1   . ILE A 1 276 ? -2.398  58.429 -5.333  1.00 60.54  ? 276 ILE Z CD1   1 
ATOM   2154 N  N     . ARG A 1 277 ? -4.273  53.528 -3.526  1.00 56.16  ? 277 ARG Z N     1 
ATOM   2155 C  CA    . ARG A 1 277 ? -4.280  52.493 -2.502  1.00 56.75  ? 277 ARG Z CA    1 
ATOM   2156 C  C     . ARG A 1 277 ? -4.516  51.118 -3.119  1.00 51.00  ? 277 ARG Z C     1 
ATOM   2157 O  O     . ARG A 1 277 ? -3.840  50.149 -2.771  1.00 54.53  ? 277 ARG Z O     1 
ATOM   2158 C  CB    . ARG A 1 277 ? -5.340  52.799 -1.437  1.00 67.01  ? 277 ARG Z CB    1 
ATOM   2159 C  CG    . ARG A 1 277 ? -4.965  53.957 -0.507  1.00 76.88  ? 277 ARG Z CG    1 
ATOM   2160 C  CD    . ARG A 1 277 ? -5.914  54.099 0.691   1.00 78.54  ? 277 ARG Z CD    1 
ATOM   2161 N  NE    . ARG A 1 277 ? -6.889  55.173 0.507   1.00 70.17  ? 277 ARG Z NE    1 
ATOM   2162 C  CZ    . ARG A 1 277 ? -8.167  54.981 0.197   1.00 76.56  ? 277 ARG Z CZ    1 
ATOM   2163 N  NH1   . ARG A 1 277 ? -8.646  53.752 0.044   1.00 81.17  ? 277 ARG Z NH1   1 
ATOM   2164 N  NH2   . ARG A 1 277 ? -8.972  56.021 0.043   1.00 72.04  ? 277 ARG Z NH2   1 
ATOM   2165 N  N     . ALA A 1 278 ? -5.466  51.044 -4.043  1.00 52.67  ? 278 ALA Z N     1 
ATOM   2166 C  CA    . ALA A 1 278 ? -5.790  49.789 -4.708  1.00 49.22  ? 278 ALA Z CA    1 
ATOM   2167 C  C     . ALA A 1 278 ? -4.607  49.286 -5.533  1.00 52.30  ? 278 ALA Z C     1 
ATOM   2168 O  O     . ALA A 1 278 ? -4.259  48.102 -5.501  1.00 53.90  ? 278 ALA Z O     1 
ATOM   2169 C  CB    . ALA A 1 278 ? -7.018  49.965 -5.580  1.00 44.64  ? 278 ALA Z CB    1 
ATOM   2170 N  N     . ASN A 1 279 ? -3.985  50.202 -6.264  1.00 51.26  ? 279 ASN Z N     1 
ATOM   2171 C  CA    . ASN A 1 279 ? -2.818  49.884 -7.069  1.00 52.79  ? 279 ASN Z CA    1 
ATOM   2172 C  C     . ASN A 1 279 ? -1.692  49.342 -6.204  1.00 52.06  ? 279 ASN Z C     1 
ATOM   2173 O  O     . ASN A 1 279 ? -1.115  48.288 -6.495  1.00 51.33  ? 279 ASN Z O     1 
ATOM   2174 C  CB    . ASN A 1 279 ? -2.351  51.122 -7.829  1.00 48.94  ? 279 ASN Z CB    1 
ATOM   2175 C  CG    . ASN A 1 279 ? -1.268  50.814 -8.837  1.00 49.60  ? 279 ASN Z CG    1 
ATOM   2176 O  OD1   . ASN A 1 279 ? -1.349  49.831 -9.576  1.00 50.31  ? 279 ASN Z OD1   1 
ATOM   2177 N  ND2   . ASN A 1 279 ? -0.240  51.655 -8.872  1.00 52.15  ? 279 ASN Z ND2   1 
ATOM   2178 N  N     . ASN A 1 280 ? -1.397  50.069 -5.129  1.00 49.21  ? 280 ASN Z N     1 
ATOM   2179 C  CA    . ASN A 1 280 ? -0.359  49.669 -4.191  1.00 50.23  ? 280 ASN Z CA    1 
ATOM   2180 C  C     . ASN A 1 280 ? -0.695  48.354 -3.507  1.00 55.60  ? 280 ASN Z C     1 
ATOM   2181 O  O     . ASN A 1 280 ? 0.191   47.647 -3.049  1.00 53.74  ? 280 ASN Z O     1 
ATOM   2182 C  CB    . ASN A 1 280 ? -0.133  50.757 -3.142  1.00 52.48  ? 280 ASN Z CB    1 
ATOM   2183 C  CG    . ASN A 1 280 ? 0.568   51.974 -3.705  1.00 60.15  ? 280 ASN Z CG    1 
ATOM   2184 O  OD1   . ASN A 1 280 ? 1.204   51.907 -4.756  1.00 55.62  ? 280 ASN Z OD1   1 
ATOM   2185 N  ND2   . ASN A 1 280 ? 0.462   53.095 -3.001  1.00 57.00  ? 280 ASN Z ND2   1 
ATOM   2186 N  N     . THR A 1 281 ? -1.980  48.030 -3.429  1.00 48.44  ? 281 THR Z N     1 
ATOM   2187 C  CA    . THR A 1 281 ? -2.393  46.780 -2.809  1.00 48.63  ? 281 THR Z CA    1 
ATOM   2188 C  C     . THR A 1 281 ? -2.149  45.631 -3.773  1.00 50.29  ? 281 THR Z C     1 
ATOM   2189 O  O     . THR A 1 281 ? -1.691  44.564 -3.371  1.00 49.77  ? 281 THR Z O     1 
ATOM   2190 C  CB    . THR A 1 281 ? -3.873  46.804 -2.387  1.00 47.16  ? 281 THR Z CB    1 
ATOM   2191 O  OG1   . THR A 1 281 ? -4.106  47.917 -1.519  1.00 46.70  ? 281 THR Z OG1   1 
ATOM   2192 C  CG2   . THR A 1 281 ? -4.234  45.525 -1.653  1.00 47.94  ? 281 THR Z CG2   1 
ATOM   2193 N  N     . PHE A 1 282 ? -2.451  45.858 -5.048  1.00 44.24  ? 282 PHE Z N     1 
ATOM   2194 C  CA    . PHE A 1 282 ? -2.161  44.865 -6.077  1.00 49.70  ? 282 PHE Z CA    1 
ATOM   2195 C  C     . PHE A 1 282 ? -0.657  44.648 -6.235  1.00 52.58  ? 282 PHE Z C     1 
ATOM   2196 O  O     . PHE A 1 282 ? -0.210  43.548 -6.556  1.00 51.69  ? 282 PHE Z O     1 
ATOM   2197 C  CB    . PHE A 1 282 ? -2.769  45.278 -7.420  1.00 42.71  ? 282 PHE Z CB    1 
ATOM   2198 C  CG    . PHE A 1 282 ? -4.177  44.799 -7.626  1.00 41.58  ? 282 PHE Z CG    1 
ATOM   2199 C  CD1   . PHE A 1 282 ? -4.448  43.457 -7.821  1.00 39.76  ? 282 PHE Z CD1   1 
ATOM   2200 C  CD2   . PHE A 1 282 ? -5.223  45.692 -7.642  1.00 40.81  ? 282 PHE Z CD2   1 
ATOM   2201 C  CE1   . PHE A 1 282 ? -5.733  43.021 -8.011  1.00 37.27  ? 282 PHE Z CE1   1 
ATOM   2202 C  CE2   . PHE A 1 282 ? -6.507  45.259 -7.833  1.00 38.83  ? 282 PHE Z CE2   1 
ATOM   2203 C  CZ    . PHE A 1 282 ? -6.763  43.922 -8.016  1.00 37.19  ? 282 PHE Z CZ    1 
ATOM   2204 N  N     . LEU A 1 283 ? 0.123   45.699 -6.002  1.00 45.36  ? 283 LEU Z N     1 
ATOM   2205 C  CA    . LEU A 1 283 ? 1.568   45.624 -6.196  1.00 47.22  ? 283 LEU Z CA    1 
ATOM   2206 C  C     . LEU A 1 283 ? 2.344   45.081 -4.989  1.00 59.11  ? 283 LEU Z C     1 
ATOM   2207 O  O     . LEU A 1 283 ? 3.173   44.186 -5.131  1.00 58.47  ? 283 LEU Z O     1 
ATOM   2208 C  CB    . LEU A 1 283 ? 2.113   47.003 -6.561  1.00 49.53  ? 283 LEU Z CB    1 
ATOM   2209 C  CG    . LEU A 1 283 ? 1.858   47.506 -7.977  1.00 49.51  ? 283 LEU Z CG    1 
ATOM   2210 C  CD1   . LEU A 1 283 ? 2.408   48.906 -8.134  1.00 52.07  ? 283 LEU Z CD1   1 
ATOM   2211 C  CD2   . LEU A 1 283 ? 2.503   46.571 -8.969  1.00 49.23  ? 283 LEU Z CD2   1 
ATOM   2212 N  N     . TYR A 1 284 ? 2.079   45.623 -3.805  1.00 55.89  ? 284 TYR Z N     1 
ATOM   2213 C  CA    . TYR A 1 284 ? 2.943   45.380 -2.651  1.00 56.32  ? 284 TYR Z CA    1 
ATOM   2214 C  C     . TYR A 1 284 ? 2.262   44.693 -1.471  1.00 52.74  ? 284 TYR Z C     1 
ATOM   2215 O  O     . TYR A 1 284 ? 2.683   44.875 -0.331  1.00 50.48  ? 284 TYR Z O     1 
ATOM   2216 C  CB    . TYR A 1 284 ? 3.549   46.701 -2.163  1.00 56.24  ? 284 TYR Z CB    1 
ATOM   2217 C  CG    . TYR A 1 284 ? 4.127   47.562 -3.261  1.00 55.46  ? 284 TYR Z CG    1 
ATOM   2218 C  CD1   . TYR A 1 284 ? 5.268   47.175 -3.949  1.00 55.91  ? 284 TYR Z CD1   1 
ATOM   2219 C  CD2   . TYR A 1 284 ? 3.531   48.767 -3.607  1.00 56.46  ? 284 TYR Z CD2   1 
ATOM   2220 C  CE1   . TYR A 1 284 ? 5.795   47.961 -4.955  1.00 61.87  ? 284 TYR Z CE1   1 
ATOM   2221 C  CE2   . TYR A 1 284 ? 4.050   49.560 -4.610  1.00 61.00  ? 284 TYR Z CE2   1 
ATOM   2222 C  CZ    . TYR A 1 284 ? 5.182   49.155 -5.281  1.00 64.45  ? 284 TYR Z CZ    1 
ATOM   2223 O  OH    . TYR A 1 284 ? 5.697   49.950 -6.280  1.00 61.43  ? 284 TYR Z OH    1 
ATOM   2224 N  N     . GLN A 1 285 ? 1.224   43.905 -1.727  1.00 53.01  ? 285 GLN Z N     1 
ATOM   2225 C  CA    . GLN A 1 285 ? 0.591   43.152 -0.650  1.00 47.76  ? 285 GLN Z CA    1 
ATOM   2226 C  C     . GLN A 1 285 ? 1.561   42.131 -0.078  1.00 49.28  ? 285 GLN Z C     1 
ATOM   2227 O  O     . GLN A 1 285 ? 2.229   41.417 -0.814  1.00 46.61  ? 285 GLN Z O     1 
ATOM   2228 C  CB    . GLN A 1 285 ? -0.676  42.458 -1.135  1.00 43.44  ? 285 GLN Z CB    1 
ATOM   2229 C  CG    . GLN A 1 285 ? -1.337  41.622 -0.067  1.00 42.30  ? 285 GLN Z CG    1 
ATOM   2230 C  CD    . GLN A 1 285 ? -2.701  41.130 -0.477  1.00 46.01  ? 285 GLN Z CD    1 
ATOM   2231 O  OE1   . GLN A 1 285 ? -3.307  40.314 0.208   1.00 48.95  ? 285 GLN Z OE1   1 
ATOM   2232 N  NE2   . GLN A 1 285 ? -3.198  41.629 -1.597  1.00 46.42  ? 285 GLN Z NE2   1 
ATOM   2233 N  N     . LEU A 1 286 ? 1.635   42.065 1.243   1.00 56.33  ? 286 LEU Z N     1 
ATOM   2234 C  CA    . LEU A 1 286 ? 2.620   41.216 1.901   1.00 57.87  ? 286 LEU Z CA    1 
ATOM   2235 C  C     . LEU A 1 286 ? 2.384   39.737 1.623   1.00 56.05  ? 286 LEU Z C     1 
ATOM   2236 O  O     . LEU A 1 286 ? 1.278   39.226 1.787   1.00 55.49  ? 286 LEU Z O     1 
ATOM   2237 C  CB    . LEU A 1 286 ? 2.624   41.470 3.412   1.00 58.63  ? 286 LEU Z CB    1 
ATOM   2238 C  CG    . LEU A 1 286 ? 2.991   42.892 3.842   1.00 62.39  ? 286 LEU Z CG    1 
ATOM   2239 C  CD1   . LEU A 1 286 ? 3.204   42.970 5.347   1.00 62.18  ? 286 LEU Z CD1   1 
ATOM   2240 C  CD2   . LEU A 1 286 ? 4.220   43.372 3.086   1.00 63.30  ? 286 LEU Z CD2   1 
ATOM   2241 N  N     . VAL A 1 287 ? 3.442   39.061 1.190   1.00 55.16  ? 287 VAL Z N     1 
ATOM   2242 C  CA    . VAL A 1 287 ? 3.418   37.617 1.001   1.00 54.47  ? 287 VAL Z CA    1 
ATOM   2243 C  C     . VAL A 1 287 ? 4.519   36.960 1.816   1.00 62.96  ? 287 VAL Z C     1 
ATOM   2244 O  O     . VAL A 1 287 ? 5.269   37.631 2.517   1.00 66.90  ? 287 VAL Z O     1 
ATOM   2245 C  CB    . VAL A 1 287 ? 3.595   37.235 -0.466  1.00 49.70  ? 287 VAL Z CB    1 
ATOM   2246 C  CG1   . VAL A 1 287 ? 2.506   37.875 -1.307  1.00 53.10  ? 287 VAL Z CG1   1 
ATOM   2247 C  CG2   . VAL A 1 287 ? 4.971   37.653 -0.944  1.00 48.08  ? 287 VAL Z CG2   1 
ATOM   2248 N  N     . PHE A 1 288 ? 4.624   35.644 1.717   1.00 72.13  ? 288 PHE Z N     1 
ATOM   2249 C  CA    . PHE A 1 288 ? 5.600   34.924 2.513   1.00 71.02  ? 288 PHE Z CA    1 
ATOM   2250 C  C     . PHE A 1 288 ? 6.510   34.084 1.633   1.00 76.14  ? 288 PHE Z C     1 
ATOM   2251 O  O     . PHE A 1 288 ? 6.054   33.156 0.975   1.00 71.92  ? 288 PHE Z O     1 
ATOM   2252 C  CB    . PHE A 1 288 ? 4.897   34.041 3.548   1.00 56.73  ? 288 PHE Z CB    1 
ATOM   2253 C  CG    . PHE A 1 288 ? 5.840   33.293 4.442   1.00 59.52  ? 288 PHE Z CG    1 
ATOM   2254 C  CD1   . PHE A 1 288 ? 6.623   33.971 5.358   1.00 65.19  ? 288 PHE Z CD1   1 
ATOM   2255 C  CD2   . PHE A 1 288 ? 5.942   31.917 4.367   1.00 60.87  ? 288 PHE Z CD2   1 
ATOM   2256 C  CE1   . PHE A 1 288 ? 7.490   33.293 6.178   1.00 71.66  ? 288 PHE Z CE1   1 
ATOM   2257 C  CE2   . PHE A 1 288 ? 6.810   31.231 5.188   1.00 63.48  ? 288 PHE Z CE2   1 
ATOM   2258 C  CZ    . PHE A 1 288 ? 7.585   31.920 6.095   1.00 67.61  ? 288 PHE Z CZ    1 
ATOM   2259 N  N     . ASP A 1 289 ? 7.795   34.423 1.620   1.00 77.29  ? 289 ASP Z N     1 
ATOM   2260 C  CA    . ASP A 1 289 ? 8.805   33.634 0.920   1.00 74.04  ? 289 ASP Z CA    1 
ATOM   2261 C  C     . ASP A 1 289 ? 9.038   32.308 1.647   1.00 72.38  ? 289 ASP Z C     1 
ATOM   2262 O  O     . ASP A 1 289 ? 9.566   32.292 2.749   1.00 70.72  ? 289 ASP Z O     1 
ATOM   2263 C  CB    . ASP A 1 289 ? 10.109  34.431 0.817   1.00 78.84  ? 289 ASP Z CB    1 
ATOM   2264 C  CG    . ASP A 1 289 ? 11.109  33.820 -0.155  1.00 85.63  ? 289 ASP Z CG    1 
ATOM   2265 O  OD1   . ASP A 1 289 ? 11.152  32.579 -0.293  1.00 89.96  ? 289 ASP Z OD1   1 
ATOM   2266 O  OD2   . ASP A 1 289 ? 11.867  34.593 -0.781  1.00 88.02  ? 289 ASP Z OD2   1 
ATOM   2267 N  N     . PRO A 1 290 ? 8.649   31.186 1.027   1.00 75.54  ? 290 PRO Z N     1 
ATOM   2268 C  CA    . PRO A 1 290 ? 8.796   29.885 1.684   1.00 78.91  ? 290 PRO Z CA    1 
ATOM   2269 C  C     . PRO A 1 290 ? 10.258  29.485 1.839   1.00 82.99  ? 290 PRO Z C     1 
ATOM   2270 O  O     . PRO A 1 290 ? 10.598  28.806 2.810   1.00 81.70  ? 290 PRO Z O     1 
ATOM   2271 C  CB    . PRO A 1 290 ? 8.074   28.918 0.738   1.00 80.85  ? 290 PRO Z CB    1 
ATOM   2272 C  CG    . PRO A 1 290 ? 7.298   29.781 -0.197  1.00 78.35  ? 290 PRO Z CG    1 
ATOM   2273 C  CD    . PRO A 1 290 ? 8.066   31.054 -0.312  1.00 78.24  ? 290 PRO Z CD    1 
ATOM   2274 N  N     . ILE A 1 291 ? 11.104  29.904 0.899   1.00 78.01  ? 291 ILE Z N     1 
ATOM   2275 C  CA    . ILE A 1 291 ? 12.510  29.509 0.901   1.00 77.83  ? 291 ILE Z CA    1 
ATOM   2276 C  C     . ILE A 1 291 ? 13.300  30.253 1.971   1.00 85.34  ? 291 ILE Z C     1 
ATOM   2277 O  O     . ILE A 1 291 ? 13.936  29.638 2.828   1.00 90.40  ? 291 ILE Z O     1 
ATOM   2278 C  CB    . ILE A 1 291 ? 13.167  29.758 -0.465  1.00 75.47  ? 291 ILE Z CB    1 
ATOM   2279 C  CG1   . ILE A 1 291 ? 12.348  29.102 -1.578  1.00 74.15  ? 291 ILE Z CG1   1 
ATOM   2280 C  CG2   . ILE A 1 291 ? 14.588  29.219 -0.470  1.00 77.47  ? 291 ILE Z CG2   1 
ATOM   2281 C  CD1   . ILE A 1 291 ? 12.898  29.341 -2.972  1.00 80.70  ? 291 ILE Z CD1   1 
ATOM   2282 N  N     . LYS A 1 292 ? 13.253  31.580 1.919   1.00 80.31  ? 292 LYS Z N     1 
ATOM   2283 C  CA    . LYS A 1 292 ? 13.990  32.404 2.867   1.00 76.36  ? 292 LYS Z CA    1 
ATOM   2284 C  C     . LYS A 1 292 ? 13.239  32.542 4.183   1.00 74.42  ? 292 LYS Z C     1 
ATOM   2285 O  O     . LYS A 1 292 ? 13.794  33.024 5.165   1.00 76.17  ? 292 LYS Z O     1 
ATOM   2286 C  CB    . LYS A 1 292 ? 14.271  33.787 2.268   1.00 75.74  ? 292 LYS Z CB    1 
ATOM   2287 C  CG    . LYS A 1 292 ? 15.303  33.783 1.145   1.00 82.33  ? 292 LYS Z CG    1 
ATOM   2288 C  CD    . LYS A 1 292 ? 15.502  35.168 0.547   1.00 90.77  ? 292 LYS Z CD    1 
ATOM   2289 C  CE    . LYS A 1 292 ? 16.634  35.166 -0.470  1.00 100.71 ? 292 LYS Z CE    1 
ATOM   2290 N  NZ    . LYS A 1 292 ? 16.422  34.148 -1.538  1.00 106.28 ? 292 LYS Z NZ    1 
ATOM   2291 N  N     . ARG A 1 293 ? 11.977  32.119 4.189   1.00 76.99  ? 293 ARG Z N     1 
ATOM   2292 C  CA    . ARG A 1 293 ? 11.123  32.171 5.378   1.00 77.09  ? 293 ARG Z CA    1 
ATOM   2293 C  C     . ARG A 1 293 ? 11.022  33.570 5.996   1.00 74.94  ? 293 ARG Z C     1 
ATOM   2294 O  O     . ARG A 1 293 ? 11.472  33.800 7.123   1.00 78.83  ? 293 ARG Z O     1 
ATOM   2295 C  CB    . ARG A 1 293 ? 11.617  31.168 6.420   1.00 82.69  ? 293 ARG Z CB    1 
ATOM   2296 C  CG    . ARG A 1 293 ? 11.504  29.723 5.965   1.00 86.41  ? 293 ARG Z CG    1 
ATOM   2297 C  CD    . ARG A 1 293 ? 12.053  28.774 7.017   1.00 90.89  ? 293 ARG Z CD    1 
ATOM   2298 N  NE    . ARG A 1 293 ? 11.795  27.373 6.689   1.00 92.94  ? 293 ARG Z NE    1 
ATOM   2299 C  CZ    . ARG A 1 293 ? 12.164  26.347 7.452   1.00 95.49  ? 293 ARG Z CZ    1 
ATOM   2300 N  NH1   . ARG A 1 293 ? 12.814  26.563 8.591   1.00 97.03  ? 293 ARG Z NH1   1 
ATOM   2301 N  NH2   . ARG A 1 293 ? 11.886  25.105 7.077   1.00 96.72  ? 293 ARG Z NH2   1 
ATOM   2302 N  N     . LYS A 1 294 ? 10.410  34.493 5.256   1.00 76.10  ? 294 LYS Z N     1 
ATOM   2303 C  CA    . LYS A 1 294 ? 10.256  35.868 5.718   1.00 76.41  ? 294 LYS Z CA    1 
ATOM   2304 C  C     . LYS A 1 294 ? 9.162   36.639 4.966   1.00 71.73  ? 294 LYS Z C     1 
ATOM   2305 O  O     . LYS A 1 294 ? 8.827   36.315 3.829   1.00 68.93  ? 294 LYS Z O     1 
ATOM   2306 C  CB    . LYS A 1 294 ? 11.591  36.608 5.598   1.00 79.18  ? 294 LYS Z CB    1 
ATOM   2307 C  CG    . LYS A 1 294 ? 12.110  36.761 4.178   1.00 76.70  ? 294 LYS Z CG    1 
ATOM   2308 C  CD    . LYS A 1 294 ? 13.536  37.306 4.177   1.00 86.64  ? 294 LYS Z CD    1 
ATOM   2309 C  CE    . LYS A 1 294 ? 13.656  38.598 4.990   1.00 93.16  ? 294 LYS Z CE    1 
ATOM   2310 N  NZ    . LYS A 1 294 ? 15.078  38.977 5.254   1.00 98.12  ? 294 LYS Z NZ    1 
ATOM   2311 N  N     . LEU A 1 295 ? 8.612   37.662 5.617   1.00 66.14  ? 295 LEU Z N     1 
ATOM   2312 C  CA    . LEU A 1 295 ? 7.584   38.505 5.015   1.00 65.57  ? 295 LEU Z CA    1 
ATOM   2313 C  C     . LEU A 1 295 ? 8.168   39.470 4.005   1.00 70.34  ? 295 LEU Z C     1 
ATOM   2314 O  O     . LEU A 1 295 ? 9.103   40.211 4.308   1.00 77.45  ? 295 LEU Z O     1 
ATOM   2315 C  CB    . LEU A 1 295 ? 6.833   39.300 6.081   1.00 66.23  ? 295 LEU Z CB    1 
ATOM   2316 C  CG    . LEU A 1 295 ? 5.726   38.591 6.851   1.00 64.30  ? 295 LEU Z CG    1 
ATOM   2317 C  CD1   . LEU A 1 295 ? 5.046   39.566 7.793   1.00 65.57  ? 295 LEU Z CD1   1 
ATOM   2318 C  CD2   . LEU A 1 295 ? 4.725   37.994 5.890   1.00 63.05  ? 295 LEU Z CD2   1 
ATOM   2319 N  N     . ILE A 1 296 ? 7.599   39.459 2.804   1.00 69.68  ? 296 ILE Z N     1 
ATOM   2320 C  CA    . ILE A 1 296 ? 7.999   40.370 1.739   1.00 66.35  ? 296 ILE Z CA    1 
ATOM   2321 C  C     . ILE A 1 296 ? 6.776   40.870 0.980   1.00 62.14  ? 296 ILE Z C     1 
ATOM   2322 O  O     . ILE A 1 296 ? 5.739   40.209 0.968   1.00 60.68  ? 296 ILE Z O     1 
ATOM   2323 C  CB    . ILE A 1 296 ? 8.960   39.694 0.749   1.00 61.45  ? 296 ILE Z CB    1 
ATOM   2324 C  CG1   . ILE A 1 296 ? 8.368   38.375 0.255   1.00 61.26  ? 296 ILE Z CG1   1 
ATOM   2325 C  CG2   . ILE A 1 296 ? 10.306  39.450 1.397   1.00 59.04  ? 296 ILE Z CG2   1 
ATOM   2326 C  CD1   . ILE A 1 296 ? 9.221   37.690 -0.784  1.00 64.04  ? 296 ILE Z CD1   1 
ATOM   2327 N  N     . PRO A 1 297 ? 6.885   42.048 0.353   1.00 59.74  ? 297 PRO Z N     1 
ATOM   2328 C  CA    . PRO A 1 297 ? 5.806   42.475 -0.536  1.00 57.75  ? 297 PRO Z CA    1 
ATOM   2329 C  C     . PRO A 1 297 ? 5.775   41.615 -1.796  1.00 57.94  ? 297 PRO Z C     1 
ATOM   2330 O  O     . PRO A 1 297 ? 6.770   40.964 -2.103  1.00 60.40  ? 297 PRO Z O     1 
ATOM   2331 C  CB    . PRO A 1 297 ? 6.169   43.925 -0.858  1.00 54.28  ? 297 PRO Z CB    1 
ATOM   2332 C  CG    . PRO A 1 297 ? 7.640   43.992 -0.666  1.00 57.03  ? 297 PRO Z CG    1 
ATOM   2333 C  CD    . PRO A 1 297 ? 7.941   43.066 0.470   1.00 60.21  ? 297 PRO Z CD    1 
ATOM   2334 N  N     . LEU A 1 298 ? 4.649   41.607 -2.501  1.00 54.66  ? 298 LEU Z N     1 
ATOM   2335 C  CA    . LEU A 1 298 ? 4.498   40.817 -3.719  1.00 52.26  ? 298 LEU Z CA    1 
ATOM   2336 C  C     . LEU A 1 298 ? 5.530   41.223 -4.757  1.00 53.96  ? 298 LEU Z C     1 
ATOM   2337 O  O     . LEU A 1 298 ? 6.099   40.382 -5.452  1.00 60.91  ? 298 LEU Z O     1 
ATOM   2338 C  CB    . LEU A 1 298 ? 3.086   40.979 -4.279  1.00 52.02  ? 298 LEU Z CB    1 
ATOM   2339 C  CG    . LEU A 1 298 ? 2.750   40.284 -5.593  1.00 48.67  ? 298 LEU Z CG    1 
ATOM   2340 C  CD1   . LEU A 1 298 ? 3.079   38.812 -5.508  1.00 46.52  ? 298 LEU Z CD1   1 
ATOM   2341 C  CD2   . LEU A 1 298 ? 1.281   40.496 -5.923  1.00 48.44  ? 298 LEU Z CD2   1 
ATOM   2342 N  N     . ASN A 1 299 ? 5.764   42.525 -4.852  1.00 51.02  ? 299 ASN Z N     1 
ATOM   2343 C  CA    . ASN A 1 299 ? 6.807   43.059 -5.715  1.00 53.15  ? 299 ASN Z CA    1 
ATOM   2344 C  C     . ASN A 1 299 ? 7.763   43.954 -4.928  1.00 66.67  ? 299 ASN Z C     1 
ATOM   2345 O  O     . ASN A 1 299 ? 7.366   44.578 -3.945  1.00 71.35  ? 299 ASN Z O     1 
ATOM   2346 C  CB    . ASN A 1 299 ? 6.197   43.838 -6.881  1.00 52.61  ? 299 ASN Z CB    1 
ATOM   2347 C  CG    . ASN A 1 299 ? 5.339   42.971 -7.779  1.00 50.21  ? 299 ASN Z CG    1 
ATOM   2348 O  OD1   . ASN A 1 299 ? 5.842   42.303 -8.678  1.00 59.43  ? 299 ASN Z OD1   1 
ATOM   2349 N  ND2   . ASN A 1 299 ? 4.036   42.987 -7.548  1.00 48.10  ? 299 ASN Z ND2   1 
ATOM   2350 N  N     . ALA A 1 300 ? 9.019   44.007 -5.360  1.00 65.58  ? 300 ALA Z N     1 
ATOM   2351 C  CA    . ALA A 1 300 ? 10.015  44.840 -4.700  1.00 61.19  ? 300 ALA Z CA    1 
ATOM   2352 C  C     . ALA A 1 300 ? 9.565   46.295 -4.703  1.00 65.65  ? 300 ALA Z C     1 
ATOM   2353 O  O     . ALA A 1 300 ? 9.057   46.782 -5.710  1.00 72.52  ? 300 ALA Z O     1 
ATOM   2354 C  CB    . ALA A 1 300 ? 11.365  44.694 -5.381  1.00 63.65  ? 300 ALA Z CB    1 
ATOM   2355 N  N     . TYR A 1 301 ? 9.741   46.975 -3.572  1.00 70.59  ? 301 TYR Z N     1 
ATOM   2356 C  CA    . TYR A 1 301 ? 9.323   48.368 -3.426  1.00 76.29  ? 301 TYR Z CA    1 
ATOM   2357 C  C     . TYR A 1 301 ? 10.031  49.279 -4.422  1.00 84.58  ? 301 TYR Z C     1 
ATOM   2358 O  O     . TYR A 1 301 ? 11.259  49.342 -4.461  1.00 90.99  ? 301 TYR Z O     1 
ATOM   2359 C  CB    . TYR A 1 301 ? 9.581   48.862 -1.996  1.00 76.05  ? 301 TYR Z CB    1 
ATOM   2360 C  CG    . TYR A 1 301 ? 8.656   48.267 -0.957  1.00 70.70  ? 301 TYR Z CG    1 
ATOM   2361 C  CD1   . TYR A 1 301 ? 7.301   48.127 -1.210  1.00 66.59  ? 301 TYR Z CD1   1 
ATOM   2362 C  CD2   . TYR A 1 301 ? 9.140   47.836 0.271   1.00 70.59  ? 301 TYR Z CD2   1 
ATOM   2363 C  CE1   . TYR A 1 301 ? 6.454   47.581 -0.273  1.00 64.88  ? 301 TYR Z CE1   1 
ATOM   2364 C  CE2   . TYR A 1 301 ? 8.297   47.286 1.213   1.00 68.94  ? 301 TYR Z CE2   1 
ATOM   2365 C  CZ    . TYR A 1 301 ? 6.957   47.161 0.933   1.00 69.12  ? 301 TYR Z CZ    1 
ATOM   2366 O  OH    . TYR A 1 301 ? 6.108   46.615 1.860   1.00 71.08  ? 301 TYR Z OH    1 
ATOM   2367 N  N     . GLU A 1 302 ? 9.253   49.983 -5.233  1.00 83.69  ? 302 GLU Z N     1 
ATOM   2368 C  CA    . GLU A 1 302 ? 9.816   50.931 -6.184  1.00 88.78  ? 302 GLU Z CA    1 
ATOM   2369 C  C     . GLU A 1 302 ? 10.303  52.177 -5.461  1.00 94.65  ? 302 GLU Z C     1 
ATOM   2370 O  O     . GLU A 1 302 ? 10.066  52.339 -4.262  1.00 96.59  ? 302 GLU Z O     1 
ATOM   2371 C  CB    . GLU A 1 302 ? 8.787   51.302 -7.244  1.00 85.49  ? 302 GLU Z CB    1 
ATOM   2372 C  CG    . GLU A 1 302 ? 8.369   50.131 -8.105  1.00 86.32  ? 302 GLU Z CG    1 
ATOM   2373 C  CD    . GLU A 1 302 ? 9.496   49.632 -8.979  1.00 95.67  ? 302 GLU Z CD    1 
ATOM   2374 O  OE1   . GLU A 1 302 ? 10.168  50.479 -9.608  1.00 101.27 ? 302 GLU Z OE1   1 
ATOM   2375 O  OE2   . GLU A 1 302 ? 9.714   48.401 -9.031  1.00 98.16  ? 302 GLU Z OE2   1 
ATOM   2376 N  N     . ASP A 1 303 ? 10.981  53.059 -6.186  1.00 94.41  ? 303 ASP Z N     1 
ATOM   2377 C  CA    . ASP A 1 303 ? 11.514  54.276 -5.582  1.00 93.22  ? 303 ASP Z CA    1 
ATOM   2378 C  C     . ASP A 1 303 ? 10.407  55.284 -5.295  1.00 93.86  ? 303 ASP Z C     1 
ATOM   2379 O  O     . ASP A 1 303 ? 10.525  56.106 -4.382  1.00 92.76  ? 303 ASP Z O     1 
ATOM   2380 C  CB    . ASP A 1 303 ? 12.572  54.906 -6.487  1.00 96.96  ? 303 ASP Z CB    1 
ATOM   2381 C  CG    . ASP A 1 303 ? 13.666  53.928 -6.869  1.00 99.59  ? 303 ASP Z CG    1 
ATOM   2382 O  OD1   . ASP A 1 303 ? 14.027  53.082 -6.020  1.00 95.70  ? 303 ASP Z OD1   1 
ATOM   2383 O  OD2   . ASP A 1 303 ? 14.154  54.002 -8.021  1.00 105.86 ? 303 ASP Z OD2   1 
ATOM   2384 N  N     . ASP A 1 304 ? 9.329   55.205 -6.073  1.00 98.42  ? 304 ASP Z N     1 
ATOM   2385 C  CA    . ASP A 1 304 ? 8.242   56.177 -5.984  1.00 103.15 ? 304 ASP Z CA    1 
ATOM   2386 C  C     . ASP A 1 304 ? 7.150   55.751 -5.006  1.00 98.89  ? 304 ASP Z C     1 
ATOM   2387 O  O     . ASP A 1 304 ? 5.984   56.097 -5.200  1.00 99.07  ? 304 ASP Z O     1 
ATOM   2388 C  CB    . ASP A 1 304 ? 7.626   56.430 -7.375  1.00 110.86 ? 304 ASP Z CB    1 
ATOM   2389 C  CG    . ASP A 1 304 ? 6.912   55.200 -7.947  1.00 107.52 ? 304 ASP Z CG    1 
ATOM   2390 O  OD1   . ASP A 1 304 ? 5.927   55.370 -8.701  1.00 101.43 ? 304 ASP Z OD1   1 
ATOM   2391 O  OD2   . ASP A 1 304 ? 7.337   54.063 -7.650  1.00 109.80 ? 304 ASP Z OD2   1 
ATOM   2392 N  N     . VAL A 1 305 ? 7.523   55.011 -3.961  1.00 98.57  ? 305 VAL Z N     1 
ATOM   2393 C  CA    . VAL A 1 305 ? 6.561   54.596 -2.937  1.00 86.10  ? 305 VAL Z CA    1 
ATOM   2394 C  C     . VAL A 1 305 ? 7.204   54.482 -1.553  1.00 81.63  ? 305 VAL Z C     1 
ATOM   2395 O  O     . VAL A 1 305 ? 8.299   53.929 -1.397  1.00 79.72  ? 305 VAL Z O     1 
ATOM   2396 C  CB    . VAL A 1 305 ? 5.883   53.243 -3.299  1.00 78.53  ? 305 VAL Z CB    1 
ATOM   2397 C  CG1   . VAL A 1 305 ? 6.920   52.143 -3.492  1.00 78.16  ? 305 VAL Z CG1   1 
ATOM   2398 C  CG2   . VAL A 1 305 ? 4.857   52.845 -2.240  1.00 72.65  ? 305 VAL Z CG2   1 
ATOM   2399 N  N     . ASP A 1 306 ? 6.515   55.027 -0.553  1.00 81.75  ? 306 ASP Z N     1 
ATOM   2400 C  CA    . ASP A 1 306 ? 6.952   54.934 0.834   1.00 78.37  ? 306 ASP Z CA    1 
ATOM   2401 C  C     . ASP A 1 306 ? 6.198   53.821 1.547   1.00 79.75  ? 306 ASP Z C     1 
ATOM   2402 O  O     . ASP A 1 306 ? 5.006   53.959 1.845   1.00 85.35  ? 306 ASP Z O     1 
ATOM   2403 C  CB    . ASP A 1 306 ? 6.747   56.266 1.562   1.00 85.19  ? 306 ASP Z CB    1 
ATOM   2404 C  CG    . ASP A 1 306 ? 7.210   56.221 3.012   1.00 96.74  ? 306 ASP Z CG    1 
ATOM   2405 O  OD1   . ASP A 1 306 ? 8.126   55.430 3.329   1.00 105.15 ? 306 ASP Z OD1   1 
ATOM   2406 O  OD2   . ASP A 1 306 ? 6.661   56.981 3.840   1.00 98.73  ? 306 ASP Z OD2   1 
ATOM   2407 N  N     . PRO A 1 307 ? 6.898   52.711 1.825   1.00 82.24  ? 307 PRO Z N     1 
ATOM   2408 C  CA    . PRO A 1 307 ? 6.322   51.526 2.469   1.00 79.46  ? 307 PRO Z CA    1 
ATOM   2409 C  C     . PRO A 1 307 ? 5.624   51.851 3.786   1.00 80.03  ? 307 PRO Z C     1 
ATOM   2410 O  O     . PRO A 1 307 ? 4.752   51.092 4.207   1.00 76.96  ? 307 PRO Z O     1 
ATOM   2411 C  CB    . PRO A 1 307 ? 7.543   50.630 2.699   1.00 78.50  ? 307 PRO Z CB    1 
ATOM   2412 C  CG    . PRO A 1 307 ? 8.505   51.037 1.643   1.00 82.49  ? 307 PRO Z CG    1 
ATOM   2413 C  CD    . PRO A 1 307 ? 8.316   52.514 1.481   1.00 81.06  ? 307 PRO Z CD    1 
ATOM   2414 N  N     . GLU A 1 308 ? 5.996   52.965 4.412   1.00 80.15  ? 308 GLU Z N     1 
ATOM   2415 C  CA    . GLU A 1 308 ? 5.424   53.369 5.696   1.00 82.09  ? 308 GLU Z CA    1 
ATOM   2416 C  C     . GLU A 1 308 ? 3.932   53.652 5.562   1.00 80.44  ? 308 GLU Z C     1 
ATOM   2417 O  O     . GLU A 1 308 ? 3.172   53.501 6.524   1.00 77.82  ? 308 GLU Z O     1 
ATOM   2418 C  CB    . GLU A 1 308 ? 6.144   54.606 6.245   1.00 85.84  ? 308 GLU Z CB    1 
ATOM   2419 C  CG    . GLU A 1 308 ? 5.664   55.065 7.625   1.00 94.57  ? 308 GLU Z CG    1 
ATOM   2420 C  CD    . GLU A 1 308 ? 6.447   56.265 8.138   1.00 108.15 ? 308 GLU Z CD    1 
ATOM   2421 O  OE1   . GLU A 1 308 ? 7.334   56.762 7.407   1.00 113.35 ? 308 GLU Z OE1   1 
ATOM   2422 O  OE2   . GLU A 1 308 ? 6.165   56.707 9.277   1.00 114.53 ? 308 GLU Z OE2   1 
ATOM   2423 N  N     . THR A 1 309 ? 3.517   54.057 4.364   1.00 74.10  ? 309 THR Z N     1 
ATOM   2424 C  CA    . THR A 1 309 ? 2.122   54.400 4.117   1.00 73.91  ? 309 THR Z CA    1 
ATOM   2425 C  C     . THR A 1 309 ? 1.341   53.240 3.519   1.00 74.66  ? 309 THR Z C     1 
ATOM   2426 O  O     . THR A 1 309 ? 0.293   53.448 2.908   1.00 74.80  ? 309 THR Z O     1 
ATOM   2427 C  CB    . THR A 1 309 ? 1.999   55.604 3.174   1.00 77.77  ? 309 THR Z CB    1 
ATOM   2428 O  OG1   . THR A 1 309 ? 2.506   55.257 1.879   1.00 78.87  ? 309 THR Z OG1   1 
ATOM   2429 C  CG2   . THR A 1 309 ? 2.782   56.770 3.718   1.00 66.69  ? 309 THR Z CG2   1 
ATOM   2430 N  N     . LEU A 1 310 ? 1.849   52.023 3.698   1.00 71.15  ? 310 LEU Z N     1 
ATOM   2431 C  CA    . LEU A 1 310 ? 1.229   50.848 3.095   1.00 68.27  ? 310 LEU Z CA    1 
ATOM   2432 C  C     . LEU A 1 310 ? 0.699   49.851 4.122   1.00 67.91  ? 310 LEU Z C     1 
ATOM   2433 O  O     . LEU A 1 310 ? 0.879   48.644 3.964   1.00 67.46  ? 310 LEU Z O     1 
ATOM   2434 C  CB    . LEU A 1 310 ? 2.225   50.147 2.171   1.00 66.85  ? 310 LEU Z CB    1 
ATOM   2435 C  CG    . LEU A 1 310 ? 2.754   50.980 1.003   1.00 62.95  ? 310 LEU Z CG    1 
ATOM   2436 C  CD1   . LEU A 1 310 ? 3.660   50.136 0.120   1.00 65.14  ? 310 LEU Z CD1   1 
ATOM   2437 C  CD2   . LEU A 1 310 ? 1.611   51.587 0.196   1.00 55.06  ? 310 LEU Z CD2   1 
ATOM   2438 N  N     . SER A 1 311 ? 0.042   50.350 5.167   1.00 70.59  ? 311 SER Z N     1 
ATOM   2439 C  CA    . SER A 1 311 ? -0.524  49.475 6.198   1.00 66.66  ? 311 SER Z CA    1 
ATOM   2440 C  C     . SER A 1 311 ? -1.745  48.730 5.677   1.00 60.66  ? 311 SER Z C     1 
ATOM   2441 O  O     . SER A 1 311 ? -2.002  47.589 6.069   1.00 59.56  ? 311 SER Z O     1 
ATOM   2442 C  CB    . SER A 1 311 ? -0.905  50.271 7.452   1.00 63.98  ? 311 SER Z CB    1 
ATOM   2443 O  OG    . SER A 1 311 ? -1.794  51.332 7.138   1.00 66.93  ? 311 SER Z OG    1 
ATOM   2444 N  N     . TYR A 1 312 ? -2.494  49.383 4.793   1.00 60.69  ? 312 TYR Z N     1 
ATOM   2445 C  CA    . TYR A 1 312 ? -3.706  48.795 4.247   1.00 48.36  ? 312 TYR Z CA    1 
ATOM   2446 C  C     . TYR A 1 312 ? -3.365  47.597 3.395   1.00 52.55  ? 312 TYR Z C     1 
ATOM   2447 O  O     . TYR A 1 312 ? -4.188  46.712 3.192   1.00 59.80  ? 312 TYR Z O     1 
ATOM   2448 C  CB    . TYR A 1 312 ? -4.493  49.820 3.428   1.00 48.82  ? 312 TYR Z CB    1 
ATOM   2449 C  CG    . TYR A 1 312 ? -3.659  50.621 2.461   1.00 56.93  ? 312 TYR Z CG    1 
ATOM   2450 C  CD1   . TYR A 1 312 ? -3.284  50.096 1.238   1.00 54.26  ? 312 TYR Z CD1   1 
ATOM   2451 C  CD2   . TYR A 1 312 ? -3.260  51.911 2.766   1.00 53.43  ? 312 TYR Z CD2   1 
ATOM   2452 C  CE1   . TYR A 1 312 ? -2.525  50.829 0.349   1.00 55.72  ? 312 TYR Z CE1   1 
ATOM   2453 C  CE2   . TYR A 1 312 ? -2.504  52.653 1.884   1.00 55.29  ? 312 TYR Z CE2   1 
ATOM   2454 C  CZ    . TYR A 1 312 ? -2.137  52.106 0.676   1.00 57.87  ? 312 TYR Z CZ    1 
ATOM   2455 O  OH    . TYR A 1 312 ? -1.382  52.838 -0.211  1.00 70.15  ? 312 TYR Z OH    1 
ATOM   2456 N  N     . ALA A 1 313 ? -2.138  47.571 2.901   1.00 58.84  ? 313 ALA Z N     1 
ATOM   2457 C  CA    . ALA A 1 313 ? -1.691  46.483 2.055   1.00 59.88  ? 313 ALA Z CA    1 
ATOM   2458 C  C     . ALA A 1 313 ? -1.171  45.326 2.888   1.00 62.86  ? 313 ALA Z C     1 
ATOM   2459 O  O     . ALA A 1 313 ? -0.644  44.357 2.353   1.00 64.34  ? 313 ALA Z O     1 
ATOM   2460 C  CB    . ALA A 1 313 ? -0.626  46.964 1.107   1.00 55.06  ? 313 ALA Z CB    1 
ATOM   2461 N  N     . GLY A 1 314 ? -1.317  45.428 4.203   1.00 65.10  ? 314 GLY Z N     1 
ATOM   2462 C  CA    . GLY A 1 314 ? -0.872  44.372 5.088   1.00 62.85  ? 314 GLY Z CA    1 
ATOM   2463 C  C     . GLY A 1 314 ? 0.157   44.851 6.085   1.00 61.13  ? 314 GLY Z C     1 
ATOM   2464 O  O     . GLY A 1 314 ? 1.101   45.550 5.735   1.00 58.65  ? 314 GLY Z O     1 
ATOM   2465 N  N     . GLN A 1 315 ? -0.033  44.466 7.338   1.00 65.73  ? 315 GLN Z N     1 
ATOM   2466 C  CA    . GLN A 1 315 ? 0.865   44.855 8.415   1.00 66.03  ? 315 GLN Z CA    1 
ATOM   2467 C  C     . GLN A 1 315 ? 1.973   43.822 8.590   1.00 58.23  ? 315 GLN Z C     1 
ATOM   2468 O  O     . GLN A 1 315 ? 1.723   42.623 8.521   1.00 66.81  ? 315 GLN Z O     1 
ATOM   2469 C  CB    . GLN A 1 315 ? 0.073   45.025 9.715   1.00 78.99  ? 315 GLN Z CB    1 
ATOM   2470 C  CG    . GLN A 1 315 ? 0.904   45.271 10.956  1.00 88.89  ? 315 GLN Z CG    1 
ATOM   2471 C  CD    . GLN A 1 315 ? 0.097   45.083 12.228  1.00 92.21  ? 315 GLN Z CD    1 
ATOM   2472 O  OE1   . GLN A 1 315 ? -0.407  46.046 12.806  1.00 99.10  ? 315 GLN Z OE1   1 
ATOM   2473 N  NE2   . GLN A 1 315 ? -0.032  43.835 12.669  1.00 86.62  ? 315 GLN Z NE2   1 
ATOM   2474 N  N     . TYR A 1 316 ? 3.198   44.288 8.808   1.00 66.64  ? 316 TYR Z N     1 
ATOM   2475 C  CA    . TYR A 1 316 ? 4.319   43.387 9.052   1.00 68.82  ? 316 TYR Z CA    1 
ATOM   2476 C  C     . TYR A 1 316 ? 4.288   42.773 10.447  1.00 71.59  ? 316 TYR Z C     1 
ATOM   2477 O  O     . TYR A 1 316 ? 3.956   43.438 11.429  1.00 79.13  ? 316 TYR Z O     1 
ATOM   2478 C  CB    . TYR A 1 316 ? 5.643   44.120 8.866   1.00 70.85  ? 316 TYR Z CB    1 
ATOM   2479 C  CG    . TYR A 1 316 ? 6.115   44.219 7.438   1.00 70.83  ? 316 TYR Z CG    1 
ATOM   2480 C  CD1   . TYR A 1 316 ? 5.929   45.383 6.705   1.00 68.76  ? 316 TYR Z CD1   1 
ATOM   2481 C  CD2   . TYR A 1 316 ? 6.762   43.155 6.827   1.00 73.59  ? 316 TYR Z CD2   1 
ATOM   2482 C  CE1   . TYR A 1 316 ? 6.369   45.483 5.401   1.00 69.66  ? 316 TYR Z CE1   1 
ATOM   2483 C  CE2   . TYR A 1 316 ? 7.206   43.243 5.521   1.00 69.99  ? 316 TYR Z CE2   1 
ATOM   2484 C  CZ    . TYR A 1 316 ? 7.008   44.411 4.814   1.00 77.57  ? 316 TYR Z CZ    1 
ATOM   2485 O  OH    . TYR A 1 316 ? 7.445   44.512 3.512   1.00 76.56  ? 316 TYR Z OH    1 
ATOM   2486 N  N     . VAL A 1 317 ? 4.640   41.497 10.527  1.00 66.10  ? 317 VAL Z N     1 
ATOM   2487 C  CA    . VAL A 1 317 ? 4.855   40.848 11.811  1.00 69.12  ? 317 VAL Z CA    1 
ATOM   2488 C  C     . VAL A 1 317 ? 6.218   40.155 11.790  1.00 77.96  ? 317 VAL Z C     1 
ATOM   2489 O  O     . VAL A 1 317 ? 6.878   40.101 10.748  1.00 79.97  ? 317 VAL Z O     1 
ATOM   2490 C  CB    . VAL A 1 317 ? 3.739   39.830 12.147  1.00 63.22  ? 317 VAL Z CB    1 
ATOM   2491 C  CG1   . VAL A 1 317 ? 2.385   40.525 12.243  1.00 62.88  ? 317 VAL Z CG1   1 
ATOM   2492 C  CG2   . VAL A 1 317 ? 3.706   38.712 11.123  1.00 61.98  ? 317 VAL Z CG2   1 
ATOM   2493 N  N     . ASP A 1 318 ? 6.647   39.642 12.939  1.00 76.11  ? 318 ASP Z N     1 
ATOM   2494 C  CA    . ASP A 1 318 ? 7.930   38.957 13.024  1.00 73.38  ? 318 ASP Z CA    1 
ATOM   2495 C  C     . ASP A 1 318 ? 7.923   37.702 12.156  1.00 74.24  ? 318 ASP Z C     1 
ATOM   2496 O  O     . ASP A 1 318 ? 6.913   36.999 12.067  1.00 67.79  ? 318 ASP Z O     1 
ATOM   2497 C  CB    . ASP A 1 318 ? 8.259   38.599 14.469  1.00 72.99  ? 318 ASP Z CB    1 
ATOM   2498 C  CG    . ASP A 1 318 ? 9.699   38.178 14.645  1.00 73.04  ? 318 ASP Z CG    1 
ATOM   2499 O  OD1   . ASP A 1 318 ? 10.573  39.069 14.690  1.00 72.59  ? 318 ASP Z OD1   1 
ATOM   2500 O  OD2   . ASP A 1 318 ? 9.957   36.959 14.739  1.00 73.27  ? 318 ASP Z OD2   1 
ATOM   2501 N  N     . ASP A 1 319 ? 9.057   37.433 11.516  1.00 72.88  ? 319 ASP Z N     1 
ATOM   2502 C  CA    . ASP A 1 319 ? 9.159   36.352 10.541  1.00 75.86  ? 319 ASP Z CA    1 
ATOM   2503 C  C     . ASP A 1 319 ? 8.825   34.984 11.132  1.00 72.19  ? 319 ASP Z C     1 
ATOM   2504 O  O     . ASP A 1 319 ? 8.351   34.098 10.420  1.00 68.80  ? 319 ASP Z O     1 
ATOM   2505 C  CB    . ASP A 1 319 ? 10.560  36.324 9.926   1.00 82.03  ? 319 ASP Z CB    1 
ATOM   2506 C  CG    . ASP A 1 319 ? 10.812  37.496 9.002   1.00 82.72  ? 319 ASP Z CG    1 
ATOM   2507 O  OD1   . ASP A 1 319 ? 9.828   38.077 8.494   1.00 72.97  ? 319 ASP Z OD1   1 
ATOM   2508 O  OD2   . ASP A 1 319 ? 11.994  37.835 8.780   1.00 91.01  ? 319 ASP Z OD2   1 
ATOM   2509 N  N     . SER A 1 320 ? 9.070   34.817 12.428  1.00 72.53  ? 320 SER Z N     1 
ATOM   2510 C  CA    . SER A 1 320 ? 8.787   33.555 13.099  1.00 71.47  ? 320 SER Z CA    1 
ATOM   2511 C  C     . SER A 1 320 ? 7.276   33.347 13.195  1.00 67.04  ? 320 SER Z C     1 
ATOM   2512 O  O     . SER A 1 320 ? 6.762   32.235 12.996  1.00 66.57  ? 320 SER Z O     1 
ATOM   2513 C  CB    . SER A 1 320 ? 9.437   33.525 14.489  1.00 75.43  ? 320 SER Z CB    1 
ATOM   2514 O  OG    . SER A 1 320 ? 9.023   34.629 15.276  1.00 77.21  ? 320 SER Z OG    1 
ATOM   2515 N  N     . ILE A 1 321 ? 6.562   34.428 13.478  1.00 64.54  ? 321 ILE Z N     1 
ATOM   2516 C  CA    . ILE A 1 321 ? 5.114   34.359 13.577  1.00 66.51  ? 321 ILE Z CA    1 
ATOM   2517 C  C     . ILE A 1 321 ? 4.497   34.104 12.207  1.00 63.24  ? 321 ILE Z C     1 
ATOM   2518 O  O     . ILE A 1 321 ? 3.577   33.293 12.066  1.00 62.91  ? 321 ILE Z O     1 
ATOM   2519 C  CB    . ILE A 1 321 ? 4.541   35.642 14.175  1.00 71.91  ? 321 ILE Z CB    1 
ATOM   2520 C  CG1   . ILE A 1 321 ? 5.161   35.887 15.548  1.00 73.83  ? 321 ILE Z CG1   1 
ATOM   2521 C  CG2   . ILE A 1 321 ? 3.035   35.543 14.294  1.00 72.56  ? 321 ILE Z CG2   1 
ATOM   2522 C  CD1   . ILE A 1 321 ? 4.694   37.151 16.204  1.00 71.60  ? 321 ILE Z CD1   1 
ATOM   2523 N  N     . ALA A 1 322 ? 5.019   34.792 11.197  1.00 64.42  ? 322 ALA Z N     1 
ATOM   2524 C  CA    . ALA A 1 322 ? 4.563   34.607 9.827   1.00 62.67  ? 322 ALA Z CA    1 
ATOM   2525 C  C     . ALA A 1 322 ? 4.812   33.177 9.362   1.00 63.42  ? 322 ALA Z C     1 
ATOM   2526 O  O     . ALA A 1 322 ? 4.014   32.595 8.631   1.00 60.71  ? 322 ALA Z O     1 
ATOM   2527 C  CB    . ALA A 1 322 ? 5.253   35.588 8.914   1.00 62.57  ? 322 ALA Z CB    1 
ATOM   2528 N  N     . LEU A 1 323 ? 5.933   32.617 9.797   1.00 64.49  ? 323 LEU Z N     1 
ATOM   2529 C  CA    . LEU A 1 323 ? 6.254   31.229 9.509   1.00 64.06  ? 323 LEU Z CA    1 
ATOM   2530 C  C     . LEU A 1 323 ? 5.241   30.300 10.166  1.00 63.63  ? 323 LEU Z C     1 
ATOM   2531 O  O     . LEU A 1 323 ? 4.743   29.372 9.526   1.00 75.25  ? 323 LEU Z O     1 
ATOM   2532 C  CB    . LEU A 1 323 ? 7.670   30.894 9.984   1.00 65.86  ? 323 LEU Z CB    1 
ATOM   2533 C  CG    . LEU A 1 323 ? 8.099   29.430 9.884   1.00 67.31  ? 323 LEU Z CG    1 
ATOM   2534 C  CD1   . LEU A 1 323 ? 7.970   28.954 8.452   1.00 67.12  ? 323 LEU Z CD1   1 
ATOM   2535 C  CD2   . LEU A 1 323 ? 9.522   29.248 10.390  1.00 69.94  ? 323 LEU Z CD2   1 
ATOM   2536 N  N     . GLN A 1 324 ? 4.936   30.555 11.438  1.00 62.71  ? 324 GLN Z N     1 
ATOM   2537 C  CA    . GLN A 1 324 ? 3.994   29.713 12.174  1.00 62.29  ? 324 GLN Z CA    1 
ATOM   2538 C  C     . GLN A 1 324 ? 2.585   29.778 11.595  1.00 60.43  ? 324 GLN Z C     1 
ATOM   2539 O  O     . GLN A 1 324 ? 1.840   28.801 11.653  1.00 60.18  ? 324 GLN Z O     1 
ATOM   2540 C  CB    . GLN A 1 324 ? 3.965   30.101 13.653  1.00 63.73  ? 324 GLN Z CB    1 
ATOM   2541 C  CG    . GLN A 1 324 ? 5.224   29.714 14.409  1.00 65.13  ? 324 GLN Z CG    1 
ATOM   2542 C  CD    . GLN A 1 324 ? 5.595   28.252 14.221  1.00 66.25  ? 324 GLN Z CD    1 
ATOM   2543 O  OE1   . GLN A 1 324 ? 4.749   27.361 14.324  1.00 65.70  ? 324 GLN Z OE1   1 
ATOM   2544 N  NE2   . GLN A 1 324 ? 6.867   28.000 13.937  1.00 68.03  ? 324 GLN Z NE2   1 
ATOM   2545 N  N     . ILE A 1 325 ? 2.226   30.935 11.045  1.00 59.91  ? 325 ILE Z N     1 
ATOM   2546 C  CA    . ILE A 1 325 ? 0.948   31.098 10.352  1.00 62.29  ? 325 ILE Z CA    1 
ATOM   2547 C  C     . ILE A 1 325 ? 0.946   30.332 9.033   1.00 61.54  ? 325 ILE Z C     1 
ATOM   2548 O  O     . ILE A 1 325 ? -0.004  29.612 8.718   1.00 61.14  ? 325 ILE Z O     1 
ATOM   2549 C  CB    . ILE A 1 325 ? 0.640   32.580 10.066  1.00 62.61  ? 325 ILE Z CB    1 
ATOM   2550 C  CG1   . ILE A 1 325 ? 0.281   33.307 11.360  1.00 58.00  ? 325 ILE Z CG1   1 
ATOM   2551 C  CG2   . ILE A 1 325 ? -0.492  32.711 9.066   1.00 56.30  ? 325 ILE Z CG2   1 
ATOM   2552 C  CD1   . ILE A 1 325 ? -0.118  34.757 11.158  1.00 56.73  ? 325 ILE Z CD1   1 
ATOM   2553 N  N     . ALA A 1 326 ? 2.025   30.491 8.272   1.00 62.32  ? 326 ALA Z N     1 
ATOM   2554 C  CA    . ALA A 1 326 ? 2.157   29.849 6.975   1.00 61.46  ? 326 ALA Z CA    1 
ATOM   2555 C  C     . ALA A 1 326 ? 2.103   28.340 7.091   1.00 64.99  ? 326 ALA Z C     1 
ATOM   2556 O  O     . ALA A 1 326 ? 1.555   27.671 6.228   1.00 64.05  ? 326 ALA Z O     1 
ATOM   2557 C  CB    . ALA A 1 326 ? 3.447   30.276 6.309   1.00 60.35  ? 326 ALA Z CB    1 
ATOM   2558 N  N     . LEU A 1 327 ? 2.673   27.805 8.161   1.00 61.93  ? 327 LEU Z N     1 
ATOM   2559 C  CA    . LEU A 1 327 ? 2.663   26.363 8.374   1.00 68.73  ? 327 LEU Z CA    1 
ATOM   2560 C  C     . LEU A 1 327 ? 1.283   25.885 8.827   1.00 69.50  ? 327 LEU Z C     1 
ATOM   2561 O  O     . LEU A 1 327 ? 0.980   24.689 8.796   1.00 72.64  ? 327 LEU Z O     1 
ATOM   2562 C  CB    . LEU A 1 327 ? 3.729   25.965 9.396   1.00 69.94  ? 327 LEU Z CB    1 
ATOM   2563 C  CG    . LEU A 1 327 ? 5.186   26.207 8.993   1.00 69.45  ? 327 LEU Z CG    1 
ATOM   2564 C  CD1   . LEU A 1 327 ? 6.135   25.777 10.105  1.00 70.18  ? 327 LEU Z CD1   1 
ATOM   2565 C  CD2   . LEU A 1 327 ? 5.513   25.483 7.697   1.00 68.14  ? 327 LEU Z CD2   1 
ATOM   2566 N  N     . GLY A 1 328 ? 0.445   26.830 9.239   1.00 66.80  ? 328 GLY Z N     1 
ATOM   2567 C  CA    . GLY A 1 328 ? -0.899  26.510 9.672   1.00 66.90  ? 328 GLY Z CA    1 
ATOM   2568 C  C     . GLY A 1 328 ? -0.956  26.212 11.150  1.00 70.32  ? 328 GLY Z C     1 
ATOM   2569 O  O     . GLY A 1 328 ? -2.016  25.862 11.661  1.00 73.21  ? 328 GLY Z O     1 
ATOM   2570 N  N     . ASN A 1 329 ? 0.183   26.353 11.831  1.00 65.18  ? 329 ASN Z N     1 
ATOM   2571 C  CA    . ASN A 1 329 ? 0.286   26.092 13.268  1.00 66.90  ? 329 ASN Z CA    1 
ATOM   2572 C  C     . ASN A 1 329 ? -0.433  27.143 14.106  1.00 71.24  ? 329 ASN Z C     1 
ATOM   2573 O  O     . ASN A 1 329 ? -1.022  26.831 15.141  1.00 78.83  ? 329 ASN Z O     1 
ATOM   2574 C  CB    . ASN A 1 329 ? 1.757   26.017 13.701  1.00 67.65  ? 329 ASN Z CB    1 
ATOM   2575 C  CG    . ASN A 1 329 ? 2.471   24.791 13.153  1.00 69.66  ? 329 ASN Z CG    1 
ATOM   2576 O  OD1   . ASN A 1 329 ? 1.842   23.781 12.837  1.00 71.64  ? 329 ASN Z OD1   1 
ATOM   2577 N  ND2   . ASN A 1 329 ? 3.794   24.873 13.045  1.00 62.69  ? 329 ASN Z ND2   1 
ATOM   2578 N  N     . LYS A 1 330 ? -0.378  28.390 13.658  1.00 69.58  ? 330 LYS Z N     1 
ATOM   2579 C  CA    . LYS A 1 330 ? -1.036  29.476 14.371  1.00 65.10  ? 330 LYS Z CA    1 
ATOM   2580 C  C     . LYS A 1 330 ? -2.366  29.832 13.717  1.00 60.01  ? 330 LYS Z C     1 
ATOM   2581 O  O     . LYS A 1 330 ? -2.431  30.108 12.515  1.00 60.27  ? 330 LYS Z O     1 
ATOM   2582 C  CB    . LYS A 1 330 ? -0.127  30.706 14.437  1.00 63.13  ? 330 LYS Z CB    1 
ATOM   2583 C  CG    . LYS A 1 330 ? -0.756  31.910 15.127  1.00 70.18  ? 330 LYS Z CG    1 
ATOM   2584 C  CD    . LYS A 1 330 ? 0.260   33.019 15.338  1.00 73.81  ? 330 LYS Z CD    1 
ATOM   2585 C  CE    . LYS A 1 330 ? 1.303   32.628 16.375  1.00 75.69  ? 330 LYS Z CE    1 
ATOM   2586 N  NZ    . LYS A 1 330 ? 0.690   32.385 17.713  1.00 81.32  ? 330 LYS Z NZ    1 
ATOM   2587 N  N     . ASP A 1 331 ? -3.428  29.813 14.517  1.00 65.98  ? 331 ASP Z N     1 
ATOM   2588 C  CA    . ASP A 1 331 ? -4.762  30.132 14.028  1.00 72.90  ? 331 ASP Z CA    1 
ATOM   2589 C  C     . ASP A 1 331 ? -4.842  31.599 13.650  1.00 77.23  ? 331 ASP Z C     1 
ATOM   2590 O  O     . ASP A 1 331 ? -4.245  32.449 14.306  1.00 77.27  ? 331 ASP Z O     1 
ATOM   2591 C  CB    . ASP A 1 331 ? -5.824  29.797 15.076  1.00 76.48  ? 331 ASP Z CB    1 
ATOM   2592 C  CG    . ASP A 1 331 ? -7.238  30.034 14.569  1.00 86.48  ? 331 ASP Z CG    1 
ATOM   2593 O  OD1   . ASP A 1 331 ? -7.800  31.117 14.839  1.00 93.12  ? 331 ASP Z OD1   1 
ATOM   2594 O  OD2   . ASP A 1 331 ? -7.787  29.137 13.895  1.00 86.07  ? 331 ASP Z OD2   1 
ATOM   2595 N  N     . ILE A 1 332 ? -5.590  31.890 12.593  1.00 77.12  ? 332 ILE Z N     1 
ATOM   2596 C  CA    . ILE A 1 332 ? -5.673  33.242 12.051  1.00 81.69  ? 332 ILE Z CA    1 
ATOM   2597 C  C     . ILE A 1 332 ? -6.279  34.254 13.025  1.00 94.20  ? 332 ILE Z C     1 
ATOM   2598 O  O     . ILE A 1 332 ? -5.692  35.307 13.280  1.00 103.90 ? 332 ILE Z O     1 
ATOM   2599 C  CB    . ILE A 1 332 ? -6.499  33.263 10.750  1.00 79.20  ? 332 ILE Z CB    1 
ATOM   2600 C  CG1   . ILE A 1 332 ? -5.845  32.377 9.683   1.00 71.31  ? 332 ILE Z CG1   1 
ATOM   2601 C  CG2   . ILE A 1 332 ? -6.681  34.691 10.255  1.00 82.15  ? 332 ILE Z CG2   1 
ATOM   2602 C  CD1   . ILE A 1 332 ? -4.376  32.661 9.471   1.00 62.80  ? 332 ILE Z CD1   1 
ATOM   2603 N  N     . ASN A 1 333 ? -7.448  33.929 13.571  1.00 91.32  ? 333 ASN Z N     1 
ATOM   2604 C  CA    . ASN A 1 333 ? -8.205  34.868 14.398  1.00 91.54  ? 333 ASN Z CA    1 
ATOM   2605 C  C     . ASN A 1 333 ? -7.725  34.938 15.842  1.00 96.95  ? 333 ASN Z C     1 
ATOM   2606 O  O     . ASN A 1 333 ? -7.458  36.016 16.378  1.00 100.00 ? 333 ASN Z O     1 
ATOM   2607 C  CB    . ASN A 1 333 ? -9.681  34.491 14.367  1.00 93.82  ? 333 ASN Z CB    1 
ATOM   2608 C  CG    . ASN A 1 333 ? -10.127 34.048 12.993  1.00 93.40  ? 333 ASN Z CG    1 
ATOM   2609 O  OD1   . ASN A 1 333 ? -10.083 32.858 12.665  1.00 87.82  ? 333 ASN Z OD1   1 
ATOM   2610 N  ND2   . ASN A 1 333 ? -10.539 35.007 12.166  1.00 96.66  ? 333 ASN Z ND2   1 
ATOM   2611 N  N     . THR A 1 334 ? -7.618  33.775 16.468  1.00 91.23  ? 334 THR Z N     1 
ATOM   2612 C  CA    . THR A 1 334 ? -7.256  33.703 17.873  1.00 93.46  ? 334 THR Z CA    1 
ATOM   2613 C  C     . THR A 1 334 ? -5.758  33.884 18.091  1.00 85.49  ? 334 THR Z C     1 
ATOM   2614 O  O     . THR A 1 334 ? -5.325  34.116 19.217  1.00 89.12  ? 334 THR Z O     1 
ATOM   2615 C  CB    . THR A 1 334 ? -7.695  32.359 18.494  1.00 99.34  ? 334 THR Z CB    1 
ATOM   2616 O  OG1   . THR A 1 334 ? -7.001  31.280 17.854  1.00 97.49  ? 334 THR Z OG1   1 
ATOM   2617 C  CG2   . THR A 1 334 ? -9.195  32.156 18.326  1.00 106.64 ? 334 THR Z CG2   1 
ATOM   2618 N  N     . PHE A 1 335 ? -4.991  33.712 17.039  1.00 82.85  ? 335 PHE Z N     1 
ATOM   2619 C  CA    . PHE A 1 335 ? -3.550  33.779 17.117  1.00 77.66  ? 335 PHE Z CA    1 
ATOM   2620 C  C     . PHE A 1 335 ? -3.017  32.754 18.059  1.00 78.46  ? 335 PHE Z C     1 
ATOM   2621 O  O     . PHE A 1 335 ? -1.995  32.941 18.662  1.00 81.36  ? 335 PHE Z O     1 
ATOM   2622 C  CB    . PHE A 1 335 ? -3.095  35.146 17.549  1.00 74.99  ? 335 PHE Z CB    1 
ATOM   2623 C  CG    . PHE A 1 335 ? -2.285  35.838 16.525  1.00 72.12  ? 335 PHE Z CG    1 
ATOM   2624 C  CD1   . PHE A 1 335 ? -2.810  36.101 15.294  1.00 68.95  ? 335 PHE Z CD1   1 
ATOM   2625 C  CD2   . PHE A 1 335 ? -0.999  36.201 16.784  1.00 71.69  ? 335 PHE Z CD2   1 
ATOM   2626 C  CE1   . PHE A 1 335 ? -2.067  36.732 14.336  1.00 67.43  ? 335 PHE Z CE1   1 
ATOM   2627 C  CE2   . PHE A 1 335 ? -0.245  36.834 15.833  1.00 68.56  ? 335 PHE Z CE2   1 
ATOM   2628 C  CZ    . PHE A 1 335 ? -0.780  37.098 14.606  1.00 66.27  ? 335 PHE Z CZ    1 
ATOM   2629 N  N     . GLU A 1 336 ? -3.709  31.640 18.127  1.00 77.08  ? 336 GLU Z N     1 
ATOM   2630 C  CA    . GLU A 1 336 ? -3.418  30.585 19.083  1.00 78.44  ? 336 GLU Z CA    1 
ATOM   2631 C  C     . GLU A 1 336 ? -2.740  29.413 18.399  1.00 74.21  ? 336 GLU Z C     1 
ATOM   2632 O  O     . GLU A 1 336 ? -3.154  29.006 17.320  1.00 76.65  ? 336 GLU Z O     1 
ATOM   2633 C  CB    . GLU A 1 336 ? -4.714  30.133 19.763  1.00 88.47  ? 336 GLU Z CB    1 
ATOM   2634 C  CG    . GLU A 1 336 ? -4.660  28.758 20.423  1.00 98.30  ? 336 GLU Z CG    1 
ATOM   2635 C  CD    . GLU A 1 336 ? -6.048  28.170 20.654  1.00 103.27 ? 336 GLU Z CD    1 
ATOM   2636 O  OE1   . GLU A 1 336 ? -6.187  27.297 21.544  1.00 105.67 ? 336 GLU Z OE1   1 
ATOM   2637 O  OE2   . GLU A 1 336 ? -6.997  28.579 19.937  1.00 98.92  ? 336 GLU Z OE2   1 
ATOM   2638 N  N     . GLN A 1 337 ? -1.701  28.873 19.023  1.00 70.00  ? 337 GLN Z N     1 
ATOM   2639 C  CA    . GLN A 1 337 ? -1.050  27.676 18.500  1.00 70.45  ? 337 GLN Z CA    1 
ATOM   2640 C  C     . GLN A 1 337 ? -1.988  26.474 18.542  1.00 78.30  ? 337 GLN Z C     1 
ATOM   2641 O  O     . GLN A 1 337 ? -2.306  25.967 19.618  1.00 86.77  ? 337 GLN Z O     1 
ATOM   2642 C  CB    . GLN A 1 337 ? 0.217   27.366 19.289  1.00 64.56  ? 337 GLN Z CB    1 
ATOM   2643 C  CG    . GLN A 1 337 ? 1.293   28.413 19.135  1.00 70.50  ? 337 GLN Z CG    1 
ATOM   2644 C  CD    . GLN A 1 337 ? 1.889   28.426 17.747  1.00 68.68  ? 337 GLN Z CD    1 
ATOM   2645 O  OE1   . GLN A 1 337 ? 2.197   29.486 17.202  1.00 67.12  ? 337 GLN Z OE1   1 
ATOM   2646 N  NE2   . GLN A 1 337 ? 2.065   27.243 17.169  1.00 65.15  ? 337 GLN Z NE2   1 
ATOM   2647 N  N     . ILE A 1 338 ? -2.421  26.016 17.370  1.00 76.71  ? 338 ILE Z N     1 
ATOM   2648 C  CA    . ILE A 1 338 ? -3.361  24.904 17.282  1.00 75.90  ? 338 ILE Z CA    1 
ATOM   2649 C  C     . ILE A 1 338 ? -2.705  23.629 16.754  1.00 76.52  ? 338 ILE Z C     1 
ATOM   2650 O  O     . ILE A 1 338 ? -3.332  22.574 16.714  1.00 80.54  ? 338 ILE Z O     1 
ATOM   2651 C  CB    . ILE A 1 338 ? -4.543  25.262 16.382  1.00 73.71  ? 338 ILE Z CB    1 
ATOM   2652 C  CG1   . ILE A 1 338 ? -4.034  25.642 14.992  1.00 74.39  ? 338 ILE Z CG1   1 
ATOM   2653 C  CG2   . ILE A 1 338 ? -5.342  26.401 16.992  1.00 64.81  ? 338 ILE Z CG2   1 
ATOM   2654 C  CD1   . ILE A 1 338 ? -5.110  26.129 14.048  1.00 81.40  ? 338 ILE Z CD1   1 
ATOM   2655 N  N     . ASP A 1 339 ? -1.447  23.741 16.362  1.00 74.93  ? 339 ASP Z N     1 
ATOM   2656 C  CA    . ASP A 1 339 ? -0.696  22.614 15.873  1.00 71.81  ? 339 ASP Z CA    1 
ATOM   2657 C  C     . ASP A 1 339 ? 0.784   22.831 16.043  1.00 71.45  ? 339 ASP Z C     1 
ATOM   2658 O  O     . ASP A 1 339 ? 1.225   23.928 16.282  1.00 69.39  ? 339 ASP Z O     1 
ATOM   2659 C  CB    . ASP A 1 339 ? -1.011  22.346 14.423  1.00 80.73  ? 339 ASP Z CB    1 
ATOM   2660 C  CG    . ASP A 1 339 ? -0.742  20.930 14.031  1.00 95.11  ? 339 ASP Z CG    1 
ATOM   2661 O  OD1   . ASP A 1 339 ? -1.551  20.056 14.340  1.00 99.81  ? 339 ASP Z OD1   1 
ATOM   2662 O  OD2   . ASP A 1 339 ? 0.283   20.681 13.404  1.00 102.80 ? 339 ASP Z OD2   1 
ATOM   2663 N  N     . ASP A 1 340 ? 1.549   21.759 15.957  1.00 110.51 ? 340 ASP Z N     1 
ATOM   2664 C  CA    . ASP A 1 340 ? 2.970   21.822 16.221  1.00 110.94 ? 340 ASP Z CA    1 
ATOM   2665 C  C     . ASP A 1 340 ? 3.884   21.492 15.065  1.00 111.15 ? 340 ASP Z C     1 
ATOM   2666 O  O     . ASP A 1 340 ? 5.048   21.242 15.281  1.00 111.70 ? 340 ASP Z O     1 
ATOM   2667 C  CB    . ASP A 1 340 ? 3.311   20.897 17.372  1.00 111.67 ? 340 ASP Z CB    1 
ATOM   2668 C  CG    . ASP A 1 340 ? 2.688   19.548 17.222  1.00 112.04 ? 340 ASP Z CG    1 
ATOM   2669 O  OD1   . ASP A 1 340 ? 2.056   19.084 18.179  1.00 112.32 ? 340 ASP Z OD1   1 
ATOM   2670 O  OD2   . ASP A 1 340 ? 2.825   18.946 16.148  1.00 112.15 ? 340 ASP Z OD2   1 
ATOM   2671 N  N     . TYR A 1 341 ? 3.396   21.499 13.842  1.00 110.83 ? 341 TYR Z N     1 
ATOM   2672 C  CA    . TYR A 1 341 ? 4.141   20.895 12.750  1.00 111.22 ? 341 TYR Z CA    1 
ATOM   2673 C  C     . TYR A 1 341 ? 5.524   21.477 12.556  1.00 111.45 ? 341 TYR Z C     1 
ATOM   2674 O  O     . TYR A 1 341 ? 5.710   22.671 12.666  1.00 111.09 ? 341 TYR Z O     1 
ATOM   2675 C  CB    . TYR A 1 341 ? 3.363   21.075 11.465  1.00 110.86 ? 341 TYR Z CB    1 
ATOM   2676 C  CG    . TYR A 1 341 ? 4.054   20.553 10.245  1.00 111.30 ? 341 TYR Z CG    1 
ATOM   2677 C  CD1   . TYR A 1 341 ? 3.635   19.396 9.638   1.00 111.72 ? 341 TYR Z CD1   1 
ATOM   2678 C  CD2   . TYR A 1 341 ? 5.106   21.230 9.688   1.00 111.39 ? 341 TYR Z CD2   1 
ATOM   2679 C  CE1   . TYR A 1 341 ? 4.255   18.923 8.515   1.00 112.24 ? 341 TYR Z CE1   1 
ATOM   2680 C  CE2   . TYR A 1 341 ? 5.729   20.761 8.563   1.00 111.89 ? 341 TYR Z CE2   1 
ATOM   2681 C  CZ    . TYR A 1 341 ? 5.294   19.608 7.988   1.00 112.32 ? 341 TYR Z CZ    1 
ATOM   2682 O  OH    . TYR A 1 341 ? 5.921   19.140 6.875   1.00 112.93 ? 341 TYR Z OH    1 
ATOM   2683 N  N     . ASN A 1 342 ? 6.501   20.614 12.284  1.00 112.19 ? 342 ASN Z N     1 
ATOM   2684 C  CA    . ASN A 1 342 ? 7.850   21.061 11.961  1.00 112.54 ? 342 ASN Z CA    1 
ATOM   2685 C  C     . ASN A 1 342 ? 8.407   20.244 10.799  1.00 113.14 ? 342 ASN Z C     1 
ATOM   2686 O  O     . ASN A 1 342 ? 8.624   19.038 10.935  1.00 113.90 ? 342 ASN Z O     1 
ATOM   2687 C  CB    . ASN A 1 342 ? 8.769   20.950 13.181  1.00 113.14 ? 342 ASN Z CB    1 
ATOM   2688 C  CG    . ASN A 1 342 ? 10.038  21.777 13.035  1.00 113.39 ? 342 ASN Z CG    1 
ATOM   2689 O  OD1   . ASN A 1 342 ? 10.651  21.814 11.968  1.00 114.22 ? 342 ASN Z OD1   1 
ATOM   2690 N  ND2   . ASN A 1 342 ? 10.430  22.453 14.109  1.00 113.46 ? 342 ASN Z ND2   1 
ATOM   2691 N  N     . PRO A 1 343 ? 8.635   20.903 9.647   1.00 112.94 ? 343 PRO Z N     1 
ATOM   2692 C  CA    . PRO A 1 343 ? 9.100   20.241 8.417   1.00 113.53 ? 343 PRO Z CA    1 
ATOM   2693 C  C     . PRO A 1 343 ? 10.554  19.760 8.502   1.00 114.51 ? 343 PRO Z C     1 
ATOM   2694 O  O     . PRO A 1 343 ? 10.944  18.821 7.801   1.00 115.31 ? 343 PRO Z O     1 
ATOM   2695 C  CB    . PRO A 1 343 ? 8.946   21.337 7.352   1.00 113.06 ? 343 PRO Z CB    1 
ATOM   2696 C  CG    . PRO A 1 343 ? 9.085   22.615 8.112   1.00 112.53 ? 343 PRO Z CG    1 
ATOM   2697 C  CD    . PRO A 1 343 ? 8.445   22.354 9.455   1.00 112.25 ? 343 PRO Z CD    1 
ATOM   2698 N  N     . ASP A 1 344 ? 11.339  20.400 9.364   1.00 114.57 ? 344 ASP Z N     1 
ATOM   2699 C  CA    . ASP A 1 344 ? 12.738  20.029 9.556   1.00 116.43 ? 344 ASP Z CA    1 
ATOM   2700 C  C     . ASP A 1 344 ? 12.872  18.609 10.142  1.00 116.56 ? 344 ASP Z C     1 
ATOM   2701 O  O     . ASP A 1 344 ? 13.732  17.824 9.720   1.00 121.11 ? 344 ASP Z O     1 
ATOM   2702 C  CB    . ASP A 1 344 ? 13.431  21.058 10.459  1.00 117.20 ? 344 ASP Z CB    1 
ATOM   2703 C  CG    . ASP A 1 344 ? 13.339  22.480 9.912   1.00 114.72 ? 344 ASP Z CG    1 
ATOM   2704 O  OD1   . ASP A 1 344 ? 13.403  22.653 8.672   1.00 114.70 ? 344 ASP Z OD1   1 
ATOM   2705 O  OD2   . ASP A 1 344 ? 13.203  23.423 10.724  1.00 114.27 ? 344 ASP Z OD2   1 
ATOM   2706 N  N     . THR A 1 345 ? 12.007  18.282 11.099  1.00 117.11 ? 345 THR Z N     1 
ATOM   2707 C  CA    . THR A 1 345 ? 12.012  16.964 11.722  1.00 119.54 ? 345 THR Z CA    1 
ATOM   2708 C  C     . THR A 1 345 ? 11.264  15.931 10.869  1.00 121.18 ? 345 THR Z C     1 
ATOM   2709 O  O     . THR A 1 345 ? 11.835  15.314 9.962   1.00 124.45 ? 345 THR Z O     1 
ATOM   2710 C  CB    . THR A 1 345 ? 11.387  17.021 13.131  1.00 119.49 ? 345 THR Z CB    1 
ATOM   2711 O  OG1   . THR A 1 345 ? 10.034  17.483 13.038  1.00 119.34 ? 345 THR Z OG1   1 
ATOM   2712 C  CG2   . THR A 1 345 ? 12.173  17.977 14.029  1.00 118.51 ? 345 THR Z CG2   1 
ATOM   2713 N  N     . LEU A 1 355 ? 9.136   21.866 -0.392  1.00 101.22 ? 355 LEU Z N     1 
ATOM   2714 C  CA    . LEU A 1 355 ? 8.846   23.276 -0.645  1.00 104.15 ? 355 LEU Z CA    1 
ATOM   2715 C  C     . LEU A 1 355 ? 9.796   24.177 0.116   1.00 109.15 ? 355 LEU Z C     1 
ATOM   2716 O  O     . LEU A 1 355 ? 10.191  25.237 -0.372  1.00 110.24 ? 355 LEU Z O     1 
ATOM   2717 C  CB    . LEU A 1 355 ? 7.408   23.620 -0.255  1.00 96.54  ? 355 LEU Z CB    1 
ATOM   2718 C  CG    . LEU A 1 355 ? 7.052   25.112 -0.281  1.00 85.91  ? 355 LEU Z CG    1 
ATOM   2719 C  CD1   . LEU A 1 355 ? 7.268   25.694 -1.672  1.00 87.62  ? 355 LEU Z CD1   1 
ATOM   2720 C  CD2   . LEU A 1 355 ? 5.622   25.340 0.180   1.00 77.91  ? 355 LEU Z CD2   1 
ATOM   2721 N  N     . TYR A 1 356 ? 10.151  23.750 1.321   1.00 111.35 ? 356 TYR Z N     1 
ATOM   2722 C  CA    . TYR A 1 356 ? 11.030  24.530 2.184   1.00 112.82 ? 356 TYR Z CA    1 
ATOM   2723 C  C     . TYR A 1 356 ? 12.500  24.106 2.043   1.00 117.03 ? 356 TYR Z C     1 
ATOM   2724 O  O     . TYR A 1 356 ? 12.803  22.918 1.872   1.00 116.30 ? 356 TYR Z O     1 
ATOM   2725 C  CB    . TYR A 1 356 ? 10.564  24.410 3.634   1.00 107.90 ? 356 TYR Z CB    1 
ATOM   2726 C  CG    . TYR A 1 356 ? 9.124   24.847 3.821   1.00 101.26 ? 356 TYR Z CG    1 
ATOM   2727 C  CD1   . TYR A 1 356 ? 8.806   26.186 4.036   1.00 99.55  ? 356 TYR Z CD1   1 
ATOM   2728 C  CD2   . TYR A 1 356 ? 8.083   23.925 3.769   1.00 96.98  ? 356 TYR Z CD2   1 
ATOM   2729 C  CE1   . TYR A 1 356 ? 7.495   26.593 4.203   1.00 96.74  ? 356 TYR Z CE1   1 
ATOM   2730 C  CE2   . TYR A 1 356 ? 6.769   24.323 3.934   1.00 94.10  ? 356 TYR Z CE2   1 
ATOM   2731 C  CZ    . TYR A 1 356 ? 6.480   25.658 4.150   1.00 92.01  ? 356 TYR Z CZ    1 
ATOM   2732 O  OH    . TYR A 1 356 ? 5.173   26.059 4.314   1.00 86.02  ? 356 TYR Z OH    1 
ATOM   2733 N  N     . PHE A 1 357 ? 13.396  25.094 2.105   1.00 117.95 ? 357 PHE Z N     1 
ATOM   2734 C  CA    . PHE A 1 357 ? 14.832  24.895 1.882   1.00 119.82 ? 357 PHE Z CA    1 
ATOM   2735 C  C     . PHE A 1 357 ? 15.120  24.323 0.488   1.00 122.45 ? 357 PHE Z C     1 
ATOM   2736 O  O     . PHE A 1 357 ? 15.621  25.024 -0.400  1.00 122.68 ? 357 PHE Z O     1 
ATOM   2737 C  CB    . PHE A 1 357 ? 15.429  23.986 2.972   1.00 118.39 ? 357 PHE Z CB    1 
ATOM   2738 O  "O5'" . DC  B 2 1   ? -28.395 44.517 -31.783 1.00 141.87 ? 1   DC  A "O5'" 1 
ATOM   2739 C  "C5'" . DC  B 2 1   ? -28.478 45.829 -31.238 1.00 140.34 ? 1   DC  A "C5'" 1 
ATOM   2740 C  "C4'" . DC  B 2 1   ? -27.092 46.400 -30.954 1.00 136.56 ? 1   DC  A "C4'" 1 
ATOM   2741 O  "O4'" . DC  B 2 1   ? -27.225 47.595 -30.141 1.00 134.73 ? 1   DC  A "O4'" 1 
ATOM   2742 C  "C3'" . DC  B 2 1   ? -26.157 45.487 -30.174 1.00 133.16 ? 1   DC  A "C3'" 1 
ATOM   2743 O  "O3'" . DC  B 2 1   ? -24.779 45.763 -30.516 1.00 131.14 ? 1   DC  A "O3'" 1 
ATOM   2744 C  "C2'" . DC  B 2 1   ? -26.470 45.843 -28.722 1.00 130.57 ? 1   DC  A "C2'" 1 
ATOM   2745 C  "C1'" . DC  B 2 1   ? -26.859 47.321 -28.799 1.00 131.11 ? 1   DC  A "C1'" 1 
ATOM   2746 N  N1    . DC  B 2 1   ? -28.012 47.658 -27.925 1.00 131.63 ? 1   DC  A N1    1 
ATOM   2747 C  C2    . DC  B 2 1   ? -27.872 48.636 -26.931 1.00 129.24 ? 1   DC  A C2    1 
ATOM   2748 O  O2    . DC  B 2 1   ? -26.785 49.220 -26.798 1.00 126.70 ? 1   DC  A O2    1 
ATOM   2749 N  N3    . DC  B 2 1   ? -28.938 48.919 -26.141 1.00 129.98 ? 1   DC  A N3    1 
ATOM   2750 C  C4    . DC  B 2 1   ? -30.095 48.267 -26.317 1.00 132.90 ? 1   DC  A C4    1 
ATOM   2751 N  N4    . DC  B 2 1   ? -31.119 48.578 -25.515 1.00 133.69 ? 1   DC  A N4    1 
ATOM   2752 C  C5    . DC  B 2 1   ? -30.251 47.265 -27.322 1.00 135.36 ? 1   DC  A C5    1 
ATOM   2753 C  C6    . DC  B 2 1   ? -29.197 46.994 -28.091 1.00 134.64 ? 1   DC  A C6    1 
ATOM   2754 P  P     . DG  B 2 2   ? -23.568 44.984 -29.781 1.00 130.02 ? 2   DG  A P     1 
ATOM   2755 O  OP1   . DG  B 2 2   ? -22.439 44.885 -30.747 1.00 127.75 ? 2   DG  A OP1   1 
ATOM   2756 O  OP2   . DG  B 2 2   ? -24.106 43.743 -29.159 1.00 127.89 ? 2   DG  A OP2   1 
ATOM   2757 O  "O5'" . DG  B 2 2   ? -23.156 45.982 -28.602 1.00 128.80 ? 2   DG  A "O5'" 1 
ATOM   2758 C  "C5'" . DG  B 2 2   ? -23.010 47.364 -28.870 1.00 123.94 ? 2   DG  A "C5'" 1 
ATOM   2759 C  "C4'" . DG  B 2 2   ? -22.537 48.083 -27.633 1.00 120.54 ? 2   DG  A "C4'" 1 
ATOM   2760 O  "O4'" . DG  B 2 2   ? -23.671 48.383 -26.781 1.00 120.89 ? 2   DG  A "O4'" 1 
ATOM   2761 C  "C3'" . DG  B 2 2   ? -21.555 47.292 -26.780 1.00 117.59 ? 2   DG  A "C3'" 1 
ATOM   2762 O  "O3'" . DG  B 2 2   ? -20.555 48.167 -26.292 1.00 114.92 ? 2   DG  A "O3'" 1 
ATOM   2763 C  "C2'" . DG  B 2 2   ? -22.430 46.723 -25.656 1.00 117.32 ? 2   DG  A "C2'" 1 
ATOM   2764 C  "C1'" . DG  B 2 2   ? -23.492 47.807 -25.498 1.00 121.18 ? 2   DG  A "C1'" 1 
ATOM   2765 N  N9    . DG  B 2 2   ? -24.798 47.308 -25.037 1.00 120.19 ? 2   DG  A N9    1 
ATOM   2766 C  C8    . DG  B 2 2   ? -25.527 46.275 -25.584 1.00 122.76 ? 2   DG  A C8    1 
ATOM   2767 N  N7    . DG  B 2 2   ? -26.664 46.058 -24.983 1.00 123.98 ? 2   DG  A N7    1 
ATOM   2768 C  C5    . DG  B 2 2   ? -26.702 47.011 -23.975 1.00 122.15 ? 2   DG  A C5    1 
ATOM   2769 C  C6    . DG  B 2 2   ? -27.694 47.258 -23.007 1.00 122.55 ? 2   DG  A C6    1 
ATOM   2770 O  O6    . DG  B 2 2   ? -28.770 46.659 -22.847 1.00 124.64 ? 2   DG  A O6    1 
ATOM   2771 N  N1    . DG  B 2 2   ? -27.344 48.317 -22.167 1.00 120.43 ? 2   DG  A N1    1 
ATOM   2772 C  C2    . DG  B 2 2   ? -26.179 49.048 -22.256 1.00 118.20 ? 2   DG  A C2    1 
ATOM   2773 N  N2    . DG  B 2 2   ? -26.021 50.034 -21.349 1.00 116.58 ? 2   DG  A N2    1 
ATOM   2774 N  N3    . DG  B 2 2   ? -25.235 48.827 -23.169 1.00 117.77 ? 2   DG  A N3    1 
ATOM   2775 C  C4    . DG  B 2 2   ? -25.564 47.796 -23.993 1.00 119.82 ? 2   DG  A C4    1 
ATOM   2776 P  P     . DC  B 2 3   ? -19.363 47.618 -25.368 1.00 111.85 ? 3   DC  A P     1 
ATOM   2777 O  OP1   . DC  B 2 3   ? -18.154 48.432 -25.664 1.00 110.35 ? 3   DC  A OP1   1 
ATOM   2778 O  OP2   . DC  B 2 3   ? -19.303 46.144 -25.536 1.00 112.62 ? 3   DC  A OP2   1 
ATOM   2779 O  "O5'" . DC  B 2 3   ? -19.878 47.942 -23.883 1.00 110.31 ? 3   DC  A "O5'" 1 
ATOM   2780 C  "C5'" . DC  B 2 3   ? -20.646 49.118 -23.637 1.00 110.76 ? 3   DC  A "C5'" 1 
ATOM   2781 C  "C4'" . DC  B 2 3   ? -21.289 49.055 -22.268 1.00 109.95 ? 3   DC  A "C4'" 1 
ATOM   2782 O  "O4'" . DC  B 2 3   ? -22.547 48.367 -22.345 1.00 112.19 ? 3   DC  A "O4'" 1 
ATOM   2783 C  "C3'" . DC  B 2 3   ? -20.484 48.291 -21.222 1.00 107.78 ? 3   DC  A "C3'" 1 
ATOM   2784 O  "O3'" . DC  B 2 3   ? -19.764 49.207 -20.425 1.00 105.65 ? 3   DC  A "O3'" 1 
ATOM   2785 C  "C2'" . DC  B 2 3   ? -21.542 47.519 -20.400 1.00 108.72 ? 3   DC  A "C2'" 1 
ATOM   2786 C  "C1'" . DC  B 2 3   ? -22.865 47.915 -21.052 1.00 119.61 ? 3   DC  A "C1'" 1 
ATOM   2787 N  N1    . DC  B 2 3   ? -23.845 46.790 -21.164 1.00 119.50 ? 3   DC  A N1    1 
ATOM   2788 C  C2    . DC  B 2 3   ? -24.897 46.692 -20.239 1.00 114.18 ? 3   DC  A C2    1 
ATOM   2789 O  O2    . DC  B 2 3   ? -24.991 47.544 -19.335 1.00 113.10 ? 3   DC  A O2    1 
ATOM   2790 N  N3    . DC  B 2 3   ? -25.785 45.662 -20.363 1.00 116.28 ? 3   DC  A N3    1 
ATOM   2791 C  C4    . DC  B 2 3   ? -25.647 44.767 -21.355 1.00 117.61 ? 3   DC  A C4    1 
ATOM   2792 N  N4    . DC  B 2 3   ? -26.544 43.773 -21.442 1.00 119.84 ? 3   DC  A N4    1 
ATOM   2793 C  C5    . DC  B 2 3   ? -24.581 44.856 -22.302 1.00 116.89 ? 3   DC  A C5    1 
ATOM   2794 C  C6    . DC  B 2 3   ? -23.713 45.870 -22.170 1.00 114.79 ? 3   DC  A C6    1 
ATOM   2795 P  P     . DT  B 2 4   ? -18.947 48.700 -19.143 1.00 103.58 ? 4   DT  A P     1 
ATOM   2796 O  OP1   . DT  B 2 4   ? -17.794 49.611 -19.007 1.00 101.74 ? 4   DT  A OP1   1 
ATOM   2797 O  OP2   . DT  B 2 4   ? -18.710 47.241 -19.257 1.00 103.99 ? 4   DT  A OP2   1 
ATOM   2798 O  "O5'" . DT  B 2 4   ? -19.963 48.931 -17.934 1.00 103.88 ? 4   DT  A "O5'" 1 
ATOM   2799 C  "C5'" . DT  B 2 4   ? -20.890 50.000 -17.984 1.00 104.86 ? 4   DT  A "C5'" 1 
ATOM   2800 C  "C4'" . DT  B 2 4   ? -21.966 49.828 -16.930 1.00 105.70 ? 4   DT  A "C4'" 1 
ATOM   2801 O  "O4'" . DT  B 2 4   ? -22.905 48.793 -17.324 1.00 107.66 ? 4   DT  A "O4'" 1 
ATOM   2802 C  "C3'" . DT  B 2 4   ? -21.452 49.436 -15.548 1.00 104.30 ? 4   DT  A "C3'" 1 
ATOM   2803 O  "O3'" . DT  B 2 4   ? -21.971 50.329 -14.601 1.00 104.36 ? 4   DT  A "O3'" 1 
ATOM   2804 C  "C2'" . DT  B 2 4   ? -21.989 48.012 -15.341 1.00 105.66 ? 4   DT  A "C2'" 1 
ATOM   2805 C  "C1'" . DT  B 2 4   ? -23.243 48.029 -16.188 1.00 116.16 ? 4   DT  A "C1'" 1 
ATOM   2806 N  N1    . DT  B 2 4   ? -23.695 46.664 -16.638 1.00 122.48 ? 4   DT  A N1    1 
ATOM   2807 C  C2    . DT  B 2 4   ? -24.894 46.151 -16.173 1.00 111.08 ? 4   DT  A C2    1 
ATOM   2808 O  O2    . DT  B 2 4   ? -25.627 46.745 -15.397 1.00 111.55 ? 4   DT  A O2    1 
ATOM   2809 N  N3    . DT  B 2 4   ? -25.208 44.905 -16.662 1.00 112.56 ? 4   DT  A N3    1 
ATOM   2810 C  C4    . DT  B 2 4   ? -24.453 44.137 -17.545 1.00 112.43 ? 4   DT  A C4    1 
ATOM   2811 O  O4    . DT  B 2 4   ? -24.808 43.028 -17.926 1.00 114.02 ? 4   DT  A O4    1 
ATOM   2812 C  C5    . DT  B 2 4   ? -23.214 44.731 -17.985 1.00 110.49 ? 4   DT  A C5    1 
ATOM   2813 C  C7    . DT  B 2 4   ? -22.319 43.988 -18.940 1.00 110.40 ? 4   DT  A C7    1 
ATOM   2814 C  C6    . DT  B 2 4   ? -22.901 45.950 -17.517 1.00 114.36 ? 4   DT  A C6    1 
ATOM   2815 P  P     . DA  B 2 5   ? -21.540 50.223 -13.058 1.00 112.51 ? 5   DA  A P     1 
ATOM   2816 O  OP1   . DA  B 2 5   ? -21.245 51.595 -12.586 1.00 115.85 ? 5   DA  A OP1   1 
ATOM   2817 O  OP2   . DA  B 2 5   ? -20.490 49.184 -12.918 1.00 111.44 ? 5   DA  A OP2   1 
ATOM   2818 O  "O5'" . DA  B 2 5   ? -22.879 49.707 -12.332 1.00 114.18 ? 5   DA  A "O5'" 1 
ATOM   2819 C  "C5'" . DA  B 2 5   ? -24.111 49.676 -13.053 1.00 113.56 ? 5   DA  A "C5'" 1 
ATOM   2820 C  "C4'" . DA  B 2 5   ? -25.239 49.154 -12.183 1.00 114.21 ? 5   DA  A "C4'" 1 
ATOM   2821 O  "O4'" . DA  B 2 5   ? -25.689 47.863 -12.684 1.00 113.88 ? 5   DA  A "O4'" 1 
ATOM   2822 C  "C3'" . DA  B 2 5   ? -24.886 48.941 -10.711 1.00 114.25 ? 5   DA  A "C3'" 1 
ATOM   2823 O  "O3'" . DA  B 2 5   ? -26.012 49.287 -9.891  1.00 115.49 ? 5   DA  A "O3'" 1 
ATOM   2824 C  "C2'" . DA  B 2 5   ? -24.564 47.446 -10.651 1.00 113.45 ? 5   DA  A "C2'" 1 
ATOM   2825 C  "C1'" . DA  B 2 5   ? -25.531 46.868 -11.684 1.00 114.75 ? 5   DA  A "C1'" 1 
ATOM   2826 N  N9    . DA  B 2 5   ? -25.031 45.660 -12.337 1.00 115.67 ? 5   DA  A N9    1 
ATOM   2827 C  C8    . DA  B 2 5   ? -23.737 45.403 -12.691 1.00 114.81 ? 5   DA  A C8    1 
ATOM   2828 N  N7    . DA  B 2 5   ? -23.569 44.247 -13.285 1.00 111.17 ? 5   DA  A N7    1 
ATOM   2829 C  C5    . DA  B 2 5   ? -24.844 43.707 -13.333 1.00 112.02 ? 5   DA  A C5    1 
ATOM   2830 C  C6    . DA  B 2 5   ? -25.338 42.493 -13.850 1.00 112.20 ? 5   DA  A C6    1 
ATOM   2831 N  N6    . DA  B 2 5   ? -24.561 41.577 -14.431 1.00 111.40 ? 5   DA  A N6    1 
ATOM   2832 N  N1    . DA  B 2 5   ? -26.663 42.255 -13.742 1.00 113.39 ? 5   DA  A N1    1 
ATOM   2833 C  C2    . DA  B 2 5   ? -27.435 43.180 -13.152 1.00 114.28 ? 5   DA  A C2    1 
ATOM   2834 N  N3    . DA  B 2 5   ? -27.086 44.360 -12.631 1.00 114.45 ? 5   DA  A N3    1 
ATOM   2835 C  C4    . DA  B 2 5   ? -25.762 44.565 -12.756 1.00 113.85 ? 5   DA  A C4    1 
ATOM   2836 P  P     . DG  B 2 6   ? -26.156 48.734 -8.386  1.00 115.99 ? 6   DG  A P     1 
ATOM   2837 O  OP1   . DG  B 2 6   ? -27.116 49.639 -7.703  1.00 117.43 ? 6   DG  A OP1   1 
ATOM   2838 O  OP2   . DG  B 2 6   ? -24.803 48.562 -7.798  1.00 115.17 ? 6   DG  A OP2   1 
ATOM   2839 O  "O5'" . DG  B 2 6   ? -26.878 47.307 -8.568  1.00 116.06 ? 6   DG  A "O5'" 1 
ATOM   2840 C  "C5'" . DG  B 2 6   ? -27.178 46.500 -7.431  1.00 116.78 ? 6   DG  A "C5'" 1 
ATOM   2841 C  "C4'" . DG  B 2 6   ? -28.167 45.404 -7.791  1.00 117.31 ? 6   DG  A "C4'" 1 
ATOM   2842 O  "O4'" . DG  B 2 6   ? -27.694 44.673 -8.959  1.00 116.63 ? 6   DG  A "O4'" 1 
ATOM   2843 C  "C3'" . DG  B 2 6   ? -28.400 44.364 -6.693  1.00 118.13 ? 6   DG  A "C3'" 1 
ATOM   2844 O  "O3'" . DG  B 2 6   ? -29.785 44.100 -6.564  1.00 121.76 ? 6   DG  A "O3'" 1 
ATOM   2845 C  "C2'" . DG  B 2 6   ? -27.637 43.131 -7.184  1.00 117.08 ? 6   DG  A "C2'" 1 
ATOM   2846 C  "C1'" . DG  B 2 6   ? -27.720 43.280 -8.698  1.00 116.31 ? 6   DG  A "C1'" 1 
ATOM   2847 N  N9    . DG  B 2 6   ? -26.594 42.654 -9.394  1.00 114.89 ? 6   DG  A N9    1 
ATOM   2848 C  C8    . DG  B 2 6   ? -25.260 43.000 -9.288  1.00 113.73 ? 6   DG  A C8    1 
ATOM   2849 N  N7    . DG  B 2 6   ? -24.468 42.262 -10.020 1.00 112.73 ? 6   DG  A N7    1 
ATOM   2850 C  C5    . DG  B 2 6   ? -25.329 41.367 -10.652 1.00 113.23 ? 6   DG  A C5    1 
ATOM   2851 C  C6    . DG  B 2 6   ? -25.041 40.330 -11.560 1.00 112.72 ? 6   DG  A C6    1 
ATOM   2852 O  O6    . DG  B 2 6   ? -23.934 39.993 -12.000 1.00 111.65 ? 6   DG  A O6    1 
ATOM   2853 N  N1    . DG  B 2 6   ? -26.199 39.657 -11.963 1.00 113.74 ? 6   DG  A N1    1 
ATOM   2854 C  C2    . DG  B 2 6   ? -27.474 39.952 -11.535 1.00 115.13 ? 6   DG  A C2    1 
ATOM   2855 N  N2    . DG  B 2 6   ? -28.458 39.190 -12.037 1.00 116.17 ? 6   DG  A N2    1 
ATOM   2856 N  N3    . DG  B 2 6   ? -27.763 40.925 -10.675 1.00 115.62 ? 6   DG  A N3    1 
ATOM   2857 C  C4    . DG  B 2 6   ? -26.643 41.590 -10.276 1.00 114.59 ? 6   DG  A C4    1 
ATOM   2858 P  P     . DT  B 2 7   ? -30.315 43.196 -5.346  1.00 127.16 ? 7   DT  A P     1 
ATOM   2859 O  OP1   . DT  B 2 7   ? -31.629 43.751 -4.928  1.00 131.20 ? 7   DT  A OP1   1 
ATOM   2860 O  OP2   . DT  B 2 7   ? -29.207 43.080 -4.362  1.00 126.19 ? 7   DT  A OP2   1 
ATOM   2861 O  "O5'" . DT  B 2 7   ? -30.522 41.748 -6.005  1.00 122.34 ? 7   DT  A "O5'" 1 
ATOM   2862 C  "C5'" . DT  B 2 7   ? -31.478 41.571 -7.041  1.00 121.81 ? 7   DT  A "C5'" 1 
ATOM   2863 C  "C4'" . DT  B 2 7   ? -31.544 40.116 -7.469  1.00 122.04 ? 7   DT  A "C4'" 1 
ATOM   2864 O  "O4'" . DT  B 2 7   ? -30.357 39.769 -8.245  1.00 120.14 ? 7   DT  A "O4'" 1 
ATOM   2865 C  "C3'" . DT  B 2 7   ? -31.618 39.102 -6.323  1.00 123.32 ? 7   DT  A "C3'" 1 
ATOM   2866 O  "O3'" . DT  B 2 7   ? -32.574 38.095 -6.646  1.00 128.60 ? 7   DT  A "O3'" 1 
ATOM   2867 C  "C2'" . DT  B 2 7   ? -30.196 38.537 -6.270  1.00 121.74 ? 7   DT  A "C2'" 1 
ATOM   2868 C  "C1'" . DT  B 2 7   ? -29.814 38.564 -7.743  1.00 120.23 ? 7   DT  A "C1'" 1 
ATOM   2869 N  N1    . DT  B 2 7   ? -28.333 38.563 -7.975  1.00 118.31 ? 7   DT  A N1    1 
ATOM   2870 C  C2    . DT  B 2 7   ? -27.794 37.707 -8.918  1.00 117.45 ? 7   DT  A C2    1 
ATOM   2871 O  O2    . DT  B 2 7   ? -28.467 36.939 -9.594  1.00 118.17 ? 7   DT  A O2    1 
ATOM   2872 N  N3    . DT  B 2 7   ? -26.429 37.787 -9.045  1.00 115.87 ? 7   DT  A N3    1 
ATOM   2873 C  C4    . DT  B 2 7   ? -25.571 38.615 -8.333  1.00 115.15 ? 7   DT  A C4    1 
ATOM   2874 O  O4    . DT  B 2 7   ? -24.358 38.614 -8.515  1.00 113.91 ? 7   DT  A O4    1 
ATOM   2875 C  C5    . DT  B 2 7   ? -26.202 39.481 -7.359  1.00 116.13 ? 7   DT  A C5    1 
ATOM   2876 C  C7    . DT  B 2 7   ? -25.370 40.422 -6.532  1.00 115.64 ? 7   DT  A C7    1 
ATOM   2877 C  C6    . DT  B 2 7   ? -27.534 39.413 -7.229  1.00 117.62 ? 7   DT  A C6    1 
ATOM   2878 P  P     . DC  B 2 8   ? -32.685 36.757 -5.759  1.00 133.32 ? 8   DC  A P     1 
ATOM   2879 O  OP1   . DC  B 2 8   ? -34.063 36.231 -5.963  1.00 136.28 ? 8   DC  A OP1   1 
ATOM   2880 O  OP2   . DC  B 2 8   ? -32.192 37.080 -4.388  1.00 129.87 ? 8   DC  A OP2   1 
ATOM   2881 O  "O5'" . DC  B 2 8   ? -31.656 35.725 -6.465  1.00 134.51 ? 8   DC  A "O5'" 1 
ATOM   2882 C  "C5'" . DC  B 2 8   ? -32.140 34.744 -7.405  1.00 133.91 ? 8   DC  A "C5'" 1 
ATOM   2883 C  "C4'" . DC  B 2 8   ? -30.993 34.024 -8.116  1.00 130.53 ? 8   DC  A "C4'" 1 
ATOM   2884 O  "O4'" . DC  B 2 8   ? -29.770 34.806 -8.039  1.00 128.43 ? 8   DC  A "O4'" 1 
ATOM   2885 C  "C3'" . DC  B 2 8   ? -30.644 32.628 -7.568  1.00 129.81 ? 8   DC  A "C3'" 1 
ATOM   2886 O  "O3'" . DC  B 2 8   ? -30.683 31.660 -8.629  1.00 132.32 ? 8   DC  A "O3'" 1 
ATOM   2887 C  "C2'" . DC  B 2 8   ? -29.222 32.789 -7.009  1.00 126.85 ? 8   DC  A "C2'" 1 
ATOM   2888 C  "C1'" . DC  B 2 8   ? -28.681 33.919 -7.870  1.00 124.41 ? 8   DC  A "C1'" 1 
ATOM   2889 N  N1    . DC  B 2 8   ? -27.526 34.662 -7.250  1.00 119.93 ? 8   DC  A N1    1 
ATOM   2890 C  C2    . DC  B 2 8   ? -26.226 34.478 -7.753  1.00 118.06 ? 8   DC  A C2    1 
ATOM   2891 O  O2    . DC  B 2 8   ? -26.048 33.702 -8.704  1.00 117.70 ? 8   DC  A O2    1 
ATOM   2892 N  N3    . DC  B 2 8   ? -25.200 35.164 -7.186  1.00 116.97 ? 8   DC  A N3    1 
ATOM   2893 C  C4    . DC  B 2 8   ? -25.435 35.995 -6.163  1.00 117.52 ? 8   DC  A C4    1 
ATOM   2894 N  N4    . DC  B 2 8   ? -24.395 36.650 -5.633  1.00 116.58 ? 8   DC  A N4    1 
ATOM   2895 C  C5    . DC  B 2 8   ? -26.747 36.190 -5.635  1.00 119.24 ? 8   DC  A C5    1 
ATOM   2896 C  C6    . DC  B 2 8   ? -27.751 35.512 -6.203  1.00 120.33 ? 8   DC  A C6    1 
ATOM   2897 P  P     . DG  B 2 9   ? -30.663 30.081 -8.291  1.00 129.28 ? 9   DG  A P     1 
ATOM   2898 O  OP1   . DG  B 2 9   ? -31.316 29.368 -9.415  1.00 135.41 ? 9   DG  A OP1   1 
ATOM   2899 O  OP2   . DG  B 2 9   ? -31.156 29.917 -6.896  1.00 127.48 ? 9   DG  A OP2   1 
ATOM   2900 O  "O5'" . DG  B 2 9   ? -29.111 29.682 -8.330  1.00 125.26 ? 9   DG  A "O5'" 1 
ATOM   2901 C  "C5'" . DG  B 2 9   ? -28.427 29.571 -9.591  1.00 124.45 ? 9   DG  A "C5'" 1 
ATOM   2902 C  "C4'" . DG  B 2 9   ? -27.033 28.980 -9.405  1.00 118.94 ? 9   DG  A "C4'" 1 
ATOM   2903 O  "O4'" . DG  B 2 9   ? -26.119 30.004 -8.921  1.00 113.60 ? 9   DG  A "O4'" 1 
ATOM   2904 C  "C3'" . DG  B 2 9   ? -26.947 27.820 -8.402  1.00 114.63 ? 9   DG  A "C3'" 1 
ATOM   2905 O  "O3'" . DG  B 2 9   ? -26.226 26.727 -8.977  1.00 115.15 ? 9   DG  A "O3'" 1 
ATOM   2906 C  "C2'" . DG  B 2 9   ? -26.205 28.426 -7.201  1.00 110.91 ? 9   DG  A "C2'" 1 
ATOM   2907 C  "C1'" . DG  B 2 9   ? -25.335 29.471 -7.877  1.00 109.95 ? 9   DG  A "C1'" 1 
ATOM   2908 N  N9    . DG  B 2 9   ? -24.926 30.555 -6.987  1.00 107.69 ? 9   DG  A N9    1 
ATOM   2909 C  C8    . DG  B 2 9   ? -25.704 31.223 -6.066  1.00 108.17 ? 9   DG  A C8    1 
ATOM   2910 N  N7    . DG  B 2 9   ? -25.052 32.144 -5.408  1.00 105.74 ? 9   DG  A N7    1 
ATOM   2911 C  C5    . DG  B 2 9   ? -23.764 32.084 -5.931  1.00 103.59 ? 9   DG  A C5    1 
ATOM   2912 C  C6    . DG  B 2 9   ? -22.612 32.845 -5.614  1.00 100.67 ? 9   DG  A C6    1 
ATOM   2913 O  O6    . DG  B 2 9   ? -22.501 33.758 -4.772  1.00 99.33  ? 9   DG  A O6    1 
ATOM   2914 N  N1    . DG  B 2 9   ? -21.509 32.457 -6.388  1.00 99.39  ? 9   DG  A N1    1 
ATOM   2915 C  C2    . DG  B 2 9   ? -21.525 31.460 -7.344  1.00 101.32 ? 9   DG  A C2    1 
ATOM   2916 N  N2    . DG  B 2 9   ? -20.368 31.225 -7.990  1.00 101.60 ? 9   DG  A N2    1 
ATOM   2917 N  N3    . DG  B 2 9   ? -22.598 30.744 -7.645  1.00 103.42 ? 9   DG  A N3    1 
ATOM   2918 C  C4    . DG  B 2 9   ? -23.675 31.109 -6.903  1.00 104.74 ? 9   DG  A C4    1 
ATOM   2919 P  P     . DT  B 2 10  ? -26.119 25.318 -8.204  1.00 116.88 ? 10  DT  A P     1 
ATOM   2920 O  OP1   . DT  B 2 10  ? -26.440 24.274 -9.209  1.00 117.86 ? 10  DT  A OP1   1 
ATOM   2921 O  OP2   . DT  B 2 10  ? -26.883 25.393 -6.929  1.00 114.89 ? 10  DT  A OP2   1 
ATOM   2922 O  "O5'" . DT  B 2 10  ? -24.566 25.210 -7.847  1.00 109.23 ? 10  DT  A "O5'" 1 
ATOM   2923 C  "C5'" . DT  B 2 10  ? -23.623 25.227 -8.896  1.00 107.48 ? 10  DT  A "C5'" 1 
ATOM   2924 C  "C4'" . DT  B 2 10  ? -22.229 25.422 -8.355  1.00 103.45 ? 10  DT  A "C4'" 1 
ATOM   2925 O  "O4'" . DT  B 2 10  ? -22.132 26.709 -7.696  1.00 102.15 ? 10  DT  A "O4'" 1 
ATOM   2926 C  "C3'" . DT  B 2 10  ? -21.793 24.380 -7.318  1.00 103.26 ? 10  DT  A "C3'" 1 
ATOM   2927 O  "O3'" . DT  B 2 10  ? -20.593 23.756 -7.747  1.00 101.88 ? 10  DT  A "O3'" 1 
ATOM   2928 C  "C2'" . DT  B 2 10  ? -21.574 25.203 -6.043  1.00 101.16 ? 10  DT  A "C2'" 1 
ATOM   2929 C  "C1'" . DT  B 2 10  ? -21.244 26.568 -6.622  1.00 98.58  ? 10  DT  A "C1'" 1 
ATOM   2930 N  N1    . DT  B 2 10  ? -21.437 27.702 -5.665  1.00 97.54  ? 10  DT  A N1    1 
ATOM   2931 C  C2    . DT  B 2 10  ? -20.349 28.473 -5.299  1.00 99.47  ? 10  DT  A C2    1 
ATOM   2932 O  O2    . DT  B 2 10  ? -19.214 28.287 -5.723  1.00 94.72  ? 10  DT  A O2    1 
ATOM   2933 N  N3    . DT  B 2 10  ? -20.639 29.484 -4.416  1.00 98.79  ? 10  DT  A N3    1 
ATOM   2934 C  C4    . DT  B 2 10  ? -21.879 29.794 -3.870  1.00 98.29  ? 10  DT  A C4    1 
ATOM   2935 O  O4    . DT  B 2 10  ? -22.043 30.724 -3.082  1.00 95.11  ? 10  DT  A O4    1 
ATOM   2936 C  C5    . DT  B 2 10  ? -22.966 28.947 -4.293  1.00 98.87  ? 10  DT  A C5    1 
ATOM   2937 C  C7    . DT  B 2 10  ? -24.350 29.186 -3.766  1.00 101.23 ? 10  DT  A C7    1 
ATOM   2938 C  C6    . DT  B 2 10  ? -22.697 27.954 -5.160  1.00 99.56  ? 10  DT  A C6    1 
ATOM   2939 P  P     . DC  B 2 11  ? -20.554 22.171 -7.990  1.00 99.79  ? 11  DC  A P     1 
ATOM   2940 O  OP1   . DC  B 2 11  ? -19.147 21.779 -8.257  1.00 97.27  ? 11  DC  A OP1   1 
ATOM   2941 O  OP2   . DC  B 2 11  ? -21.577 21.880 -9.021  1.00 103.61 ? 11  DC  A OP2   1 
ATOM   2942 O  "O5'" . DC  B 2 11  ? -21.042 21.557 -6.582  1.00 99.07  ? 11  DC  A "O5'" 1 
ATOM   2943 C  "C5'" . DC  B 2 11  ? -20.131 21.477 -5.468  1.00 95.59  ? 11  DC  A "C5'" 1 
ATOM   2944 C  "C4'" . DC  B 2 11  ? -20.681 20.593 -4.348  1.00 95.61  ? 11  DC  A "C4'" 1 
ATOM   2945 O  "O4'" . DC  B 2 11  ? -21.836 21.225 -3.728  1.00 97.06  ? 11  DC  A "O4'" 1 
ATOM   2946 C  "C3'" . DC  B 2 11  ? -21.143 19.201 -4.774  1.00 97.83  ? 11  DC  A "C3'" 1 
ATOM   2947 O  "O3'" . DC  B 2 11  ? -20.814 18.252 -3.760  1.00 96.31  ? 11  DC  A "O3'" 1 
ATOM   2948 C  "C2'" . DC  B 2 11  ? -22.652 19.379 -4.912  1.00 101.31 ? 11  DC  A "C2'" 1 
ATOM   2949 C  "C1'" . DC  B 2 11  ? -22.937 20.343 -3.772  1.00 99.98  ? 11  DC  A "C1'" 1 
ATOM   2950 N  N1    . DC  B 2 11  ? -24.198 21.146 -3.948  1.00 102.78 ? 11  DC  A N1    1 
ATOM   2951 C  C2    . DC  B 2 11  ? -25.207 21.053 -2.984  1.00 103.92 ? 11  DC  A C2    1 
ATOM   2952 O  O2    . DC  B 2 11  ? -25.036 20.312 -2.008  1.00 103.87 ? 11  DC  A O2    1 
ATOM   2953 N  N3    . DC  B 2 11  ? -26.344 21.780 -3.143  1.00 106.57 ? 11  DC  A N3    1 
ATOM   2954 C  C4    . DC  B 2 11  ? -26.488 22.568 -4.208  1.00 108.10 ? 11  DC  A C4    1 
ATOM   2955 N  N4    . DC  B 2 11  ? -27.624 23.263 -4.321  1.00 110.86 ? 11  DC  A N4    1 
ATOM   2956 C  C5    . DC  B 2 11  ? -25.473 22.676 -5.206  1.00 106.99 ? 11  DC  A C5    1 
ATOM   2957 C  C6    . DC  B 2 11  ? -24.354 21.955 -5.039  1.00 104.33 ? 11  DC  A C6    1 
ATOM   2958 P  P     . DA  B 2 12  ? -20.392 16.756 -4.166  1.00 96.81  ? 12  DA  A P     1 
ATOM   2959 O  OP1   . DA  B 2 12  ? -19.175 16.381 -3.411  1.00 93.53  ? 12  DA  A OP1   1 
ATOM   2960 O  OP2   . DA  B 2 12  ? -20.366 16.696 -5.649  1.00 102.95 ? 12  DA  A OP2   1 
ATOM   2961 O  "O5'" . DA  B 2 12  ? -21.634 15.869 -3.674  1.00 99.53  ? 12  DA  A "O5'" 1 
ATOM   2962 C  "C5'" . DA  B 2 12  ? -22.709 16.463 -2.933  1.00 100.63 ? 12  DA  A "C5'" 1 
ATOM   2963 C  "C4'" . DA  B 2 12  ? -24.050 15.855 -3.327  1.00 104.67 ? 12  DA  A "C4'" 1 
ATOM   2964 O  "O4'" . DA  B 2 12  ? -24.763 16.765 -4.210  1.00 109.55 ? 12  DA  A "O4'" 1 
ATOM   2965 C  "C3'" . DA  B 2 12  ? -23.964 14.528 -4.080  1.00 109.11 ? 12  DA  A "C3'" 1 
ATOM   2966 O  "O3'" . DA  B 2 12  ? -25.056 13.684 -3.718  1.00 119.80 ? 12  DA  A "O3'" 1 
ATOM   2967 C  "C2'" . DA  B 2 12  ? -24.053 14.958 -5.541  1.00 111.62 ? 12  DA  A "C2'" 1 
ATOM   2968 C  "C1'" . DA  B 2 12  ? -25.023 16.129 -5.453  1.00 111.88 ? 12  DA  A "C1'" 1 
ATOM   2969 N  N9    . DA  B 2 12  ? -24.850 17.107 -6.531  1.00 116.07 ? 12  DA  A N9    1 
ATOM   2970 C  C8    . DA  B 2 12  ? -23.899 17.082 -7.524  1.00 118.91 ? 12  DA  A C8    1 
ATOM   2971 N  N7    . DA  B 2 12  ? -23.979 18.094 -8.359  1.00 121.55 ? 12  DA  A N7    1 
ATOM   2972 C  C5    . DA  B 2 12  ? -25.058 18.839 -7.884  1.00 120.78 ? 12  DA  A C5    1 
ATOM   2973 C  C6    . DA  B 2 12  ? -25.664 20.042 -8.329  1.00 119.95 ? 12  DA  A C6    1 
ATOM   2974 N  N6    . DA  B 2 12  ? -25.247 20.732 -9.403  1.00 118.90 ? 12  DA  A N6    1 
ATOM   2975 N  N1    . DA  B 2 12  ? -26.718 20.506 -7.626  1.00 118.75 ? 12  DA  A N1    1 
ATOM   2976 C  C2    . DA  B 2 12  ? -27.136 19.817 -6.556  1.00 116.13 ? 12  DA  A C2    1 
ATOM   2977 N  N3    . DA  B 2 12  ? -26.655 18.685 -6.044  1.00 114.41 ? 12  DA  A N3    1 
ATOM   2978 C  C4    . DA  B 2 12  ? -25.606 18.243 -6.759  1.00 117.59 ? 12  DA  A C4    1 
ATOM   2979 P  P     . DT  B 2 13  ? -24.798 12.123 -3.416  1.00 113.80 ? 13  DT  A P     1 
ATOM   2980 O  OP1   . DT  B 2 13  ? -24.039 12.007 -2.141  1.00 106.48 ? 13  DT  A OP1   1 
ATOM   2981 O  OP2   . DT  B 2 13  ? -24.248 11.542 -4.668  1.00 116.44 ? 13  DT  A OP2   1 
ATOM   2982 O  "O5'" . DT  B 2 13  ? -26.269 11.533 -3.178  1.00 119.92 ? 13  DT  A "O5'" 1 
ATOM   2983 C  "C5'" . DT  B 2 13  ? -27.214 12.281 -2.427  1.00 122.77 ? 13  DT  A "C5'" 1 
ATOM   2984 C  "C4'" . DT  B 2 13  ? -28.509 12.425 -3.201  1.00 126.92 ? 13  DT  A "C4'" 1 
ATOM   2985 O  "O4'" . DT  B 2 13  ? -28.212 12.617 -4.611  1.00 130.41 ? 13  DT  A "O4'" 1 
ATOM   2986 C  "C3'" . DT  B 2 13  ? -29.411 11.206 -3.162  1.00 126.56 ? 13  DT  A "C3'" 1 
ATOM   2987 O  "O3'" . DT  B 2 13  ? -30.228 11.242 -1.996  1.00 122.80 ? 13  DT  A "O3'" 1 
ATOM   2988 C  "C2'" . DT  B 2 13  ? -30.240 11.381 -4.435  1.00 132.52 ? 13  DT  A "C2'" 1 
ATOM   2989 C  "C1'" . DT  B 2 13  ? -29.226 12.011 -5.405  1.00 133.35 ? 13  DT  A "C1'" 1 
ATOM   2990 N  N1    . DT  B 2 13  ? -28.582 11.016 -6.351  1.00 132.07 ? 13  DT  A N1    1 
ATOM   2991 C  C2    . DT  B 2 13  ? -29.213 10.695 -7.546  1.00 132.80 ? 13  DT  A C2    1 
ATOM   2992 O  O2    . DT  B 2 13  ? -30.278 11.177 -7.897  1.00 136.12 ? 13  DT  A O2    1 
ATOM   2993 N  N3    . DT  B 2 13  ? -28.544 9.782  -8.319  1.00 129.72 ? 13  DT  A N3    1 
ATOM   2994 C  C4    . DT  B 2 13  ? -27.336 9.165  -8.032  1.00 125.79 ? 13  DT  A C4    1 
ATOM   2995 O  O4    . DT  B 2 13  ? -26.815 8.355  -8.798  1.00 124.91 ? 13  DT  A O4    1 
ATOM   2996 C  C5    . DT  B 2 13  ? -26.730 9.544  -6.767  1.00 124.22 ? 13  DT  A C5    1 
ATOM   2997 C  C7    . DT  B 2 13  ? -25.418 8.943  -6.345  1.00 120.14 ? 13  DT  A C7    1 
ATOM   2998 C  C6    . DT  B 2 13  ? -27.375 10.438 -6.000  1.00 127.30 ? 13  DT  A C6    1 
ATOM   2999 O  OP3   . DA  C 3 1   ? -13.794 33.380 2.442   1.00 93.63  ? 1   DA  B OP3   1 
ATOM   3000 P  P     . DA  C 3 1   ? -13.868 34.787 1.960   1.00 90.15  ? 1   DA  B P     1 
ATOM   3001 O  OP1   . DA  C 3 1   ? -13.079 35.621 2.899   1.00 100.36 ? 1   DA  B OP1   1 
ATOM   3002 O  OP2   . DA  C 3 1   ? -15.308 35.082 1.760   1.00 86.77  ? 1   DA  B OP2   1 
ATOM   3003 O  "O5'" . DA  C 3 1   ? -13.165 34.872 0.518   1.00 86.21  ? 1   DA  B "O5'" 1 
ATOM   3004 C  "C5'" . DA  C 3 1   ? -11.920 34.182 0.278   1.00 86.39  ? 1   DA  B "C5'" 1 
ATOM   3005 C  "C4'" . DA  C 3 1   ? -11.944 33.416 -1.043  1.00 86.60  ? 1   DA  B "C4'" 1 
ATOM   3006 O  "O4'" . DA  C 3 1   ? -12.912 32.325 -0.982  1.00 86.44  ? 1   DA  B "O4'" 1 
ATOM   3007 C  "C3'" . DA  C 3 1   ? -12.355 34.225 -2.266  1.00 82.22  ? 1   DA  B "C3'" 1 
ATOM   3008 O  "O3'" . DA  C 3 1   ? -11.248 34.979 -2.776  1.00 76.88  ? 1   DA  B "O3'" 1 
ATOM   3009 C  "C2'" . DA  C 3 1   ? -12.784 33.115 -3.218  1.00 85.64  ? 1   DA  B "C2'" 1 
ATOM   3010 C  "C1'" . DA  C 3 1   ? -13.533 32.179 -2.258  1.00 88.79  ? 1   DA  B "C1'" 1 
ATOM   3011 N  N9    . DA  C 3 1   ? -14.983 32.448 -2.130  1.00 89.19  ? 1   DA  B N9    1 
ATOM   3012 C  C8    . DA  C 3 1   ? -15.599 33.336 -1.280  1.00 88.05  ? 1   DA  B C8    1 
ATOM   3013 N  N7    . DA  C 3 1   ? -16.915 33.341 -1.374  1.00 86.77  ? 1   DA  B N7    1 
ATOM   3014 C  C5    . DA  C 3 1   ? -17.184 32.385 -2.350  1.00 84.91  ? 1   DA  B C5    1 
ATOM   3015 C  C6    . DA  C 3 1   ? -18.390 31.908 -2.918  1.00 77.45  ? 1   DA  B C6    1 
ATOM   3016 N  N6    . DA  C 3 1   ? -19.600 32.355 -2.559  1.00 78.83  ? 1   DA  B N6    1 
ATOM   3017 N  N1    . DA  C 3 1   ? -18.301 30.950 -3.872  1.00 76.10  ? 1   DA  B N1    1 
ATOM   3018 C  C2    . DA  C 3 1   ? -17.093 30.501 -4.229  1.00 78.03  ? 1   DA  B C2    1 
ATOM   3019 N  N3    . DA  C 3 1   ? -15.895 30.866 -3.772  1.00 86.04  ? 1   DA  B N3    1 
ATOM   3020 C  C4    . DA  C 3 1   ? -16.008 31.822 -2.824  1.00 88.79  ? 1   DA  B C4    1 
ATOM   3021 P  P     . DC  C 3 2   ? -11.516 36.287 -3.675  1.00 76.28  ? 2   DC  B P     1 
ATOM   3022 O  OP1   . DC  C 3 2   ? -10.195 36.914 -3.906  1.00 76.16  ? 2   DC  B OP1   1 
ATOM   3023 O  OP2   . DC  C 3 2   ? -12.645 37.061 -3.107  1.00 76.79  ? 2   DC  B OP2   1 
ATOM   3024 O  "O5'" . DC  C 3 2   ? -12.023 35.684 -5.066  1.00 83.81  ? 2   DC  B "O5'" 1 
ATOM   3025 C  "C5'" . DC  C 3 2   ? -13.275 36.084 -5.637  1.00 81.84  ? 2   DC  B "C5'" 1 
ATOM   3026 C  "C4'" . DC  C 3 2   ? -13.914 34.919 -6.374  1.00 74.14  ? 2   DC  B "C4'" 1 
ATOM   3027 O  "O4'" . DC  C 3 2   ? -14.776 34.207 -5.469  1.00 79.06  ? 2   DC  B "O4'" 1 
ATOM   3028 C  "C3'" . DC  C 3 2   ? -14.806 35.290 -7.537  1.00 69.72  ? 2   DC  B "C3'" 1 
ATOM   3029 O  "O3'" . DC  C 3 2   ? -14.046 35.386 -8.678  1.00 70.79  ? 2   DC  B "O3'" 1 
ATOM   3030 C  "C2'" . DC  C 3 2   ? -15.735 34.093 -7.626  1.00 69.61  ? 2   DC  B "C2'" 1 
ATOM   3031 C  "C1'" . DC  C 3 2   ? -15.894 33.702 -6.167  1.00 72.80  ? 2   DC  B "C1'" 1 
ATOM   3032 N  N1    . DC  C 3 2   ? -17.104 34.253 -5.550  1.00 74.97  ? 2   DC  B N1    1 
ATOM   3033 C  C2    . DC  C 3 2   ? -18.334 33.671 -5.833  1.00 73.56  ? 2   DC  B C2    1 
ATOM   3034 O  O2    . DC  C 3 2   ? -18.376 32.703 -6.605  1.00 72.06  ? 2   DC  B O2    1 
ATOM   3035 N  N3    . DC  C 3 2   ? -19.448 34.184 -5.251  1.00 77.93  ? 2   DC  B N3    1 
ATOM   3036 C  C4    . DC  C 3 2   ? -19.351 35.230 -4.417  1.00 83.66  ? 2   DC  B C4    1 
ATOM   3037 N  N4    . DC  C 3 2   ? -20.479 35.702 -3.864  1.00 88.92  ? 2   DC  B N4    1 
ATOM   3038 C  C5    . DC  C 3 2   ? -18.096 35.835 -4.117  1.00 85.19  ? 2   DC  B C5    1 
ATOM   3039 C  C6    . DC  C 3 2   ? -17.010 35.318 -4.700  1.00 80.13  ? 2   DC  B C6    1 
ATOM   3040 P  P     . DG  C 3 3   ? -14.608 36.231 -9.912  1.00 72.88  ? 3   DG  B P     1 
ATOM   3041 O  OP1   . DG  C 3 3   ? -13.467 36.471 -10.824 1.00 70.00  ? 3   DG  B OP1   1 
ATOM   3042 O  OP2   . DG  C 3 3   ? -15.356 37.363 -9.317  1.00 75.13  ? 3   DG  B OP2   1 
ATOM   3043 O  "O5'" . DG  C 3 3   ? -15.651 35.251 -10.629 1.00 76.35  ? 3   DG  B "O5'" 1 
ATOM   3044 C  "C5'" . DG  C 3 3   ? -15.240 33.959 -11.041 1.00 69.26  ? 3   DG  B "C5'" 1 
ATOM   3045 C  "C4'" . DG  C 3 3   ? -16.349 33.233 -11.805 1.00 66.23  ? 3   DG  B "C4'" 1 
ATOM   3046 O  "O4'" . DG  C 3 3   ? -17.488 32.956 -10.936 1.00 69.26  ? 3   DG  B "O4'" 1 
ATOM   3047 C  "C3'" . DG  C 3 3   ? -16.911 33.971 -13.019 1.00 66.86  ? 3   DG  B "C3'" 1 
ATOM   3048 O  "O3'" . DG  C 3 3   ? -17.272 33.023 -14.055 1.00 70.61  ? 3   DG  B "O3'" 1 
ATOM   3049 C  "C2'" . DG  C 3 3   ? -18.124 34.678 -12.445 1.00 70.52  ? 3   DG  B "C2'" 1 
ATOM   3050 C  "C1'" . DG  C 3 3   ? -18.604 33.708 -11.363 1.00 75.95  ? 3   DG  B "C1'" 1 
ATOM   3051 N  N9    . DG  C 3 3   ? -19.161 34.406 -10.223 1.00 83.11  ? 3   DG  B N9    1 
ATOM   3052 C  C8    . DG  C 3 3   ? -18.523 35.302 -9.397  1.00 83.42  ? 3   DG  B C8    1 
ATOM   3053 N  N7    . DG  C 3 3   ? -19.295 35.787 -8.473  1.00 84.72  ? 3   DG  B N7    1 
ATOM   3054 C  C5    . DG  C 3 3   ? -20.521 35.173 -8.714  1.00 85.29  ? 3   DG  B C5    1 
ATOM   3055 C  C6    . DG  C 3 3   ? -21.751 35.298 -8.042  1.00 86.95  ? 3   DG  B C6    1 
ATOM   3056 O  O6    . DG  C 3 3   ? -22.016 36.001 -7.065  1.00 93.73  ? 3   DG  B O6    1 
ATOM   3057 N  N1    . DG  C 3 3   ? -22.738 34.495 -8.615  1.00 83.34  ? 3   DG  B N1    1 
ATOM   3058 C  C2    . DG  C 3 3   ? -22.554 33.678 -9.701  1.00 80.17  ? 3   DG  B C2    1 
ATOM   3059 N  N2    . DG  C 3 3   ? -23.623 32.980 -10.114 1.00 82.15  ? 3   DG  B N2    1 
ATOM   3060 N  N3    . DG  C 3 3   ? -21.407 33.554 -10.337 1.00 82.64  ? 3   DG  B N3    1 
ATOM   3061 C  C4    . DG  C 3 3   ? -20.443 34.327 -9.789  1.00 84.41  ? 3   DG  B C4    1 
ATOM   3062 P  P     . DA  C 3 4   ? -17.795 33.510 -15.502 1.00 85.00  ? 4   DA  B P     1 
ATOM   3063 O  OP1   . DA  C 3 4   ? -17.160 32.675 -16.546 1.00 86.48  ? 4   DA  B OP1   1 
ATOM   3064 O  OP2   . DA  C 3 4   ? -17.692 34.984 -15.587 1.00 83.22  ? 4   DA  B OP2   1 
ATOM   3065 O  "O5'" . DA  C 3 4   ? -19.338 33.097 -15.514 1.00 90.95  ? 4   DA  B "O5'" 1 
ATOM   3066 C  "C5'" . DA  C 3 4   ? -19.718 31.755 -15.227 1.00 89.49  ? 4   DA  B "C5'" 1 
ATOM   3067 C  "C4'" . DA  C 3 4   ? -21.229 31.608 -15.210 1.00 83.67  ? 4   DA  B "C4'" 1 
ATOM   3068 O  "O4'" . DA  C 3 4   ? -21.767 32.297 -14.053 1.00 79.73  ? 4   DA  B "O4'" 1 
ATOM   3069 C  "C3'" . DA  C 3 4   ? -21.946 32.181 -16.429 1.00 81.78  ? 4   DA  B "C3'" 1 
ATOM   3070 O  "O3'" . DA  C 3 4   ? -23.022 31.330 -16.814 1.00 90.26  ? 4   DA  B "O3'" 1 
ATOM   3071 C  "C2'" . DA  C 3 4   ? -22.440 33.540 -15.941 1.00 78.64  ? 4   DA  B "C2'" 1 
ATOM   3072 C  "C1'" . DA  C 3 4   ? -22.678 33.295 -14.455 1.00 78.53  ? 4   DA  B "C1'" 1 
ATOM   3073 N  N9    . DA  C 3 4   ? -22.434 34.474 -13.637 1.00 75.75  ? 4   DA  B N9    1 
ATOM   3074 C  C8    . DA  C 3 4   ? -21.267 35.178 -13.548 1.00 75.38  ? 4   DA  B C8    1 
ATOM   3075 N  N7    . DA  C 3 4   ? -21.324 36.200 -12.732 1.00 75.17  ? 4   DA  B N7    1 
ATOM   3076 C  C5    . DA  C 3 4   ? -22.621 36.166 -12.252 1.00 76.94  ? 4   DA  B C5    1 
ATOM   3077 C  C6    . DA  C 3 4   ? -23.311 36.989 -11.345 1.00 78.69  ? 4   DA  B C6    1 
ATOM   3078 N  N6    . DA  C 3 4   ? -22.747 38.045 -10.749 1.00 78.89  ? 4   DA  B N6    1 
ATOM   3079 N  N1    . DA  C 3 4   ? -24.605 36.684 -11.074 1.00 80.59  ? 4   DA  B N1    1 
ATOM   3080 C  C2    . DA  C 3 4   ? -25.155 35.623 -11.680 1.00 80.75  ? 4   DA  B C2    1 
ATOM   3081 N  N3    . DA  C 3 4   ? -24.602 34.775 -12.553 1.00 79.28  ? 4   DA  B N3    1 
ATOM   3082 C  C4    . DA  C 3 4   ? -23.321 35.107 -12.798 1.00 77.34  ? 4   DA  B C4    1 
ATOM   3083 P  P     . DC  C 3 5   ? -23.781 31.561 -18.213 1.00 113.37 ? 5   DC  B P     1 
ATOM   3084 O  OP1   . DC  C 3 5   ? -24.275 30.233 -18.663 1.00 112.13 ? 5   DC  B OP1   1 
ATOM   3085 O  OP2   . DC  C 3 5   ? -22.900 32.367 -19.095 1.00 109.95 ? 5   DC  B OP2   1 
ATOM   3086 O  "O5'" . DC  C 3 5   ? -25.037 32.463 -17.807 1.00 111.37 ? 5   DC  B "O5'" 1 
ATOM   3087 C  "C5'" . DC  C 3 5   ? -25.907 32.032 -16.761 1.00 112.18 ? 5   DC  B "C5'" 1 
ATOM   3088 C  "C4'" . DC  C 3 5   ? -26.954 33.087 -16.474 1.00 112.47 ? 5   DC  B "C4'" 1 
ATOM   3089 O  "O4'" . DC  C 3 5   ? -26.408 34.066 -15.564 1.00 111.42 ? 5   DC  B "O4'" 1 
ATOM   3090 C  "C3'" . DC  C 3 5   ? -27.434 33.850 -17.714 1.00 112.63 ? 5   DC  B "C3'" 1 
ATOM   3091 O  "O3'" . DC  C 3 5   ? -28.840 33.616 -17.932 1.00 114.05 ? 5   DC  B "O3'" 1 
ATOM   3092 C  "C2'" . DC  C 3 5   ? -27.122 35.326 -17.417 1.00 111.56 ? 5   DC  B "C2'" 1 
ATOM   3093 C  "C1'" . DC  C 3 5   ? -26.864 35.349 -15.913 1.00 111.17 ? 5   DC  B "C1'" 1 
ATOM   3094 N  N1    . DC  C 3 5   ? -25.811 36.319 -15.524 1.00 109.80 ? 5   DC  B N1    1 
ATOM   3095 C  C2    . DC  C 3 5   ? -26.074 37.300 -14.555 1.00 109.51 ? 5   DC  B C2    1 
ATOM   3096 O  O2    . DC  C 3 5   ? -27.197 37.356 -14.028 1.00 110.41 ? 5   DC  B O2    1 
ATOM   3097 N  N3    . DC  C 3 5   ? -25.080 38.167 -14.220 1.00 108.31 ? 5   DC  B N3    1 
ATOM   3098 C  C4    . DC  C 3 5   ? -23.883 38.075 -14.812 1.00 107.43 ? 5   DC  B C4    1 
ATOM   3099 N  N4    . DC  C 3 5   ? -22.937 38.947 -14.457 1.00 106.34 ? 5   DC  B N4    1 
ATOM   3100 C  C5    . DC  C 3 5   ? -23.604 37.085 -15.794 1.00 107.71 ? 5   DC  B C5    1 
ATOM   3101 C  C6    . DC  C 3 5   ? -24.586 36.240 -16.116 1.00 108.89 ? 5   DC  B C6    1 
ATOM   3102 P  P     . DT  C 3 6   ? -29.584 34.194 -19.240 1.00 118.57 ? 6   DT  B P     1 
ATOM   3103 O  OP1   . DT  C 3 6   ? -30.686 33.252 -19.546 1.00 116.30 ? 6   DT  B OP1   1 
ATOM   3104 O  OP2   . DT  C 3 6   ? -28.583 34.508 -20.297 1.00 113.81 ? 6   DT  B OP2   1 
ATOM   3105 O  "O5'" . DT  C 3 6   ? -30.217 35.575 -18.712 1.00 117.93 ? 6   DT  B "O5'" 1 
ATOM   3106 C  "C5'" . DT  C 3 6   ? -30.838 35.634 -17.405 1.00 114.77 ? 6   DT  B "C5'" 1 
ATOM   3107 C  "C4'" . DT  C 3 6   ? -31.249 37.060 -17.045 1.00 114.40 ? 6   DT  B "C4'" 1 
ATOM   3108 O  "O4'" . DT  C 3 6   ? -30.130 37.771 -16.438 1.00 112.92 ? 6   DT  B "O4'" 1 
ATOM   3109 C  "C3'" . DT  C 3 6   ? -31.709 37.926 -18.226 1.00 114.58 ? 6   DT  B "C3'" 1 
ATOM   3110 O  "O3'" . DT  C 3 6   ? -32.805 38.734 -17.829 1.00 115.21 ? 6   DT  B "O3'" 1 
ATOM   3111 C  "C2'" . DT  C 3 6   ? -30.479 38.778 -18.519 1.00 113.04 ? 6   DT  B "C2'" 1 
ATOM   3112 C  "C1'" . DT  C 3 6   ? -29.950 39.004 -17.110 1.00 112.23 ? 6   DT  B "C1'" 1 
ATOM   3113 N  N1    . DT  C 3 6   ? -28.510 39.368 -17.072 1.00 110.76 ? 6   DT  B N1    1 
ATOM   3114 C  C2    . DT  C 3 6   ? -28.071 40.267 -16.132 1.00 109.89 ? 6   DT  B C2    1 
ATOM   3115 O  O2    . DT  C 3 6   ? -28.811 40.782 -15.309 1.00 110.26 ? 6   DT  B O2    1 
ATOM   3116 N  N3    . DT  C 3 6   ? -26.724 40.539 -16.185 1.00 108.63 ? 6   DT  B N3    1 
ATOM   3117 C  C4    . DT  C 3 6   ? -25.798 40.005 -17.078 1.00 108.18 ? 6   DT  B C4    1 
ATOM   3118 O  O4    . DT  C 3 6   ? -24.606 40.303 -17.054 1.00 107.10 ? 6   DT  B O4    1 
ATOM   3119 C  C5    . DT  C 3 6   ? -26.335 39.069 -18.041 1.00 109.15 ? 6   DT  B C5    1 
ATOM   3120 C  C7    . DT  C 3 6   ? -25.434 38.427 -19.057 1.00 108.87 ? 6   DT  B C7    1 
ATOM   3121 C  C6    . DT  C 3 6   ? -27.647 38.803 -17.994 1.00 110.38 ? 6   DT  B C6    1 
ATOM   3122 P  P     . DA  C 3 7   ? -34.150 38.779 -18.710 1.00 116.72 ? 7   DA  B P     1 
ATOM   3123 O  OP1   . DA  C 3 7   ? -34.822 37.466 -18.543 1.00 118.05 ? 7   DA  B OP1   1 
ATOM   3124 O  OP2   . DA  C 3 7   ? -33.805 39.252 -20.082 1.00 116.42 ? 7   DA  B OP2   1 
ATOM   3125 O  "O5'" . DA  C 3 7   ? -35.030 39.883 -17.945 1.00 117.40 ? 7   DA  B "O5'" 1 
ATOM   3126 C  "C5'" . DA  C 3 7   ? -35.060 39.899 -16.508 1.00 116.80 ? 7   DA  B "C5'" 1 
ATOM   3127 C  "C4'" . DA  C 3 7   ? -34.803 41.300 -15.971 1.00 115.83 ? 7   DA  B "C4'" 1 
ATOM   3128 O  "O4'" . DA  C 3 7   ? -33.377 41.567 -15.971 1.00 114.25 ? 7   DA  B "O4'" 1 
ATOM   3129 C  "C3'" . DA  C 3 7   ? -35.457 42.437 -16.766 1.00 116.08 ? 7   DA  B "C3'" 1 
ATOM   3130 O  "O3'" . DA  C 3 7   ? -36.057 43.390 -15.872 1.00 116.22 ? 7   DA  B "O3'" 1 
ATOM   3131 C  "C2'" . DA  C 3 7   ? -34.294 43.050 -17.546 1.00 114.69 ? 7   DA  B "C2'" 1 
ATOM   3132 C  "C1'" . DA  C 3 7   ? -33.114 42.796 -16.616 1.00 113.50 ? 7   DA  B "C1'" 1 
ATOM   3133 N  N9    . DA  C 3 7   ? -31.844 42.674 -17.328 1.00 112.38 ? 7   DA  B N9    1 
ATOM   3134 C  C8    . DA  C 3 7   ? -31.617 41.971 -18.480 1.00 112.63 ? 7   DA  B C8    1 
ATOM   3135 N  N7    . DA  C 3 7   ? -30.380 42.033 -18.902 1.00 111.50 ? 7   DA  B N7    1 
ATOM   3136 C  C5    . DA  C 3 7   ? -29.748 42.833 -17.962 1.00 110.43 ? 7   DA  B C5    1 
ATOM   3137 C  C6    . DA  C 3 7   ? -28.423 43.280 -17.849 1.00 109.04 ? 7   DA  B C6    1 
ATOM   3138 N  N6    . DA  C 3 7   ? -27.477 42.960 -18.729 1.00 108.48 ? 7   DA  B N6    1 
ATOM   3139 N  N1    . DA  C 3 7   ? -28.111 44.073 -16.799 1.00 108.35 ? 7   DA  B N1    1 
ATOM   3140 C  C2    . DA  C 3 7   ? -29.078 44.388 -15.926 1.00 109.01 ? 7   DA  B C2    1 
ATOM   3141 N  N3    . DA  C 3 7   ? -30.363 44.024 -15.928 1.00 110.31 ? 7   DA  B N3    1 
ATOM   3142 C  C4    . DA  C 3 7   ? -30.634 43.240 -16.985 1.00 110.96 ? 7   DA  B C4    1 
ATOM   3143 P  P     . DG  C 3 8   ? -36.987 44.574 -16.445 1.00 116.77 ? 8   DG  B P     1 
ATOM   3144 O  OP1   . DG  C 3 8   ? -38.079 44.832 -15.475 1.00 117.80 ? 8   DG  B OP1   1 
ATOM   3145 O  OP2   . DG  C 3 8   ? -37.300 44.241 -17.858 1.00 117.44 ? 8   DG  B OP2   1 
ATOM   3146 O  "O5'" . DG  C 3 8   ? -36.017 45.842 -16.448 1.00 115.20 ? 8   DG  B "O5'" 1 
ATOM   3147 C  "C5'" . DG  C 3 8   ? -35.319 46.203 -15.261 1.00 114.24 ? 8   DG  B "C5'" 1 
ATOM   3148 C  "C4'" . DG  C 3 8   ? -34.265 47.253 -15.562 1.00 112.77 ? 8   DG  B "C4'" 1 
ATOM   3149 O  "O4'" . DG  C 3 8   ? -33.145 46.644 -16.259 1.00 111.92 ? 8   DG  B "O4'" 1 
ATOM   3150 C  "C3'" . DG  C 3 8   ? -34.740 48.405 -16.449 1.00 112.87 ? 8   DG  B "C3'" 1 
ATOM   3151 O  "O3'" . DG  C 3 8   ? -34.233 49.624 -15.944 1.00 111.88 ? 8   DG  B "O3'" 1 
ATOM   3152 C  "C2'" . DG  C 3 8   ? -34.137 48.067 -17.810 1.00 112.51 ? 8   DG  B "C2'" 1 
ATOM   3153 C  "C1'" . DG  C 3 8   ? -32.832 47.416 -17.392 1.00 111.42 ? 8   DG  B "C1'" 1 
ATOM   3154 N  N9    . DG  C 3 8   ? -32.256 46.542 -18.411 1.00 111.32 ? 8   DG  B N9    1 
ATOM   3155 C  C8    . DG  C 3 8   ? -32.928 45.688 -19.252 1.00 112.45 ? 8   DG  B C8    1 
ATOM   3156 N  N7    . DG  C 3 8   ? -32.144 45.032 -20.061 1.00 112.11 ? 8   DG  B N7    1 
ATOM   3157 C  C5    . DG  C 3 8   ? -30.875 45.481 -19.738 1.00 110.64 ? 8   DG  B C5    1 
ATOM   3158 C  C6    . DG  C 3 8   ? -29.631 45.124 -20.282 1.00 109.75 ? 8   DG  B C6    1 
ATOM   3159 O  O6    . DG  C 3 8   ? -29.398 44.307 -21.190 1.00 110.07 ? 8   DG  B O6    1 
ATOM   3160 N  N1    . DG  C 3 8   ? -28.589 45.818 -19.666 1.00 108.42 ? 8   DG  B N1    1 
ATOM   3161 C  C2    . DG  C 3 8   ? -28.741 46.738 -18.653 1.00 108.04 ? 8   DG  B C2    1 
ATOM   3162 N  N2    . DG  C 3 8   ? -27.620 47.305 -18.183 1.00 106.81 ? 8   DG  B N2    1 
ATOM   3163 N  N3    . DG  C 3 8   ? -29.907 47.077 -18.137 1.00 108.88 ? 8   DG  B N3    1 
ATOM   3164 C  C4    . DG  C 3 8   ? -30.926 46.412 -18.725 1.00 110.15 ? 8   DG  B C4    1 
ATOM   3165 P  P     . DC  C 3 9   ? -34.964 51.015 -16.283 1.00 119.67 ? 9   DC  B P     1 
ATOM   3166 O  OP1   . DC  C 3 9   ? -35.738 51.440 -15.087 1.00 122.91 ? 9   DC  B OP1   1 
ATOM   3167 O  OP2   . DC  C 3 9   ? -35.641 50.837 -17.593 1.00 115.47 ? 9   DC  B OP2   1 
ATOM   3168 O  "O5'" . DC  C 3 9   ? -33.743 52.034 -16.485 1.00 111.98 ? 9   DC  B "O5'" 1 
ATOM   3169 C  "C5'" . DC  C 3 9   ? -32.731 52.135 -15.479 1.00 109.55 ? 9   DC  B "C5'" 1 
ATOM   3170 C  "C4'" . DC  C 3 9   ? -31.359 52.288 -16.107 1.00 109.83 ? 9   DC  B "C4'" 1 
ATOM   3171 O  "O4'" . DC  C 3 9   ? -30.993 51.065 -16.771 1.00 108.34 ? 9   DC  B "O4'" 1 
ATOM   3172 C  "C3'" . DC  C 3 9   ? -31.273 53.342 -17.189 1.00 107.88 ? 9   DC  B "C3'" 1 
ATOM   3173 O  "O3'" . DC  C 3 9   ? -30.993 54.599 -16.603 1.00 107.22 ? 9   DC  B "O3'" 1 
ATOM   3174 C  "C2'" . DC  C 3 9   ? -30.106 52.858 -18.059 1.00 107.05 ? 9   DC  B "C2'" 1 
ATOM   3175 C  "C1'" . DC  C 3 9   ? -30.052 51.352 -17.785 1.00 107.46 ? 9   DC  B "C1'" 1 
ATOM   3176 N  N1    . DC  C 3 9   ? -30.366 50.520 -18.966 1.00 108.16 ? 9   DC  B N1    1 
ATOM   3177 C  C2    . DC  C 3 9   ? -29.324 50.010 -19.738 1.00 107.52 ? 9   DC  B C2    1 
ATOM   3178 O  O2    . DC  C 3 9   ? -28.154 50.278 -19.423 1.00 106.36 ? 9   DC  B O2    1 
ATOM   3179 N  N3    . DC  C 3 9   ? -29.622 49.237 -20.812 1.00 108.26 ? 9   DC  B N3    1 
ATOM   3180 C  C4    . DC  C 3 9   ? -30.893 48.973 -21.116 1.00 109.58 ? 9   DC  B C4    1 
ATOM   3181 N  N4    . DC  C 3 9   ? -31.136 48.205 -22.188 1.00 110.36 ? 9   DC  B N4    1 
ATOM   3182 C  C5    . DC  C 3 9   ? -31.971 49.486 -20.337 1.00 110.25 ? 9   DC  B C5    1 
ATOM   3183 C  C6    . DC  C 3 9   ? -31.665 50.247 -19.280 1.00 109.50 ? 9   DC  B C6    1 
ATOM   3184 P  P     . DG  C 3 10  ? -31.276 55.949 -17.424 1.00 119.99 ? 10  DG  B P     1 
ATOM   3185 O  OP1   . DG  C 3 10  ? -31.197 57.041 -16.425 1.00 119.21 ? 10  DG  B OP1   1 
ATOM   3186 O  OP2   . DG  C 3 10  ? -32.495 55.745 -18.251 1.00 108.40 ? 10  DG  B OP2   1 
ATOM   3187 O  "O5'" . DG  C 3 10  ? -30.032 56.069 -18.433 1.00 109.36 ? 10  DG  B "O5'" 1 
ATOM   3188 C  "C5'" . DG  C 3 10  ? -28.719 56.229 -17.918 1.00 104.86 ? 10  DG  B "C5'" 1 
ATOM   3189 C  "C4'" . DG  C 3 10  ? -27.689 56.067 -19.019 1.00 104.15 ? 10  DG  B "C4'" 1 
ATOM   3190 O  "O4'" . DG  C 3 10  ? -27.900 54.802 -19.696 1.00 104.76 ? 10  DG  B "O4'" 1 
ATOM   3191 C  "C3'" . DG  C 3 10  ? -27.731 57.138 -20.104 1.00 104.03 ? 10  DG  B "C3'" 1 
ATOM   3192 O  "O3'" . DG  C 3 10  ? -26.410 57.475 -20.499 1.00 102.94 ? 10  DG  B "O3'" 1 
ATOM   3193 C  "C2'" . DG  C 3 10  ? -28.491 56.459 -21.238 1.00 105.04 ? 10  DG  B "C2'" 1 
ATOM   3194 C  "C1'" . DG  C 3 10  ? -28.049 55.013 -21.082 1.00 105.05 ? 10  DG  B "C1'" 1 
ATOM   3195 N  N9    . DG  C 3 10  ? -29.034 54.069 -21.568 1.00 106.27 ? 10  DG  B N9    1 
ATOM   3196 C  C8    . DG  C 3 10  ? -30.357 54.024 -21.218 1.00 107.39 ? 10  DG  B C8    1 
ATOM   3197 N  N7    . DG  C 3 10  ? -31.015 53.072 -21.807 1.00 108.43 ? 10  DG  B N7    1 
ATOM   3198 C  C5    . DG  C 3 10  ? -30.067 52.444 -22.604 1.00 107.96 ? 10  DG  B C5    1 
ATOM   3199 C  C6    . DG  C 3 10  ? -30.202 51.341 -23.472 1.00 108.70 ? 10  DG  B C6    1 
ATOM   3200 O  O6    . DG  C 3 10  ? -31.221 50.684 -23.718 1.00 109.95 ? 10  DG  B O6    1 
ATOM   3201 N  N1    . DG  C 3 10  ? -28.995 51.017 -24.087 1.00 107.90 ? 10  DG  B N1    1 
ATOM   3202 C  C2    . DG  C 3 10  ? -27.806 51.681 -23.887 1.00 106.58 ? 10  DG  B C2    1 
ATOM   3203 N  N2    . DG  C 3 10  ? -26.747 51.222 -24.571 1.00 106.05 ? 10  DG  B N2    1 
ATOM   3204 N  N3    . DG  C 3 10  ? -27.666 52.722 -23.074 1.00 105.88 ? 10  DG  B N3    1 
ATOM   3205 C  C4    . DG  C 3 10  ? -28.838 53.046 -22.467 1.00 106.63 ? 10  DG  B C4    1 
HETATM 3206 MN MN    . MN  D 4 .   ? -9.475  38.022 -5.462  1.00 59.96  ? 401 MN  Z MN    1 
HETATM 3207 MN MN    . MN  E 4 .   ? -1.276  38.510 10.639  1.00 88.21  ? 402 MN  Z MN    1 
HETATM 3208 NA NA    . NA  F 5 .   ? -18.022 48.664 -12.616 1.00 82.78  ? 403 NA  Z NA    1 
HETATM 3209 MN MN    . MN  G 4 .   ? -26.826 19.436 -0.847  1.00 122.24 ? 101 MN  A MN    1 
HETATM 3210 MN MN    . MN  H 4 .   ? -8.946  35.116 -2.813  1.00 54.45  ? 101 MN  B MN    1 
HETATM 3211 MN MN    . MN  I 4 .   ? -12.059 35.115 4.756   1.00 93.20  ? 102 MN  B MN    1 
HETATM 3212 O  O     . HOH J 6 .   ? -3.272  53.153 -25.335 1.00 100.96 ? 501 HOH Z O     1 
HETATM 3213 O  O     . HOH J 6 .   ? 0.341   33.559 19.456  1.00 72.94  ? 502 HOH Z O     1 
HETATM 3214 O  O     . HOH J 6 .   ? -22.254 44.897 10.256  1.00 101.22 ? 503 HOH Z O     1 
HETATM 3215 O  O     . HOH J 6 .   ? -1.918  60.210 -23.614 1.00 98.13  ? 504 HOH Z O     1 
HETATM 3216 O  O     . HOH J 6 .   ? -2.142  29.525 10.104  1.00 61.71  ? 505 HOH Z O     1 
HETATM 3217 O  O     . HOH J 6 .   ? 2.098   46.503 3.551   1.00 68.13  ? 506 HOH Z O     1 
HETATM 3218 O  O     . HOH J 6 .   ? -14.284 23.748 -10.838 1.00 78.29  ? 507 HOH Z O     1 
HETATM 3219 O  O     . HOH J 6 .   ? -10.683 60.463 2.573   1.00 105.26 ? 508 HOH Z O     1 
HETATM 3220 O  O     . HOH J 6 .   ? -13.923 53.274 -11.878 1.00 67.10  ? 509 HOH Z O     1 
HETATM 3221 O  O     . HOH J 6 .   ? -11.590 38.772 -4.966  1.00 62.06  ? 510 HOH Z O     1 
HETATM 3222 O  O     . HOH J 6 .   ? -12.123 51.600 -9.388  1.00 51.07  ? 511 HOH Z O     1 
HETATM 3223 O  O     . HOH J 6 .   ? 0.905   52.835 7.363   1.00 72.13  ? 512 HOH Z O     1 
HETATM 3224 O  O     . HOH J 6 .   ? -9.093  34.108 -4.704  1.00 50.82  ? 513 HOH Z O     1 
HETATM 3225 O  O     . HOH J 6 .   ? -7.144  29.964 6.548   1.00 59.08  ? 514 HOH Z O     1 
HETATM 3226 O  O     . HOH J 6 .   ? 4.696   20.633 -19.841 1.00 95.00  ? 515 HOH Z O     1 
HETATM 3227 O  O     . HOH J 6 .   ? 3.616   46.657 1.503   1.00 43.18  ? 516 HOH Z O     1 
HETATM 3228 O  O     . HOH J 6 .   ? 0.855   48.853 -24.186 1.00 76.86  ? 517 HOH Z O     1 
HETATM 3229 O  O     . HOH J 6 .   ? -8.572  39.745 3.743   1.00 80.82  ? 518 HOH Z O     1 
HETATM 3230 O  O     . HOH J 6 .   ? -8.656  36.230 -0.982  1.00 65.51  ? 519 HOH Z O     1 
HETATM 3231 O  O     . HOH J 6 .   ? -3.572  31.798 -23.064 1.00 66.94  ? 520 HOH Z O     1 
HETATM 3232 O  O     . HOH J 6 .   ? -9.745  31.855 10.321  1.00 70.98  ? 521 HOH Z O     1 
HETATM 3233 O  O     . HOH J 6 .   ? -10.346 25.867 -11.255 1.00 61.76  ? 522 HOH Z O     1 
HETATM 3234 O  O     . HOH J 6 .   ? 14.061  34.089 -2.598  1.00 80.35  ? 523 HOH Z O     1 
HETATM 3235 O  O     . HOH J 6 .   ? -8.752  51.298 -2.815  1.00 72.67  ? 524 HOH Z O     1 
HETATM 3236 O  O     . HOH J 6 .   ? -18.403 35.511 7.754   1.00 104.77 ? 525 HOH Z O     1 
HETATM 3237 O  O     . HOH J 6 .   ? 0.052   40.480 -22.598 1.00 69.90  ? 526 HOH Z O     1 
HETATM 3238 O  O     . HOH J 6 .   ? -10.872 42.770 -7.040  1.00 66.59  ? 527 HOH Z O     1 
HETATM 3239 O  O     . HOH J 6 .   ? 1.539   42.464 -8.180  1.00 63.89  ? 528 HOH Z O     1 
HETATM 3240 O  O     . HOH J 6 .   ? 11.665  52.511 -8.891  1.00 83.89  ? 529 HOH Z O     1 
HETATM 3241 O  O     . HOH J 6 .   ? -14.132 30.561 -12.847 1.00 57.73  ? 530 HOH Z O     1 
HETATM 3242 O  O     . HOH J 6 .   ? -18.300 37.770 -14.575 1.00 98.55  ? 531 HOH Z O     1 
HETATM 3243 O  O     . HOH J 6 .   ? -8.519  33.117 -2.165  1.00 58.70  ? 532 HOH Z O     1 
HETATM 3244 O  O     . HOH J 6 .   ? -15.648 44.146 -13.132 1.00 74.79  ? 533 HOH Z O     1 
HETATM 3245 O  O     . HOH J 6 .   ? -9.928  37.155 0.992   1.00 78.01  ? 534 HOH Z O     1 
HETATM 3246 O  O     . HOH J 6 .   ? -21.832 54.935 -18.662 1.00 81.84  ? 535 HOH Z O     1 
HETATM 3247 O  O     . HOH J 6 .   ? -0.828  40.757 -16.391 1.00 64.45  ? 536 HOH Z O     1 
HETATM 3248 O  O     . HOH J 6 .   ? 0.016   19.918 10.085  1.00 91.90  ? 537 HOH Z O     1 
HETATM 3249 O  O     . HOH J 6 .   ? -10.637 24.074 -9.513  1.00 56.84  ? 538 HOH Z O     1 
HETATM 3250 O  O     . HOH J 6 .   ? 3.546   39.363 -14.663 1.00 76.84  ? 539 HOH Z O     1 
HETATM 3251 O  O     . HOH J 6 .   ? 2.237   51.406 -11.186 1.00 53.28  ? 540 HOH Z O     1 
HETATM 3252 O  O     . HOH J 6 .   ? -0.027  43.739 -11.628 1.00 60.28  ? 541 HOH Z O     1 
HETATM 3253 O  O     . HOH J 6 .   ? -17.295 39.841 -3.947  1.00 70.95  ? 542 HOH Z O     1 
HETATM 3254 O  O     . HOH J 6 .   ? -7.249  29.677 -0.776  1.00 46.85  ? 543 HOH Z O     1 
HETATM 3255 O  O     . HOH J 6 .   ? -8.606  49.846 -0.695  1.00 64.16  ? 544 HOH Z O     1 
HETATM 3256 O  O     . HOH J 6 .   ? -17.932 47.952 -10.389 1.00 72.89  ? 545 HOH Z O     1 
HETATM 3257 O  O     . HOH J 6 .   ? -0.094  29.169 -22.691 1.00 78.49  ? 546 HOH Z O     1 
HETATM 3258 O  O     . HOH J 6 .   ? -0.647  37.160 1.493   1.00 47.55  ? 547 HOH Z O     1 
HETATM 3259 O  O     . HOH J 6 .   ? -19.141 21.563 11.732  1.00 80.95  ? 548 HOH Z O     1 
HETATM 3260 O  O     . HOH J 6 .   ? -4.254  42.655 -29.701 1.00 70.51  ? 549 HOH Z O     1 
HETATM 3261 O  O     . HOH J 6 .   ? -3.095  29.263 -23.132 1.00 66.28  ? 550 HOH Z O     1 
HETATM 3262 O  O     . HOH J 6 .   ? -35.563 33.990 13.098  1.00 117.52 ? 551 HOH Z O     1 
HETATM 3263 O  O     . HOH J 6 .   ? -4.589  64.137 -6.354  1.00 85.49  ? 552 HOH Z O     1 
HETATM 3264 O  O     . HOH J 6 .   ? -16.321 58.308 -26.868 1.00 108.99 ? 553 HOH Z O     1 
HETATM 3265 O  O     . HOH J 6 .   ? -26.559 43.662 12.079  1.00 95.18  ? 554 HOH Z O     1 
HETATM 3266 O  O     . HOH J 6 .   ? 4.402   52.444 -7.123  1.00 85.46  ? 555 HOH Z O     1 
HETATM 3267 O  O     . HOH J 6 .   ? -16.268 21.539 10.723  1.00 74.32  ? 556 HOH Z O     1 
HETATM 3268 O  O     . HOH J 6 .   ? -31.892 33.253 1.194   1.00 85.67  ? 557 HOH Z O     1 
HETATM 3269 O  O     . HOH J 6 .   ? -11.827 40.456 -27.836 1.00 75.84  ? 558 HOH Z O     1 
HETATM 3270 O  O     . HOH J 6 .   ? -6.885  51.000 0.737   1.00 76.18  ? 559 HOH Z O     1 
HETATM 3271 O  O     . HOH J 6 .   ? 4.316   23.276 -19.867 1.00 88.31  ? 560 HOH Z O     1 
HETATM 3272 O  O     . HOH J 6 .   ? 3.776   45.929 -13.345 1.00 64.39  ? 561 HOH Z O     1 
HETATM 3273 O  O     . HOH J 6 .   ? -17.058 52.536 -25.840 1.00 74.17  ? 562 HOH Z O     1 
HETATM 3274 O  O     . HOH J 6 .   ? -4.500  20.739 -23.164 1.00 81.49  ? 563 HOH Z O     1 
HETATM 3275 O  O     . HOH J 6 .   ? -16.179 44.434 -6.551  1.00 58.89  ? 564 HOH Z O     1 
HETATM 3276 O  O     . HOH J 6 .   ? -12.142 48.698 -26.015 1.00 66.54  ? 565 HOH Z O     1 
HETATM 3277 O  O     . HOH J 6 .   ? -28.750 42.529 11.608  1.00 81.70  ? 566 HOH Z O     1 
HETATM 3278 O  O     . HOH J 6 .   ? 2.217   39.908 -25.324 1.00 67.70  ? 567 HOH Z O     1 
HETATM 3279 O  O     . HOH J 6 .   ? -19.960 27.918 8.957   1.00 77.26  ? 568 HOH Z O     1 
HETATM 3280 O  O     . HOH J 6 .   ? -17.127 45.463 -11.573 1.00 78.72  ? 569 HOH Z O     1 
HETATM 3281 O  O     . HOH J 6 .   ? -17.211 44.612 -9.016  1.00 81.48  ? 570 HOH Z O     1 
HETATM 3282 O  O     . HOH J 6 .   ? -1.478  56.167 -18.993 1.00 84.60  ? 571 HOH Z O     1 
HETATM 3283 O  O     . HOH J 6 .   ? -8.283  37.238 3.530   1.00 54.49  ? 572 HOH Z O     1 
HETATM 3284 O  O     . HOH J 6 .   ? 7.328   31.358 -14.360 1.00 68.81  ? 573 HOH Z O     1 
HETATM 3285 O  O     . HOH J 6 .   ? 12.382  32.669 -4.043  1.00 62.38  ? 574 HOH Z O     1 
HETATM 3286 O  O     . HOH J 6 .   ? -8.128  67.784 -8.121  1.00 84.55  ? 575 HOH Z O     1 
HETATM 3287 O  O     . HOH J 6 .   ? -18.476 54.689 -23.917 1.00 84.78  ? 576 HOH Z O     1 
HETATM 3288 O  O     . HOH J 6 .   ? 0.358   55.550 -9.245  1.00 50.87  ? 577 HOH Z O     1 
HETATM 3289 O  O     . HOH J 6 .   ? -2.714  40.386 11.152  1.00 67.12  ? 578 HOH Z O     1 
HETATM 3290 O  O     . HOH J 6 .   ? -0.850  53.656 -18.173 1.00 62.39  ? 579 HOH Z O     1 
HETATM 3291 O  O     . HOH K 6 .   ? -24.719 50.629 -26.456 1.00 102.11 ? 201 HOH A O     1 
HETATM 3292 O  O     . HOH K 6 .   ? -28.194 49.557 -31.359 1.00 105.50 ? 202 HOH A O     1 
HETATM 3293 O  O     . HOH K 6 .   ? -30.214 41.522 -10.032 1.00 107.97 ? 203 HOH A O     1 
HETATM 3294 O  O     . HOH K 6 .   ? -22.809 19.819 -9.900  1.00 109.65 ? 204 HOH A O     1 
HETATM 3295 O  O     . HOH K 6 .   ? -19.500 46.828 -12.564 1.00 93.79  ? 205 HOH A O     1 
HETATM 3296 O  O     . HOH K 6 .   ? -25.923 26.442 -11.584 1.00 98.08  ? 206 HOH A O     1 
HETATM 3297 O  O     . HOH K 6 .   ? -26.093 33.262 -3.237  1.00 104.23 ? 207 HOH A O     1 
HETATM 3298 O  O     . HOH K 6 .   ? -29.947 34.207 -11.294 1.00 93.06  ? 208 HOH A O     1 
HETATM 3299 O  O     . HOH K 6 .   ? -22.910 50.994 -24.621 1.00 99.24  ? 209 HOH A O     1 
HETATM 3300 O  O     . HOH K 6 .   ? -26.065 41.816 -24.709 1.00 82.75  ? 210 HOH A O     1 
HETATM 3301 O  O     . HOH K 6 .   ? -20.000 51.931 -26.917 1.00 84.08  ? 211 HOH A O     1 
HETATM 3302 O  O     . HOH L 6 .   ? -30.553 33.018 -16.093 1.00 106.32 ? 201 HOH B O     1 
HETATM 3303 O  O     . HOH L 6 .   ? -29.835 42.514 -23.001 1.00 91.57  ? 202 HOH B O     1 
HETATM 3304 O  O     . HOH L 6 .   ? -26.166 32.254 -13.622 1.00 92.39  ? 203 HOH B O     1 
HETATM 3305 O  O     . HOH L 6 .   ? -25.926 49.191 -17.207 1.00 87.83  ? 204 HOH B O     1 
HETATM 3306 O  O     . HOH L 6 .   ? -22.515 39.719 -18.769 1.00 71.26  ? 205 HOH B O     1 
HETATM 3307 O  O     . HOH L 6 .   ? -16.079 32.634 4.103   1.00 76.44  ? 206 HOH B O     1 
HETATM 3308 O  O     . HOH L 6 .   ? -30.763 47.988 -14.723 1.00 98.53  ? 207 HOH B O     1 
HETATM 3309 O  O     . HOH L 6 .   ? -12.118 32.269 -6.256  1.00 76.84  ? 208 HOH B O     1 
HETATM 3310 O  O     . HOH L 6 .   ? -17.355 40.257 -9.003  1.00 83.30  ? 209 HOH B O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . GLY A 2   ? 0.8827 0.8090 0.8207 0.0711  0.1433  -0.0315 2   GLY Z N     
2    C CA    . GLY A 2   ? 0.8937 0.8445 0.8641 0.0667  0.1271  -0.0347 2   GLY Z CA    
3    C C     . GLY A 2   ? 1.0229 0.9823 0.9992 0.0666  0.1233  -0.0344 2   GLY Z C     
4    O O     . GLY A 2   ? 1.1321 1.0816 1.1052 0.0729  0.1369  -0.0270 2   GLY Z O     
5    N N     . ILE A 3   ? 1.0874 1.0639 1.0710 0.0597  0.1048  -0.0426 3   ILE Z N     
6    C CA    . ILE A 3   ? 0.9974 0.9834 0.9883 0.0573  0.0977  -0.0422 3   ILE Z CA    
7    C C     . ILE A 3   ? 1.0181 1.0220 1.0544 0.0554  0.0920  -0.0343 3   ILE Z C     
8    O O     . ILE A 3   ? 1.0258 1.0431 1.0763 0.0480  0.0768  -0.0397 3   ILE Z O     
9    C CB    . ILE A 3   ? 0.8667 0.8613 0.8357 0.0490  0.0805  -0.0552 3   ILE Z CB    
10   C CG1   . ILE A 3   ? 0.8433 0.8255 0.7722 0.0488  0.0828  -0.0626 3   ILE Z CG1   
11   C CG2   . ILE A 3   ? 0.7291 0.7267 0.6951 0.0461  0.0751  -0.0538 3   ILE Z CG2   
12   C CD1   . ILE A 3   ? 0.8486 0.8076 0.7475 0.0532  0.0965  -0.0575 3   ILE Z CD1   
13   N N     . GLN A 4   ? 1.0192 1.0227 1.0775 0.0619  0.1042  -0.0212 4   GLN Z N     
14   C CA    . GLN A 4   ? 1.0776 1.0993 1.1829 0.0601  0.1006  -0.0100 4   GLN Z CA    
15   C C     . GLN A 4   ? 0.9265 0.9649 1.0457 0.0497  0.0787  -0.0139 4   GLN Z C     
16   O O     . GLN A 4   ? 0.9213 0.9604 1.0323 0.0487  0.0735  -0.0151 4   GLN Z O     
17   C CB    . GLN A 4   ? 1.2409 1.2619 1.3674 0.0707  0.1186  0.0053  4   GLN Z CB    
18   C CG    . GLN A 4   ? 1.3527 1.3955 1.5323 0.0694  0.1174  0.0207  4   GLN Z CG    
19   C CD    . GLN A 4   ? 1.4199 1.4644 1.6223 0.0824  0.1388  0.0365  4   GLN Z CD    
20   O OE1   . GLN A 4   ? 1.4127 1.4378 1.5882 0.0933  0.1564  0.0352  4   GLN Z OE1   
21   N NE2   . GLN A 4   ? 1.4541 1.5215 1.7057 0.0812  0.1375  0.0518  4   GLN Z NE2   
22   N N     . GLY A 5   ? 0.8489 0.8980 0.9863 0.0411  0.0652  -0.0161 5   GLY Z N     
23   C CA    . GLY A 5   ? 0.7940 0.8567 0.9436 0.0300  0.0446  -0.0192 5   GLY Z CA    
24   C C     . GLY A 5   ? 0.7838 0.8450 0.8998 0.0232  0.0312  -0.0371 5   GLY Z C     
25   O O     . GLY A 5   ? 0.7817 0.8521 0.8996 0.0138  0.0155  -0.0409 5   GLY Z O     
26   N N     . LEU A 6   ? 0.7900 0.8407 0.8755 0.0274  0.0372  -0.0475 6   LEU Z N     
27   C CA    . LEU A 6   ? 0.6998 0.7523 0.7540 0.0223  0.0267  -0.0636 6   LEU Z CA    
28   C C     . LEU A 6   ? 0.7198 0.7796 0.7806 0.0150  0.0117  -0.0729 6   LEU Z C     
29   O O     . LEU A 6   ? 0.7756 0.8438 0.8250 0.0071  -0.0012 -0.0828 6   LEU Z O     
30   C CB    . LEU A 6   ? 0.7012 0.7419 0.7232 0.0289  0.0370  -0.0700 6   LEU Z CB    
31   C CG    . LEU A 6   ? 0.7010 0.7473 0.6923 0.0245  0.0278  -0.0851 6   LEU Z CG    
32   C CD1   . LEU A 6   ? 0.6602 0.7117 0.6359 0.0183  0.0219  -0.0866 6   LEU Z CD1   
33   C CD2   . LEU A 6   ? 0.6714 0.7071 0.6370 0.0306  0.0370  -0.0886 6   LEU Z CD2   
34   N N     . LEU A 7   ? 0.6957 0.7506 0.7730 0.0172  0.0137  -0.0695 7   LEU Z N     
35   C CA    . LEU A 7   ? 0.6726 0.7283 0.7526 0.0115  0.0002  -0.0787 7   LEU Z CA    
36   C C     . LEU A 7   ? 0.6480 0.7129 0.7443 -0.0001 -0.0153 -0.0770 7   LEU Z C     
37   O O     . LEU A 7   ? 0.7785 0.8458 0.8617 -0.0067 -0.0282 -0.0897 7   LEU Z O     
38   C CB    . LEU A 7   ? 0.7487 0.7943 0.8441 0.0149  0.0043  -0.0727 7   LEU Z CB    
39   C CG    . LEU A 7   ? 0.9445 0.9787 1.0230 0.0249  0.0183  -0.0735 7   LEU Z CG    
40   C CD1   . LEU A 7   ? 1.0505 1.0738 1.1426 0.0260  0.0190  -0.0685 7   LEU Z CD1   
41   C CD2   . LEU A 7   ? 0.9386 0.9728 0.9844 0.0281  0.0157  -0.0895 7   LEU Z CD2   
42   N N     . GLN A 8   ? 0.6409 0.7111 0.7657 -0.0026 -0.0139 -0.0609 8   GLN Z N     
43   C CA    . GLN A 8   ? 0.7159 0.7949 0.8580 -0.0150 -0.0300 -0.0567 8   GLN Z CA    
44   C C     . GLN A 8   ? 0.7038 0.7894 0.8256 -0.0200 -0.0369 -0.0643 8   GLN Z C     
45   O O     . GLN A 8   ? 0.7487 0.8394 0.8704 -0.0321 -0.0530 -0.0677 8   GLN Z O     
46   C CB    . GLN A 8   ? 0.7569 0.8430 0.9386 -0.0157 -0.0267 -0.0353 8   GLN Z CB    
47   C CG    . GLN A 8   ? 0.8718 0.9537 1.0756 -0.0140 -0.0217 -0.0259 8   GLN Z CG    
48   C CD    . GLN A 8   ? 0.9928 1.0674 1.1938 -0.0245 -0.0385 -0.0334 8   GLN Z CD    
49   O OE1   . GLN A 8   ? 1.0441 1.1212 1.2433 -0.0364 -0.0557 -0.0376 8   GLN Z OE1   
50   N NE2   . GLN A 8   ? 1.0087 1.0715 1.2065 -0.0205 -0.0340 -0.0354 8   GLN Z NE2   
51   N N     . PHE A 9   ? 0.6759 0.7599 0.7778 -0.0119 -0.0253 -0.0666 9   PHE Z N     
52   C CA    . PHE A 9   ? 0.7423 0.8313 0.8227 -0.0171 -0.0311 -0.0723 9   PHE Z CA    
53   C C     . PHE A 9   ? 0.7415 0.8339 0.7920 -0.0231 -0.0403 -0.0911 9   PHE Z C     
54   O O     . PHE A 9   ? 0.8028 0.9026 0.8420 -0.0338 -0.0525 -0.0966 9   PHE Z O     
55   C CB    . PHE A 9   ? 0.8509 0.9334 0.9162 -0.0072 -0.0162 -0.0683 9   PHE Z CB    
56   C CG    . PHE A 9   ? 0.8486 0.9337 0.8939 -0.0132 -0.0227 -0.0706 9   PHE Z CG    
57   C CD1   . PHE A 9   ? 0.8466 0.9338 0.9103 -0.0162 -0.0275 -0.0584 9   PHE Z CD1   
58   C CD2   . PHE A 9   ? 0.8260 0.9120 0.8348 -0.0161 -0.0246 -0.0837 9   PHE Z CD2   
59   C CE1   . PHE A 9   ? 0.8042 0.8911 0.8477 -0.0223 -0.0348 -0.0599 9   PHE Z CE1   
60   C CE2   . PHE A 9   ? 0.7999 0.8877 0.7886 -0.0234 -0.0315 -0.0849 9   PHE Z CE2   
61   C CZ    . PHE A 9   ? 0.8055 0.8921 0.8103 -0.0266 -0.0369 -0.0732 9   PHE Z CZ    
62   N N     . ILE A 10  ? 0.6968 0.7846 0.7349 -0.0160 -0.0341 -0.1005 10  ILE Z N     
63   C CA    . ILE A 10  ? 0.6776 0.7705 0.6903 -0.0188 -0.0407 -0.1182 10  ILE Z CA    
64   C C     . ILE A 10  ? 0.7353 0.8228 0.7561 -0.0198 -0.0477 -0.1250 10  ILE Z C     
65   O O     . ILE A 10  ? 0.6348 0.7215 0.6391 -0.0148 -0.0469 -0.1384 10  ILE Z O     
66   C CB    . ILE A 10  ? 0.5981 0.6910 0.5866 -0.0096 -0.0298 -0.1250 10  ILE Z CB    
67   C CG1   . ILE A 10  ? 0.5346 0.6150 0.5333 0.0018  -0.0181 -0.1191 10  ILE Z CG1   
68   C CG2   . ILE A 10  ? 0.6807 0.7759 0.6538 -0.0111 -0.0255 -0.1200 10  ILE Z CG2   
69   C CD1   . ILE A 10  ? 0.5056 0.5848 0.4809 0.0097  -0.0097 -0.1256 10  ILE Z CD1   
70   N N     . LYS A 11  ? 0.7505 0.8340 0.7954 -0.0268 -0.0558 -0.1161 11  LYS Z N     
71   C CA    . LYS A 11  ? 0.8031 0.8764 0.8553 -0.0288 -0.0633 -0.1202 11  LYS Z CA    
72   C C     . LYS A 11  ? 0.8378 0.9116 0.8645 -0.0330 -0.0725 -0.1392 11  LYS Z C     
73   O O     . LYS A 11  ? 0.7851 0.8483 0.8050 -0.0286 -0.0742 -0.1489 11  LYS Z O     
74   C CB    . LYS A 11  ? 0.8953 0.9666 0.9758 -0.0397 -0.0735 -0.1059 11  LYS Z CB    
75   C CG    . LYS A 11  ? 1.0720 1.1291 1.1598 -0.0438 -0.0827 -0.1075 11  LYS Z CG    
76   C CD    . LYS A 11  ? 1.2177 1.2750 1.3327 -0.0577 -0.0955 -0.0921 11  LYS Z CD    
77   C CE    . LYS A 11  ? 1.3178 1.3585 1.4419 -0.0617 -0.1032 -0.0896 11  LYS Z CE    
78   N NZ    . LYS A 11  ? 1.3727 1.3972 1.4664 -0.0630 -0.1118 -0.1100 11  LYS Z NZ    
79   N N     . GLU A 12  ? 0.8206 0.9056 0.8329 -0.0418 -0.0787 -0.1444 12  GLU Z N     
80   C CA    . GLU A 12  ? 0.8422 0.9293 0.8300 -0.0479 -0.0875 -0.1620 12  GLU Z CA    
81   C C     . GLU A 12  ? 0.7576 0.8490 0.7233 -0.0356 -0.0787 -0.1780 12  GLU Z C     
82   O O     . GLU A 12  ? 0.7689 0.8608 0.7155 -0.0368 -0.0833 -0.1939 12  GLU Z O     
83   C CB    . GLU A 12  ? 0.9270 1.0268 0.9032 -0.0613 -0.0954 -0.1623 12  GLU Z CB    
84   C CG    . GLU A 12  ? 0.9942 1.0911 0.9932 -0.0740 -0.1063 -0.1462 12  GLU Z CG    
85   C CD    . GLU A 12  ? 1.0940 1.2017 1.0806 -0.0876 -0.1154 -0.1457 12  GLU Z CD    
86   O OE1   . GLU A 12  ? 1.1348 1.2402 1.1362 -0.1006 -0.1283 -0.1350 12  GLU Z OE1   
87   O OE2   . GLU A 12  ? 1.1193 1.2381 1.0818 -0.0864 -0.1107 -0.1550 12  GLU Z OE2   
88   N N     . ALA A 13  ? 0.7744 0.8686 0.7422 -0.0237 -0.0660 -0.1734 13  ALA Z N     
89   C CA    . ALA A 13  ? 0.7456 0.8456 0.6962 -0.0118 -0.0583 -0.1857 13  ALA Z CA    
90   C C     . ALA A 13  ? 0.7037 0.7868 0.6639 -0.0004 -0.0550 -0.1863 13  ALA Z C     
91   O O     . ALA A 13  ? 0.7226 0.8077 0.6727 0.0111  -0.0493 -0.1949 13  ALA Z O     
92   C CB    . ALA A 13  ? 0.7599 0.8719 0.7021 -0.0078 -0.0484 -0.1804 13  ALA Z CB    
93   N N     . SER A 14  ? 0.6858 0.7529 0.6664 -0.0042 -0.0594 -0.1761 14  SER Z N     
94   C CA    . SER A 14  ? 0.7074 0.7561 0.6971 0.0043  -0.0579 -0.1746 14  SER Z CA    
95   C C     . SER A 14  ? 0.8088 0.8434 0.7895 0.0032  -0.0685 -0.1881 14  SER Z C     
96   O O     . SER A 14  ? 0.8290 0.8637 0.8034 -0.0080 -0.0785 -0.1931 14  SER Z O     
97   C CB    . SER A 14  ? 0.6358 0.6751 0.6522 0.0004  -0.0566 -0.1554 14  SER Z CB    
98   O OG    . SER A 14  ? 0.7269 0.7639 0.7556 -0.0134 -0.0684 -0.1495 14  SER Z OG    
99   N N     . GLU A 15  ? 0.7904 0.8101 0.7683 0.0146  -0.0668 -0.1937 15  GLU Z N     
100  C CA    . GLU A 15  ? 0.7955 0.7972 0.7609 0.0165  -0.0758 -0.2080 15  GLU Z CA    
101  C C     . GLU A 15  ? 0.7686 0.7444 0.7431 0.0227  -0.0779 -0.2032 15  GLU Z C     
102  O O     . GLU A 15  ? 0.6853 0.6605 0.6629 0.0344  -0.0697 -0.2003 15  GLU Z O     
103  C CB    . GLU A 15  ? 0.7813 0.7953 0.7242 0.0276  -0.0714 -0.2272 15  GLU Z CB    
104  C CG    . GLU A 15  ? 1.0785 1.0713 1.0068 0.0359  -0.0772 -0.2436 15  GLU Z CG    
105  C CD    . GLU A 15  ? 1.2864 1.2965 1.1964 0.0491  -0.0704 -0.2616 15  GLU Z CD    
106  O OE1   . GLU A 15  ? 1.3205 1.3601 1.2256 0.0463  -0.0644 -0.2627 15  GLU Z OE1   
107  O OE2   . GLU A 15  ? 1.3922 1.3866 1.2930 0.0626  -0.0711 -0.2740 15  GLU Z OE2   
108  N N     . PRO A 16  ? 0.8258 0.7787 0.8034 0.0133  -0.0903 -0.2012 16  PRO Z N     
109  C CA    . PRO A 16  ? 0.7781 0.7033 0.7613 0.0172  -0.0946 -0.1968 16  PRO Z CA    
110  C C     . PRO A 16  ? 0.8243 0.7360 0.7881 0.0340  -0.0936 -0.2142 16  PRO Z C     
111  O O     . PRO A 16  ? 0.8986 0.8050 0.8421 0.0364  -0.0982 -0.2315 16  PRO Z O     
112  C CB    . PRO A 16  ? 0.6827 0.5878 0.6676 0.0007  -0.1105 -0.1930 16  PRO Z CB    
113  C CG    . PRO A 16  ? 0.7929 0.7200 0.7844 -0.0130 -0.1122 -0.1873 16  PRO Z CG    
114  C CD    . PRO A 16  ? 0.8594 0.8106 0.8359 -0.0039 -0.1020 -0.2001 16  PRO Z CD    
115  N N     . ILE A 17  ? 0.7837 0.6898 0.7531 0.0459  -0.0872 -0.2097 17  ILE Z N     
116  C CA    . ILE A 17  ? 0.8009 0.6954 0.7552 0.0636  -0.0864 -0.2246 17  ILE Z CA    
117  C C     . ILE A 17  ? 0.8522 0.7168 0.8118 0.0681  -0.0911 -0.2174 17  ILE Z C     
118  O O     . ILE A 17  ? 0.9207 0.7746 0.8952 0.0565  -0.0946 -0.2008 17  ILE Z O     
119  C CB    . ILE A 17  ? 0.8109 0.7340 0.7628 0.0769  -0.0734 -0.2287 17  ILE Z CB    
120  C CG1   . ILE A 17  ? 0.7828 0.7119 0.7500 0.0770  -0.0652 -0.2108 17  ILE Z CG1   
121  C CG2   . ILE A 17  ? 0.7322 0.6859 0.6769 0.0717  -0.0690 -0.2355 17  ILE Z CG2   
122  C CD1   . ILE A 17  ? 0.7881 0.7345 0.7503 0.0909  -0.0558 -0.2137 17  ILE Z CD1   
123  N N     . HIS A 18  ? 0.9538 0.8061 0.9015 0.0852  -0.0912 -0.2294 18  HIS Z N     
124  C CA    . HIS A 18  ? 0.9793 0.8057 0.9306 0.0919  -0.0946 -0.2226 18  HIS Z CA    
125  C C     . HIS A 18  ? 1.0185 0.8597 0.9687 0.1098  -0.0854 -0.2262 18  HIS Z C     
126  O O     . HIS A 18  ? 1.0857 0.9506 1.0286 0.1194  -0.0793 -0.2386 18  HIS Z O     
127  C CB    . HIS A 18  ? 0.9832 0.7695 0.9195 0.0946  -0.1086 -0.2330 18  HIS Z CB    
128  C CG    . HIS A 18  ? 1.0002 0.7552 0.9405 0.0956  -0.1155 -0.2225 18  HIS Z CG    
129  N ND1   . HIS A 18  ? 0.9826 0.7263 0.9182 0.1135  -0.1146 -0.2270 18  HIS Z ND1   
130  C CD2   . HIS A 18  ? 0.9479 0.6818 0.8973 0.0800  -0.1239 -0.2064 18  HIS Z CD2   
131  C CE1   . HIS A 18  ? 1.0081 0.7225 0.9473 0.1085  -0.1226 -0.2148 18  HIS Z CE1   
132  N NE2   . HIS A 18  ? 0.9244 0.6331 0.8719 0.0880  -0.1279 -0.2021 18  HIS Z NE2   
133  N N     . VAL A 19  ? 0.9943 0.8225 0.9515 0.1132  -0.0849 -0.2145 19  VAL Z N     
134  C CA    . VAL A 19  ? 1.0376 0.8807 0.9951 0.1272  -0.0770 -0.2140 19  VAL Z CA    
135  C C     . VAL A 19  ? 0.9872 0.8267 0.9336 0.1475  -0.0799 -0.2319 19  VAL Z C     
136  O O     . VAL A 19  ? 0.9962 0.8568 0.9435 0.1595  -0.0734 -0.2335 19  VAL Z O     
137  C CB    . VAL A 19  ? 1.1547 0.9802 1.1195 0.1251  -0.0773 -0.1971 19  VAL Z CB    
138  C CG1   . VAL A 19  ? 1.2422 1.0267 1.2020 0.1281  -0.0907 -0.1988 19  VAL Z CG1   
139  C CG2   . VAL A 19  ? 1.2325 1.0744 1.1964 0.1365  -0.0698 -0.1946 19  VAL Z CG2   
140  N N     . ARG A 20  ? 1.0322 0.8449 0.9677 0.1515  -0.0896 -0.2448 20  ARG Z N     
141  C CA    . ARG A 20  ? 1.0165 0.8241 0.9406 0.1726  -0.0912 -0.2635 20  ARG Z CA    
142  C C     . ARG A 20  ? 0.9625 0.8131 0.8855 0.1797  -0.0802 -0.2740 20  ARG Z C     
143  O O     . ARG A 20  ? 0.9630 0.8245 0.8836 0.1990  -0.0770 -0.2849 20  ARG Z O     
144  C CB    . ARG A 20  ? 1.0956 0.8666 1.0033 0.1732  -0.1022 -0.2770 20  ARG Z CB    
145  C CG    . ARG A 20  ? 1.1345 0.8594 1.0401 0.1659  -0.1156 -0.2677 20  ARG Z CG    
146  C CD    . ARG A 20  ? 1.1811 0.8662 1.0650 0.1670  -0.1275 -0.2827 20  ARG Z CD    
147  N NE    . ARG A 20  ? 1.1855 0.8803 1.0617 0.1523  -0.1273 -0.2885 20  ARG Z NE    
148  C CZ    . ARG A 20  ? 1.2048 0.9152 1.0676 0.1606  -0.1214 -0.3071 20  ARG Z CZ    
149  N NH1   . ARG A 20  ? 1.2438 0.9646 1.1020 0.1847  -0.1141 -0.3215 20  ARG Z NH1   
150  N NH2   . ARG A 20  ? 1.1478 0.8646 1.0024 0.1446  -0.1228 -0.3106 20  ARG Z NH2   
151  N N     . LYS A 21  ? 0.8389 0.7142 0.7643 0.1638  -0.0748 -0.2697 21  LYS Z N     
152  C CA    . LYS A 21  ? 0.8974 0.8146 0.8210 0.1658  -0.0650 -0.2769 21  LYS Z CA    
153  C C     . LYS A 21  ? 0.9874 0.9299 0.9184 0.1789  -0.0579 -0.2730 21  LYS Z C     
154  O O     . LYS A 21  ? 1.0628 1.0344 0.9911 0.1896  -0.0520 -0.2834 21  LYS Z O     
155  C CB    . LYS A 21  ? 0.8402 0.7765 0.7680 0.1449  -0.0614 -0.2668 21  LYS Z CB    
156  C CG    . LYS A 21  ? 0.8868 0.8625 0.8090 0.1429  -0.0536 -0.2744 21  LYS Z CG    
157  C CD    . LYS A 21  ? 0.9867 0.9745 0.9128 0.1222  -0.0523 -0.2632 21  LYS Z CD    
158  C CE    . LYS A 21  ? 1.0704 1.0886 0.9866 0.1165  -0.0485 -0.2727 21  LYS Z CE    
159  N NZ    . LYS A 21  ? 1.0908 1.1442 1.0065 0.1242  -0.0397 -0.2731 21  LYS Z NZ    
160  N N     . TYR A 22  ? 0.9315 0.8631 0.8714 0.1772  -0.0589 -0.2572 22  TYR Z N     
161  C CA    . TYR A 22  ? 0.9429 0.8949 0.8886 0.1865  -0.0541 -0.2505 22  TYR Z CA    
162  C C     . TYR A 22  ? 0.9604 0.8869 0.9085 0.2027  -0.0610 -0.2509 22  TYR Z C     
163  O O     . TYR A 22  ? 0.9270 0.8543 0.8805 0.2049  -0.0609 -0.2386 22  TYR Z O     
164  C CB    . TYR A 22  ? 0.8802 0.8405 0.8305 0.1712  -0.0490 -0.2314 22  TYR Z CB    
165  C CG    . TYR A 22  ? 0.8201 0.8042 0.7681 0.1561  -0.0428 -0.2301 22  TYR Z CG    
166  C CD1   . TYR A 22  ? 0.8099 0.8309 0.7544 0.1561  -0.0360 -0.2319 22  TYR Z CD1   
167  C CD2   . TYR A 22  ? 0.7859 0.7557 0.7355 0.1414  -0.0448 -0.2263 22  TYR Z CD2   
168  C CE1   . TYR A 22  ? 0.8136 0.8538 0.7541 0.1420  -0.0316 -0.2305 22  TYR Z CE1   
169  C CE2   . TYR A 22  ? 0.7917 0.7822 0.7398 0.1283  -0.0403 -0.2246 22  TYR Z CE2   
170  C CZ    . TYR A 22  ? 0.8573 0.8816 0.7999 0.1288  -0.0338 -0.2271 22  TYR Z CZ    
171  O OH    . TYR A 22  ? 0.9549 0.9974 0.8945 0.1154  -0.0306 -0.2250 22  TYR Z OH    
172  N N     . LYS A 23  ? 1.0284 0.9295 0.9703 0.2138  -0.0678 -0.2649 23  LYS Z N     
173  C CA    . LYS A 23  ? 1.0226 0.8953 0.9652 0.2309  -0.0759 -0.2668 23  LYS Z CA    
174  C C     . LYS A 23  ? 1.0183 0.9202 0.9688 0.2498  -0.0717 -0.2692 23  LYS Z C     
175  O O     . LYS A 23  ? 1.0120 0.9432 0.9622 0.2607  -0.0653 -0.2824 23  LYS Z O     
176  C CB    . LYS A 23  ? 1.0873 0.9260 1.0176 0.2397  -0.0835 -0.2836 23  LYS Z CB    
177  C CG    . LYS A 23  ? 1.1635 0.9656 1.0920 0.2576  -0.0935 -0.2864 23  LYS Z CG    
178  C CD    . LYS A 23  ? 1.2711 1.0345 1.1821 0.2645  -0.1012 -0.3037 23  LYS Z CD    
179  C CE    . LYS A 23  ? 1.3395 1.0624 1.2464 0.2835  -0.1120 -0.3071 23  LYS Z CE    
180  N NZ    . LYS A 23  ? 1.3857 1.0656 1.2710 0.2901  -0.1200 -0.3245 23  LYS Z NZ    
181  N N     . GLY A 24  ? 1.0469 0.9418 1.0047 0.2528  -0.0755 -0.2553 24  GLY Z N     
182  C CA    . GLY A 24  ? 1.0173 0.9390 0.9847 0.2693  -0.0737 -0.2540 24  GLY Z CA    
183  C C     . GLY A 24  ? 0.9959 0.9599 0.9675 0.2579  -0.0652 -0.2428 24  GLY Z C     
184  O O     . GLY A 24  ? 0.9655 0.9581 0.9454 0.2679  -0.0638 -0.2395 24  GLY Z O     
185  N N     . GLN A 25  ? 0.9697 0.9370 0.9353 0.2367  -0.0602 -0.2364 25  GLN Z N     
186  C CA    . GLN A 25  ? 0.9477 0.9483 0.9127 0.2238  -0.0526 -0.2255 25  GLN Z CA    
187  C C     . GLN A 25  ? 0.9273 0.9082 0.8890 0.2086  -0.0533 -0.2062 25  GLN Z C     
188  O O     . GLN A 25  ? 0.8894 0.8337 0.8509 0.2075  -0.0594 -0.2009 25  GLN Z O     
189  C CB    . GLN A 25  ? 0.9684 0.9907 0.9278 0.2121  -0.0454 -0.2329 25  GLN Z CB    
190  C CG    . GLN A 25  ? 1.0113 1.0550 0.9708 0.2254  -0.0431 -0.2520 25  GLN Z CG    
191  C CD    . GLN A 25  ? 1.0159 1.0773 0.9676 0.2118  -0.0374 -0.2589 25  GLN Z CD    
192  O OE1   . GLN A 25  ? 1.0487 1.1341 0.9977 0.1980  -0.0324 -0.2505 25  GLN Z OE1   
193  N NE2   . GLN A 25  ? 0.9828 1.0296 0.9286 0.2151  -0.0391 -0.2740 25  GLN Z NE2   
194  N N     . VAL A 26  ? 0.9212 0.9250 0.8782 0.1966  -0.0468 -0.1956 26  VAL Z N     
195  C CA    . VAL A 26  ? 0.8785 0.8646 0.8290 0.1829  -0.0453 -0.1777 26  VAL Z CA    
196  C C     . VAL A 26  ? 0.8360 0.8207 0.7803 0.1649  -0.0372 -0.1731 26  VAL Z C     
197  O O     . VAL A 26  ? 0.7617 0.7724 0.7031 0.1596  -0.0318 -0.1782 26  VAL Z O     
198  C CB    . VAL A 26  ? 0.8501 0.8558 0.7959 0.1823  -0.0448 -0.1667 26  VAL Z CB    
199  C CG1   . VAL A 26  ? 0.8961 0.8765 0.8313 0.1694  -0.0436 -0.1491 26  VAL Z CG1   
200  C CG2   . VAL A 26  ? 0.7474 0.7616 0.7035 0.2014  -0.0529 -0.1710 26  VAL Z CG2   
201  N N     . VAL A 27  ? 0.8574 0.8124 0.8004 0.1556  -0.0366 -0.1628 27  VAL Z N     
202  C CA    . VAL A 27  ? 0.7996 0.7518 0.7405 0.1403  -0.0287 -0.1569 27  VAL Z CA    
203  C C     . VAL A 27  ? 0.8104 0.7455 0.7435 0.1300  -0.0229 -0.1395 27  VAL Z C     
204  O O     . VAL A 27  ? 0.9024 0.8118 0.8361 0.1310  -0.0270 -0.1324 27  VAL Z O     
205  C CB    . VAL A 27  ? 0.7354 0.6691 0.6854 0.1380  -0.0325 -0.1624 27  VAL Z CB    
206  C CG1   . VAL A 27  ? 0.7462 0.6766 0.6982 0.1227  -0.0248 -0.1527 27  VAL Z CG1   
207  C CG2   . VAL A 27  ? 0.7024 0.6514 0.6552 0.1454  -0.0364 -0.1800 27  VAL Z CG2   
208  N N     . ALA A 28  ? 0.7547 0.7019 0.6782 0.1199  -0.0134 -0.1329 28  ALA Z N     
209  C CA    . ALA A 28  ? 0.6878 0.6177 0.6003 0.1099  -0.0052 -0.1173 28  ALA Z CA    
210  C C     . ALA A 28  ? 0.7243 0.6413 0.6452 0.1012  0.0018  -0.1119 28  ALA Z C     
211  O O     . ALA A 28  ? 0.8344 0.7628 0.7655 0.0993  0.0022  -0.1186 28  ALA Z O     
212  C CB    . ALA A 28  ? 0.5896 0.5349 0.4841 0.1041  0.0014  -0.1126 28  ALA Z CB    
213  N N     . VAL A 29  ? 0.6690 0.5633 0.5860 0.0953  0.0074  -0.0988 29  VAL Z N     
214  C CA    . VAL A 29  ? 0.6996 0.5833 0.6289 0.0879  0.0136  -0.0920 29  VAL Z CA    
215  C C     . VAL A 29  ? 0.7979 0.6762 0.7164 0.0794  0.0292  -0.0791 29  VAL Z C     
216  O O     . VAL A 29  ? 0.8434 0.7082 0.7438 0.0775  0.0337  -0.0709 29  VAL Z O     
217  C CB    . VAL A 29  ? 0.7128 0.5725 0.6514 0.0881  0.0061  -0.0877 29  VAL Z CB    
218  C CG1   . VAL A 29  ? 0.7113 0.5633 0.6641 0.0788  0.0127  -0.0781 29  VAL Z CG1   
219  C CG2   . VAL A 29  ? 0.7649 0.6248 0.7124 0.0974  -0.0090 -0.1012 29  VAL Z CG2   
220  N N     . ASP A 30  ? 0.7751 0.6625 0.7037 0.0747  0.0374  -0.0772 30  ASP Z N     
221  C CA    . ASP A 30  ? 0.6318 0.5116 0.5543 0.0685  0.0537  -0.0647 30  ASP Z CA    
222  C C     . ASP A 30  ? 0.6563 0.5181 0.5905 0.0643  0.0573  -0.0534 30  ASP Z C     
223  O O     . ASP A 30  ? 0.6610 0.5273 0.6171 0.0607  0.0602  -0.0490 30  ASP Z O     
224  C CB    . ASP A 30  ? 0.6147 0.5115 0.5475 0.0663  0.0603  -0.0660 30  ASP Z CB    
225  C CG    . ASP A 30  ? 0.7714 0.6619 0.6907 0.0632  0.0780  -0.0560 30  ASP Z CG    
226  O OD1   . ASP A 30  ? 0.8358 0.7075 0.7425 0.0613  0.0872  -0.0464 30  ASP Z OD1   
227  O OD2   . ASP A 30  ? 0.6831 0.5859 0.6031 0.0627  0.0826  -0.0579 30  ASP Z OD2   
228  N N     . THR A 31  ? 0.7336 0.5759 0.6530 0.0636  0.0564  -0.0476 31  THR Z N     
229  C CA    . THR A 31  ? 0.7430 0.5670 0.6715 0.0589  0.0557  -0.0378 31  THR Z CA    
230  C C     . THR A 31  ? 0.7539 0.5754 0.6905 0.0518  0.0731  -0.0241 31  THR Z C     
231  O O     . THR A 31  ? 0.7452 0.5603 0.6988 0.0466  0.0719  -0.0162 31  THR Z O     
232  C CB    . THR A 31  ? 0.7340 0.5364 0.6410 0.0588  0.0510  -0.0335 31  THR Z CB    
233  O OG1   . THR A 31  ? 0.7580 0.5642 0.6633 0.0670  0.0341  -0.0451 31  THR Z OG1   
234  C CG2   . THR A 31  ? 0.7427 0.5250 0.6569 0.0523  0.0496  -0.0226 31  THR Z CG2   
235  N N     . TYR A 32  ? 1.1273 0.5708 0.6052 -0.0175 0.0634  -0.0117 32  TYR Z N     
236  C CA    . TYR A 32  ? 1.1763 0.6067 0.6578 -0.0121 0.0663  -0.0007 32  TYR Z CA    
237  C C     . TYR A 32  ? 1.2015 0.6448 0.6883 -0.0032 0.0592  0.0063  32  TYR Z C     
238  O O     . TYR A 32  ? 1.1927 0.6368 0.6914 0.0022  0.0582  0.0127  32  TYR Z O     
239  C CB    . TYR A 32  ? 1.1687 0.5753 0.6364 -0.0141 0.0802  0.0068  32  TYR Z CB    
240  C CG    . TYR A 32  ? 1.2677 0.6605 0.7356 -0.0193 0.0857  0.0015  32  TYR Z CG    
241  C CD1   . TYR A 32  ? 1.2398 0.6381 0.7068 -0.0290 0.0839  -0.0098 32  TYR Z CD1   
242  C CD2   . TYR A 32  ? 1.3212 0.6999 0.7896 -0.0134 0.0923  0.0067  32  TYR Z CD2   
243  C CE1   . TYR A 32  ? 1.2208 0.6104 0.6845 -0.0335 0.0869  -0.0149 32  TYR Z CE1   
244  C CE2   . TYR A 32  ? 1.2792 0.6479 0.7430 -0.0181 0.0975  0.0003  32  TYR Z CE2   
245  C CZ    . TYR A 32  ? 1.2319 0.6059 0.6919 -0.0286 0.0939  -0.0102 32  TYR Z CZ    
246  O OH    . TYR A 32  ? 1.0933 0.4612 0.5455 -0.0330 0.0971  -0.0168 32  TYR Z OH    
247  N N     . CYS A 33  ? 1.1669 0.6251 0.6453 -0.0018 0.0543  0.0044  33  CYS Z N     
248  C CA    . CYS A 33  ? 1.1943 0.6709 0.6759 0.0062  0.0444  0.0087  33  CYS Z CA    
249  C C     . CYS A 33  ? 1.1334 0.6241 0.6366 0.0042  0.0313  -0.0027 33  CYS Z C     
250  O O     . CYS A 33  ? 1.2464 0.7476 0.7656 0.0075  0.0252  0.0019  33  CYS Z O     
251  C CB    . CYS A 33  ? 1.2556 0.7469 0.7172 0.0076  0.0425  0.0082  33  CYS Z CB    
252  S SG    . CYS A 33  ? 1.3017 0.7728 0.7362 0.0065  0.0591  0.0255  33  CYS Z SG    
253  N N     . TRP A 34  ? 1.0533 0.5443 0.5589 -0.0014 0.0271  -0.0177 34  TRP Z N     
254  C CA    . TRP A 34  ? 1.1687 0.6624 0.6940 -0.0047 0.0155  -0.0287 34  TRP Z CA    
255  C C     . TRP A 34  ? 1.1676 0.6482 0.7084 -0.0082 0.0191  -0.0198 34  TRP Z C     
256  O O     . TRP A 34  ? 1.2118 0.6964 0.7716 -0.0122 0.0114  -0.0207 34  TRP Z O     
257  C CB    . TRP A 34  ? 1.1568 0.6478 0.6809 -0.0062 0.0118  -0.0455 34  TRP Z CB    
258  C CG    . TRP A 34  ? 1.1442 0.6537 0.6544 -0.0027 0.0088  -0.0579 34  TRP Z CG    
259  C CD1   . TRP A 34  ? 1.1743 0.7022 0.6715 0.0005  0.0063  -0.0551 34  TRP Z CD1   
260  C CD2   . TRP A 34  ? 1.1272 0.6425 0.6338 -0.0006 0.0085  -0.0750 34  TRP Z CD2   
261  N NE1   . TRP A 34  ? 1.1252 0.6697 0.6077 0.0029  0.0055  -0.0695 34  TRP Z NE1   
262  C CE2   . TRP A 34  ? 1.1596 0.6977 0.6494 0.0026  0.0076  -0.0829 34  TRP Z CE2   
263  C CE3   . TRP A 34  ? 1.1175 0.6240 0.6335 0.0007  0.0086  -0.0841 34  TRP Z CE3   
264  C CZ2   . TRP A 34  ? 1.2028 0.7564 0.6859 0.0065  0.0090  -0.1012 34  TRP Z CZ2   
265  C CZ3   . TRP A 34  ? 1.1617 0.6837 0.6744 0.0062  0.0085  -0.1020 34  TRP Z CZ3   
266  C CH2   . TRP A 34  ? 1.2269 0.7729 0.7238 0.0087  0.0098  -0.1113 34  TRP Z CH2   
267  N N     . LEU A 35  ? 1.1722 0.6381 0.7041 -0.0082 0.0313  -0.0118 35  LEU Z N     
268  C CA    . LEU A 35  ? 1.1317 0.5876 0.6724 -0.0108 0.0370  -0.0038 35  LEU Z CA    
269  C C     . LEU A 35  ? 1.1183 0.5852 0.6705 -0.0066 0.0399  0.0070  35  LEU Z C     
270  O O     . LEU A 35  ? 1.1615 0.6333 0.7307 -0.0106 0.0397  0.0112  35  LEU Z O     
271  C CB    . LEU A 35  ? 1.1249 0.5649 0.6499 -0.0117 0.0487  -0.0017 35  LEU Z CB    
272  C CG    . LEU A 35  ? 1.1691 0.6019 0.6927 -0.0162 0.0452  -0.0085 35  LEU Z CG    
273  C CD1   . LEU A 35  ? 1.2278 0.6515 0.7357 -0.0187 0.0547  -0.0093 35  LEU Z CD1   
274  C CD2   . LEU A 35  ? 1.0937 0.5227 0.6298 -0.0190 0.0417  -0.0026 35  LEU Z CD2   
275  N N     . HIS A 36  ? 1.0792 0.5516 0.6229 0.0018  0.0430  0.0126  36  HIS Z N     
276  C CA    . HIS A 36  ? 1.1597 0.6475 0.7166 0.0101  0.0443  0.0228  36  HIS Z CA    
277  C C     . HIS A 36  ? 1.1681 0.6840 0.7470 0.0068  0.0295  0.0188  36  HIS Z C     
278  O O     . HIS A 36  ? 1.2533 0.7852 0.8563 0.0039  0.0291  0.0225  36  HIS Z O     
279  C CB    . HIS A 36  ? 1.2372 0.7202 0.7778 0.0225  0.0495  0.0319  36  HIS Z CB    
280  C CG    . HIS A 36  ? 1.3737 0.8299 0.9023 0.0273  0.0657  0.0379  36  HIS Z CG    
281  N ND1   . HIS A 36  ? 1.4503 0.9079 0.9903 0.0373  0.0742  0.0447  36  HIS Z ND1   
282  C CD2   . HIS A 36  ? 1.4199 0.8482 0.9270 0.0229  0.0751  0.0357  36  HIS Z CD2   
283  C CE1   . HIS A 36  ? 1.4057 0.8331 0.9292 0.0398  0.0879  0.0450  36  HIS Z CE1   
284  N NE2   . HIS A 36  ? 1.3778 0.7866 0.8818 0.0296  0.0881  0.0397  36  HIS Z NE2   
285  N N     . LYS A 37  ? 1.1178 0.6421 0.6886 0.0058  0.0179  0.0098  37  LYS Z N     
286  C CA    . LYS A 37  ? 1.1817 0.7327 0.7709 0.0013  0.0018  0.0017  37  LYS Z CA    
287  C C     . LYS A 37  ? 1.2081 0.7540 0.8202 -0.0130 -0.0021 -0.0052 37  LYS Z C     
288  O O     . LYS A 37  ? 1.3661 0.9334 1.0039 -0.0199 -0.0099 -0.0062 37  LYS Z O     
289  C CB    . LYS A 37  ? 1.2316 0.7899 0.8027 0.0024  -0.0088 -0.0107 37  LYS Z CB    
290  C CG    . LYS A 37  ? 1.3266 0.8931 0.8736 0.0153  -0.0061 0.0001  37  LYS Z CG    
291  C CD    . LYS A 37  ? 1.4346 1.0225 0.9660 0.0165  -0.0192 -0.0113 37  LYS Z CD    
292  C CE    . LYS A 37  ? 1.5056 1.0809 1.0259 0.0091  -0.0189 -0.0299 37  LYS Z CE    
293  N NZ    . LYS A 37  ? 1.5582 1.1566 1.0608 0.0111  -0.0299 -0.0441 37  LYS Z NZ    
294  N N     . GLY A 38  ? 1.1581 0.6773 0.8082 -0.2332 0.0060  0.0729  38  GLY Z N     
295  C CA    . GLY A 38  ? 1.2020 0.6709 0.8149 -0.2345 0.0199  0.0813  38  GLY Z CA    
296  C C     . GLY A 38  ? 1.2667 0.7366 0.8741 -0.2526 0.0240  0.0804  38  GLY Z C     
297  O O     . GLY A 38  ? 1.3231 0.7538 0.9046 -0.2666 0.0373  0.0788  38  GLY Z O     
298  N N     . ALA A 39  ? 1.2374 0.7502 0.8667 -0.2530 0.0131  0.0814  39  ALA Z N     
299  C CA    . ALA A 39  ? 1.1985 0.7153 0.8236 -0.2688 0.0167  0.0809  39  ALA Z CA    
300  C C     . ALA A 39  ? 1.2400 0.7650 0.8777 -0.2947 0.0230  0.0637  39  ALA Z C     
301  O O     . ALA A 39  ? 1.3113 0.8275 0.9390 -0.3111 0.0310  0.0619  39  ALA Z O     
302  C CB    . ALA A 39  ? 1.1527 0.7100 0.7941 -0.2618 0.0041  0.0868  39  ALA Z CB    
303  N N     . ILE A 40  ? 1.1975 0.7420 0.8576 -0.2985 0.0194  0.0519  40  ILE Z N     
304  C CA    . ILE A 40  ? 1.2735 0.8302 0.9465 -0.3231 0.0252  0.0369  40  ILE Z CA    
305  C C     . ILE A 40  ? 1.3306 0.8411 0.9730 -0.3406 0.0406  0.0346  40  ILE Z C     
306  O O     . ILE A 40  ? 1.4172 0.9322 1.0596 -0.3630 0.0480  0.0278  40  ILE Z O     
307  C CB    . ILE A 40  ? 1.1950 0.7804 0.8959 -0.3232 0.0181  0.0260  40  ILE Z CB    
308  C CG1   . ILE A 40  ? 1.1396 0.7732 0.8710 -0.3115 0.0043  0.0261  40  ILE Z CG1   
309  C CG2   . ILE A 40  ? 1.2392 0.8346 0.9497 -0.3493 0.0253  0.0122  40  ILE Z CG2   
310  C CD1   . ILE A 40  ? 1.1844 0.8430 0.9402 -0.3049 -0.0046 0.0189  40  ILE Z CD1   
311  N N     . ALA A 41  ? 1.3740 0.8395 0.9884 -0.3299 0.0460  0.0410  41  ALA Z N     
312  C CA    . ALA A 41  ? 1.3574 0.7701 0.9356 -0.3454 0.0616  0.0394  41  ALA Z CA    
313  C C     . ALA A 41  ? 1.4541 0.8502 1.0126 -0.3577 0.0700  0.0442  41  ALA Z C     
314  O O     . ALA A 41  ? 1.4888 0.8622 1.0295 -0.3820 0.0816  0.0375  41  ALA Z O     
315  C CB    . ALA A 41  ? 1.3584 0.7221 0.9060 -0.3256 0.0668  0.0489  41  ALA Z CB    
316  N N     . CYS A 42  ? 1.3983 0.8063 0.9587 -0.3423 0.0639  0.0559  42  CYS Z N     
317  C CA    . CYS A 42  ? 1.4772 0.8705 1.0189 -0.3520 0.0709  0.0617  42  CYS Z CA    
318  C C     . CYS A 42  ? 1.4252 0.8679 0.9948 -0.3553 0.0627  0.0601  42  CYS Z C     
319  O O     . CYS A 42  ? 1.4527 0.8951 1.0135 -0.3477 0.0608  0.0707  42  CYS Z O     
320  C CB    . CYS A 42  ? 1.5712 0.9240 1.0800 -0.3318 0.0741  0.0793  42  CYS Z CB    
321  S SG    . CYS A 42  ? 1.5612 0.9389 1.0844 -0.2964 0.0587  0.0937  42  CYS Z SG    
322  N N     . ALA A 43  ? 1.4261 0.9099 1.0275 -0.3669 0.0588  0.0472  43  ALA Z N     
323  C CA    . ALA A 43  ? 1.3427 0.8723 0.9706 -0.3678 0.0520  0.0450  43  ALA Z CA    
324  C C     . ALA A 43  ? 1.3874 0.9116 1.0030 -0.3838 0.0611  0.0461  43  ALA Z C     
325  O O     . ALA A 43  ? 1.4133 0.9529 1.0317 -0.3782 0.0574  0.0516  43  ALA Z O     
326  C CB    . ALA A 43  ? 1.2242 0.7966 0.8870 -0.3756 0.0476  0.0318  43  ALA Z CB    
327  N N     . GLU A 44  ? 1.3600 0.8620 0.9602 -0.4048 0.0732  0.0407  44  GLU Z N     
328  C CA    . GLU A 44  ? 1.4153 0.9142 1.0047 -0.4222 0.0828  0.0407  44  GLU Z CA    
329  C C     . GLU A 44  ? 1.4465 0.9138 1.0071 -0.4126 0.0844  0.0543  44  GLU Z C     
330  O O     . GLU A 44  ? 1.4366 0.9151 0.9967 -0.4163 0.0859  0.0572  44  GLU Z O     
331  C CB    . GLU A 44  ? 1.5134 0.9903 1.0873 -0.4474 0.0951  0.0333  44  GLU Z CB    
332  C CG    . GLU A 44  ? 1.7034 1.1216 1.2400 -0.4448 0.1012  0.0384  44  GLU Z CG    
333  C CD    . GLU A 44  ? 1.7958 1.2093 1.3387 -0.4358 0.0964  0.0343  44  GLU Z CD    
334  O OE1   . GLU A 44  ? 1.7852 1.2245 1.3483 -0.4501 0.0959  0.0227  44  GLU Z OE1   
335  O OE2   . GLU A 44  ? 1.8513 1.2360 1.3782 -0.4142 0.0934  0.0435  44  GLU Z OE2   
336  N N     . LYS A 45  ? 1.4995 0.9269 1.0351 -0.3993 0.0847  0.0633  45  LYS Z N     
337  C CA    . LYS A 45  ? 1.5005 0.8978 1.0075 -0.3881 0.0861  0.0783  45  LYS Z CA    
338  C C     . LYS A 45  ? 1.4083 0.8382 0.9306 -0.3712 0.0736  0.0864  45  LYS Z C     
339  O O     . LYS A 45  ? 1.4544 0.8825 0.9648 -0.3728 0.0747  0.0938  45  LYS Z O     
340  C CB    . LYS A 45  ? 1.5493 0.8990 1.0273 -0.3735 0.0894  0.0876  45  LYS Z CB    
341  C CG    . LYS A 45  ? 1.6255 0.9195 1.0634 -0.3878 0.1052  0.0893  45  LYS Z CG    
342  C CD    . LYS A 45  ? 1.6176 0.9097 1.0577 -0.4167 0.1145  0.0732  45  LYS Z CD    
343  C CE    . LYS A 45  ? 1.6489 0.8790 1.0439 -0.4310 0.1303  0.0747  45  LYS Z CE    
344  N NZ    . LYS A 45  ? 1.6648 0.8706 1.0336 -0.4316 0.1361  0.0858  45  LYS Z NZ    
345  N N     . LEU A 46  ? 1.3828 0.8418 0.9296 -0.3565 0.0619  0.0847  46  LEU Z N     
346  C CA    . LEU A 46  ? 1.3876 0.8780 0.9474 -0.3422 0.0495  0.0916  46  LEU Z CA    
347  C C     . LEU A 46  ? 1.4290 0.9512 1.0048 -0.3555 0.0499  0.0841  46  LEU Z C     
348  O O     . LEU A 46  ? 1.4347 0.9684 1.0064 -0.3512 0.0450  0.0912  46  LEU Z O     
349  C CB    . LEU A 46  ? 1.3243 0.8385 0.9065 -0.3257 0.0376  0.0902  46  LEU Z CB    
350  C CG    . LEU A 46  ? 1.2718 0.7572 0.8377 -0.3077 0.0367  0.1001  46  LEU Z CG    
351  C CD1   . LEU A 46  ? 1.2792 0.7911 0.8698 -0.2940 0.0257  0.0964  46  LEU Z CD1   
352  C CD2   . LEU A 46  ? 1.2967 0.7665 0.8383 -0.2928 0.0343  0.1195  46  LEU Z CD2   
353  N N     . ALA A 47  ? 1.4732 1.0092 1.0656 -0.3719 0.0565  0.0702  47  ALA Z N     
354  C CA    . ALA A 47  ? 1.4018 0.9676 1.0096 -0.3835 0.0597  0.0630  47  ALA Z CA    
355  C C     . ALA A 47  ? 1.4740 1.0189 1.0579 -0.3964 0.0703  0.0675  47  ALA Z C     
356  O O     . ALA A 47  ? 1.4987 1.0577 1.0826 -0.3981 0.0706  0.0691  47  ALA Z O     
357  C CB    . ALA A 47  ? 1.3029 0.8940 0.9366 -0.3960 0.0638  0.0489  47  ALA Z CB    
358  N N     . LYS A 48  ? 1.4857 0.9943 1.0467 -0.4061 0.0795  0.0694  48  LYS Z N     
359  C CA    . LYS A 48  ? 1.4917 0.9775 1.0280 -0.4194 0.0900  0.0737  48  LYS Z CA    
360  C C     . LYS A 48  ? 1.5819 1.0498 1.0952 -0.4066 0.0852  0.0887  48  LYS Z C     
361  O O     . LYS A 48  ? 1.6210 1.0835 1.1201 -0.4146 0.0904  0.0925  48  LYS Z O     
362  C CB    . LYS A 48  ? 1.4239 0.8720 0.9380 -0.4341 0.1015  0.0718  48  LYS Z CB    
363  C CG    . LYS A 48  ? 1.3470 0.8138 0.8778 -0.4557 0.1094  0.0578  48  LYS Z CG    
364  C CD    . LYS A 48  ? 1.5024 0.9260 1.0036 -0.4730 0.1211  0.0568  48  LYS Z CD    
365  C CE    . LYS A 48  ? 1.5108 0.9558 1.0260 -0.4982 0.1289  0.0441  48  LYS Z CE    
366  N NZ    . LYS A 48  ? 1.4955 0.8950 0.9766 -0.5183 0.1408  0.0431  48  LYS Z NZ    
367  N N     . GLY A 49  ? 1.5098 0.9707 1.0195 -0.3868 0.0754  0.0977  49  GLY Z N     
368  C CA    . GLY A 49  ? 1.5403 0.9873 1.0281 -0.3739 0.0701  0.1142  49  GLY Z CA    
369  C C     . GLY A 49  ? 1.5527 0.9537 1.0100 -0.3677 0.0759  0.1251  49  GLY Z C     
370  O O     . GLY A 49  ? 1.5488 0.9362 0.9864 -0.3543 0.0720  0.1411  49  GLY Z O     
371  N N     . GLU A 50  ? 1.5083 0.8849 0.9600 -0.3778 0.0858  0.1168  50  GLU Z N     
372  C CA    . GLU A 50  ? 1.5501 0.8761 0.9691 -0.3729 0.0938  0.1255  50  GLU Z CA    
373  C C     . GLU A 50  ? 1.5963 0.9179 1.0150 -0.3463 0.0855  0.1359  50  GLU Z C     
374  O O     . GLU A 50  ? 1.6207 0.9717 1.0665 -0.3385 0.0767  0.1295  50  GLU Z O     
375  C CB    . GLU A 50  ? 1.5683 0.8705 0.9804 -0.3931 0.1063  0.1124  50  GLU Z CB    
376  C CG    . GLU A 50  ? 1.6305 0.9418 1.0444 -0.4201 0.1152  0.1027  50  GLU Z CG    
377  C CD    . GLU A 50  ? 1.7125 1.0080 1.1215 -0.4428 0.1263  0.0898  50  GLU Z CD    
378  O OE1   . GLU A 50  ? 1.7227 1.0247 1.1310 -0.4658 0.1347  0.0828  50  GLU Z OE1   
379  O OE2   . GLU A 50  ? 1.7682 1.0455 1.1731 -0.4384 0.1270  0.0870  50  GLU Z OE2   
380  N N     . PRO A 51  ? 1.6161 0.9024 1.0041 -0.3314 0.0885  0.1529  51  PRO Z N     
381  C CA    . PRO A 51  ? 1.6427 0.9256 1.0279 -0.3033 0.0817  0.1663  51  PRO Z CA    
382  C C     . PRO A 51  ? 1.6893 0.9510 1.0751 -0.2989 0.0867  0.1583  51  PRO Z C     
383  O O     . PRO A 51  ? 1.6451 0.8711 1.0139 -0.3155 0.0996  0.1487  51  PRO Z O     
384  C CB    . PRO A 51  ? 1.6327 0.8775 0.9803 -0.2920 0.0879  0.1862  51  PRO Z CB    
385  C CG    . PRO A 51  ? 1.6547 0.8636 0.9792 -0.3161 0.1024  0.1789  51  PRO Z CG    
386  C CD    . PRO A 51  ? 1.6255 0.8725 0.9784 -0.3399 0.0996  0.1613  51  PRO Z CD    
387  N N     . THR A 52  ? 1.6609 0.9445 1.0644 -0.2781 0.0766  0.1621  52  THR Z N     
388  C CA    . THR A 52  ? 1.6286 0.8947 1.0333 -0.2715 0.0802  0.1554  52  THR Z CA    
389  C C     . THR A 52  ? 1.6253 0.8971 1.0309 -0.2396 0.0729  0.1707  52  THR Z C     
390  O O     . THR A 52  ? 1.6044 0.9051 1.0170 -0.2247 0.0623  0.1848  52  THR Z O     
391  C CB    . THR A 52  ? 1.6036 0.9054 1.0433 -0.2871 0.0749  0.1351  52  THR Z CB    
392  O OG1   . THR A 52  ? 1.6460 0.9234 1.0809 -0.2851 0.0807  0.1278  52  THR Z OG1   
393  C CG2   . THR A 52  ? 1.5660 0.9217 1.0385 -0.2745 0.0582  0.1371  52  THR Z CG2   
394  N N     . ASP A 53  ? 1.6297 0.8727 1.0258 -0.2298 0.0794  0.1686  53  ASP Z N     
395  C CA    . ASP A 53  ? 1.5828 0.8353 0.9836 -0.1991 0.0729  0.1815  53  ASP Z CA    
396  C C     . ASP A 53  ? 1.5393 0.7746 0.9432 -0.1977 0.0778  0.1695  53  ASP Z C     
397  O O     . ASP A 53  ? 1.6558 0.8721 1.0475 -0.1729 0.0808  0.1802  53  ASP Z O     
398  C CB    . ASP A 53  ? 1.6877 0.9043 1.0531 -0.1746 0.0803  0.2056  53  ASP Z CB    
399  C CG    . ASP A 53  ? 1.8248 0.9681 1.1468 -0.1792 0.1011  0.2048  53  ASP Z CG    
400  O OD1   . ASP A 53  ? 1.8407 0.9623 1.1525 -0.2081 0.1095  0.1906  53  ASP Z OD1   
401  O OD2   . ASP A 53  ? 1.9013 1.0079 1.1973 -0.1538 0.1097  0.2189  53  ASP Z OD2   
402  N N     . ARG A 54  ? 1.4710 0.7145 0.8909 -0.2242 0.0789  0.1480  54  ARG Z N     
403  C CA    . ARG A 54  ? 1.4984 0.7248 0.9195 -0.2283 0.0840  0.1349  54  ARG Z CA    
404  C C     . ARG A 54  ? 1.5143 0.7853 0.9692 -0.2108 0.0697  0.1341  54  ARG Z C     
405  O O     . ARG A 54  ? 1.5731 0.8241 1.0209 -0.1976 0.0736  0.1340  54  ARG Z O     
406  C CB    . ARG A 54  ? 1.4714 0.6994 0.9003 -0.2636 0.0888  0.1135  54  ARG Z CB    
407  C CG    . ARG A 54  ? 1.5217 0.7212 0.9414 -0.2729 0.0972  0.1005  54  ARG Z CG    
408  C CD    . ARG A 54  ? 1.5781 0.7776 1.0001 -0.3101 0.1034  0.0821  54  ARG Z CD    
409  N NE    . ARG A 54  ? 1.6615 0.8237 1.0641 -0.3229 0.1139  0.0710  54  ARG Z NE    
410  C CZ    . ARG A 54  ? 1.7178 0.8715 1.1139 -0.3566 0.1216  0.0561  54  ARG Z CZ    
411  N NH1   . ARG A 54  ? 1.6426 0.8238 1.0519 -0.3788 0.1204  0.0509  54  ARG Z NH1   
412  N NH2   . ARG A 54  ? 1.8007 0.9190 1.1758 -0.3689 0.1310  0.0468  54  ARG Z NH2   
413  N N     . TYR A 55  ? 1.3662 0.5945 0.6661 0.0632  -0.0935 0.0195  55  TYR Z N     
414  C CA    . TYR A 55  ? 1.3969 0.6403 0.7236 0.0749  -0.0730 0.0085  55  TYR Z CA    
415  C C     . TYR A 55  ? 1.4188 0.6476 0.7785 0.0818  -0.0858 -0.0099 55  TYR Z C     
416  O O     . TYR A 55  ? 1.4642 0.7049 0.8490 0.0913  -0.0735 -0.0213 55  TYR Z O     
417  C CB    . TYR A 55  ? 1.4240 0.6746 0.7464 0.0777  -0.0550 0.0150  55  TYR Z CB    
418  C CG    . TYR A 55  ? 1.4470 0.6762 0.7605 0.0724  -0.0710 0.0168  55  TYR Z CG    
419  C CD1   . TYR A 55  ? 1.4599 0.6764 0.7981 0.0759  -0.0807 0.0029  55  TYR Z CD1   
420  C CD2   . TYR A 55  ? 1.4471 0.6717 0.7274 0.0637  -0.0760 0.0329  55  TYR Z CD2   
421  C CE1   . TYR A 55  ? 1.4612 0.6615 0.7903 0.0703  -0.0958 0.0042  55  TYR Z CE1   
422  C CE2   . TYR A 55  ? 1.4324 0.6393 0.7029 0.0590  -0.0905 0.0344  55  TYR Z CE2   
423  C CZ    . TYR A 55  ? 1.4792 0.6743 0.7737 0.0620  -0.1006 0.0197  55  TYR Z CZ    
424  O OH    . TYR A 55  ? 1.5400 0.7207 0.8237 0.0565  -0.1155 0.0209  55  TYR Z OH    
425  N N     . VAL A 56  ? 1.3825 0.5876 0.7422 0.0778  -0.1103 -0.0113 56  VAL Z N     
426  C CA    . VAL A 56  ? 1.3082 0.5000 0.6982 0.0845  -0.1248 -0.0261 56  VAL Z CA    
427  C C     . VAL A 56  ? 1.3571 0.5487 0.7589 0.0887  -0.1258 -0.0354 56  VAL Z C     
428  O O     . VAL A 56  ? 1.4064 0.6055 0.8367 0.0991  -0.1175 -0.0486 56  VAL Z O     
429  C CB    . VAL A 56  ? 1.2895 0.4575 0.6738 0.0789  -0.1525 -0.0226 56  VAL Z CB    
430  C CG1   . VAL A 56  ? 1.2964 0.4539 0.7140 0.0874  -0.1665 -0.0362 56  VAL Z CG1   
431  C CG2   . VAL A 56  ? 1.2899 0.4583 0.6594 0.0739  -0.1519 -0.0145 56  VAL Z CG2   
432  N N     . GLY A 57  ? 1.3783 0.5616 0.7575 0.0801  -0.1351 -0.0286 57  GLY Z N     
433  C CA    . GLY A 57  ? 1.4102 0.5903 0.7956 0.0817  -0.1365 -0.0381 57  GLY Z CA    
434  C C     . GLY A 57  ? 1.3856 0.5947 0.7770 0.0875  -0.1111 -0.0431 57  GLY Z C     
435  O O     . GLY A 57  ? 1.3424 0.5540 0.7533 0.0953  -0.1068 -0.0571 57  GLY Z O     
436  N N     . PHE A 58  ? 1.3856 0.6173 0.7603 0.0845  -0.0934 -0.0309 58  PHE Z N     
437  C CA    . PHE A 58  ? 1.3482 0.6113 0.7276 0.0905  -0.0678 -0.0321 58  PHE Z CA    
438  C C     . PHE A 58  ? 1.3627 0.6328 0.7778 0.1049  -0.0565 -0.0463 58  PHE Z C     
439  O O     . PHE A 58  ? 1.4644 0.7498 0.8931 0.1121  -0.0451 -0.0557 58  PHE Z O     
440  C CB    . PHE A 58  ? 1.3034 0.5883 0.6617 0.0872  -0.0497 -0.0145 58  PHE Z CB    
441  C CG    . PHE A 58  ? 1.3306 0.6510 0.6901 0.0928  -0.0233 -0.0117 58  PHE Z CG    
442  C CD1   . PHE A 58  ? 1.4513 0.7895 0.7901 0.0853  -0.0205 -0.0053 58  PHE Z CD1   
443  C CD2   . PHE A 58  ? 1.3284 0.6659 0.7100 0.1051  -0.0011 -0.0146 58  PHE Z CD2   
444  C CE1   . PHE A 58  ? 1.5040 0.8790 0.8436 0.0907  0.0035  -0.0014 58  PHE Z CE1   
445  C CE2   . PHE A 58  ? 1.3812 0.7529 0.7643 0.1113  0.0238  -0.0101 58  PHE Z CE2   
446  C CZ    . PHE A 58  ? 1.4311 0.8230 0.7929 0.1046  0.0259  -0.0032 58  PHE Z CZ    
447  N N     . CYS A 59  ? 1.2449 0.5050 0.6750 0.1086  -0.0601 -0.0478 59  CYS Z N     
448  C CA    . CYS A 59  ? 1.2964 0.5626 0.7624 0.1210  -0.0512 -0.0606 59  CYS Z CA    
449  C C     . CYS A 59  ? 1.3972 0.6485 0.8848 0.1269  -0.0668 -0.0756 59  CYS Z C     
450  O O     . CYS A 59  ? 1.4208 0.6839 0.9350 0.1381  -0.0561 -0.0871 59  CYS Z O     
451  C CB    . CYS A 59  ? 1.2745 0.5330 0.7495 0.1206  -0.0533 -0.0590 59  CYS Z CB    
452  S SG    . CYS A 59  ? 1.2757 0.5463 0.7252 0.1149  -0.0334 -0.0423 59  CYS Z SG    
453  N N     . MET A 60  ? 1.4306 0.6559 0.9070 0.1201  -0.0914 -0.0744 60  MET Z N     
454  C CA    . MET A 60  ? 1.4194 0.6259 0.9158 0.1263  -0.1073 -0.0869 60  MET Z CA    
455  C C     . MET A 60  ? 1.3632 0.5746 0.8597 0.1298  -0.0998 -0.0964 60  MET Z C     
456  O O     . MET A 60  ? 1.2564 0.4598 0.7760 0.1397  -0.1037 -0.1097 60  MET Z O     
457  C CB    . MET A 60  ? 1.4767 0.6534 0.9596 0.1183  -0.1341 -0.0809 60  MET Z CB    
458  C CG    . MET A 60  ? 1.4751 0.6452 0.9699 0.1191  -0.1458 -0.0778 60  MET Z CG    
459  S SD    . MET A 60  ? 1.4337 0.6138 0.9758 0.1349  -0.1409 -0.0928 60  MET Z SD    
460  C CE    . MET A 60  ? 1.3505 0.5447 0.8946 0.1307  -0.1331 -0.0872 60  MET Z CE    
461  N N     . LYS A 61  ? 1.3566 0.5829 0.8270 0.1218  -0.0888 -0.0897 61  LYS Z N     
462  C CA    . LYS A 61  ? 1.3493 0.5861 0.8181 0.1240  -0.0794 -0.0995 61  LYS Z CA    
463  C C     . LYS A 61  ? 1.3182 0.5780 0.8171 0.1395  -0.0598 -0.1102 61  LYS Z C     
464  O O     . LYS A 61  ? 1.3588 0.6139 0.8753 0.1484  -0.0602 -0.1249 61  LYS Z O     
465  C CB    . LYS A 61  ? 1.3895 0.6463 0.8259 0.1123  -0.0693 -0.0885 61  LYS Z CB    
466  C CG    . LYS A 61  ? 1.5051 0.7425 0.9110 0.0961  -0.0872 -0.0765 61  LYS Z CG    
467  C CD    . LYS A 61  ? 1.6173 0.8760 0.9943 0.0843  -0.0786 -0.0690 61  LYS Z CD    
468  C CE    . LYS A 61  ? 1.6436 0.9436 1.0197 0.0894  -0.0524 -0.0602 61  LYS Z CE    
469  N NZ    . LYS A 61  ? 1.6508 0.9784 1.0024 0.0798  -0.0427 -0.0537 61  LYS Z NZ    
470  N N     . PHE A 62  ? 1.2832 0.5669 0.7881 0.1430  -0.0420 -0.1022 62  PHE Z N     
471  C CA    . PHE A 62  ? 1.2496 0.5572 0.7837 0.1571  -0.0215 -0.1093 62  PHE Z CA    
472  C C     . PHE A 62  ? 1.2643 0.5573 0.8335 0.1678  -0.0311 -0.1214 62  PHE Z C     
473  O O     . PHE A 62  ? 1.3002 0.6027 0.8933 0.1799  -0.0228 -0.1334 62  PHE Z O     
474  C CB    . PHE A 62  ? 1.1697 0.5002 0.7025 0.1574  -0.0012 -0.0965 62  PHE Z CB    
475  C CG    . PHE A 62  ? 1.1703 0.5250 0.6749 0.1513  0.0144  -0.0838 62  PHE Z CG    
476  C CD1   . PHE A 62  ? 1.2155 0.5615 0.6866 0.1374  0.0040  -0.0714 62  PHE Z CD1   
477  C CD2   . PHE A 62  ? 1.1448 0.5336 0.6571 0.1598  0.0397  -0.0829 62  PHE Z CD2   
478  C CE1   . PHE A 62  ? 1.1629 0.5349 0.6093 0.1320  0.0184  -0.0582 62  PHE Z CE1   
479  C CE2   . PHE A 62  ? 1.2161 0.6314 0.7034 0.1549  0.0542  -0.0694 62  PHE Z CE2   
480  C CZ    . PHE A 62  ? 1.1463 0.5536 0.6008 0.1408  0.0433  -0.0571 62  PHE Z CZ    
481  N N     . VAL A 63  ? 1.1930 0.4651 0.7652 0.1635  -0.0485 -0.1175 63  VAL Z N     
482  C CA    . VAL A 63  ? 1.1979 0.4591 0.8035 0.1729  -0.0593 -0.1270 63  VAL Z CA    
483  C C     . VAL A 63  ? 1.3800 0.6246 0.9951 0.1799  -0.0709 -0.1392 63  VAL Z C     
484  O O     . VAL A 63  ? 1.3786 0.6303 1.0243 0.1934  -0.0653 -0.1502 63  VAL Z O     
485  C CB    . VAL A 63  ? 1.2833 0.5258 0.8862 0.1654  -0.0789 -0.1200 63  VAL Z CB    
486  C CG1   . VAL A 63  ? 1.3191 0.5528 0.9564 0.1749  -0.0923 -0.1288 63  VAL Z CG1   
487  C CG2   . VAL A 63  ? 1.1886 0.4454 0.7852 0.1599  -0.0657 -0.1107 63  VAL Z CG2   
488  N N     . ASN A 64  ? 1.3364 0.5584 0.9253 0.1708  -0.0860 -0.1370 64  ASN Z N     
489  C CA    . ASN A 64  ? 1.3569 0.5576 0.9501 0.1759  -0.0964 -0.1484 64  ASN Z CA    
490  C C     . ASN A 64  ? 1.3469 0.5655 0.9460 0.1843  -0.0776 -0.1607 64  ASN Z C     
491  O O     . ASN A 64  ? 1.3910 0.6014 1.0108 0.1964  -0.0785 -0.1738 64  ASN Z O     
492  C CB    . ASN A 64  ? 1.3499 0.5237 0.9104 0.1618  -0.1134 -0.1425 64  ASN Z CB    
493  C CG    . ASN A 64  ? 1.3841 0.5351 0.9425 0.1566  -0.1356 -0.1323 64  ASN Z CG    
494  O OD1   . ASN A 64  ? 1.3654 0.5141 0.9505 0.1655  -0.1428 -0.1337 64  ASN Z OD1   
495  N ND2   . ASN A 64  ? 1.3171 0.4533 0.8439 0.1419  -0.1468 -0.1214 64  ASN Z ND2   
496  N N     . MET A 65  ? 1.3782 0.6227 0.9589 0.1786  -0.0600 -0.1559 65  MET Z N     
497  C CA    . MET A 65  ? 1.3615 0.6289 0.9460 0.1861  -0.0409 -0.1663 65  MET Z CA    
498  C C     . MET A 65  ? 1.3280 0.6142 0.9512 0.2037  -0.0272 -0.1736 65  MET Z C     
499  O O     . MET A 65  ? 1.2366 0.5277 0.8741 0.2150  -0.0198 -0.1870 65  MET Z O     
500  C CB    . MET A 65  ? 1.3181 0.6152 0.8771 0.1772  -0.0242 -0.1563 65  MET Z CB    
501  C CG    . MET A 65  ? 1.3059 0.6286 0.8634 0.1829  -0.0063 -0.1663 65  MET Z CG    
502  S SD    . MET A 65  ? 1.4166 0.7899 0.9800 0.1890  0.0244  -0.1554 65  MET Z SD    
503  C CE    . MET A 65  ? 1.3723 0.7468 0.9809 0.2054  0.0302  -0.1581 65  MET Z CE    
504  N N     . LEU A 66  ? 1.2845 0.5812 0.9242 0.2055  -0.0231 -0.1650 66  LEU Z N     
505  C CA    . LEU A 66  ? 1.2643 0.5782 0.9429 0.2205  -0.0115 -0.1707 66  LEU Z CA    
506  C C     . LEU A 66  ? 1.3715 0.6642 1.0760 0.2308  -0.0271 -0.1816 66  LEU Z C     
507  O O     . LEU A 66  ? 1.3974 0.7018 1.1286 0.2455  -0.0173 -0.1918 66  LEU Z O     
508  C CB    . LEU A 66  ? 1.2425 0.5674 0.9317 0.2173  -0.0060 -0.1598 66  LEU Z CB    
509  C CG    . LEU A 66  ? 1.1784 0.5298 0.8522 0.2126  0.0165  -0.1487 66  LEU Z CG    
510  C CD1   . LEU A 66  ? 1.1460 0.4981 0.8268 0.2077  0.0187  -0.1391 66  LEU Z CD1   
511  C CD2   . LEU A 66  ? 1.1438 0.5272 0.8350 0.2253  0.0418  -0.1536 66  LEU Z CD2   
512  N N     . LEU A 67  ? 1.3820 0.6448 1.0789 0.2241  -0.0507 -0.1782 67  LEU Z N     
513  C CA    . LEU A 67  ? 1.3759 0.6178 1.0964 0.2343  -0.0666 -0.1858 67  LEU Z CA    
514  C C     . LEU A 67  ? 1.3694 0.5985 1.0879 0.2429  -0.0650 -0.1994 67  LEU Z C     
515  O O     . LEU A 67  ? 1.3724 0.5982 1.1196 0.2582  -0.0656 -0.2086 67  LEU Z O     
516  C CB    . LEU A 67  ? 1.3898 0.6032 1.0984 0.2246  -0.0920 -0.1769 67  LEU Z CB    
517  C CG    . LEU A 67  ? 1.3512 0.5731 1.0689 0.2189  -0.0979 -0.1665 67  LEU Z CG    
518  C CD1   . LEU A 67  ? 1.2739 0.4685 0.9757 0.2093  -0.1233 -0.1576 67  LEU Z CD1   
519  C CD2   . LEU A 67  ? 1.3400 0.5792 1.1012 0.2323  -0.0936 -0.1719 67  LEU Z CD2   
520  N N     . SER A 68  ? 1.3526 0.5750 1.0371 0.2327  -0.0625 -0.2011 68  SER Z N     
521  C CA    . SER A 68  ? 1.3811 0.5887 1.0586 0.2379  -0.0609 -0.2157 68  SER Z CA    
522  C C     . SER A 68  ? 1.4380 0.6745 1.1343 0.2525  -0.0383 -0.2274 68  SER Z C     
523  O O     . SER A 68  ? 1.4432 0.6684 1.1486 0.2639  -0.0364 -0.2416 68  SER Z O     
524  C CB    . SER A 68  ? 1.3185 0.5144 0.9536 0.2202  -0.0643 -0.2144 68  SER Z CB    
525  O OG    . SER A 68  ? 1.3643 0.5945 0.9828 0.2132  -0.0466 -0.2095 68  SER Z OG    
526  N N     . HIS A 69  ? 1.4355 0.7082 1.1395 0.2535  -0.0209 -0.2209 69  HIS Z N     
527  C CA    . HIS A 69  ? 1.4213 0.7248 1.1422 0.2670  0.0016  -0.2295 69  HIS Z CA    
528  C C     . HIS A 69  ? 1.3835 0.6973 1.1482 0.2835  0.0052  -0.2311 69  HIS Z C     
529  O O     . HIS A 69  ? 1.3481 0.6907 1.1329 0.2955  0.0244  -0.2353 69  HIS Z O     
530  C CB    . HIS A 69  ? 1.4051 0.7445 1.1111 0.2604  0.0211  -0.2206 69  HIS Z CB    
531  C CG    . HIS A 69  ? 1.4144 0.7542 1.0803 0.2470  0.0224  -0.2215 69  HIS Z CG    
532  N ND1   . HIS A 69  ? 1.4260 0.7838 1.0828 0.2512  0.0365  -0.2328 69  HIS Z ND1   
533  C CD2   . HIS A 69  ? 1.4159 0.7433 1.0487 0.2289  0.0114  -0.2122 69  HIS Z CD2   
534  C CE1   . HIS A 69  ? 1.4228 0.7796 1.0426 0.2353  0.0335  -0.2308 69  HIS Z CE1   
535  N NE2   . HIS A 69  ? 1.4149 0.7535 1.0202 0.2217  0.0186  -0.2178 69  HIS Z NE2   
536  N N     . GLY A 70  ? 1.3455 0.6381 1.1252 0.2836  -0.0135 -0.2267 70  GLY Z N     
537  C CA    . GLY A 70  ? 1.2810 0.5832 1.1034 0.2979  -0.0133 -0.2276 70  GLY Z CA    
538  C C     . GLY A 70  ? 1.2717 0.6007 1.1118 0.2946  -0.0044 -0.2170 70  GLY Z C     
539  O O     . GLY A 70  ? 1.2604 0.6041 1.1377 0.3052  -0.0011 -0.2177 70  GLY Z O     
540  N N     . ILE A 71  ? 1.1913 0.5266 1.0052 0.2798  0.0000  -0.2071 71  ILE Z N     
541  C CA    . ILE A 71  ? 1.2814 0.6384 1.1081 0.2754  0.0104  -0.1972 71  ILE Z CA    
542  C C     . ILE A 71  ? 1.2543 0.5941 1.0875 0.2672  -0.0102 -0.1906 71  ILE Z C     
543  O O     . ILE A 71  ? 1.3062 0.6188 1.1179 0.2587  -0.0308 -0.1880 71  ILE Z O     
544  C CB    . ILE A 71  ? 1.2209 0.5917 1.0165 0.2641  0.0253  -0.1878 71  ILE Z CB    
545  C CG1   . ILE A 71  ? 1.2203 0.6033 0.9973 0.2680  0.0391  -0.1938 71  ILE Z CG1   
546  C CG2   . ILE A 71  ? 1.1884 0.5849 1.0025 0.2644  0.0441  -0.1798 71  ILE Z CG2   
547  C CD1   . ILE A 71  ? 1.2284 0.6401 1.0335 0.2847  0.0601  -0.2012 71  ILE Z CD1   
548  N N     . LYS A 72  ? 1.1530 0.5097 1.0161 0.2693  -0.0045 -0.1878 72  LYS Z N     
549  C CA    . LYS A 72  ? 1.1772 0.5230 1.0449 0.2594  -0.0221 -0.1817 72  LYS Z CA    
550  C C     . LYS A 72  ? 1.1753 0.5291 1.0257 0.2460  -0.0109 -0.1724 72  LYS Z C     
551  O O     . LYS A 72  ? 1.1804 0.5561 1.0513 0.2480  0.0078  -0.1714 72  LYS Z O     
552  C CB    . LYS A 72  ? 1.1977 0.5558 1.1105 0.2686  -0.0261 -0.1857 72  LYS Z CB    
553  C CG    . LYS A 72  ? 1.1563 0.5067 1.0744 0.2575  -0.0452 -0.1802 72  LYS Z CG    
554  C CD    . LYS A 72  ? 1.2645 0.6332 1.2290 0.2651  -0.0479 -0.1835 72  LYS Z CD    
555  C CE    . LYS A 72  ? 1.2914 0.6568 1.2591 0.2515  -0.0660 -0.1785 72  LYS Z CE    
556  N NZ    . LYS A 72  ? 1.3382 0.7245 1.3514 0.2568  -0.0705 -0.1813 72  LYS Z NZ    
557  N N     . PRO A 73  ? 0.8300 0.9005 0.7969 0.3294  -0.0331 -0.0423 73  PRO Z N     
558  C CA    . PRO A 73  ? 0.8229 0.8886 0.7814 0.2992  -0.0391 -0.0405 73  PRO Z CA    
559  C C     . PRO A 73  ? 0.8711 0.9737 0.8542 0.2778  -0.0433 -0.0249 73  PRO Z C     
560  O O     . PRO A 73  ? 0.9187 1.0326 0.9207 0.2814  -0.0517 -0.0148 73  PRO Z O     
561  C CB    . PRO A 73  ? 0.8184 0.8338 0.7608 0.2960  -0.0538 -0.0492 73  PRO Z CB    
562  C CG    . PRO A 73  ? 0.8587 0.8635 0.8105 0.3146  -0.0613 -0.0461 73  PRO Z CG    
563  C CD    . PRO A 73  ? 0.8776 0.9071 0.8396 0.3417  -0.0475 -0.0464 73  PRO Z CD    
564  N N     . ILE A 74  ? 0.8195 0.9365 0.7993 0.2551  -0.0393 -0.0227 74  ILE Z N     
565  C CA    . ILE A 74  ? 0.7753 0.9178 0.7694 0.2301  -0.0442 -0.0108 74  ILE Z CA    
566  C C     . ILE A 74  ? 0.7992 0.9138 0.7790 0.2073  -0.0488 -0.0190 74  ILE Z C     
567  O O     . ILE A 74  ? 0.9129 1.0221 0.8829 0.1983  -0.0442 -0.0245 74  ILE Z O     
568  C CB    . ILE A 74  ? 0.7455 0.9340 0.7523 0.2215  -0.0346 -0.0003 74  ILE Z CB    
569  C CG1   . ILE A 74  ? 0.6968 0.9222 0.7282 0.2447  -0.0277 0.0076  74  ILE Z CG1   
570  C CG2   . ILE A 74  ? 0.7625 0.9693 0.7770 0.1924  -0.0419 0.0104  74  ILE Z CG2   
571  C CD1   . ILE A 74  ? 0.6227 0.9005 0.6729 0.2347  -0.0176 0.0196  74  ILE Z CD1   
572  N N     . LEU A 75  ? 0.8035 0.8999 0.7829 0.1979  -0.0579 -0.0198 75  LEU Z N     
573  C CA    . LEU A 75  ? 0.7478 0.8202 0.7193 0.1783  -0.0591 -0.0301 75  LEU Z CA    
574  C C     . LEU A 75  ? 0.7683 0.8599 0.7416 0.1526  -0.0554 -0.0264 75  LEU Z C     
575  O O     . LEU A 75  ? 0.9130 1.0232 0.8892 0.1385  -0.0587 -0.0157 75  LEU Z O     
576  C CB    . LEU A 75  ? 0.7415 0.7909 0.7105 0.1732  -0.0669 -0.0322 75  LEU Z CB    
577  C CG    . LEU A 75  ? 0.7130 0.7371 0.6777 0.1962  -0.0735 -0.0352 75  LEU Z CG    
578  C CD1   . LEU A 75  ? 0.7705 0.7691 0.7305 0.1843  -0.0813 -0.0370 75  LEU Z CD1   
579  C CD2   . LEU A 75  ? 0.6802 0.6841 0.6366 0.2106  -0.0710 -0.0478 75  LEU Z CD2   
580  N N     . VAL A 76  ? 0.6793 0.7624 0.6489 0.1457  -0.0509 -0.0350 76  VAL Z N     
581  C CA    . VAL A 76  ? 0.6556 0.7491 0.6241 0.1220  -0.0476 -0.0340 76  VAL Z CA    
582  C C     . VAL A 76  ? 0.6825 0.7499 0.6508 0.1077  -0.0459 -0.0493 76  VAL Z C     
583  O O     . VAL A 76  ? 0.7158 0.7594 0.6885 0.1177  -0.0473 -0.0610 76  VAL Z O     
584  C CB    . VAL A 76  ? 0.5317 0.6335 0.4968 0.1227  -0.0442 -0.0313 76  VAL Z CB    
585  C CG1   . VAL A 76  ? 0.5329 0.6369 0.4947 0.0974  -0.0428 -0.0316 76  VAL Z CG1   
586  C CG2   . VAL A 76  ? 0.5785 0.7139 0.5481 0.1349  -0.0414 -0.0170 76  VAL Z CG2   
587  N N     . PHE A 77  ? 0.6741 0.7465 0.6379 0.0840  -0.0427 -0.0497 77  PHE Z N     
588  C CA    . PHE A 77  ? 0.6480 0.6992 0.6131 0.0697  -0.0363 -0.0665 77  PHE Z CA    
589  C C     . PHE A 77  ? 0.5623 0.6098 0.5233 0.0510  -0.0307 -0.0737 77  PHE Z C     
590  O O     . PHE A 77  ? 0.5670 0.6305 0.5179 0.0398  -0.0328 -0.0625 77  PHE Z O     
591  C CB    . PHE A 77  ? 0.5728 0.6240 0.5291 0.0557  -0.0348 -0.0650 77  PHE Z CB    
592  C CG    . PHE A 77  ? 0.6038 0.6512 0.5625 0.0721  -0.0421 -0.0585 77  PHE Z CG    
593  C CD1   . PHE A 77  ? 0.6227 0.6870 0.5795 0.0842  -0.0513 -0.0410 77  PHE Z CD1   
594  C CD2   . PHE A 77  ? 0.6703 0.6973 0.6359 0.0752  -0.0401 -0.0702 77  PHE Z CD2   
595  C CE1   . PHE A 77  ? 0.7160 0.7710 0.6743 0.1007  -0.0588 -0.0363 77  PHE Z CE1   
596  C CE2   . PHE A 77  ? 0.7752 0.7932 0.7397 0.0883  -0.0485 -0.0642 77  PHE Z CE2   
597  C CZ    . PHE A 77  ? 0.8235 0.8525 0.7825 0.1018  -0.0581 -0.0477 77  PHE Z CZ    
598  N N     . ASP A 78  ? 0.5411 0.5669 0.5126 0.0478  -0.0241 -0.0927 78  ASP Z N     
599  C CA    . ASP A 78  ? 0.6953 0.7101 0.6640 0.0317  -0.0181 -0.1034 78  ASP Z CA    
600  C C     . ASP A 78  ? 0.7383 0.7570 0.6861 0.0051  -0.0096 -0.1054 78  ASP Z C     
601  O O     . ASP A 78  ? 0.7531 0.7726 0.6960 -0.0018 -0.0038 -0.1087 78  ASP Z O     
602  C CB    . ASP A 78  ? 0.7017 0.6931 0.6949 0.0393  -0.0133 -0.1247 78  ASP Z CB    
603  C CG    . ASP A 78  ? 0.7672 0.7475 0.7742 0.0595  -0.0257 -0.1219 78  ASP Z CG    
604  O OD1   . ASP A 78  ? 0.7791 0.7484 0.7828 0.0564  -0.0303 -0.1212 78  ASP Z OD1   
605  O OD2   . ASP A 78  ? 0.8738 0.8527 0.8915 0.0767  -0.0323 -0.1202 78  ASP Z OD2   
606  N N     . GLY A 79  ? 0.7549 0.7730 0.6864 -0.0125 -0.0100 -0.1030 79  GLY Z N     
607  C CA    . GLY A 79  ? 0.6876 0.7063 0.5914 -0.0411 -0.0047 -0.1036 79  GLY Z CA    
608  C C     . GLY A 79  ? 0.7160 0.7075 0.6124 -0.0572 0.0095  -0.1280 79  GLY Z C     
609  O O     . GLY A 79  ? 0.7913 0.7691 0.7037 -0.0518 0.0231  -0.1487 79  GLY Z O     
610  N N     . CYS A 80  ? 0.7790 0.7632 0.6533 -0.0769 0.0068  -0.1263 80  CYS Z N     
611  C CA    . CYS A 80  ? 0.8743 0.8283 0.7357 -0.0937 0.0206  -0.1508 80  CYS Z CA    
612  C C     . CYS A 80  ? 0.8609 0.7917 0.7521 -0.0749 0.0225  -0.1669 80  CYS Z C     
613  O O     . CYS A 80  ? 0.8478 0.7831 0.7559 -0.0578 0.0085  -0.1539 80  CYS Z O     
614  C CB    . CYS A 80  ? 0.9027 0.8520 0.7255 -0.1236 0.0140  -0.1425 80  CYS Z CB    
615  S SG    . CYS A 80  ? 0.8983 0.8713 0.6844 -0.1497 0.0065  -0.1219 80  CYS Z SG    
616  N N     . THR A 81  ? 0.9503 0.8555 0.8476 -0.0785 0.0399  -0.1955 81  THR Z N     
617  C CA    . THR A 81  ? 0.9655 0.8455 0.8954 -0.0605 0.0401  -0.2123 81  THR Z CA    
618  C C     . THR A 81  ? 0.9234 0.7833 0.8364 -0.0685 0.0253  -0.2035 81  THR Z C     
619  O O     . THR A 81  ? 1.0152 0.8665 0.8904 -0.0947 0.0258  -0.2017 81  THR Z O     
620  C CB    . THR A 81  ? 1.0899 0.9485 1.0326 -0.0633 0.0646  -0.2469 81  THR Z CB    
621  O OG1   . THR A 81  ? 1.1686 1.0485 1.1274 -0.0590 0.0792  -0.2536 81  THR Z OG1   
622  C CG2   . THR A 81  ? 1.1210 0.9539 1.1061 -0.0411 0.0615  -0.2635 81  THR Z CG2   
623  N N     . LEU A 82  ? 0.9425 0.7934 0.8806 -0.0483 0.0102  -0.1966 82  LEU Z N     
624  C CA    . LEU A 82  ? 0.8999 0.7275 0.8234 -0.0562 -0.0049 -0.1876 82  LEU Z CA    
625  C C     . LEU A 82  ? 0.9244 0.7063 0.8615 -0.0532 0.0004  -0.2147 82  LEU Z C     
626  O O     . LEU A 82  ? 0.9069 0.6796 0.8843 -0.0313 0.0063  -0.2329 82  LEU Z O     
627  C CB    . LEU A 82  ? 0.8969 0.7346 0.8334 -0.0389 -0.0245 -0.1646 82  LEU Z CB    
628  C CG    . LEU A 82  ? 0.8991 0.7235 0.8132 -0.0520 -0.0413 -0.1462 82  LEU Z CG    
629  C CD1   . LEU A 82  ? 0.8415 0.6958 0.7231 -0.0771 -0.0417 -0.1270 82  LEU Z CD1   
630  C CD2   . LEU A 82  ? 0.8403 0.6678 0.7675 -0.0333 -0.0572 -0.1289 82  LEU Z CD2   
631  N N     . PRO A 83  ? 0.8978 0.6505 0.8035 -0.0752 -0.0022 -0.2182 83  PRO Z N     
632  C CA    . PRO A 83  ? 0.9995 0.7021 0.9157 -0.0720 0.0017  -0.2449 83  PRO Z CA    
633  C C     . PRO A 83  ? 1.0327 0.7130 0.9887 -0.0451 -0.0161 -0.2428 83  PRO Z C     
634  O O     . PRO A 83  ? 1.0356 0.6950 1.0317 -0.0252 -0.0089 -0.2677 83  PRO Z O     
635  C CB    . PRO A 83  ? 0.9217 0.5991 0.7892 -0.1032 -0.0064 -0.2380 83  PRO Z CB    
636  C CG    . PRO A 83  ? 0.9038 0.6219 0.7371 -0.1261 -0.0033 -0.2199 83  PRO Z CG    
637  C CD    . PRO A 83  ? 0.8462 0.6112 0.7055 -0.1060 -0.0081 -0.1993 83  PRO Z CD    
638  N N     . SER A 84  ? 0.9792 0.6654 0.9246 -0.0455 -0.0394 -0.2130 84  SER Z N     
639  C CA    . SER A 84  ? 1.1174 0.7799 1.0898 -0.0246 -0.0610 -0.2055 84  SER Z CA    
640  C C     . SER A 84  ? 1.1663 0.8422 1.1898 0.0059  -0.0584 -0.2163 84  SER Z C     
641  O O     . SER A 84  ? 1.2726 0.9211 1.3285 0.0254  -0.0746 -0.2196 84  SER Z O     
642  C CB    . SER A 84  ? 1.1317 0.8095 1.0780 -0.0328 -0.0812 -0.1699 84  SER Z CB    
643  O OG    . SER A 84  ? 1.1757 0.8329 1.0832 -0.0603 -0.0898 -0.1584 84  SER Z OG    
644  N N     . LYS A 85  ? 1.2307 0.9474 1.2612 0.0084  -0.0403 -0.2205 85  LYS Z N     
645  C CA    . LYS A 85  ? 1.1283 0.8628 1.2044 0.0334  -0.0385 -0.2276 85  LYS Z CA    
646  C C     . LYS A 85  ? 1.1971 0.9358 1.3032 0.0370  -0.0116 -0.2601 85  LYS Z C     
647  O O     . LYS A 85  ? 1.2386 0.9910 1.3910 0.0564  -0.0078 -0.2706 85  LYS Z O     
648  C CB    . LYS A 85  ? 0.9401 0.7171 1.0027 0.0347  -0.0405 -0.2054 85  LYS Z CB    
649  C CG    . LYS A 85  ? 0.8775 0.6657 0.9786 0.0593  -0.0492 -0.2042 85  LYS Z CG    
650  C CD    . LYS A 85  ? 0.7904 0.6149 0.8724 0.0596  -0.0495 -0.1846 85  LYS Z CD    
651  C CE    . LYS A 85  ? 0.8118 0.6430 0.9277 0.0816  -0.0589 -0.1849 85  LYS Z CE    
652  N NZ    . LYS A 85  ? 0.6724 0.5337 0.7692 0.0828  -0.0572 -0.1697 85  LYS Z NZ    
653  N N     . LYS A 86  ? 1.2188 0.9452 1.2974 0.0166  0.0074  -0.2762 86  LYS Z N     
654  C CA    . LYS A 86  ? 1.1928 0.9264 1.2873 0.0140  0.0387  -0.3072 86  LYS Z CA    
655  C C     . LYS A 86  ? 1.2024 0.9216 1.3634 0.0404  0.0436  -0.3334 86  LYS Z C     
656  O O     . LYS A 86  ? 1.3001 1.0431 1.4963 0.0477  0.0656  -0.3523 86  LYS Z O     
657  C CB    . LYS A 86  ? 1.1945 0.9063 1.2415 -0.0138 0.0559  -0.3219 86  LYS Z CB    
658  C CG    . LYS A 86  ? 1.1979 0.9199 1.2477 -0.0222 0.0917  -0.3522 86  LYS Z CG    
659  C CD    . LYS A 86  ? 1.2636 0.9684 1.2491 -0.0563 0.1065  -0.3605 86  LYS Z CD    
660  C CE    . LYS A 86  ? 1.2561 0.9878 1.1905 -0.0794 0.0936  -0.3275 86  LYS Z CE    
661  N NZ    . LYS A 86  ? 1.3291 1.0450 1.2002 -0.1153 0.1049  -0.3342 86  LYS Z NZ    
662  N N     . GLU A 87  ? 1.1303 0.8339 2.1638 -0.0813 -0.3442 0.0964  87  GLU Z N     
663  C CA    . GLU A 87  ? 1.0959 0.8072 2.0879 -0.0738 -0.3251 0.0825  87  GLU Z CA    
664  C C     . GLU A 87  ? 1.0291 0.7820 1.9827 -0.0764 -0.2676 0.0793  87  GLU Z C     
665  O O     . GLU A 87  ? 1.0636 0.8134 1.9502 -0.0632 -0.2528 0.0541  87  GLU Z O     
666  C CB    . GLU A 87  ? 1.1419 0.8622 2.1881 -0.0844 -0.3334 0.1016  87  GLU Z CB    
667  C CG    . GLU A 87  ? 1.2996 0.9705 2.3727 -0.0830 -0.3909 0.1004  87  GLU Z CG    
668  C CD    . GLU A 87  ? 1.4018 1.0753 2.5273 -0.0954 -0.3960 0.1220  87  GLU Z CD    
669  O OE1   . GLU A 87  ? 1.4161 1.1330 2.5653 -0.1050 -0.3554 0.1417  87  GLU Z OE1   
670  O OE2   . GLU A 87  ? 1.4635 1.0910 2.6023 -0.0951 -0.4404 0.1194  87  GLU Z OE2   
671  N N     . VAL A 88  ? 1.0243 0.8149 2.0198 -0.0936 -0.2352 0.1048  88  VAL Z N     
672  C CA    . VAL A 88  ? 1.0498 0.8759 2.0105 -0.0993 -0.1819 0.1030  88  VAL Z CA    
673  C C     . VAL A 88  ? 1.1277 0.9340 2.0248 -0.0911 -0.1703 0.0831  88  VAL Z C     
674  O O     . VAL A 88  ? 1.1418 0.9606 1.9819 -0.0899 -0.1376 0.0649  88  VAL Z O     
675  C CB    . VAL A 88  ? 1.0094 0.8702 2.0244 -0.1167 -0.1525 0.1362  88  VAL Z CB    
676  C CG1   . VAL A 88  ? 0.9883 0.8820 1.9648 -0.1240 -0.0991 0.1337  88  VAL Z CG1   
677  C CG2   . VAL A 88  ? 0.9663 0.8378 2.0460 -0.1236 -0.1671 0.1585  88  VAL Z CG2   
678  N N     . GLU A 89  ? 1.0864 0.8609 1.9919 -0.0849 -0.1985 0.0854  89  GLU Z N     
679  C CA    . GLU A 89  ? 1.1040 0.8515 1.9458 -0.0738 -0.1890 0.0686  89  GLU Z CA    
680  C C     . GLU A 89  ? 1.1338 0.8554 1.9043 -0.0569 -0.1957 0.0359  89  GLU Z C     
681  O O     . GLU A 89  ? 1.1188 0.8274 1.8229 -0.0505 -0.1702 0.0193  89  GLU Z O     
682  C CB    . GLU A 89  ? 1.1245 0.8428 1.9916 -0.0659 -0.2261 0.0765  89  GLU Z CB    
683  C CG    . GLU A 89  ? 1.1028 0.8504 2.0442 -0.0797 -0.2201 0.1102  89  GLU Z CG    
684  C CD    . GLU A 89  ? 1.1352 0.8830 2.0462 -0.0766 -0.1871 0.1170  89  GLU Z CD    
685  O OE1   . GLU A 89  ? 1.1854 0.9007 2.0197 -0.0630 -0.1778 0.0953  89  GLU Z OE1   
686  O OE2   . GLU A 89  ? 1.1163 0.8934 2.0768 -0.0862 -0.1691 0.1449  89  GLU Z OE2   
687  N N     . ARG A 90  ? 1.2231 0.9346 2.0057 -0.0487 -0.2291 0.0277  90  ARG Z N     
688  C CA    . ARG A 90  ? 1.2845 0.9729 2.0014 -0.0289 -0.2367 -0.0017 90  ARG Z CA    
689  C C     . ARG A 90  ? 1.2765 1.0100 1.9667 -0.0348 -0.1917 -0.0106 90  ARG Z C     
690  O O     . ARG A 90  ? 1.2507 0.9794 1.8784 -0.0221 -0.1776 -0.0343 90  ARG Z O     
691  C CB    . ARG A 90  ? 1.2861 0.9411 2.0194 -0.0151 -0.2901 -0.0076 90  ARG Z CB    
692  C CG    . ARG A 90  ? 1.2808 0.8943 1.9408 0.0129  -0.3091 -0.0377 90  ARG Z CG    
693  C CD    . ARG A 90  ? 1.2606 0.8820 1.9146 0.0233  -0.3172 -0.0465 90  ARG Z CD    
694  N NE    . ARG A 90  ? 1.2429 0.8471 1.9542 0.0181  -0.3577 -0.0318 90  ARG Z NE    
695  C CZ    . ARG A 90  ? 1.1634 0.8043 1.9284 0.0017  -0.3452 -0.0120 90  ARG Z CZ    
696  N NH1   . ARG A 90  ? 1.1020 0.8003 1.8703 -0.0098 -0.2961 -0.0060 90  ARG Z NH1   
697  N NH2   . ARG A 90  ? 1.1471 0.7641 1.9598 -0.0033 -0.3820 0.0014  90  ARG Z NH2   
698  N N     . SER A 91  ? 1.2048 0.9837 1.9417 -0.0533 -0.1691 0.0081  91  SER Z N     
699  C CA    . SER A 91  ? 1.2107 1.0359 1.9275 -0.0579 -0.1333 -0.0014 91  SER Z CA    
700  C C     . SER A 91  ? 1.1179 0.9644 1.7976 -0.0725 -0.0839 -0.0061 91  SER Z C     
701  O O     . SER A 91  ? 1.1838 1.0426 1.8112 -0.0694 -0.0605 -0.0283 91  SER Z O     
702  C CB    . SER A 91  ? 1.2507 1.1115 2.0249 -0.0684 -0.1310 0.0188  91  SER Z CB    
703  O OG    . SER A 91  ? 1.2805 1.1540 2.1012 -0.0874 -0.1156 0.0463  91  SER Z OG    
704  N N     . ARG A 92  ? 1.1209 0.9670 1.8256 -0.0876 -0.0691 0.0149  92  ARG Z N     
705  C CA    . ARG A 92  ? 0.9900 0.8457 1.6576 -0.1025 -0.0231 0.0134  92  ARG Z CA    
706  C C     . ARG A 92  ? 1.0381 0.8557 1.6359 -0.0919 -0.0171 -0.0084 92  ARG Z C     
707  O O     . ARG A 92  ? 1.0678 0.8979 1.6169 -0.1008 0.0203  -0.0235 92  ARG Z O     
708  C CB    . ARG A 92  ? 0.9262 0.7759 1.6297 -0.1129 -0.0158 0.0412  92  ARG Z CB    
709  C CG    . ARG A 92  ? 0.8623 0.7455 1.6334 -0.1237 -0.0150 0.0677  92  ARG Z CG    
710  C CD    . ARG A 92  ? 0.8538 0.7310 1.6509 -0.1309 -0.0018 0.0943  92  ARG Z CD    
711  N NE    . ARG A 92  ? 0.8374 0.7474 1.6908 -0.1415 0.0095  0.1213  92  ARG Z NE    
712  C CZ    . ARG A 92  ? 0.8440 0.7551 1.7390 -0.1445 0.0142  0.1501  92  ARG Z CZ    
713  N NH1   . ARG A 92  ? 0.8421 0.7264 1.7309 -0.1373 0.0066  0.1552  92  ARG Z NH1   
714  N NH2   . ARG A 92  ? 0.8402 0.7799 1.7819 -0.1522 0.0270  0.1744  92  ARG Z NH2   
715  N N     . ARG A 93  ? 1.0719 0.8421 1.6641 -0.0730 -0.0545 -0.0102 93  ARG Z N     
716  C CA    . ARG A 93  ? 1.1537 0.8791 1.6752 -0.0567 -0.0547 -0.0309 93  ARG Z CA    
717  C C     . ARG A 93  ? 1.1492 0.8851 1.6258 -0.0474 -0.0462 -0.0569 93  ARG Z C     
718  O O     . ARG A 93  ? 1.1696 0.8890 1.5811 -0.0439 -0.0197 -0.0739 93  ARG Z O     
719  C CB    . ARG A 93  ? 1.2178 0.8924 1.7477 -0.0349 -0.1061 -0.0291 93  ARG Z CB    
720  C CG    . ARG A 93  ? 1.3035 0.9250 1.7562 -0.0125 -0.1110 -0.0504 93  ARG Z CG    
721  C CD    . ARG A 93  ? 1.4003 0.9804 1.8586 0.0126  -0.1706 -0.0582 93  ARG Z CD    
722  N NE    . ARG A 93  ? 1.5200 1.0437 1.8991 0.0385  -0.1779 -0.0787 93  ARG Z NE    
723  C CZ    . ARG A 93  ? 1.6107 1.0913 1.9667 0.0650  -0.2233 -0.0938 93  ARG Z CZ    
724  N NH1   . ARG A 93  ? 1.6178 1.1042 2.0243 0.0667  -0.2650 -0.0910 93  ARG Z NH1   
725  N NH2   . ARG A 93  ? 1.6777 1.1043 1.9551 0.0907  -0.2265 -0.1118 93  ARG Z NH2   
726  N N     . GLU A 94  ? 1.1149 0.8784 1.6253 -0.0423 -0.0667 -0.0590 94  GLU Z N     
727  C CA    . GLU A 94  ? 1.1922 0.9744 1.6654 -0.0304 -0.0587 -0.0821 94  GLU Z CA    
728  C C     . GLU A 94  ? 1.1919 1.0290 1.6497 -0.0532 -0.0049 -0.0885 94  GLU Z C     
729  O O     . GLU A 94  ? 1.1973 1.0372 1.6008 -0.0513 0.0220  -0.1079 94  GLU Z O     
730  C CB    . GLU A 94  ? 1.2612 1.0567 1.7718 -0.0168 -0.0942 -0.0814 94  GLU Z CB    
731  C CG    . GLU A 94  ? 1.3795 1.1743 1.8440 0.0086  -0.1007 -0.1060 94  GLU Z CG    
732  C CD    . GLU A 94  ? 1.4799 1.2072 1.8902 0.0350  -0.1268 -0.1199 94  GLU Z CD    
733  O OE1   . GLU A 94  ? 1.5183 1.2435 1.8695 0.0496  -0.1079 -0.1402 94  GLU Z OE1   
734  O OE2   . GLU A 94  ? 1.5168 1.1942 1.9439 0.0417  -0.1665 -0.1107 94  GLU Z OE2   
735  N N     . ARG A 95  ? 1.1449 1.0243 1.6501 -0.0753 0.0107  -0.0721 95  ARG Z N     
736  C CA    . ARG A 95  ? 1.1314 1.0648 1.6276 -0.0996 0.0577  -0.0778 95  ARG Z CA    
737  C C     . ARG A 95  ? 1.0860 0.9984 1.5237 -0.1135 0.0966  -0.0874 95  ARG Z C     
738  O O     . ARG A 95  ? 1.1421 1.0798 1.5422 -0.1199 0.1254  -0.1073 95  ARG Z O     
739  C CB    . ARG A 95  ? 1.1328 1.0975 1.6817 -0.1195 0.0669  -0.0552 95  ARG Z CB    
740  C CG    . ARG A 95  ? 1.1502 1.1747 1.6943 -0.1430 0.1078  -0.0626 95  ARG Z CG    
741  C CD    . ARG A 95  ? 1.1586 1.2164 1.7554 -0.1532 0.1081  -0.0421 95  ARG Z CD    
742  N NE    . ARG A 95  ? 1.1879 1.2316 1.7877 -0.1735 0.1325  -0.0234 95  ARG Z NE    
743  C CZ    . ARG A 95  ? 1.1808 1.2533 1.7643 -0.1978 0.1708  -0.0260 95  ARG Z CZ    
744  N NH1   . ARG A 95  ? 1.1332 1.1842 1.7143 -0.2119 0.1910  -0.0077 95  ARG Z NH1   
745  N NH2   . ARG A 95  ? 1.2129 1.3363 1.7817 -0.2074 0.1883  -0.0473 95  ARG Z NH2   
746  N N     . ARG A 96  ? 1.1090 0.9746 1.5388 -0.1169 0.0973  -0.0729 96  ARG Z N     
747  C CA    . ARG A 96  ? 1.0611 0.8893 1.4275 -0.1251 0.1307  -0.0797 96  ARG Z CA    
748  C C     . ARG A 96  ? 1.0826 0.8934 1.3904 -0.1101 0.1362  -0.1044 96  ARG Z C     
749  O O     . ARG A 96  ? 1.0989 0.9229 1.3631 -0.1271 0.1784  -0.1184 96  ARG Z O     
750  C CB    . ARG A 96  ? 1.0587 0.8285 1.4215 -0.1147 0.1141  -0.0628 96  ARG Z CB    
751  C CG    . ARG A 96  ? 1.0187 0.8030 1.4456 -0.1230 0.1027  -0.0353 96  ARG Z CG    
752  C CD    . ARG A 96  ? 1.0438 0.7762 1.4649 -0.1108 0.0887  -0.0199 96  ARG Z CD    
753  N NE    . ARG A 96  ? 1.1035 0.8480 1.6001 -0.1070 0.0563  0.0048  96  ARG Z NE    
754  C CZ    . ARG A 96  ? 1.1591 0.9328 1.6975 -0.1233 0.0736  0.0269  96  ARG Z CZ    
755  N NH1   . ARG A 96  ? 1.1470 0.9381 1.6564 -0.1444 0.1203  0.0258  96  ARG Z NH1   
756  N NH2   . ARG A 96  ? 0.9514 0.7357 1.5600 -0.1189 0.0446  0.0502  96  ARG Z NH2   
757  N N     . GLN A 97  ? 1.1087 0.8897 1.4156 -0.0789 0.0936  -0.1095 97  GLN Z N     
758  C CA    . GLN A 97  ? 1.2216 0.9790 1.4697 -0.0577 0.0948  -0.1314 97  GLN Z CA    
759  C C     . GLN A 97  ? 1.2838 1.1042 1.5233 -0.0706 0.1291  -0.1483 97  GLN Z C     
760  O O     . GLN A 97  ? 1.3157 1.1326 1.5015 -0.0783 0.1672  -0.1622 97  GLN Z O     
761  C CB    . GLN A 97  ? 1.2546 0.9790 1.5112 -0.0220 0.0390  -0.1346 97  GLN Z CB    
762  C CG    . GLN A 97  ? 1.3328 1.0308 1.5257 0.0061  0.0372  -0.1572 97  GLN Z CG    
763  C CD    . GLN A 97  ? 1.3563 1.0136 1.5515 0.0424  -0.0210 -0.1614 97  GLN Z CD    
764  O OE1   . GLN A 97  ? 1.3882 1.0079 1.6113 0.0492  -0.0615 -0.1490 97  GLN Z OE1   
765  N NE2   . GLN A 97  ? 1.3329 0.9979 1.4980 0.0659  -0.0251 -0.1790 97  GLN Z NE2   
766  N N     . ALA A 98  ? 1.2080 1.0880 1.5017 -0.0740 0.1172  -0.1463 98  ALA Z N     
767  C CA    . ALA A 98  ? 1.2385 1.1893 1.5329 -0.0845 0.1457  -0.1622 98  ALA Z CA    
768  C C     . ALA A 98  ? 1.2311 1.2074 1.5061 -0.1233 0.1996  -0.1654 98  ALA Z C     
769  O O     . ALA A 98  ? 1.2986 1.2955 1.5360 -0.1319 0.2334  -0.1827 98  ALA Z O     
770  C CB    . ALA A 98  ? 1.2002 1.2076 1.5560 -0.0819 0.1240  -0.1565 98  ALA Z CB    
771  N N     . ASN A 99  ? 1.2580 1.2287 1.5560 -0.1468 0.2082  -0.1482 99  ASN Z N     
772  C CA    . ASN A 99  ? 1.1905 1.1775 1.4675 -0.1848 0.2569  -0.1505 99  ASN Z CA    
773  C C     . ASN A 99  ? 1.2113 1.1383 1.4157 -0.1890 0.2863  -0.1578 99  ASN Z C     
774  O O     . ASN A 99  ? 1.1244 1.0616 1.2966 -0.2200 0.3314  -0.1661 99  ASN Z O     
775  C CB    . ASN A 99  ? 1.1273 1.1109 1.4383 -0.2029 0.2573  -0.1286 99  ASN Z CB    
776  C CG    . ASN A 99  ? 1.0372 1.0819 1.4134 -0.2027 0.2374  -0.1215 99  ASN Z CG    
777  O OD1   . ASN A 99  ? 1.0501 1.1521 1.4397 -0.2263 0.2607  -0.1277 99  ASN Z OD1   
778  N ND2   . ASN A 99  ? 0.9668 0.9971 1.3817 -0.1761 0.1937  -0.1086 99  ASN Z ND2   
779  N N     . LEU A 100 ? 1.2338 1.0952 1.4096 -0.1578 0.2605  -0.1550 100 LEU Z N     
780  C CA    . LEU A 100 ? 1.2881 1.0858 1.3884 -0.1557 0.2866  -0.1616 100 LEU Z CA    
781  C C     . LEU A 100 ? 1.3116 1.1305 1.3756 -0.1495 0.3067  -0.1838 100 LEU Z C     
782  O O     . LEU A 100 ? 1.3236 1.1186 1.3288 -0.1638 0.3487  -0.1928 100 LEU Z O     
783  C CB    . LEU A 100 ? 1.3430 1.0633 1.4232 -0.1222 0.2500  -0.1514 100 LEU Z CB    
784  C CG    . LEU A 100 ? 1.4146 1.0586 1.4100 -0.1142 0.2744  -0.1561 100 LEU Z CG    
785  C CD1   . LEU A 100 ? 1.4202 1.0514 1.3865 -0.1499 0.3232  -0.1498 100 LEU Z CD1   
786  C CD2   . LEU A 100 ? 1.4355 1.0097 1.4169 -0.0775 0.2307  -0.1472 100 LEU Z CD2   
787  N N     . LEU A 101 ? 1.2772 1.1400 1.3748 -0.1274 0.2782  -0.1916 101 LEU Z N     
788  C CA    . LEU A 101 ? 1.3196 1.2121 1.3890 -0.1167 0.2958  -0.2115 101 LEU Z CA    
789  C C     . LEU A 101 ? 1.3750 1.3499 1.4641 -0.1561 0.3395  -0.2216 101 LEU Z C     
790  O O     . LEU A 101 ? 1.4892 1.4650 1.5349 -0.1762 0.3847  -0.2325 101 LEU Z O     
791  C CB    . LEU A 101 ? 1.2535 1.1637 1.3489 -0.0770 0.2501  -0.2162 101 LEU Z CB    
792  C CG    . LEU A 101 ? 1.2672 1.2110 1.3347 -0.0579 0.2648  -0.2357 101 LEU Z CG    
793  C CD1   . LEU A 101 ? 1.3406 1.2114 1.3283 -0.0420 0.2832  -0.2420 101 LEU Z CD1   
794  C CD2   . LEU A 101 ? 1.2580 1.2183 1.3516 -0.0180 0.2181  -0.2389 101 LEU Z CD2   
795  N N     . LYS A 102 ? 1.3265 1.3691 1.4808 -0.1671 0.3251  -0.2178 102 LYS Z N     
796  C CA    . LYS A 102 ? 1.3260 1.4559 1.5092 -0.2029 0.3576  -0.2278 102 LYS Z CA    
797  C C     . LYS A 102 ? 1.3688 1.4813 1.5146 -0.2472 0.4081  -0.2301 102 LYS Z C     
798  O O     . LYS A 102 ? 1.3994 1.5527 1.5279 -0.2707 0.4472  -0.2460 102 LYS Z O     
799  C CB    . LYS A 102 ? 1.2693 1.4483 1.5190 -0.2089 0.3327  -0.2175 102 LYS Z CB    
800  C CG    . LYS A 102 ? 1.2720 1.5508 1.5570 -0.2364 0.3552  -0.2304 102 LYS Z CG    
801  C CD    . LYS A 102 ? 1.3036 1.6493 1.6140 -0.2062 0.3365  -0.2434 102 LYS Z CD    
802  C CE    . LYS A 102 ? 1.3085 1.6421 1.6550 -0.1693 0.2848  -0.2304 102 LYS Z CE    
803  N NZ    . LYS A 102 ? 1.3033 1.6950 1.6676 -0.1359 0.2658  -0.2424 102 LYS Z NZ    
804  N N     . GLY A 103 ? 1.3243 1.3745 1.4564 -0.2582 0.4077  -0.2138 103 GLY Z N     
805  C CA    . GLY A 103 ? 1.3768 1.3903 1.4615 -0.2959 0.4535  -0.2139 103 GLY Z CA    
806  C C     . GLY A 103 ? 1.4559 1.4348 1.4735 -0.2978 0.4893  -0.2272 103 GLY Z C     
807  O O     . GLY A 103 ? 1.4759 1.4847 1.4757 -0.3358 0.5341  -0.2395 103 GLY Z O     
808  N N     . LYS A 104 ? 1.4621 1.3778 1.4417 -0.2575 0.4699  -0.2249 104 LYS Z N     
809  C CA    . LYS A 104 ? 1.4719 1.3482 1.3819 -0.2521 0.5028  -0.2362 104 LYS Z CA    
810  C C     . LYS A 104 ? 1.4647 1.4272 1.3942 -0.2596 0.5234  -0.2549 104 LYS Z C     
811  O O     . LYS A 104 ? 1.5839 1.5502 1.4738 -0.2842 0.5718  -0.2657 104 LYS Z O     
812  C CB    . LYS A 104 ? 1.4602 1.2564 1.3287 -0.2009 0.4700  -0.2312 104 LYS Z CB    
813  C CG    . LYS A 104 ? 1.4552 1.1616 1.2911 -0.1932 0.4580  -0.2145 104 LYS Z CG    
814  C CD    . LYS A 104 ? 1.4652 1.1032 1.2720 -0.1407 0.4152  -0.2110 104 LYS Z CD    
815  C CE    . LYS A 104 ? 1.4833 1.0434 1.2672 -0.1310 0.3991  -0.1941 104 LYS Z CE    
816  N NZ    . LYS A 104 ? 1.5133 1.0135 1.2782 -0.0812 0.3500  -0.1914 104 LYS Z NZ    
817  N N     . GLN A 105 ? 1.4248 1.4574 1.4159 -0.2388 0.4876  -0.2580 105 GLN Z N     
818  C CA    . GLN A 105 ? 1.4483 1.5752 1.4674 -0.2409 0.5020  -0.2749 105 GLN Z CA    
819  C C     . GLN A 105 ? 1.4321 1.6305 1.4757 -0.2974 0.5442  -0.2838 105 GLN Z C     
820  O O     . GLN A 105 ? 1.4880 1.7520 1.5354 -0.3131 0.5764  -0.2991 105 GLN Z O     
821  C CB    . GLN A 105 ? 1.4314 1.6151 1.5108 -0.2070 0.4531  -0.2746 105 GLN Z CB    
822  C CG    . GLN A 105 ? 1.4772 1.7621 1.5863 -0.1997 0.4630  -0.2915 105 GLN Z CG    
823  C CD    . GLN A 105 ? 1.6124 1.8823 1.6681 -0.1787 0.4888  -0.3024 105 GLN Z CD    
824  O OE1   . GLN A 105 ? 1.7167 1.8961 1.7157 -0.1477 0.4786  -0.2975 105 GLN Z OE1   
825  N NE2   . GLN A 105 ? 1.6088 1.9704 1.6830 -0.1948 0.5227  -0.3173 105 GLN Z NE2   
826  N N     . LEU A 106 ? 1.4397 1.6271 1.5009 -0.3276 0.5432  -0.2741 106 LEU Z N     
827  C CA    . LEU A 106 ? 1.4543 1.6998 1.5344 -0.3829 0.5794  -0.2829 106 LEU Z CA    
828  C C     . LEU A 106 ? 1.5302 1.7147 1.5418 -0.4195 0.6322  -0.2860 106 LEU Z C     
829  O O     . LEU A 106 ? 1.5308 1.7630 1.5466 -0.4679 0.6711  -0.2982 106 LEU Z O     
830  C CB    . LEU A 106 ? 1.3986 1.6531 1.5194 -0.3977 0.5572  -0.2713 106 LEU Z CB    
831  C CG    . LEU A 106 ? 1.3362 1.6613 1.5270 -0.3696 0.5119  -0.2694 106 LEU Z CG    
832  C CD1   . LEU A 106 ? 1.3244 1.6280 1.5420 -0.3734 0.4877  -0.2518 106 LEU Z CD1   
833  C CD2   . LEU A 106 ? 1.3093 1.7529 1.5450 -0.3887 0.5248  -0.2889 106 LEU Z CD2   
834  N N     . LEU A 107 ? 1.5264 1.6044 1.4731 -0.3963 0.6332  -0.2754 107 LEU Z N     
835  C CA    . LEU A 107 ? 1.6010 1.6072 1.4709 -0.4244 0.6840  -0.2771 107 LEU Z CA    
836  C C     . LEU A 107 ? 1.7258 1.7591 1.5702 -0.4261 0.7197  -0.2921 107 LEU Z C     
837  O O     . LEU A 107 ? 1.7419 1.7589 1.5440 -0.4664 0.7721  -0.2990 107 LEU Z O     
838  C CB    . LEU A 107 ? 1.5877 1.4710 1.3930 -0.3937 0.6720  -0.2609 107 LEU Z CB    
839  C CG    . LEU A 107 ? 1.5351 1.3718 1.3428 -0.4036 0.6576  -0.2445 107 LEU Z CG    
840  C CD1   . LEU A 107 ? 1.6311 1.3495 1.3686 -0.3723 0.6515  -0.2303 107 LEU Z CD1   
841  C CD2   . LEU A 107 ? 1.4942 1.3480 1.2959 -0.4641 0.6996  -0.2494 107 LEU Z CD2   
842  N N     . ARG A 108 ? 1.6518 1.2158 1.8238 -0.1712 0.4195  -0.1584 108 ARG Z N     
843  C CA    . ARG A 108 ? 1.7348 1.3085 1.9119 -0.1766 0.4384  -0.1617 108 ARG Z CA    
844  C C     . ARG A 108 ? 1.8240 1.4592 2.0427 -0.1832 0.4434  -0.1736 108 ARG Z C     
845  O O     . ARG A 108 ? 1.8552 1.5021 2.0840 -0.1965 0.4611  -0.1804 108 ARG Z O     
846  C CB    . ARG A 108 ? 1.6852 1.2451 1.8459 -0.1592 0.4391  -0.1531 108 ARG Z CB    
847  C CG    . ARG A 108 ? 1.6298 1.1346 1.7476 -0.1563 0.4357  -0.1419 108 ARG Z CG    
848  C CD    . ARG A 108 ? 1.6285 1.1249 1.7325 -0.1378 0.4285  -0.1357 108 ARG Z CD    
849  N NE    . ARG A 108 ? 1.6725 1.1222 1.7346 -0.1376 0.4247  -0.1254 108 ARG Z NE    
850  C CZ    . ARG A 108 ? 1.7083 1.1431 1.7514 -0.1246 0.4154  -0.1200 108 ARG Z CZ    
851  N NH1   . ARG A 108 ? 1.7018 1.1603 1.7650 -0.1092 0.4105  -0.1233 108 ARG Z NH1   
852  N NH2   . ARG A 108 ? 1.7537 1.1516 1.7585 -0.1271 0.4117  -0.1104 108 ARG Z NH2   
853  N N     . GLU A 109 ? 1.6969 1.3743 1.9400 -0.1745 0.4275  -0.1753 109 GLU Z N     
854  C CA    . GLU A 109 ? 1.7296 1.4752 2.0137 -0.1799 0.4296  -0.1841 109 GLU Z CA    
855  C C     . GLU A 109 ? 1.7214 1.4864 2.0185 -0.2051 0.4315  -0.1987 109 GLU Z C     
856  O O     . GLU A 109 ? 1.7639 1.5897 2.0939 -0.2152 0.4334  -0.2083 109 GLU Z O     
857  C CB    . GLU A 109 ? 1.7366 1.5258 2.0429 -0.1583 0.4129  -0.1769 109 GLU Z CB    
858  C CG    . GLU A 109 ? 1.7737 1.5524 2.0759 -0.1342 0.4163  -0.1646 109 GLU Z CG    
859  C CD    . GLU A 109 ? 1.7559 1.5813 2.0858 -0.1122 0.4036  -0.1560 109 GLU Z CD    
860  O OE1   . GLU A 109 ? 1.7532 1.6231 2.1045 -0.1159 0.3900  -0.1589 109 GLU Z OE1   
861  O OE2   . GLU A 109 ? 1.7399 1.5579 2.0705 -0.0917 0.4088  -0.1461 109 GLU Z OE2   
862  N N     . GLY A 110 ? 1.7561 1.4709 2.0281 -0.2158 0.4323  -0.2001 110 GLY Z N     
863  C CA    . GLY A 110 ? 1.7173 1.4391 1.9987 -0.2416 0.4389  -0.2152 110 GLY Z CA    
864  C C     . GLY A 110 ? 1.6433 1.3913 1.9363 -0.2432 0.4214  -0.2209 110 GLY Z C     
865  O O     . GLY A 110 ? 1.6057 1.3474 1.9006 -0.2646 0.4273  -0.2335 110 GLY Z O     
866  N N     . LYS A 111 ? 1.6738 1.4506 1.9751 -0.2214 0.4018  -0.2119 111 LYS Z N     
867  C CA    . LYS A 111 ? 1.7257 1.5293 2.0368 -0.2205 0.3836  -0.2154 111 LYS Z CA    
868  C C     . LYS A 111 ? 1.6760 1.4168 1.9581 -0.2197 0.3781  -0.2115 111 LYS Z C     
869  O O     . LYS A 111 ? 1.7148 1.4107 1.9724 -0.2002 0.3713  -0.1962 111 LYS Z O     
870  C CB    . LYS A 111 ? 1.7479 1.5934 2.0743 -0.1942 0.3657  -0.2033 111 LYS Z CB    
871  C CG    . LYS A 111 ? 1.7714 1.6826 2.1305 -0.1911 0.3715  -0.2029 111 LYS Z CG    
872  C CD    . LYS A 111 ? 1.7715 1.7152 2.1455 -0.1613 0.3579  -0.1867 111 LYS Z CD    
873  C CE    . LYS A 111 ? 1.7439 1.7536 2.1536 -0.1563 0.3659  -0.1831 111 LYS Z CE    
874  N NZ    . LYS A 111 ? 1.7275 1.8115 2.1679 -0.1785 0.3645  -0.1959 111 LYS Z NZ    
875  N N     . VAL A 112 ? 1.7430 1.4796 2.0278 -0.2423 0.3835  -0.2254 112 VAL Z N     
876  C CA    . VAL A 112 ? 1.6680 1.3446 1.9288 -0.2426 0.3822  -0.2210 112 VAL Z CA    
877  C C     . VAL A 112 ? 1.6753 1.3630 1.9379 -0.2347 0.3619  -0.2205 112 VAL Z C     
878  O O     . VAL A 112 ? 1.6713 1.3118 1.9124 -0.2218 0.3539  -0.2087 112 VAL Z O     
879  C CB    . VAL A 112 ? 1.5587 1.2069 1.8179 -0.2709 0.4052  -0.2345 112 VAL Z CB    
880  C CG1   . VAL A 112 ? 1.5264 1.1169 1.7656 -0.2690 0.4043  -0.2277 112 VAL Z CG1   
881  C CG2   . VAL A 112 ? 1.5367 1.1615 1.7895 -0.2782 0.4270  -0.2325 112 VAL Z CG2   
882  N N     . SER A 113 ? 1.5909 1.3434 1.8792 -0.2431 0.3537  -0.2328 113 SER Z N     
883  C CA    . SER A 113 ? 1.6316 1.4001 1.9225 -0.2371 0.3347  -0.2332 113 SER Z CA    
884  C C     . SER A 113 ? 1.6488 1.4159 1.9327 -0.2036 0.3140  -0.2132 113 SER Z C     
885  O O     . SER A 113 ? 1.6908 1.4216 1.9578 -0.1909 0.3022  -0.2046 113 SER Z O     
886  C CB    . SER A 113 ? 1.6313 1.4782 1.9517 -0.2562 0.3313  -0.2509 113 SER Z CB    
887  O OG    . SER A 113 ? 1.6102 1.4712 1.9314 -0.2542 0.3149  -0.2530 113 SER Z OG    
888  N N     . GLU A 114 ? 1.6537 1.4599 1.9522 -0.1897 0.3116  -0.2059 114 GLU Z N     
889  C CA    . GLU A 114 ? 1.6052 1.4088 1.8992 -0.1585 0.2975  -0.1877 114 GLU Z CA    
890  C C     . GLU A 114 ? 1.5035 1.2313 1.7634 -0.1458 0.2990  -0.1756 114 GLU Z C     
891  O O     . GLU A 114 ? 1.4703 1.1770 1.7175 -0.1264 0.2847  -0.1644 114 GLU Z O     
892  C CB    . GLU A 114 ? 1.6880 1.5388 2.0043 -0.1477 0.3021  -0.1821 114 GLU Z CB    
893  C CG    . GLU A 114 ? 1.7413 1.6760 2.0937 -0.1602 0.3009  -0.1914 114 GLU Z CG    
894  C CD    . GLU A 114 ? 1.7754 1.7578 2.1529 -0.1460 0.3061  -0.1819 114 GLU Z CD    
895  O OE1   . GLU A 114 ? 1.7918 1.7415 2.1590 -0.1238 0.3094  -0.1682 114 GLU Z OE1   
896  O OE2   . GLU A 114 ? 1.7714 1.8254 2.1795 -0.1578 0.3081  -0.1883 114 GLU Z OE2   
897  N N     . ALA A 115 ? 1.5424 1.2324 1.7876 -0.1576 0.3164  -0.1774 115 ALA Z N     
898  C CA    . ALA A 115 ? 1.5033 1.1272 1.7153 -0.1487 0.3192  -0.1650 115 ALA Z CA    
899  C C     . ALA A 115 ? 1.5369 1.1206 1.7311 -0.1477 0.3095  -0.1608 115 ALA Z C     
900  O O     . ALA A 115 ? 1.5591 1.1058 1.7306 -0.1314 0.3006  -0.1472 115 ALA Z O     
901  C CB    . ALA A 115 ? 1.5023 1.0991 1.7043 -0.1644 0.3409  -0.1676 115 ALA Z CB    
902  N N     . ARG A 116 ? 1.4799 1.0722 1.6851 -0.1662 0.3124  -0.1732 116 ARG Z N     
903  C CA    . ARG A 116 ? 1.5348 1.0913 1.7272 -0.1661 0.3054  -0.1702 116 ARG Z CA    
904  C C     . ARG A 116 ? 1.4916 1.0711 1.6890 -0.1482 0.2824  -0.1660 116 ARG Z C     
905  O O     . ARG A 116 ? 1.5024 1.0461 1.6824 -0.1360 0.2718  -0.1555 116 ARG Z O     
906  C CB    . ARG A 116 ? 1.6083 1.1653 1.8119 -0.1933 0.3196  -0.1870 116 ARG Z CB    
907  C CG    . ARG A 116 ? 1.7250 1.2491 1.9224 -0.2108 0.3452  -0.1895 116 ARG Z CG    
908  C CD    . ARG A 116 ? 1.8254 1.3399 2.0326 -0.2375 0.3625  -0.2060 116 ARG Z CD    
909  N NE    . ARG A 116 ? 1.9053 1.3864 2.1084 -0.2536 0.3896  -0.2074 116 ARG Z NE    
910  C CZ    . ARG A 116 ? 1.9405 1.3608 2.1237 -0.2486 0.4007  -0.1908 116 ARG Z CZ    
911  N NH1   . ARG A 116 ? 1.9423 1.3364 2.1241 -0.2632 0.4269  -0.1915 116 ARG Z NH1   
912  N NH2   . ARG A 116 ? 1.9553 1.3432 2.1206 -0.2288 0.3861  -0.1723 116 ARG Z NH2   
913  N N     . GLU A 117 ? 1.5026 1.1438 1.7246 -0.1460 0.2751  -0.1726 117 GLU Z N     
914  C CA    . GLU A 117 ? 1.4901 1.1573 1.7190 -0.1270 0.2544  -0.1663 117 GLU Z CA    
915  C C     . GLU A 117 ? 1.4164 1.0575 1.6293 -0.1002 0.2468  -0.1490 117 GLU Z C     
916  O O     . GLU A 117 ? 1.3746 1.0163 1.5853 -0.0826 0.2312  -0.1411 117 GLU Z O     
917  C CB    . GLU A 117 ? 1.5556 1.3007 1.8167 -0.1295 0.2497  -0.1736 117 GLU Z CB    
918  C CG    . GLU A 117 ? 1.6392 1.4199 1.9153 -0.1536 0.2494  -0.1912 117 GLU Z CG    
919  C CD    . GLU A 117 ? 1.6520 1.5134 1.9564 -0.1498 0.2365  -0.1927 117 GLU Z CD    
920  O OE1   . GLU A 117 ? 1.6301 1.5145 1.9432 -0.1245 0.2271  -0.1774 117 GLU Z OE1   
921  O OE2   . GLU A 117 ? 1.6539 1.5573 1.9723 -0.1728 0.2372  -0.2089 117 GLU Z OE2   
922  N N     . CYS A 118 ? 1.4475 1.0659 1.6488 -0.0985 0.2591  -0.1441 118 CYS Z N     
923  C CA    . CYS A 118 ? 1.3682 0.9590 1.5512 -0.0775 0.2551  -0.1305 118 CYS Z CA    
924  C C     . CYS A 118 ? 1.2766 0.8057 1.4269 -0.0776 0.2540  -0.1223 118 CYS Z C     
925  O O     . CYS A 118 ? 1.2714 0.7774 1.4050 -0.0614 0.2438  -0.1122 118 CYS Z O     
926  C CB    . CYS A 118 ? 1.3488 0.9493 1.5352 -0.0756 0.2696  -0.1296 118 CYS Z CB    
927  S SG    . CYS A 118 ? 1.2880 0.9604 1.5132 -0.0641 0.2693  -0.1306 118 CYS Z SG    
928  N N     . PHE A 119 ? 1.3016 0.8056 1.4440 -0.0958 0.2655  -0.1257 119 PHE Z N     
929  C CA    . PHE A 119 ? 1.3389 0.7881 1.4532 -0.0960 0.2661  -0.1145 119 PHE Z CA    
930  C C     . PHE A 119 ? 1.4039 0.8402 1.5158 -0.0902 0.2512  -0.1112 119 PHE Z C     
931  O O     . PHE A 119 ? 1.4300 0.8293 1.5196 -0.0811 0.2444  -0.0981 119 PHE Z O     
932  C CB    . PHE A 119 ? 1.3756 0.8023 1.4862 -0.1161 0.2856  -0.1171 119 PHE Z CB    
933  C CG    . PHE A 119 ? 1.4249 0.8495 1.5287 -0.1206 0.3008  -0.1158 119 PHE Z CG    
934  C CD1   . PHE A 119 ? 1.4661 0.8904 1.5567 -0.1066 0.2971  -0.1086 119 PHE Z CD1   
935  C CD2   . PHE A 119 ? 1.4367 0.8583 1.5472 -0.1400 0.3207  -0.1229 119 PHE Z CD2   
936  C CE1   . PHE A 119 ? 1.5214 0.9432 1.6049 -0.1118 0.3123  -0.1084 119 PHE Z CE1   
937  C CE2   . PHE A 119 ? 1.4940 0.9136 1.5981 -0.1444 0.3352  -0.1217 119 PHE Z CE2   
938  C CZ    . PHE A 119 ? 1.5385 0.9586 1.6287 -0.1302 0.3306  -0.1143 119 PHE Z CZ    
939  N N     . THR A 120 ? 1.3825 0.8521 1.5172 -0.0963 0.2463  -0.1232 120 THR Z N     
940  C CA    . THR A 120 ? 1.3535 0.8139 1.4881 -0.0929 0.2336  -0.1224 120 THR Z CA    
941  C C     . THR A 120 ? 1.3465 0.8154 1.4776 -0.0699 0.2141  -0.1142 120 THR Z C     
942  O O     . THR A 120 ? 1.4530 0.9110 1.5811 -0.0638 0.2019  -0.1112 120 THR Z O     
943  C CB    . THR A 120 ? 1.3641 0.8609 1.5231 -0.1098 0.2357  -0.1398 120 THR Z CB    
944  O OG1   . THR A 120 ? 1.4410 0.9207 1.5970 -0.1087 0.2265  -0.1393 120 THR Z OG1   
945  C CG2   . THR A 120 ? 1.3177 0.8776 1.4997 -0.1044 0.2272  -0.1467 120 THR Z CG2   
946  N N     . ARG A 121 ? 1.3303 0.8174 1.4630 -0.0576 0.2132  -0.1107 121 ARG Z N     
947  C CA    . ARG A 121 ? 1.2644 0.7575 1.3951 -0.0356 0.1990  -0.1030 121 ARG Z CA    
948  C C     . ARG A 121 ? 1.2513 0.7108 1.3569 -0.0254 0.2017  -0.0927 121 ARG Z C     
949  O O     . ARG A 121 ? 1.2045 0.6704 1.3098 -0.0088 0.1963  -0.0885 121 ARG Z O     
950  C CB    . ARG A 121 ? 1.2358 0.7856 1.3950 -0.0281 0.1970  -0.1077 121 ARG Z CB    
951  C CG    . ARG A 121 ? 1.3020 0.8955 1.4858 -0.0407 0.1939  -0.1188 121 ARG Z CG    
952  C CD    . ARG A 121 ? 1.4061 1.0626 1.6193 -0.0316 0.1912  -0.1193 121 ARG Z CD    
953  N NE    . ARG A 121 ? 1.5025 1.2085 1.7383 -0.0489 0.1903  -0.1314 121 ARG Z NE    
954  C CZ    . ARG A 121 ? 1.5249 1.2975 1.7896 -0.0459 0.1878  -0.1321 121 ARG Z CZ    
955  N NH1   . ARG A 121 ? 1.4859 1.2800 1.7627 -0.0239 0.1876  -0.1199 121 ARG Z NH1   
956  N NH2   . ARG A 121 ? 1.5452 1.3649 1.8276 -0.0655 0.1868  -0.1447 121 ARG Z NH2   
957  N N     . SER A 122 ? 1.2896 0.7147 1.3746 -0.0361 0.2116  -0.0887 122 SER Z N     
958  C CA    . SER A 122 ? 1.3489 0.7447 1.4069 -0.0308 0.2150  -0.0794 122 SER Z CA    
959  C C     . SER A 122 ? 1.3700 0.7237 1.4023 -0.0350 0.2124  -0.0677 122 SER Z C     
960  O O     . SER A 122 ? 1.4679 0.7990 1.4771 -0.0391 0.2198  -0.0598 122 SER Z O     
961  C CB    . SER A 122 ? 1.3888 0.7921 1.4467 -0.0393 0.2325  -0.0833 122 SER Z CB    
962  O OG    . SER A 122 ? 1.4460 0.8419 1.5058 -0.0569 0.2441  -0.0858 122 SER Z OG    
963  N N     . ILE A 123 ? 1.3208 0.6663 1.3576 -0.0340 0.2024  -0.0656 123 ILE Z N     
964  C CA    . ILE A 123 ? 1.3158 0.6242 1.3335 -0.0366 0.2008  -0.0522 123 ILE Z CA    
965  C C     . ILE A 123 ? 1.3320 0.6243 1.3298 -0.0225 0.1857  -0.0414 123 ILE Z C     
966  O O     . ILE A 123 ? 1.3874 0.6919 1.3935 -0.0112 0.1731  -0.0453 123 ILE Z O     
967  C CB    . ILE A 123 ? 1.2574 0.5615 1.2912 -0.0442 0.2012  -0.0556 123 ILE Z CB    
968  C CG1   . ILE A 123 ? 1.3145 0.6345 1.3670 -0.0616 0.2182  -0.0684 123 ILE Z CG1   
969  C CG2   . ILE A 123 ? 1.1270 0.3924 1.1444 -0.0444 0.2015  -0.0388 123 ILE Z CG2   
970  C CD1   . ILE A 123 ? 1.3846 0.6866 1.4246 -0.0714 0.2356  -0.0621 123 ILE Z CD1   
971  N N     . ASN A 124 ? 1.2740 0.5413 1.2456 -0.0240 0.1877  -0.0272 124 ASN Z N     
972  C CA    . ASN A 124 ? 1.2892 0.5424 1.2402 -0.0139 0.1739  -0.0166 124 ASN Z CA    
973  C C     . ASN A 124 ? 1.3175 0.5447 1.2559 -0.0160 0.1716  0.0020  124 ASN Z C     
974  O O     . ASN A 124 ? 1.3475 0.5625 1.2753 -0.0246 0.1829  0.0130  124 ASN Z O     
975  C CB    . ASN A 124 ? 1.3399 0.5945 1.2684 -0.0133 0.1770  -0.0163 124 ASN Z CB    
976  C CG    . ASN A 124 ? 1.4001 0.6438 1.3069 -0.0055 0.1638  -0.0083 124 ASN Z CG    
977  O OD1   . ASN A 124 ? 1.4876 0.7174 1.3699 -0.0100 0.1625  0.0062  124 ASN Z OD1   
978  N ND2   . ASN A 124 ? 1.2831 0.5355 1.1992 0.0060  0.1543  -0.0167 124 ASN Z ND2   
979  N N     . ILE A 125 ? 1.1211 0.5338 0.9023 -0.0724 0.2280  -0.1092 125 ILE Z N     
980  C CA    . ILE A 125 ? 1.2513 0.6493 0.9697 -0.0655 0.1972  -0.1003 125 ILE Z CA    
981  C C     . ILE A 125 ? 1.2825 0.6955 0.9808 -0.0902 0.2126  -0.1125 125 ILE Z C     
982  O O     . ILE A 125 ? 1.2495 0.6837 0.9733 -0.0818 0.2320  -0.1192 125 ILE Z O     
983  C CB    . ILE A 125 ? 1.2238 0.6206 0.9399 -0.0205 0.1764  -0.0854 125 ILE Z CB    
984  C CG1   . ILE A 125 ? 1.1547 0.5458 0.8931 0.0044  0.1625  -0.0753 125 ILE Z CG1   
985  C CG2   . ILE A 125 ? 1.3139 0.6945 0.9708 -0.0108 0.1432  -0.0767 125 ILE Z CG2   
986  C CD1   . ILE A 125 ? 1.2195 0.5863 0.9264 -0.0061 0.1356  -0.0731 125 ILE Z CD1   
987  N N     . THR A 126 ? 1.2663 0.6691 0.9173 -0.1219 0.2045  -0.1154 126 THR Z N     
988  C CA    . THR A 126 ? 1.3215 0.7443 0.9443 -0.1477 0.2134  -0.1266 126 THR Z CA    
989  C C     . THR A 126 ? 1.2935 0.7185 0.8777 -0.1209 0.1798  -0.1129 126 THR Z C     
990  O O     . THR A 126 ? 1.2516 0.6555 0.8257 -0.0861 0.1512  -0.0954 126 THR Z O     
991  C CB    . THR A 126 ? 1.4446 0.8566 1.0228 -0.1915 0.2155  -0.1314 126 THR Z CB    
992  O OG1   . THR A 126 ? 1.4424 0.8169 0.9676 -0.1815 0.1778  -0.1090 126 THR Z OG1   
993  C CG2   . THR A 126 ? 1.5098 0.9225 1.1308 -0.2204 0.2518  -0.1486 126 THR Z CG2   
994  N N     . HIS A 127 ? 1.1975 0.6519 0.7627 -0.1377 0.1838  -0.1233 127 HIS Z N     
995  C CA    . HIS A 127 ? 1.2710 0.7363 0.8043 -0.1132 0.1515  -0.1121 127 HIS Z CA    
996  C C     . HIS A 127 ? 1.3431 0.7789 0.8114 -0.1135 0.1141  -0.0905 127 HIS Z C     
997  O O     . HIS A 127 ? 1.3672 0.8020 0.8088 -0.0867 0.0821  -0.0757 127 HIS Z O     
998  C CB    . HIS A 127 ? 1.2954 0.8108 0.8326 -0.1326 0.1661  -0.1324 127 HIS Z CB    
999  C CG    . HIS A 127 ? 1.2944 0.8318 0.8158 -0.1035 0.1359  -0.1243 127 HIS Z CG    
1000 N ND1   . HIS A 127 ? 1.2547 0.7847 0.8001 -0.0607 0.1251  -0.1151 127 HIS Z ND1   
1001 C CD2   . HIS A 127 ? 1.3498 0.9211 0.8367 -0.1111 0.1148  -0.1252 127 HIS Z CD2   
1002 C CE1   . HIS A 127 ? 1.2593 0.8165 0.7903 -0.0431 0.1010  -0.1124 127 HIS Z CE1   
1003 N NE2   . HIS A 127 ? 1.3151 0.8997 0.8125 -0.0718 0.0927  -0.1177 127 HIS Z NE2   
1004 N N     . ALA A 128 ? 1.3086 0.7205 0.7523 -0.1454 0.1211  -0.0893 128 ALA Z N     
1005 C CA    . ALA A 128 ? 1.3659 0.7419 0.7440 -0.1497 0.0906  -0.0668 128 ALA Z CA    
1006 C C     . ALA A 128 ? 1.3767 0.7077 0.7532 -0.1126 0.0649  -0.0475 128 ALA Z C     
1007 O O     . ALA A 128 ? 1.5358 0.8434 0.8732 -0.0893 0.0319  -0.0267 128 ALA Z O     
1008 C CB    . ALA A 128 ? 1.3996 0.7601 0.7530 -0.1965 0.1105  -0.0725 128 ALA Z CB    
1009 N N     . MET A 129 ? 1.3916 0.7132 0.8132 -0.1066 0.0807  -0.0556 129 MET Z N     
1010 C CA    . MET A 129 ? 1.3640 0.6506 0.7892 -0.0745 0.0595  -0.0435 129 MET Z CA    
1011 C C     . MET A 129 ? 1.2333 0.5310 0.6646 -0.0309 0.0393  -0.0368 129 MET Z C     
1012 O O     . MET A 129 ? 1.3618 0.6282 0.7645 -0.0051 0.0104  -0.0216 129 MET Z O     
1013 C CB    . MET A 129 ? 1.3583 0.6487 0.8362 -0.0769 0.0807  -0.0556 129 MET Z CB    
1014 C CG    . MET A 129 ? 1.4138 0.7045 0.9007 -0.1209 0.1078  -0.0681 129 MET Z CG    
1015 S SD    . MET A 129 ? 1.3971 0.7129 0.9646 -0.1199 0.1378  -0.0847 129 MET Z SD    
1016 C CE    . MET A 129 ? 1.3643 0.6539 0.9345 -0.0858 0.1069  -0.0731 129 MET Z CE    
1017 N N     . ALA A 130 ? 1.1914 0.5324 0.6624 -0.0243 0.0584  -0.0500 130 ALA Z N     
1018 C CA    . ALA A 130 ? 1.1329 0.4910 0.6161 0.0129  0.0466  -0.0478 130 ALA Z CA    
1019 C C     . ALA A 130 ? 1.2977 0.6561 0.7387 0.0232  0.0175  -0.0361 130 ALA Z C     
1020 O O     . ALA A 130 ? 1.3198 0.6706 0.7562 0.0586  -0.0042 -0.0276 130 ALA Z O     
1021 C CB    . ALA A 130 ? 1.1016 0.5047 0.6321 0.0097  0.0779  -0.0653 130 ALA Z CB    
1022 N N     . HIS A 131 ? 1.2433 0.6114 0.6529 -0.0074 0.0171  -0.0352 131 HIS Z N     
1023 C CA    . HIS A 131 ? 1.3246 0.6998 0.6939 0.0026  -0.0122 -0.0212 131 HIS Z CA    
1024 C C     . HIS A 131 ? 1.4028 0.7171 0.7281 0.0180  -0.0412 0.0042  131 HIS Z C     
1025 O O     . HIS A 131 ? 1.5765 0.8830 0.8809 0.0471  -0.0701 0.0202  131 HIS Z O     
1026 C CB    . HIS A 131 ? 1.3166 0.7270 0.6608 -0.0363 -0.0045 -0.0277 131 HIS Z CB    
1027 C CG    . HIS A 131 ? 1.3830 0.8154 0.6911 -0.0228 -0.0371 -0.0131 131 HIS Z CG    
1028 N ND1   . HIS A 131 ? 1.5056 0.9033 0.7526 -0.0252 -0.0641 0.0142  131 HIS Z ND1   
1029 C CD2   . HIS A 131 ? 1.3655 0.8519 0.6925 -0.0041 -0.0478 -0.0205 131 HIS Z CD2   
1030 C CE1   . HIS A 131 ? 1.5316 0.9630 0.7614 -0.0062 -0.0925 0.0252  131 HIS Z CE1   
1031 N NE2   . HIS A 131 ? 1.4571 0.9459 0.7370 0.0062  -0.0836 0.0025  131 HIS Z NE2   
1032 N N     . LYS A 132 ? 1.4261 0.6970 0.7416 -0.0012 -0.0320 0.0065  132 LYS Z N     
1033 C CA    . LYS A 132 ? 1.4062 0.6134 0.6863 0.0120  -0.0541 0.0266  132 LYS Z CA    
1034 C C     . LYS A 132 ? 1.3608 0.5558 0.6634 0.0574  -0.0692 0.0272  132 LYS Z C     
1035 O O     . LYS A 132 ? 1.4335 0.5975 0.7107 0.0850  -0.0949 0.0441  132 LYS Z O     
1036 C CB    . LYS A 132 ? 1.3986 0.5688 0.6755 -0.0188 -0.0371 0.0221  132 LYS Z CB    
1037 C CG    . LYS A 132 ? 1.4469 0.6126 0.6882 -0.0650 -0.0235 0.0248  132 LYS Z CG    
1038 C CD    . LYS A 132 ? 1.5749 0.7012 0.8170 -0.0928 -0.0074 0.0196  132 LYS Z CD    
1039 C CE    . LYS A 132 ? 1.7475 0.8638 0.9493 -0.1405 0.0086  0.0223  132 LYS Z CE    
1040 N NZ    . LYS A 132 ? 1.8566 0.9405 1.0680 -0.1694 0.0279  0.0129  132 LYS Z NZ    
1041 N N     . VAL A 133 ? 1.3309 0.5505 0.6809 0.0655  -0.0518 0.0092  133 VAL Z N     
1042 C CA    . VAL A 133 ? 1.3702 0.5848 0.7402 0.1054  -0.0620 0.0068  133 VAL Z CA    
1043 C C     . VAL A 133 ? 1.3982 0.6394 0.7687 0.1350  -0.0775 0.0111  133 VAL Z C     
1044 O O     . VAL A 133 ? 1.3878 0.6073 0.7538 0.1686  -0.0954 0.0166  133 VAL Z O     
1045 C CB    . VAL A 133 ? 1.3136 0.5569 0.7306 0.1084  -0.0394 -0.0098 133 VAL Z CB    
1046 C CG1   . VAL A 133 ? 1.2395 0.4772 0.6684 0.1473  -0.0494 -0.0119 133 VAL Z CG1   
1047 C CG2   . VAL A 133 ? 1.3439 0.5694 0.7686 0.0820  -0.0262 -0.0148 133 VAL Z CG2   
1048 N N     . ILE A 134 ? 1.3976 0.6885 0.7763 0.1208  -0.0692 0.0057  134 ILE Z N     
1049 C CA    . ILE A 134 ? 1.3621 0.6922 0.7484 0.1446  -0.0827 0.0060  134 ILE Z CA    
1050 C C     . ILE A 134 ? 1.5231 0.8247 0.8692 0.1633  -0.1166 0.0293  134 ILE Z C     
1051 O O     . ILE A 134 ? 1.6013 0.9059 0.9567 0.2007  -0.1342 0.0334  134 ILE Z O     
1052 C CB    . ILE A 134 ? 1.2596 0.6526 0.6616 0.1177  -0.0656 -0.0083 134 ILE Z CB    
1053 C CG1   . ILE A 134 ? 1.1657 0.5907 0.6187 0.1138  -0.0320 -0.0309 134 ILE Z CG1   
1054 C CG2   . ILE A 134 ? 1.2681 0.7034 0.6663 0.1352  -0.0879 -0.0047 134 ILE Z CG2   
1055 C CD1   . ILE A 134 ? 1.0542 0.5364 0.5280 0.0840  -0.0084 -0.0501 134 ILE Z CD1   
1056 N N     . LYS A 135 ? 1.4743 0.7469 0.7764 0.1378  -0.1239 0.0455  135 LYS Z N     
1057 C CA    . LYS A 135 ? 1.6020 0.8388 0.8608 0.1551  -0.1547 0.0736  135 LYS Z CA    
1058 C C     . LYS A 135 ? 1.6328 0.8040 0.8885 0.1855  -0.1652 0.0819  135 LYS Z C     
1059 O O     . LYS A 135 ? 1.6646 0.8228 0.9181 0.2232  -0.1876 0.0948  135 LYS Z O     
1060 C CB    . LYS A 135 ? 1.6426 0.8545 0.8488 0.1173  -0.1553 0.0905  135 LYS Z CB    
1061 C CG    . LYS A 135 ? 1.7127 0.9902 0.9127 0.0855  -0.1476 0.0821  135 LYS Z CG    
1062 C CD    . LYS A 135 ? 1.7829 1.1045 0.9699 0.1080  -0.1777 0.0963  135 LYS Z CD    
1063 C CE    . LYS A 135 ? 1.8889 1.1588 1.0135 0.1174  -0.2070 0.1358  135 LYS Z CE    
1064 N NZ    . LYS A 135 ? 1.8955 1.2161 1.0061 0.1390  -0.2396 0.1529  135 LYS Z NZ    
1065 N N     . ALA A 136 ? 1.6985 0.8320 0.9577 0.1689  -0.1481 0.0721  136 ALA Z N     
1066 C CA    . ALA A 136 ? 1.6257 0.6995 0.8829 0.1912  -0.1544 0.0732  136 ALA Z CA    
1067 C C     . ALA A 136 ? 1.5761 0.6840 0.8759 0.2301  -0.1582 0.0596  136 ALA Z C     
1068 O O     . ALA A 136 ? 1.5525 0.6562 0.8659 0.2483  -0.1664 0.0613  136 ALA Z O     
1069 C CB    . ALA A 136 ? 1.4992 0.5524 0.7654 0.1642  -0.1343 0.0578  136 ALA Z CB    
1070 N N     . ALA A 137 ? 1.5416 0.6963 0.8716 0.2363  -0.1461 0.0432  137 ALA Z N     
1071 C CA    . ALA A 137 ? 1.5562 0.7439 0.9235 0.2695  -0.1454 0.0294  137 ALA Z CA    
1072 C C     . ALA A 137 ? 1.5501 0.7552 0.9175 0.3008  -0.1666 0.0402  137 ALA Z C     
1073 O O     . ALA A 137 ? 1.5845 0.8099 0.9821 0.3249  -0.1696 0.0332  137 ALA Z O     
1074 C CB    . ALA A 137 ? 1.2118 0.4437 0.6115 0.2642  -0.1219 0.0100  137 ALA Z CB    
1075 N N     . ARG A 138 ? 1.4525 0.6885 0.8064 0.2848  -0.1744 0.0512  138 ARG Z N     
1076 C CA    . ARG A 138 ? 1.5873 0.8571 0.9454 0.3103  -0.1974 0.0622  138 ARG Z CA    
1077 C C     . ARG A 138 ? 1.6774 0.8878 1.0117 0.3377  -0.2209 0.0858  138 ARG Z C     
1078 O O     . ARG A 138 ? 1.7236 0.9592 1.0863 0.3685  -0.2330 0.0871  138 ARG Z O     
1079 C CB    . ARG A 138 ? 1.7140 1.0284 1.0535 0.2803  -0.2020 0.0698  138 ARG Z CB    
1080 C CG    . ARG A 138 ? 1.7561 1.1441 1.1312 0.2568  -0.1778 0.0428  138 ARG Z CG    
1081 C CD    . ARG A 138 ? 1.7722 1.2216 1.1931 0.2865  -0.1813 0.0278  138 ARG Z CD    
1082 N NE    . ARG A 138 ? 1.6969 1.2086 1.1551 0.2633  -0.1522 -0.0003 138 ARG Z NE    
1083 C CZ    . ARG A 138 ? 1.6532 1.2055 1.1058 0.2248  -0.1411 -0.0086 138 ARG Z CZ    
1084 N NH1   . ARG A 138 ? 1.7055 1.2460 1.1121 0.2044  -0.1582 0.0100  138 ARG Z NH1   
1085 N NH2   . ARG A 138 ? 1.5718 1.1737 1.0629 0.2057  -0.1107 -0.0359 138 ARG Z NH2   
1086 N N     . SER A 139 ? 1.7216 0.8824 1.0272 0.3111  -0.2162 0.0968  139 SER Z N     
1087 C CA    . SER A 139 ? 1.7235 0.8525 1.0275 0.3194  -0.2248 0.1127  139 SER Z CA    
1088 C C     . SER A 139 ? 1.6858 0.8140 1.0335 0.3364  -0.2130 0.0933  139 SER Z C     
1089 O O     . SER A 139 ? 1.7890 0.8814 1.1377 0.3406  -0.2139 0.1018  139 SER Z O     
1090 C CB    . SER A 139 ? 1.7084 0.7818 0.9694 0.2848  -0.2193 0.1272  139 SER Z CB    
1091 O OG    . SER A 139 ? 1.7421 0.7964 1.0114 0.2614  -0.1972 0.1057  139 SER Z OG    
1092 N N     . GLN A 140 ? 1.6447 0.8109 1.0254 0.3447  -0.2006 0.0681  140 GLN Z N     
1093 C CA    . GLN A 140 ? 1.6407 0.8128 1.0567 0.3566  -0.1884 0.0491  140 GLN Z CA    
1094 C C     . GLN A 140 ? 1.5654 0.7886 1.0199 0.3866  -0.1889 0.0364  140 GLN Z C     
1095 O O     . GLN A 140 ? 1.6413 0.8739 1.1245 0.3982  -0.1788 0.0210  140 GLN Z O     
1096 C CB    . GLN A 140 ? 1.6689 0.8379 1.0863 0.3314  -0.1684 0.0298  140 GLN Z CB    
1097 C CG    . GLN A 140 ? 1.7272 0.8502 1.1132 0.3005  -0.1653 0.0370  140 GLN Z CG    
1098 C CD    . GLN A 140 ? 1.7856 0.8663 1.1702 0.3008  -0.1651 0.0382  140 GLN Z CD    
1099 O OE1   . GLN A 140 ? 1.8340 0.9081 1.2332 0.3251  -0.1715 0.0432  140 GLN Z OE1   
1100 N NE2   . GLN A 140 ? 1.7944 0.8452 1.1643 0.2743  -0.1564 0.0327  140 GLN Z NE2   
1101 N N     . GLY A 141 ? 1.5337 0.7904 0.9871 0.3985  -0.2004 0.0419  141 GLY Z N     
1102 C CA    . GLY A 141 ? 1.4672 0.7768 0.9592 0.4269  -0.2002 0.0276  141 GLY Z CA    
1103 C C     . GLY A 141 ? 1.3840 0.7222 0.8913 0.4173  -0.1764 0.0037  141 GLY Z C     
1104 O O     . GLY A 141 ? 1.3947 0.7768 0.9361 0.4368  -0.1689 -0.0126 141 GLY Z O     
1105 N N     . VAL A 142 ? 1.4041 0.7187 0.8891 0.3868  -0.1627 0.0020  142 VAL Z N     
1106 C CA    . VAL A 142 ? 1.3560 0.6946 0.8550 0.3744  -0.1379 -0.0158 142 VAL Z CA    
1107 C C     . VAL A 142 ? 1.3295 0.6925 0.8264 0.3717  -0.1343 -0.0183 142 VAL Z C     
1108 O O     . VAL A 142 ? 1.3903 0.7518 0.8654 0.3438  -0.1395 -0.0066 142 VAL Z O     
1109 C CB    . VAL A 142 ? 1.3303 0.6427 0.8143 0.3433  -0.1252 -0.0162 142 VAL Z CB    
1110 C CG1   . VAL A 142 ? 1.2930 0.6356 0.7964 0.3328  -0.1000 -0.0299 142 VAL Z CG1   
1111 C CG2   . VAL A 142 ? 1.3540 0.6465 0.8403 0.3433  -0.1277 -0.0177 142 VAL Z CG2   
1112 N N     . ASP A 143 ? 1.2160 0.6338 0.7510 0.3785  -0.1162 -0.0371 143 ASP Z N     
1113 C CA    . ASP A 143 ? 1.2216 0.7023 0.7784 0.3533  -0.1018 -0.0465 143 ASP Z CA    
1114 C C     . ASP A 143 ? 1.2652 0.7387 0.8156 0.3164  -0.0764 -0.0495 143 ASP Z C     
1115 O O     . ASP A 143 ? 1.2707 0.7093 0.8151 0.3164  -0.0632 -0.0503 143 ASP Z O     
1116 C CB    . ASP A 143 ? 1.2109 0.7482 0.8135 0.3692  -0.0846 -0.0681 143 ASP Z CB    
1117 C CG    . ASP A 143 ? 1.4451 1.0098 1.0664 0.4028  -0.1093 -0.0679 143 ASP Z CG    
1118 O OD1   . ASP A 143 ? 1.5305 1.1066 1.1796 0.4297  -0.1002 -0.0821 143 ASP Z OD1   
1119 O OD2   . ASP A 143 ? 1.5138 1.0900 1.1223 0.4031  -0.1373 -0.0531 143 ASP Z OD2   
1120 N N     . CYS A 144 ? 1.1689 0.6784 0.7219 0.2853  -0.0700 -0.0522 144 CYS Z N     
1121 C CA    . CYS A 144 ? 1.1460 0.6546 0.7019 0.2499  -0.0420 -0.0579 144 CYS Z CA    
1122 C C     . CYS A 144 ? 1.1528 0.7247 0.7436 0.2281  -0.0162 -0.0782 144 CYS Z C     
1123 O O     . CYS A 144 ? 1.1698 0.7905 0.7725 0.2310  -0.0273 -0.0858 144 CYS Z O     
1124 C CB    . CYS A 144 ? 1.2293 0.7050 0.7473 0.2239  -0.0543 -0.0430 144 CYS Z CB    
1125 S SG    . CYS A 144 ? 1.2972 0.6937 0.7764 0.2412  -0.0779 -0.0229 144 CYS Z SG    
1126 N N     . LEU A 145 ? 0.9248 0.6154 0.6931 0.1358  -0.1396 -0.0919 145 LEU Z N     
1127 C CA    . LEU A 145 ? 0.8597 0.5831 0.6352 0.1206  -0.1374 -0.0907 145 LEU Z CA    
1128 C C     . LEU A 145 ? 0.9062 0.6088 0.6732 0.0945  -0.1135 -0.0850 145 LEU Z C     
1129 O O     . LEU A 145 ? 0.9019 0.6181 0.6924 0.0880  -0.0963 -0.0865 145 LEU Z O     
1130 C CB    . LEU A 145 ? 0.8903 0.6857 0.7115 0.1275  -0.1402 -0.0993 145 LEU Z CB    
1131 C CG    . LEU A 145 ? 1.0074 0.8422 0.8430 0.1105  -0.1377 -0.0984 145 LEU Z CG    
1132 C CD1   . LEU A 145 ? 1.1000 0.9347 0.9170 0.1141  -0.1592 -0.0980 145 LEU Z CD1   
1133 C CD2   . LEU A 145 ? 0.9923 0.8954 0.8739 0.1143  -0.1345 -0.1049 145 LEU Z CD2   
1134 N N     . VAL A 146 ? 0.9406 0.6106 0.6733 0.0805  -0.1128 -0.0792 146 VAL Z N     
1135 C CA    . VAL A 146 ? 0.8726 0.5228 0.5970 0.0572  -0.0901 -0.0757 146 VAL Z CA    
1136 C C     . VAL A 146 ? 0.8734 0.5658 0.6218 0.0442  -0.0865 -0.0787 146 VAL Z C     
1137 O O     . VAL A 146 ? 0.9124 0.6181 0.6523 0.0419  -0.1005 -0.0802 146 VAL Z O     
1138 C CB    . VAL A 146 ? 0.9209 0.5149 0.5948 0.0469  -0.0884 -0.0695 146 VAL Z CB    
1139 C CG1   . VAL A 146 ? 0.9415 0.5200 0.6101 0.0241  -0.0643 -0.0686 146 VAL Z CG1   
1140 C CG2   . VAL A 146 ? 0.8682 0.4165 0.5179 0.0564  -0.0897 -0.0644 146 VAL Z CG2   
1141 N N     . ALA A 147 ? 0.7909 0.5033 0.5692 0.0354  -0.0685 -0.0791 147 ALA Z N     
1142 C CA    . ALA A 147 ? 0.7420 0.4917 0.5454 0.0222  -0.0635 -0.0802 147 ALA Z CA    
1143 C C     . ALA A 147 ? 0.8029 0.5246 0.5796 0.0034  -0.0588 -0.0795 147 ALA Z C     
1144 O O     . ALA A 147 ? 0.8999 0.5735 0.6439 -0.0028 -0.0497 -0.0775 147 ALA Z O     
1145 C CB    . ALA A 147 ? 0.7614 0.5294 0.5970 0.0170  -0.0449 -0.0783 147 ALA Z CB    
1146 N N     . PRO A 148 ? 0.7881 0.5403 0.5783 -0.0067 -0.0648 -0.0820 148 PRO Z N     
1147 C CA    . PRO A 148 ? 0.7561 0.4846 0.5248 -0.0262 -0.0598 -0.0839 148 PRO Z CA    
1148 C C     . PRO A 148 ? 0.8624 0.5609 0.6307 -0.0391 -0.0344 -0.0820 148 PRO Z C     
1149 O O     . PRO A 148 ? 0.9481 0.6061 0.6848 -0.0499 -0.0261 -0.0841 148 PRO Z O     
1150 C CB    . PRO A 148 ? 0.7657 0.5420 0.5638 -0.0346 -0.0684 -0.0866 148 PRO Z CB    
1151 C CG    . PRO A 148 ? 0.8088 0.6302 0.6296 -0.0162 -0.0852 -0.0873 148 PRO Z CG    
1152 C CD    . PRO A 148 ? 0.7714 0.5832 0.5972 -0.0005 -0.0773 -0.0843 148 PRO Z CD    
1153 N N     . TYR A 149 ? 0.7464 0.4665 0.5498 -0.0371 -0.0225 -0.0786 149 TYR Z N     
1154 C CA    . TYR A 149 ? 0.7927 0.4885 0.6014 -0.0460 0.0005  -0.0764 149 TYR Z CA    
1155 C C     . TYR A 149 ? 0.8353 0.5411 0.6660 -0.0344 0.0082  -0.0724 149 TYR Z C     
1156 O O     . TYR A 149 ? 0.9079 0.5934 0.7221 -0.0244 0.0066  -0.0725 149 TYR Z O     
1157 C CB    . TYR A 149 ? 0.7761 0.4864 0.6073 -0.0613 0.0083  -0.0760 149 TYR Z CB    
1158 C CG    . TYR A 149 ? 0.9158 0.6101 0.7235 -0.0751 0.0022  -0.0823 149 TYR Z CG    
1159 C CD1   . TYR A 149 ? 1.0167 0.6649 0.7944 -0.0853 0.0145  -0.0872 149 TYR Z CD1   
1160 C CD2   . TYR A 149 ? 0.9239 0.6512 0.7392 -0.0783 -0.0160 -0.0846 149 TYR Z CD2   
1161 C CE1   . TYR A 149 ? 1.0423 0.6753 0.7956 -0.0982 0.0084  -0.0949 149 TYR Z CE1   
1162 C CE2   . TYR A 149 ? 0.9839 0.6977 0.7777 -0.0920 -0.0233 -0.0916 149 TYR Z CE2   
1163 C CZ    . TYR A 149 ? 1.0527 0.7179 0.8139 -0.1018 -0.0114 -0.0971 149 TYR Z CZ    
1164 O OH    . TYR A 149 ? 1.0848 0.7360 0.8221 -0.1157 -0.0190 -0.1059 149 TYR Z OH    
1165 N N     . GLU A 150 ? 0.7947 0.5302 0.6610 -0.0363 0.0160  -0.0686 150 GLU Z N     
1166 C CA    . GLU A 150 ? 0.7180 0.4668 0.6054 -0.0258 0.0218  -0.0657 150 GLU Z CA    
1167 C C     . GLU A 150 ? 0.7070 0.4874 0.6019 -0.0092 0.0056  -0.0679 150 GLU Z C     
1168 O O     . GLU A 150 ? 0.7371 0.5510 0.6405 -0.0069 -0.0075 -0.0692 150 GLU Z O     
1169 C CB    . GLU A 150 ? 0.6956 0.4681 0.6166 -0.0320 0.0331  -0.0597 150 GLU Z CB    
1170 C CG    . GLU A 150 ? 0.7915 0.5310 0.7107 -0.0438 0.0511  -0.0582 150 GLU Z CG    
1171 C CD    . GLU A 150 ? 0.8774 0.6352 0.8296 -0.0444 0.0617  -0.0511 150 GLU Z CD    
1172 O OE1   . GLU A 150 ? 0.8277 0.6028 0.7975 -0.0525 0.0625  -0.0455 150 GLU Z OE1   
1173 O OE2   . GLU A 150 ? 0.9847 0.7388 0.9449 -0.0373 0.0685  -0.0504 150 GLU Z OE2   
1174 N N     . ALA A 151 ? 0.6859 0.4563 0.5794 0.0022  0.0067  -0.0693 151 ALA Z N     
1175 C CA    . ALA A 151 ? 0.6842 0.4817 0.5863 0.0198  -0.0074 -0.0735 151 ALA Z CA    
1176 C C     . ALA A 151 ? 0.7048 0.5568 0.6422 0.0227  -0.0072 -0.0723 151 ALA Z C     
1177 O O     . ALA A 151 ? 0.7224 0.6109 0.6708 0.0349  -0.0195 -0.0766 151 ALA Z O     
1178 C CB    . ALA A 151 ? 0.6302 0.3996 0.5229 0.0290  -0.0049 -0.0760 151 ALA Z CB    
1179 N N     . ASP A 152 ? 0.6837 0.5412 0.6382 0.0119  0.0070  -0.0660 152 ASP Z N     
1180 C CA    . ASP A 152 ? 0.6203 0.5262 0.6048 0.0124  0.0088  -0.0620 152 ASP Z CA    
1181 C C     . ASP A 152 ? 0.7200 0.6667 0.7143 0.0107  -0.0014 -0.0619 152 ASP Z C     
1182 O O     . ASP A 152 ? 0.7857 0.7769 0.7958 0.0211  -0.0083 -0.0648 152 ASP Z O     
1183 C CB    . ASP A 152 ? 0.4971 0.3946 0.4944 -0.0009 0.0243  -0.0529 152 ASP Z CB    
1184 C CG    . ASP A 152 ? 0.6685 0.5252 0.6575 -0.0014 0.0355  -0.0538 152 ASP Z CG    
1185 O OD1   . ASP A 152 ? 0.7246 0.5476 0.6905 0.0022  0.0334  -0.0598 152 ASP Z OD1   
1186 O OD2   . ASP A 152 ? 0.6090 0.4681 0.6153 -0.0059 0.0463  -0.0478 152 ASP Z OD2   
1187 N N     . ALA A 153 ? 0.6872 0.6196 0.6722 -0.0027 -0.0020 -0.0598 153 ALA Z N     
1188 C CA    . ALA A 153 ? 0.5977 0.5681 0.5938 -0.0081 -0.0113 -0.0597 153 ALA Z CA    
1189 C C     . ALA A 153 ? 0.6217 0.6143 0.6138 0.0082  -0.0286 -0.0688 153 ALA Z C     
1190 O O     . ALA A 153 ? 0.5429 0.5868 0.5557 0.0123  -0.0354 -0.0705 153 ALA Z O     
1191 C CB    . ALA A 153 ? 0.5633 0.5073 0.5472 -0.0262 -0.0096 -0.0580 153 ALA Z CB    
1192 N N     . GLN A 154 ? 0.6724 0.6261 0.6378 0.0176  -0.0354 -0.0744 154 GLN Z N     
1193 C CA    . GLN A 154 ? 0.6323 0.5987 0.5912 0.0349  -0.0536 -0.0824 154 GLN Z CA    
1194 C C     . GLN A 154 ? 0.7049 0.7088 0.6844 0.0536  -0.0566 -0.0878 154 GLN Z C     
1195 O O     . GLN A 154 ? 0.6901 0.7377 0.6847 0.0651  -0.0685 -0.0939 154 GLN Z O     
1196 C CB    . GLN A 154 ? 0.5531 0.4627 0.4758 0.0406  -0.0591 -0.0845 154 GLN Z CB    
1197 C CG    . GLN A 154 ? 0.6314 0.5465 0.5434 0.0585  -0.0804 -0.0910 154 GLN Z CG    
1198 C CD    . GLN A 154 ? 0.7512 0.6990 0.6701 0.0529  -0.0932 -0.0926 154 GLN Z CD    
1199 O OE1   . GLN A 154 ? 0.7894 0.7215 0.6966 0.0343  -0.0900 -0.0892 154 GLN Z OE1   
1200 N NE2   . GLN A 154 ? 0.6528 0.6482 0.5925 0.0688  -0.1078 -0.0990 154 GLN Z NE2   
1201 N N     . LEU A 155 ? 0.7702 0.7588 0.7512 0.0564  -0.0456 -0.0867 155 LEU Z N     
1202 C CA    . LEU A 155 ? 0.6861 0.7071 0.6845 0.0725  -0.0467 -0.0931 155 LEU Z CA    
1203 C C     . LEU A 155 ? 0.5834 0.6681 0.6109 0.0688  -0.0437 -0.0910 155 LEU Z C     
1204 O O     . LEU A 155 ? 0.6096 0.7383 0.6518 0.0836  -0.0515 -0.0994 155 LEU Z O     
1205 C CB    . LEU A 155 ? 0.6434 0.6366 0.6389 0.0717  -0.0348 -0.0914 155 LEU Z CB    
1206 C CG    . LEU A 155 ? 0.6334 0.5669 0.6029 0.0753  -0.0354 -0.0938 155 LEU Z CG    
1207 C CD1   . LEU A 155 ? 0.6125 0.5262 0.5858 0.0678  -0.0206 -0.0902 155 LEU Z CD1   
1208 C CD2   . LEU A 155 ? 0.6208 0.5518 0.5844 0.0970  -0.0496 -0.1049 155 LEU Z CD2   
1209 N N     . ALA A 156 ? 0.5475 0.6362 0.5831 0.0488  -0.0318 -0.0797 156 ALA Z N     
1210 C CA    . ALA A 156 ? 0.5097 0.6547 0.5707 0.0411  -0.0275 -0.0742 156 ALA Z CA    
1211 C C     . ALA A 156 ? 0.5865 0.7730 0.6582 0.0441  -0.0394 -0.0798 156 ALA Z C     
1212 O O     . ALA A 156 ? 0.6275 0.8712 0.7204 0.0498  -0.0401 -0.0827 156 ALA Z O     
1213 C CB    . ALA A 156 ? 0.4588 0.5903 0.5235 0.0183  -0.0150 -0.0601 156 ALA Z CB    
1214 N N     . TYR A 157 ? 0.6064 0.7666 0.6634 0.0403  -0.0490 -0.0819 157 TYR Z N     
1215 C CA    . TYR A 157 ? 0.6415 0.8407 0.7097 0.0432  -0.0627 -0.0879 157 TYR Z CA    
1216 C C     . TYR A 157 ? 0.6171 0.8426 0.6911 0.0706  -0.0750 -0.1011 157 TYR Z C     
1217 O O     . TYR A 157 ? 0.5707 0.8565 0.6696 0.0770  -0.0791 -0.1065 157 TYR Z O     
1218 C CB    . TYR A 157 ? 0.6239 0.7860 0.6712 0.0339  -0.0723 -0.0878 157 TYR Z CB    
1219 C CG    . TYR A 157 ? 0.6219 0.8248 0.6810 0.0395  -0.0898 -0.0953 157 TYR Z CG    
1220 C CD1   . TYR A 157 ? 0.5840 0.8406 0.6708 0.0246  -0.0890 -0.0929 157 TYR Z CD1   
1221 C CD2   . TYR A 157 ? 0.6723 0.8615 0.7165 0.0599  -0.1077 -0.1043 157 TYR Z CD2   
1222 C CE1   . TYR A 157 ? 0.5886 0.8880 0.6905 0.0296  -0.1052 -0.1006 157 TYR Z CE1   
1223 C CE2   . TYR A 157 ? 0.6556 0.8855 0.7135 0.0671  -0.1253 -0.1114 157 TYR Z CE2   
1224 C CZ    . TYR A 157 ? 0.6269 0.9139 0.7150 0.0518  -0.1239 -0.1102 157 TYR Z CZ    
1225 O OH    . TYR A 157 ? 0.7233 1.0555 0.8290 0.0585  -0.1417 -0.1181 157 TYR Z OH    
1226 N N     . LEU A 158 ? 0.4708 0.6509 0.5229 0.0865  -0.0803 -0.1066 158 LEU Z N     
1227 C CA    . LEU A 158 ? 0.6396 0.8347 0.6952 0.1141  -0.0927 -0.1200 158 LEU Z CA    
1228 C C     . LEU A 158 ? 0.6711 0.9209 0.7523 0.1233  -0.0854 -0.1259 158 LEU Z C     
1229 O O     . LEU A 158 ? 0.6765 0.9692 0.7741 0.1424  -0.0944 -0.1380 158 LEU Z O     
1230 C CB    . LEU A 158 ? 0.6345 0.7655 0.6617 0.1260  -0.0964 -0.1227 158 LEU Z CB    
1231 C CG    . LEU A 158 ? 0.6509 0.7260 0.6470 0.1212  -0.1054 -0.1181 158 LEU Z CG    
1232 C CD1   . LEU A 158 ? 0.7001 0.7172 0.6702 0.1341  -0.1085 -0.1206 158 LEU Z CD1   
1233 C CD2   . LEU A 158 ? 0.6749 0.7762 0.6753 0.1292  -0.1244 -0.1226 158 LEU Z CD2   
1234 N N     . ASN A 159 ? 0.6060 0.8554 0.6901 0.1100  -0.0690 -0.1177 159 ASN Z N     
1235 C CA    . ASN A 159 ? 0.6123 0.9119 0.7158 0.1164  -0.0609 -0.1219 159 ASN Z CA    
1236 C C     . ASN A 159 ? 0.5663 0.9352 0.6961 0.1067  -0.0568 -0.1184 159 ASN Z C     
1237 O O     . ASN A 159 ? 0.5607 0.9847 0.7084 0.1201  -0.0570 -0.1284 159 ASN Z O     
1238 C CB    . ASN A 159 ? 0.6670 0.9421 0.7633 0.1055  -0.0465 -0.1128 159 ASN Z CB    
1239 C CG    . ASN A 159 ? 0.7307 1.0511 0.8403 0.1142  -0.0400 -0.1183 159 ASN Z CG    
1240 O OD1   . ASN A 159 ? 0.7622 1.1112 0.8815 0.1000  -0.0285 -0.1072 159 ASN Z OD1   
1241 N ND2   . ASN A 159 ? 0.7630 1.0889 0.8716 0.1379  -0.0478 -0.1356 159 ASN Z ND2   
1242 N N     . LYS A 160 ? 0.5440 0.9097 0.6761 0.0827  -0.0523 -0.1048 160 LYS Z N     
1243 C CA    . LYS A 160 ? 0.5317 0.9589 0.6888 0.0684  -0.0471 -0.0990 160 LYS Z CA    
1244 C C     . LYS A 160 ? 0.5889 1.0560 0.7619 0.0775  -0.0610 -0.1099 160 LYS Z C     
1245 O O     . LYS A 160 ? 0.6296 1.1624 0.8285 0.0740  -0.0580 -0.1112 160 LYS Z O     
1246 C CB    . LYS A 160 ? 0.4946 0.8998 0.6493 0.0385  -0.0379 -0.0811 160 LYS Z CB    
1247 C CG    . LYS A 160 ? 0.5777 0.9642 0.7267 0.0287  -0.0228 -0.0683 160 LYS Z CG    
1248 C CD    . LYS A 160 ? 0.6595 0.9992 0.7993 0.0052  -0.0164 -0.0537 160 LYS Z CD    
1249 C CE    . LYS A 160 ? 0.7226 1.0912 0.8788 -0.0173 -0.0151 -0.0450 160 LYS Z CE    
1250 N NZ    . LYS A 160 ? 0.7648 1.0863 0.9129 -0.0398 -0.0076 -0.0314 160 LYS Z NZ    
1251 N N     . ALA A 161 ? 0.6570 1.0860 0.8148 0.0892  -0.0765 -0.1173 161 ALA Z N     
1252 C CA    . ALA A 161 ? 0.5664 1.0309 0.7390 0.1000  -0.0929 -0.1276 161 ALA Z CA    
1253 C C     . ALA A 161 ? 0.5956 1.1022 0.7838 0.1303  -0.0990 -0.1446 161 ALA Z C     
1254 O O     . ALA A 161 ? 0.6400 1.1986 0.8516 0.1409  -0.1092 -0.1543 161 ALA Z O     
1255 C CB    . ALA A 161 ? 0.4840 0.8918 0.6314 0.1027  -0.1088 -0.1284 161 ALA Z CB    
1256 N N     . GLY A 162 ? 0.6342 1.1192 0.8108 0.1446  -0.0932 -0.1495 162 GLY Z N     
1257 C CA    . GLY A 162 ? 0.6341 1.1519 0.8228 0.1744  -0.0986 -0.1679 162 GLY Z CA    
1258 C C     . GLY A 162 ? 0.6377 1.1023 0.8067 0.1991  -0.1157 -0.1781 162 GLY Z C     
1259 O O     . GLY A 162 ? 0.5504 1.0316 0.7275 0.2268  -0.1232 -0.1949 162 GLY Z O     
1260 N N     . ILE A 163 ? 0.6430 1.0420 0.7850 0.1889  -0.1216 -0.1680 163 ILE Z N     
1261 C CA    . ILE A 163 ? 0.6119 0.9526 0.7300 0.2088  -0.1377 -0.1737 163 ILE Z CA    
1262 C C     . ILE A 163 ? 0.6355 0.9363 0.7383 0.2205  -0.1320 -0.1793 163 ILE Z C     
1263 O O     . ILE A 163 ? 0.6144 0.8933 0.7108 0.2457  -0.1444 -0.1912 163 ILE Z O     
1264 C CB    . ILE A 163 ? 0.6016 0.8834 0.6910 0.1918  -0.1432 -0.1603 163 ILE Z CB    
1265 C CG1   . ILE A 163 ? 0.6079 0.9279 0.7118 0.1791  -0.1509 -0.1564 163 ILE Z CG1   
1266 C CG2   . ILE A 163 ? 0.6180 0.8393 0.6798 0.2112  -0.1594 -0.1639 163 ILE Z CG2   
1267 C CD1   . ILE A 163 ? 0.6076 0.8728 0.6813 0.1646  -0.1588 -0.1464 163 ILE Z CD1   
1268 N N     . VAL A 164 ? 0.6475 0.9381 0.7454 0.2022  -0.1141 -0.1709 164 VAL Z N     
1269 C CA    . VAL A 164 ? 0.6415 0.9045 0.7297 0.2109  -0.1080 -0.1774 164 VAL Z CA    
1270 C C     . VAL A 164 ? 0.6522 0.9682 0.7591 0.2049  -0.0924 -0.1791 164 VAL Z C     
1271 O O     . VAL A 164 ? 0.6682 1.0259 0.7893 0.1869  -0.0829 -0.1690 164 VAL Z O     
1272 C CB    . VAL A 164 ? 0.6740 0.8633 0.7336 0.1958  -0.1026 -0.1657 164 VAL Z CB    
1273 C CG1   . VAL A 164 ? 0.6870 0.8229 0.7232 0.2007  -0.1171 -0.1628 164 VAL Z CG1   
1274 C CG2   . VAL A 164 ? 0.5062 0.6995 0.5671 0.1669  -0.0871 -0.1491 164 VAL Z CG2   
1275 N N     . GLN A 165 ? 0.6649 0.9779 0.7702 0.2193  -0.0903 -0.1915 165 GLN Z N     
1276 C CA    . GLN A 165 ? 0.6676 1.0324 0.7869 0.2165  -0.0773 -0.1950 165 GLN Z CA    
1277 C C     . GLN A 165 ? 0.6236 0.9579 0.7304 0.1988  -0.0651 -0.1839 165 GLN Z C     
1278 O O     . GLN A 165 ? 0.5659 0.9395 0.6812 0.1885  -0.0532 -0.1786 165 GLN Z O     
1279 C CB    . GLN A 165 ? 0.6857 1.0774 0.8133 0.2450  -0.0830 -0.2193 165 GLN Z CB    
1280 C CG    . GLN A 165 ? 0.6896 1.1471 0.8417 0.2612  -0.0883 -0.2314 165 GLN Z CG    
1281 C CD    . GLN A 165 ? 0.7546 1.1963 0.9085 0.2667  -0.1034 -0.2286 165 GLN Z CD    
1282 O OE1   . GLN A 165 ? 0.7182 1.1044 0.8566 0.2809  -0.1174 -0.2332 165 GLN Z OE1   
1283 N NE2   . GLN A 165 ? 0.7868 1.2774 0.9592 0.2545  -0.1012 -0.2203 165 GLN Z NE2   
1284 N N     . ALA A 166 ? 0.6376 0.9033 0.7243 0.1954  -0.0682 -0.1800 166 ALA Z N     
1285 C CA    . ALA A 166 ? 0.5752 0.8099 0.6524 0.1799  -0.0577 -0.1707 166 ALA Z CA    
1286 C C     . ALA A 166 ? 0.6446 0.8121 0.7031 0.1675  -0.0581 -0.1591 166 ALA Z C     
1287 O O     . ALA A 166 ? 0.6901 0.8244 0.7367 0.1756  -0.0688 -0.1620 166 ALA Z O     
1288 C CB    . ALA A 166 ? 0.4522 0.6817 0.5270 0.1940  -0.0591 -0.1868 166 ALA Z CB    
1289 N N     . ILE A 167 ? 0.5561 0.7048 0.6115 0.1485  -0.0464 -0.1461 167 ILE Z N     
1290 C CA    . ILE A 167 ? 0.6028 0.6911 0.6412 0.1353  -0.0434 -0.1358 167 ILE Z CA    
1291 C C     . ILE A 167 ? 0.6291 0.6825 0.6617 0.1332  -0.0383 -0.1382 167 ILE Z C     
1292 O O     . ILE A 167 ? 0.6154 0.6912 0.6590 0.1274  -0.0303 -0.1358 167 ILE Z O     
1293 C CB    . ILE A 167 ? 0.6274 0.7200 0.6695 0.1134  -0.0331 -0.1181 167 ILE Z CB    
1294 C CG1   . ILE A 167 ? 0.6430 0.7727 0.6934 0.1123  -0.0381 -0.1158 167 ILE Z CG1   
1295 C CG2   . ILE A 167 ? 0.5945 0.6263 0.6181 0.1012  -0.0289 -0.1101 167 ILE Z CG2   
1296 C CD1   . ILE A 167 ? 0.7492 0.8534 0.7856 0.1213  -0.0514 -0.1213 167 ILE Z CD1   
1297 N N     . ILE A 168 ? 0.6227 0.6220 0.6378 0.1372  -0.0434 -0.1425 168 ILE Z N     
1298 C CA    . ILE A 168 ? 0.6248 0.5881 0.6354 0.1318  -0.0378 -0.1440 168 ILE Z CA    
1299 C C     . ILE A 168 ? 0.7060 0.6344 0.7093 0.1114  -0.0259 -0.1290 168 ILE Z C     
1300 O O     . ILE A 168 ? 0.7949 0.6865 0.7803 0.1068  -0.0270 -0.1235 168 ILE Z O     
1301 C CB    . ILE A 168 ? 0.6324 0.5530 0.6283 0.1448  -0.0481 -0.1561 168 ILE Z CB    
1302 C CG1   . ILE A 168 ? 0.6600 0.6142 0.6656 0.1666  -0.0588 -0.1743 168 ILE Z CG1   
1303 C CG2   . ILE A 168 ? 0.6481 0.5289 0.6401 0.1343  -0.0409 -0.1558 168 ILE Z CG2   
1304 C CD1   . ILE A 168 ? 0.7005 0.6112 0.6929 0.1818  -0.0708 -0.1871 168 ILE Z CD1   
1305 N N     . THR A 169 ? 0.6625 0.6037 0.6794 0.1001  -0.0149 -0.1229 169 THR Z N     
1306 C CA    . THR A 169 ? 0.5912 0.5041 0.6058 0.0823  -0.0022 -0.1101 169 THR Z CA    
1307 C C     . THR A 169 ? 0.5689 0.4907 0.6002 0.0758  0.0062  -0.1085 169 THR Z C     
1308 O O     . THR A 169 ? 0.6876 0.6415 0.7308 0.0838  0.0018  -0.1160 169 THR Z O     
1309 C CB    . THR A 169 ? 0.6258 0.5560 0.6435 0.0724  0.0027  -0.0978 169 THR Z CB    
1310 O OG1   . THR A 169 ? 0.6644 0.5630 0.6792 0.0569  0.0152  -0.0879 169 THR Z OG1   
1311 C CG2   . THR A 169 ? 0.5390 0.5243 0.5776 0.0728  0.0041  -0.0939 169 THR Z CG2   
1312 N N     . GLU A 170 ? 0.5256 0.4207 0.5580 0.0619  0.0180  -0.0996 170 GLU Z N     
1313 C CA    . GLU A 170 ? 0.6316 0.5390 0.6838 0.0555  0.0259  -0.0961 170 GLU Z CA    
1314 C C     . GLU A 170 ? 0.6338 0.5599 0.6980 0.0465  0.0342  -0.0816 170 GLU Z C     
1315 O O     . GLU A 170 ? 0.6857 0.6308 0.7685 0.0432  0.0389  -0.0759 170 GLU Z O     
1316 C CB    . GLU A 170 ? 0.6578 0.5233 0.7077 0.0472  0.0339  -0.0982 170 GLU Z CB    
1317 C CG    . GLU A 170 ? 0.7780 0.6183 0.8162 0.0536  0.0262  -0.1112 170 GLU Z CG    
1318 C CD    . GLU A 170 ? 0.9058 0.7779 0.9575 0.0636  0.0168  -0.1229 170 GLU Z CD    
1319 O OE1   . GLU A 170 ? 0.9271 0.8350 0.9987 0.0620  0.0189  -0.1199 170 GLU Z OE1   
1320 O OE2   . GLU A 170 ? 0.8789 0.7387 0.9200 0.0736  0.0065  -0.1354 170 GLU Z OE2   
1321 N N     . ASP A 171 ? 0.6322 0.5521 0.6855 0.0429  0.0347  -0.0758 171 ASP Z N     
1322 C CA    . ASP A 171 ? 0.6608 0.5884 0.7227 0.0326  0.0427  -0.0625 171 ASP Z CA    
1323 C C     . ASP A 171 ? 0.7083 0.6856 0.7825 0.0353  0.0378  -0.0565 171 ASP Z C     
1324 O O     . ASP A 171 ? 0.7966 0.7978 0.8656 0.0432  0.0288  -0.0622 171 ASP Z O     
1325 C CB    . ASP A 171 ? 0.6314 0.5271 0.6744 0.0253  0.0452  -0.0605 171 ASP Z CB    
1326 C CG    . ASP A 171 ? 0.7229 0.6177 0.7739 0.0135  0.0540  -0.0489 171 ASP Z CG    
1327 O OD1   . ASP A 171 ? 0.7153 0.6224 0.7858 0.0106  0.0605  -0.0413 171 ASP Z OD1   
1328 O OD2   . ASP A 171 ? 0.7583 0.6384 0.7957 0.0073  0.0537  -0.0476 171 ASP Z OD2   
1329 N N     . SER A 172 ? 0.6673 0.6602 0.7580 0.0290  0.0441  -0.0444 172 SER Z N     
1330 C CA    . SER A 172 ? 0.7146 0.7534 0.8157 0.0292  0.0411  -0.0355 172 SER Z CA    
1331 C C     . SER A 172 ? 0.7518 0.7928 0.8506 0.0193  0.0430  -0.0261 172 SER Z C     
1332 O O     . SER A 172 ? 0.7404 0.8201 0.8452 0.0179  0.0403  -0.0194 172 SER Z O     
1333 C CB    . SER A 172 ? 0.7284 0.7817 0.8470 0.0270  0.0452  -0.0246 172 SER Z CB    
1334 O OG    . SER A 172 ? 0.7702 0.7902 0.8951 0.0179  0.0548  -0.0159 172 SER Z OG    
1335 N N     . ASP A 173 ? 0.7207 0.7207 0.8104 0.0114  0.0481  -0.0261 173 ASP Z N     
1336 C CA    . ASP A 173 ? 0.6593 0.6554 0.7450 0.0006  0.0489  -0.0200 173 ASP Z CA    
1337 C C     . ASP A 173 ? 0.5963 0.6264 0.6779 0.0047  0.0389  -0.0250 173 ASP Z C     
1338 O O     . ASP A 173 ? 0.6670 0.7163 0.7538 -0.0045 0.0385  -0.0175 173 ASP Z O     
1339 C CB    . ASP A 173 ? 0.7055 0.6514 0.7753 -0.0059 0.0538  -0.0247 173 ASP Z CB    
1340 C CG    . ASP A 173 ? 0.8140 0.7308 0.8920 -0.0142 0.0662  -0.0175 173 ASP Z CG    
1341 O OD1   . ASP A 173 ? 0.8605 0.7936 0.9562 -0.0181 0.0695  -0.0054 173 ASP Z OD1   
1342 O OD2   . ASP A 173 ? 0.9024 0.7797 0.9688 -0.0164 0.0728  -0.0237 173 ASP Z OD2   
1343 N N     . LEU A 174 ? 0.7997 0.5433 0.5472 0.0324  -0.0565 -0.0889 174 LEU Z N     
1344 C CA    . LEU A 174 ? 0.7547 0.5175 0.5077 0.0306  -0.0499 -0.0740 174 LEU Z CA    
1345 C C     . LEU A 174 ? 0.8225 0.5840 0.5708 0.0174  -0.0595 -0.0727 174 LEU Z C     
1346 O O     . LEU A 174 ? 0.8797 0.6571 0.6273 0.0115  -0.0628 -0.0621 174 LEU Z O     
1347 C CB    . LEU A 174 ? 0.7060 0.4751 0.4758 0.0401  -0.0246 -0.0691 174 LEU Z CB    
1348 C CG    . LEU A 174 ? 0.7528 0.5280 0.5248 0.0552  -0.0091 -0.0617 174 LEU Z CG    
1349 C CD1   . LEU A 174 ? 0.8573 0.6543 0.6207 0.0587  -0.0173 -0.0480 174 LEU Z CD1   
1350 C CD2   . LEU A 174 ? 0.7142 0.4742 0.4825 0.0606  -0.0102 -0.0727 174 LEU Z CD2   
1351 N N     . LEU A 175 ? 0.8804 0.6240 0.6251 0.0138  -0.0637 -0.0840 175 LEU Z N     
1352 C CA    . LEU A 175 ? 0.8068 0.5438 0.5427 0.0035  -0.0712 -0.0827 175 LEU Z CA    
1353 C C     . LEU A 175 ? 0.9002 0.6282 0.6161 -0.0065 -0.0894 -0.0818 175 LEU Z C     
1354 O O     . LEU A 175 ? 1.0941 0.8250 0.8053 -0.0172 -0.0925 -0.0746 175 LEU Z O     
1355 C CB    . LEU A 175 ? 0.7821 0.5025 0.5160 0.0059  -0.0713 -0.0961 175 LEU Z CB    
1356 C CG    . LEU A 175 ? 0.8206 0.5488 0.5744 0.0114  -0.0526 -0.0987 175 LEU Z CG    
1357 C CD1   . LEU A 175 ? 0.8621 0.5778 0.6141 0.0144  -0.0561 -0.1162 175 LEU Z CD1   
1358 C CD2   . LEU A 175 ? 0.8206 0.5602 0.5798 0.0072  -0.0430 -0.0847 175 LEU Z CD2   
1359 N N     . ALA A 176 ? 0.8774 0.5934 0.5817 -0.0036 -0.0998 -0.0896 176 ALA Z N     
1360 C CA    . ALA A 176 ? 0.8202 0.5230 0.5031 -0.0132 -0.1158 -0.0904 176 ALA Z CA    
1361 C C     . ALA A 176 ? 0.8593 0.5851 0.5470 -0.0200 -0.1178 -0.0808 176 ALA Z C     
1362 O O     . ALA A 176 ? 0.8768 0.5975 0.5518 -0.0331 -0.1281 -0.0805 176 ALA Z O     
1363 C CB    . ALA A 176 ? 0.7678 0.4508 0.4361 -0.0062 -0.1253 -0.1017 176 ALA Z CB    
1364 N N     . PHE A 177 ? 0.8847 0.6360 0.5901 -0.0106 -0.1070 -0.0740 177 PHE Z N     
1365 C CA    . PHE A 177 ? 0.9133 0.6928 0.6240 -0.0129 -0.1091 -0.0655 177 PHE Z CA    
1366 C C     . PHE A 177 ? 0.9404 0.7410 0.6629 -0.0219 -0.1038 -0.0561 177 PHE Z C     
1367 O O     . PHE A 177 ? 0.9833 0.8122 0.7122 -0.0263 -0.1069 -0.0503 177 PHE Z O     
1368 C CB    . PHE A 177 ? 0.7338 0.5303 0.4539 0.0049  -0.0987 -0.0609 177 PHE Z CB    
1369 C CG    . PHE A 177 ? 0.8015 0.5865 0.5085 0.0120  -0.1069 -0.0680 177 PHE Z CG    
1370 C CD1   . PHE A 177 ? 0.7552 0.5502 0.4514 0.0074  -0.1211 -0.0687 177 PHE Z CD1   
1371 C CD2   . PHE A 177 ? 0.7759 0.5414 0.4823 0.0229  -0.1000 -0.0749 177 PHE Z CD2   
1372 C CE1   . PHE A 177 ? 0.7653 0.5484 0.4475 0.0148  -0.1283 -0.0750 177 PHE Z CE1   
1373 C CE2   . PHE A 177 ? 0.8260 0.5807 0.5200 0.0301  -0.1064 -0.0807 177 PHE Z CE2   
1374 C CZ    . PHE A 177 ? 0.7623 0.5244 0.4427 0.0267  -0.1207 -0.0801 177 PHE Z CZ    
1375 N N     . GLY A 178 ? 0.9565 0.7450 0.6821 -0.0240 -0.0959 -0.0555 178 GLY Z N     
1376 C CA    . GLY A 178 ? 0.9536 0.7578 0.6886 -0.0325 -0.0898 -0.0466 178 GLY Z CA    
1377 C C     . GLY A 178 ? 0.9231 0.7507 0.6769 -0.0205 -0.0723 -0.0364 178 GLY Z C     
1378 O O     . GLY A 178 ? 1.0151 0.8703 0.7798 -0.0234 -0.0680 -0.0266 178 GLY Z O     
1379 N N     . CYS A 179 ? 0.8095 0.6263 0.5674 -0.0071 -0.0610 -0.0392 179 CYS Z N     
1380 C CA    . CYS A 179 ? 0.8269 0.6581 0.5993 0.0044  -0.0413 -0.0301 179 CYS Z CA    
1381 C C     . CYS A 179 ? 0.8525 0.6784 0.6284 -0.0017 -0.0341 -0.0276 179 CYS Z C     
1382 O O     . CYS A 179 ? 0.9046 0.7082 0.6705 -0.0103 -0.0420 -0.0358 179 CYS Z O     
1383 C CB    . CYS A 179 ? 0.8910 0.7087 0.6669 0.0182  -0.0285 -0.0358 179 CYS Z CB    
1384 S SG    . CYS A 179 ? 1.0974 0.9261 0.8709 0.0323  -0.0272 -0.0326 179 CYS Z SG    
1385 N N     . LYS A 180 ? 0.7195 0.5646 0.5071 0.0048  -0.0187 -0.0158 180 LYS Z N     
1386 C CA    . LYS A 180 ? 0.8303 0.6714 0.6210 0.0008  -0.0097 -0.0121 180 LYS Z CA    
1387 C C     . LYS A 180 ? 0.8094 0.6294 0.6025 0.0087  0.0045  -0.0195 180 LYS Z C     
1388 O O     . LYS A 180 ? 0.8427 0.6431 0.6297 0.0032  0.0016  -0.0282 180 LYS Z O     
1389 C CB    . LYS A 180 ? 0.8628 0.7355 0.6646 0.0047  0.0007  0.0038  180 LYS Z CB    
1390 C CG    . LYS A 180 ? 0.8652 0.7664 0.6695 -0.0044 -0.0127 0.0089  180 LYS Z CG    
1391 C CD    . LYS A 180 ? 1.0128 0.8979 0.8075 -0.0243 -0.0272 0.0019  180 LYS Z CD    
1392 C CE    . LYS A 180 ? 1.0916 1.0056 0.8920 -0.0372 -0.0376 0.0052  180 LYS Z CE    
1393 N NZ    . LYS A 180 ? 1.1717 1.1165 0.9871 -0.0383 -0.0271 0.0172  180 LYS Z NZ    
1394 N N     . LYS A 181 ? 0.7766 0.6005 0.5777 0.0220  0.0208  -0.0168 181 LYS Z N     
1395 C CA    . LYS A 181 ? 0.8013 0.6065 0.6076 0.0279  0.0375  -0.0256 181 LYS Z CA    
1396 C C     . LYS A 181 ? 0.8132 0.6098 0.6221 0.0358  0.0427  -0.0337 181 LYS Z C     
1397 O O     . LYS A 181 ? 0.7842 0.5923 0.5928 0.0454  0.0479  -0.0245 181 LYS Z O     
1398 C CB    . LYS A 181 ? 0.8431 0.6555 0.6565 0.0364  0.0607  -0.0137 181 LYS Z CB    
1399 C CG    . LYS A 181 ? 0.9001 0.7203 0.7121 0.0299  0.0591  -0.0055 181 LYS Z CG    
1400 C CD    . LYS A 181 ? 0.9788 0.8115 0.7965 0.0413  0.0816  0.0098  181 LYS Z CD    
1401 C CE    . LYS A 181 ? 1.0437 0.8869 0.8608 0.0354  0.0806  0.0191  181 LYS Z CE    
1402 N NZ    . LYS A 181 ? 1.1278 0.9470 0.9402 0.0286  0.0818  0.0083  181 LYS Z NZ    
1403 N N     . VAL A 182 ? 0.8395 0.6170 0.6504 0.0327  0.0418  -0.0514 182 VAL Z N     
1404 C CA    . VAL A 182 ? 0.8481 0.6166 0.6636 0.0385  0.0479  -0.0614 182 VAL Z CA    
1405 C C     . VAL A 182 ? 0.8076 0.5620 0.6359 0.0392  0.0672  -0.0759 182 VAL Z C     
1406 O O     . VAL A 182 ? 0.9143 0.6628 0.7446 0.0324  0.0622  -0.0881 182 VAL Z O     
1407 C CB    . VAL A 182 ? 0.8742 0.6367 0.6810 0.0331  0.0243  -0.0729 182 VAL Z CB    
1408 C CG1   . VAL A 182 ? 0.9252 0.6794 0.7382 0.0394  0.0319  -0.0835 182 VAL Z CG1   
1409 C CG2   . VAL A 182 ? 0.8496 0.6243 0.6443 0.0305  0.0068  -0.0611 182 VAL Z CG2   
1410 N N     . ILE A 183 ? 0.7860 0.5346 0.6221 0.0476  0.0901  -0.0753 183 ILE Z N     
1411 C CA    . ILE A 183 ? 0.7730 0.5078 0.6235 0.0462  0.1120  -0.0906 183 ILE Z CA    
1412 C C     . ILE A 183 ? 0.7757 0.5029 0.6351 0.0453  0.1127  -0.1085 183 ILE Z C     
1413 O O     . ILE A 183 ? 0.7850 0.5080 0.6435 0.0536  0.1245  -0.1027 183 ILE Z O     
1414 C CB    . ILE A 183 ? 0.7942 0.5224 0.6470 0.0558  0.1444  -0.0777 183 ILE Z CB    
1415 C CG1   . ILE A 183 ? 0.7705 0.5095 0.6149 0.0584  0.1436  -0.0592 183 ILE Z CG1   
1416 C CG2   . ILE A 183 ? 0.8256 0.5369 0.6938 0.0514  0.1691  -0.0956 183 ILE Z CG2   
1417 C CD1   . ILE A 183 ? 0.7332 0.4657 0.5759 0.0709  0.1749  -0.0445 183 ILE Z CD1   
1418 N N     . LEU A 184 ? 0.7967 0.5229 0.6647 0.0369  0.1019  -0.1306 184 LEU Z N     
1419 C CA    . LEU A 184 ? 0.7523 0.4760 0.6306 0.0358  0.1003  -0.1494 184 LEU Z CA    
1420 C C     . LEU A 184 ? 0.7885 0.5055 0.6895 0.0318  0.1262  -0.1686 184 LEU Z C     
1421 O O     . LEU A 184 ? 0.8072 0.5213 0.7152 0.0276  0.1392  -0.1730 184 LEU Z O     
1422 C CB    . LEU A 184 ? 0.8249 0.5549 0.6977 0.0310  0.0701  -0.1637 184 LEU Z CB    
1423 C CG    . LEU A 184 ? 0.9632 0.6959 0.8135 0.0321  0.0422  -0.1515 184 LEU Z CG    
1424 C CD1   . LEU A 184 ? 1.0413 0.7747 0.8807 0.0277  0.0208  -0.1587 184 LEU Z CD1   
1425 C CD2   . LEU A 184 ? 1.0102 0.7412 0.8575 0.0359  0.0329  -0.1569 184 LEU Z CD2   
1426 N N     . LYS A 185 ? 0.8811 0.4972 0.6482 -0.0428 0.0429  -0.1706 185 LYS Z N     
1427 C CA    . LYS A 185 ? 0.8989 0.4973 0.6787 -0.0518 0.0400  -0.1773 185 LYS Z CA    
1428 C C     . LYS A 185 ? 0.9306 0.4987 0.7113 -0.0445 0.0252  -0.1835 185 LYS Z C     
1429 O O     . LYS A 185 ? 0.9750 0.5384 0.7688 -0.0424 0.0175  -0.1979 185 LYS Z O     
1430 C CB    . LYS A 185 ? 0.8792 0.5055 0.6763 -0.0494 0.0411  -0.1913 185 LYS Z CB    
1431 C CG    . LYS A 185 ? 0.8939 0.5442 0.6947 -0.0584 0.0556  -0.1851 185 LYS Z CG    
1432 C CD    . LYS A 185 ? 0.9444 0.6232 0.7611 -0.0531 0.0537  -0.1979 185 LYS Z CD    
1433 C CE    . LYS A 185 ? 0.9891 0.6879 0.8133 -0.0619 0.0677  -0.1910 185 LYS Z CE    
1434 N NZ    . LYS A 185 ? 0.9361 0.6398 0.7418 -0.0601 0.0783  -0.1793 185 LYS Z NZ    
1435 N N     . MET A 186 ? 0.9498 0.4956 0.7162 -0.0402 0.0197  -0.1731 186 MET Z N     
1436 C CA    . MET A 186 ? 1.0376 0.5501 0.8043 -0.0318 0.0053  -0.1774 186 MET Z CA    
1437 C C     . MET A 186 ? 1.1590 0.6314 0.9255 -0.0508 0.0049  -0.1699 186 MET Z C     
1438 O O     . MET A 186 ? 1.2493 0.7088 1.0032 -0.0666 0.0139  -0.1526 186 MET Z O     
1439 C CB    . MET A 186 ? 0.9947 0.4998 0.7491 -0.0181 -0.0023 -0.1683 186 MET Z CB    
1440 C CG    . MET A 186 ? 1.0850 0.5596 0.8421 -0.0033 -0.0178 -0.1749 186 MET Z CG    
1441 S SD    . MET A 186 ? 1.0471 0.5111 0.7934 0.0116  -0.0287 -0.1607 186 MET Z SD    
1442 C CE    . MET A 186 ? 1.2392 0.6683 0.9607 -0.0131 -0.0251 -0.1356 186 MET Z CE    
1443 N N     . ASP A 187 ? 1.1605 0.6120 0.9396 -0.0500 -0.0051 -0.1830 187 ASP Z N     
1444 C CA    . ASP A 187 ? 1.0794 0.4913 0.8624 -0.0696 -0.0063 -0.1762 187 ASP Z CA    
1445 C C     . ASP A 187 ? 1.1842 0.5493 0.9523 -0.0640 -0.0176 -0.1662 187 ASP Z C     
1446 O O     . ASP A 187 ? 1.1859 0.5527 0.9429 -0.0445 -0.0248 -0.1646 187 ASP Z O     
1447 C CB    . ASP A 187 ? 1.2233 0.6329 1.0292 -0.0744 -0.0135 -0.1956 187 ASP Z CB    
1448 C CG    . ASP A 187 ? 1.2666 0.6755 1.0737 -0.0502 -0.0289 -0.2177 187 ASP Z CG    
1449 O OD1   . ASP A 187 ? 1.2700 0.6628 1.0645 -0.0320 -0.0364 -0.2163 187 ASP Z OD1   
1450 O OD2   . ASP A 187 ? 1.2923 0.7174 1.1124 -0.0485 -0.0337 -0.2370 187 ASP Z OD2   
1451 N N     . GLN A 188 ? 1.2445 0.5681 1.0147 -0.0812 -0.0197 -0.1590 188 GLN Z N     
1452 C CA    . GLN A 188 ? 1.3659 0.6383 1.1201 -0.0778 -0.0307 -0.1465 188 GLN Z CA    
1453 C C     . GLN A 188 ? 1.4667 0.7212 1.2267 -0.0534 -0.0496 -0.1647 188 GLN Z C     
1454 O O     . GLN A 188 ? 1.4191 0.6380 1.1666 -0.0414 -0.0611 -0.1567 188 GLN Z O     
1455 C CB    . GLN A 188 ? 1.4401 0.6714 1.1958 -0.1048 -0.0262 -0.1331 188 GLN Z CB    
1456 C CG    . GLN A 188 ? 1.4935 0.7220 1.2786 -0.1167 -0.0296 -0.1510 188 GLN Z CG    
1457 C CD    . GLN A 188 ? 1.5658 0.7580 1.3579 -0.1466 -0.0231 -0.1359 188 GLN Z CD    
1458 O OE1   . GLN A 188 ? 1.5333 0.6965 1.3035 -0.1572 -0.0157 -0.1112 188 GLN Z OE1   
1459 N NE2   . GLN A 188 ? 1.6129 0.8069 1.4353 -0.1612 -0.0260 -0.1504 188 GLN Z NE2   
1460 N N     . PHE A 189 ? 1.4527 0.7312 1.2301 -0.0449 -0.0529 -0.1894 189 PHE Z N     
1461 C CA    . PHE A 189 ? 1.3958 0.6578 1.1771 -0.0212 -0.0688 -0.2105 189 PHE Z CA    
1462 C C     . PHE A 189 ? 1.2884 0.5851 1.0647 0.0079  -0.0694 -0.2165 189 PHE Z C     
1463 O O     . PHE A 189 ? 1.2357 0.5151 1.0109 0.0317  -0.0809 -0.2264 189 PHE Z O     
1464 C CB    . PHE A 189 ? 1.4498 0.7179 1.2479 -0.0258 -0.0733 -0.2354 189 PHE Z CB    
1465 C CG    . PHE A 189 ? 1.5885 0.8268 1.3993 -0.0558 -0.0737 -0.2308 189 PHE Z CG    
1466 C CD1   . PHE A 189 ? 1.6697 0.8569 1.4741 -0.0696 -0.0761 -0.2117 189 PHE Z CD1   
1467 C CD2   . PHE A 189 ? 1.6882 0.9507 1.5185 -0.0708 -0.0719 -0.2443 189 PHE Z CD2   
1468 C CE1   . PHE A 189 ? 1.7503 0.9114 1.5692 -0.0991 -0.0745 -0.2058 189 PHE Z CE1   
1469 C CE2   . PHE A 189 ? 1.7725 1.0121 1.6209 -0.0997 -0.0720 -0.2396 189 PHE Z CE2   
1470 C CZ    . PHE A 189 ? 1.7924 0.9815 1.6359 -0.1147 -0.0722 -0.2201 189 PHE Z CZ    
1471 N N     . GLY A 190 ? 1.1991 0.5443 0.9741 0.0058  -0.0564 -0.2104 190 GLY Z N     
1472 C CA    . GLY A 190 ? 1.1346 0.5168 0.9079 0.0291  -0.0549 -0.2130 190 GLY Z CA    
1473 C C     . GLY A 190 ? 1.1585 0.5902 0.9391 0.0355  -0.0463 -0.2289 190 GLY Z C     
1474 O O     . GLY A 190 ? 1.1467 0.6115 0.9283 0.0545  -0.0435 -0.2327 190 GLY Z O     
1475 N N     . ASN A 191 ? 1.2086 0.6462 0.9956 0.0194  -0.0425 -0.2371 191 ASN Z N     
1476 C CA    . ASN A 191 ? 1.1160 0.5964 0.9072 0.0251  -0.0364 -0.2516 191 ASN Z CA    
1477 C C     . ASN A 191 ? 1.1531 0.6703 0.9438 0.0128  -0.0216 -0.2372 191 ASN Z C     
1478 O O     . ASN A 191 ? 1.1124 0.6222 0.9055 -0.0092 -0.0153 -0.2248 191 ASN Z O     
1479 C CB    . ASN A 191 ? 1.1003 0.5698 0.9000 0.0160  -0.0433 -0.2695 191 ASN Z CB    
1480 C CG    . ASN A 191 ? 1.1913 0.6175 0.9900 0.0262  -0.0591 -0.2856 191 ASN Z CG    
1481 O OD1   . ASN A 191 ? 1.1918 0.6219 0.9841 0.0503  -0.0645 -0.3038 191 ASN Z OD1   
1482 N ND2   . ASN A 191 ? 1.2414 0.6244 1.0456 0.0079  -0.0656 -0.2791 191 ASN Z ND2   
1483 N N     . GLY A 192 ? 0.9808 0.5368 0.7689 0.0268  -0.0149 -0.2388 192 GLY Z N     
1484 C CA    . GLY A 192 ? 0.9434 0.5318 0.7302 0.0167  -0.0016 -0.2264 192 GLY Z CA    
1485 C C     . GLY A 192 ? 0.9905 0.6205 0.7772 0.0300  0.0045  -0.2353 192 GLY Z C     
1486 O O     . GLY A 192 ? 1.0256 0.6615 0.8112 0.0480  -0.0005 -0.2515 192 GLY Z O     
1487 N N     . LEU A 193 ? 0.8861 0.5427 0.6716 0.0214  0.0159  -0.2247 193 LEU Z N     
1488 C CA    . LEU A 193 ? 0.8623 0.5570 0.6461 0.0320  0.0233  -0.2284 193 LEU Z CA    
1489 C C     . LEU A 193 ? 0.8478 0.5602 0.6297 0.0381  0.0290  -0.2161 193 LEU Z C     
1490 O O     . LEU A 193 ? 0.8603 0.5679 0.6395 0.0255  0.0327  -0.2010 193 LEU Z O     
1491 C CB    . LEU A 193 ? 0.8606 0.5725 0.6463 0.0192  0.0311  -0.2255 193 LEU Z CB    
1492 C CG    . LEU A 193 ? 0.9572 0.6657 0.7493 0.0155  0.0246  -0.2394 193 LEU Z CG    
1493 C CD1   . LEU A 193 ? 0.9604 0.6894 0.7584 0.0044  0.0324  -0.2339 193 LEU Z CD1   
1494 C CD2   . LEU A 193 ? 0.9822 0.6994 0.7673 0.0348  0.0172  -0.2579 193 LEU Z CD2   
1495 N N     . GLU A 194 ? 0.8479 0.5811 0.6312 0.0571  0.0298  -0.2230 194 GLU Z N     
1496 C CA    . GLU A 194 ? 0.8357 0.5910 0.6235 0.0630  0.0346  -0.2121 194 GLU Z CA    
1497 C C     . GLU A 194 ? 0.8437 0.6349 0.6304 0.0627  0.0469  -0.2083 194 GLU Z C     
1498 O O     . GLU A 194 ? 0.8758 0.6817 0.6574 0.0712  0.0510  -0.2186 194 GLU Z O     
1499 C CB    . GLU A 194 ? 0.9166 0.6748 0.7122 0.0848  0.0294  -0.2200 194 GLU Z CB    
1500 C CG    . GLU A 194 ? 0.8817 0.6711 0.6892 0.0922  0.0346  -0.2100 194 GLU Z CG    
1501 C CD    . GLU A 194 ? 1.0882 0.8890 0.9075 0.1170  0.0329  -0.2199 194 GLU Z CD    
1502 O OE1   . GLU A 194 ? 1.1402 0.9651 0.9581 0.1310  0.0424  -0.2307 194 GLU Z OE1   
1503 O OE2   . GLU A 194 ? 1.1767 0.9620 1.0056 0.1237  0.0226  -0.2166 194 GLU Z OE2   
1504 N N     . ILE A 195 ? 0.7934 0.5957 0.5822 0.0525  0.0520  -0.1931 195 ILE Z N     
1505 C CA    . ILE A 195 ? 0.8166 0.6495 0.6054 0.0511  0.0635  -0.1871 195 ILE Z CA    
1506 C C     . ILE A 195 ? 0.8428 0.6980 0.6443 0.0562  0.0653  -0.1783 195 ILE Z C     
1507 O O     . ILE A 195 ? 0.8582 0.7044 0.6635 0.0472  0.0596  -0.1681 195 ILE Z O     
1508 C CB    . ILE A 195 ? 0.7599 0.5862 0.5411 0.0323  0.0686  -0.1774 195 ILE Z CB    
1509 C CG1   . ILE A 195 ? 0.7810 0.5925 0.5565 0.0278  0.0674  -0.1858 195 ILE Z CG1   
1510 C CG2   . ILE A 195 ? 0.7443 0.5975 0.5255 0.0308  0.0794  -0.1696 195 ILE Z CG2   
1511 C CD1   . ILE A 195 ? 0.7836 0.5912 0.5549 0.0123  0.0742  -0.1776 195 ILE Z CD1   
1512 N N     . ASP A 196 ? 0.7680 0.6529 0.5762 0.0706  0.0731  -0.1824 196 ASP Z N     
1513 C CA    . ASP A 196 ? 0.7703 0.6834 0.5973 0.0755  0.0765  -0.1740 196 ASP Z CA    
1514 C C     . ASP A 196 ? 0.7985 0.7340 0.6264 0.0634  0.0876  -0.1615 196 ASP Z C     
1515 O O     . ASP A 196 ? 0.8501 0.7892 0.6644 0.0614  0.0962  -0.1627 196 ASP Z O     
1516 C CB    . ASP A 196 ? 0.9236 0.8583 0.7600 0.0989  0.0814  -0.1849 196 ASP Z CB    
1517 C CG    . ASP A 196 ? 1.1368 1.0994 1.0006 0.1059  0.0822  -0.1775 196 ASP Z CG    
1518 O OD1   . ASP A 196 ? 1.1519 1.1438 1.0273 0.0982  0.0916  -0.1658 196 ASP Z OD1   
1519 O OD2   . ASP A 196 ? 1.2644 1.2195 1.1404 0.1190  0.0727  -0.1830 196 ASP Z OD2   
1520 N N     . GLN A 197 ? 0.7842 0.7333 0.6285 0.0552  0.0860  -0.1495 197 GLN Z N     
1521 C CA    . GLN A 197 ? 0.7273 0.6919 0.5733 0.0409  0.0946  -0.1370 197 GLN Z CA    
1522 C C     . GLN A 197 ? 0.8630 0.8625 0.7159 0.0503  0.1105  -0.1358 197 GLN Z C     
1523 O O     . GLN A 197 ? 0.7214 0.7268 0.5656 0.0416  0.1205  -0.1284 197 GLN Z O     
1524 C CB    . GLN A 197 ? 0.7433 0.7131 0.6065 0.0291  0.0860  -0.1258 197 GLN Z CB    
1525 C CG    . GLN A 197 ? 0.7951 0.7713 0.6580 0.0107  0.0918  -0.1137 197 GLN Z CG    
1526 C CD    . GLN A 197 ? 0.9115 0.8974 0.7946 -0.0002 0.0812  -0.1043 197 GLN Z CD    
1527 O OE1   . GLN A 197 ? 0.9192 0.9307 0.8294 0.0095  0.0768  -0.1038 197 GLN Z OE1   
1528 N NE2   . GLN A 197 ? 0.9606 0.9262 0.8312 -0.0197 0.0762  -0.0975 197 GLN Z NE2   
1529 N N     . ALA A 198 ? 0.8334 0.8546 0.7005 0.0691  0.1137  -0.1429 198 ALA Z N     
1530 C CA    . ALA A 198 ? 0.7931 0.8497 0.6659 0.0800  0.1312  -0.1417 198 ALA Z CA    
1531 C C     . ALA A 198 ? 0.8455 0.8938 0.6878 0.0884  0.1392  -0.1507 198 ALA Z C     
1532 O O     . ALA A 198 ? 0.8897 0.9612 0.7258 0.0934  0.1548  -0.1468 198 ALA Z O     
1533 C CB    . ALA A 198 ? 0.8086 0.8911 0.7063 0.0996  0.1333  -0.1478 198 ALA Z CB    
1534 N N     . ARG A 199 ? 0.8602 0.8756 0.6836 0.0894  0.1278  -0.1621 199 ARG Z N     
1535 C CA    . ARG A 199 ? 0.8600 0.8666 0.6563 0.0979  0.1306  -0.1729 199 ARG Z CA    
1536 C C     . ARG A 199 ? 0.8169 0.8098 0.5971 0.0825  0.1306  -0.1650 199 ARG Z C     
1537 O O     . ARG A 199 ? 0.7643 0.7476 0.5236 0.0870  0.1290  -0.1729 199 ARG Z O     
1538 C CB    . ARG A 199 ? 0.8649 0.8451 0.6534 0.1082  0.1175  -0.1913 199 ARG Z CB    
1539 C CG    . ARG A 199 ? 0.8836 0.8714 0.6877 0.1260  0.1158  -0.2005 199 ARG Z CG    
1540 C CD    . ARG A 199 ? 0.9629 0.9366 0.7492 0.1448  0.1120  -0.2220 199 ARG Z CD    
1541 N NE    . ARG A 199 ? 1.0395 0.9793 0.8091 0.1358  0.0989  -0.2300 199 ARG Z NE    
1542 C CZ    . ARG A 199 ? 1.1188 1.0540 0.8645 0.1387  0.0985  -0.2396 199 ARG Z CZ    
1543 N NH1   . ARG A 199 ? 1.0364 0.9954 0.7660 0.1513  0.1111  -0.2419 199 ARG Z NH1   
1544 N NH2   . ARG A 199 ? 1.1477 1.0553 0.8857 0.1290  0.0855  -0.2462 199 ARG Z NH2   
1545 N N     . LEU A 200 ? 0.7713 0.7634 0.5618 0.0650  0.1316  -0.1500 200 LEU Z N     
1546 C CA    . LEU A 200 ? 0.7866 0.7641 0.5641 0.0513  0.1324  -0.1422 200 LEU Z CA    
1547 C C     . LEU A 200 ? 0.8351 0.8275 0.5963 0.0569  0.1440  -0.1374 200 LEU Z C     
1548 O O     . LEU A 200 ? 0.8691 0.8489 0.6163 0.0516  0.1434  -0.1340 200 LEU Z O     
1549 C CB    . LEU A 200 ? 0.7216 0.6941 0.5112 0.0327  0.1319  -0.1283 200 LEU Z CB    
1550 C CG    . LEU A 200 ? 0.9555 0.9014 0.7484 0.0229  0.1192  -0.1311 200 LEU Z CG    
1551 C CD1   . LEU A 200 ? 0.7114 0.6519 0.5101 0.0052  0.1187  -0.1185 200 LEU Z CD1   
1552 C CD2   . LEU A 200 ? 0.7170 0.6373 0.4947 0.0215  0.1141  -0.1391 200 LEU Z CD2   
1553 N N     . GLY A 201 ? 0.7738 0.8169 0.5579 0.2015  0.0428  -0.0544 201 GLY Z N     
1554 C CA    . GLY A 201 ? 0.8986 0.9293 0.6413 0.2155  0.0460  -0.0458 201 GLY Z CA    
1555 C C     . GLY A 201 ? 1.0179 1.0310 0.7262 0.2350  0.0280  -0.0635 201 GLY Z C     
1556 O O     . GLY A 201 ? 1.1221 1.1217 0.7926 0.2475  0.0254  -0.0579 201 GLY Z O     
1557 N N     . MET A 202 ? 0.9825 0.9946 0.7030 0.2371  0.0150  -0.0845 202 MET Z N     
1558 C CA    . MET A 202 ? 0.9799 0.9757 0.6741 0.2527  -0.0054 -0.1049 202 MET Z CA    
1559 C C     . MET A 202 ? 0.9536 0.9387 0.6540 0.2481  -0.0257 -0.1097 202 MET Z C     
1560 O O     . MET A 202 ? 1.1228 1.0951 0.7963 0.2620  -0.0434 -0.1217 202 MET Z O     
1561 C CB    . MET A 202 ? 0.9806 0.9761 0.6918 0.2532  -0.0140 -0.1259 202 MET Z CB    
1562 C CG    . MET A 202 ? 0.9975 1.0016 0.7022 0.2620  0.0034  -0.1245 202 MET Z CG    
1563 S SD    . MET A 202 ? 1.1049 1.1030 0.7489 0.2886  0.0135  -0.1224 202 MET Z SD    
1564 C CE    . MET A 202 ? 1.1869 1.1606 0.8018 0.3025  -0.0170 -0.1508 202 MET Z CE    
1565 N N     A CYS A 203 ? 0.9349 0.9262 0.6717 0.2292  -0.0238 -0.1017 203 CYS Z N     
1566 N N     B CYS A 203 ? 0.9347 0.9260 0.6714 0.2293  -0.0237 -0.1015 203 CYS Z N     
1567 C CA    A CYS A 203 ? 0.9073 0.8910 0.6564 0.2248  -0.0409 -0.1061 203 CYS Z CA    
1568 C CA    B CYS A 203 ? 0.9069 0.8906 0.6559 0.2248  -0.0407 -0.1058 203 CYS Z CA    
1569 C C     A CYS A 203 ? 0.9190 0.8918 0.6407 0.2321  -0.0379 -0.0882 203 CYS Z C     
1570 C C     B CYS A 203 ? 0.9191 0.8917 0.6400 0.2324  -0.0377 -0.0880 203 CYS Z C     
1571 O O     A CYS A 203 ? 0.8988 0.8741 0.6280 0.2221  -0.0212 -0.0687 203 CYS Z O     
1572 O O     B CYS A 203 ? 0.9057 0.8807 0.6325 0.2229  -0.0207 -0.0682 203 CYS Z O     
1573 C CB    A CYS A 203 ? 0.8557 0.8494 0.6529 0.2027  -0.0391 -0.1064 203 CYS Z CB    
1574 C CB    B CYS A 203 ? 0.8571 0.8508 0.6541 0.2026  -0.0387 -0.1059 203 CYS Z CB    
1575 S SG    A CYS A 203 ? 0.7951 0.8005 0.6230 0.1917  -0.0374 -0.1199 203 CYS Z SG    
1576 S SG    B CYS A 203 ? 0.9205 0.9106 0.7437 0.1978  -0.0620 -0.1223 203 CYS Z SG    
1577 N N     . ARG A 204 ? 0.9016 0.8613 0.5910 0.2497  -0.0548 -0.0947 204 ARG Z N     
1578 C CA    . ARG A 204 ? 1.0096 0.9551 0.6678 0.2594  -0.0544 -0.0773 204 ARG Z CA    
1579 C C     . ARG A 204 ? 1.0018 0.9432 0.6904 0.2467  -0.0568 -0.0687 204 ARG Z C     
1580 O O     . ARG A 204 ? 1.0476 0.9784 0.7229 0.2460  -0.0459 -0.0474 204 ARG Z O     
1581 C CB    . ARG A 204 ? 1.1763 1.1094 0.7938 0.2817  -0.0762 -0.0883 204 ARG Z CB    
1582 C CG    . ARG A 204 ? 1.3688 1.2851 0.9357 0.2971  -0.0717 -0.0671 204 ARG Z CG    
1583 C CD    . ARG A 204 ? 1.4864 1.4051 1.0402 0.2911  -0.0401 -0.0423 204 ARG Z CD    
1584 N NE    . ARG A 204 ? 1.5856 1.4864 1.0957 0.3018  -0.0334 -0.0181 204 ARG Z NE    
1585 C CZ    . ARG A 204 ? 1.5861 1.4853 1.0948 0.2919  -0.0079 0.0080  204 ARG Z CZ    
1586 N NH1   . ARG A 204 ? 1.5071 1.4240 1.0572 0.2718  0.0108  0.0113  204 ARG Z NH1   
1587 N NH2   . ARG A 204 ? 1.6553 1.5352 1.1219 0.3016  -0.0018 0.0312  204 ARG Z NH2   
1588 N N     . GLN A 205 ? 0.9861 0.9347 0.7145 0.2374  -0.0708 -0.0858 205 GLN Z N     
1589 C CA    . GLN A 205 ? 1.0298 0.9754 0.7894 0.2270  -0.0744 -0.0823 205 GLN Z CA    
1590 C C     . GLN A 205 ? 1.0395 0.9874 0.8180 0.2085  -0.0518 -0.0649 205 GLN Z C     
1591 O O     . GLN A 205 ? 1.1082 1.0447 0.8947 0.2039  -0.0500 -0.0541 205 GLN Z O     
1592 C CB    . GLN A 205 ? 1.0227 0.9808 0.8238 0.2190  -0.0897 -0.1053 205 GLN Z CB    
1593 C CG    . GLN A 205 ? 1.0652 1.0212 0.8586 0.2350  -0.1161 -0.1224 205 GLN Z CG    
1594 C CD    . GLN A 205 ? 1.0749 1.0459 0.9158 0.2245  -0.1285 -0.1434 205 GLN Z CD    
1595 O OE1   . GLN A 205 ? 1.1266 1.0985 0.9819 0.2311  -0.1459 -0.1516 205 GLN Z OE1   
1596 N NE2   . GLN A 205 ? 1.0049 0.9884 0.8710 0.2086  -0.1193 -0.1515 205 GLN Z NE2   
1597 N N     . LEU A 206 ? 0.9696 0.9316 0.7563 0.1982  -0.0359 -0.0630 206 LEU Z N     
1598 C CA    . LEU A 206 ? 0.8768 0.8452 0.6846 0.1795  -0.0165 -0.0487 206 LEU Z CA    
1599 C C     . LEU A 206 ? 0.8876 0.8432 0.6702 0.1817  -0.0020 -0.0241 206 LEU Z C     
1600 O O     . LEU A 206 ? 0.9254 0.8763 0.7254 0.1674  0.0071  -0.0124 206 LEU Z O     
1601 C CB    . LEU A 206 ? 0.8280 0.8165 0.6495 0.1709  -0.0047 -0.0520 206 LEU Z CB    
1602 C CG    . LEU A 206 ? 0.7911 0.7917 0.6469 0.1602  -0.0133 -0.0706 206 LEU Z CG    
1603 C CD1   . LEU A 206 ? 0.8036 0.8211 0.6699 0.1533  -0.0011 -0.0696 206 LEU Z CD1   
1604 C CD2   . LEU A 206 ? 0.7035 0.7037 0.5906 0.1442  -0.0151 -0.0719 206 LEU Z CD2   
1605 N N     . GLY A 207 ? 0.8907 0.8394 0.6311 0.1991  0.0005  -0.0164 207 GLY Z N     
1606 C CA    . GLY A 207 ? 0.9360 0.8733 0.6497 0.2008  0.0171  0.0091  207 GLY Z CA    
1607 C C     . GLY A 207 ? 0.9871 0.9433 0.7186 0.1848  0.0413  0.0209  207 GLY Z C     
1608 O O     . GLY A 207 ? 0.9982 0.9742 0.7336 0.1864  0.0472  0.0129  207 GLY Z O     
1609 N N     . ASP A 208 ? 0.9568 0.9069 0.7014 0.1695  0.0545  0.0394  208 ASP Z N     
1610 C CA    . ASP A 208 ? 1.0189 0.9894 0.7854 0.1524  0.0766  0.0514  208 ASP Z CA    
1611 C C     . ASP A 208 ? 0.9664 0.9536 0.7809 0.1325  0.0732  0.0390  208 ASP Z C     
1612 O O     . ASP A 208 ? 0.9986 1.0045 0.8374 0.1164  0.0876  0.0468  208 ASP Z O     
1613 C CB    . ASP A 208 ? 1.1570 1.1129 0.9153 0.1433  0.0930  0.0778  208 ASP Z CB    
1614 C CG    . ASP A 208 ? 1.2894 1.2237 1.0700 0.1295  0.0848  0.0793  208 ASP Z CG    
1615 O OD1   . ASP A 208 ? 1.3003 1.2232 1.0859 0.1357  0.0645  0.0629  208 ASP Z OD1   
1616 O OD2   . ASP A 208 ? 1.3829 1.3119 1.1774 0.1122  0.0989  0.0963  208 ASP Z OD2   
1617 N N     . VAL A 209 ? 0.9934 0.9750 0.8210 0.1336  0.0540  0.0197  209 VAL Z N     
1618 C CA    . VAL A 209 ? 0.8766 0.8716 0.7444 0.1159  0.0499  0.0073  209 VAL Z CA    
1619 C C     . VAL A 209 ? 0.8345 0.8523 0.7116 0.1185  0.0481  -0.0061 209 VAL Z C     
1620 O O     . VAL A 209 ? 0.7647 0.7835 0.6521 0.1203  0.0341  -0.0241 209 VAL Z O     
1621 C CB    . VAL A 209 ? 0.8049 0.7842 0.6845 0.1153  0.0325  -0.0066 209 VAL Z CB    
1622 C CG1   . VAL A 209 ? 0.8331 0.8233 0.7503 0.0947  0.0325  -0.0156 209 VAL Z CG1   
1623 C CG2   . VAL A 209 ? 0.7688 0.7199 0.6318 0.1204  0.0309  0.0059  209 VAL Z CG2   
1624 N N     . PHE A 210 ? 0.8628 0.8985 0.7372 0.1190  0.0630  0.0031  210 PHE Z N     
1625 C CA    . PHE A 210 ? 0.7765 0.8320 0.6608 0.1224  0.0623  -0.0079 210 PHE Z CA    
1626 C C     . PHE A 210 ? 0.7686 0.8489 0.6826 0.1063  0.0750  0.0003  210 PHE Z C     
1627 O O     . PHE A 210 ? 0.7196 0.8173 0.6464 0.1075  0.0749  -0.0064 210 PHE Z O     
1628 C CB    . PHE A 210 ? 0.7809 0.8364 0.6323 0.1442  0.0659  -0.0088 210 PHE Z CB    
1629 C CG    . PHE A 210 ? 0.8115 0.8677 0.6398 0.1498  0.0840  0.0111  210 PHE Z CG    
1630 C CD1   . PHE A 210 ? 0.7306 0.8110 0.5736 0.1432  0.1034  0.0235  210 PHE Z CD1   
1631 C CD2   . PHE A 210 ? 0.7985 0.8322 0.5909 0.1616  0.0818  0.0181  210 PHE Z CD2   
1632 C CE1   . PHE A 210 ? 0.7927 0.8758 0.6166 0.1468  0.1225  0.0427  210 PHE Z CE1   
1633 C CE2   . PHE A 210 ? 0.8154 0.8484 0.5839 0.1659  0.1002  0.0384  210 PHE Z CE2   
1634 C CZ    . PHE A 210 ? 0.8542 0.9124 0.6392 0.1578  0.1218  0.0508  210 PHE Z CZ    
1635 N N     . THR A 211 ? 0.6447 0.7258 0.5704 0.0913  0.0847  0.0147  211 THR Z N     
1636 C CA    . THR A 211 ? 0.7050 0.8108 0.6632 0.0732  0.0936  0.0212  211 THR Z CA    
1637 C C     . THR A 211 ? 0.6639 0.7715 0.6474 0.0588  0.0807  0.0078  211 THR Z C     
1638 O O     . THR A 211 ? 0.8068 0.8942 0.7861 0.0581  0.0691  -0.0021 211 THR Z O     
1639 C CB    . THR A 211 ? 0.7661 0.8713 0.7313 0.0592  0.1075  0.0399  211 THR Z CB    
1640 O OG1   . THR A 211 ? 0.8698 0.9507 0.8392 0.0477  0.0991  0.0376  211 THR Z OG1   
1641 C CG2   . THR A 211 ? 0.7566 0.8550 0.6910 0.0734  0.1212  0.0548  211 THR Z CG2   
1642 N N     . GLU A 212 ? 0.5486 0.6813 0.5578 0.0479  0.0829  0.0078  212 GLU Z N     
1643 C CA    . GLU A 212 ? 0.6117 0.7480 0.6399 0.0358  0.0712  -0.0045 212 GLU Z CA    
1644 C C     . GLU A 212 ? 0.6494 0.7697 0.6854 0.0198  0.0666  -0.0075 212 GLU Z C     
1645 O O     . GLU A 212 ? 0.7076 0.8152 0.7431 0.0185  0.0559  -0.0210 212 GLU Z O     
1646 C CB    . GLU A 212 ? 0.4758 0.6429 0.5285 0.0271  0.0742  -0.0008 212 GLU Z CB    
1647 C CG    . GLU A 212 ? 0.8130 0.9841 0.8799 0.0158  0.0623  -0.0120 212 GLU Z CG    
1648 C CD    . GLU A 212 ? 0.7860 0.9866 0.8725 0.0124  0.0624  -0.0082 212 GLU Z CD    
1649 O OE1   . GLU A 212 ? 0.6922 0.8981 0.7888 0.0017  0.0534  -0.0145 212 GLU Z OE1   
1650 O OE2   . GLU A 212 ? 0.8626 1.0816 0.9535 0.0214  0.0715  0.0013  212 GLU Z OE2   
1651 N N     . GLU A 213 ? 0.6709 0.7911 0.7150 0.0077  0.0755  0.0047  213 GLU Z N     
1652 C CA    . GLU A 213 ? 0.6681 0.7707 0.7206 -0.0081 0.0718  0.0016  213 GLU Z CA    
1653 C C     . GLU A 213 ? 0.6596 0.7300 0.6927 0.0027  0.0650  -0.0047 213 GLU Z C     
1654 O O     . GLU A 213 ? 0.6758 0.7347 0.7143 -0.0020 0.0557  -0.0183 213 GLU Z O     
1655 C CB    . GLU A 213 ? 0.6297 0.7355 0.6943 -0.0227 0.0835  0.0174  213 GLU Z CB    
1656 C CG    . GLU A 213 ? 0.7029 0.7932 0.7819 -0.0426 0.0794  0.0126  213 GLU Z CG    
1657 C CD    . GLU A 213 ? 0.7570 0.8423 0.8460 -0.0570 0.0909  0.0289  213 GLU Z CD    
1658 O OE1   . GLU A 213 ? 0.8286 0.9266 0.9146 -0.0522 0.1039  0.0452  213 GLU Z OE1   
1659 O OE2   . GLU A 213 ? 0.7886 0.8565 0.8886 -0.0735 0.0879  0.0251  213 GLU Z OE2   
1660 N N     . LYS A 214 ? 0.6855 0.7428 0.6956 0.0181  0.0696  0.0051  214 LYS Z N     
1661 C CA    . LYS A 214 ? 0.6579 0.6863 0.6489 0.0308  0.0614  0.0005  214 LYS Z CA    
1662 C C     . LYS A 214 ? 0.6503 0.6802 0.6399 0.0410  0.0477  -0.0186 214 LYS Z C     
1663 O O     . LYS A 214 ? 0.7263 0.7404 0.7182 0.0427  0.0381  -0.0294 214 LYS Z O     
1664 C CB    . LYS A 214 ? 0.6789 0.6953 0.6404 0.0469  0.0681  0.0155  214 LYS Z CB    
1665 C CG    . LYS A 214 ? 0.7975 0.8060 0.7583 0.0365  0.0827  0.0365  214 LYS Z CG    
1666 C CD    . LYS A 214 ? 0.8855 0.8809 0.8113 0.0540  0.0900  0.0521  214 LYS Z CD    
1667 C CE    . LYS A 214 ? 0.9741 0.9586 0.8987 0.0424  0.1061  0.0750  214 LYS Z CE    
1668 N NZ    . LYS A 214 ? 1.0260 0.9996 0.9123 0.0595  0.1158  0.0923  214 LYS Z NZ    
1669 N N     . PHE A 215 ? 0.6293 0.6784 0.6177 0.0475  0.0473  -0.0228 215 PHE Z N     
1670 C CA    . PHE A 215 ? 0.5785 0.6292 0.5675 0.0553  0.0353  -0.0398 215 PHE Z CA    
1671 C C     . PHE A 215 ? 0.6491 0.7031 0.6606 0.0399  0.0302  -0.0519 215 PHE Z C     
1672 O O     . PHE A 215 ? 0.7135 0.7592 0.7281 0.0431  0.0209  -0.0654 215 PHE Z O     
1673 C CB    . PHE A 215 ? 0.5225 0.5905 0.5078 0.0631  0.0371  -0.0409 215 PHE Z CB    
1674 C CG    . PHE A 215 ? 0.6139 0.6782 0.5950 0.0735  0.0251  -0.0567 215 PHE Z CG    
1675 C CD1   . PHE A 215 ? 0.5879 0.6389 0.5468 0.0914  0.0183  -0.0609 215 PHE Z CD1   
1676 C CD2   . PHE A 215 ? 0.5756 0.6494 0.5744 0.0647  0.0205  -0.0670 215 PHE Z CD2   
1677 C CE1   . PHE A 215 ? 0.5319 0.5802 0.4904 0.0990  0.0062  -0.0766 215 PHE Z CE1   
1678 C CE2   . PHE A 215 ? 0.5095 0.5791 0.5073 0.0719  0.0104  -0.0808 215 PHE Z CE2   
1679 C CZ    . PHE A 215 ? 0.5078 0.5653 0.4876 0.0884  0.0029  -0.0864 215 PHE Z CZ    
1680 N N     . ARG A 216 ? 0.5035 0.5713 0.5309 0.0233  0.0363  -0.0472 216 ARG Z N     
1681 C CA    . ARG A 216 ? 0.5231 0.5947 0.5676 0.0078  0.0326  -0.0580 216 ARG Z CA    
1682 C C     . ARG A 216 ? 0.5832 0.6332 0.6293 0.0049  0.0297  -0.0643 216 ARG Z C     
1683 O O     . ARG A 216 ? 0.6228 0.6692 0.6753 0.0041  0.0237  -0.0789 216 ARG Z O     
1684 C CB    . ARG A 216 ? 0.5724 0.6626 0.6309 -0.0088 0.0382  -0.0509 216 ARG Z CB    
1685 C CG    . ARG A 216 ? 0.6960 0.7917 0.7671 -0.0246 0.0339  -0.0621 216 ARG Z CG    
1686 C CD    . ARG A 216 ? 0.6517 0.7689 0.7357 -0.0397 0.0363  -0.0555 216 ARG Z CD    
1687 N NE    . ARG A 216 ? 0.6293 0.7443 0.7202 -0.0486 0.0426  -0.0449 216 ARG Z NE    
1688 C CZ    . ARG A 216 ? 0.5872 0.7165 0.6822 -0.0464 0.0500  -0.0300 216 ARG Z CZ    
1689 N NH1   . ARG A 216 ? 0.5808 0.7266 0.6723 -0.0338 0.0515  -0.0255 216 ARG Z NH1   
1690 N NH2   . ARG A 216 ? 0.6126 0.7394 0.7162 -0.0571 0.0568  -0.0200 216 ARG Z NH2   
1691 N N     . TYR A 217 ? 0.6331 0.6683 0.6741 0.0041  0.0347  -0.0529 217 TYR Z N     
1692 C CA    . TYR A 217 ? 0.6129 0.6231 0.6550 0.0033  0.0318  -0.0574 217 TYR Z CA    
1693 C C     . TYR A 217 ? 0.6430 0.6419 0.6779 0.0208  0.0223  -0.0681 217 TYR Z C     
1694 O O     . TYR A 217 ? 0.6352 0.6246 0.6798 0.0200  0.0173  -0.0811 217 TYR Z O     
1695 C CB    . TYR A 217 ? 0.6757 0.6678 0.7099 0.0020  0.0390  -0.0400 217 TYR Z CB    
1696 C CG    . TYR A 217 ? 0.6683 0.6701 0.7162 -0.0185 0.0478  -0.0309 217 TYR Z CG    
1697 C CD1   . TYR A 217 ? 0.6197 0.6378 0.6855 -0.0352 0.0459  -0.0416 217 TYR Z CD1   
1698 C CD2   . TYR A 217 ? 0.6547 0.6505 0.6978 -0.0216 0.0579  -0.0114 217 TYR Z CD2   
1699 C CE1   . TYR A 217 ? 0.5950 0.6242 0.6752 -0.0541 0.0514  -0.0346 217 TYR Z CE1   
1700 C CE2   . TYR A 217 ? 0.6241 0.6317 0.6847 -0.0417 0.0654  -0.0038 217 TYR Z CE2   
1701 C CZ    . TYR A 217 ? 0.6055 0.6305 0.6856 -0.0577 0.0609  -0.0161 217 TYR Z CZ    
1702 O OH    . TYR A 217 ? 0.5680 0.6071 0.6675 -0.0781 0.0660  -0.0097 217 TYR Z OH    
1703 N N     . MET A 218 ? 0.6133 0.6148 0.6324 0.0370  0.0194  -0.0636 218 MET Z N     
1704 C CA    . MET A 218 ? 0.6475 0.6418 0.6608 0.0539  0.0081  -0.0741 218 MET Z CA    
1705 C C     . MET A 218 ? 0.6404 0.6493 0.6721 0.0493  0.0025  -0.0927 218 MET Z C     
1706 O O     . MET A 218 ? 0.6928 0.6962 0.7348 0.0536  -0.0044 -0.1052 218 MET Z O     
1707 C CB    . MET A 218 ? 0.6128 0.6089 0.6036 0.0705  0.0056  -0.0674 218 MET Z CB    
1708 C CG    . MET A 218 ? 0.6776 0.6677 0.6622 0.0879  -0.0088 -0.0789 218 MET Z CG    
1709 S SD    . MET A 218 ? 0.7656 0.7600 0.7226 0.1056  -0.0128 -0.0759 218 MET Z SD    
1710 C CE    . MET A 218 ? 0.7018 0.7201 0.6749 0.0933  -0.0073 -0.0829 218 MET Z CE    
1711 N N     . CYS A 219 ? 0.5781 0.6062 0.6146 0.0409  0.0062  -0.0936 219 CYS Z N     
1712 C CA    . CYS A 219 ? 0.5549 0.5959 0.6064 0.0351  0.0028  -0.1084 219 CYS Z CA    
1713 C C     . CYS A 219 ? 0.5497 0.5892 0.6168 0.0230  0.0050  -0.1181 219 CYS Z C     
1714 O O     . CYS A 219 ? 0.5867 0.6303 0.6661 0.0236  0.0014  -0.1322 219 CYS Z O     
1715 C CB    . CYS A 219 ? 0.5807 0.6389 0.6326 0.0277  0.0069  -0.1045 219 CYS Z CB    
1716 S SG    . CYS A 219 ? 0.6083 0.6684 0.6448 0.0442  0.0030  -0.1007 219 CYS Z SG    
1717 N N     . ILE A 220 ? 0.5510 0.5852 0.6183 0.0117  0.0113  -0.1115 220 ILE Z N     
1718 C CA    . ILE A 220 ? 0.5804 0.6104 0.6595 0.0006  0.0134  -0.1225 220 ILE Z CA    
1719 C C     . ILE A 220 ? 0.6518 0.6630 0.7351 0.0119  0.0088  -0.1305 220 ILE Z C     
1720 O O     . ILE A 220 ? 0.7409 0.7544 0.8372 0.0112  0.0080  -0.1460 220 ILE Z O     
1721 C CB    . ILE A 220 ? 0.5866 0.6133 0.6654 -0.0149 0.0194  -0.1150 220 ILE Z CB    
1722 C CG1   . ILE A 220 ? 0.5252 0.5740 0.6033 -0.0254 0.0223  -0.1079 220 ILE Z CG1   
1723 C CG2   . ILE A 220 ? 0.4892 0.5081 0.5771 -0.0252 0.0208  -0.1291 220 ILE Z CG2   
1724 C CD1   . ILE A 220 ? 0.5161 0.5667 0.5971 -0.0405 0.0266  -0.0993 220 ILE Z CD1   
1725 N N     . LEU A 221 ? 0.6450 0.6381 0.7172 0.0233  0.0063  -0.1191 221 LEU Z N     
1726 C CA    . LEU A 221 ? 0.6051 0.5777 0.6796 0.0365  0.0003  -0.1238 221 LEU Z CA    
1727 C C     . LEU A 221 ? 0.6347 0.6170 0.7184 0.0507  -0.0090 -0.1371 221 LEU Z C     
1728 O O     . LEU A 221 ? 0.6992 0.6736 0.7952 0.0590  -0.0136 -0.1479 221 LEU Z O     
1729 C CB    . LEU A 221 ? 0.6479 0.5984 0.7036 0.0466  -0.0007 -0.1056 221 LEU Z CB    
1730 C CG    . LEU A 221 ? 0.7650 0.6982 0.8169 0.0334  0.0080  -0.0929 221 LEU Z CG    
1731 C CD1   . LEU A 221 ? 0.7714 0.6829 0.8027 0.0447  0.0081  -0.0730 221 LEU Z CD1   
1732 C CD2   . LEU A 221 ? 0.7742 0.6912 0.8408 0.0265  0.0085  -0.1053 221 LEU Z CD2   
1733 N N     . SER A 222 ? 0.7108 0.7104 0.7908 0.0537  -0.0121 -0.1370 222 SER Z N     
1734 C CA    . SER A 222 ? 0.7508 0.7613 0.8422 0.0652  -0.0220 -0.1500 222 SER Z CA    
1735 C C     . SER A 222 ? 0.7512 0.7779 0.8675 0.0553  -0.0182 -0.1673 222 SER Z C     
1736 O O     . SER A 222 ? 0.7986 0.8324 0.9332 0.0637  -0.0246 -0.1805 222 SER Z O     
1737 C CB    . SER A 222 ? 0.6827 0.7042 0.7631 0.0695  -0.0262 -0.1463 222 SER Z CB    
1738 O OG    . SER A 222 ? 0.7134 0.7495 0.7965 0.0540  -0.0178 -0.1455 222 SER Z OG    
1739 N N     . GLY A 223 ? 0.6687 0.7031 0.7858 0.0375  -0.0077 -0.1670 223 GLY Z N     
1740 C CA    . GLY A 223 ? 0.6578 0.7077 0.7925 0.0265  -0.0015 -0.1816 223 GLY Z CA    
1741 C C     . GLY A 223 ? 0.7420 0.8085 0.8732 0.0135  0.0035  -0.1786 223 GLY Z C     
1742 O O     . GLY A 223 ? 0.8711 0.9467 1.0048 0.0174  -0.0011 -0.1789 223 GLY Z O     
1743 N N     . CYS A 224 ? 0.6165 0.6854 0.7411 -0.0017 0.0118  -0.1757 224 CYS Z N     
1744 C CA    . CYS A 224 ? 0.5754 0.6582 0.6944 -0.0132 0.0156  -0.1706 224 CYS Z CA    
1745 C C     . CYS A 224 ? 0.6659 0.7597 0.7908 -0.0266 0.0239  -0.1812 224 CYS Z C     
1746 O O     . CYS A 224 ? 0.7447 0.8369 0.8797 -0.0261 0.0274  -0.1941 224 CYS Z O     
1747 C CB    . CYS A 224 ? 0.5111 0.5909 0.6147 -0.0188 0.0167  -0.1555 224 CYS Z CB    
1748 S SG    . CYS A 224 ? 0.6606 0.7299 0.7614 -0.0292 0.0211  -0.1565 224 CYS Z SG    
1749 N N     . ALA A 225 ? 0.6613 0.7656 0.7783 -0.0376 0.0274  -0.1752 225 ALA Z N     
1750 C CA    . ALA A 225 ? 0.6821 0.7971 0.7987 -0.0508 0.0360  -0.1828 225 ALA Z CA    
1751 C C     . ALA A 225 ? 0.7415 0.8522 0.8490 -0.0598 0.0401  -0.1876 225 ALA Z C     
1752 O O     . ALA A 225 ? 0.9033 1.0193 1.0109 -0.0671 0.0479  -0.1996 225 ALA Z O     
1753 C CB    . ALA A 225 ? 0.6178 0.7416 0.7247 -0.0588 0.0369  -0.1721 225 ALA Z CB    
1754 N N     . TYR A 226 ? 0.6342 0.7353 0.7340 -0.0598 0.0354  -0.1789 226 TYR Z N     
1755 C CA    . TYR A 226 ? 0.5796 0.6752 0.6714 -0.0703 0.0371  -0.1830 226 TYR Z CA    
1756 C C     . TYR A 226 ? 0.6035 0.6821 0.7037 -0.0643 0.0380  -0.1951 226 TYR Z C     
1757 O O     . TYR A 226 ? 0.6662 0.7380 0.7619 -0.0726 0.0409  -0.2052 226 TYR Z O     
1758 C CB    . TYR A 226 ? 0.5861 0.6812 0.6703 -0.0751 0.0320  -0.1677 226 TYR Z CB    
1759 C CG    . TYR A 226 ? 0.5861 0.6967 0.6638 -0.0776 0.0298  -0.1547 226 TYR Z CG    
1760 C CD1   . TYR A 226 ? 0.5515 0.6738 0.6219 -0.0848 0.0328  -0.1571 226 TYR Z CD1   
1761 C CD2   . TYR A 226 ? 0.5445 0.6570 0.6227 -0.0719 0.0257  -0.1395 226 TYR Z CD2   
1762 C CE1   . TYR A 226 ? 0.4508 0.5836 0.5151 -0.0857 0.0301  -0.1442 226 TYR Z CE1   
1763 C CE2   . TYR A 226 ? 0.5227 0.6480 0.5964 -0.0720 0.0236  -0.1284 226 TYR Z CE2   
1764 C CZ    . TYR A 226 ? 0.6219 0.7560 0.6890 -0.0786 0.0250  -0.1305 226 TYR Z CZ    
1765 O OH    . TYR A 226 ? 0.6054 0.7487 0.6678 -0.0774 0.0221  -0.1184 226 TYR Z OH    
1766 N N     . LEU A 227 ? 0.5575 0.6280 0.6688 -0.0492 0.0346  -0.1947 227 LEU Z N     
1767 C CA    . LEU A 227 ? 0.6459 0.6973 0.7654 -0.0403 0.0335  -0.2032 227 LEU Z CA    
1768 C C     . LEU A 227 ? 0.7769 0.8274 0.9106 -0.0223 0.0290  -0.2061 227 LEU Z C     
1769 O O     . LEU A 227 ? 0.8339 0.8837 0.9651 -0.0135 0.0225  -0.1942 227 LEU Z O     
1770 C CB    . LEU A 227 ? 0.6566 0.6888 0.7685 -0.0421 0.0298  -0.1915 227 LEU Z CB    
1771 C CG    . LEU A 227 ? 0.7637 0.7695 0.8814 -0.0334 0.0282  -0.1970 227 LEU Z CG    
1772 C CD1   . LEU A 227 ? 0.7492 0.7483 0.8696 -0.0408 0.0335  -0.2163 227 LEU Z CD1   
1773 C CD2   . LEU A 227 ? 0.8290 0.8166 0.9390 -0.0359 0.0254  -0.1804 227 LEU Z CD2   
1774 N N     . SER A 228 ? 0.8184 0.8703 0.9673 -0.0161 0.0321  -0.2228 228 SER Z N     
1775 C CA    . SER A 228 ? 0.8230 0.8760 0.9894 0.0017  0.0258  -0.2273 228 SER Z CA    
1776 C C     . SER A 228 ? 0.7891 0.8162 0.9513 0.0152  0.0173  -0.2193 228 SER Z C     
1777 O O     . SER A 228 ? 0.8335 0.8398 0.9884 0.0114  0.0194  -0.2187 228 SER Z O     
1778 C CB    . SER A 228 ? 0.9049 0.9691 1.0925 0.0053  0.0324  -0.2478 228 SER Z CB    
1779 O OG    . SER A 228 ? 0.9394 1.0271 1.1290 -0.0077 0.0421  -0.2533 228 SER Z OG    
1780 N N     . SER A 229 ? 0.7912 0.8179 0.9565 0.0304  0.0072  -0.2130 229 SER Z N     
1781 C CA    . SER A 229 ? 0.7859 0.7870 0.9424 0.0444  -0.0011 -0.2023 229 SER Z CA    
1782 C C     . SER A 229 ? 0.8395 0.8248 1.0104 0.0565  -0.0029 -0.2141 229 SER Z C     
1783 O O     . SER A 229 ? 0.9089 0.9079 1.1001 0.0569  0.0017  -0.2322 229 SER Z O     
1784 C CB    . SER A 229 ? 0.7263 0.7318 0.8781 0.0588  -0.0126 -0.1936 229 SER Z CB    
1785 O OG    . SER A 229 ? 0.7189 0.7430 0.8933 0.0686  -0.0186 -0.2077 229 SER Z OG    
1786 N N     . LEU A 230 ? 0.8236 0.7796 0.9841 0.0669  -0.0088 -0.2033 230 LEU Z N     
1787 C CA    . LEU A 230 ? 0.8199 0.7569 0.9935 0.0832  -0.0135 -0.2120 230 LEU Z CA    
1788 C C     . LEU A 230 ? 0.8359 0.7919 1.0290 0.1025  -0.0245 -0.2203 230 LEU Z C     
1789 O O     . LEU A 230 ? 0.8491 0.8233 1.0384 0.1042  -0.0307 -0.2148 230 LEU Z O     
1790 C CB    . LEU A 230 ? 0.8408 0.7391 0.9959 0.0902  -0.0181 -0.1945 230 LEU Z CB    
1791 C CG    . LEU A 230 ? 0.8418 0.7209 0.9809 0.0702  -0.0086 -0.1847 230 LEU Z CG    
1792 C CD1   . LEU A 230 ? 0.9468 0.7883 1.0690 0.0771  -0.0126 -0.1648 230 LEU Z CD1   
1793 C CD2   . LEU A 230 ? 0.7756 0.6501 0.9267 0.0587  0.0001  -0.2037 230 LEU Z CD2   
1794 N N     . ARG A 231 ? 0.8924 0.8447 1.1078 0.1171  -0.0274 -0.2346 231 ARG Z N     
1795 C CA    . ARG A 231 ? 0.8984 0.8724 1.1386 0.1356  -0.0388 -0.2444 231 ARG Z CA    
1796 C C     . ARG A 231 ? 0.8383 0.8000 1.0624 0.1531  -0.0566 -0.2280 231 ARG Z C     
1797 O O     . ARG A 231 ? 0.9627 0.8904 1.1693 0.1640  -0.0622 -0.2149 231 ARG Z O     
1798 C CB    . ARG A 231 ? 0.9685 0.9394 1.2371 0.1501  -0.0383 -0.2622 231 ARG Z CB    
1799 C CG    . ARG A 231 ? 1.0244 1.0297 1.3290 0.1641  -0.0460 -0.2776 231 ARG Z CG    
1800 C CD    . ARG A 231 ? 1.0848 1.1288 1.4047 0.1451  -0.0334 -0.2892 231 ARG Z CD    
1801 N NE    . ARG A 231 ? 1.1673 1.2472 1.5244 0.1558  -0.0411 -0.3024 231 ARG Z NE    
1802 C CZ    . ARG A 231 ? 1.1897 1.3060 1.5669 0.1419  -0.0326 -0.3122 231 ARG Z CZ    
1803 N NH1   . ARG A 231 ? 1.2024 1.3513 1.6176 0.1515  -0.0408 -0.3242 231 ARG Z NH1   
1804 N NH2   . ARG A 231 ? 1.1650 1.2849 1.5250 0.1182  -0.0166 -0.3094 231 ARG Z NH2   
1805 N N     . GLY A 232 ? 0.8203 0.8081 1.0483 0.1554  -0.0652 -0.2286 232 GLY Z N     
1806 C CA    . GLY A 232 ? 0.9733 0.9535 1.1848 0.1730  -0.0835 -0.2165 232 GLY Z CA    
1807 C C     . GLY A 232 ? 0.9791 0.9462 1.1516 0.1647  -0.0817 -0.1962 232 GLY Z C     
1808 O O     . GLY A 232 ? 1.0502 1.0061 1.2002 0.1790  -0.0948 -0.1839 232 GLY Z O     
1809 N N     . ILE A 233 ? 1.0346 0.8755 1.1182 0.1637  -0.1498 -0.0922 233 ILE Z N     
1810 C CA    . ILE A 233 ? 0.9640 0.7894 1.0144 0.1558  -0.1577 -0.0978 233 ILE Z CA    
1811 C C     . ILE A 233 ? 1.0213 0.8559 1.0632 0.1389  -0.1729 -0.1105 233 ILE Z C     
1812 O O     . ILE A 233 ? 1.0480 0.8833 1.0979 0.1258  -0.1684 -0.1194 233 ILE Z O     
1813 C CB    . ILE A 233 ? 0.9202 0.7119 0.9553 0.1505  -0.1378 -0.1030 233 ILE Z CB    
1814 C CG1   . ILE A 233 ? 1.0017 0.7766 1.0477 0.1660  -0.1186 -0.0920 233 ILE Z CG1   
1815 C CG2   . ILE A 233 ? 0.8521 0.6333 0.8609 0.1461  -0.1445 -0.1040 233 ILE Z CG2   
1816 C CD1   . ILE A 233 ? 1.0646 0.8465 1.1090 0.1838  -0.1273 -0.0730 233 ILE Z CD1   
1817 N N     . GLY A 234 ? 0.9385 0.7778 0.9627 0.1387  -0.1893 -0.1109 234 GLY Z N     
1818 C CA    . GLY A 234 ? 0.8827 0.7236 0.8987 0.1246  -0.2015 -0.1228 234 GLY Z CA    
1819 C C     . GLY A 234 ? 0.9428 0.7657 0.9328 0.1249  -0.2010 -0.1264 234 GLY Z C     
1820 O O     . GLY A 234 ? 1.0190 0.8259 1.0005 0.1293  -0.1875 -0.1223 234 GLY Z O     
1821 N N     . LEU A 235 ? 0.8304 0.6547 0.8086 0.1196  -0.2136 -0.1346 235 LEU Z N     
1822 C CA    . LEU A 235 ? 0.8527 0.6593 0.8087 0.1208  -0.2091 -0.1398 235 LEU Z CA    
1823 C C     . LEU A 235 ? 0.9771 0.7809 0.9072 0.1322  -0.2073 -0.1330 235 LEU Z C     
1824 O O     . LEU A 235 ? 1.0492 0.8384 0.9664 0.1370  -0.1941 -0.1306 235 LEU Z O     
1825 C CB    . LEU A 235 ? 0.8440 0.6467 0.7952 0.1116  -0.2193 -0.1528 235 LEU Z CB    
1826 C CG    . LEU A 235 ? 0.8191 0.6179 0.7926 0.1004  -0.2185 -0.1569 235 LEU Z CG    
1827 C CD1   . LEU A 235 ? 0.8333 0.6291 0.8063 0.0914  -0.2308 -0.1680 235 LEU Z CD1   
1828 C CD2   . LEU A 235 ? 0.7705 0.5547 0.7463 0.1020  -0.2048 -0.1545 235 LEU Z CD2   
1829 N N     . ALA A 236 ? 0.8214 0.6417 0.7446 0.1351  -0.2213 -0.1279 236 ALA Z N     
1830 C CA    . ALA A 236 ? 0.8517 0.6727 0.7466 0.1435  -0.2233 -0.1185 236 ALA Z CA    
1831 C C     . ALA A 236 ? 0.9613 0.7742 0.8613 0.1555  -0.2072 -0.1028 236 ALA Z C     
1832 O O     . ALA A 236 ? 1.0184 0.8171 0.8955 0.1596  -0.1964 -0.0997 236 ALA Z O     
1833 C CB    . ALA A 236 ? 0.8679 0.7150 0.7618 0.1425  -0.2449 -0.1105 236 ALA Z CB    
1834 N N     . LYS A 237 ? 0.9716 0.7913 0.9014 0.1605  -0.2031 -0.0934 237 LYS Z N     
1835 C CA    . LYS A 237 ? 1.0036 0.8098 0.9382 0.1707  -0.1866 -0.0798 237 LYS Z CA    
1836 C C     . LYS A 237 ? 0.9969 0.7794 0.9257 0.1650  -0.1691 -0.0868 237 LYS Z C     
1837 O O     . LYS A 237 ? 1.0030 0.7721 0.9188 0.1701  -0.1580 -0.0779 237 LYS Z O     
1838 C CB    . LYS A 237 ? 0.9983 0.8115 0.9674 0.1766  -0.1815 -0.0721 237 LYS Z CB    
1839 C CG    . LYS A 237 ? 0.9640 0.8084 0.9503 0.1809  -0.1997 -0.0636 237 LYS Z CG    
1840 C CD    . LYS A 237 ? 1.0815 0.9365 1.0655 0.1956  -0.2057 -0.0392 237 LYS Z CD    
1841 C CE    . LYS A 237 ? 1.0953 0.9868 1.1101 0.2012  -0.2226 -0.0249 237 LYS Z CE    
1842 N NZ    . LYS A 237 ? 1.0689 0.9646 1.1284 0.2058  -0.2086 -0.0261 237 LYS Z NZ    
1843 N N     . ALA A 238 ? 0.9045 0.6844 0.8444 0.1530  -0.1678 -0.1005 238 ALA Z N     
1844 C CA    . ALA A 238 ? 0.8702 0.6340 0.8095 0.1453  -0.1546 -0.1041 238 ALA Z CA    
1845 C C     . ALA A 238 ? 0.9356 0.6936 0.8534 0.1484  -0.1507 -0.1036 238 ALA Z C     
1846 O O     . ALA A 238 ? 1.0063 0.7530 0.9198 0.1493  -0.1370 -0.0965 238 ALA Z O     
1847 C CB    . ALA A 238 ? 0.8229 0.5902 0.7778 0.1311  -0.1586 -0.1153 238 ALA Z CB    
1848 N N     . CYS A 239 ? 0.8428 0.6076 0.7466 0.1488  -0.1612 -0.1120 239 CYS Z N     
1849 C CA    . CYS A 239 ? 0.8823 0.6397 0.7620 0.1517  -0.1544 -0.1151 239 CYS Z CA    
1850 C C     . CYS A 239 ? 0.8929 0.6472 0.7484 0.1610  -0.1481 -0.1010 239 CYS Z C     
1851 O O     . CYS A 239 ? 1.0104 0.7558 0.8527 0.1633  -0.1334 -0.0974 239 CYS Z O     
1852 C CB    . CYS A 239 ? 0.8789 0.6390 0.7430 0.1484  -0.1662 -0.1297 239 CYS Z CB    
1853 S SG    . CYS A 239 ? 0.9532 0.6986 0.7850 0.1511  -0.1524 -0.1392 239 CYS Z SG    
1854 N N     . LYS A 240 ? 0.8887 0.6525 0.7423 0.1665  -0.1589 -0.0904 240 LYS Z N     
1855 C CA    . LYS A 240 ? 1.0085 0.7709 0.8421 0.1757  -0.1557 -0.0718 240 LYS Z CA    
1856 C C     . LYS A 240 ? 1.0301 0.7766 0.8771 0.1784  -0.1366 -0.0603 240 LYS Z C     
1857 O O     . LYS A 240 ? 1.1006 0.8385 0.9283 0.1818  -0.1254 -0.0495 240 LYS Z O     
1858 C CB    . LYS A 240 ? 1.0725 0.8525 0.9127 0.1820  -0.1728 -0.0585 240 LYS Z CB    
1859 C CG    . LYS A 240 ? 1.2189 1.0010 1.0393 0.1918  -0.1734 -0.0342 240 LYS Z CG    
1860 C CD    . LYS A 240 ? 1.3381 1.1441 1.1733 0.1988  -0.1930 -0.0170 240 LYS Z CD    
1861 C CE    . LYS A 240 ? 1.4924 1.3025 1.3110 0.2089  -0.1957 0.0128  240 LYS Z CE    
1862 N NZ    . LYS A 240 ? 1.5623 1.4019 1.4017 0.2165  -0.2171 0.0348  240 LYS Z NZ    
1863 N N     . VAL A 241 ? 1.0561 0.7974 0.9336 0.1745  -0.1324 -0.0632 241 VAL Z N     
1864 C CA    . VAL A 241 ? 1.0590 0.7816 0.9480 0.1723  -0.1150 -0.0555 241 VAL Z CA    
1865 C C     . VAL A 241 ? 1.0803 0.7970 0.9628 0.1646  -0.1034 -0.0588 241 VAL Z C     
1866 O O     . VAL A 241 ? 1.1174 0.8231 0.9919 0.1660  -0.0901 -0.0466 241 VAL Z O     
1867 C CB    . VAL A 241 ? 1.0373 0.7538 0.9530 0.1645  -0.1123 -0.0633 241 VAL Z CB    
1868 C CG1   . VAL A 241 ? 1.0491 0.7437 0.9708 0.1550  -0.0950 -0.0606 241 VAL Z CG1   
1869 C CG2   . VAL A 241 ? 1.0457 0.7662 0.9748 0.1752  -0.1166 -0.0563 241 VAL Z CG2   
1870 N N     . LEU A 242 ? 1.0120 0.7372 0.9015 0.1570  -0.1077 -0.0732 242 LEU Z N     
1871 C CA    . LEU A 242 ? 1.0596 0.7839 0.9536 0.1510  -0.0960 -0.0742 242 LEU Z CA    
1872 C C     . LEU A 242 ? 1.1160 0.8401 0.9829 0.1595  -0.0872 -0.0701 242 LEU Z C     
1873 O O     . LEU A 242 ? 1.0921 0.8149 0.9621 0.1577  -0.0717 -0.0649 242 LEU Z O     
1874 C CB    . LEU A 242 ? 1.0150 0.7488 0.9281 0.1431  -0.1029 -0.0873 242 LEU Z CB    
1875 C CG    . LEU A 242 ? 0.9431 0.6776 0.8798 0.1301  -0.1088 -0.0896 242 LEU Z CG    
1876 C CD1   . LEU A 242 ? 0.9380 0.6832 0.8934 0.1224  -0.1163 -0.0974 242 LEU Z CD1   
1877 C CD2   . LEU A 242 ? 0.9298 0.6551 0.8751 0.1200  -0.0973 -0.0800 242 LEU Z CD2   
1878 N N     . ARG A 243 ? 1.0742 0.8016 0.9137 0.1672  -0.0970 -0.0717 243 ARG Z N     
1879 C CA    . ARG A 243 ? 1.1163 0.8424 0.9196 0.1726  -0.0893 -0.0687 243 ARG Z CA    
1880 C C     . ARG A 243 ? 1.1577 0.8766 0.9494 0.1769  -0.0788 -0.0468 243 ARG Z C     
1881 O O     . ARG A 243 ? 1.2232 0.9378 1.0045 0.1768  -0.0607 -0.0403 243 ARG Z O     
1882 C CB    . ARG A 243 ? 1.1184 0.8513 0.8915 0.1746  -0.1067 -0.0765 243 ARG Z CB    
1883 C CG    . ARG A 243 ? 1.1833 0.9146 0.9453 0.1705  -0.1070 -0.0991 243 ARG Z CG    
1884 C CD    . ARG A 243 ? 1.3112 1.0476 1.0365 0.1679  -0.1255 -0.1065 243 ARG Z CD    
1885 N NE    . ARG A 243 ? 1.4326 1.1767 1.1328 0.1717  -0.1339 -0.0861 243 ARG Z NE    
1886 C CZ    . ARG A 243 ? 1.4413 1.1813 1.0994 0.1729  -0.1244 -0.0774 243 ARG Z CZ    
1887 N NH1   . ARG A 243 ? 1.3345 1.0617 0.9700 0.1713  -0.1029 -0.0900 243 ARG Z NH1   
1888 N NH2   . ARG A 243 ? 1.4510 1.2002 1.0913 0.1763  -0.1352 -0.0541 243 ARG Z NH2   
1889 N N     . LEU A 244 ? 1.1434 0.8609 0.9404 0.1812  -0.0886 -0.0340 244 LEU Z N     
1890 C CA    . LEU A 244 ? 1.1868 0.8947 0.9740 0.1868  -0.0804 -0.0103 244 LEU Z CA    
1891 C C     . LEU A 244 ? 1.3634 1.0561 1.1732 0.1804  -0.0616 -0.0040 244 LEU Z C     
1892 O O     . LEU A 244 ? 1.4589 1.1417 1.2580 0.1819  -0.0487 0.0140  244 LEU Z O     
1893 C CB    . LEU A 244 ? 1.0836 0.7932 0.8807 0.1953  -0.0943 0.0031  244 LEU Z CB    
1894 C CG    . LEU A 244 ? 1.0727 0.8026 0.8485 0.1996  -0.1163 0.0034  244 LEU Z CG    
1895 C CD1   . LEU A 244 ? 1.0183 0.7547 0.8172 0.2096  -0.1284 0.0209  244 LEU Z CD1   
1896 C CD2   . LEU A 244 ? 1.0873 0.8214 0.8145 0.1996  -0.1159 0.0125  244 LEU Z CD2   
1897 N N     . ALA A 245 ? 1.0965 1.0719 1.0615 0.0017  0.0881  0.0603  245 ALA Z N     
1898 C CA    . ALA A 245 ? 1.2334 1.1976 1.2015 -0.0174 0.1011  0.0711  245 ALA Z CA    
1899 C C     . ALA A 245 ? 1.2735 1.2785 1.2438 -0.0286 0.1213  0.0653  245 ALA Z C     
1900 O O     . ALA A 245 ? 1.3215 1.3481 1.3160 -0.0211 0.1273  0.0449  245 ALA Z O     
1901 C CB    . ALA A 245 ? 1.2714 1.2109 1.2722 -0.0139 0.0988  0.0599  245 ALA Z CB    
1902 N N     . ASN A 246 ? 1.3857 1.4035 1.3329 -0.0468 0.1317  0.0852  246 ASN Z N     
1903 C CA    . ASN A 246 ? 1.3866 1.4510 1.3437 -0.0558 0.1514  0.0804  246 ASN Z CA    
1904 C C     . ASN A 246 ? 1.4308 1.4890 1.4058 -0.0804 0.1571  0.0915  246 ASN Z C     
1905 O O     . ASN A 246 ? 1.5013 1.5970 1.4762 -0.0982 0.1715  0.1033  246 ASN Z O     
1906 C CB    . ASN A 246 ? 1.3669 1.4691 1.2901 -0.0591 0.1633  0.0920  246 ASN Z CB    
1907 C CG    . ASN A 246 ? 1.2722 1.3987 1.1855 -0.0338 0.1638  0.0677  246 ASN Z CG    
1908 O OD1   . ASN A 246 ? 1.2196 1.3841 1.1469 -0.0251 0.1775  0.0506  246 ASN Z OD1   
1909 N ND2   . ASN A 246 ? 1.2271 1.3292 1.1177 -0.0209 0.1462  0.0647  246 ASN Z ND2   
1910 N N     . ASN A 247 ? 1.3987 1.4161 1.3907 -0.0822 0.1468  0.0858  247 ASN Z N     
1911 C CA    . ASN A 247 ? 1.3870 1.3725 1.3793 -0.1079 0.1433  0.1003  247 ASN Z CA    
1912 C C     . ASN A 247 ? 1.4226 1.4362 1.4285 -0.1373 0.1534  0.1083  247 ASN Z C     
1913 O O     . ASN A 247 ? 1.5216 1.5163 1.5141 -0.1637 0.1509  0.1313  247 ASN Z O     
1914 C CB    . ASN A 247 ? 1.3552 1.2871 1.3578 -0.0978 0.1295  0.0868  247 ASN Z CB    
1915 C CG    . ASN A 247 ? 1.3877 1.2707 1.3838 -0.1217 0.1216  0.0979  247 ASN Z CG    
1916 O OD1   . ASN A 247 ? 1.2884 1.1851 1.2948 -0.1446 0.1267  0.0972  247 ASN Z OD1   
1917 N ND2   . ASN A 247 ? 1.4709 1.2958 1.4504 -0.1167 0.1067  0.1085  247 ASN Z ND2   
1918 N N     . PRO A 248 ? 1.3507 1.4092 1.3844 -0.1367 0.1623  0.0931  248 PRO Z N     
1919 C CA    . PRO A 248 ? 1.2815 1.3434 1.3306 -0.1098 0.1606  0.0683  248 PRO Z CA    
1920 C C     . PRO A 248 ? 1.1512 1.1962 1.2171 -0.1169 0.1549  0.0556  248 PRO Z C     
1921 O O     . PRO A 248 ? 1.0342 1.1086 1.1188 -0.1090 0.1584  0.0431  248 PRO Z O     
1922 C CB    . PRO A 248 ? 1.3021 1.4260 1.3645 -0.1012 0.1738  0.0636  248 PRO Z CB    
1923 C CG    . PRO A 248 ? 1.3214 1.4797 1.3900 -0.1288 0.1822  0.0815  248 PRO Z CG    
1924 C CD    . PRO A 248 ? 1.3619 1.4820 1.4046 -0.1511 0.1770  0.1043  248 PRO Z CD    
1925 N N     . ASP A 249 ? 1.1616 1.1585 1.2177 -0.1322 0.1454  0.0590  249 ASP Z N     
1926 C CA    . ASP A 249 ? 1.0755 1.0522 1.1392 -0.1341 0.1397  0.0412  249 ASP Z CA    
1927 C C     . ASP A 249 ? 0.9942 0.9484 1.0582 -0.1053 0.1372  0.0251  249 ASP Z C     
1928 O O     . ASP A 249 ? 0.9436 0.8590 0.9966 -0.0952 0.1304  0.0277  249 ASP Z O     
1929 C CB    . ASP A 249 ? 1.1268 1.0520 1.1767 -0.1579 0.1288  0.0454  249 ASP Z CB    
1930 C CG    . ASP A 249 ? 1.1938 1.0976 1.2439 -0.1590 0.1230  0.0224  249 ASP Z CG    
1931 O OD1   . ASP A 249 ? 1.1783 1.1191 1.2405 -0.1496 0.1285  0.0099  249 ASP Z OD1   
1932 O OD2   . ASP A 249 ? 1.2728 1.1199 1.3076 -0.1691 0.1122  0.0168  249 ASP Z OD2   
1933 N N     . ILE A 250 ? 0.9321 0.9131 1.0109 -0.0926 0.1418  0.0105  250 ILE Z N     
1934 C CA    . ILE A 250 ? 0.9073 0.8826 0.9929 -0.0676 0.1417  -0.0011 250 ILE Z CA    
1935 C C     . ILE A 250 ? 1.0564 0.9905 1.1372 -0.0598 0.1370  -0.0142 250 ILE Z C     
1936 O O     . ILE A 250 ? 1.0690 0.9925 1.1561 -0.0392 0.1345  -0.0195 250 ILE Z O     
1937 C CB    . ILE A 250 ? 0.7524 0.7658 0.8551 -0.0600 0.1475  -0.0094 250 ILE Z CB    
1938 C CG1   . ILE A 250 ? 0.6416 0.6553 0.7558 -0.0397 0.1470  -0.0180 250 ILE Z CG1   
1939 C CG2   . ILE A 250 ? 0.7074 0.7263 0.8098 -0.0720 0.1487  -0.0168 250 ILE Z CG2   
1940 C CD1   . ILE A 250 ? 0.6371 0.6504 0.7499 -0.0284 0.1422  -0.0121 250 ILE Z CD1   
1941 N N     . VAL A 251 ? 1.0092 0.9219 1.0795 -0.0750 0.1348  -0.0211 251 VAL Z N     
1942 C CA    . VAL A 251 ? 1.0202 0.8917 1.0824 -0.0647 0.1315  -0.0391 251 VAL Z CA    
1943 C C     . VAL A 251 ? 1.0445 0.8676 1.1002 -0.0530 0.1217  -0.0331 251 VAL Z C     
1944 O O     . VAL A 251 ? 1.0537 0.8628 1.1174 -0.0271 0.1207  -0.0450 251 VAL Z O     
1945 C CB    . VAL A 251 ? 0.9854 0.8360 1.0308 -0.0861 0.1275  -0.0497 251 VAL Z CB    
1946 C CG1   . VAL A 251 ? 0.9629 0.7650 0.9952 -0.0714 0.1244  -0.0737 251 VAL Z CG1   
1947 C CG2   . VAL A 251 ? 0.9613 0.8605 1.0116 -0.0951 0.1341  -0.0540 251 VAL Z CG2   
1948 N N     . LYS A 252 ? 1.0496 0.8512 1.0925 -0.0717 0.1141  -0.0121 252 LYS Z N     
1949 C CA    . LYS A 252 ? 1.0810 0.8309 1.1129 -0.0637 0.1017  0.0001  252 LYS Z CA    
1950 C C     . LYS A 252 ? 1.0742 0.8449 1.1178 -0.0366 0.1007  0.0056  252 LYS Z C     
1951 O O     . LYS A 252 ? 1.1179 0.8551 1.1638 -0.0136 0.0906  0.0033  252 LYS Z O     
1952 C CB    . LYS A 252 ? 1.1599 0.8923 1.1743 -0.0951 0.0957  0.0277  252 LYS Z CB    
1953 C CG    . LYS A 252 ? 1.2174 0.9282 1.2233 -0.1269 0.0923  0.0239  252 LYS Z CG    
1954 C CD    . LYS A 252 ? 1.2431 0.9574 1.2399 -0.1634 0.0898  0.0549  252 LYS Z CD    
1955 C CE    . LYS A 252 ? 1.2899 0.9874 1.2834 -0.1994 0.0832  0.0510  252 LYS Z CE    
1956 N NZ    . LYS A 252 ? 1.3103 1.0320 1.3040 -0.2388 0.0842  0.0831  252 LYS Z NZ    
1957 N N     . VAL A 253 ? 1.0276 0.8534 1.0797 -0.0384 0.1093  0.0113  253 VAL Z N     
1958 C CA    . VAL A 253 ? 1.0041 0.8538 1.0661 -0.0171 0.1064  0.0139  253 VAL Z CA    
1959 C C     . VAL A 253 ? 0.9950 0.8518 1.0820 0.0084  0.1066  -0.0067 253 VAL Z C     
1960 O O     . VAL A 253 ? 1.0884 0.9355 1.1844 0.0299  0.0961  -0.0055 253 VAL Z O     
1961 C CB    . VAL A 253 ? 0.9734 0.8761 1.0389 -0.0236 0.1155  0.0170  253 VAL Z CB    
1962 C CG1   . VAL A 253 ? 0.9072 0.8300 0.9813 -0.0038 0.1093  0.0151  253 VAL Z CG1   
1963 C CG2   . VAL A 253 ? 1.0082 0.9170 1.0524 -0.0454 0.1187  0.0370  253 VAL Z CG2   
1964 N N     . ILE A 254 ? 0.9555 0.8341 1.0542 0.0055  0.1185  -0.0239 254 ILE Z N     
1965 C CA    . ILE A 254 ? 0.8677 0.7639 0.9903 0.0259  0.1237  -0.0424 254 ILE Z CA    
1966 C C     . ILE A 254 ? 0.9107 0.7638 1.0332 0.0458  0.1169  -0.0524 254 ILE Z C     
1967 O O     . ILE A 254 ? 0.9694 0.8359 1.1162 0.0711  0.1154  -0.0609 254 ILE Z O     
1968 C CB    . ILE A 254 ? 0.8569 0.7809 0.9825 0.0152  0.1381  -0.0554 254 ILE Z CB    
1969 C CG1   . ILE A 254 ? 0.8162 0.7795 0.9470 0.0018  0.1421  -0.0455 254 ILE Z CG1   
1970 C CG2   . ILE A 254 ? 0.7080 0.6538 0.8547 0.0340  0.1470  -0.0732 254 ILE Z CG2   
1971 C CD1   . ILE A 254 ? 0.8881 0.8772 1.0200 -0.0091 0.1527  -0.0523 254 ILE Z CD1   
1972 N N     . LYS A 255 ? 0.9567 0.7577 1.0542 0.0344  0.1113  -0.0512 255 LYS Z N     
1973 C CA    . LYS A 255 ? 1.0564 0.8016 1.1499 0.0546  0.1015  -0.0614 255 LYS Z CA    
1974 C C     . LYS A 255 ? 1.1311 0.8531 1.2289 0.0722  0.0839  -0.0423 255 LYS Z C     
1975 O O     . LYS A 255 ? 1.2092 0.8990 1.3170 0.1009  0.0745  -0.0509 255 LYS Z O     
1976 C CB    . LYS A 255 ? 1.0623 0.7486 1.1255 0.0328  0.0961  -0.0644 255 LYS Z CB    
1977 C CG    . LYS A 255 ? 1.0367 0.7364 1.0916 0.0213  0.1089  -0.0891 255 LYS Z CG    
1978 C CD    . LYS A 255 ? 1.0676 0.7067 1.0924 -0.0040 0.0987  -0.0927 255 LYS Z CD    
1979 C CE    . LYS A 255 ? 1.1102 0.7623 1.1218 -0.0138 0.1080  -0.1200 255 LYS Z CE    
1980 N NZ    . LYS A 255 ? 1.1706 0.7616 1.1525 -0.0402 0.0944  -0.1279 255 LYS Z NZ    
1981 N N     . LYS A 256 ? 1.0925 0.8322 1.1814 0.0571  0.0787  -0.0172 256 LYS Z N     
1982 C CA    . LYS A 256 ? 1.1834 0.9069 1.2696 0.0712  0.0603  0.0038  256 LYS Z CA    
1983 C C     . LYS A 256 ? 1.1257 0.9092 1.2360 0.0854  0.0593  0.0041  256 LYS Z C     
1984 O O     . LYS A 256 ? 1.2170 1.0010 1.3179 0.0894  0.0442  0.0236  256 LYS Z O     
1985 C CB    . LYS A 256 ? 1.2573 0.9533 1.3075 0.0434  0.0530  0.0340  256 LYS Z CB    
1986 C CG    . LYS A 256 ? 1.3405 0.9570 1.3675 0.0356  0.0395  0.0460  256 LYS Z CG    
1987 C CD    . LYS A 256 ? 1.4196 1.0213 1.4128 0.0026  0.0351  0.0810  256 LYS Z CD    
1988 C CE    . LYS A 256 ? 1.4569 0.9718 1.4270 -0.0069 0.0168  0.0993  256 LYS Z CE    
1989 N NZ    . LYS A 256 ? 1.4750 0.9467 1.4485 0.0287  -0.0055 0.1064  256 LYS Z NZ    
1990 N N     . ILE A 257 ? 1.0656 0.8985 1.2043 0.0902  0.0738  -0.0164 257 ILE Z N     
1991 C CA    . ILE A 257 ? 1.0081 0.8961 1.1735 0.0988  0.0714  -0.0175 257 ILE Z CA    
1992 C C     . ILE A 257 ? 1.0985 0.9850 1.2844 0.1277  0.0513  -0.0123 257 ILE Z C     
1993 O O     . ILE A 257 ? 1.1770 1.0896 1.3673 0.1296  0.0377  -0.0021 257 ILE Z O     
1994 C CB    . ILE A 257 ? 0.9381 0.8746 1.1338 0.0983  0.0896  -0.0375 257 ILE Z CB    
1995 C CG1   . ILE A 257 ? 0.9377 0.9263 1.1610 0.1000  0.0845  -0.0362 257 ILE Z CG1   
1996 C CG2   . ILE A 257 ? 0.9649 0.8980 1.1822 0.1207  0.0969  -0.0565 257 ILE Z CG2   
1997 C CD1   . ILE A 257 ? 0.9251 0.9611 1.1788 0.0952  0.1009  -0.0496 257 ILE Z CD1   
1998 N N     . GLY A 258 ? 1.0741 0.9280 1.2708 0.1514  0.0471  -0.0201 258 GLY Z N     
1999 C CA    . GLY A 258 ? 1.1173 0.9676 1.3368 0.1834  0.0257  -0.0141 258 GLY Z CA    
2000 C C     . GLY A 258 ? 1.1572 0.9699 1.3417 0.1778  0.0019  0.0159  258 GLY Z C     
2001 O O     . GLY A 258 ? 1.0908 0.9235 1.2873 0.1930  -0.0189 0.0277  258 GLY Z O     
2002 N N     . HIS A 259 ? 1.1541 0.9163 1.2942 0.1537  0.0045  0.0298  259 HIS Z N     
2003 C CA    . HIS A 259 ? 1.2809 1.0093 1.3806 0.1425  -0.0141 0.0622  259 HIS Z CA    
2004 C C     . HIS A 259 ? 1.2650 1.0459 1.3519 0.1270  -0.0142 0.0707  259 HIS Z C     
2005 O O     . HIS A 259 ? 1.2904 1.0736 1.3621 0.1342  -0.0354 0.0898  259 HIS Z O     
2006 C CB    . HIS A 259 ? 1.3649 1.0355 1.4248 0.1145  -0.0080 0.0758  259 HIS Z CB    
2007 C CG    . HIS A 259 ? 1.4513 1.1020 1.4659 0.0934  -0.0194 0.1118  259 HIS Z CG    
2008 N ND1   . HIS A 259 ? 1.5425 1.1722 1.5428 0.1093  -0.0458 0.1371  259 HIS Z ND1   
2009 C CD2   . HIS A 259 ? 1.4437 1.0980 1.4239 0.0577  -0.0072 0.1279  259 HIS Z CD2   
2010 C CE1   . HIS A 259 ? 1.5851 1.2047 1.5385 0.0825  -0.0481 0.1681  259 HIS Z CE1   
2011 N NE2   . HIS A 259 ? 1.5362 1.1733 1.4791 0.0513  -0.0235 0.1624  259 HIS Z NE2   
2012 N N     . TYR A 260 ? 1.2605 1.0809 1.3513 0.1075  0.0076  0.0554  260 TYR Z N     
2013 C CA    . TYR A 260 ? 1.2014 1.0631 1.2763 0.0938  0.0085  0.0587  260 TYR Z CA    
2014 C C     . TYR A 260 ? 1.1295 1.0353 1.2350 0.1112  -0.0062 0.0490  260 TYR Z C     
2015 O O     . TYR A 260 ? 1.0726 0.9987 1.1578 0.1064  -0.0177 0.0551  260 TYR Z O     
2016 C CB    . TYR A 260 ? 1.1462 1.0325 1.2200 0.0716  0.0335  0.0451  260 TYR Z CB    
2017 C CG    . TYR A 260 ? 1.1610 1.0182 1.2037 0.0485  0.0457  0.0576  260 TYR Z CG    
2018 C CD1   . TYR A 260 ? 1.1982 1.0470 1.1996 0.0336  0.0425  0.0812  260 TYR Z CD1   
2019 C CD2   . TYR A 260 ? 1.1081 0.9516 1.1621 0.0395  0.0601  0.0463  260 TYR Z CD2   
2020 C CE1   . TYR A 260 ? 1.2438 1.0748 1.2228 0.0085  0.0542  0.0951  260 TYR Z CE1   
2021 C CE2   . TYR A 260 ? 1.1414 0.9627 1.1715 0.0147  0.0683  0.0581  260 TYR Z CE2   
2022 C CZ    . TYR A 260 ? 1.2276 1.0446 1.2235 -0.0017 0.0657  0.0835  260 TYR Z CZ    
2023 O OH    . TYR A 260 ? 1.2670 1.0705 1.2451 -0.0301 0.0745  0.0976  260 TYR Z OH    
2024 N N     . LEU A 261 ? 1.1138 1.0379 1.2678 0.1303  -0.0060 0.0331  261 LEU Z N     
2025 C CA    . LEU A 261 ? 1.0987 1.0737 1.2908 0.1422  -0.0195 0.0245  261 LEU Z CA    
2026 C C     . LEU A 261 ? 1.1581 1.1299 1.3686 0.1708  -0.0475 0.0355  261 LEU Z C     
2027 O O     . LEU A 261 ? 1.1828 1.2009 1.4282 0.1808  -0.0636 0.0310  261 LEU Z O     
2028 C CB    . LEU A 261 ? 1.0011 1.0171 1.2422 0.1427  -0.0005 0.0020  261 LEU Z CB    
2029 C CG    . LEU A 261 ? 0.8778 0.9140 1.1124 0.1165  0.0186  -0.0083 261 LEU Z CG    
2030 C CD1   . LEU A 261 ? 0.8029 0.8804 1.0848 0.1162  0.0349  -0.0246 261 LEU Z CD1   
2031 C CD2   . LEU A 261 ? 0.8033 0.8555 1.0197 0.1045  0.0037  -0.0053 261 LEU Z CD2   
2032 N N     . LYS A 262 ? 1.1776 1.0948 1.3675 0.1834  -0.0554 0.0508  262 LYS Z N     
2033 C CA    . LYS A 262 ? 1.2603 1.1678 1.4697 0.2155  -0.0837 0.0627  262 LYS Z CA    
2034 C C     . LYS A 262 ? 1.2104 1.1715 1.4901 0.2407  -0.0821 0.0414  262 LYS Z C     
2035 O O     . LYS A 262 ? 1.2360 1.2430 1.5477 0.2540  -0.1036 0.0438  262 LYS Z O     
2036 C CB    . LYS A 262 ? 1.3332 1.2452 1.5123 0.2146  -0.1147 0.0863  262 LYS Z CB    
2037 C CG    . LYS A 262 ? 1.4641 1.3239 1.5717 0.1945  -0.1184 0.1135  262 LYS Z CG    
2038 C CD    . LYS A 262 ? 1.6200 1.4936 1.6947 0.1952  -0.1492 0.1347  262 LYS Z CD    
2039 C CE    . LYS A 262 ? 1.7650 1.5934 1.7646 0.1737  -0.1502 0.1653  262 LYS Z CE    
2040 N NZ    . LYS A 262 ? 1.8570 1.7000 1.8130 0.1731  -0.1791 0.1864  262 LYS Z NZ    
2041 N N     . MET A 263 ? 1.2496 1.2116 1.5525 0.2442  -0.0552 0.0202  263 MET Z N     
2042 C CA    . MET A 263 ? 1.1527 1.1651 1.5218 0.2721  -0.0482 -0.0003 263 MET Z CA    
2043 C C     . MET A 263 ? 1.1367 1.1171 1.5068 0.2823  -0.0223 -0.0203 263 MET Z C     
2044 O O     . MET A 263 ? 1.0412 0.9881 1.3722 0.2559  -0.0032 -0.0240 263 MET Z O     
2045 C CB    . MET A 263 ? 1.0361 1.1305 1.4441 0.2543  -0.0380 -0.0121 263 MET Z CB    
2046 C CG    . MET A 263 ? 0.9921 1.0875 1.3729 0.2167  -0.0117 -0.0201 263 MET Z CG    
2047 S SD    . MET A 263 ? 0.9933 1.1721 1.4197 0.1938  -0.0023 -0.0310 263 MET Z SD    
2048 C CE    . MET A 263 ? 1.0257 1.2631 1.5223 0.2212  0.0157  -0.0481 263 MET Z CE    
2049 N N     . ASN A 264 ? 1.1372 1.1297 1.5516 0.3219  -0.0226 -0.0347 264 ASN Z N     
2050 C CA    . ASN A 264 ? 1.1916 1.1515 1.6037 0.3367  0.0003  -0.0590 264 ASN Z CA    
2051 C C     . ASN A 264 ? 1.1718 1.1856 1.5952 0.3152  0.0357  -0.0808 264 ASN Z C     
2052 O O     . ASN A 264 ? 1.1154 1.2112 1.5909 0.3226  0.0468  -0.0912 264 ASN Z O     
2053 C CB    . ASN A 264 ? 1.2502 1.2146 1.7092 0.3909  -0.0087 -0.0723 264 ASN Z CB    
2054 C CG    . ASN A 264 ? 1.2984 1.2198 1.7484 0.4111  0.0131  -0.1026 264 ASN Z CG    
2055 O OD1   . ASN A 264 ? 1.3233 1.1906 1.7230 0.3835  0.0263  -0.1081 264 ASN Z OD1   
2056 N ND2   . ASN A 264 ? 1.3022 1.2505 1.8019 0.4605  0.0159  -0.1244 264 ASN Z ND2   
2057 N N     . ILE A 265 ? 1.2428 1.2124 1.6178 0.2865  0.0518  -0.0850 265 ILE Z N     
2058 C CA    . ILE A 265 ? 1.1736 1.1833 1.5484 0.2641  0.0827  -0.1020 265 ILE Z CA    
2059 C C     . ILE A 265 ? 1.2428 1.1992 1.5836 0.2656  0.0988  -0.1229 265 ILE Z C     
2060 O O     . ILE A 265 ? 1.2969 1.1818 1.5908 0.2487  0.0906  -0.1150 265 ILE Z O     
2061 C CB    . ILE A 265 ? 1.0104 1.0330 1.3594 0.2200  0.0850  -0.0855 265 ILE Z CB    
2062 C CG1   . ILE A 265 ? 0.9693 1.0439 1.3485 0.2156  0.0686  -0.0703 265 ILE Z CG1   
2063 C CG2   . ILE A 265 ? 0.8750 0.9286 1.2192 0.1980  0.1136  -0.0995 265 ILE Z CG2   
2064 C CD1   . ILE A 265 ? 0.9079 0.9891 1.2614 0.1781  0.0687  -0.0582 265 ILE Z CD1   
2065 N N     . THR A 266 ? 1.1704 1.1653 1.5344 0.2845  0.1218  -0.1501 266 THR Z N     
2066 C CA    . THR A 266 ? 1.2300 1.1810 1.5590 0.2864  0.1379  -0.1758 266 THR Z CA    
2067 C C     . THR A 266 ? 1.1547 1.1276 1.4546 0.2447  0.1573  -0.1754 266 THR Z C     
2068 O O     . THR A 266 ? 1.1371 1.1849 1.4612 0.2349  0.1757  -0.1761 266 THR Z O     
2069 C CB    . THR A 266 ? 1.3405 1.3250 1.7017 0.3298  0.1560  -0.2094 266 THR Z CB    
2070 O OG1   . THR A 266 ? 1.3226 1.4118 1.7269 0.3260  0.1783  -0.2111 266 THR Z OG1   
2071 C CG2   . THR A 266 ? 1.3819 1.3376 1.7737 0.3778  0.1341  -0.2115 266 THR Z CG2   
2072 N N     . VAL A 267 ? 1.1959 1.1046 1.4460 0.2192  0.1514  -0.1717 267 VAL Z N     
2073 C CA    . VAL A 267 ? 1.1015 1.0273 1.3238 0.1816  0.1653  -0.1693 267 VAL Z CA    
2074 C C     . VAL A 267 ? 1.1613 1.0598 1.3493 0.1814  0.1788  -0.1983 267 VAL Z C     
2075 O O     . VAL A 267 ? 1.2106 1.0349 1.3646 0.1776  0.1663  -0.2052 267 VAL Z O     
2076 C CB    . VAL A 267 ? 1.0103 0.8997 1.2046 0.1484  0.1493  -0.1425 267 VAL Z CB    
2077 C CG1   . VAL A 267 ? 0.8363 0.7494 1.0090 0.1139  0.1617  -0.1394 267 VAL Z CG1   
2078 C CG2   . VAL A 267 ? 1.0237 0.9359 1.2427 0.1497  0.1348  -0.1175 267 VAL Z CG2   
2079 N N     . PRO A 268 ? 1.0685 1.0267 1.2628 0.1832  0.2034  -0.2148 268 PRO Z N     
2080 C CA    . PRO A 268 ? 1.1493 1.0902 1.3039 0.1813  0.2174  -0.2441 268 PRO Z CA    
2081 C C     . PRO A 268 ? 1.1810 1.0841 1.2897 0.1410  0.2085  -0.2350 268 PRO Z C     
2082 O O     . PRO A 268 ? 1.1154 1.0362 1.2284 0.1130  0.2021  -0.2060 268 PRO Z O     
2083 C CB    . PRO A 268 ? 1.0895 1.1195 1.2625 0.1839  0.2460  -0.2514 268 PRO Z CB    
2084 C CG    . PRO A 268 ? 0.9976 1.0836 1.2305 0.2001  0.2462  -0.2351 268 PRO Z CG    
2085 C CD    . PRO A 268 ? 0.9681 1.0147 1.2064 0.1864  0.2188  -0.2063 268 PRO Z CD    
2086 N N     . GLU A 269 ? 1.2639 1.1170 1.3305 0.1393  0.2070  -0.2613 269 GLU Z N     
2087 C CA    . GLU A 269 ? 1.3557 1.1781 1.3820 0.1006  0.1965  -0.2548 269 GLU Z CA    
2088 C C     . GLU A 269 ? 1.2384 1.1298 1.2591 0.0769  0.2115  -0.2437 269 GLU Z C     
2089 O O     . GLU A 269 ? 1.2670 1.1585 1.2734 0.0443  0.2021  -0.2243 269 GLU Z O     
2090 C CB    . GLU A 269 ? 1.5292 1.2837 1.5110 0.1036  0.1898  -0.2899 269 GLU Z CB    
2091 C CG    . GLU A 269 ? 1.6143 1.3497 1.5545 0.0620  0.1793  -0.2883 269 GLU Z CG    
2092 C CD    . GLU A 269 ? 1.6093 1.3232 1.5576 0.0295  0.1591  -0.2523 269 GLU Z CD    
2093 O OE1   . GLU A 269 ? 1.6416 1.3159 1.6083 0.0382  0.1467  -0.2378 269 GLU Z OE1   
2094 O OE2   . GLU A 269 ? 1.5573 1.2977 1.4936 -0.0037 0.1558  -0.2377 269 GLU Z OE2   
2095 N N     . ASP A 270 ? 1.2447 1.1976 1.2798 0.0938  0.2346  -0.2536 270 ASP Z N     
2096 C CA    . ASP A 270 ? 1.1664 1.1820 1.1936 0.0718  0.2490  -0.2408 270 ASP Z CA    
2097 C C     . ASP A 270 ? 0.9787 1.0264 1.0389 0.0531  0.2426  -0.2021 270 ASP Z C     
2098 O O     . ASP A 270 ? 0.9587 1.0300 1.0064 0.0271  0.2422  -0.1839 270 ASP Z O     
2099 C CB    . ASP A 270 ? 1.2429 1.3192 1.2773 0.0929  0.2773  -0.2591 270 ASP Z CB    
2100 C CG    . ASP A 270 ? 1.2907 1.4077 1.2865 0.0706  0.2916  -0.2589 270 ASP Z CG    
2101 O OD1   . ASP A 270 ? 1.3187 1.4002 1.2686 0.0500  0.2790  -0.2645 270 ASP Z OD1   
2102 O OD2   . ASP A 270 ? 1.3171 1.5038 1.3282 0.0720  0.3141  -0.2513 270 ASP Z OD2   
2103 N N     . TYR A 271 ? 1.0174 0.8341 1.0719 0.0100  0.0087  -0.2070 271 TYR Z N     
2104 C CA    . TYR A 271 ? 0.9264 0.7531 0.9937 0.0011  0.0050  -0.1890 271 TYR Z CA    
2105 C C     . TYR A 271 ? 0.9309 0.7436 1.0046 -0.0146 0.0002  -0.1929 271 TYR Z C     
2106 O O     . TYR A 271 ? 0.9144 0.7415 0.9971 -0.0224 -0.0054 -0.1841 271 TYR Z O     
2107 C CB    . TYR A 271 ? 0.9048 0.7229 0.9784 0.0078  0.0087  -0.1755 271 TYR Z CB    
2108 C CG    . TYR A 271 ? 0.8948 0.7222 0.9805 -0.0001 0.0034  -0.1598 271 TYR Z CG    
2109 C CD1   . TYR A 271 ? 0.8151 0.6717 0.9086 0.0012  -0.0011 -0.1461 271 TYR Z CD1   
2110 C CD2   . TYR A 271 ? 0.8800 0.6882 0.9701 -0.0086 0.0021  -0.1586 271 TYR Z CD2   
2111 C CE1   . TYR A 271 ? 0.8044 0.6665 0.9102 -0.0052 -0.0085 -0.1342 271 TYR Z CE1   
2112 C CE2   . TYR A 271 ? 0.8531 0.6706 0.9527 -0.0135 -0.0036 -0.1476 271 TYR Z CE2   
2113 C CZ    . TYR A 271 ? 0.8344 0.6767 0.9421 -0.0115 -0.0099 -0.1367 271 TYR Z CZ    
2114 O OH    . TYR A 271 ? 0.8004 0.6490 0.9189 -0.0156 -0.0180 -0.1282 271 TYR Z OH    
2115 N N     . ILE A 272 ? 0.9112 0.6963 0.9823 -0.0189 0.0019  -0.2059 272 ILE Z N     
2116 C CA    . ILE A 272 ? 0.9018 0.6774 0.9806 -0.0344 -0.0016 -0.2099 272 ILE Z CA    
2117 C C     . ILE A 272 ? 0.9292 0.7258 1.0083 -0.0414 -0.0088 -0.2177 272 ILE Z C     
2118 O O     . ILE A 272 ? 0.9379 0.7467 1.0271 -0.0506 -0.0136 -0.2128 272 ILE Z O     
2119 C CB    . ILE A 272 ? 0.9372 0.6794 1.0156 -0.0390 0.0007  -0.2208 272 ILE Z CB    
2120 C CG1   . ILE A 272 ? 1.0401 0.7601 1.1167 -0.0296 0.0068  -0.2130 272 ILE Z CG1   
2121 C CG2   . ILE A 272 ? 0.7770 0.5141 0.8669 -0.0558 -0.0013 -0.2203 272 ILE Z CG2   
2122 C CD1   . ILE A 272 ? 1.0705 0.7936 1.1536 -0.0319 0.0091  -0.1946 272 ILE Z CD1   
2123 N N     . ASN A 273 ? 0.9143 0.7162 0.9820 -0.0356 -0.0100 -0.2306 273 ASN Z N     
2124 C CA    . ASN A 273 ? 0.9659 0.7900 1.0310 -0.0406 -0.0175 -0.2374 273 ASN Z CA    
2125 C C     . ASN A 273 ? 0.8846 0.7402 0.9541 -0.0394 -0.0214 -0.2204 273 ASN Z C     
2126 O O     . ASN A 273 ? 0.7740 0.6447 0.8504 -0.0477 -0.0293 -0.2188 273 ASN Z O     
2127 C CB    . ASN A 273 ? 1.0654 0.8916 1.1136 -0.0320 -0.0179 -0.2550 273 ASN Z CB    
2128 C CG    . ASN A 273 ? 1.1201 0.9112 1.1664 -0.0339 -0.0175 -0.2737 273 ASN Z CG    
2129 O OD1   . ASN A 273 ? 1.0865 0.8583 1.1451 -0.0474 -0.0198 -0.2757 273 ASN Z OD1   
2130 N ND2   . ASN A 273 ? 1.1877 0.9711 1.2200 -0.0200 -0.0150 -0.2874 273 ASN Z ND2   
2131 N N     . GLY A 274 ? 0.7889 0.6538 0.8571 -0.0294 -0.0168 -0.2071 274 GLY Z N     
2132 C CA    . GLY A 274 ? 0.7948 0.6863 0.8710 -0.0294 -0.0216 -0.1886 274 GLY Z CA    
2133 C C     . GLY A 274 ? 0.7775 0.6635 0.8704 -0.0386 -0.0273 -0.1802 274 GLY Z C     
2134 O O     . GLY A 274 ? 0.8149 0.7184 0.9174 -0.0432 -0.0362 -0.1713 274 GLY Z O     
2135 N N     . PHE A 275 ? 0.7505 0.6127 0.8470 -0.0405 -0.0226 -0.1831 275 PHE Z N     
2136 C CA    . PHE A 275 ? 0.7162 0.5743 0.8259 -0.0474 -0.0265 -0.1782 275 PHE Z CA    
2137 C C     . PHE A 275 ? 0.7320 0.5946 0.8482 -0.0576 -0.0326 -0.1878 275 PHE Z C     
2138 O O     . PHE A 275 ? 0.6949 0.5688 0.8234 -0.0611 -0.0404 -0.1832 275 PHE Z O     
2139 C CB    . PHE A 275 ? 0.6948 0.5296 0.8036 -0.0468 -0.0188 -0.1782 275 PHE Z CB    
2140 C CG    . PHE A 275 ? 0.7013 0.5361 0.8207 -0.0519 -0.0215 -0.1741 275 PHE Z CG    
2141 C CD1   . PHE A 275 ? 0.6350 0.4754 0.7594 -0.0468 -0.0249 -0.1627 275 PHE Z CD1   
2142 C CD2   . PHE A 275 ? 0.7153 0.5469 0.8403 -0.0614 -0.0213 -0.1824 275 PHE Z CD2   
2143 C CE1   . PHE A 275 ? 0.6449 0.4869 0.7771 -0.0493 -0.0281 -0.1617 275 PHE Z CE1   
2144 C CE2   . PHE A 275 ? 0.7406 0.5769 0.8743 -0.0640 -0.0229 -0.1799 275 PHE Z CE2   
2145 C CZ    . PHE A 275 ? 0.7563 0.5973 0.8922 -0.0572 -0.0264 -0.1706 275 PHE Z CZ    
2146 N N     . ILE A 276 ? 0.6882 0.5416 0.7979 -0.0619 -0.0302 -0.2019 276 ILE Z N     
2147 C CA    . ILE A 276 ? 0.6835 0.5442 0.8008 -0.0718 -0.0367 -0.2116 276 ILE Z CA    
2148 C C     . ILE A 276 ? 0.7461 0.6322 0.8654 -0.0709 -0.0471 -0.2072 276 ILE Z C     
2149 O O     . ILE A 276 ? 0.7900 0.6875 0.9226 -0.0764 -0.0552 -0.2067 276 ILE Z O     
2150 C CB    . ILE A 276 ? 0.6683 0.5149 0.7783 -0.0765 -0.0345 -0.2281 276 ILE Z CB    
2151 C CG1   . ILE A 276 ? 0.7286 0.5477 0.8400 -0.0794 -0.0258 -0.2299 276 ILE Z CG1   
2152 C CG2   . ILE A 276 ? 0.5952 0.4535 0.7146 -0.0870 -0.0429 -0.2377 276 ILE Z CG2   
2153 C CD1   . ILE A 276 ? 0.7979 0.5974 0.9048 -0.0843 -0.0255 -0.2457 276 ILE Z CD1   
2154 N N     . ARG A 277 ? 0.7100 0.6069 0.8169 -0.0634 -0.0468 -0.2030 277 ARG Z N     
2155 C CA    . ARG A 277 ? 0.7086 0.6317 0.8158 -0.0628 -0.0563 -0.1950 277 ARG Z CA    
2156 C C     . ARG A 277 ? 0.6273 0.5593 0.7513 -0.0632 -0.0639 -0.1780 277 ARG Z C     
2157 O O     . ARG A 277 ? 0.6639 0.6093 0.7985 -0.0673 -0.0753 -0.1740 277 ARG Z O     
2158 C CB    . ARG A 277 ? 0.8399 0.7767 0.9294 -0.0538 -0.0521 -0.1919 277 ARG Z CB    
2159 C CG    . ARG A 277 ? 0.9720 0.9049 1.0440 -0.0521 -0.0493 -0.2120 277 ARG Z CG    
2160 C CD    . ARG A 277 ? 0.9921 0.9473 1.0450 -0.0413 -0.0462 -0.2102 277 ARG Z CD    
2161 N NE    . ARG A 277 ? 0.8942 0.8356 0.9363 -0.0305 -0.0347 -0.2172 277 ARG Z NE    
2162 C CZ    . ARG A 277 ? 0.9722 0.9214 1.0154 -0.0218 -0.0278 -0.2028 277 ARG Z CZ    
2163 N NH1   . ARG A 277 ? 1.0197 0.9895 1.0747 -0.0240 -0.0316 -0.1800 277 ARG Z NH1   
2164 N NH2   . ARG A 277 ? 0.9222 0.8583 0.9567 -0.0108 -0.0182 -0.2110 277 ARG Z NH2   
2165 N N     . ALA A 278 ? 0.6475 0.6454 0.7083 -0.1484 -0.0571 -0.2150 278 ALA Z N     
2166 C CA    . ALA A 278 ? 0.5967 0.6240 0.6495 -0.1326 -0.0390 -0.2057 278 ALA Z CA    
2167 C C     . ALA A 278 ? 0.6141 0.6837 0.6893 -0.1409 -0.0339 -0.1826 278 ALA Z C     
2168 O O     . ALA A 278 ? 0.6260 0.7272 0.6946 -0.1314 -0.0253 -0.1794 278 ALA Z O     
2169 C CB    . ALA A 278 ? 0.5478 0.5558 0.5925 -0.1209 -0.0278 -0.2018 278 ALA Z CB    
2170 N N     . ASN A 279 ? 0.5924 0.6619 0.6932 -0.1584 -0.0392 -0.1662 279 ASN Z N     
2171 C CA    . ASN A 279 ? 0.5895 0.7016 0.7147 -0.1681 -0.0347 -0.1431 279 ASN Z CA    
2172 C C     . ASN A 279 ? 0.5666 0.7124 0.6992 -0.1730 -0.0424 -0.1462 279 ASN Z C     
2173 O O     . ASN A 279 ? 0.5430 0.7289 0.6784 -0.1642 -0.0323 -0.1363 279 ASN Z O     
2174 C CB    . ASN A 279 ? 0.5354 0.6380 0.6862 -0.1898 -0.0418 -0.1264 279 ASN Z CB    
2175 C CG    . ASN A 279 ? 0.5198 0.6691 0.6960 -0.1988 -0.0341 -0.1003 279 ASN Z CG    
2176 O OD1   . ASN A 279 ? 0.5216 0.6975 0.6926 -0.1842 -0.0174 -0.0905 279 ASN Z OD1   
2177 N ND2   . ASN A 279 ? 0.5397 0.6993 0.7425 -0.2236 -0.0462 -0.0890 279 ASN Z ND2   
2178 N N     . ASN A 280 ? 0.5359 0.6640 0.6700 -0.1862 -0.0606 -0.1604 280 ASN Z N     
2179 C CA    . ASN A 280 ? 0.5366 0.6950 0.6771 -0.1924 -0.0711 -0.1647 280 ASN Z CA    
2180 C C     . ASN A 280 ? 0.6089 0.7798 0.7237 -0.1698 -0.0633 -0.1771 280 ASN Z C     
2181 O O     . ASN A 280 ? 0.5715 0.7787 0.6916 -0.1683 -0.0659 -0.1743 280 ASN Z O     
2182 C CB    . ASN A 280 ? 0.5743 0.7040 0.7156 -0.2115 -0.0930 -0.1801 280 ASN Z CB    
2183 C CG    . ASN A 280 ? 0.6638 0.7886 0.8331 -0.2390 -0.1037 -0.1652 280 ASN Z CG    
2184 O OD1   . ASN A 280 ? 0.5875 0.7447 0.7811 -0.2462 -0.0962 -0.1414 280 ASN Z OD1   
2185 N ND2   . ASN A 280 ? 0.6395 0.7224 0.8038 -0.2551 -0.1213 -0.1793 280 ASN Z ND2   
2186 N N     . THR A 281 ? 0.5375 0.6787 0.6243 -0.1525 -0.0541 -0.1900 281 THR Z N     
2187 C CA    . THR A 281 ? 0.5465 0.6954 0.6059 -0.1325 -0.0462 -0.2012 281 THR Z CA    
2188 C C     . THR A 281 ? 0.5565 0.7378 0.6164 -0.1194 -0.0286 -0.1837 281 THR Z C     
2189 O O     . THR A 281 ? 0.5449 0.7507 0.5953 -0.1087 -0.0252 -0.1838 281 THR Z O     
2190 C CB    . THR A 281 ? 0.5511 0.6607 0.5802 -0.1197 -0.0420 -0.2204 281 THR Z CB    
2191 O OG1   . THR A 281 ? 0.5570 0.6337 0.5838 -0.1300 -0.0577 -0.2374 281 THR Z OG1   
2192 C CG2   . THR A 281 ? 0.5681 0.6856 0.5678 -0.1025 -0.0353 -0.2315 281 THR Z CG2   
2193 N N     . PHE A 282 ? 0.4773 0.6571 0.5466 -0.1199 -0.0176 -0.1688 282 PHE Z N     
2194 C CA    . PHE A 282 ? 0.5366 0.7456 0.6063 -0.1089 -0.0007 -0.1516 282 PHE Z CA    
2195 C C     . PHE A 282 ? 0.5488 0.8037 0.6451 -0.1154 -0.0031 -0.1356 282 PHE Z C     
2196 O O     . PHE A 282 ? 0.5300 0.8132 0.6209 -0.1015 0.0082  -0.1272 282 PHE Z O     
2197 C CB    . PHE A 282 ? 0.4500 0.6480 0.5248 -0.1102 0.0101  -0.1385 282 PHE Z CB    
2198 C CG    . PHE A 282 ? 0.4545 0.6262 0.4991 -0.0954 0.0210  -0.1477 282 PHE Z CG    
2199 C CD1   . PHE A 282 ? 0.4362 0.6181 0.4564 -0.0788 0.0348  -0.1477 282 PHE Z CD1   
2200 C CD2   . PHE A 282 ? 0.4577 0.5949 0.4981 -0.0982 0.0171  -0.1557 282 PHE Z CD2   
2201 C CE1   . PHE A 282 ? 0.4210 0.5811 0.4139 -0.0682 0.0439  -0.1554 282 PHE Z CE1   
2202 C CE2   . PHE A 282 ? 0.4469 0.5661 0.4623 -0.0853 0.0267  -0.1631 282 PHE Z CE2   
2203 C CZ    . PHE A 282 ? 0.4298 0.5615 0.4217 -0.0717 0.0398  -0.1628 282 PHE Z CZ    
2204 N N     . LEU A 283 ? 0.4456 0.7078 0.5699 -0.1365 -0.0181 -0.1315 283 LEU Z N     
2205 C CA    . LEU A 283 ? 0.4430 0.7541 0.5973 -0.1457 -0.0213 -0.1145 283 LEU Z CA    
2206 C C     . LEU A 283 ? 0.5857 0.9211 0.7391 -0.1428 -0.0322 -0.1229 283 LEU Z C     
2207 O O     . LEU A 283 ? 0.5612 0.9387 0.7215 -0.1322 -0.0257 -0.1121 283 LEU Z O     
2208 C CB    . LEU A 283 ? 0.4615 0.7727 0.6475 -0.1731 -0.0330 -0.1035 283 LEU Z CB    
2209 C CG    . LEU A 283 ? 0.4591 0.7654 0.6567 -0.1788 -0.0220 -0.0855 283 LEU Z CG    
2210 C CD1   . LEU A 283 ? 0.4840 0.7848 0.7098 -0.2082 -0.0364 -0.0762 283 LEU Z CD1   
2211 C CD2   . LEU A 283 ? 0.4369 0.7899 0.6435 -0.1673 -0.0045 -0.0655 283 LEU Z CD2   
2212 N N     . TYR A 284 ? 0.5570 0.8660 0.7008 -0.1513 -0.0488 -0.1422 284 TYR Z N     
2213 C CA    . TYR A 284 ? 0.5529 0.8864 0.7006 -0.1548 -0.0633 -0.1487 284 TYR Z CA    
2214 C C     . TYR A 284 ? 0.5272 0.8378 0.6389 -0.1392 -0.0660 -0.1708 284 TYR Z C     
2215 O O     . TYR A 284 ? 0.4981 0.8120 0.6080 -0.1468 -0.0824 -0.1820 284 TYR Z O     
2216 C CB    . TYR A 284 ? 0.5454 0.8751 0.7163 -0.1841 -0.0847 -0.1507 284 TYR Z CB    
2217 C CG    . TYR A 284 ? 0.5191 0.8641 0.7240 -0.2041 -0.0841 -0.1296 284 TYR Z CG    
2218 C CD1   . TYR A 284 ? 0.4959 0.8985 0.7301 -0.2063 -0.0783 -0.1065 284 TYR Z CD1   
2219 C CD2   . TYR A 284 ? 0.5457 0.8474 0.7523 -0.2203 -0.0892 -0.1322 284 TYR Z CD2   
2220 C CE1   . TYR A 284 ? 0.5558 0.9745 0.8205 -0.2259 -0.0771 -0.0862 284 TYR Z CE1   
2221 C CE2   . TYR A 284 ? 0.5895 0.9029 0.8252 -0.2398 -0.0889 -0.1117 284 TYR Z CE2   
2222 C CZ    . TYR A 284 ? 0.6037 0.9764 0.8685 -0.2436 -0.0828 -0.0886 284 TYR Z CZ    
2223 O OH    . TYR A 284 ? 0.5517 0.9378 0.8448 -0.2643 -0.0820 -0.0673 284 TYR Z OH    
2224 N N     . GLN A 285 ? 0.5479 0.8365 0.6300 -0.1189 -0.0504 -0.1767 285 GLN Z N     
2225 C CA    . GLN A 285 ? 0.4992 0.7694 0.5460 -0.1044 -0.0513 -0.1955 285 GLN Z CA    
2226 C C     . GLN A 285 ? 0.5063 0.8143 0.5519 -0.0940 -0.0537 -0.1907 285 GLN Z C     
2227 O O     . GLN A 285 ? 0.4575 0.7989 0.5144 -0.0841 -0.0432 -0.1733 285 GLN Z O     
2228 C CB    . GLN A 285 ? 0.4636 0.7068 0.4802 -0.0868 -0.0335 -0.2000 285 GLN Z CB    
2229 C CG    . GLN A 285 ? 0.4673 0.6934 0.4466 -0.0730 -0.0333 -0.2175 285 GLN Z CG    
2230 C CD    . GLN A 285 ? 0.5336 0.7308 0.4838 -0.0607 -0.0180 -0.2235 285 GLN Z CD    
2231 O OE1   . GLN A 285 ? 0.5857 0.7703 0.5038 -0.0492 -0.0144 -0.2347 285 GLN Z OE1   
2232 N NE2   . GLN A 285 ? 0.5384 0.7260 0.4995 -0.0640 -0.0093 -0.2152 285 GLN Z NE2   
2233 N N     . LEU A 286 ? 0.6023 0.9049 0.6330 -0.0951 -0.0676 -0.2061 286 LEU Z N     
2234 C CA    . LEU A 286 ? 0.6094 0.9488 0.6406 -0.0866 -0.0733 -0.2014 286 LEU Z CA    
2235 C C     . LEU A 286 ? 0.5936 0.9372 0.5990 -0.0600 -0.0560 -0.1961 286 LEU Z C     
2236 O O     . LEU A 286 ? 0.6095 0.9186 0.5802 -0.0489 -0.0470 -0.2075 286 LEU Z O     
2237 C CB    . LEU A 286 ? 0.6281 0.9560 0.6436 -0.0936 -0.0921 -0.2204 286 LEU Z CB    
2238 C CG    . LEU A 286 ? 0.6704 0.9926 0.7075 -0.1209 -0.1120 -0.2272 286 LEU Z CG    
2239 C CD1   . LEU A 286 ? 0.6743 0.9932 0.6949 -0.1264 -0.1309 -0.2443 286 LEU Z CD1   
2240 C CD2   . LEU A 286 ? 0.6527 1.0181 0.7343 -0.1359 -0.1165 -0.2059 286 LEU Z CD2   
2241 N N     . VAL A 287 ? 0.5623 0.9488 0.5845 -0.0501 -0.0514 -0.1782 287 VAL Z N     
2242 C CA    . VAL A 287 ? 0.5607 0.9517 0.5575 -0.0237 -0.0368 -0.1725 287 VAL Z CA    
2243 C C     . VAL A 287 ? 0.6544 1.0826 0.6551 -0.0140 -0.0466 -0.1674 287 VAL Z C     
2244 O O     . VAL A 287 ? 0.6886 1.1411 0.7121 -0.0290 -0.0650 -0.1685 287 VAL Z O     
2245 C CB    . VAL A 287 ? 0.4916 0.8971 0.4996 -0.0140 -0.0176 -0.1544 287 VAL Z CB    
2246 C CG1   . VAL A 287 ? 0.5476 0.9184 0.5517 -0.0234 -0.0085 -0.1580 287 VAL Z CG1   
2247 C CG2   . VAL A 287 ? 0.4380 0.8978 0.4911 -0.0215 -0.0221 -0.1356 287 VAL Z CG2   
2248 N N     . PHE A 288 ? 0.7771 1.2090 0.7543 0.0113  -0.0349 -0.1614 288 PHE Z N     
2249 C CA    . PHE A 288 ? 0.7523 1.2169 0.7292 0.0245  -0.0437 -0.1562 288 PHE Z CA    
2250 C C     . PHE A 288 ? 0.8002 1.3025 0.7901 0.0458  -0.0304 -0.1355 288 PHE Z C     
2251 O O     . PHE A 288 ? 0.7629 1.2439 0.7260 0.0654  -0.0122 -0.1323 288 PHE Z O     
2252 C CB    . PHE A 288 ? 0.5991 1.0285 0.5280 0.0378  -0.0451 -0.1704 288 PHE Z CB    
2253 C CG    . PHE A 288 ? 0.6258 1.0850 0.5506 0.0523  -0.0553 -0.1652 288 PHE Z CG    
2254 C CD1   . PHE A 288 ? 0.6794 1.1700 0.6277 0.0376  -0.0771 -0.1673 288 PHE Z CD1   
2255 C CD2   . PHE A 288 ? 0.6543 1.1086 0.5500 0.0805  -0.0439 -0.1581 288 PHE Z CD2   
2256 C CE1   . PHE A 288 ? 0.7522 1.2731 0.6975 0.0512  -0.0875 -0.1616 288 PHE Z CE1   
2257 C CE2   . PHE A 288 ? 0.6797 1.1610 0.5712 0.0957  -0.0537 -0.1522 288 PHE Z CE2   
2258 C CZ    . PHE A 288 ? 0.7116 1.2284 0.6290 0.0812  -0.0757 -0.1536 288 PHE Z CZ    
2259 N N     . ASP A 289 ? 0.7824 1.3413 0.8131 0.0414  -0.0396 -0.1217 289 ASP Z N     
2260 C CA    . ASP A 289 ? 0.7211 1.3249 0.7673 0.0638  -0.0283 -0.1016 289 ASP Z CA    
2261 C C     . ASP A 289 ? 0.7114 1.3134 0.7254 0.0930  -0.0276 -0.1017 289 ASP Z C     
2262 O O     . ASP A 289 ? 0.6827 1.3046 0.6999 0.0918  -0.0451 -0.1044 289 ASP Z O     
2263 C CB    . ASP A 289 ? 0.7414 1.4115 0.8424 0.0487  -0.0401 -0.0867 289 ASP Z CB    
2264 C CG    . ASP A 289 ? 0.8027 1.5241 0.9267 0.0695  -0.0254 -0.0645 289 ASP Z CG    
2265 O OD1   . ASP A 289 ? 0.8687 1.5842 0.9653 0.1015  -0.0123 -0.0607 289 ASP Z OD1   
2266 O OD2   . ASP A 289 ? 0.8026 1.5703 0.9714 0.0538  -0.0269 -0.0506 289 ASP Z OD2   
2267 N N     . PRO A 290 ? 0.7710 1.3473 0.7518 0.1190  -0.0079 -0.0986 290 PRO Z N     
2268 C CA    . PRO A 290 ? 0.8294 1.3949 0.7739 0.1475  -0.0066 -0.0986 290 PRO Z CA    
2269 C C     . PRO A 290 ? 0.8505 1.4794 0.8232 0.1659  -0.0117 -0.0813 290 PRO Z C     
2270 O O     . PRO A 290 ? 0.8388 1.4717 0.7938 0.1813  -0.0213 -0.0819 290 PRO Z O     
2271 C CB    . PRO A 290 ? 0.8811 1.4038 0.7871 0.1676  0.0170  -0.0978 290 PRO Z CB    
2272 C CG    . PRO A 290 ? 0.8520 1.3558 0.7689 0.1461  0.0253  -0.1017 290 PRO Z CG    
2273 C CD    . PRO A 290 ? 0.8155 1.3692 0.7881 0.1231  0.0135  -0.0947 290 PRO Z CD    
2274 N N     . ILE A 291 ? 0.7561 1.4358 0.7723 0.1645  -0.0055 -0.0653 291 ILE Z N     
2275 C CA    . ILE A 291 ? 0.7211 1.4683 0.7676 0.1840  -0.0078 -0.0468 291 ILE Z CA    
2276 C C     . ILE A 291 ? 0.7888 1.5836 0.8700 0.1648  -0.0338 -0.0459 291 ILE Z C     
2277 O O     . ILE A 291 ? 0.8466 1.6652 0.9230 0.1821  -0.0443 -0.0420 291 ILE Z O     
2278 C CB    . ILE A 291 ? 0.6642 1.4556 0.7476 0.1871  0.0080  -0.0293 291 ILE Z CB    
2279 C CG1   . ILE A 291 ? 0.6756 1.4181 0.7235 0.2031  0.0333  -0.0312 291 ILE Z CG1   
2280 C CG2   . ILE A 291 ? 0.6560 1.5191 0.7682 0.2122  0.0080  -0.0099 291 ILE Z CG2   
2281 C CD1   . ILE A 291 ? 0.7352 1.5167 0.8144 0.2061  0.0504  -0.0150 291 ILE Z CD1   
2282 N N     . LYS A 292 ? 0.7102 1.5168 0.8244 0.1288  -0.0449 -0.0493 292 LYS Z N     
2283 C CA    . LYS A 292 ? 0.6348 1.4844 0.7820 0.1055  -0.0705 -0.0492 292 LYS Z CA    
2284 C C     . LYS A 292 ? 0.6370 1.4403 0.7504 0.0936  -0.0877 -0.0703 292 LYS Z C     
2285 O O     . LYS A 292 ? 0.6442 1.4761 0.7738 0.0782  -0.1103 -0.0726 292 LYS Z O     
2286 C CB    . LYS A 292 ? 0.6023 1.4794 0.7960 0.0702  -0.0759 -0.0440 292 LYS Z CB    
2287 C CG    . LYS A 292 ? 0.6498 1.5919 0.8866 0.0776  -0.0636 -0.0202 292 LYS Z CG    
2288 C CD    . LYS A 292 ? 0.7355 1.6987 1.0147 0.0400  -0.0689 -0.0147 292 LYS Z CD    
2289 C CE    . LYS A 292 ? 0.8216 1.8588 1.1462 0.0460  -0.0579 0.0106  292 LYS Z CE    
2290 N NZ    . LYS A 292 ? 0.9026 1.9289 1.2065 0.0808  -0.0294 0.0181  292 LYS Z NZ    
2291 N N     . ARG A 293 ? 0.7085 1.4421 0.7745 0.1001  -0.0769 -0.0854 293 ARG Z N     
2292 C CA    . ARG A 293 ? 0.7381 1.4238 0.7669 0.0910  -0.0896 -0.1060 293 ARG Z CA    
2293 C C     . ARG A 293 ? 0.7038 1.3900 0.7535 0.0536  -0.1102 -0.1182 293 ARG Z C     
2294 O O     . ARG A 293 ? 0.7461 1.4506 0.7986 0.0444  -0.1313 -0.1232 293 ARG Z O     
2295 C CB    . ARG A 293 ? 0.8123 1.5107 0.8188 0.1140  -0.0988 -0.1038 293 ARG Z CB    
2296 C CG    . ARG A 293 ? 0.8769 1.5565 0.8497 0.1518  -0.0791 -0.0957 293 ARG Z CG    
2297 C CD    . ARG A 293 ? 0.9365 1.6290 0.8881 0.1749  -0.0897 -0.0918 293 ARG Z CD    
2298 N NE    . ARG A 293 ? 0.9872 1.6471 0.8970 0.2103  -0.0717 -0.0867 293 ARG Z NE    
2299 C CZ    . ARG A 293 ? 1.0286 1.6885 0.9113 0.2362  -0.0768 -0.0819 293 ARG Z CZ    
2300 N NH1   . ARG A 293 ? 1.0323 1.7272 0.9270 0.2309  -0.0995 -0.0811 293 ARG Z NH1   
2301 N NH2   . ARG A 293 ? 1.0699 1.6931 0.9119 0.2671  -0.0596 -0.0775 293 ARG Z NH2   
2302 N N     . LYS A 294 ? 0.7223 1.3853 0.7839 0.0326  -0.1041 -0.1231 294 LYS Z N     
2303 C CA    . LYS A 294 ? 0.7229 1.3783 0.8019 -0.0024 -0.1220 -0.1349 294 LYS Z CA    
2304 C C     . LYS A 294 ? 0.6814 1.2888 0.7552 -0.0178 -0.1115 -0.1444 294 LYS Z C     
2305 O O     . LYS A 294 ? 0.6493 1.2475 0.7223 -0.0067 -0.0912 -0.1361 294 LYS Z O     
2306 C CB    . LYS A 294 ? 0.7182 1.4398 0.8504 -0.0206 -0.1361 -0.1196 294 LYS Z CB    
2307 C CG    . LYS A 294 ? 0.6633 1.4193 0.8317 -0.0196 -0.1206 -0.0994 294 LYS Z CG    
2308 C CD    . LYS A 294 ? 0.7468 1.5778 0.9673 -0.0351 -0.1349 -0.0820 294 LYS Z CD    
2309 C CE    . LYS A 294 ? 0.8253 1.6534 1.0608 -0.0737 -0.1607 -0.0932 294 LYS Z CE    
2310 N NZ    . LYS A 294 ? 0.8477 1.7517 1.1288 -0.0889 -0.1784 -0.0774 294 LYS Z NZ    
2311 N N     . LEU A 295 ? 0.6225 1.1991 0.6914 -0.0427 -0.1258 -0.1619 295 LEU Z N     
2312 C CA    . LEU A 295 ? 0.6317 1.1631 0.6967 -0.0575 -0.1185 -0.1714 295 LEU Z CA    
2313 C C     . LEU A 295 ? 0.6684 1.2262 0.7780 -0.0773 -0.1183 -0.1571 295 LEU Z C     
2314 O O     . LEU A 295 ? 0.7359 1.3291 0.8776 -0.0981 -0.1356 -0.1516 295 LEU Z O     
2315 C CB    . LEU A 295 ? 0.6611 1.1503 0.7049 -0.0753 -0.1339 -0.1954 295 LEU Z CB    
2316 C CG    . LEU A 295 ? 0.6685 1.1126 0.6621 -0.0598 -0.1289 -0.2133 295 LEU Z CG    
2317 C CD1   . LEU A 295 ? 0.7023 1.1088 0.6803 -0.0791 -0.1434 -0.2365 295 LEU Z CD1   
2318 C CD2   . LEU A 295 ? 0.6697 1.0828 0.6432 -0.0435 -0.1049 -0.2115 295 LEU Z CD2   
2319 N N     . ILE A 296 ? 0.6657 1.2059 0.7760 -0.0721 -0.0990 -0.1505 296 ILE Z N     
2320 C CA    . ILE A 296 ? 0.6046 1.1635 0.7530 -0.0906 -0.0964 -0.1364 296 ILE Z CA    
2321 C C     . ILE A 296 ? 0.5732 1.0804 0.7074 -0.0951 -0.0843 -0.1434 296 ILE Z C     
2322 O O     . ILE A 296 ? 0.5793 1.0485 0.6776 -0.0778 -0.0720 -0.1536 296 ILE Z O     
2323 C CB    . ILE A 296 ? 0.5159 1.1291 0.6897 -0.0757 -0.0825 -0.1118 296 ILE Z CB    
2324 C CG1   . ILE A 296 ? 0.5309 1.1256 0.6711 -0.0429 -0.0603 -0.1108 296 ILE Z CG1   
2325 C CG2   . ILE A 296 ? 0.4567 1.1310 0.6555 -0.0753 -0.0965 -0.1016 296 ILE Z CG2   
2326 C CD1   . ILE A 296 ? 0.5438 1.1857 0.7039 -0.0251 -0.0443 -0.0883 296 ILE Z CD1   
2327 N N     . PRO A 297 ? 0.5340 1.0399 0.6960 -0.1191 -0.0883 -0.1374 297 PRO Z N     
2328 C CA    . PRO A 297 ? 0.5265 0.9896 0.6783 -0.1208 -0.0754 -0.1399 297 PRO Z CA    
2329 C C     . PRO A 297 ? 0.5237 1.0026 0.6750 -0.1008 -0.0519 -0.1235 297 PRO Z C     
2330 O O     . PRO A 297 ? 0.5332 1.0606 0.7013 -0.0904 -0.0467 -0.1075 297 PRO Z O     
2331 C CB    . PRO A 297 ? 0.4715 0.9351 0.6557 -0.1520 -0.0875 -0.1343 297 PRO Z CB    
2332 C CG    . PRO A 297 ? 0.4745 0.9986 0.6938 -0.1633 -0.0989 -0.1195 297 PRO Z CG    
2333 C CD    . PRO A 297 ? 0.5154 1.0554 0.7169 -0.1472 -0.1059 -0.1285 297 PRO Z CD    
2334 N N     . LEU A 298 ? 0.5021 0.9412 0.6333 -0.0948 -0.0380 -0.1275 298 LEU Z N     
2335 C CA    . LEU A 298 ? 0.4710 0.9183 0.5963 -0.0770 -0.0158 -0.1139 298 LEU Z CA    
2336 C C     . LEU A 298 ? 0.4641 0.9569 0.6291 -0.0866 -0.0114 -0.0905 298 LEU Z C     
2337 O O     . LEU A 298 ? 0.5397 1.0658 0.7087 -0.0698 0.0029  -0.0759 298 LEU Z O     
2338 C CB    . LEU A 298 ? 0.4928 0.8903 0.5933 -0.0748 -0.0051 -0.1223 298 LEU Z CB    
2339 C CG    . LEU A 298 ? 0.4537 0.8517 0.5438 -0.0598 0.0170  -0.1101 298 LEU Z CG    
2340 C CD1   . LEU A 298 ? 0.4284 0.8424 0.4967 -0.0341 0.0280  -0.1075 298 LEU Z CD1   
2341 C CD2   . LEU A 298 ? 0.4757 0.8247 0.5403 -0.0596 0.0236  -0.1208 298 LEU Z CD2   
2342 N N     . ASN A 299 ? 0.4176 0.9106 0.6104 -0.1140 -0.0237 -0.0870 299 ASN Z N     
2343 C CA    . ASN A 299 ? 0.4158 0.9545 0.6492 -0.1287 -0.0225 -0.0643 299 ASN Z CA    
2344 C C     . ASN A 299 ? 0.5681 1.1328 0.8324 -0.1549 -0.0452 -0.0629 299 ASN Z C     
2345 O O     . ASN A 299 ? 0.6419 1.1730 0.8959 -0.1681 -0.0621 -0.0807 299 ASN Z O     
2346 C CB    . ASN A 299 ? 0.4153 0.9295 0.6541 -0.1404 -0.0137 -0.0561 299 ASN Z CB    
2347 C CG    . ASN A 299 ? 0.4008 0.8954 0.6114 -0.1170 0.0085  -0.0550 299 ASN Z CG    
2348 O OD1   . ASN A 299 ? 0.5045 1.0325 0.7211 -0.1041 0.0243  -0.0390 299 ASN Z OD1   
2349 N ND2   . ASN A 299 ? 0.4024 0.8436 0.5815 -0.1118 0.0097  -0.0720 299 ASN Z ND2   
2350 N N     . ALA A 300 ? 0.5216 1.1473 0.8227 -0.1626 -0.0453 -0.0421 300 ALA Z N     
2351 C CA    . ALA A 300 ? 0.4448 1.1022 0.7779 -0.1902 -0.0671 -0.0381 300 ALA Z CA    
2352 C C     . ALA A 300 ? 0.5138 1.1279 0.8527 -0.2223 -0.0806 -0.0438 300 ALA Z C     
2353 O O     . ALA A 300 ? 0.6080 1.1993 0.9482 -0.2279 -0.0703 -0.0361 300 ALA Z O     
2354 C CB    . ALA A 300 ? 0.4370 1.1704 0.8110 -0.1939 -0.0620 -0.0117 300 ALA Z CB    
2355 N N     . TYR A 301 ? 0.5946 1.1438 0.9437 -0.1922 -0.0421 -0.3356 301 TYR Z N     
2356 C CA    . TYR A 301 ? 0.6873 1.1988 1.0124 -0.2187 -0.0432 -0.3378 301 TYR Z CA    
2357 C C     . TYR A 301 ? 0.7851 1.3136 1.1150 -0.2543 -0.0313 -0.3334 301 TYR Z C     
2358 O O     . TYR A 301 ? 0.8547 1.4036 1.1990 -0.2682 -0.0304 -0.3338 301 TYR Z O     
2359 C CB    . TYR A 301 ? 0.7021 1.1758 1.0116 -0.2243 -0.0568 -0.3451 301 TYR Z CB    
2360 C CG    . TYR A 301 ? 0.6464 1.0965 0.9436 -0.1947 -0.0671 -0.3482 301 TYR Z CG    
2361 C CD1   . TYR A 301 ? 0.6057 1.0327 0.8917 -0.1756 -0.0634 -0.3463 301 TYR Z CD1   
2362 C CD2   . TYR A 301 ? 0.6441 1.0967 0.9411 -0.1853 -0.0804 -0.3503 301 TYR Z CD2   
2363 C CE1   . TYR A 301 ? 0.5956 0.9984 0.8710 -0.1464 -0.0707 -0.3466 301 TYR Z CE1   
2364 C CE2   . TYR A 301 ? 0.6319 1.0689 0.9187 -0.1595 -0.0888 -0.3516 301 TYR Z CE2   
2365 C CZ    . TYR A 301 ? 0.6449 1.0580 0.9232 -0.1406 -0.0841 -0.3522 301 TYR Z CZ    
2366 O OH    . TYR A 301 ? 0.6776 1.0749 0.9481 -0.1138 -0.0917 -0.3538 301 TYR Z OH    
2367 N N     . GLU A 302 ? 0.7876 1.2946 1.0976 -0.2611 -0.0194 -0.3178 302 GLU Z N     
2368 C CA    . GLU A 302 ? 0.8499 1.3642 1.1590 -0.2913 -0.0048 -0.3025 302 GLU Z CA    
2369 C C     . GLU A 302 ? 0.9429 1.4078 1.2456 -0.3168 -0.0058 -0.3020 302 GLU Z C     
2370 O O     . GLU A 302 ? 0.9854 1.4079 1.2765 -0.3103 -0.0173 -0.3143 302 GLU Z O     
2371 C CB    . GLU A 302 ? 0.8220 1.3205 1.1058 -0.2835 0.0088  -0.2739 302 GLU Z CB    
2372 C CG    . GLU A 302 ? 0.8108 1.3662 1.1027 -0.2630 0.0112  -0.2780 302 GLU Z CG    
2373 C CD    . GLU A 302 ? 0.8926 1.5278 1.2147 -0.2816 0.0191  -0.2903 302 GLU Z CD    
2374 O OE1   . GLU A 302 ? 0.9607 1.6058 1.2814 -0.3104 0.0307  -0.2760 302 GLU Z OE1   
2375 O OE2   . GLU A 302 ? 0.9015 1.5806 1.2475 -0.2640 0.0161  -0.3106 302 GLU Z OE2   
2376 N N     . ASP A 303 ? 0.9344 1.4065 1.2462 -0.3465 0.0072  -0.2888 303 ASP Z N     
2377 C CA    . ASP A 303 ? 0.9327 1.3608 1.2485 -0.3736 0.0085  -0.2905 303 ASP Z CA    
2378 C C     . ASP A 303 ? 0.9765 1.3239 1.2659 -0.3681 0.0156  -0.2723 303 ASP Z C     
2379 O O     . ASP A 303 ? 0.9791 1.2771 1.2683 -0.3812 0.0133  -0.2838 303 ASP Z O     
2380 C CB    . ASP A 303 ? 0.9603 1.4217 1.3019 -0.4066 0.0227  -0.2793 303 ASP Z CB    
2381 C CG    . ASP A 303 ? 0.9563 1.4987 1.3292 -0.4130 0.0193  -0.2970 303 ASP Z CG    
2382 O OD1   . ASP A 303 ? 0.9016 1.4547 1.2798 -0.3947 0.0024  -0.3174 303 ASP Z OD1   
2383 O OD2   . ASP A 303 ? 1.0167 1.6029 1.4027 -0.4279 0.0349  -0.2828 303 ASP Z OD2   
2384 N N     . ASP A 304 ? 1.0442 1.3808 1.3145 -0.3490 0.0245  -0.2455 304 ASP Z N     
2385 C CA    . ASP A 304 ? 1.1342 1.3975 1.3873 -0.3436 0.0339  -0.2218 304 ASP Z CA    
2386 C C     . ASP A 304 ? 1.1033 1.3211 1.3330 -0.3131 0.0239  -0.2339 304 ASP Z C     
2387 O O     . ASP A 304 ? 1.1255 1.2985 1.3403 -0.2971 0.0311  -0.2111 304 ASP Z O     
2388 C CB    . ASP A 304 ? 1.2296 1.5061 1.4766 -0.3407 0.0485  -0.1805 304 ASP Z CB    
2389 C CG    . ASP A 304 ? 1.1783 1.4979 1.4090 -0.3112 0.0424  -0.1791 304 ASP Z CG    
2390 O OD1   . ASP A 304 ? 1.1092 1.4193 1.3253 -0.2989 0.0491  -0.1482 304 ASP Z OD1   
2391 O OD2   . ASP A 304 ? 1.1898 1.5547 1.4272 -0.3007 0.0309  -0.2085 304 ASP Z OD2   
2392 N N     . VAL A 305 ? 1.0950 1.3263 1.3238 -0.3051 0.0078  -0.2668 305 VAL Z N     
2393 C CA    . VAL A 305 ? 0.9577 1.1492 1.1645 -0.2771 -0.0010 -0.2784 305 VAL Z CA    
2394 C C     . VAL A 305 ? 0.9023 1.0911 1.1080 -0.2842 -0.0156 -0.3122 305 VAL Z C     
2395 O O     . VAL A 305 ? 0.8531 1.0979 1.0778 -0.2953 -0.0270 -0.3295 305 VAL Z O     
2396 C CB    . VAL A 305 ? 0.8507 1.0794 1.0537 -0.2430 -0.0074 -0.2752 305 VAL Z CB    
2397 C CG1   . VAL A 305 ? 0.8107 1.1196 1.0393 -0.2451 -0.0175 -0.2932 305 VAL Z CG1   
2398 C CG2   . VAL A 305 ? 0.7972 0.9830 0.9803 -0.2135 -0.0144 -0.2837 305 VAL Z CG2   
2399 N N     . ASP A 306 ? 0.9320 1.0578 1.1164 -0.2785 -0.0149 -0.3211 306 ASP Z N     
2400 C CA    . ASP A 306 ? 0.8934 1.0164 1.0681 -0.2835 -0.0291 -0.3530 306 ASP Z CA    
2401 C C     . ASP A 306 ? 0.9149 1.0444 1.0709 -0.2480 -0.0403 -0.3580 306 ASP Z C     
2402 O O     . ASP A 306 ? 1.0106 1.0875 1.1450 -0.2270 -0.0327 -0.3507 306 ASP Z O     
2403 C CB    . ASP A 306 ? 1.0062 1.0601 1.1705 -0.3031 -0.0193 -0.3657 306 ASP Z CB    
2404 C CG    . ASP A 306 ? 1.1567 1.2133 1.3058 -0.3114 -0.0345 -0.4022 306 ASP Z CG    
2405 O OD1   . ASP A 306 ? 1.2396 1.3590 1.3968 -0.3146 -0.0533 -0.4154 306 ASP Z OD1   
2406 O OD2   . ASP A 306 ? 1.2074 1.2061 1.3379 -0.3153 -0.0272 -0.4178 306 ASP Z OD2   
2407 N N     . PRO A 307 ? 0.9200 1.1146 1.0901 -0.2410 -0.0573 -0.3688 307 PRO Z N     
2408 C CA    . PRO A 307 ? 0.8811 1.0933 1.0449 -0.2071 -0.0683 -0.3703 307 PRO Z CA    
2409 C C     . PRO A 307 ? 0.9170 1.0786 1.0453 -0.1980 -0.0704 -0.3824 307 PRO Z C     
2410 O O     . PRO A 307 ? 0.8838 1.0387 1.0017 -0.1662 -0.0724 -0.3763 307 PRO Z O     
2411 C CB    . PRO A 307 ? 0.8330 1.1226 1.0270 -0.2134 -0.0860 -0.3815 307 PRO Z CB    
2412 C CG    . PRO A 307 ? 0.8658 1.1833 1.0852 -0.2396 -0.0791 -0.3765 307 PRO Z CG    
2413 C CD    . PRO A 307 ? 0.8734 1.1313 1.0751 -0.2653 -0.0657 -0.3775 307 PRO Z CD    
2414 N N     . GLU A 308 ? 0.9350 1.0626 1.0476 -0.2259 -0.0684 -0.4009 308 GLU Z N     
2415 C CA    . GLU A 308 ? 0.9864 1.0690 1.0636 -0.2224 -0.0685 -0.4189 308 GLU Z CA    
2416 C C     . GLU A 308 ? 0.9943 1.0085 1.0534 -0.1984 -0.0500 -0.4040 308 GLU Z C     
2417 O O     . GLU A 308 ? 0.9797 0.9656 1.0113 -0.1807 -0.0492 -0.4119 308 GLU Z O     
2418 C CB    . GLU A 308 ? 1.0448 1.1027 1.1141 -0.2560 -0.0659 -0.4369 308 GLU Z CB    
2419 C CG    . GLU A 308 ? 1.1818 1.1992 1.2124 -0.2519 -0.0647 -0.4528 308 GLU Z CG    
2420 C CD    . GLU A 308 ? 1.3600 1.3600 1.3892 -0.2835 -0.0628 -0.4711 308 GLU Z CD    
2421 O OE1   . GLU A 308 ? 1.4107 1.4255 1.4707 -0.3080 -0.0616 -0.4698 308 GLU Z OE1   
2422 O OE2   . GLU A 308 ? 1.4597 1.4330 1.4589 -0.2837 -0.0618 -0.4878 308 GLU Z OE2   
2423 N N     . THR A 309 ? 0.9164 0.9072 0.9919 -0.1980 -0.0351 -0.3806 309 THR Z N     
2424 C CA    . THR A 309 ? 0.9386 0.8657 1.0040 -0.1771 -0.0178 -0.3624 309 THR Z CA    
2425 C C     . THR A 309 ? 0.9381 0.8882 1.0103 -0.1406 -0.0204 -0.3394 309 THR Z C     
2426 O O     . THR A 309 ? 0.9524 0.8637 1.0260 -0.1247 -0.0077 -0.3174 309 THR Z O     
2427 C CB    . THR A 309 ? 0.9957 0.8815 1.0778 -0.1973 0.0005  -0.3453 309 THR Z CB    
2428 O OG1   . THR A 309 ? 0.9852 0.9207 1.0907 -0.2017 -0.0017 -0.3236 309 THR Z OG1   
2429 C CG2   . THR A 309 ? 0.8619 0.7242 0.9477 -0.2344 0.0052  -0.3698 309 THR Z CG2   
2430 N N     . LEU A 310 ? 0.8690 0.8834 0.9510 -0.1278 -0.0369 -0.3443 310 LEU Z N     
2431 C CA    . LEU A 310 ? 0.8170 0.8610 0.9158 -0.0951 -0.0392 -0.3269 310 LEU Z CA    
2432 C C     . LEU A 310 ? 0.8122 0.8637 0.9044 -0.0643 -0.0472 -0.3316 310 LEU Z C     
2433 O O     . LEU A 310 ? 0.7792 0.8857 0.8980 -0.0457 -0.0568 -0.3279 310 LEU Z O     
2434 C CB    . LEU A 310 ? 0.7628 0.8821 0.8951 -0.1036 -0.0474 -0.3250 310 LEU Z CB    
2435 C CG    . LEU A 310 ? 0.7089 0.8323 0.8507 -0.1317 -0.0383 -0.3156 310 LEU Z CG    
2436 C CD1   . LEU A 310 ? 0.6993 0.9013 0.8743 -0.1368 -0.0444 -0.3163 310 LEU Z CD1   
2437 C CD2   . LEU A 310 ? 0.6284 0.7023 0.7613 -0.1227 -0.0227 -0.2910 310 LEU Z CD2   
2438 N N     . SER A 311 ? 0.8746 0.8722 0.9354 -0.0591 -0.0416 -0.3395 311 SER Z N     
2439 C CA    . SER A 311 ? 0.8264 0.8288 0.8774 -0.0298 -0.0469 -0.3408 311 SER Z CA    
2440 C C     . SER A 311 ? 0.7495 0.7381 0.8171 0.0073  -0.0392 -0.3195 311 SER Z C     
2441 O O     . SER A 311 ? 0.7199 0.7399 0.8032 0.0349  -0.0459 -0.3141 311 SER Z O     
2442 C CB    . SER A 311 ? 0.8239 0.7736 0.8334 -0.0366 -0.0403 -0.3579 311 SER Z CB    
2443 O OG    . SER A 311 ? 0.8901 0.7647 0.8883 -0.0400 -0.0201 -0.3540 311 SER Z OG    
2444 N N     . TYR A 312 ? 0.7646 0.7082 0.8330 0.0077  -0.0253 -0.3060 312 TYR Z N     
2445 C CA    . TYR A 312 ? 0.6085 0.5363 0.6928 0.0407  -0.0184 -0.2865 312 TYR Z CA    
2446 C C     . TYR A 312 ? 0.6251 0.6230 0.7487 0.0534  -0.0282 -0.2806 312 TYR Z C     
2447 O O     . TYR A 312 ? 0.7072 0.7122 0.8526 0.0844  -0.0270 -0.2709 312 TYR Z O     
2448 C CB    . TYR A 312 ? 0.6347 0.5058 0.7144 0.0350  -0.0034 -0.2703 312 TYR Z CB    
2449 C CG    . TYR A 312 ? 0.7308 0.6164 0.8159 0.0019  -0.0026 -0.2667 312 TYR Z CG    
2450 C CD1   . TYR A 312 ? 0.6705 0.6117 0.7796 0.0001  -0.0080 -0.2562 312 TYR Z CD1   
2451 C CD2   . TYR A 312 ? 0.7053 0.5502 0.7744 -0.0281 0.0054  -0.2745 312 TYR Z CD2   
2452 C CE1   . TYR A 312 ? 0.6822 0.6394 0.7953 -0.0302 -0.0056 -0.2502 312 TYR Z CE1   
2453 C CE2   . TYR A 312 ? 0.7211 0.5792 0.8004 -0.0579 0.0078  -0.2679 312 TYR Z CE2   
2454 C CZ    . TYR A 312 ? 0.7281 0.6431 0.8275 -0.0585 0.0022  -0.2539 312 TYR Z CZ    
2455 O OH    . TYR A 312 ? 0.8752 0.8064 0.9837 -0.0881 0.0061  -0.2448 312 TYR Z OH    
2456 N N     . ALA A 313 ? 0.6850 0.7882 0.7626 -0.3867 0.0117  0.1151  313 ALA Z N     
2457 C CA    . ALA A 313 ? 0.6991 0.8192 0.7570 -0.3947 -0.0020 0.1100  313 ALA Z CA    
2458 C C     . ALA A 313 ? 0.7348 0.8749 0.7788 -0.3979 -0.0054 0.0998  313 ALA Z C     
2459 O O     . ALA A 313 ? 0.7549 0.9092 0.7806 -0.3915 -0.0150 0.0874  313 ALA Z O     
2460 C CB    . ALA A 313 ? 0.6323 0.7816 0.6783 -0.4086 -0.0026 0.0910  313 ALA Z CB    
2461 N N     . GLY A 314 ? 0.7663 0.8954 0.8117 -0.3786 0.0029  0.0969  314 GLY Z N     
2462 C CA    . GLY A 314 ? 0.7430 0.8768 0.7681 -0.3490 -0.0017 0.0806  314 GLY Z CA    
2463 C C     . GLY A 314 ? 0.7168 0.8738 0.7320 -0.3407 0.0032  0.0533  314 GLY Z C     
2464 O O     . GLY A 314 ? 0.6731 0.8636 0.6918 -0.3562 0.0041  0.0348  314 GLY Z O     
2465 N N     . GLN A 315 ? 0.7864 0.9235 0.7876 -0.3172 0.0057  0.0518  315 GLN Z N     
2466 C CA    . GLN A 315 ? 0.7909 0.9418 0.7762 -0.3087 0.0068  0.0277  315 GLN Z CA    
2467 C C     . GLN A 315 ? 0.6860 0.8699 0.6564 -0.2896 -0.0090 0.0036  315 GLN Z C     
2468 O O     . GLN A 315 ? 0.8006 0.9755 0.7625 -0.2711 -0.0171 0.0090  315 GLN Z O     
2469 C CB    . GLN A 315 ? 0.9747 1.0806 0.9459 -0.2943 0.0188  0.0391  315 GLN Z CB    
2470 C CG    . GLN A 315 ? 1.1084 1.2173 1.0519 -0.2835 0.0170  0.0158  315 GLN Z CG    
2471 C CD    . GLN A 315 ? 1.1758 1.2336 1.0942 -0.2647 0.0287  0.0271  315 GLN Z CD    
2472 O OE1   . GLN A 315 ? 1.2751 1.3012 1.1889 -0.2720 0.0468  0.0336  315 GLN Z OE1   
2473 N NE2   . GLN A 315 ? 1.1146 1.1615 1.0150 -0.2403 0.0201  0.0298  315 GLN Z NE2   
2474 N N     . TYR A 316 ? 0.7800 1.0019 0.7503 -0.2944 -0.0141 -0.0221 316 TYR Z N     
2475 C CA    . TYR A 316 ? 0.7982 1.0549 0.7619 -0.2755 -0.0296 -0.0447 316 TYR Z CA    
2476 C C     . TYR A 316 ? 0.8502 1.0833 0.7866 -0.2487 -0.0373 -0.0477 316 TYR Z C     
2477 O O     . TYR A 316 ? 0.9611 1.1649 0.8804 -0.2496 -0.0308 -0.0448 316 TYR Z O     
2478 C CB    . TYR A 316 ? 0.8016 1.1093 0.7810 -0.2905 -0.0336 -0.0692 316 TYR Z CB    
2479 C CG    . TYR A 316 ? 0.7815 1.1257 0.7841 -0.3089 -0.0299 -0.0739 316 TYR Z CG    
2480 C CD1   . TYR A 316 ? 0.7500 1.0964 0.7663 -0.3395 -0.0182 -0.0675 316 TYR Z CD1   
2481 C CD2   . TYR A 316 ? 0.8050 1.1783 0.8129 -0.2957 -0.0368 -0.0849 316 TYR Z CD2   
2482 C CE1   . TYR A 316 ? 0.7465 1.1223 0.7778 -0.3577 -0.0137 -0.0715 316 TYR Z CE1   
2483 C CE2   . TYR A 316 ? 0.7447 1.1468 0.7677 -0.3129 -0.0300 -0.0901 316 TYR Z CE2   
2484 C CZ    . TYR A 316 ? 0.8372 1.2401 0.8700 -0.3445 -0.0186 -0.0832 316 TYR Z CZ    
2485 O OH    . TYR A 316 ? 0.8132 1.2406 0.8551 -0.3630 -0.0108 -0.0878 316 TYR Z OH    
2486 N N     . VAL A 317 ? 0.7800 1.0224 0.7090 -0.2249 -0.0506 -0.0536 317 VAL Z N     
2487 C CA    . VAL A 317 ? 0.8327 1.0591 0.7344 -0.1993 -0.0621 -0.0593 317 VAL Z CA    
2488 C C     . VAL A 317 ? 0.9253 1.2004 0.8363 -0.1851 -0.0814 -0.0828 317 VAL Z C     
2489 O O     . VAL A 317 ? 0.9274 1.2449 0.8660 -0.1936 -0.0817 -0.0930 317 VAL Z O     
2490 C CB    . VAL A 317 ? 0.7807 0.9588 0.6626 -0.1792 -0.0595 -0.0379 317 VAL Z CB    
2491 C CG1   . VAL A 317 ? 0.7921 0.9242 0.6728 -0.1918 -0.0392 -0.0130 317 VAL Z CG1   
2492 C CG2   . VAL A 317 ? 0.7569 0.9470 0.6511 -0.1709 -0.0658 -0.0345 317 VAL Z CG2   
2493 N N     . ASP A 318 ? 0.9117 1.1798 0.8002 -0.1637 -0.0968 -0.0906 318 ASP Z N     
2494 C CA    . ASP A 318 ? 0.8573 1.1711 0.7596 -0.1477 -0.1173 -0.1106 318 ASP Z CA    
2495 C C     . ASP A 318 ? 0.8605 1.1845 0.7757 -0.1310 -0.1189 -0.1085 318 ASP Z C     
2496 O O     . ASP A 318 ? 0.7987 1.0811 0.6960 -0.1211 -0.1132 -0.0907 318 ASP Z O     
2497 C CB    . ASP A 318 ? 0.8691 1.1647 0.7396 -0.1277 -0.1363 -0.1154 318 ASP Z CB    
2498 C CG    . ASP A 318 ? 0.8446 1.1933 0.7373 -0.1155 -0.1605 -0.1362 318 ASP Z CG    
2499 O OD1   . ASP A 318 ? 0.8193 1.2061 0.7326 -0.1325 -0.1667 -0.1510 318 ASP Z OD1   
2500 O OD2   . ASP A 318 ? 0.8462 1.1987 0.7390 -0.0890 -0.1735 -0.1370 318 ASP Z OD2   
2501 N N     . ASP A 319 ? 0.8145 1.1928 0.7617 -0.1284 -0.1255 -0.1266 319 ASP Z N     
2502 C CA    . ASP A 319 ? 0.8446 1.2337 0.8042 -0.1154 -0.1232 -0.1279 319 ASP Z CA    
2503 C C     . ASP A 319 ? 0.8169 1.1733 0.7526 -0.0834 -0.1354 -0.1205 319 ASP Z C     
2504 O O     . ASP A 319 ? 0.7818 1.1197 0.7125 -0.0750 -0.1305 -0.1132 319 ASP Z O     
2505 C CB    . ASP A 319 ? 0.8873 1.3419 0.8875 -0.1153 -0.1261 -0.1505 319 ASP Z CB    
2506 C CG    . ASP A 319 ? 0.8780 1.3628 0.9021 -0.1481 -0.1097 -0.1559 319 ASP Z CG    
2507 O OD1   . ASP A 319 ? 0.7697 1.2231 0.7797 -0.1690 -0.0952 -0.1408 319 ASP Z OD1   
2508 O OD2   . ASP A 319 ? 0.9526 1.4931 1.0123 -0.1533 -0.1116 -0.1739 319 ASP Z OD2   
2509 N N     . SER A 320 ? 0.8309 1.1766 0.7484 -0.0670 -0.1523 -0.1222 320 SER Z N     
2510 C CA    . SER A 320 ? 0.8372 1.1495 0.7289 -0.0368 -0.1652 -0.1145 320 SER Z CA    
2511 C C     . SER A 320 ? 0.8128 1.0620 0.6723 -0.0389 -0.1523 -0.0898 320 SER Z C     
2512 O O     . SER A 320 ? 0.8200 1.0415 0.6678 -0.0220 -0.1538 -0.0796 320 SER Z O     
2513 C CB    . SER A 320 ? 0.8923 1.2060 0.7677 -0.0218 -0.1880 -0.1214 320 SER Z CB    
2514 O OG    . SER A 320 ? 0.9312 1.2205 0.7817 -0.0398 -0.1836 -0.1165 320 SER Z OG    
2515 N N     . ILE A 321 ? 0.7924 1.0189 0.6408 -0.0601 -0.1391 -0.0795 321 ILE Z N     
2516 C CA    . ILE A 321 ? 0.8431 1.0136 0.6703 -0.0638 -0.1245 -0.0544 321 ILE Z CA    
2517 C C     . ILE A 321 ? 0.7958 0.9646 0.6423 -0.0755 -0.1134 -0.0440 321 ILE Z C     
2518 O O     . ILE A 321 ? 0.8082 0.9390 0.6431 -0.0672 -0.1112 -0.0259 321 ILE Z O     
2519 C CB    . ILE A 321 ? 0.9229 1.0707 0.7385 -0.0832 -0.1103 -0.0466 321 ILE Z CB    
2520 C CG1   . ILE A 321 ? 0.9586 1.1010 0.7456 -0.0734 -0.1229 -0.0577 321 ILE Z CG1   
2521 C CG2   . ILE A 321 ? 0.9543 1.0466 0.7562 -0.0852 -0.0932 -0.0188 321 ILE Z CG2   
2522 C CD1   . ILE A 321 ? 0.9454 1.0609 0.7143 -0.0917 -0.1082 -0.0533 321 ILE Z CD1   
2523 N N     . ALA A 322 ? 0.7884 0.9968 0.6624 -0.0961 -0.1075 -0.0551 322 ALA Z N     
2524 C CA    . ALA A 322 ? 0.7624 0.9695 0.6492 -0.1102 -0.0989 -0.0474 322 ALA Z CA    
2525 C C     . ALA A 322 ? 0.7744 0.9795 0.6558 -0.0886 -0.1083 -0.0520 322 ALA Z C     
2526 O O     . ALA A 322 ? 0.7522 0.9279 0.6264 -0.0920 -0.1054 -0.0376 322 ALA Z O     
2527 C CB    . ALA A 322 ? 0.7380 0.9890 0.6504 -0.1350 -0.0911 -0.0611 322 ALA Z CB    
2528 N N     . LEU A 323 ? 0.7765 1.0116 0.6622 -0.0667 -0.1206 -0.0717 323 LEU Z N     
2529 C CA    . LEU A 323 ? 0.7738 1.0055 0.6547 -0.0420 -0.1295 -0.0774 323 LEU Z CA    
2530 C C     . LEU A 323 ? 0.7971 0.9724 0.6483 -0.0247 -0.1357 -0.0571 323 LEU Z C     
2531 O O     . LEU A 323 ? 0.9564 1.1049 0.7979 -0.0190 -0.1360 -0.0491 323 LEU Z O     
2532 C CB    . LEU A 323 ? 0.7757 1.0527 0.6738 -0.0206 -0.1426 -0.1007 323 LEU Z CB    
2533 C CG    . LEU A 323 ? 0.7964 1.0694 0.6918 0.0102  -0.1529 -0.1074 323 LEU Z CG    
2534 C CD1   . LEU A 323 ? 0.7942 1.0636 0.6924 0.0031  -0.1401 -0.1102 323 LEU Z CD1   
2535 C CD2   . LEU A 323 ? 0.8041 1.1272 0.7262 0.0301  -0.1667 -0.1284 323 LEU Z CD2   
2536 N N     . GLN A 324 ? 0.7978 0.9526 0.6322 -0.0176 -0.1401 -0.0487 324 GLN Z N     
2537 C CA    . GLN A 324 ? 0.8202 0.9209 0.6257 -0.0012 -0.1438 -0.0287 324 GLN Z CA    
2538 C C     . GLN A 324 ? 0.8108 0.8712 0.6139 -0.0186 -0.1306 -0.0032 324 GLN Z C     
2539 O O     . GLN A 324 ? 0.8260 0.8466 0.6141 -0.0073 -0.1338 0.0127  324 GLN Z O     
2540 C CB    . GLN A 324 ? 0.8516 0.9356 0.6343 0.0069  -0.1477 -0.0253 324 GLN Z CB    
2541 C CG    . GLN A 324 ? 0.8613 0.9731 0.6401 0.0291  -0.1682 -0.0450 324 GLN Z CG    
2542 C CD    . GLN A 324 ? 0.8771 0.9858 0.6543 0.0566  -0.1824 -0.0486 324 GLN Z CD    
2543 O OE1   . GLN A 324 ? 0.8923 0.9555 0.6484 0.0675  -0.1819 -0.0316 324 GLN Z OE1   
2544 N NE2   . GLN A 324 ? 0.8752 1.0323 0.6775 0.0680  -0.1944 -0.0705 324 GLN Z NE2   
2545 N N     . ILE A 325 ? 0.7952 0.8657 0.6155 -0.0466 -0.1172 0.0016  325 ILE Z N     
2546 C CA    . ILE A 325 ? 0.8337 0.8724 0.6605 -0.0661 -0.1071 0.0265  325 ILE Z CA    
2547 C C     . ILE A 325 ? 0.8231 0.8620 0.6531 -0.0707 -0.1125 0.0251  325 ILE Z C     
2548 O O     . ILE A 325 ? 0.8334 0.8335 0.6560 -0.0710 -0.1152 0.0450  325 ILE Z O     
2549 C CB    . ILE A 325 ? 0.8273 0.8781 0.6736 -0.0950 -0.0927 0.0319  325 ILE Z CB    
2550 C CG1   . ILE A 325 ? 0.7779 0.8106 0.6152 -0.0925 -0.0833 0.0393  325 ILE Z CG1   
2551 C CG2   . ILE A 325 ? 0.7507 0.7778 0.6108 -0.1169 -0.0869 0.0558  325 ILE Z CG2   
2552 C CD1   . ILE A 325 ? 0.7540 0.7913 0.6101 -0.1193 -0.0675 0.0463  325 ILE Z CD1   
2553 N N     . ALA A 326 ? 0.8158 0.8966 0.6556 -0.0749 -0.1135 0.0015  326 ALA Z N     
2554 C CA    . ALA A 326 ? 0.8060 0.8863 0.6428 -0.0804 -0.1155 -0.0039 326 ALA Z CA    
2555 C C     . ALA A 326 ? 0.8671 0.9187 0.6836 -0.0545 -0.1267 -0.0035 326 ALA Z C     
2556 O O     . ALA A 326 ? 0.8692 0.8911 0.6732 -0.0607 -0.1296 0.0053  326 ALA Z O     
2557 C CB    . ALA A 326 ? 0.7699 0.9022 0.6211 -0.0858 -0.1106 -0.0313 326 ALA Z CB    
2558 N N     . LEU A 327 ? 0.7863 0.9704 0.5963 0.0272  -0.1483 -0.0452 327 LEU Z N     
2559 C CA    . LEU A 327 ? 0.8839 1.0437 0.6837 0.0420  -0.1947 -0.0510 327 LEU Z CA    
2560 C C     . LEU A 327 ? 0.9077 1.0219 0.7109 0.0289  -0.2024 -0.0219 327 LEU Z C     
2561 O O     . LEU A 327 ? 0.9606 1.0441 0.7553 0.0362  -0.2416 -0.0202 327 LEU Z O     
2562 C CB    . LEU A 327 ? 0.9040 1.0666 0.6867 0.0432  -0.2113 -0.0679 327 LEU Z CB    
2563 C CG    . LEU A 327 ? 0.8760 1.0972 0.6656 0.0580  -0.2115 -0.0969 327 LEU Z CG    
2564 C CD1   . LEU A 327 ? 0.8866 1.1147 0.6655 0.0582  -0.2342 -0.1072 327 LEU Z CD1   
2565 C CD2   . LEU A 327 ? 0.8498 1.0918 0.6473 0.0918  -0.2332 -0.1158 327 LEU Z CD2   
2566 N N     . GLY A 328 ? 0.8706 0.9799 0.6875 0.0092  -0.1633 0.0011  328 GLY Z N     
2567 C CA    . GLY A 328 ? 0.8763 0.9583 0.7074 -0.0045 -0.1622 0.0311  328 GLY Z CA    
2568 C C     . GLY A 328 ? 0.9389 0.9882 0.7449 -0.0232 -0.1583 0.0369  328 GLY Z C     
2569 O O     . GLY A 328 ? 0.9794 1.0081 0.7942 -0.0382 -0.1554 0.0621  328 GLY Z O     
2570 N N     . ASN A 329 ? 0.8842 0.9335 0.6587 -0.0250 -0.1587 0.0154  329 ASN Z N     
2571 C CA    . ASN A 329 ? 0.9290 0.9463 0.6667 -0.0451 -0.1588 0.0196  329 ASN Z CA    
2572 C C     . ASN A 329 ? 0.9903 0.9946 0.7218 -0.0691 -0.1038 0.0334  329 ASN Z C     
2573 O O     . ASN A 329 ? 1.1043 1.0778 0.8129 -0.0886 -0.0964 0.0492  329 ASN Z O     
2574 C CB    . ASN A 329 ? 0.9437 0.9741 0.6525 -0.0409 -0.1787 -0.0063 329 ASN Z CB    
2575 C CG    . ASN A 329 ? 0.9669 1.0016 0.6781 -0.0123 -0.2337 -0.0198 329 ASN Z CG    
2576 O OD1   . ASN A 329 ? 1.0011 1.0053 0.7157 -0.0036 -0.2632 -0.0084 329 ASN Z OD1   
2577 N ND2   . ASN A 329 ? 0.8664 0.9386 0.5770 0.0022  -0.2470 -0.0444 329 ASN Z ND2   
2578 N N     . LYS A 330 ? 0.9574 0.9808 0.7055 -0.0672 -0.0633 0.0273  330 LYS Z N     
2579 C CA    . LYS A 330 ? 0.9097 0.9127 0.6513 -0.0837 -0.0064 0.0364  330 LYS Z CA    
2580 C C     . LYS A 330 ? 0.8237 0.8371 0.6192 -0.0726 0.0194  0.0635  330 LYS Z C     
2581 O O     . LYS A 330 ? 0.8059 0.8464 0.6378 -0.0546 0.0137  0.0671  330 LYS Z O     
2582 C CB    . LYS A 330 ? 0.8918 0.8957 0.6110 -0.0919 0.0241  0.0134  330 LYS Z CB    
2583 C CG    . LYS A 330 ? 0.9977 0.9662 0.7025 -0.1060 0.0863  0.0174  330 LYS Z CG    
2584 C CD    . LYS A 330 ? 1.0604 1.0159 0.7282 -0.1229 0.1097  -0.0085 330 LYS Z CD    
2585 C CE    . LYS A 330 ? 1.1060 1.0544 0.7154 -0.1485 0.0846  -0.0295 330 LYS Z CE    
2586 N NZ    . LYS A 330 ? 1.2072 1.1122 0.7706 -0.1678 0.1012  -0.0231 330 LYS Z NZ    
2587 N N     . ASP A 331 ? 0.9030 0.8997 0.7043 -0.0837 0.0472  0.0843  331 ASP Z N     
2588 C CA    . ASP A 331 ? 0.9632 0.9804 0.8262 -0.0726 0.0725  0.1141  331 ASP Z CA    
2589 C C     . ASP A 331 ? 1.0121 1.0286 0.8937 -0.0590 0.1217  0.1122  331 ASP Z C     
2590 O O     . ASP A 331 ? 1.0381 1.0219 0.8760 -0.0684 0.1559  0.0913  331 ASP Z O     
2591 C CB    . ASP A 331 ? 1.0104 1.0179 0.8776 -0.0889 0.0974  0.1360  331 ASP Z CB    
2592 C CG    . ASP A 331 ? 1.0983 1.1433 1.0441 -0.0764 0.1201  0.1704  331 ASP Z CG    
2593 O OD1   . ASP A 331 ? 1.1752 1.2196 1.1433 -0.0660 0.1782  0.1770  331 ASP Z OD1   
2594 O OD2   . ASP A 331 ? 1.0698 1.1444 1.0559 -0.0768 0.0786  0.1911  331 ASP Z OD2   
2595 N N     . ILE A 332 ? 0.9798 1.0278 0.9226 -0.0387 0.1227  0.1356  332 ILE Z N     
2596 C CA    . ILE A 332 ? 1.0325 1.0759 0.9956 -0.0216 0.1622  0.1394  332 ILE Z CA    
2597 C C     . ILE A 332 ? 1.2029 1.2120 1.1642 -0.0202 0.2296  0.1427  332 ILE Z C     
2598 O O     . ILE A 332 ? 1.3521 1.3195 1.2760 -0.0223 0.2649  0.1229  332 ILE Z O     
2599 C CB    . ILE A 332 ? 0.9636 1.0506 0.9950 0.0003  0.1444  0.1713  332 ILE Z CB    
2600 C CG1   . ILE A 332 ? 0.8589 0.9709 0.8799 -0.0001 0.0826  0.1624  332 ILE Z CG1   
2601 C CG2   . ILE A 332 ? 0.9981 1.0729 1.0505 0.0202  0.1861  0.1820  332 ILE Z CG2   
2602 C CD1   . ILE A 332 ? 0.7741 0.8709 0.7412 -0.0049 0.0757  0.1279  332 ILE Z CD1   
2603 N N     . ASN A 333 ? 1.1481 1.1736 1.1480 -0.0180 0.2491  0.1664  333 ASN Z N     
2604 C CA    . ASN A 333 ? 1.1561 1.1566 1.1656 -0.0087 0.3192  0.1718  333 ASN Z CA    
2605 C C     . ASN A 333 ? 1.2696 1.2166 1.1974 -0.0350 0.3504  0.1423  333 ASN Z C     
2606 O O     . ASN A 333 ? 1.3400 1.2333 1.2262 -0.0344 0.4003  0.1215  333 ASN Z O     
2607 C CB    . ASN A 333 ? 1.1391 1.1935 1.2322 0.0045  0.3305  0.2112  333 ASN Z CB    
2608 C CG    . ASN A 333 ? 1.0900 1.2043 1.2544 0.0190  0.2804  0.2414  333 ASN Z CG    
2609 O OD1   . ASN A 333 ? 1.0092 1.1516 1.1761 0.0018  0.2244  0.2472  333 ASN Z OD1   
2610 N ND2   . ASN A 333 ? 1.1097 1.2371 1.3259 0.0499  0.2981  0.2607  333 ASN Z ND2   
2611 N N     . THR A 334 ? 1.2038 1.1598 1.1026 -0.0600 0.3186  0.1413  334 THR Z N     
2612 C CA    . THR A 334 ? 1.2748 1.1844 1.0919 -0.0884 0.3423  0.1193  334 THR Z CA    
2613 C C     . THR A 334 ? 1.2137 1.0840 0.9504 -0.1082 0.3182  0.0828  334 THR Z C     
2614 O O     . THR A 334 ? 1.3007 1.1252 0.9601 -0.1330 0.3404  0.0605  334 THR Z O     
2615 C CB    . THR A 334 ? 1.3447 1.2742 1.1555 -0.1108 0.3141  0.1371  334 THR Z CB    
2616 O OG1   . THR A 334 ? 1.3162 1.2632 1.1246 -0.1169 0.2389  0.1371  334 THR Z OG1   
2617 C CG2   . THR A 334 ? 1.3920 1.3716 1.2884 -0.0980 0.3382  0.1753  334 THR Z CG2   
2618 N N     . PHE A 335 ? 1.1665 1.0605 0.9212 -0.0996 0.2713  0.0779  335 PHE Z N     
2619 C CA    . PHE A 335 ? 1.1257 1.0033 0.8217 -0.1170 0.2428  0.0470  335 PHE Z CA    
2620 C C     . PHE A 335 ? 1.1572 1.0266 0.7972 -0.1424 0.2071  0.0385  335 PHE Z C     
2621 O O     . PHE A 335 ? 1.2223 1.0692 0.7998 -0.1641 0.1985  0.0136  335 PHE Z O     
2622 C CB    . PHE A 335 ? 1.1243 0.9513 0.7735 -0.1277 0.2918  0.0223  335 PHE Z CB    
2623 C CG    . PHE A 335 ? 1.0809 0.9163 0.7431 -0.1209 0.2815  0.0117  335 PHE Z CG    
2624 C CD1   . PHE A 335 ? 1.0087 0.8727 0.7386 -0.0915 0.2814  0.0338  335 PHE Z CD1   
2625 C CD2   . PHE A 335 ? 1.0992 0.9189 0.7059 -0.1472 0.2696  -0.0178 335 PHE Z CD2   
2626 C CE1   . PHE A 335 ? 0.9852 0.8561 0.7208 -0.0885 0.2733  0.0268  335 PHE Z CE1   
2627 C CE2   . PHE A 335 ? 1.0508 0.8837 0.6705 -0.1456 0.2626  -0.0255 335 PHE Z CE2   
2628 C CZ    . PHE A 335 ? 0.9936 0.8496 0.6749 -0.1162 0.2659  -0.0031 335 PHE Z CZ    
2629 N N     . GLU A 336 ? 1.1250 1.0140 0.7895 -0.1408 0.1816  0.0624  336 GLU Z N     
2630 C CA    . GLU A 336 ? 1.1654 1.0384 0.7765 -0.1644 0.1488  0.0632  336 GLU Z CA    
2631 C C     . GLU A 336 ? 1.0990 0.9963 0.7243 -0.1552 0.0759  0.0644  336 GLU Z C     
2632 O O     . GLU A 336 ? 1.0998 1.0276 0.7850 -0.1343 0.0537  0.0780  336 GLU Z O     
2633 C CB    . GLU A 336 ? 1.2906 1.1593 0.9116 -0.1744 0.1754  0.0913  336 GLU Z CB    
2634 C CG    . GLU A 336 ? 1.4313 1.2885 1.0152 -0.1960 0.1297  0.1056  336 GLU Z CG    
2635 C CD    . GLU A 336 ? 1.4770 1.3485 1.0982 -0.2043 0.1469  0.1410  336 GLU Z CD    
2636 O OE1   . GLU A 336 ? 1.5308 1.3792 1.1048 -0.2314 0.1313  0.1551  336 GLU Z OE1   
2637 O OE2   . GLU A 336 ? 1.3833 1.2925 1.0827 -0.1853 0.1744  0.1573  336 GLU Z OE2   
2638 N N     . GLN A 337 ? 1.0696 0.9519 0.6382 -0.1695 0.0381  0.0498  337 GLN Z N     
2639 C CA    . GLN A 337 ? 1.0669 0.9645 0.6456 -0.1558 -0.0298 0.0502  337 GLN Z CA    
2640 C C     . GLN A 337 ? 1.1651 1.0505 0.7593 -0.1577 -0.0552 0.0797  337 GLN Z C     
2641 O O     . GLN A 337 ? 1.2982 1.1515 0.8473 -0.1820 -0.0555 0.0943  337 GLN Z O     
2642 C CB    . GLN A 337 ? 1.0161 0.9022 0.5345 -0.1688 -0.0646 0.0328  337 GLN Z CB    
2643 C CG    . GLN A 337 ? 1.0876 0.9949 0.5963 -0.1712 -0.0515 0.0035  337 GLN Z CG    
2644 C CD    . GLN A 337 ? 1.0295 0.9846 0.5953 -0.1411 -0.0730 -0.0085 337 GLN Z CD    
2645 O OE1   . GLN A 337 ? 0.9979 0.9723 0.5801 -0.1404 -0.0432 -0.0229 337 GLN Z OE1   
2646 N NE2   . GLN A 337 ? 0.9721 0.9410 0.5624 -0.1172 -0.1236 -0.0032 337 GLN Z NE2   
2647 N N     . ILE A 338 ? 1.1179 1.0267 0.7702 -0.1365 -0.0776 0.0889  338 ILE Z N     
2648 C CA    . ILE A 338 ? 1.1053 1.0022 0.7764 -0.1432 -0.1037 0.1170  338 ILE Z CA    
2649 C C     . ILE A 338 ? 1.1215 1.0018 0.7842 -0.1286 -0.1731 0.1110  338 ILE Z C     
2650 O O     . ILE A 338 ? 1.1794 1.0352 0.8454 -0.1376 -0.2040 0.1319  338 ILE Z O     
2651 C CB    . ILE A 338 ? 1.0422 0.9737 0.7846 -0.1353 -0.0799 0.1360  338 ILE Z CB    
2652 C CG1   . ILE A 338 ? 1.0283 0.9915 0.8067 -0.1058 -0.0946 0.1182  338 ILE Z CG1   
2653 C CG2   . ILE A 338 ? 0.9213 0.8640 0.6772 -0.1448 -0.0094 0.1460  338 ILE Z CG2   
2654 C CD1   . ILE A 338 ? 1.0821 1.0827 0.9280 -0.0965 -0.0744 0.1383  338 ILE Z CD1   
2655 N N     . ASP A 339 ? 1.1006 0.9934 0.7529 -0.1065 -0.1953 0.0823  339 ASP Z N     
2656 C CA    . ASP A 339 ? 1.0685 0.9466 0.7135 -0.0842 -0.2556 0.0712  339 ASP Z CA    
2657 C C     . ASP A 339 ? 1.0645 0.9615 0.6886 -0.0678 -0.2708 0.0433  339 ASP Z C     
2658 O O     . ASP A 339 ? 1.0299 0.9559 0.6506 -0.0754 -0.2358 0.0302  339 ASP Z O     
2659 C CB    . ASP A 339 ? 1.1604 1.0566 0.8503 -0.0617 -0.2718 0.0661  339 ASP Z CB    
2660 C CG    . ASP A 339 ? 1.3604 1.2170 1.0365 -0.0453 -0.3317 0.0622  339 ASP Z CG    
2661 O OD1   . ASP A 339 ? 1.4384 1.2503 1.1035 -0.0641 -0.3527 0.0861  339 ASP Z OD1   
2662 O OD2   . ASP A 339 ? 1.4540 1.3222 1.1299 -0.0136 -0.3566 0.0349  339 ASP Z OD2   
2663 N N     . ASP A 340 ? 1.0653 1.5772 1.5564 0.1478  -0.1298 0.2908  340 ASP Z N     
2664 C CA    . ASP A 340 ? 1.0649 1.5898 1.5604 0.1503  -0.1296 0.2905  340 ASP Z CA    
2665 C C     . ASP A 340 ? 1.0672 1.5894 1.5665 0.1594  -0.1292 0.2857  340 ASP Z C     
2666 O O     . ASP A 340 ? 1.0686 1.6017 1.5738 0.1631  -0.1307 0.2860  340 ASP Z O     
2667 C CB    . ASP A 340 ? 1.0706 1.6025 1.5698 0.1495  -0.1371 0.2992  340 ASP Z CB    
2668 C CG    . ASP A 340 ? 1.0804 1.5958 1.5808 0.1538  -0.1441 0.3048  340 ASP Z CG    
2669 O OD1   . ASP A 340 ? 1.0850 1.5995 1.5830 0.1480  -0.1484 0.3121  340 ASP Z OD1   
2670 O OD2   . ASP A 340 ? 1.0848 1.5881 1.5882 0.1619  -0.1446 0.3012  340 ASP Z OD2   
2671 N N     . TYR A 341 ? 1.0682 1.5783 1.5646 0.1627  -0.1270 0.2809  341 TYR Z N     
2672 C CA    . TYR A 341 ? 1.0730 1.5795 1.5733 0.1706  -0.1273 0.2759  341 TYR Z CA    
2673 C C     . TYR A 341 ? 1.0701 1.5910 1.5736 0.1723  -0.1231 0.2709  341 TYR Z C     
2674 O O     . TYR A 341 ? 1.0643 1.5932 1.5633 0.1667  -0.1171 0.2685  341 TYR Z O     
2675 C CB    . TYR A 341 ? 1.0741 1.5698 1.5683 0.1708  -0.1245 0.2710  341 TYR Z CB    
2676 C CG    . TYR A 341 ? 1.0795 1.5731 1.5763 0.1767  -0.1233 0.2638  341 TYR Z CG    
2677 C CD1   . TYR A 341 ? 1.0879 1.5700 1.5870 0.1801  -0.1264 0.2617  341 TYR Z CD1   
2678 C CD2   . TYR A 341 ? 1.0773 1.5810 1.5742 0.1774  -0.1181 0.2579  341 TYR Z CD2   
2679 C CE1   . TYR A 341 ? 1.0938 1.5751 1.5958 0.1843  -0.1241 0.2532  341 TYR Z CE1   
2680 C CE2   . TYR A 341 ? 1.0827 1.5864 1.5821 0.1816  -0.1164 0.2500  341 TYR Z CE2   
2681 C CZ    . TYR A 341 ? 1.0908 1.5835 1.5931 0.1851  -0.1193 0.2474  341 TYR Z CZ    
2682 O OH    . TYR A 341 ? 1.0972 1.5910 1.6026 0.1882  -0.1164 0.2377  341 TYR Z OH    
2683 N N     . ASN A 342 ? 1.0753 1.5996 1.5877 0.1799  -0.1257 0.2688  342 ASN Z N     
2684 C CA    . ASN A 342 ? 1.0732 1.6130 1.5899 0.1820  -0.1217 0.2625  342 ASN Z CA    
2685 C C     . ASN A 342 ? 1.0801 1.6154 1.6034 0.1901  -0.1214 0.2550  342 ASN Z C     
2686 O O     . ASN A 342 ? 1.0878 1.6184 1.6215 0.1978  -0.1266 0.2570  342 ASN Z O     
2687 C CB    . ASN A 342 ? 1.0721 1.6301 1.5966 0.1826  -0.1251 0.2676  342 ASN Z CB    
2688 C CG    . ASN A 342 ? 1.0678 1.6461 1.5942 0.1808  -0.1194 0.2606  342 ASN Z CG    
2689 O OD1   . ASN A 342 ? 1.0774 1.6568 1.6056 0.1843  -0.1154 0.2519  342 ASN Z OD1   
2690 N ND2   . ASN A 342 ? 1.0632 1.6590 1.5886 0.1740  -0.1184 0.2634  342 ASN Z ND2   
2691 N N     . PRO A 343 ? 1.0790 1.6156 1.5964 0.1879  -0.1148 0.2462  343 PRO Z N     
2692 C CA    . PRO A 343 ? 1.0859 1.6200 1.6079 0.1932  -0.1129 0.2368  343 PRO Z CA    
2693 C C     . PRO A 343 ? 1.0884 1.6378 1.6248 0.2003  -0.1129 0.2316  343 PRO Z C     
2694 O O     . PRO A 343 ? 1.0964 1.6426 1.6423 0.2072  -0.1129 0.2247  343 PRO Z O     
2695 C CB    . PRO A 343 ? 1.0839 1.6188 1.5930 0.1861  -0.1058 0.2310  343 PRO Z CB    
2696 C CG    . PRO A 343 ? 1.0764 1.6198 1.5794 0.1795  -0.1025 0.2351  343 PRO Z CG    
2697 C CD    . PRO A 343 ? 1.0731 1.6132 1.5788 0.1794  -0.1082 0.2449  343 PRO Z CD    
2698 N N     . ASP A 344 ? 1.0824 1.6494 1.6212 0.1985  -0.1125 0.2343  344 ASP Z N     
2699 C CA    . ASP A 344 ? 1.0947 1.6809 1.6481 0.2052  -0.1131 0.2303  344 ASP Z CA    
2700 C C     . ASP A 344 ? 1.0923 1.6742 1.6622 0.2166  -0.1213 0.2368  344 ASP Z C     
2701 O O     . ASP A 344 ? 1.1430 1.7303 1.7282 0.2261  -0.1215 0.2308  344 ASP Z O     
2702 C CB    . ASP A 344 ? 1.0981 1.7060 1.6491 0.1988  -0.1111 0.2325  344 ASP Z CB    
2703 C CG    . ASP A 344 ? 1.0713 1.6808 1.6069 0.1874  -0.1020 0.2265  344 ASP Z CG    
2704 O OD1   . ASP A 344 ? 1.0744 1.6786 1.6051 0.1864  -0.0968 0.2179  344 ASP Z OD1   
2705 O OD2   . ASP A 344 ? 1.0659 1.6816 1.5943 0.1790  -0.0997 0.2304  344 ASP Z OD2   
2706 N N     . THR A 345 ? 1.1037 1.6751 1.6708 0.2155  -0.1276 0.2489  345 THR Z N     
2707 C CA    . THR A 345 ? 1.1324 1.6963 1.7131 0.2251  -0.1356 0.2577  345 THR Z CA    
2708 C C     . THR A 345 ? 1.1612 1.6993 1.7439 0.2295  -0.1355 0.2540  345 THR Z C     
2709 O O     . THR A 345 ? 1.1997 1.7356 1.7932 0.2368  -0.1324 0.2439  345 THR Z O     
2710 C CB    . THR A 345 ? 1.1335 1.6977 1.7088 0.2201  -0.1421 0.2725  345 THR Z CB    
2711 O OG1   . THR A 345 ? 1.1423 1.6905 1.7017 0.2106  -0.1402 0.2736  345 THR Z OG1   
2712 C CG2   . THR A 345 ? 1.1122 1.7044 1.6863 0.2145  -0.1418 0.2752  345 THR Z CG2   
2738 O "O5'" . DC  B 1   ? 1.8494 1.8983 1.6428 0.2463  -0.3840 0.6563  1   DC  A "O5'" 
2739 C "C5'" . DC  B 1   ? 1.8322 1.8703 1.6296 0.2807  -0.3286 0.7016  1   DC  A "C5'" 
2740 C "C4'" . DC  B 1   ? 1.8234 1.7965 1.5688 0.2950  -0.2795 0.6534  1   DC  A "C4'" 
2741 O "O4'" . DC  B 1   ? 1.7987 1.7575 1.5629 0.3284  -0.2215 0.6962  1   DC  A "O4'" 
2742 C "C3'" . DC  B 1   ? 1.7977 1.7163 1.5453 0.2851  -0.2833 0.5886  1   DC  A "C3'" 
2743 O "O3'" . DC  B 1   ? 1.8086 1.6798 1.4944 0.2862  -0.2575 0.5271  1   DC  A "O3'" 
2744 C "C2'" . DC  B 1   ? 1.7548 1.6541 1.5520 0.3081  -0.2488 0.6219  1   DC  A "C2'" 
2745 C "C1'" . DC  B 1   ? 1.7574 1.6731 1.5510 0.3361  -0.2004 0.6770  1   DC  A "C1'" 
2746 N N1    . DC  B 1   ? 1.7329 1.6746 1.5939 0.3512  -0.1865 0.7436  1   DC  A N1    
2747 C C2    . DC  B 1   ? 1.7070 1.6213 1.5822 0.3782  -0.1263 0.7636  1   DC  A C2    
2748 O O2    . DC  B 1   ? 1.7040 1.5741 1.5357 0.3899  -0.0862 0.7257  1   DC  A O2    
2749 N N3    . DC  B 1   ? 1.6873 1.6252 1.6260 0.3897  -0.1118 0.8220  1   DC  A N3    
2750 C C4    . DC  B 1   ? 1.6914 1.6781 1.6802 0.3760  -0.1554 0.8597  1   DC  A C4    
2751 N N4    . DC  B 1   ? 1.6733 1.6800 1.7262 0.3835  -0.1357 0.9057  1   DC  A N4    
2752 C C5    . DC  B 1   ? 1.7167 1.7333 1.6929 0.3487  -0.2184 0.8396  1   DC  A C5    
2753 C C6    . DC  B 1   ? 1.7373 1.7298 1.6485 0.3368  -0.2314 0.7816  1   DC  A C6    
2754 P P     . DG  B 2   ? 1.8161 1.6259 1.4982 0.2799  -0.2558 0.4536  2   DG  A P     
2755 O OP1   . DG  B 2   ? 1.8155 1.6013 1.4370 0.2658  -0.2559 0.3876  2   DG  A OP1   
2756 O OP2   . DG  B 2   ? 1.7687 1.5852 1.5054 0.2639  -0.2989 0.4544  2   DG  A OP2   
2757 O "O5'" . DG  B 2   ? 1.8109 1.5829 1.5001 0.3123  -0.1951 0.4663  2   DG  A "O5'" 
2758 C "C5'" . DG  B 2   ? 1.7595 1.5306 1.4189 0.3347  -0.1438 0.4899  2   DG  A "C5'" 
2759 C "C4'" . DG  B 2   ? 1.7252 1.4572 1.3974 0.3602  -0.0901 0.4890  2   DG  A "C4'" 
2760 O "O4'" . DG  B 2   ? 1.7030 1.4602 1.4298 0.3738  -0.0797 0.5556  2   DG  A "O4'" 
2761 C "C3'" . DG  B 2   ? 1.7030 1.3869 1.3780 0.3548  -0.0970 0.4277  2   DG  A "C3'" 
2762 O "O3'" . DG  B 2   ? 1.6908 1.3338 1.3418 0.3743  -0.0427 0.3977  2   DG  A "O3'" 
2763 C "C2'" . DG  B 2   ? 1.6769 1.3712 1.4095 0.3556  -0.1143 0.4664  2   DG  A "C2'" 
2764 C "C1'" . DG  B 2   ? 1.7063 1.4348 1.4633 0.3749  -0.0804 0.5406  2   DG  A "C1'" 
2765 N N9    . DG  B 2   ? 1.6628 1.4272 1.4769 0.3695  -0.1071 0.5959  2   DG  A N9    
2766 C C8    . DG  B 2   ? 1.6760 1.4751 1.5132 0.3463  -0.1648 0.6063  2   DG  A C8    
2767 N N7    . DG  B 2   ? 1.6637 1.4905 1.5566 0.3464  -0.1743 0.6583  2   DG  A N7    
2768 C C5    . DG  B 2   ? 1.6419 1.4512 1.5479 0.3707  -0.1190 0.6846  2   DG  A C5    
2769 C C6    . DG  B 2   ? 1.6240 1.4482 1.5842 0.3803  -0.0994 0.7392  2   DG  A C6    
2770 O O6    . DG  B 2   ? 1.6229 1.4797 1.6333 0.3694  -0.1285 0.7770  2   DG  A O6    
2771 N N1    . DG  B 2   ? 1.6079 1.4054 1.5626 0.4034  -0.0372 0.7458  2   DG  A N1    
2772 C C2    . DG  B 2   ? 1.6080 1.3697 1.5132 0.4162  0.0006  0.7043  2   DG  A C2    
2773 N N2    . DG  B 2   ? 1.5923 1.3339 1.5032 0.4366  0.0608  0.7154  2   DG  A N2    
2774 N N3    . DG  B 2   ? 1.6241 1.3709 1.4798 0.4080  -0.0172 0.6532  2   DG  A N3    
2775 C C4    . DG  B 2   ? 1.6409 1.4126 1.4991 0.3851  -0.0772 0.6466  2   DG  A C4    
2776 P P     . DC  B 3   ? 1.6696 1.2608 1.3193 0.3745  -0.0404 0.3322  3   DC  A P     
2777 O OP1   . DC  B 3   ? 1.6759 1.2338 1.2831 0.3846  0.0041  0.2830  3   DC  A OP1   
2778 O OP2   . DC  B 3   ? 1.6752 1.2650 1.3389 0.3497  -0.1015 0.3013  3   DC  A OP2   
2779 O "O5'" . DC  B 3   ? 1.6386 1.2254 1.3274 0.3924  -0.0148 0.3728  3   DC  A "O5'" 
2780 C "C5'" . DC  B 3   ? 1.6325 1.2407 1.3351 0.4118  0.0307  0.4321  3   DC  A "C5'" 
2781 C "C4'" . DC  B 3   ? 1.6082 1.2164 1.3530 0.4200  0.0408  0.4688  3   DC  A "C4'" 
2782 O "O4'" . DC  B 3   ? 1.6106 1.2569 1.3951 0.4080  0.0002  0.5193  3   DC  A "O4'" 
2783 C "C3'" . DC  B 3   ? 1.5939 1.1625 1.3386 0.4164  0.0280  0.4228  3   DC  A "C3'" 
2784 O "O3'" . DC  B 3   ? 1.5811 1.1214 1.3118 0.4349  0.0826  0.4030  3   DC  A "O3'" 
2785 C "C2'" . DC  B 3   ? 1.5858 1.1703 1.3750 0.4089  -0.0007 0.4683  3   DC  A "C2'" 
2786 C "C1'" . DC  B 3   ? 1.6980 1.3323 1.5142 0.4087  -0.0017 0.5338  3   DC  A "C1'" 
2787 N N1    . DC  B 3   ? 1.6750 1.3371 1.5285 0.3895  -0.0564 0.5627  3   DC  A N1    
2788 C C2    . DC  B 3   ? 1.5871 1.2644 1.4868 0.3912  -0.0515 0.6154  3   DC  A C2    
2789 O O2    . DC  B 3   ? 1.5744 1.2417 1.4812 0.4082  -0.0016 0.6364  3   DC  A O2    
2790 N N3    . DC  B 3   ? 1.5930 1.2954 1.5298 0.3728  -0.0997 0.6397  3   DC  A N3    
2791 C C4    . DC  B 3   ? 1.6086 1.3221 1.5377 0.3529  -0.1509 0.6124  3   DC  A C4    
2792 N N4    . DC  B 3   ? 1.6147 1.3538 1.5849 0.3341  -0.1954 0.6354  3   DC  A N4    
2793 C C5    . DC  B 3   ? 1.6208 1.3193 1.5011 0.3501  -0.1560 0.5581  3   DC  A C5    
2794 C C6    . DC  B 3   ? 1.6149 1.2875 1.4589 0.3688  -0.1081 0.5356  3   DC  A C6    
2795 P P     . DT  B 4   ? 1.5682 1.0699 1.2974 0.4364  0.0799  0.3626  4   DT  A P     
2796 O OP1   . DT  B 4   ? 1.5640 1.0380 1.2636 0.4504  0.1279  0.3150  4   DT  A OP1   
2797 O OP2   . DT  B 4   ? 1.5749 1.0663 1.3099 0.4175  0.0161  0.3345  4   DT  A OP2   
2798 O "O5'" . DT  B 4   ? 1.5570 1.0708 1.3192 0.4433  0.1002  0.4209  4   DT  A "O5'" 
2799 C "C5'" . DT  B 4   ? 1.5536 1.0955 1.3352 0.4551  0.1440  0.4767  4   DT  A "C5'" 
2800 C "C4'" . DT  B 4   ? 1.5470 1.1023 1.3669 0.4542  0.1475  0.5302  4   DT  A "C4'" 
2801 O "O4'" . DT  B 4   ? 1.5535 1.1347 1.4024 0.4377  0.0927  0.5630  4   DT  A "O4'" 
2802 C "C3'" . DT  B 4   ? 1.5429 1.0656 1.3546 0.4538  0.1508  0.5068  4   DT  A "C3'" 
2803 O "O3'" . DT  B 4   ? 1.5368 1.0640 1.3644 0.4648  0.2050  0.5408  4   DT  A "O3'" 
2804 C "C2'" . DT  B 4   ? 1.5524 1.0777 1.3845 0.4357  0.0896  0.5219  4   DT  A "C2'" 
2805 C "C1'" . DT  B 4   ? 1.6590 1.2282 1.5265 0.4302  0.0762  0.5761  4   DT  A "C1'" 
2806 N N1    . DT  B 4   ? 1.7288 1.3092 1.6156 0.4096  0.0101  0.5812  4   DT  A N1    
2807 C C2    . DT  B 4   ? 1.5632 1.1643 1.4931 0.4005  -0.0055 0.6328  4   DT  A C2    
2808 O O2    . DT  B 4   ? 1.5580 1.1689 1.5114 0.4081  0.0320  0.6756  4   DT  A O2    
2809 N N3    . DT  B 4   ? 1.5729 1.1830 1.5209 0.3808  -0.0648 0.6304  4   DT  A N3    
2810 C C4    . DT  B 4   ? 1.5814 1.1816 1.5090 0.3691  -0.1082 0.5815  4   DT  A C4    
2811 O O4    . DT  B 4   ? 1.5912 1.2004 1.5406 0.3502  -0.1579 0.5807  4   DT  A O4    
2812 C C5    . DT  B 4   ? 1.5793 1.1574 1.4615 0.3793  -0.0884 0.5291  4   DT  A C5    
2813 C C7    . DT  B 4   ? 1.5900 1.1550 1.4498 0.3665  -0.1285 0.4712  4   DT  A C7    
2814 C C6    . DT  B 4   ? 1.6372 1.2066 1.5014 0.3990  -0.0312 0.5318  4   DT  A C6    
2815 P P     . DA  B 5   ? 1.9103 0.9727 1.3918 0.6583  0.2420  0.2625  5   DA  A P     
2816 O OP1   . DA  B 5   ? 1.9536 1.0131 1.4353 0.6610  0.2560  0.2417  5   DA  A OP1   
2817 O OP2   . DA  B 5   ? 1.8928 0.9659 1.3757 0.6451  0.2453  0.2720  5   DA  A OP2   
2818 O "O5'" . DA  B 5   ? 1.9035 1.0221 1.4127 0.6616  0.2278  0.2692  5   DA  A "O5'" 
2819 C "C5'" . DA  B 5   ? 1.9023 1.0043 1.4083 0.6737  0.2122  0.2741  5   DA  A "C5'" 
2820 C "C4'" . DA  B 5   ? 1.8781 1.0444 1.4170 0.6728  0.2023  0.2798  5   DA  A "C4'" 
2821 O "O4'" . DA  B 5   ? 1.8718 1.0380 1.4172 0.6680  0.1870  0.2986  5   DA  A "O4'" 
2822 C "C3'" . DA  B 5   ? 1.8486 1.0803 1.4121 0.6622  0.2123  0.2787  5   DA  A "C3'" 
2823 O "O3'" . DA  B 5   ? 1.8386 1.1232 1.4263 0.6688  0.2091  0.2734  5   DA  A "O3'" 
2824 C "C2'" . DA  B 5   ? 1.8314 1.0771 1.4022 0.6487  0.2066  0.2997  5   DA  A "C2'" 
2825 C "C1'" . DA  B 5   ? 1.8570 1.0766 1.4265 0.6536  0.1884  0.3109  5   DA  A "C1'" 
2826 N N9    . DA  B 5   ? 1.8803 1.0736 1.4410 0.6453  0.1802  0.3274  5   DA  A N9    
2827 C C8    . DA  B 5   ? 1.8873 1.0484 1.4267 0.6401  0.1872  0.3288  5   DA  A C8    
2828 N N7    . DA  B 5   ? 1.8492 0.9910 1.3836 0.6352  0.1756  0.3438  5   DA  A N7    
2829 C C5    . DA  B 5   ? 1.8465 1.0077 1.4020 0.6360  0.1599  0.3529  5   DA  A C5    
2830 C C6    . DA  B 5   ? 1.8485 1.0019 1.4125 0.6317  0.1417  0.3685  5   DA  A C6    
2831 N N6    . DA  B 5   ? 1.8478 0.9824 1.4027 0.6184  0.1337  0.3724  5   DA  A N6    
2832 N N1    . DA  B 5   ? 1.8456 1.0264 1.4362 0.6321  0.1295  0.3726  5   DA  A N1    
2833 C C2    . DA  B 5   ? 1.8403 1.0557 1.4462 0.6379  0.1355  0.3619  5   DA  A C2    
2834 N N3    . DA  B 5   ? 1.8421 1.0668 1.4397 0.6440  0.1514  0.3467  5   DA  A N3    
2835 C C4    . DA  B 5   ? 1.8528 1.0476 1.4253 0.6420  0.1630  0.3430  5   DA  A C4    
2836 P P     . DG  B 6   ? 1.8084 1.1727 1.4258 0.6602  0.2143  0.2793  6   DG  A P     
2837 O OP1   . DG  B 6   ? 1.8078 1.2129 1.4411 0.6723  0.2149  0.2649  6   DG  A OP1   
2838 O OP2   . DG  B 6   ? 1.7979 1.1686 1.4094 0.6508  0.2270  0.2775  6   DG  A OP2   
2839 O "O5'" . DG  B 6   ? 1.7976 1.1802 1.4318 0.6510  0.2013  0.3037  6   DG  A "O5'" 
2840 C "C5'" . DG  B 6   ? 1.7767 1.2241 1.4364 0.6415  0.2039  0.3171  6   DG  A "C5'" 
2841 C "C4'" . DG  B 6   ? 1.7737 1.2311 1.4523 0.6344  0.1899  0.3370  6   DG  A "C4'" 
2842 O "O4'" . DG  B 6   ? 1.7908 1.1892 1.4515 0.6296  0.1796  0.3470  6   DG  A "O4'" 
2843 C "C3'" . DG  B 6   ? 1.7560 1.2734 1.4591 0.6211  0.1936  0.3566  6   DG  A "C3'" 
2844 O "O3'" . DG  B 6   ? 1.7796 1.3347 1.5120 0.6201  0.1861  0.3637  6   DG  A "O3'" 
2845 C "C2'" . DG  B 6   ? 1.7580 1.2407 1.4500 0.6084  0.1878  0.3751  6   DG  A "C2'" 
2846 C "C1'" . DG  B 6   ? 1.7760 1.1924 1.4509 0.6148  0.1743  0.3697  6   DG  A "C1'" 
2847 N N9    . DG  B 6   ? 1.7830 1.1488 1.4333 0.6099  0.1715  0.3760  6   DG  A N9    
2848 C C8    . DG  B 6   ? 1.7826 1.1289 1.4098 0.6106  0.1831  0.3676  6   DG  A C8    
2849 N N7    . DG  B 6   ? 1.7901 1.0942 1.3991 0.6065  0.1774  0.3755  6   DG  A N7    
2850 C C5    . DG  B 6   ? 1.7966 1.0891 1.4166 0.6031  0.1600  0.3899  6   DG  A C5    
2851 C C6    . DG  B 6   ? 1.8076 1.0585 1.4167 0.5995  0.1459  0.4018  6   DG  A C6    
2852 O O6    . DG  B 6   ? 1.8134 1.0299 1.3989 0.5992  0.1468  0.4025  6   DG  A O6    
2853 N N1    . DG  B 6   ? 1.8128 1.0662 1.4427 0.5967  0.1288  0.4123  6   DG  A N1    
2854 C C2    . DG  B 6   ? 1.8071 1.1013 1.4661 0.5966  0.1269  0.4114  6   DG  A C2    
2855 N N2    . DG  B 6   ? 1.8139 1.1062 1.4938 0.5925  0.1092  0.4208  6   DG  A N2    
2856 N N3    . DG  B 6   ? 1.7963 1.1320 1.4648 0.6009  0.1407  0.4007  6   DG  A N3    
2857 C C4    . DG  B 6   ? 1.7920 1.1228 1.4391 0.6043  0.1563  0.3903  6   DG  A C4    
2858 P P     . DT  B 7   ? 1.8146 1.4403 1.5768 0.6073  0.1924  0.3842  7   DT  A P     
2859 O OP1   . DT  B 7   ? 1.8394 1.5168 1.6287 0.6145  0.1925  0.3769  7   DT  A OP1   
2860 O OP2   . DT  B 7   ? 1.8003 1.4449 1.5494 0.6043  0.2068  0.3869  7   DT  A OP2   
2861 O "O5'" . DT  B 7   ? 1.7585 1.3597 1.5301 0.5911  0.1791  0.4084  7   DT  A "O5'" 
2862 C "C5'" . DT  B 7   ? 1.7550 1.3334 1.5398 0.5920  0.1622  0.4079  7   DT  A "C5'" 
2863 C "C4'" . DT  B 7   ? 1.7606 1.3202 1.5561 0.5751  0.1504  0.4311  7   DT  A "C4'" 
2864 O "O4'" . DT  B 7   ? 1.7688 1.2647 1.5314 0.5754  0.1452  0.4321  7   DT  A "O4'" 
2865 C "C3'" . DT  B 7   ? 1.7535 1.3624 1.5697 0.5576  0.1597  0.4557  7   DT  A "C3'" 
2866 O "O3'" . DT  B 7   ? 1.8077 1.4234 1.6553 0.5434  0.1473  0.4723  7   DT  A "O3'" 
2867 C "C2'" . DT  B 7   ? 1.7555 1.3289 1.5413 0.5535  0.1632  0.4641  7   DT  A "C2'" 
2868 C "C1'" . DT  B 7   ? 1.7675 1.2689 1.5317 0.5599  0.1471  0.4544  7   DT  A "C1'" 
2869 N N1    . DT  B 7   ? 1.7696 1.2285 1.4973 0.5636  0.1510  0.4504  7   DT  A N1    
2870 C C2    . DT  B 7   ? 1.7818 1.1868 1.4941 0.5600  0.1373  0.4582  7   DT  A C2    
2871 O O2    . DT  B 7   ? 1.7920 1.1792 1.5187 0.5540  0.1208  0.4677  7   DT  A O2    
2872 N N3    . DT  B 7   ? 1.7827 1.1567 1.4631 0.5642  0.1431  0.4528  7   DT  A N3    
2873 C C4    . DT  B 7   ? 1.7727 1.1642 1.4382 0.5703  0.1605  0.4400  7   DT  A C4    
2874 O O4    . DT  B 7   ? 1.7745 1.1386 1.4148 0.5730  0.1645  0.4346  7   DT  A O4    
2875 C C5    . DT  B 7   ? 1.7610 1.2072 1.4441 0.5740  0.1729  0.4318  7   DT  A C5    
2876 C C7    . DT  B 7   ? 1.7514 1.2203 1.4221 0.5815  0.1902  0.4154  7   DT  A C7    
2877 C C6    . DT  B 7   ? 1.7600 1.2371 1.4718 0.5711  0.1679  0.4377  7   DT  A C6    
2878 P P     . DC  B 8   ? 1.8495 1.4981 1.7180 0.5214  0.1531  0.5033  8   DC  A P     
2879 O OP1   . DC  B 8   ? 1.8637 1.5386 1.7758 0.5095  0.1437  0.5121  8   DC  A OP1   
2880 O OP2   . DC  B 8   ? 1.7927 1.4893 1.6524 0.5237  0.1749  0.5073  8   DC  A OP2   
2881 O "O5'" . DC  B 8   ? 1.8947 1.4778 1.7385 0.5144  0.1412  0.5152  8   DC  A "O5'" 
2882 C "C5'" . DC  B 8   ? 1.8933 1.4413 1.7532 0.5037  0.1208  0.5250  8   DC  A "C5'" 
2883 C "C4'" . DC  B 8   ? 1.8828 1.3659 1.7107 0.5037  0.1098  0.5298  8   DC  A "C4'" 
2884 O "O4'" . DC  B 8   ? 1.8757 1.3401 1.6641 0.5182  0.1203  0.5154  8   DC  A "O4'" 
2885 C "C3'" . DC  B 8   ? 1.8730 1.3543 1.7047 0.4857  0.1096  0.5580  8   DC  A "C3'" 
2886 O "O3'" . DC  B 8   ? 1.9216 1.3502 1.7556 0.4796  0.0867  0.5638  8   DC  A "O3'" 
2887 C "C2'" . DC  B 8   ? 1.8516 1.3239 1.6442 0.4936  0.1225  0.5571  8   DC  A "C2'" 
2888 C "C1'" . DC  B 8   ? 1.8407 1.2794 1.6069 0.5127  0.1202  0.5292  8   DC  A "C1'" 
2889 N N1    . DC  B 8   ? 1.7913 1.2380 1.5276 0.5235  0.1371  0.5179  8   DC  A N1    
2890 C C2    . DC  B 8   ? 1.7945 1.1946 1.4966 0.5297  0.1338  0.5127  8   DC  A C2    
2891 O O2    . DC  B 8   ? 1.8085 1.1607 1.5030 0.5274  0.1168  0.5180  8   DC  A O2    
2892 N N3    . DC  B 8   ? 1.7845 1.1953 1.4643 0.5385  0.1489  0.5004  8   DC  A N3    
2893 C C4    . DC  B 8   ? 1.7711 1.2341 1.4601 0.5422  0.1655  0.4933  8   DC  A C4    
2894 N N4    . DC  B 8   ? 1.7628 1.2350 1.4315 0.5510  0.1786  0.4791  8   DC  A N4    
2895 C C5    . DC  B 8   ? 1.7665 1.2768 1.4873 0.5376  0.1689  0.4989  8   DC  A C5    
2896 C C6    . DC  B 8   ? 1.7755 1.2769 1.5196 0.5278  0.1550  0.5113  8   DC  A C6    
2897 P P     . DG  B 9   ? 1.4645 1.3993 2.0481 -0.2405 -0.5727 0.5252  9   DG  A P     
2898 O OP1   . DG  B 9   ? 1.5401 1.5022 2.1027 -0.2810 -0.5927 0.5159  9   DG  A OP1   
2899 O OP2   . DG  B 9   ? 1.4108 1.3736 2.0592 -0.2246 -0.5432 0.5092  9   DG  A OP2   
2900 O "O5'" . DG  B 9   ? 1.4702 1.3195 1.9696 -0.2445 -0.5388 0.5316  9   DG  A "O5'" 
2901 C "C5'" . DG  B 9   ? 1.4982 1.3087 1.9218 -0.2654 -0.5548 0.5434  9   DG  A "C5'" 
2902 C "C4'" . DG  B 9   ? 1.4774 1.2140 1.8279 -0.2703 -0.5139 0.5423  9   DG  A "C4'" 
2903 O "O4'" . DG  B 9   ? 1.4216 1.1257 1.7689 -0.2333 -0.5116 0.5591  9   DG  A "O4'" 
2904 C "C3'" . DG  B 9   ? 1.4282 1.1495 1.7776 -0.2799 -0.4616 0.5189  9   DG  A "C3'" 
2905 O "O3'" . DG  B 9   ? 1.4782 1.1501 1.7471 -0.3112 -0.4379 0.5108  9   DG  A "O3'" 
2906 C "C2'" . DG  B 9   ? 1.3834 1.0798 1.7509 -0.2393 -0.4363 0.5238  9   DG  A "C2'" 
2907 C "C1'" . DG  B 9   ? 1.3928 1.0596 1.7251 -0.2230 -0.4626 0.5478  9   DG  A "C1'" 
2908 N N9    . DG  B 9   ? 1.3537 1.0161 1.7219 -0.1806 -0.4601 0.5585  9   DG  A N9    
2909 C C8    . DG  B 9   ? 1.3178 1.0247 1.7675 -0.1522 -0.4668 0.5579  9   DG  A C8    
2910 N N7    . DG  B 9   ? 1.2888 0.9775 1.7515 -0.1171 -0.4617 0.5684  9   DG  A N7    
2911 C C5    . DG  B 9   ? 1.3066 0.9370 1.6922 -0.1234 -0.4509 0.5759  9   DG  A C5    
2912 C C6    . DG  B 9   ? 1.2903 0.8837 1.6510 -0.0980 -0.4390 0.5835  9   DG  A C6    
2913 O O6    . DG  B 9   ? 1.2536 0.8699 1.6506 -0.0642 -0.4261 0.5708  9   DG  A O6    
2914 N N1    . DG  B 9   ? 1.3161 0.8691 1.5912 -0.1163 -0.4237 0.5762  9   DG  A N1    
2915 C C2    . DG  B 9   ? 1.3658 0.8942 1.5898 -0.1549 -0.4320 0.5831  9   DG  A C2    
2916 N N2    . DG  B 9   ? 1.4074 0.9002 1.5526 -0.1657 -0.4150 0.5737  9   DG  A N2    
2917 N N3    . DG  B 9   ? 1.3736 0.9368 1.6190 -0.1789 -0.4412 0.5735  9   DG  A N3    
2918 C C4    . DG  B 9   ? 1.3462 0.9602 1.6732 -0.1618 -0.4501 0.5701  9   DG  A C4    
2919 P P     . DT  B 10  ? 1.5161 1.1615 1.7632 -0.3289 -0.3842 0.4859  10  DT  A P     
2920 O OP1   . DT  B 10  ? 1.5445 1.1870 1.7468 -0.3747 -0.3871 0.4748  10  DT  A OP1   
2921 O OP2   . DT  B 10  ? 1.4536 1.1359 1.7759 -0.3102 -0.3668 0.4746  10  DT  A OP2   
2922 O "O5'" . DT  B 10  ? 1.4650 1.0389 1.6462 -0.3112 -0.3507 0.4901  10  DT  A "O5'" 
2923 C "C5'" . DT  B 10  ? 1.4811 1.0143 1.5884 -0.3230 -0.3618 0.5011  10  DT  A "C5'" 
2924 C "C4'" . DT  B 10  ? 1.4621 0.9419 1.5266 -0.2967 -0.3335 0.5052  10  DT  A "C4'" 
2925 O "O4'" . DT  B 10  ? 1.4221 0.9197 1.5395 -0.2574 -0.3462 0.5190  10  DT  A "O4'" 
2926 C "C3'" . DT  B 10  ? 1.4789 0.9238 1.5208 -0.2923 -0.2795 0.4852  10  DT  A "C3'" 
2927 O "O3'" . DT  B 10  ? 1.5097 0.8969 1.4642 -0.3011 -0.2582 0.4821  10  DT  A "O3'" 
2928 C "C2'" . DT  B 10  ? 1.4320 0.8854 1.5262 -0.2482 -0.2661 0.4886  10  DT  A "C2'" 
2929 C "C1'" . DT  B 10  ? 1.3924 0.8561 1.4971 -0.2315 -0.3054 0.5116  10  DT  A "C1'" 
2930 N N1    . DT  B 10  ? 1.3465 0.8376 1.5218 -0.1921 -0.3118 0.5198  10  DT  A N1    
2931 C C2    . DT  B 10  ? 1.3853 0.8490 1.5450 -0.1627 -0.3041 0.5287  10  DT  A C2    
2932 O O2    . DT  B 10  ? 1.3604 0.7881 1.4504 -0.1650 -0.2888 0.5231  10  DT  A O2    
2933 N N3    . DT  B 10  ? 1.3448 0.8361 1.5729 -0.1282 -0.3106 0.5351  10  DT  A N3    
2934 C C4    . DT  B 10  ? 1.2940 0.8376 1.6031 -0.1191 -0.3242 0.5336  10  DT  A C4    
2935 O O4    . DT  B 10  ? 1.2275 0.7925 1.5938 -0.0865 -0.3294 0.5395  10  DT  A O4    
2936 C C5    . DT  B 10  ? 1.2873 0.8601 1.6090 -0.1512 -0.3316 0.5233  10  DT  A C5    
2937 C C7    . DT  B 10  ? 1.2680 0.9027 1.6757 -0.1454 -0.3460 0.5185  10  DT  A C7    
2938 C C6    . DT  B 10  ? 1.3276 0.8727 1.5826 -0.1864 -0.3249 0.5169  10  DT  A C6    
2939 P P     . DC  B 11  ? 1.5157 0.8678 1.4082 -0.3349 -0.2268 0.4620  11  DC  A P     
2940 O OP1   . DC  B 11  ? 1.5317 0.8250 1.3389 -0.3316 -0.2052 0.4606  11  DC  A OP1   
2941 O OP2   . DC  B 11  ? 1.5498 0.9350 1.4520 -0.3733 -0.2575 0.4616  11  DC  A OP2   
2942 O "O5'" . DC  B 11  ? 1.4932 0.8475 1.4233 -0.3222 -0.1863 0.4440  11  DC  A "O5'" 
2943 C "C5'" . DC  B 11  ? 1.4668 0.7848 1.3803 -0.2882 -0.1471 0.4382  11  DC  A "C5'" 
2944 C "C4'" . DC  B 11  ? 1.4625 0.7751 1.3953 -0.2868 -0.1070 0.4190  11  DC  A "C4'" 
2945 O "O4'" . DC  B 11  ? 1.4300 0.8015 1.4563 -0.2775 -0.1220 0.4208  11  DC  A "O4'" 
2946 C "C3'" . DC  B 11  ? 1.5129 0.8030 1.4011 -0.3281 -0.0886 0.4020  11  DC  A "C3'" 
2947 O "O3'" . DC  B 11  ? 1.5192 0.7646 1.3755 -0.3178 -0.0377 0.3850  11  DC  A "O3'" 
2948 C "C2'" . DC  B 11  ? 1.5109 0.8642 1.4740 -0.3501 -0.1141 0.4003  11  DC  A "C2'" 
2949 C "C1'" . DC  B 11  ? 1.4557 0.8452 1.4980 -0.3109 -0.1147 0.4059  11  DC  A "C1'" 
2950 N N1    . DC  B 11  ? 1.4375 0.9012 1.5665 -0.3159 -0.1543 0.4124  11  DC  A N1    
2951 C C2    . DC  B 11  ? 1.4166 0.9182 1.6136 -0.3120 -0.1413 0.4010  11  DC  A C2    
2952 O O2    . DC  B 11  ? 1.4313 0.9014 1.6138 -0.3052 -0.0968 0.3868  11  DC  A O2    
2953 N N3    . DC  B 11  ? 1.4005 0.9728 1.6760 -0.3147 -0.1778 0.4053  11  DC  A N3    
2954 C C4    . DC  B 11  ? 1.4072 1.0085 1.6916 -0.3197 -0.2255 0.4212  11  DC  A C4    
2955 N N4    . DC  B 11  ? 1.3935 1.0647 1.7540 -0.3193 -0.2608 0.4242  11  DC  A N4    
2956 C C5    . DC  B 11  ? 1.4305 0.9904 1.6444 -0.3247 -0.2389 0.4341  11  DC  A C5    
2957 C C6    . DC  B 11  ? 1.4437 0.9373 1.5830 -0.3233 -0.2024 0.4288  11  DC  A C6    
2958 P P     . DA  B 12  ? 1.5780 0.7601 1.3401 -0.3466 -0.0053 0.3689  12  DA  A P     
2959 O OP1   . DA  B 12  ? 1.5752 0.6991 1.2793 -0.3143 0.0347  0.3626  12  DA  A OP1   
2960 O OP2   . DA  B 12  ? 1.6667 0.8523 1.3927 -0.3807 -0.0383 0.3756  12  DA  A OP2   
2961 O "O5'" . DA  B 12  ? 1.5991 0.7925 1.3902 -0.3737 0.0159  0.3513  12  DA  A "O5'" 
2962 C "C5'" . DA  B 12  ? 1.5623 0.8142 1.4472 -0.3653 0.0070  0.3516  12  DA  A "C5'" 
2963 C "C4'" . DA  B 12  ? 1.5925 0.8784 1.5061 -0.4104 -0.0003 0.3393  12  DA  A "C4'" 
2964 O "O4'" . DA  B 12  ? 1.6129 0.9664 1.5832 -0.4228 -0.0535 0.3518  12  DA  A "O4'" 
2965 C "C3'" . DA  B 12  ? 1.6918 0.9293 1.5246 -0.4526 0.0179  0.3254  12  DA  A "C3'" 
2966 O "O3'" . DA  B 12  ? 1.8169 1.0649 1.6701 -0.4840 0.0392  0.3062  12  DA  A "O3'" 
2967 C "C2'" . DA  B 12  ? 1.7155 0.9829 1.5428 -0.4767 -0.0301 0.3370  12  DA  A "C2'" 
2968 C "C1'" . DA  B 12  ? 1.6575 1.0076 1.5859 -0.4670 -0.0695 0.3472  12  DA  A "C1'" 
2969 N N9    . DA  B 12  ? 1.6969 1.0784 1.6349 -0.4651 -0.1198 0.3668  12  DA  A N9    
2970 C C8    . DA  B 12  ? 1.7681 1.1134 1.6366 -0.4710 -0.1323 0.3764  12  DA  A C8    
2971 N N7    . DA  B 12  ? 1.7805 1.1641 1.6739 -0.4678 -0.1794 0.3944  12  DA  A N7    
2972 C C5    . DA  B 12  ? 1.7179 1.1677 1.7035 -0.4575 -0.2001 0.3967  12  DA  A C5    
2973 C C6    . DA  B 12  ? 1.6658 1.1773 1.7145 -0.4475 -0.2492 0.4127  12  DA  A C6    
2974 N N6    . DA  B 12  ? 1.6596 1.1731 1.6851 -0.4474 -0.2872 0.4309  12  DA  A N6    
2975 N N1    . DA  B 12  ? 1.6028 1.1724 1.7369 -0.4367 -0.2575 0.4089  12  DA  A N1    
2976 C C2    . DA  B 12  ? 1.5633 1.1301 1.7190 -0.4380 -0.2188 0.3906  12  DA  A C2    
2977 N N3    . DA  B 12  ? 1.5790 1.0884 1.6799 -0.4477 -0.1705 0.3753  12  DA  A N3    
2978 C C4    . DA  B 12  ? 1.6668 1.1185 1.6825 -0.4563 -0.1639 0.3794  12  DA  A C4    
2979 P P     . DT  B 13  ? 1.7950 0.9645 1.5642 -0.5056 0.0925  0.2857  13  DT  A P     
2980 O OP1   . DT  B 13  ? 1.7252 0.8468 1.4737 -0.4633 0.1339  0.2838  13  DT  A OP1   
2981 O OP2   . DT  B 13  ? 1.8670 0.9997 1.5575 -0.5335 0.0828  0.2858  13  DT  A OP2   
2982 O "O5'" . DT  B 13  ? 1.8445 1.0508 1.6613 -0.5454 0.1022  0.2669  13  DT  A "O5'" 
2983 C "C5'" . DT  B 13  ? 1.8249 1.0998 1.7400 -0.5329 0.0912  0.2673  13  DT  A "C5'" 
2984 C "C4'" . DT  B 13  ? 1.8328 1.1831 1.8065 -0.5735 0.0559  0.2612  13  DT  A "C4'" 
2985 O "O4'" . DT  B 13  ? 1.8851 1.2426 1.8273 -0.5913 0.0174  0.2713  13  DT  A "O4'" 
2986 C "C3'" . DT  B 13  ? 1.8360 1.1775 1.7952 -0.6226 0.0852  0.2357  13  DT  A "C3'" 
2987 O "O3'" . DT  B 13  ? 1.7570 1.1290 1.7797 -0.6164 0.1071  0.2246  13  DT  A "O3'" 
2988 C "C2'" . DT  B 13  ? 1.8804 1.2862 1.8687 -0.6619 0.0401  0.2338  13  DT  A "C2'" 
2989 C "C1'" . DT  B 13  ? 1.9086 1.2995 1.8584 -0.6434 0.0057  0.2561  13  DT  A "C1'" 
2990 N N1    . DT  B 13  ? 1.9466 1.2733 1.7981 -0.6737 0.0168  0.2508  13  DT  A N1    
2991 C C2    . DT  B 13  ? 1.9470 1.3054 1.7934 -0.7190 -0.0100 0.2436  13  DT  A C2    
2992 O O2    . DT  B 13  ? 1.9387 1.3770 1.8563 -0.7355 -0.0431 0.2408  13  DT  A O2    
2993 N N3    . DT  B 13  ? 1.9602 1.2545 1.7139 -0.7432 0.0033  0.2389  13  DT  A N3    
2994 C C4    . DT  B 13  ? 1.9696 1.1738 1.6362 -0.7261 0.0394  0.2402  13  DT  A C4    
2995 O O4    . DT  B 13  ? 2.0027 1.1548 1.5886 -0.7495 0.0482  0.2350  13  DT  A O4    
2996 C C5    . DT  B 13  ? 1.9553 1.1326 1.6320 -0.6774 0.0656  0.2472  13  DT  A C5    
2997 C C7    . DT  B 13  ? 1.9643 1.0493 1.5510 -0.6523 0.1047  0.2476  13  DT  A C7    
2998 C C6    . DT  B 13  ? 1.9434 1.1822 1.7112 -0.6546 0.0534  0.2522  13  DT  A C6    
2999 O OP3   . DA  C 1   ? 1.4218 1.1659 0.9697 -0.0189 -0.1832 -0.0476 1   DA  B OP3   
3000 P P     . DA  C 1   ? 1.3854 1.1164 0.9234 -0.0140 -0.0934 -0.0711 1   DA  B P     
3001 O OP1   . DA  C 1   ? 1.5495 1.2506 1.0130 -0.0385 -0.0620 -0.1200 1   DA  B OP1   
3002 O OP2   . DA  C 1   ? 1.3413 1.0681 0.8875 0.0019  -0.0363 -0.0084 1   DA  B OP2   
3003 O "O5'" . DA  C 1   ? 1.3012 1.0625 0.9119 0.0023  -0.1073 -0.1117 1   DA  B "O5'" 
3004 C "C5'" . DA  C 1   ? 1.2847 1.0712 0.9265 -0.0020 -0.1820 -0.1607 1   DA  B "C5'" 
3005 C "C4'" . DA  C 1   ? 1.2476 1.0702 0.9728 0.0223  -0.2278 -0.1552 1   DA  B "C4'" 
3006 O "O4'" . DA  C 1   ? 1.2361 1.0640 0.9843 0.0309  -0.2729 -0.0944 1   DA  B "O4'" 
3007 C "C3'" . DA  C 1   ? 1.1775 1.0089 0.9377 0.0418  -0.1665 -0.1530 1   DA  B "C3'" 
3008 O "O3'" . DA  C 1   ? 1.1057 0.9431 0.8723 0.0378  -0.1424 -0.2164 1   DA  B "O3'" 
3009 C "C2'" . DA  C 1   ? 1.1874 1.0506 1.0159 0.0630  -0.2264 -0.1250 1   DA  B "C2'" 
3010 C "C1'" . DA  C 1   ? 1.2371 1.0889 1.0476 0.0540  -0.2683 -0.0727 1   DA  B "C1'" 
3011 N N9    . DA  C 1   ? 1.2472 1.0920 1.0498 0.0593  -0.2192 -0.0074 1   DA  B N9    
3012 C C8    . DA  C 1   ? 1.2610 1.0787 1.0060 0.0506  -0.1475 0.0161  1   DA  B C8    
3013 N N7    . DA  C 1   ? 1.2376 1.0627 0.9967 0.0608  -0.1170 0.0776  1   DA  B N7    
3014 C C5    . DA  C 1   ? 1.1790 1.0383 1.0088 0.0742  -0.1753 0.0950  1   DA  B C5    
3015 C C6    . DA  C 1   ? 1.0585 0.9460 0.9382 0.0865  -0.1821 0.1525  1   DA  B C6    
3016 N N6    . DA  C 1   ? 1.0783 0.9687 0.9482 0.0897  -0.1257 0.2077  1   DA  B N6    
3017 N N1    . DA  C 1   ? 1.0117 0.9266 0.9533 0.0953  -0.2493 0.1495  1   DA  B N1    
3018 C C2    . DA  C 1   ? 1.0326 0.9462 0.9858 0.0952  -0.3031 0.0940  1   DA  B C2    
3019 N N3    . DA  C 1   ? 1.1528 1.0473 1.0689 0.0862  -0.3026 0.0392  1   DA  B N3    
3020 C C4    . DA  C 1   ? 1.2171 1.0851 1.0714 0.0742  -0.2378 0.0425  1   DA  B C4    
3021 P P     . DC  C 2   ? 1.1004 0.9272 0.8705 0.0496  -0.0518 -0.2215 2   DC  B P     
3022 O OP1   . DC  C 2   ? 1.0977 0.9281 0.8680 0.0357  -0.0381 -0.2912 2   DC  B OP1   
3023 O OP2   . DC  C 2   ? 1.1346 0.9252 0.8579 0.0502  0.0210  -0.1756 2   DC  B OP2   
3024 O "O5'" . DC  C 2   ? 1.1608 1.0236 1.0001 0.0802  -0.0781 -0.1952 2   DC  B "O5'" 
3025 C "C5'" . DC  C 2   ? 1.1330 0.9942 0.9822 0.1014  -0.0287 -0.1412 2   DC  B "C5'" 
3026 C "C4'" . DC  C 2   ? 1.0044 0.9021 0.9105 0.1204  -0.0921 -0.1045 2   DC  B "C4'" 
3027 O "O4'" . DC  C 2   ? 1.0730 0.9642 0.9669 0.1122  -0.1204 -0.0546 2   DC  B "O4'" 
3028 C "C3'" . DC  C 2   ? 0.9311 0.8482 0.8697 0.1480  -0.0551 -0.0693 2   DC  B "C3'" 
3029 O "O3'" . DC  C 2   ? 0.9275 0.8654 0.8969 0.1604  -0.0626 -0.1096 2   DC  B "O3'" 
3030 C "C2'" . DC  C 2   ? 0.9086 0.8513 0.8849 0.1544  -0.1165 -0.0196 2   DC  B "C2'" 
3031 C "C1'" . DC  C 2   ? 0.9702 0.8878 0.9081 0.1307  -0.1339 -0.0020 2   DC  B "C1'" 
3032 N N1    . DC  C 2   ? 1.0109 0.9155 0.9223 0.1315  -0.0747 0.0544  2   DC  B N1    
3033 C C2    . DC  C 2   ? 0.9711 0.9033 0.9207 0.1419  -0.0907 0.1151  2   DC  B C2    
3034 O O2    . DC  C 2   ? 0.9247 0.8869 0.9262 0.1484  -0.1557 0.1182  2   DC  B O2    
3035 N N3    . DC  C 2   ? 1.0346 0.9614 0.9648 0.1442  -0.0337 0.1676  2   DC  B N3    
3036 C C4    . DC  C 2   ? 1.1402 1.0286 1.0098 0.1377  0.0371  0.1587  2   DC  B C4    
3037 N N4    . DC  C 2   ? 1.2138 1.0983 1.0664 0.1433  0.0944  0.2109  2   DC  B N4    
3038 C C5    . DC  C 2   ? 1.1857 1.0398 1.0113 0.1247  0.0528  0.0946  2   DC  B C5    
3039 C C6    . DC  C 2   ? 1.1089 0.9758 0.9599 0.1213  -0.0048 0.0453  2   DC  B C6    
3040 P P     . DG  C 3   ? 0.9450 0.8945 0.9297 0.1880  -0.0020 -0.0897 3   DG  B P     
3041 O OP1   . DG  C 3   ? 0.8994 0.8609 0.8994 0.1923  -0.0024 -0.1462 3   DG  B OP1   
3042 O OP2   . DG  C 3   ? 0.9992 0.9140 0.9413 0.1886  0.0829  -0.0565 3   DG  B OP2   
3043 O "O5'" . DG  C 3   ? 0.9595 0.9489 0.9926 0.2076  -0.0531 -0.0407 3   DG  B "O5'" 
3044 C "C5'" . DG  C 3   ? 0.8475 0.8637 0.9205 0.2072  -0.1417 -0.0600 3   DG  B "C5'" 
3045 C "C4'" . DG  C 3   ? 0.7833 0.8343 0.8989 0.2243  -0.1772 -0.0122 3   DG  B "C4'" 
3046 O "O4'" . DG  C 3   ? 0.8241 0.8711 0.9363 0.2149  -0.1775 0.0466  3   DG  B "O4'" 
3047 C "C3'" . DG  C 3   ? 0.7792 0.8543 0.9071 0.2522  -0.1295 0.0077  3   DG  B "C3'" 
3048 O "O3'" . DG  C 3   ? 0.7981 0.9133 0.9715 0.2660  -0.1913 0.0163  3   DG  B "O3'" 
3049 C "C2'" . DG  C 3   ? 0.8335 0.9010 0.9448 0.2561  -0.0690 0.0684  3   DG  B "C2'" 
3050 C "C1'" . DG  C 3   ? 0.9018 0.9651 1.0188 0.2340  -0.1189 0.0960  3   DG  B "C1'" 
3051 N N9    . DG  C 3   ? 1.0145 1.0500 1.0933 0.2247  -0.0599 0.1279  3   DG  B N9    
3052 C C8    . DG  C 3   ? 1.0511 1.0423 1.0763 0.2126  -0.0057 0.0996  3   DG  B C8    
3053 N N7    . DG  C 3   ? 1.0836 1.0559 1.0796 0.2081  0.0430  0.1383  3   DG  B N7    
3054 C C5    . DG  C 3   ? 1.0636 1.0752 1.1019 0.2179  0.0200  0.1977  3   DG  B C5    
3055 C C6    . DG  C 3   ? 1.0823 1.1016 1.1196 0.2192  0.0530  0.2589  3   DG  B C6    
3056 O O6    . DG  C 3   ? 1.1938 1.1814 1.1862 0.2138  0.1124  0.2724  3   DG  B O6    
3057 N N1    . DG  C 3   ? 0.9996 1.0710 1.0959 0.2270  0.0105  0.3057  3   DG  B N1    
3058 C C2    . DG  C 3   ? 0.9320 1.0379 1.0762 0.2326  -0.0563 0.2924  3   DG  B C2    
3059 N N2    . DG  C 3   ? 0.9231 1.0777 1.1206 0.2361  -0.0911 0.3409  3   DG  B N2    
3060 N N3    . DG  C 3   ? 0.9681 1.0632 1.1087 0.2339  -0.0859 0.2342  3   DG  B N3    
3061 C C4    . DG  C 3   ? 1.0227 1.0727 1.1118 0.2265  -0.0445 0.1909  3   DG  B C4    
3062 P P     . DA  C 4   ? 0.9630 1.1138 1.1529 0.2969  -0.1638 0.0335  4   DA  B P     
3063 O OP1   . DA  C 4   ? 0.9649 1.1399 1.1813 0.3051  -0.2263 -0.0071 4   DA  B OP1   
3064 O OP2   . DA  C 4   ? 0.9593 1.0895 1.1134 0.3089  -0.0706 0.0354  4   DA  B OP2   
3065 O "O5'" . DA  C 4   ? 1.0177 1.2007 1.2374 0.3024  -0.1794 0.1034  4   DA  B "O5'" 
3066 C "C5'" . DA  C 4   ? 0.9837 1.1796 1.2368 0.2858  -0.2594 0.1164  4   DA  B "C5'" 
3067 C "C4'" . DA  C 4   ? 0.8885 1.1196 1.1711 0.2891  -0.2575 0.1860  4   DA  B "C4'" 
3068 O "O4'" . DA  C 4   ? 0.8535 1.0639 1.1119 0.2810  -0.1985 0.2236  4   DA  B "O4'" 
3069 C "C3'" . DA  C 4   ? 0.8439 1.1203 1.1431 0.3194  -0.2288 0.2131  4   DA  B "C3'" 
3070 O "O3'" . DA  C 4   ? 0.9281 1.2388 1.2627 0.3106  -0.2761 0.2425  4   DA  B "O3'" 
3071 C "C2'" . DA  C 4   ? 0.8178 1.0817 1.0886 0.3330  -0.1341 0.2488  4   DA  B "C2'" 
3072 C "C1'" . DA  C 4   ? 0.8294 1.0647 1.0897 0.3060  -0.1317 0.2680  4   DA  B "C1'" 
3073 N N9    . DA  C 4   ? 0.8251 1.0167 1.0365 0.3073  -0.0494 0.2660  4   DA  B N9    
3074 C C8    . DA  C 4   ? 0.8493 0.9970 1.0178 0.3056  -0.0139 0.2135  4   DA  B C8    
3075 N N7    . DA  C 4   ? 0.8731 0.9825 1.0005 0.3045  0.0605  0.2219  4   DA  B N7    
3076 C C5    . DA  C 4   ? 0.8826 1.0139 1.0269 0.3089  0.0769  0.2854  4   DA  B C5    
3077 C C6    . DA  C 4   ? 0.9208 1.0306 1.0383 0.3124  0.1486  0.3222  4   DA  B C6    
3078 N N6    . DA  C 4   ? 0.9609 1.0139 1.0226 0.3102  0.2177  0.2964  4   DA  B N6    
3079 N N1    . DA  C 4   ? 0.9206 1.0699 1.0717 0.3173  0.1477  0.3850  4   DA  B N1    
3080 C C2    . DA  C 4   ? 0.8849 1.0902 1.0931 0.3153  0.0770  0.4080  4   DA  B C2    
3081 N N3    . DA  C 4   ? 0.8511 1.0757 1.0855 0.3107  0.0043  0.3757  4   DA  B N3    
3082 C C4    . DA  C 4   ? 0.8515 1.0367 1.0505 0.3094  0.0094  0.3143  4   DA  B C4    
3083 P P     . DC  C 5   ? 1.1869 1.0702 2.0504 0.1172  -0.2797 0.6716  5   DC  B P     
3084 O OP1   . DC  C 5   ? 1.1606 1.0456 2.0542 0.1119  -0.2989 0.6711  5   DC  B OP1   
3085 O OP2   . DC  C 5   ? 1.1618 1.0303 1.9857 0.1291  -0.2758 0.6605  5   DC  B OP2   
3086 O "O5'" . DC  C 5   ? 1.1549 1.0479 2.0288 0.1189  -0.2672 0.6818  5   DC  B "O5'" 
3087 C "C5'" . DC  C 5   ? 1.1486 1.0570 2.0569 0.1089  -0.2646 0.6945  5   DC  B "C5'" 
3088 C "C4'" . DC  C 5   ? 1.1486 1.0641 2.0606 0.1130  -0.2503 0.7030  5   DC  B "C4'" 
3089 O "O4'" . DC  C 5   ? 1.1426 1.0587 2.0320 0.1140  -0.2318 0.7056  5   DC  B "O4'" 
3090 C "C3'" . DC  C 5   ? 1.1584 1.0656 2.0556 0.1249  -0.2519 0.6971  5   DC  B "C3'" 
3091 O "O3'" . DC  C 5   ? 1.1625 1.0783 2.0925 0.1237  -0.2573 0.7046  5   DC  B "O3'" 
3092 C "C2'" . DC  C 5   ? 1.1559 1.0603 2.0224 0.1319  -0.2325 0.6970  5   DC  B "C2'" 
3093 C "C1'" . DC  C 5   ? 1.1459 1.0596 2.0185 0.1234  -0.2199 0.7056  5   DC  B "C1'" 
3094 N N1    . DC  C 5   ? 1.1429 1.0494 1.9794 0.1272  -0.2062 0.7012  5   DC  B N1    
3095 C C2    . DC  C 5   ? 1.1397 1.0513 1.9698 0.1276  -0.1878 0.7087  5   DC  B C2    
3096 O O2    . DC  C 5   ? 1.1391 1.0618 1.9941 0.1251  -0.1821 0.7194  5   DC  B O2    
3097 N N3    . DC  C 5   ? 1.1381 1.0420 1.9353 0.1308  -0.1766 0.7041  5   DC  B N3    
3098 C C4    . DC  C 5   ? 1.1388 1.0313 1.9119 0.1334  -0.1828 0.6932  5   DC  B C4    
3099 N N4    . DC  C 5   ? 1.1374 1.0228 1.8804 0.1362  -0.1717 0.6892  5   DC  B N4    
3100 C C5    . DC  C 5   ? 1.1420 1.0294 1.9212 0.1335  -0.2005 0.6858  5   DC  B C5    
3101 C C6    . DC  C 5   ? 1.1444 1.0386 1.9545 0.1305  -0.2119 0.6899  5   DC  B C6    
3102 P P     . DT  C 6   ? 1.2245 1.1327 2.1478 0.1348  -0.2630 0.6999  6   DT  B P     
3103 O OP1   . DT  C 6   ? 1.1804 1.0951 2.1432 0.1299  -0.2781 0.7048  6   DT  B OP1   
3104 O OP2   . DT  C 6   ? 1.1831 1.0739 2.0672 0.1450  -0.2678 0.6860  6   DT  B OP2   
3105 O "O5'" . DT  C 6   ? 1.2158 1.1309 2.1341 0.1389  -0.2428 0.7078  6   DT  B "O5'" 
3106 C "C5'" . DT  C 6   ? 1.1621 1.0928 2.1059 0.1310  -0.2300 0.7213  6   DT  B "C5'" 
3107 C "C4'" . DT  C 6   ? 1.1605 1.0942 2.0917 0.1371  -0.2103 0.7263  6   DT  B "C4'" 
3108 O "O4'" . DT  C 6   ? 1.1550 1.0833 2.0521 0.1386  -0.1966 0.7226  6   DT  B "O4'" 
3109 C "C3'" . DT  C 6   ? 1.1703 1.0960 2.0874 0.1482  -0.2122 0.7210  6   DT  B "C3'" 
3110 O "O3'" . DT  C 6   ? 1.1693 1.1051 2.1031 0.1497  -0.1994 0.7312  6   DT  B "O3'" 
3111 C "C2'" . DT  C 6   ? 1.1706 1.0830 2.0412 0.1557  -0.2049 0.7105  6   DT  B "C2'" 
3112 C "C1'" . DT  C 6   ? 1.1595 1.0787 2.0262 0.1492  -0.1891 0.7165  6   DT  B "C1'" 
3113 N N1    . DT  C 6   ? 1.1572 1.0653 1.9859 0.1517  -0.1848 0.7071  6   DT  B N1    
3114 C C2    . DT  C 6   ? 1.1517 1.0609 1.9626 0.1516  -0.1670 0.7100  6   DT  B C2    
3115 O O2    . DT  C 6   ? 1.1490 1.0676 1.9728 0.1501  -0.1538 0.7198  6   DT  B O2    
3116 N N3    . DT  C 6   ? 1.1503 1.0488 1.9283 0.1537  -0.1651 0.7009  6   DT  B N3    
3117 C C4    . DT  C 6   ? 1.1537 1.0409 1.9156 0.1561  -0.1781 0.6899  6   DT  B C4    
3118 O O4    . DT  C 6   ? 1.1522 1.0306 1.8865 0.1578  -0.1749 0.6828  6   DT  B O4    
3119 C C5    . DT  C 6   ? 1.1603 1.0464 1.9406 0.1568  -0.1959 0.6873  6   DT  B C5    
3120 C C7    . DT  C 6   ? 1.1664 1.0396 1.9305 0.1605  -0.2105 0.6755  6   DT  B C7    
3121 C C6    . DT  C 6   ? 1.1619 1.0581 1.9740 0.1545  -0.1988 0.6958  6   DT  B C6    
3122 P P     . DA  C 7   ? 1.1789 1.1174 2.1384 0.1536  -0.2086 0.7344  7   DA  B P     
3123 O OP1   . DA  C 7   ? 1.1788 1.1265 2.1803 0.1444  -0.2222 0.7406  7   DA  B OP1   
3124 O OP2   . DA  C 7   ? 1.1906 1.1132 2.1196 0.1645  -0.2178 0.7222  7   DA  B OP2   
3125 O "O5'" . DA  C 7   ? 1.1798 1.1298 2.1510 0.1549  -0.1880 0.7459  7   DA  B "O5'" 
3126 C "C5'" . DA  C 7   ? 1.1642 1.1260 2.1477 0.1481  -0.1719 0.7563  7   DA  B "C5'" 
3127 C "C4'" . DA  C 7   ? 1.1612 1.1217 2.1182 0.1538  -0.1503 0.7574  7   DA  B "C4'" 
3128 O "O4'" . DA  C 7   ? 1.1591 1.1075 2.0744 0.1560  -0.1483 0.7468  7   DA  B "O4'" 
3129 C "C3'" . DA  C 7   ? 1.1675 1.1253 2.1179 0.1632  -0.1460 0.7563  7   DA  B "C3'" 
3130 O "O3'" . DA  C 7   ? 1.1637 1.1308 2.1215 0.1644  -0.1249 0.7663  7   DA  B "O3'" 
3131 C "C2'" . DA  C 7   ? 1.1709 1.1122 2.0746 0.1708  -0.1482 0.7423  7   DA  B "C2'" 
3132 C "C1'" . DA  C 7   ? 1.1630 1.1022 2.0474 0.1657  -0.1416 0.7401  7   DA  B "C1'" 
3133 N N9    . DA  C 7   ? 1.1653 1.0897 2.0150 0.1691  -0.1506 0.7266  7   DA  B N9    
3134 C C8    . DA  C 7   ? 1.1728 1.0881 2.0186 0.1717  -0.1698 0.7178  7   DA  B C8    
3135 N N7    . DA  C 7   ? 1.1740 1.0765 1.9860 0.1751  -0.1729 0.7068  7   DA  B N7    
3136 C C5    . DA  C 7   ? 1.1663 1.0699 1.9595 0.1741  -0.1553 0.7085  7   DA  B C5    
3137 C C6    . DA  C 7   ? 1.1638 1.0576 1.9218 0.1762  -0.1496 0.7005  7   DA  B C6    
3138 N N6    . DA  C 7   ? 1.1683 1.0495 1.9039 0.1800  -0.1606 0.6892  7   DA  B N6    
3139 N N1    . DA  C 7   ? 1.1576 1.0545 1.9046 0.1745  -0.1322 0.7045  7   DA  B N1    
3140 C C2    . DA  C 7   ? 1.1547 1.0635 1.9235 0.1716  -0.1206 0.7159  7   DA  B C2    
3141 N N3    . DA  C 7   ? 1.1561 1.0755 1.9594 0.1697  -0.1234 0.7247  7   DA  B N3    
3142 C C4    . DA  C 7   ? 1.1616 1.0780 1.9763 0.1707  -0.1416 0.7203  7   DA  B C4    
3143 P P     . DG  C 8   ? 1.1691 1.1375 2.1303 0.1726  -0.1176 0.7689  8   DG  B P     
3144 O OP1   . DG  C 8   ? 1.1657 1.1495 2.1606 0.1699  -0.1021 0.7837  8   DG  B OP1   
3145 O OP2   . DG  C 8   ? 1.1789 1.1399 2.1434 0.1767  -0.1379 0.7620  8   DG  B OP2   
3146 O "O5'" . DG  C 8   ? 1.1681 1.1259 2.0830 0.1798  -0.1044 0.7609  8   DG  B "O5'" 
3147 C "C5'" . DG  C 8   ? 1.1614 1.1201 2.0593 0.1773  -0.0879 0.7630  8   DG  B "C5'" 
3148 C "C4'" . DG  C 8   ? 1.1620 1.1080 2.0148 0.1840  -0.0812 0.7527  8   DG  B "C4'" 
3149 O "O4'" . DG  C 8   ? 1.1632 1.0972 1.9922 0.1839  -0.0963 0.7407  8   DG  B "O4'" 
3150 C "C3'" . DG  C 8   ? 1.1675 1.1100 2.0110 0.1931  -0.0780 0.7502  8   DG  B "C3'" 
3151 O "O3'" . DG  C 8   ? 1.1652 1.1042 1.9816 0.1971  -0.0602 0.7488  8   DG  B "O3'" 
3152 C "C2'" . DG  C 8   ? 1.1742 1.1034 1.9974 0.1974  -0.0970 0.7378  8   DG  B "C2'" 
3153 C "C1'" . DG  C 8   ? 1.1693 1.0921 1.9718 0.1927  -0.1002 0.7313  8   DG  B "C1'" 
3154 N N9    . DG  C 8   ? 1.1746 1.0873 1.9677 0.1936  -0.1202 0.7215  8   DG  B N9    
3155 C C8    . DG  C 8   ? 1.1819 1.0945 1.9964 0.1937  -0.1380 0.7210  8   DG  B C8    
3156 N N7    . DG  C 8   ? 1.1871 1.0881 1.9844 0.1955  -0.1532 0.7107  8   DG  B N7    
3157 C C5    . DG  C 8   ? 1.1822 1.0758 1.9460 0.1964  -0.1446 0.7043  8   DG  B C5    
3158 C C6    . DG  C 8   ? 1.1846 1.0652 1.9201 0.1987  -0.1530 0.6930  8   DG  B C6    
3159 O O6    . DG  C 8   ? 1.1924 1.0647 1.9252 0.2009  -0.1700 0.6859  8   DG  B O6    
3160 N N1    . DG  C 8   ? 1.1779 1.0550 1.8866 0.1985  -0.1396 0.6901  8   DG  B N1    
3161 C C2    . DG  C 8   ? 1.1709 1.0553 1.8788 0.1967  -0.1209 0.6968  8   DG  B C2    
3162 N N2    . DG  C 8   ? 1.1664 1.0451 1.8466 0.1968  -0.1112 0.6924  8   DG  B N2    
3163 N N3    . DG  C 8   ? 1.1693 1.0653 1.9022 0.1953  -0.1124 0.7072  8   DG  B N3    
3164 C C4    . DG  C 8   ? 1.1747 1.0751 1.9354 0.1951  -0.1249 0.7106  8   DG  B C4    
3165 P P     . DC  C 9   ? 1.2639 1.2045 2.0785 0.2050  -0.0483 0.7514  9   DC  B P     
3166 O OP1   . DC  C 9   ? 1.2938 1.2465 2.1296 0.2030  -0.0292 0.7637  9   DC  B OP1   
3167 O OP2   . DC  C 9   ? 1.2075 1.1458 2.0340 0.2092  -0.0643 0.7489  9   DC  B OP2   
3168 O "O5'" . DC  C 9   ? 1.1858 1.1139 1.9548 0.2104  -0.0415 0.7410  9   DC  B "O5'" 
3169 C "C5'" . DC  C 9   ? 1.1632 1.0882 1.9111 0.2069  -0.0314 0.7392  9   DC  B "C5'" 
3170 C "C4'" . DC  C 9   ? 1.1840 1.0948 1.8941 0.2095  -0.0383 0.7262  9   DC  B "C4'" 
3171 O "O4'" . DC  C 9   ? 1.1655 1.0719 1.8790 0.2067  -0.0577 0.7207  9   DC  B "O4'" 
3172 C "C3'" . DC  C 9   ? 1.1688 1.0720 1.8581 0.2184  -0.0384 0.7195  9   DC  B "C3'" 
3173 O "O3'" . DC  C 9   ? 1.1666 1.0692 1.8380 0.2212  -0.0204 0.7201  9   DC  B "O3'" 
3174 C "C2'" . DC  C 9   ? 1.1713 1.0614 1.8346 0.2199  -0.0529 0.7074  9   DC  B "C2'" 
3175 C "C1'" . DC  C 9   ? 1.1692 1.0623 1.8514 0.2123  -0.0655 0.7089  9   DC  B "C1'" 
3176 N N1    . DC  C 9   ? 1.1766 1.0653 1.8675 0.2146  -0.0851 0.7047  9   DC  B N1    
3177 C C2    . DC  C 9   ? 1.1803 1.0565 1.8483 0.2166  -0.0979 0.6938  9   DC  B C2    
3178 O O2    . DC  C 9   ? 1.1762 1.0462 1.8188 0.2160  -0.0923 0.6883  9   DC  B O2    
3179 N N3    . DC  C 9   ? 1.1894 1.0601 1.8637 0.2196  -0.1161 0.6897  9   DC  B N3    
3180 C C4    . DC  C 9   ? 1.1943 1.0719 1.8974 0.2199  -0.1224 0.6960  9   DC  B C4    
3181 N N4    . DC  C 9   ? 1.2051 1.0757 1.9124 0.2233  -0.1414 0.6911  9   DC  B N4    
3182 C C5    . DC  C 9   ? 1.1895 1.0809 1.9187 0.2172  -0.1096 0.7076  9   DC  B C5    
3183 C C6    . DC  C 9   ? 1.1808 1.0772 1.9024 0.2149  -0.0908 0.7115  9   DC  B C6    
3184 P P     . DG  C 10  ? 1.3340 1.2331 1.9920 0.2301  -0.0147 0.7174  10  DG  B P     
3185 O OP1   . DG  C 10  ? 1.3259 1.2282 1.9754 0.2308  0.0060  0.7213  10  DG  B OP1   
3186 O OP2   . DG  C 10  ? 1.1772 1.0809 1.8605 0.2331  -0.0240 0.7215  10  DG  B OP2   
3187 O "O5'" . DG  C 10  ? 1.2160 1.1004 1.8389 0.2343  -0.0248 0.7043  10  DG  B "O5'" 
3188 C "C5'" . DG  C 10  ? 1.1699 1.0477 1.7665 0.2321  -0.0196 0.6983  10  DG  B "C5'" 
3189 C "C4'" . DG  C 10  ? 1.1740 1.0387 1.7444 0.2359  -0.0321 0.6868  10  DG  B "C4'" 
3190 O "O4'" . DG  C 10  ? 1.1783 1.0408 1.7612 0.2347  -0.0504 0.6849  10  DG  B "O4'" 
3191 C "C3'" . DG  C 10  ? 1.1808 1.0387 1.7333 0.2450  -0.0316 0.6820  10  DG  B "C3'" 
3192 O "O3'" . DG  C 10  ? 1.1813 1.0279 1.7023 0.2475  -0.0323 0.6725  10  DG  B "O3'" 
3193 C "C2'" . DG  C 10  ? 1.1904 1.0455 1.7553 0.2488  -0.0488 0.6811  10  DG  B "C2'" 
3194 C "C1'" . DG  C 10  ? 1.1886 1.0422 1.7606 0.2428  -0.0612 0.6790  10  DG  B "C1'" 
3195 N N9    . DG  C 10  ? 1.1945 1.0513 1.7921 0.2424  -0.0753 0.6823  10  DG  B N9    
3196 C C8    . DG  C 10  ? 1.1940 1.0627 1.8237 0.2403  -0.0726 0.6923  10  DG  B C8    
3197 N N7    . DG  C 10  ? 1.2005 1.0695 1.8497 0.2401  -0.0884 0.6932  10  DG  B N7    
3198 C C5    . DG  C 10  ? 1.2064 1.0622 1.8333 0.2427  -0.1022 0.6828  10  DG  B C5    
3199 C C6    . DG  C 10  ? 1.2160 1.0652 1.8487 0.2442  -0.1221 0.6785  10  DG  B C6    
3200 O O6    . DG  C 10  ? 1.2211 1.0753 1.8814 0.2430  -0.1324 0.6832  10  DG  B O6    
3201 N N1    . DG  C 10  ? 1.2205 1.0558 1.8235 0.2477  -0.1299 0.6678  10  DG  B N1    
3202 C C2    . DG  C 10  ? 1.2156 1.0447 1.7891 0.2488  -0.1199 0.6622  10  DG  B C2    
3203 N N2    . DG  C 10  ? 1.2214 1.0372 1.7708 0.2524  -0.1293 0.6524  10  DG  B N2    
3204 N N3    . DG  C 10  ? 1.2064 1.0417 1.7750 0.2469  -0.1020 0.6661  10  DG  B N3    
3205 C C4    . DG  C 10  ? 1.2025 1.0509 1.7981 0.2441  -0.0940 0.6763  10  DG  B C4    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   Z . n 
A 1 2   GLY 2   2   2   GLY GLY Z . n 
A 1 3   ILE 3   3   3   ILE ILE Z . n 
A 1 4   GLN 4   4   4   GLN GLN Z . n 
A 1 5   GLY 5   5   5   GLY GLY Z . n 
A 1 6   LEU 6   6   6   LEU LEU Z . n 
A 1 7   LEU 7   7   7   LEU LEU Z . n 
A 1 8   GLN 8   8   8   GLN GLN Z . n 
A 1 9   PHE 9   9   9   PHE PHE Z . n 
A 1 10  ILE 10  10  10  ILE ILE Z . n 
A 1 11  LYS 11  11  11  LYS LYS Z . n 
A 1 12  GLU 12  12  12  GLU GLU Z . n 
A 1 13  ALA 13  13  13  ALA ALA Z . n 
A 1 14  SER 14  14  14  SER SER Z . n 
A 1 15  GLU 15  15  15  GLU GLU Z . n 
A 1 16  PRO 16  16  16  PRO PRO Z . n 
A 1 17  ILE 17  17  17  ILE ILE Z . n 
A 1 18  HIS 18  18  18  HIS HIS Z . n 
A 1 19  VAL 19  19  19  VAL VAL Z . n 
A 1 20  ARG 20  20  20  ARG ARG Z . n 
A 1 21  LYS 21  21  21  LYS LYS Z . n 
A 1 22  TYR 22  22  22  TYR TYR Z . n 
A 1 23  LYS 23  23  23  LYS LYS Z . n 
A 1 24  GLY 24  24  24  GLY GLY Z . n 
A 1 25  GLN 25  25  25  GLN GLN Z . n 
A 1 26  VAL 26  26  26  VAL VAL Z . n 
A 1 27  VAL 27  27  27  VAL VAL Z . n 
A 1 28  ALA 28  28  28  ALA ALA Z . n 
A 1 29  VAL 29  29  29  VAL VAL Z . n 
A 1 30  ASP 30  30  30  ASP ASP Z . n 
A 1 31  THR 31  31  31  THR THR Z . n 
A 1 32  TYR 32  32  32  TYR TYR Z . n 
A 1 33  CYS 33  33  33  CYS CYS Z . n 
A 1 34  TRP 34  34  34  TRP TRP Z . n 
A 1 35  LEU 35  35  35  LEU LEU Z . n 
A 1 36  HIS 36  36  36  HIS HIS Z . n 
A 1 37  LYS 37  37  37  LYS LYS Z . n 
A 1 38  GLY 38  38  38  GLY GLY Z . n 
A 1 39  ALA 39  39  39  ALA ALA Z . n 
A 1 40  ILE 40  40  40  ILE ILE Z . n 
A 1 41  ALA 41  41  41  ALA ALA Z . n 
A 1 42  CYS 42  42  42  CYS CYS Z . n 
A 1 43  ALA 43  43  43  ALA ALA Z . n 
A 1 44  GLU 44  44  44  GLU GLU Z . n 
A 1 45  LYS 45  45  45  LYS LYS Z . n 
A 1 46  LEU 46  46  46  LEU LEU Z . n 
A 1 47  ALA 47  47  47  ALA ALA Z . n 
A 1 48  LYS 48  48  48  LYS LYS Z . n 
A 1 49  GLY 49  49  49  GLY GLY Z . n 
A 1 50  GLU 50  50  50  GLU GLU Z . n 
A 1 51  PRO 51  51  51  PRO PRO Z . n 
A 1 52  THR 52  52  52  THR THR Z . n 
A 1 53  ASP 53  53  53  ASP ASP Z . n 
A 1 54  ARG 54  54  54  ARG ARG Z . n 
A 1 55  TYR 55  55  55  TYR TYR Z . n 
A 1 56  VAL 56  56  56  VAL VAL Z . n 
A 1 57  GLY 57  57  57  GLY GLY Z . n 
A 1 58  PHE 58  58  58  PHE PHE Z . n 
A 1 59  CYS 59  59  59  CYS CYS Z . n 
A 1 60  MET 60  60  60  MET MET Z . n 
A 1 61  LYS 61  61  61  LYS LYS Z . n 
A 1 62  PHE 62  62  62  PHE PHE Z . n 
A 1 63  VAL 63  63  63  VAL VAL Z . n 
A 1 64  ASN 64  64  64  ASN ASN Z . n 
A 1 65  MET 65  65  65  MET MET Z . n 
A 1 66  LEU 66  66  66  LEU LEU Z . n 
A 1 67  LEU 67  67  67  LEU LEU Z . n 
A 1 68  SER 68  68  68  SER SER Z . n 
A 1 69  HIS 69  69  69  HIS HIS Z . n 
A 1 70  GLY 70  70  70  GLY GLY Z . n 
A 1 71  ILE 71  71  71  ILE ILE Z . n 
A 1 72  LYS 72  72  72  LYS LYS Z . n 
A 1 73  PRO 73  73  73  PRO PRO Z . n 
A 1 74  ILE 74  74  74  ILE ILE Z . n 
A 1 75  LEU 75  75  75  LEU LEU Z . n 
A 1 76  VAL 76  76  76  VAL VAL Z . n 
A 1 77  PHE 77  77  77  PHE PHE Z . n 
A 1 78  ASP 78  78  78  ASP ASP Z . n 
A 1 79  GLY 79  79  79  GLY GLY Z . n 
A 1 80  CYS 80  80  80  CYS CYS Z . n 
A 1 81  THR 81  81  81  THR THR Z . n 
A 1 82  LEU 82  82  82  LEU LEU Z . n 
A 1 83  PRO 83  83  83  PRO PRO Z . n 
A 1 84  SER 84  84  84  SER SER Z . n 
A 1 85  LYS 85  85  85  LYS LYS Z . n 
A 1 86  LYS 86  86  86  LYS LYS Z . n 
A 1 87  GLU 87  87  87  GLU GLU Z . n 
A 1 88  VAL 88  88  88  VAL VAL Z . n 
A 1 89  GLU 89  89  89  GLU GLU Z . n 
A 1 90  ARG 90  90  90  ARG ARG Z . n 
A 1 91  SER 91  91  91  SER SER Z . n 
A 1 92  ARG 92  92  92  ARG ARG Z . n 
A 1 93  ARG 93  93  93  ARG ARG Z . n 
A 1 94  GLU 94  94  94  GLU GLU Z . n 
A 1 95  ARG 95  95  95  ARG ARG Z . n 
A 1 96  ARG 96  96  96  ARG ARG Z . n 
A 1 97  GLN 97  97  97  GLN GLN Z . n 
A 1 98  ALA 98  98  98  ALA ALA Z . n 
A 1 99  ASN 99  99  99  ASN ASN Z . n 
A 1 100 LEU 100 100 100 LEU LEU Z . n 
A 1 101 LEU 101 101 101 LEU LEU Z . n 
A 1 102 LYS 102 102 102 LYS LYS Z . n 
A 1 103 GLY 103 103 103 GLY GLY Z . n 
A 1 104 LYS 104 104 104 LYS LYS Z . n 
A 1 105 GLN 105 105 105 GLN GLN Z . n 
A 1 106 LEU 106 106 106 LEU LEU Z . n 
A 1 107 LEU 107 107 107 LEU LEU Z . n 
A 1 108 ARG 108 108 108 ARG ARG Z . n 
A 1 109 GLU 109 109 109 GLU GLU Z . n 
A 1 110 GLY 110 110 110 GLY GLY Z . n 
A 1 111 LYS 111 111 111 LYS LYS Z . n 
A 1 112 VAL 112 112 112 VAL VAL Z . n 
A 1 113 SER 113 113 113 SER SER Z . n 
A 1 114 GLU 114 114 114 GLU GLU Z . n 
A 1 115 ALA 115 115 115 ALA ALA Z . n 
A 1 116 ARG 116 116 116 ARG ARG Z . n 
A 1 117 GLU 117 117 117 GLU GLU Z . n 
A 1 118 CYS 118 118 118 CYS CYS Z . n 
A 1 119 PHE 119 119 119 PHE PHE Z . n 
A 1 120 THR 120 120 120 THR THR Z . n 
A 1 121 ARG 121 121 121 ARG ARG Z . n 
A 1 122 SER 122 122 122 SER SER Z . n 
A 1 123 ILE 123 123 123 ILE ILE Z . n 
A 1 124 ASN 124 124 124 ASN ASN Z . n 
A 1 125 ILE 125 125 125 ILE ILE Z . n 
A 1 126 THR 126 126 126 THR THR Z . n 
A 1 127 HIS 127 127 127 HIS HIS Z . n 
A 1 128 ALA 128 128 128 ALA ALA Z . n 
A 1 129 MET 129 129 129 MET MET Z . n 
A 1 130 ALA 130 130 130 ALA ALA Z . n 
A 1 131 HIS 131 131 131 HIS HIS Z . n 
A 1 132 LYS 132 132 132 LYS LYS Z . n 
A 1 133 VAL 133 133 133 VAL VAL Z . n 
A 1 134 ILE 134 134 134 ILE ILE Z . n 
A 1 135 LYS 135 135 135 LYS LYS Z . n 
A 1 136 ALA 136 136 136 ALA ALA Z . n 
A 1 137 ALA 137 137 137 ALA ALA Z . n 
A 1 138 ARG 138 138 138 ARG ARG Z . n 
A 1 139 SER 139 139 139 SER SER Z . n 
A 1 140 GLN 140 140 140 GLN GLN Z . n 
A 1 141 GLY 141 141 141 GLY GLY Z . n 
A 1 142 VAL 142 142 142 VAL VAL Z . n 
A 1 143 ASP 143 143 143 ASP ASP Z . n 
A 1 144 CYS 144 144 144 CYS CYS Z . n 
A 1 145 LEU 145 145 145 LEU LEU Z . n 
A 1 146 VAL 146 146 146 VAL VAL Z . n 
A 1 147 ALA 147 147 147 ALA ALA Z . n 
A 1 148 PRO 148 148 148 PRO PRO Z . n 
A 1 149 TYR 149 149 149 TYR TYR Z . n 
A 1 150 GLU 150 150 150 GLU GLU Z . n 
A 1 151 ALA 151 151 151 ALA ALA Z . n 
A 1 152 ASP 152 152 152 ASP ASP Z . n 
A 1 153 ALA 153 153 153 ALA ALA Z . n 
A 1 154 GLN 154 154 154 GLN GLN Z . n 
A 1 155 LEU 155 155 155 LEU LEU Z . n 
A 1 156 ALA 156 156 156 ALA ALA Z . n 
A 1 157 TYR 157 157 157 TYR TYR Z . n 
A 1 158 LEU 158 158 158 LEU LEU Z . n 
A 1 159 ASN 159 159 159 ASN ASN Z . n 
A 1 160 LYS 160 160 160 LYS LYS Z . n 
A 1 161 ALA 161 161 161 ALA ALA Z . n 
A 1 162 GLY 162 162 162 GLY GLY Z . n 
A 1 163 ILE 163 163 163 ILE ILE Z . n 
A 1 164 VAL 164 164 164 VAL VAL Z . n 
A 1 165 GLN 165 165 165 GLN GLN Z . n 
A 1 166 ALA 166 166 166 ALA ALA Z . n 
A 1 167 ILE 167 167 167 ILE ILE Z . n 
A 1 168 ILE 168 168 168 ILE ILE Z . n 
A 1 169 THR 169 169 169 THR THR Z . n 
A 1 170 GLU 170 170 170 GLU GLU Z . n 
A 1 171 ASP 171 171 171 ASP ASP Z . n 
A 1 172 SER 172 172 172 SER SER Z . n 
A 1 173 ASP 173 173 173 ASP ASP Z . n 
A 1 174 LEU 174 174 174 LEU LEU Z . n 
A 1 175 LEU 175 175 175 LEU LEU Z . n 
A 1 176 ALA 176 176 176 ALA ALA Z . n 
A 1 177 PHE 177 177 177 PHE PHE Z . n 
A 1 178 GLY 178 178 178 GLY GLY Z . n 
A 1 179 CYS 179 179 179 CYS CYS Z . n 
A 1 180 LYS 180 180 180 LYS LYS Z . n 
A 1 181 LYS 181 181 181 LYS LYS Z . n 
A 1 182 VAL 182 182 182 VAL VAL Z . n 
A 1 183 ILE 183 183 183 ILE ILE Z . n 
A 1 184 LEU 184 184 184 LEU LEU Z . n 
A 1 185 LYS 185 185 185 LYS LYS Z . n 
A 1 186 MET 186 186 186 MET MET Z . n 
A 1 187 ASP 187 187 187 ASP ASP Z . n 
A 1 188 GLN 188 188 188 GLN GLN Z . n 
A 1 189 PHE 189 189 189 PHE PHE Z . n 
A 1 190 GLY 190 190 190 GLY GLY Z . n 
A 1 191 ASN 191 191 191 ASN ASN Z . n 
A 1 192 GLY 192 192 192 GLY GLY Z . n 
A 1 193 LEU 193 193 193 LEU LEU Z . n 
A 1 194 GLU 194 194 194 GLU GLU Z . n 
A 1 195 ILE 195 195 195 ILE ILE Z . n 
A 1 196 ASP 196 196 196 ASP ASP Z . n 
A 1 197 GLN 197 197 197 GLN GLN Z . n 
A 1 198 ALA 198 198 198 ALA ALA Z . n 
A 1 199 ARG 199 199 199 ARG ARG Z . n 
A 1 200 LEU 200 200 200 LEU LEU Z . n 
A 1 201 GLY 201 201 201 GLY GLY Z . n 
A 1 202 MET 202 202 202 MET MET Z . n 
A 1 203 CYS 203 203 203 CYS CYS Z . n 
A 1 204 ARG 204 204 204 ARG ARG Z . n 
A 1 205 GLN 205 205 205 GLN GLN Z . n 
A 1 206 LEU 206 206 206 LEU LEU Z . n 
A 1 207 GLY 207 207 207 GLY GLY Z . n 
A 1 208 ASP 208 208 208 ASP ASP Z . n 
A 1 209 VAL 209 209 209 VAL VAL Z . n 
A 1 210 PHE 210 210 210 PHE PHE Z . n 
A 1 211 THR 211 211 211 THR THR Z . n 
A 1 212 GLU 212 212 212 GLU GLU Z . n 
A 1 213 GLU 213 213 213 GLU GLU Z . n 
A 1 214 LYS 214 214 214 LYS LYS Z . n 
A 1 215 PHE 215 215 215 PHE PHE Z . n 
A 1 216 ARG 216 216 216 ARG ARG Z . n 
A 1 217 TYR 217 217 217 TYR TYR Z . n 
A 1 218 MET 218 218 218 MET MET Z . n 
A 1 219 CYS 219 219 219 CYS CYS Z . n 
A 1 220 ILE 220 220 220 ILE ILE Z . n 
A 1 221 LEU 221 221 221 LEU LEU Z . n 
A 1 222 SER 222 222 222 SER SER Z . n 
A 1 223 GLY 223 223 223 GLY GLY Z . n 
A 1 224 CYS 224 224 224 CYS CYS Z . n 
A 1 225 ALA 225 225 225 ALA ALA Z . n 
A 1 226 TYR 226 226 226 TYR TYR Z . n 
A 1 227 LEU 227 227 227 LEU LEU Z . n 
A 1 228 SER 228 228 228 SER SER Z . n 
A 1 229 SER 229 229 229 SER SER Z . n 
A 1 230 LEU 230 230 230 LEU LEU Z . n 
A 1 231 ARG 231 231 231 ARG ARG Z . n 
A 1 232 GLY 232 232 232 GLY GLY Z . n 
A 1 233 ILE 233 233 233 ILE ILE Z . n 
A 1 234 GLY 234 234 234 GLY GLY Z . n 
A 1 235 LEU 235 235 235 LEU LEU Z . n 
A 1 236 ALA 236 236 236 ALA ALA Z . n 
A 1 237 LYS 237 237 237 LYS LYS Z . n 
A 1 238 ALA 238 238 238 ALA ALA Z . n 
A 1 239 CYS 239 239 239 CYS CYS Z . n 
A 1 240 LYS 240 240 240 LYS LYS Z . n 
A 1 241 VAL 241 241 241 VAL VAL Z . n 
A 1 242 LEU 242 242 242 LEU LEU Z . n 
A 1 243 ARG 243 243 243 ARG ARG Z . n 
A 1 244 LEU 244 244 244 LEU LEU Z . n 
A 1 245 ALA 245 245 245 ALA ALA Z . n 
A 1 246 ASN 246 246 246 ASN ASN Z . n 
A 1 247 ASN 247 247 247 ASN ASN Z . n 
A 1 248 PRO 248 248 248 PRO PRO Z . n 
A 1 249 ASP 249 249 249 ASP ASP Z . n 
A 1 250 ILE 250 250 250 ILE ILE Z . n 
A 1 251 VAL 251 251 251 VAL VAL Z . n 
A 1 252 LYS 252 252 252 LYS LYS Z . n 
A 1 253 VAL 253 253 253 VAL VAL Z . n 
A 1 254 ILE 254 254 254 ILE ILE Z . n 
A 1 255 LYS 255 255 255 LYS LYS Z . n 
A 1 256 LYS 256 256 256 LYS LYS Z . n 
A 1 257 ILE 257 257 257 ILE ILE Z . n 
A 1 258 GLY 258 258 258 GLY GLY Z . n 
A 1 259 HIS 259 259 259 HIS HIS Z . n 
A 1 260 TYR 260 260 260 TYR TYR Z . n 
A 1 261 LEU 261 261 261 LEU LEU Z . n 
A 1 262 LYS 262 262 262 LYS LYS Z . n 
A 1 263 MET 263 263 263 MET MET Z . n 
A 1 264 ASN 264 264 264 ASN ASN Z . n 
A 1 265 ILE 265 265 265 ILE ILE Z . n 
A 1 266 THR 266 266 266 THR THR Z . n 
A 1 267 VAL 267 267 267 VAL VAL Z . n 
A 1 268 PRO 268 268 268 PRO PRO Z . n 
A 1 269 GLU 269 269 269 GLU GLU Z . n 
A 1 270 ASP 270 270 270 ASP ASP Z . n 
A 1 271 TYR 271 271 271 TYR TYR Z . n 
A 1 272 ILE 272 272 272 ILE ILE Z . n 
A 1 273 ASN 273 273 273 ASN ASN Z . n 
A 1 274 GLY 274 274 274 GLY GLY Z . n 
A 1 275 PHE 275 275 275 PHE PHE Z . n 
A 1 276 ILE 276 276 276 ILE ILE Z . n 
A 1 277 ARG 277 277 277 ARG ARG Z . n 
A 1 278 ALA 278 278 278 ALA ALA Z . n 
A 1 279 ASN 279 279 279 ASN ASN Z . n 
A 1 280 ASN 280 280 280 ASN ASN Z . n 
A 1 281 THR 281 281 281 THR THR Z . n 
A 1 282 PHE 282 282 282 PHE PHE Z . n 
A 1 283 LEU 283 283 283 LEU LEU Z . n 
A 1 284 TYR 284 284 284 TYR TYR Z . n 
A 1 285 GLN 285 285 285 GLN GLN Z . n 
A 1 286 LEU 286 286 286 LEU LEU Z . n 
A 1 287 VAL 287 287 287 VAL VAL Z . n 
A 1 288 PHE 288 288 288 PHE PHE Z . n 
A 1 289 ASP 289 289 289 ASP ASP Z . n 
A 1 290 PRO 290 290 290 PRO PRO Z . n 
A 1 291 ILE 291 291 291 ILE ILE Z . n 
A 1 292 LYS 292 292 292 LYS LYS Z . n 
A 1 293 ARG 293 293 293 ARG ARG Z . n 
A 1 294 LYS 294 294 294 LYS LYS Z . n 
A 1 295 LEU 295 295 295 LEU LEU Z . n 
A 1 296 ILE 296 296 296 ILE ILE Z . n 
A 1 297 PRO 297 297 297 PRO PRO Z . n 
A 1 298 LEU 298 298 298 LEU LEU Z . n 
A 1 299 ASN 299 299 299 ASN ASN Z . n 
A 1 300 ALA 300 300 300 ALA ALA Z . n 
A 1 301 TYR 301 301 301 TYR TYR Z . n 
A 1 302 GLU 302 302 302 GLU GLU Z . n 
A 1 303 ASP 303 303 303 ASP ASP Z . n 
A 1 304 ASP 304 304 304 ASP ASP Z . n 
A 1 305 VAL 305 305 305 VAL VAL Z . n 
A 1 306 ASP 306 306 306 ASP ASP Z . n 
A 1 307 PRO 307 307 307 PRO PRO Z . n 
A 1 308 GLU 308 308 308 GLU GLU Z . n 
A 1 309 THR 309 309 309 THR THR Z . n 
A 1 310 LEU 310 310 310 LEU LEU Z . n 
A 1 311 SER 311 311 311 SER SER Z . n 
A 1 312 TYR 312 312 312 TYR TYR Z . n 
A 1 313 ALA 313 313 313 ALA ALA Z . n 
A 1 314 GLY 314 314 314 GLY GLY Z . n 
A 1 315 GLN 315 315 315 GLN GLN Z . n 
A 1 316 TYR 316 316 316 TYR TYR Z . n 
A 1 317 VAL 317 317 317 VAL VAL Z . n 
A 1 318 ASP 318 318 318 ASP ASP Z . n 
A 1 319 ASP 319 319 319 ASP ASP Z . n 
A 1 320 SER 320 320 320 SER SER Z . n 
A 1 321 ILE 321 321 321 ILE ILE Z . n 
A 1 322 ALA 322 322 322 ALA ALA Z . n 
A 1 323 LEU 323 323 323 LEU LEU Z . n 
A 1 324 GLN 324 324 324 GLN GLN Z . n 
A 1 325 ILE 325 325 325 ILE ILE Z . n 
A 1 326 ALA 326 326 326 ALA ALA Z . n 
A 1 327 LEU 327 327 327 LEU LEU Z . n 
A 1 328 GLY 328 328 328 GLY GLY Z . n 
A 1 329 ASN 329 329 329 ASN ASN Z . n 
A 1 330 LYS 330 330 330 LYS LYS Z . n 
A 1 331 ASP 331 331 331 ASP ASP Z . n 
A 1 332 ILE 332 332 332 ILE ILE Z . n 
A 1 333 ASN 333 333 333 ASN ASN Z . n 
A 1 334 THR 334 334 334 THR THR Z . n 
A 1 335 PHE 335 335 335 PHE PHE Z . n 
A 1 336 GLU 336 336 336 GLU GLU Z . n 
A 1 337 GLN 337 337 337 GLN GLN Z . n 
A 1 338 ILE 338 338 338 ILE ILE Z . n 
A 1 339 ASP 339 339 339 ASP ASP Z . n 
A 1 340 ASP 340 340 340 ASP ASP Z . n 
A 1 341 TYR 341 341 341 TYR TYR Z . n 
A 1 342 ASN 342 342 342 ASN ASN Z . n 
A 1 343 PRO 343 343 343 PRO PRO Z . n 
A 1 344 ASP 344 344 344 ASP ASP Z . n 
A 1 345 THR 345 345 345 THR THR Z . n 
A 1 346 ALA 346 346 ?   ?   ?   Z . n 
A 1 347 MET 347 347 ?   ?   ?   Z . n 
A 1 348 PRO 348 348 ?   ?   ?   Z . n 
A 1 349 ALA 349 349 ?   ?   ?   Z . n 
A 1 350 HIS 350 350 ?   ?   ?   Z . n 
A 1 351 SER 351 351 ?   ?   ?   Z . n 
A 1 352 ARG 352 352 ?   ?   ?   Z . n 
A 1 353 GLU 353 353 ?   ?   ?   Z . n 
A 1 354 ASN 354 354 ?   ?   ?   Z . n 
A 1 355 LEU 355 355 355 LEU LEU Z . n 
A 1 356 TYR 356 356 356 TYR TYR Z . n 
A 1 357 PHE 357 357 357 PHE PHE Z . n 
A 1 358 GLN 358 358 ?   ?   ?   Z . n 
B 2 1   DC  1   1   1   DC  DC  A . n 
B 2 2   DG  2   2   2   DG  DG  A . n 
B 2 3   DC  3   3   3   DC  DC  A . n 
B 2 4   DT  4   4   4   DT  DT  A . n 
B 2 5   DA  5   5   5   DA  DA  A . n 
B 2 6   DG  6   6   6   DG  DG  A . n 
B 2 7   DT  7   7   7   DT  DT  A . n 
B 2 8   DC  8   8   8   DC  DC  A . n 
B 2 9   DG  9   9   9   DG  DG  A . n 
B 2 10  DT  10  10  10  DT  DT  A . n 
B 2 11  DC  11  11  11  DC  DC  A . n 
B 2 12  DA  12  12  12  DA  DA  A . n 
B 2 13  DT  13  13  13  DT  DT  A . n 
C 3 1   DA  1   1   1   DA  DA  B . n 
C 3 2   DC  2   2   2   DC  DC  B . n 
C 3 3   DG  3   3   3   DG  DG  B . n 
C 3 4   DA  4   4   4   DA  DA  B . n 
C 3 5   DC  5   5   5   DC  DC  B . n 
C 3 6   DT  6   6   6   DT  DT  B . n 
C 3 7   DA  7   7   7   DA  DA  B . n 
C 3 8   DG  8   8   8   DG  DG  B . n 
C 3 9   DC  9   9   9   DC  DC  B . n 
C 3 10  DG  10  10  10  DG  DG  B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 MN  1  401 1  MN  MN  Z . 
E 4 MN  1  402 3  MN  MN  Z . 
F 5 NA  1  403 5  NA  NA  Z . 
G 4 MN  1  101 1  MN  MN  A . 
H 4 MN  1  101 2  MN  MN  B . 
I 4 MN  1  102 4  MN  MN  B . 
J 6 HOH 1  501 20 HOH HOH Z . 
J 6 HOH 2  502 71 HOH HOH Z . 
J 6 HOH 3  503 17 HOH HOH Z . 
J 6 HOH 4  504 70 HOH HOH Z . 
J 6 HOH 5  505 67 HOH HOH Z . 
J 6 HOH 6  506 28 HOH HOH Z . 
J 6 HOH 7  507 42 HOH HOH Z . 
J 6 HOH 8  508 68 HOH HOH Z . 
J 6 HOH 9  509 64 HOH HOH Z . 
J 6 HOH 10 510 4  HOH HOH Z . 
J 6 HOH 11 511 5  HOH HOH Z . 
J 6 HOH 12 512 40 HOH HOH Z . 
J 6 HOH 13 513 1  HOH HOH Z . 
J 6 HOH 14 514 29 HOH HOH Z . 
J 6 HOH 15 515 37 HOH HOH Z . 
J 6 HOH 16 516 8  HOH HOH Z . 
J 6 HOH 17 517 27 HOH HOH Z . 
J 6 HOH 18 518 96 HOH HOH Z . 
J 6 HOH 19 519 3  HOH HOH Z . 
J 6 HOH 20 520 74 HOH HOH Z . 
J 6 HOH 21 521 14 HOH HOH Z . 
J 6 HOH 22 522 50 HOH HOH Z . 
J 6 HOH 23 523 75 HOH HOH Z . 
J 6 HOH 24 524 97 HOH HOH Z . 
J 6 HOH 25 525 72 HOH HOH Z . 
J 6 HOH 26 526 78 HOH HOH Z . 
J 6 HOH 27 527 95 HOH HOH Z . 
J 6 HOH 28 528 55 HOH HOH Z . 
J 6 HOH 29 529 33 HOH HOH Z . 
J 6 HOH 30 530 6  HOH HOH Z . 
J 6 HOH 31 531 35 HOH HOH Z . 
J 6 HOH 32 532 2  HOH HOH Z . 
J 6 HOH 33 533 69 HOH HOH Z . 
J 6 HOH 34 534 83 HOH HOH Z . 
J 6 HOH 35 535 60 HOH HOH Z . 
J 6 HOH 36 536 51 HOH HOH Z . 
J 6 HOH 37 537 25 HOH HOH Z . 
J 6 HOH 38 538 12 HOH HOH Z . 
J 6 HOH 39 539 43 HOH HOH Z . 
J 6 HOH 40 540 23 HOH HOH Z . 
J 6 HOH 41 541 85 HOH HOH Z . 
J 6 HOH 42 542 44 HOH HOH Z . 
J 6 HOH 43 543 9  HOH HOH Z . 
J 6 HOH 44 544 58 HOH HOH Z . 
J 6 HOH 45 545 39 HOH HOH Z . 
J 6 HOH 46 546 77 HOH HOH Z . 
J 6 HOH 47 547 10 HOH HOH Z . 
J 6 HOH 48 548 18 HOH HOH Z . 
J 6 HOH 49 549 46 HOH HOH Z . 
J 6 HOH 50 550 24 HOH HOH Z . 
J 6 HOH 51 551 26 HOH HOH Z . 
J 6 HOH 52 552 30 HOH HOH Z . 
J 6 HOH 53 553 52 HOH HOH Z . 
J 6 HOH 54 554 99 HOH HOH Z . 
J 6 HOH 55 555 48 HOH HOH Z . 
J 6 HOH 56 556 11 HOH HOH Z . 
J 6 HOH 57 557 7  HOH HOH Z . 
J 6 HOH 58 558 66 HOH HOH Z . 
J 6 HOH 59 559 98 HOH HOH Z . 
J 6 HOH 60 560 84 HOH HOH Z . 
J 6 HOH 61 561 56 HOH HOH Z . 
J 6 HOH 62 562 41 HOH HOH Z . 
J 6 HOH 63 563 61 HOH HOH Z . 
J 6 HOH 64 564 63 HOH HOH Z . 
J 6 HOH 65 565 76 HOH HOH Z . 
J 6 HOH 66 566 54 HOH HOH Z . 
J 6 HOH 67 567 86 HOH HOH Z . 
J 6 HOH 68 568 80 HOH HOH Z . 
J 6 HOH 69 569 92 HOH HOH Z . 
J 6 HOH 70 570 91 HOH HOH Z . 
J 6 HOH 71 571 65 HOH HOH Z . 
J 6 HOH 72 572 47 HOH HOH Z . 
J 6 HOH 73 573 87 HOH HOH Z . 
J 6 HOH 74 574 34 HOH HOH Z . 
J 6 HOH 75 575 88 HOH HOH Z . 
J 6 HOH 76 576 79 HOH HOH Z . 
J 6 HOH 77 577 59 HOH HOH Z . 
J 6 HOH 78 578 45 HOH HOH Z . 
J 6 HOH 79 579 21 HOH HOH Z . 
K 6 HOH 1  201 32 HOH HOH A . 
K 6 HOH 2  202 36 HOH HOH A . 
K 6 HOH 3  203 62 HOH HOH A . 
K 6 HOH 4  204 31 HOH HOH A . 
K 6 HOH 5  205 93 HOH HOH A . 
K 6 HOH 6  206 22 HOH HOH A . 
K 6 HOH 7  207 81 HOH HOH A . 
K 6 HOH 8  208 49 HOH HOH A . 
K 6 HOH 9  209 82 HOH HOH A . 
K 6 HOH 10 210 38 HOH HOH A . 
K 6 HOH 11 211 73 HOH HOH A . 
L 6 HOH 1  201 89 HOH HOH B . 
L 6 HOH 2  202 13 HOH HOH B . 
L 6 HOH 3  203 57 HOH HOH B . 
L 6 HOH 4  204 15 HOH HOH B . 
L 6 HOH 5  205 19 HOH HOH B . 
L 6 HOH 6  206 16 HOH HOH B . 
L 6 HOH 7  207 90 HOH HOH B . 
L 6 HOH 8  208 53 HOH HOH B . 
L 6 HOH 9  209 94 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4550  ? 
1 MORE         -63   ? 
1 'SSA (A^2)'  18520 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG    ? A CYS 80  ? Z CYS 80  ? 1_555 MN ? E MN . ? Z MN 402 ? 1_555 O     ? J HOH .   ? Z HOH 578 ? 1_555 89.1  ? 
2  OD1   ? A ASP 152 ? Z ASP 152 ? 1_555 MN ? H MN . ? B MN 101 ? 1_555 "O3'" ? C DA  1   ? B DA  1   ? 1_555 160.6 ? 
3  OD1   ? A ASP 152 ? Z ASP 152 ? 1_555 MN ? H MN . ? B MN 101 ? 1_555 OP1   ? C DC  2   ? B DC  2   ? 1_555 98.7  ? 
4  "O3'" ? C DA  1   ? B DA  1   ? 1_555 MN ? H MN . ? B MN 101 ? 1_555 OP1   ? C DC  2   ? B DC  2   ? 1_555 62.7  ? 
5  OD1   ? A ASP 152 ? Z ASP 152 ? 1_555 MN ? H MN . ? B MN 101 ? 1_555 O     ? J HOH .   ? Z HOH 513 ? 1_555 87.8  ? 
6  "O3'" ? C DA  1   ? B DA  1   ? 1_555 MN ? H MN . ? B MN 101 ? 1_555 O     ? J HOH .   ? Z HOH 513 ? 1_555 85.3  ? 
7  OP1   ? C DC  2   ? B DC  2   ? 1_555 MN ? H MN . ? B MN 101 ? 1_555 O     ? J HOH .   ? Z HOH 513 ? 1_555 85.2  ? 
8  OD1   ? A ASP 152 ? Z ASP 152 ? 1_555 MN ? H MN . ? B MN 101 ? 1_555 O     ? J HOH .   ? Z HOH 532 ? 1_555 98.9  ? 
9  "O3'" ? C DA  1   ? B DA  1   ? 1_555 MN ? H MN . ? B MN 101 ? 1_555 O     ? J HOH .   ? Z HOH 532 ? 1_555 98.0  ? 
10 OP1   ? C DC  2   ? B DC  2   ? 1_555 MN ? H MN . ? B MN 101 ? 1_555 O     ? J HOH .   ? Z HOH 532 ? 1_555 157.2 ? 
11 O     ? J HOH .   ? Z HOH 513 ? 1_555 MN ? H MN . ? B MN 101 ? 1_555 O     ? J HOH .   ? Z HOH 532 ? 1_555 80.9  ? 
12 OD1   ? A ASP 152 ? Z ASP 152 ? 1_555 MN ? H MN . ? B MN 101 ? 1_555 O     ? J HOH .   ? Z HOH 519 ? 1_555 87.5  ? 
13 "O3'" ? C DA  1   ? B DA  1   ? 1_555 MN ? H MN . ? B MN 101 ? 1_555 O     ? J HOH .   ? Z HOH 519 ? 1_555 98.7  ? 
14 OP1   ? C DC  2   ? B DC  2   ? 1_555 MN ? H MN . ? B MN 101 ? 1_555 O     ? J HOH .   ? Z HOH 519 ? 1_555 93.9  ? 
15 O     ? J HOH .   ? Z HOH 513 ? 1_555 MN ? H MN . ? B MN 101 ? 1_555 O     ? J HOH .   ? Z HOH 519 ? 1_555 175.0 ? 
16 O     ? J HOH .   ? Z HOH 532 ? 1_555 MN ? H MN . ? B MN 101 ? 1_555 O     ? J HOH .   ? Z HOH 519 ? 1_555 101.4 ? 
17 OD2   ? A ASP 152 ? Z ASP 152 ? 1_555 MN ? D MN . ? Z MN 401 ? 1_555 OD2   ? A ASP 171 ? Z ASP 171 ? 1_555 84.4  ? 
18 OD2   ? A ASP 152 ? Z ASP 152 ? 1_555 MN ? D MN . ? Z MN 401 ? 1_555 OD2   ? A ASP 173 ? Z ASP 173 ? 1_555 134.6 ? 
19 OD2   ? A ASP 171 ? Z ASP 171 ? 1_555 MN ? D MN . ? Z MN 401 ? 1_555 OD2   ? A ASP 173 ? Z ASP 173 ? 1_555 101.0 ? 
20 OD2   ? A ASP 152 ? Z ASP 152 ? 1_555 MN ? D MN . ? Z MN 401 ? 1_555 OP1   ? C DC  2   ? B DC  2   ? 1_555 83.4  ? 
21 OD2   ? A ASP 171 ? Z ASP 171 ? 1_555 MN ? D MN . ? Z MN 401 ? 1_555 OP1   ? C DC  2   ? B DC  2   ? 1_555 90.1  ? 
22 OD2   ? A ASP 173 ? Z ASP 173 ? 1_555 MN ? D MN . ? Z MN 401 ? 1_555 OP1   ? C DC  2   ? B DC  2   ? 1_555 140.8 ? 
23 OD2   ? A ASP 152 ? Z ASP 152 ? 1_555 MN ? D MN . ? Z MN 401 ? 1_555 O     ? J HOH .   ? Z HOH 510 ? 1_555 150.6 ? 
24 OD2   ? A ASP 171 ? Z ASP 171 ? 1_555 MN ? D MN . ? Z MN 401 ? 1_555 O     ? J HOH .   ? Z HOH 510 ? 1_555 110.8 ? 
25 OD2   ? A ASP 173 ? Z ASP 173 ? 1_555 MN ? D MN . ? Z MN 401 ? 1_555 O     ? J HOH .   ? Z HOH 510 ? 1_555 69.1  ? 
26 OP1   ? C DC  2   ? B DC  2   ? 1_555 MN ? D MN . ? Z MN 401 ? 1_555 O     ? J HOH .   ? Z HOH 510 ? 1_555 71.8  ? 
27 O     ? A SER 222 ? Z SER 222 ? 1_555 NA ? F NA . ? Z NA 403 ? 1_555 OG    ? A SER 229 ? Z SER 229 ? 1_555 79.7  ? 
28 O     ? A SER 222 ? Z SER 222 ? 1_555 NA ? F NA . ? Z NA 403 ? 1_555 O     ? A ILE 233 ? Z ILE 233 ? 1_555 88.2  ? 
29 OG    ? A SER 229 ? Z SER 229 ? 1_555 NA ? F NA . ? Z NA 403 ? 1_555 O     ? A ILE 233 ? Z ILE 233 ? 1_555 74.0  ? 
30 O     ? A SER 222 ? Z SER 222 ? 1_555 NA ? F NA . ? Z NA 403 ? 1_555 OP2   ? B DA  5   ? A DA  5   ? 1_555 172.4 ? 
31 OG    ? A SER 229 ? Z SER 229 ? 1_555 NA ? F NA . ? Z NA 403 ? 1_555 OP2   ? B DA  5   ? A DA  5   ? 1_555 101.9 ? 
32 O     ? A ILE 233 ? Z ILE 233 ? 1_555 NA ? F NA . ? Z NA 403 ? 1_555 OP2   ? B DA  5   ? A DA  5   ? 1_555 85.2  ? 
33 O     ? A SER 222 ? Z SER 222 ? 1_555 NA ? F NA . ? Z NA 403 ? 1_555 O     ? K HOH .   ? A HOH 205 ? 1_555 119.8 ? 
34 OG    ? A SER 229 ? Z SER 229 ? 1_555 NA ? F NA . ? Z NA 403 ? 1_555 O     ? K HOH .   ? A HOH 205 ? 1_555 140.7 ? 
35 O     ? A ILE 233 ? Z ILE 233 ? 1_555 NA ? F NA . ? Z NA 403 ? 1_555 O     ? K HOH .   ? A HOH 205 ? 1_555 134.7 ? 
36 OP2   ? B DA  5   ? A DA  5   ? 1_555 NA ? F NA . ? Z NA 403 ? 1_555 O     ? K HOH .   ? A HOH 205 ? 1_555 63.4  ? 
37 O     ? A SER 222 ? Z SER 222 ? 1_555 NA ? F NA . ? Z NA 403 ? 1_555 O     ? J HOH .   ? Z HOH 545 ? 1_555 85.3  ? 
38 OG    ? A SER 229 ? Z SER 229 ? 1_555 NA ? F NA . ? Z NA 403 ? 1_555 O     ? J HOH .   ? Z HOH 545 ? 1_555 71.4  ? 
39 O     ? A ILE 233 ? Z ILE 233 ? 1_555 NA ? F NA . ? Z NA 403 ? 1_555 O     ? J HOH .   ? Z HOH 545 ? 1_555 145.4 ? 
40 OP2   ? B DA  5   ? A DA  5   ? 1_555 NA ? F NA . ? Z NA 403 ? 1_555 O     ? J HOH .   ? Z HOH 545 ? 1_555 102.3 ? 
41 O     ? K HOH .   ? A HOH 205 ? 1_555 NA ? F NA . ? Z NA 403 ? 1_555 O     ? J HOH .   ? Z HOH 545 ? 1_555 76.5  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-05-24 
2 'Structure model' 1 1 2017-06-07 
3 'Structure model' 1 2 2017-06-21 
4 'Structure model' 1 3 2017-09-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Database references'        
3 4 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' citation           
2 4 'Structure model' pdbx_audit_support 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_citation.country'                        
2 3 'Structure model' '_citation.journal_id_ASTM'                
3 3 'Structure model' '_citation.journal_id_CSD'                 
4 3 'Structure model' '_citation.journal_volume'                 
5 3 'Structure model' '_citation.page_first'                     
6 3 'Structure model' '_citation.page_last'                      
7 4 'Structure model' '_pdbx_audit_support.funding_organization' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1  ? refined -23.9366 47.1860 -23.2889 1.6290 1.3326 1.4497 0.3814  -0.0749 0.5616  3.7271 3.4090 1.0516 
0.9999  -1.4332 0.8613  0.6336  1.0110  -0.3085 -0.5030 1.0462  0.9180  0.0634  -0.9297 -1.1278 
'X-RAY DIFFRACTION' 2  ? refined -27.3146 41.6220 -9.0058  1.7763 1.1746 1.4516 0.5993  0.1643  0.3946  1.9533 1.5661 2.2263 
-1.3321 0.4027  0.9085  0.1946  -0.9070 -0.1653 -0.3384 -0.0406 0.5473  -0.0295 -0.5541 -0.2099 
'X-RAY DIFFRACTION' 3  ? refined -24.6036 21.4747 -6.0093  1.4806 0.9747 1.5895 -0.3563 -0.2166 0.4264  0.6496 0.5473 2.7865 
-0.3237 -0.4656 1.1942  -0.8627 0.7959  0.3199  -0.7315 0.2890  1.3609  0.7208  -1.2337 0.4916  
'X-RAY DIFFRACTION' 4  ? refined -17.4567 34.3171 -7.6792  0.9103 0.8649 0.8967 0.1691  -0.0750 0.0601  3.9466 3.7525 4.6597 
-0.1854 -0.7910 -0.1846 1.5274  -0.2693 -0.2824 0.9165  0.5889  0.2907  -0.4388 -0.3056 -1.7380 
'X-RAY DIFFRACTION' 5  ? refined -30.2539 44.4537 -18.1072 1.0360 0.5510 2.1836 0.4707  -0.3223 1.3325  0.6155 1.7727 0.1302 
-0.0584 0.2165  -0.2521 0.5292  0.0326  -0.5596 -0.0135 -0.0583 0.9198  -0.0751 -0.2822 0.0236  
'X-RAY DIFFRACTION' 6  ? refined -6.5341  28.6060 -16.8104 0.5329 0.5333 0.5237 0.0578  -0.0231 -0.1597 0.7198 1.7819 2.1224 
0.7034  0.5714  -0.8472 0.0335  0.2033  -0.4423 -0.0372 0.2336  0.3572  0.3800  0.1965  -0.1942 
'X-RAY DIFFRACTION' 7  ? refined -13.0378 26.1572 -1.8417  1.0470 0.5175 0.5624 -0.0013 0.0384  -0.0021 4.1703 2.5207 4.2387 
-0.1643 -0.0648 0.3788  0.2045  0.4691  -0.1107 -0.1483 0.0630  0.2724  -0.1892 -0.1783 -0.2514 
'X-RAY DIFFRACTION' 8  ? refined -22.1436 20.2075 7.0944   1.3326 0.7210 0.8474 -0.3412 0.0701  0.0878  0.4250 0.5415 2.8398 
0.4795  -0.7742 -0.7731 -0.1429 -0.1700 -0.3890 0.3307  -0.2115 0.1047  1.1058  -0.0853 0.3154  
'X-RAY DIFFRACTION' 9  ? refined -6.8314  16.1841 -5.2633  1.2045 0.4665 0.7785 0.1653  -0.0563 -0.1236 1.8528 0.6347 1.7505 
-0.0501 -0.8058 -0.6917 0.3620  0.2621  -0.3364 0.1469  0.0349  -0.7326 0.4961  -0.0837 -0.3441 
'X-RAY DIFFRACTION' 10 ? refined -5.8228  35.0046 2.4533   0.5679 0.5635 0.5306 0.0197  -0.0213 -0.1073 2.3689 4.3324 3.1777 
1.6653  0.9829  -0.1951 0.2787  -0.2871 0.2960  0.2387  -0.5555 0.4234  -0.3683 0.4359  0.2121  
'X-RAY DIFFRACTION' 11 ? refined -25.6412 36.7358 6.6006   1.0522 0.9051 1.4132 -0.0941 0.0984  -0.1067 0.8897 3.1575 4.4985 
-1.6331 -0.3464 -0.1267 -0.8973 -0.0127 0.5366  1.0756  0.0388  -0.4620 0.2292  -0.9173 0.5872  
'X-RAY DIFFRACTION' 12 ? refined -32.0650 27.6376 4.2067   1.1065 0.6784 1.2873 -0.1215 0.2944  -0.1463 2.6697 0.8381 1.7284 
0.7684  -2.0575 -0.5049 -0.1745 0.3258  -0.3165 0.4397  -0.1108 0.4760  0.3667  -0.8983 0.2439  
'X-RAY DIFFRACTION' 13 ? refined -4.9896  20.9111 5.9408   1.1612 0.4668 0.5379 0.1272  -0.0756 0.0074  4.7763 3.5790 3.6497 
0.9770  -2.1045 1.2324  0.7665  -0.8152 -0.2929 0.5906  -0.4042 -0.1426 1.0575  0.7018  -0.2151 
'X-RAY DIFFRACTION' 14 ? refined -0.8053  32.8617 -5.5048  0.4682 0.4786 0.4666 0.0659  -0.0390 -0.0891 2.5371 2.0903 2.5012 
0.2056  0.3106  0.3985  0.2076  0.4088  -0.0579 0.5019  -0.0172 -0.1857 0.2537  0.8065  -0.2170 
'X-RAY DIFFRACTION' 15 ? refined -2.9562  34.3666 -13.2063 0.6910 0.4740 0.4703 0.0216  -0.0188 -0.0554 1.1680 1.6099 2.7054 
-1.1410 -1.3925 0.8192  -0.4104 -0.1914 -0.1649 0.0163  -0.1034 0.0007  -0.1149 0.3970  0.4532  
'X-RAY DIFFRACTION' 16 ? refined -7.6235  26.5637 -17.9415 0.8682 0.5586 0.6512 0.0438  0.0206  -0.2128 2.2474 3.2980 2.5073 
-0.2687 0.3244  -0.1673 0.3464  0.3513  -0.6522 0.0551  -0.2303 -0.0574 0.6236  0.2679  -0.1181 
'X-RAY DIFFRACTION' 17 ? refined -7.7959  46.8342 -17.0146 0.5226 0.5341 0.5214 0.0669  0.0048  -0.0749 2.4789 2.6948 2.3618 
-0.3596 0.1291  0.2223  0.2699  0.2727  0.3438  -0.4892 -0.4311 0.1028  -0.3379 0.1412  0.1321  
'X-RAY DIFFRACTION' 18 ? refined -11.6806 51.8763 -21.5785 0.8580 0.6227 0.7445 0.1654  -0.1576 -0.0871 3.7562 3.8119 2.9670 
1.6572  -1.0071 -1.5339 0.2288  0.6599  0.2608  -0.6089 -0.0457 0.1501  -0.1493 -0.3091 -0.2068 
'X-RAY DIFFRACTION' 19 ? refined -9.5603  61.0467 -16.3103 0.7520 0.5832 0.8708 0.0591  0.0926  -0.0237 5.1871 3.9175 5.7118 
0.2475  1.5753  -0.4078 -0.1361 0.0792  0.9016  -0.2016 -0.1296 0.5709  -1.1978 -0.2766 0.1473  
'X-RAY DIFFRACTION' 20 ? refined -7.0681  55.9996 -5.3309  0.5931 0.4383 0.6819 -0.0425 -0.0188 -0.1983 3.3452 1.4861 2.0304 
-0.4695 1.1886  -0.2908 0.0548  -0.5028 0.2918  0.1884  0.1701  -0.1107 -0.4749 -0.0940 -0.1694 
'X-RAY DIFFRACTION' 21 ? refined 5.1479   40.2671 -0.8974  0.4365 0.8938 0.5416 -0.0732 -0.0470 -0.1389 1.3145 1.1495 3.0748 
0.1230  0.2120  -0.5094 -0.1376 -0.1045 0.6601  0.2898  -0.2488 -0.6820 -0.1718 1.1296  0.2742  
'X-RAY DIFFRACTION' 22 ? refined 5.2909   52.2303 -0.0132  0.6315 0.8128 0.8040 -0.2050 -0.0370 -0.3253 6.0164 2.4373 0.2236 
0.6593  -1.1185 -0.3010 0.1074  0.1545  0.8379  0.3198  0.2469  -0.4123 -1.0974 1.0050  -0.3291 
'X-RAY DIFFRACTION' 23 ? refined 4.6037   37.0430 10.1322  0.7125 0.9384 0.6160 -0.1499 -0.0825 -0.0494 1.2898 4.4469 1.7755 
0.7577  -0.0386 -0.9599 -0.0729 -0.0340 0.0185  0.4050  0.5734  -0.2385 0.2067  1.0215  -0.5577 
'X-RAY DIFFRACTION' 24 ? refined -2.7612  29.4130 14.9997  0.8042 0.7881 0.5683 -0.0929 0.0281  0.0710  4.6138 5.8948 7.4487 
1.5970  0.2926  -1.1972 1.0350  -0.2986 0.1045  0.9903  0.0811  0.8139  -0.0426 -0.0464 -0.9773 
'X-RAY DIFFRACTION' 25 ? refined 8.0931   20.2088 11.5537  1.0789 1.6142 1.6019 0.1883  -0.1242 0.2609  2.0091 0.6217 1.5389 
0.8954  -0.5254 0.3179  0.1143  -0.1040 -0.3702 -0.0486 0.0251  -0.1774 0.1772  0.3315  -0.0458 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1  ? ? ? ? ? ? ? ? ? '(chain A and resid 1:4)'     
'X-RAY DIFFRACTION' 2  2  ? ? ? ? ? ? ? ? ? '(chain A and resid 5:8)'     
'X-RAY DIFFRACTION' 3  3  ? ? ? ? ? ? ? ? ? '(chain A and resid 9:13)'    
'X-RAY DIFFRACTION' 4  4  ? ? ? ? ? ? ? ? ? '(chain B and resid 1:4)'     
'X-RAY DIFFRACTION' 5  5  ? ? ? ? ? ? ? ? ? '(chain B and resid 5:10)'    
'X-RAY DIFFRACTION' 6  6  ? ? ? ? ? ? ? ? ? '(chain Z and resid 2:31)'    
'X-RAY DIFFRACTION' 7  7  ? ? ? ? ? ? ? ? ? '(chain Z and resid 32:37)'   
'X-RAY DIFFRACTION' 8  8  ? ? ? ? ? ? ? ? ? '(chain Z and resid 38:54)'   
'X-RAY DIFFRACTION' 9  9  ? ? ? ? ? ? ? ? ? '(chain Z and resid 55:72)'   
'X-RAY DIFFRACTION' 10 10 ? ? ? ? ? ? ? ? ? '(chain Z and resid 73:86)'   
'X-RAY DIFFRACTION' 11 11 ? ? ? ? ? ? ? ? ? '(chain Z and resid 87:107)'  
'X-RAY DIFFRACTION' 12 12 ? ? ? ? ? ? ? ? ? '(chain Z and resid 108:124)' 
'X-RAY DIFFRACTION' 13 13 ? ? ? ? ? ? ? ? ? '(chain Z and resid 125:144)' 
'X-RAY DIFFRACTION' 14 14 ? ? ? ? ? ? ? ? ? '(chain Z and resid 145:173)' 
'X-RAY DIFFRACTION' 15 15 ? ? ? ? ? ? ? ? ? '(chain Z and resid 174:184)' 
'X-RAY DIFFRACTION' 16 16 ? ? ? ? ? ? ? ? ? '(chain Z and resid 185:200)' 
'X-RAY DIFFRACTION' 17 17 ? ? ? ? ? ? ? ? ? '(chain Z and resid 201:232)' 
'X-RAY DIFFRACTION' 18 18 ? ? ? ? ? ? ? ? ? '(chain Z and resid 233:244)' 
'X-RAY DIFFRACTION' 19 19 ? ? ? ? ? ? ? ? ? '(chain Z and resid 245:270)' 
'X-RAY DIFFRACTION' 20 20 ? ? ? ? ? ? ? ? ? '(chain Z and resid 271:277)' 
'X-RAY DIFFRACTION' 21 21 ? ? ? ? ? ? ? ? ? '(chain Z and resid 278:300)' 
'X-RAY DIFFRACTION' 22 22 ? ? ? ? ? ? ? ? ? '(chain Z and resid 301:312)' 
'X-RAY DIFFRACTION' 23 23 ? ? ? ? ? ? ? ? ? '(chain Z and resid 313:326)' 
'X-RAY DIFFRACTION' 24 24 ? ? ? ? ? ? ? ? ? '(chain Z and resid 327:339)' 
'X-RAY DIFFRACTION' 25 25 ? ? ? ? ? ? ? ? ? '(chain Z and resid 340:345)' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? dev_1839 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .        4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 ND2 Z ASN 246 ? ? O Z HOH 501 ? ? 2.12 
2 1 NZ  Z LYS 330 ? ? O Z HOH 502 ? ? 2.13 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 P     B DA 1 ? ? OP3   B DA 1 ? ? 1.489 1.607 -0.118 0.012 N 
2 1 "O3'" B DC 2 ? ? "C3'" B DC 2 ? ? 1.374 1.419 -0.045 0.006 N 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             N 
_pdbx_validate_rmsd_angle.auth_asym_id_1             Z 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ASN 
_pdbx_validate_rmsd_angle.auth_seq_id_1              246 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_2             Z 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ASN 
_pdbx_validate_rmsd_angle.auth_seq_id_2              246 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             C 
_pdbx_validate_rmsd_angle.auth_asym_id_3             Z 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ASN 
_pdbx_validate_rmsd_angle.auth_seq_id_3              246 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                92.59 
_pdbx_validate_rmsd_angle.angle_target_value         111.00 
_pdbx_validate_rmsd_angle.angle_deviation            -18.41 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.70 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP Z 53  ? ? -154.78 28.60   
2 1 SER Z 139 ? ? -69.87  11.54   
3 1 TYR Z 149 ? ? -137.54 -108.94 
4 1 ASP Z 304 ? ? -91.32  30.72   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 Z PHE 357 ? CG  ? A PHE 357 CG  
2 1 Y 1 Z PHE 357 ? CD1 ? A PHE 357 CD1 
3 1 Y 1 Z PHE 357 ? CD2 ? A PHE 357 CD2 
4 1 Y 1 Z PHE 357 ? CE1 ? A PHE 357 CE1 
5 1 Y 1 Z PHE 357 ? CE2 ? A PHE 357 CE2 
6 1 Y 1 Z PHE 357 ? CZ  ? A PHE 357 CZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 Z MET 1   ? A MET 1   
2  1 Y 1 Z ALA 346 ? A ALA 346 
3  1 Y 1 Z MET 347 ? A MET 347 
4  1 Y 1 Z PRO 348 ? A PRO 348 
5  1 Y 1 Z ALA 349 ? A ALA 349 
6  1 Y 1 Z HIS 350 ? A HIS 350 
7  1 Y 1 Z SER 351 ? A SER 351 
8  1 Y 1 Z ARG 352 ? A ARG 352 
9  1 Y 1 Z GLU 353 ? A GLU 353 
10 1 Y 1 Z ASN 354 ? A ASN 354 
11 1 Y 1 Z GLN 358 ? A GLN 358 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5V09 'double helix'        
5V09 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DC 1  1_555 C DG 10 1_555 -0.157 -0.093 0.103  -7.810  -3.829  -4.984  1  A_DC1:DG10_B A 1  ? B 10 ? 19 1 
1 B DG 2  1_555 C DC 9  1_555 -0.399 -0.351 0.483  -8.908  -24.791 -5.423  2  A_DG2:DC9_B  A 2  ? B 9  ? 19 1 
1 B DC 3  1_555 C DG 8  1_555 -0.505 -0.116 1.101  -28.280 -10.526 -4.724  3  A_DC3:DG8_B  A 3  ? B 8  ? 19 1 
1 B DT 4  1_555 C DA 7  1_555 -0.361 -0.062 1.055  -23.614 -18.464 -19.550 4  A_DT4:DA7_B  A 4  ? B 7  ? 20 1 
1 B DA 5  1_555 C DT 6  1_555 -0.994 -0.518 0.631  -19.517 -12.924 -10.392 5  A_DA5:DT6_B  A 5  ? B 6  ? 20 1 
1 B DG 6  1_555 C DC 5  1_555 -0.844 -0.432 0.574  -1.162  -11.614 -6.309  6  A_DG6:DC5_B  A 6  ? B 5  ? 19 1 
1 B DT 7  1_555 C DA 4  1_555 -0.801 -0.106 0.491  -0.738  -13.448 -11.119 7  A_DT7:DA4_B  A 7  ? B 4  ? 20 1 
1 B DC 8  1_555 C DG 3  1_555 0.630  -0.253 -0.003 -6.643  0.053   -2.410  8  A_DC8:DG3_B  A 8  ? B 3  ? 19 1 
1 B DG 9  1_555 C DC 2  1_555 -0.970 -0.352 0.062  5.900   -7.122  0.326   9  A_DG9:DC2_B  A 9  ? B 2  ? 19 1 
1 B DT 10 1_555 C DA 1  1_555 0.230  -0.184 0.235  13.961  -4.964  0.511   10 A_DT10:DA1_B A 10 ? B 1  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DC 1 1_555 C DG 10 1_555 B DG 2  1_555 C DC 9 1_555 -0.339 0.062  3.411 -6.226 3.311   34.448 -0.418 -0.418 3.410 5.518   
10.378 35.141 1 AA_DC1DG2:DC9DG10_BB A 1 ? B 10 ? A 2  ? B 9 ? 
1 B DG 2 1_555 C DC 9  1_555 B DC 3  1_555 C DG 8 1_555 0.585  -0.529 3.762 -2.285 -6.962  35.903 0.268  -1.295 3.753 -11.151 
3.660  36.619 2 AA_DG2DC3:DG8DC9_BB  A 2 ? B 9  ? A 3  ? B 8 ? 
1 B DC 3 1_555 C DG 8  1_555 B DT 4  1_555 C DA 7 1_555 -1.206 -0.418 3.142 -1.483 -2.297  34.077 -0.358 1.825  3.211 -3.911  
2.525  34.183 3 AA_DC3DT4:DA7DG8_BB  A 3 ? B 8  ? A 4  ? B 7 ? 
1 B DT 4 1_555 C DA 7  1_555 B DA 5  1_555 C DT 6 1_555 0.375  0.346  3.246 5.714  -11.272 38.282 1.767  0.096  3.052 -16.644 
-8.437 40.239 4 AA_DT4DA5:DT6DA7_BB  A 4 ? B 7  ? A 5  ? B 6 ? 
1 B DA 5 1_555 C DT 6  1_555 B DG 6  1_555 C DC 5 1_555 0.288  -0.448 2.925 1.776  2.855   30.407 -1.352 -0.232 2.883 5.422   
-3.374 30.588 5 AA_DA5DG6:DC5DT6_BB  A 5 ? B 6  ? A 6  ? B 5 ? 
1 B DG 6 1_555 C DC 5  1_555 B DT 7  1_555 C DA 4 1_555 -0.403 -0.541 3.290 0.902  -0.677  36.756 -0.765 0.763  3.288 -1.074  
-1.431 36.772 6 AA_DG6DT7:DA4DC5_BB  A 6 ? B 5  ? A 7  ? B 4 ? 
1 B DT 7 1_555 C DA 4  1_555 B DC 8  1_555 C DG 3 1_555 1.166  -0.416 3.571 4.463  -7.042  43.095 0.192  -1.086 3.688 -9.480  
-6.009 43.856 7 AA_DT7DC8:DG3DA4_BB  A 7 ? B 4  ? A 8  ? B 3 ? 
1 B DC 8 1_555 C DG 3  1_555 B DG 9  1_555 C DC 2 1_555 0.296  -1.051 2.961 -0.438 8.584   28.815 -3.542 -0.649 2.544 16.783  
0.856  30.044 8 AA_DC8DG9:DC2DG3_BB  A 8 ? B 3  ? A 9  ? B 2 ? 
1 B DG 9 1_555 C DC 2  1_555 B DT 10 1_555 C DA 1 1_555 -1.370 -1.409 3.265 -6.169 3.120   25.149 -3.996 1.312  3.305 6.999   
13.836 26.067 9 AA_DG9DT10:DA1DC2_BB A 9 ? B 2  ? A 10 ? B 1 ? 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Institute of General Medical Sciences' 'United States' 'R01 GM091487' 1 
'National Institutes of Health/National Cancer Institute'                      'United States' 'P01 CA092584' 2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MANGANESE (II) ION' MN  
5 'SODIUM ION'         NA  
6 water                HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
#