data_5V35
# 
_entry.id   5V35 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5V35         
WWPDB D_1000226752 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5V35 
_pdbx_database_status.recvd_initial_deposition_date   2017-03-06 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Yadav, R.P.'    1 ? 
'Gakhar, L.'     2 ? 
'Liping, Y.'     3 ? 
'Artemyev, N.O.' 4 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Proc. Natl. Acad. Sci. U.S.A.' 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            114 
_citation.language                  ? 
_citation.page_first                E6536 
_citation.page_last                 E6545 
_citation.title                     
;Unique structural features of the AIPL1-FKBP domain that support prenyl lipid binding and underlie protein malfunction in blindness.
;
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1704782114 
_citation.pdbx_database_id_PubMed   28739921 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yadav, R.P.'    1 
primary 'Gakhar, L.'     2 
primary 'Yu, L.'         3 
primary 'Artemyev, N.O.' 4 
# 
_cell.entry_id           5V35 
_cell.length_a           53.150 
_cell.length_b           65.520 
_cell.length_c           106.950 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5V35 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Aryl hydrocarbon receptor-interacting protein-like 1 (AIPL1)' 19375.152 1 ? V71F 'UNP residues 2-161' ? 
2 non-polymer syn FARNESYL                                                       206.367   1 ? ?    ?                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGHHHHHHGDAALLLNVEGVKKTILHGGTGELPNFITGSRVIFHFRTMKCDEERTVIDDSRQVGQPMHIIIGNMFKLEFW
EILLTSMRVHEVAEFWCDTIHTGVYPILSRSLRQMAQGKDPTEWHVHTCGLANMFAYHTLGYEDLDELQKEPQPLVFVIE
LLQVDAPSD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGHHHHHHGDAALLLNVEGVKKTILHGGTGELPNFITGSRVIFHFRTMKCDEERTVIDDSRQVGQPMHIIIGNMFKLEFW
EILLTSMRVHEVAEFWCDTIHTGVYPILSRSLRQMAQGKDPTEWHVHTCGLANMFAYHTLGYEDLDELQKEPQPLVFVIE
LLQVDAPSD
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   GLY n 
1 10  ASP n 
1 11  ALA n 
1 12  ALA n 
1 13  LEU n 
1 14  LEU n 
1 15  LEU n 
1 16  ASN n 
1 17  VAL n 
1 18  GLU n 
1 19  GLY n 
1 20  VAL n 
1 21  LYS n 
1 22  LYS n 
1 23  THR n 
1 24  ILE n 
1 25  LEU n 
1 26  HIS n 
1 27  GLY n 
1 28  GLY n 
1 29  THR n 
1 30  GLY n 
1 31  GLU n 
1 32  LEU n 
1 33  PRO n 
1 34  ASN n 
1 35  PHE n 
1 36  ILE n 
1 37  THR n 
1 38  GLY n 
1 39  SER n 
1 40  ARG n 
1 41  VAL n 
1 42  ILE n 
1 43  PHE n 
1 44  HIS n 
1 45  PHE n 
1 46  ARG n 
1 47  THR n 
1 48  MET n 
1 49  LYS n 
1 50  CYS n 
1 51  ASP n 
1 52  GLU n 
1 53  GLU n 
1 54  ARG n 
1 55  THR n 
1 56  VAL n 
1 57  ILE n 
1 58  ASP n 
1 59  ASP n 
1 60  SER n 
1 61  ARG n 
1 62  GLN n 
1 63  VAL n 
1 64  GLY n 
1 65  GLN n 
1 66  PRO n 
1 67  MET n 
1 68  HIS n 
1 69  ILE n 
1 70  ILE n 
1 71  ILE n 
1 72  GLY n 
1 73  ASN n 
1 74  MET n 
1 75  PHE n 
1 76  LYS n 
1 77  LEU n 
1 78  GLU n 
1 79  PHE n 
1 80  TRP n 
1 81  GLU n 
1 82  ILE n 
1 83  LEU n 
1 84  LEU n 
1 85  THR n 
1 86  SER n 
1 87  MET n 
1 88  ARG n 
1 89  VAL n 
1 90  HIS n 
1 91  GLU n 
1 92  VAL n 
1 93  ALA n 
1 94  GLU n 
1 95  PHE n 
1 96  TRP n 
1 97  CYS n 
1 98  ASP n 
1 99  THR n 
1 100 ILE n 
1 101 HIS n 
1 102 THR n 
1 103 GLY n 
1 104 VAL n 
1 105 TYR n 
1 106 PRO n 
1 107 ILE n 
1 108 LEU n 
1 109 SER n 
1 110 ARG n 
1 111 SER n 
1 112 LEU n 
1 113 ARG n 
1 114 GLN n 
1 115 MET n 
1 116 ALA n 
1 117 GLN n 
1 118 GLY n 
1 119 LYS n 
1 120 ASP n 
1 121 PRO n 
1 122 THR n 
1 123 GLU n 
1 124 TRP n 
1 125 HIS n 
1 126 VAL n 
1 127 HIS n 
1 128 THR n 
1 129 CYS n 
1 130 GLY n 
1 131 LEU n 
1 132 ALA n 
1 133 ASN n 
1 134 MET n 
1 135 PHE n 
1 136 ALA n 
1 137 TYR n 
1 138 HIS n 
1 139 THR n 
1 140 LEU n 
1 141 GLY n 
1 142 TYR n 
1 143 GLU n 
1 144 ASP n 
1 145 LEU n 
1 146 ASP n 
1 147 GLU n 
1 148 LEU n 
1 149 GLN n 
1 150 LYS n 
1 151 GLU n 
1 152 PRO n 
1 153 GLN n 
1 154 PRO n 
1 155 LEU n 
1 156 VAL n 
1 157 PHE n 
1 158 VAL n 
1 159 ILE n 
1 160 GLU n 
1 161 LEU n 
1 162 LEU n 
1 163 GLN n 
1 164 VAL n 
1 165 ASP n 
1 166 ALA n 
1 167 PRO n 
1 168 SER n 
1 169 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   169 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'AIPL1, AIPL2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET15b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AIPL1_HUMAN 
_struct_ref.pdbx_db_accession          Q9NZN9 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DAALLLNVEGVKKTILHGGTGELPNFITGSRVIFHFRTMKCDEERTVIDDSRQVGQPMHIIIGNMFKLEVWEILLTSMRV
HEVAEFWCDTIHTGVYPILSRSLRQMAQGKDPTEWHVHTCGLANMFAYHTLGYEDLDELQKEPQPLVFVIELLQVDAPSD

;
_struct_ref.pdbx_align_begin           2 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5V35 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 10 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 169 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9NZN9 
_struct_ref_seq.db_align_beg                  2 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  161 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       161 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5V35 MET A 1  ? UNP Q9NZN9 ?   ?  'initiating methionine' -7 1  
1 5V35 GLY A 2  ? UNP Q9NZN9 ?   ?  'expression tag'        -6 2  
1 5V35 HIS A 3  ? UNP Q9NZN9 ?   ?  'expression tag'        -5 3  
1 5V35 HIS A 4  ? UNP Q9NZN9 ?   ?  'expression tag'        -4 4  
1 5V35 HIS A 5  ? UNP Q9NZN9 ?   ?  'expression tag'        -3 5  
1 5V35 HIS A 6  ? UNP Q9NZN9 ?   ?  'expression tag'        -2 6  
1 5V35 HIS A 7  ? UNP Q9NZN9 ?   ?  'expression tag'        -1 7  
1 5V35 HIS A 8  ? UNP Q9NZN9 ?   ?  'expression tag'        0  8  
1 5V35 GLY A 9  ? UNP Q9NZN9 ?   ?  'expression tag'        1  9  
1 5V35 PHE A 79 ? UNP Q9NZN9 VAL 71 'engineered mutation'   71 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
FAR non-polymer         . FARNESYL        ? 'C15 H26'        206.367 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5V35 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.40 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         48.81 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;100 mM Na-Citrate
20 % (W/V) PEG 4000
20 % (V/V) 2-Propanol
;
_exptl_crystal_grow.pdbx_pH_range   5-7 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CMOS 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RDI CMOS_8M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-11-09 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ALS BEAMLINE 4.2.2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   4.2.2 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.B_iso_Wilson_estimate            63.99 
_reflns.entry_id                         5V35 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.5 
_reflns.d_resolution_low                 53.475 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       6744 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  13.8 
_reflns.pdbx_Rmerge_I_obs                0.055 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            23.8 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.999 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.5 
_reflns_shell.d_res_low                   2.64 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         3.5 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           741 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        99.9 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.681 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             13.0 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.984 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5V35 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     6393 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             53.47 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    99.82 
_refine.ls_R_factor_obs                          0.21871 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.21601 
_refine.ls_R_factor_R_free                       0.27242 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  331 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.952 
_refine.correlation_coeff_Fo_to_Fc_free          0.938 
_refine.B_iso_mean                               76.432 
_refine.aniso_B[1][1]                            7.79 
_refine.aniso_B[2][2]                            1.19 
_refine.aniso_B[3][3]                            -8.99 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      5U9A 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.468 
_refine.pdbx_overall_ESU_R_Free                  0.299 
_refine.overall_SU_ML                            0.292 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             14.423 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        1174 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         15 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               1189 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        53.47 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.014  0.019  ? 1219 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.002  0.020  ? 1091 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.729  1.937  ? 1661 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.011  2.993  ? 2513 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.756  5.000  ? 151  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       32.885 24.074 ? 54   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       18.039 15.000 ? 181  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       12.946 15.000 ? 5    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.095  0.200  ? 188  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.021  ? 1370 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.002  0.020  ? 253  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  6.369  7.952  ? 607  'X-RAY DIFFRACTION' ? 
r_mcbond_other               6.371  7.949  ? 606  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 9.237  11.906 ? 757  'X-RAY DIFFRACTION' ? 
r_mcangle_other              9.231  11.909 ? 758  'X-RAY DIFFRACTION' ? 
r_scbond_it                  6.303  8.193  ? 612  'X-RAY DIFFRACTION' ? 
r_scbond_other               6.301  8.198  ? 613  'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_other              9.439  12.197 ? 905  'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       12.660 94.347 ? 1349 'X-RAY DIFFRACTION' ? 
r_long_range_B_other         12.656 94.366 ? 1350 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.500 
_refine_ls_shell.d_res_low                        2.565 
_refine_ls_shell.number_reflns_R_work             458 
_refine_ls_shell.R_factor_R_work                  0.392 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.267 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             18 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                     5V35 
_struct.title                        
;Crystal structure of V71F mutant of the FKBP domain of human aryl hydrocarbon receptor-interacting protein-like 1 (AIPL1) complexed with S-farnesyl-L-cysteine methyl ester
;
_struct.pdbx_descriptor              'Aryl hydrocarbon receptor-interacting protein-like 1 (AIPL1)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5V35 
_struct_keywords.text            'AIPL1, FKBP, chaperone, PDE6, photoreceptor, LCA, isoprenyl, SIGNALING PROTEIN' 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 SER A 60  ? GLY A 64  ? SER A 52  GLY A 56  1 ? 5  
HELX_P HELX_P2 AA2 GLU A 78  ? THR A 85  ? GLU A 70  THR A 77  1 ? 8  
HELX_P HELX_P3 AA3 THR A 99  ? THR A 102 ? THR A 91  THR A 94  5 ? 4  
HELX_P HELX_P4 AA4 VAL A 104 ? GLN A 117 ? VAL A 96  GLN A 109 1 ? 14 
HELX_P HELX_P5 AA5 GLU A 123 ? HIS A 138 ? GLU A 115 HIS A 130 1 ? 16 
HELX_P HELX_P6 AA6 TYR A 142 ? LYS A 150 ? TYR A 134 LYS A 142 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 20  ? HIS A 26  ? VAL A 12  HIS A 18  
AA1 2 VAL A 92  ? CYS A 97  ? VAL A 84  CYS A 89  
AA1 3 LEU A 155 ? ASP A 165 ? LEU A 147 ASP A 157 
AA1 4 ARG A 40  ? LYS A 49  ? ARG A 32  LYS A 41  
AA1 5 VAL A 56  ? ASP A 59  ? VAL A 48  ASP A 51  
AA2 1 VAL A 20  ? HIS A 26  ? VAL A 12  HIS A 18  
AA2 2 VAL A 92  ? CYS A 97  ? VAL A 84  CYS A 89  
AA2 3 LEU A 155 ? ASP A 165 ? LEU A 147 ASP A 157 
AA2 4 ARG A 40  ? LYS A 49  ? ARG A 32  LYS A 41  
AA2 5 MET A 67  ? ILE A 70  ? MET A 59  ILE A 62  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LYS A 21  ? N LYS A 13  O TRP A 96  ? O TRP A 88  
AA1 2 3 N PHE A 95  ? N PHE A 87  O PHE A 157 ? O PHE A 149 
AA1 3 4 O VAL A 156 ? O VAL A 148 N MET A 48  ? N MET A 40  
AA1 4 5 N THR A 47  ? N THR A 39  O ILE A 57  ? O ILE A 49  
AA2 1 2 N LYS A 21  ? N LYS A 13  O TRP A 96  ? O TRP A 88  
AA2 2 3 N PHE A 95  ? N PHE A 87  O PHE A 157 ? O PHE A 149 
AA2 3 4 O VAL A 156 ? O VAL A 148 N MET A 48  ? N MET A 40  
AA2 4 5 N VAL A 41  ? N VAL A 33  O ILE A 69  ? O ILE A 61  
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    FAR 
_struct_site.pdbx_auth_seq_id     201 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'binding site for residue FAR A 201' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 PHE A 45  ? PHE A 37  . ? 1_555 ? 
2 AC1 6 MET A 67  ? MET A 59  . ? 1_555 ? 
3 AC1 6 TRP A 80  ? TRP A 72  . ? 1_555 ? 
4 AC1 6 LEU A 108 ? LEU A 100 . ? 1_555 ? 
5 AC1 6 LEU A 112 ? LEU A 104 . ? 1_555 ? 
6 AC1 6 PHE A 157 ? PHE A 149 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5V35 
_atom_sites.fract_transf_matrix[1][1]   0.018815 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015263 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009350 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASN A 1 16  ? -1.087  30.723  9.952  1.00 127.22 ?  8   ASN A N   1 
ATOM   2    C CA  . ASN A 1 16  ? -0.284  30.752  8.736  1.00 140.14 ?  8   ASN A CA  1 
ATOM   3    C C   . ASN A 1 16  ? -1.061  30.260  7.520  1.00 143.96 ?  8   ASN A C   1 
ATOM   4    O O   . ASN A 1 16  ? -0.964  30.833  6.435  1.00 131.98 ?  8   ASN A O   1 
ATOM   5    C CB  . ASN A 1 16  ? 0.991   29.925  8.915  1.00 133.43 ?  8   ASN A CB  1 
ATOM   6    C CG  . ASN A 1 16  ? 1.597   30.081  10.296 1.00 122.99 ?  8   ASN A CG  1 
ATOM   7    O OD1 . ASN A 1 16  ? 0.965   29.762  11.304 1.00 102.54 ?  8   ASN A OD1 1 
ATOM   8    N ND2 . ASN A 1 16  ? 2.828   30.575  10.349 1.00 109.68 ?  8   ASN A ND2 1 
ATOM   9    N N   . VAL A 1 17  ? -1.833  29.194  7.709  1.00 138.89 ?  9   VAL A N   1 
ATOM   10   C CA  . VAL A 1 17  ? -2.628  28.622  6.628  1.00 124.69 ?  9   VAL A CA  1 
ATOM   11   C C   . VAL A 1 17  ? -4.118  28.699  6.941  1.00 111.65 ?  9   VAL A C   1 
ATOM   12   O O   . VAL A 1 17  ? -4.514  28.835  8.098  1.00 113.34 ?  9   VAL A O   1 
ATOM   13   C CB  . VAL A 1 17  ? -2.243  27.155  6.360  1.00 132.46 ?  9   VAL A CB  1 
ATOM   14   C CG1 . VAL A 1 17  ? -2.649  26.750  4.951  1.00 133.57 ?  9   VAL A CG1 1 
ATOM   15   C CG2 . VAL A 1 17  ? -0.751  26.951  6.572  1.00 130.99 ?  9   VAL A CG2 1 
ATOM   16   N N   . GLU A 1 18  ? -4.941  28.610  5.900  1.00 114.44 ?  10  GLU A N   1 
ATOM   17   C CA  . GLU A 1 18  ? -6.389  28.669  6.061  1.00 109.87 ?  10  GLU A CA  1 
ATOM   18   C C   . GLU A 1 18  ? -6.910  27.450  6.816  1.00 98.92  ?  10  GLU A C   1 
ATOM   19   O O   . GLU A 1 18  ? -6.371  26.351  6.688  1.00 94.11  ?  10  GLU A O   1 
ATOM   20   C CB  . GLU A 1 18  ? -7.076  28.776  4.698  1.00 112.83 ?  10  GLU A CB  1 
ATOM   21   C CG  . GLU A 1 18  ? -6.581  29.931  3.843  1.00 124.00 ?  10  GLU A CG  1 
ATOM   22   C CD  . GLU A 1 18  ? -7.371  31.205  4.072  1.00 131.24 ?  10  GLU A CD  1 
ATOM   23   O OE1 . GLU A 1 18  ? -8.567  31.110  4.419  1.00 137.76 ?  10  GLU A OE1 1 
ATOM   24   O OE2 . GLU A 1 18  ? -6.796  32.301  3.904  1.00 125.50 -1 10  GLU A OE2 1 
ATOM   25   N N   . GLY A 1 19  ? -7.962  27.654  7.603  1.00 97.73  ?  11  GLY A N   1 
ATOM   26   C CA  . GLY A 1 19  ? -8.555  26.578  8.376  1.00 90.70  ?  11  GLY A CA  1 
ATOM   27   C C   . GLY A 1 19  ? -7.535  25.838  9.220  1.00 95.83  ?  11  GLY A C   1 
ATOM   28   O O   . GLY A 1 19  ? -7.522  24.608  9.257  1.00 88.95  ?  11  GLY A O   1 
ATOM   29   N N   . VAL A 1 20  ? -6.678  26.593  9.899  1.00 93.48  ?  12  VAL A N   1 
ATOM   30   C CA  . VAL A 1 20  ? -5.647  26.006  10.748 1.00 91.73  ?  12  VAL A CA  1 
ATOM   31   C C   . VAL A 1 20  ? -5.184  26.993  11.814 1.00 90.91  ?  12  VAL A C   1 
ATOM   32   O O   . VAL A 1 20  ? -4.515  27.981  11.511 1.00 107.87 ?  12  VAL A O   1 
ATOM   33   C CB  . VAL A 1 20  ? -4.430  25.547  9.923  1.00 88.08  ?  12  VAL A CB  1 
ATOM   34   C CG1 . VAL A 1 20  ? -3.332  25.032  10.840 1.00 83.71  ?  12  VAL A CG1 1 
ATOM   35   C CG2 . VAL A 1 20  ? -4.841  24.481  8.920  1.00 86.52  ?  12  VAL A CG2 1 
ATOM   36   N N   . LYS A 1 21  ? -5.543  26.718  13.064 1.00 90.18  ?  13  LYS A N   1 
ATOM   37   C CA  . LYS A 1 21  ? -5.161  27.588  14.187 1.00 86.71  ?  13  LYS A CA  1 
ATOM   38   C C   . LYS A 1 21  ? -4.115  26.832  15.024 1.00 87.02  ?  13  LYS A C   1 
ATOM   39   O O   . LYS A 1 21  ? -4.409  25.742  15.572 1.00 78.30  ?  13  LYS A O   1 
ATOM   40   C CB  . LYS A 1 21  ? -6.377  27.948  15.058 1.00 84.54  ?  13  LYS A CB  1 
ATOM   41   N N   . LYS A 1 22  ? -2.897  27.393  15.075 1.00 74.28  ?  14  LYS A N   1 
ATOM   42   C CA  . LYS A 1 22  ? -1.815  26.880  15.926 1.00 69.85  ?  14  LYS A CA  1 
ATOM   43   C C   . LYS A 1 22  ? -1.686  27.690  17.231 1.00 76.74  ?  14  LYS A C   1 
ATOM   44   O O   . LYS A 1 22  ? -1.908  28.903  17.237 1.00 87.20  ?  14  LYS A O   1 
ATOM   45   C CB  . LYS A 1 22  ? -0.479  26.913  15.181 1.00 59.78  ?  14  LYS A CB  1 
ATOM   46   C CG  . LYS A 1 22  ? 0.705   26.601  16.099 1.00 59.47  ?  14  LYS A CG  1 
ATOM   47   C CD  . LYS A 1 22  ? 2.006   26.412  15.367 1.00 55.51  ?  14  LYS A CD  1 
ATOM   48   C CE  . LYS A 1 22  ? 3.058   25.941  16.333 1.00 57.81  ?  14  LYS A CE  1 
ATOM   49   N NZ  . LYS A 1 22  ? 4.394   25.789  15.699 1.00 62.90  ?  14  LYS A NZ  1 
ATOM   50   N N   . THR A 1 23  ? -1.309  27.010  18.316 1.00 76.30  ?  15  THR A N   1 
ATOM   51   C CA  . THR A 1 23  ? -1.107  27.621  19.631 1.00 70.31  ?  15  THR A CA  1 
ATOM   52   C C   . THR A 1 23  ? 0.038   26.905  20.317 1.00 70.15  ?  15  THR A C   1 
ATOM   53   O O   . THR A 1 23  ? -0.064  25.735  20.579 1.00 66.28  ?  15  THR A O   1 
ATOM   54   C CB  . THR A 1 23  ? -2.362  27.463  20.498 1.00 76.46  ?  15  THR A CB  1 
ATOM   55   O OG1 . THR A 1 23  ? -2.675  26.064  20.661 1.00 91.85  ?  15  THR A OG1 1 
ATOM   56   C CG2 . THR A 1 23  ? -3.520  28.170  19.857 1.00 82.70  ?  15  THR A CG2 1 
ATOM   57   N N   . ILE A 1 24  ? 1.143   27.583  20.588 1.00 75.95  ?  16  ILE A N   1 
ATOM   58   C CA  . ILE A 1 24  ? 2.262   26.943  21.287 1.00 76.35  ?  16  ILE A CA  1 
ATOM   59   C C   . ILE A 1 24  ? 1.925   26.714  22.758 1.00 79.96  ?  16  ILE A C   1 
ATOM   60   O O   . ILE A 1 24  ? 1.291   27.527  23.387 1.00 92.36  ?  16  ILE A O   1 
ATOM   61   C CB  . ILE A 1 24  ? 3.545   27.767  21.145 1.00 80.66  ?  16  ILE A CB  1 
ATOM   62   C CG1 . ILE A 1 24  ? 3.836   27.889  19.635 1.00 88.23  ?  16  ILE A CG1 1 
ATOM   63   C CG2 . ILE A 1 24  ? 4.699   27.141  21.950 1.00 79.34  ?  16  ILE A CG2 1 
ATOM   64   C CD1 . ILE A 1 24  ? 5.221   28.364  19.262 1.00 94.82  ?  16  ILE A CD1 1 
ATOM   65   N N   . LEU A 1 25  ? 2.336   25.576  23.285 1.00 85.31  ?  17  LEU A N   1 
ATOM   66   C CA  . LEU A 1 25  ? 2.101   25.212  24.683 1.00 82.50  ?  17  LEU A CA  1 
ATOM   67   C C   . LEU A 1 25  ? 3.376   25.203  25.512 1.00 81.59  ?  17  LEU A C   1 
ATOM   68   O O   . LEU A 1 25  ? 3.353   25.550  26.683 1.00 100.23 ?  17  LEU A O   1 
ATOM   69   C CB  . LEU A 1 25  ? 1.470   23.819  24.744 1.00 81.30  ?  17  LEU A CB  1 
ATOM   70   C CG  . LEU A 1 25  ? 0.089   23.666  24.115 1.00 74.25  ?  17  LEU A CG  1 
ATOM   71   C CD1 . LEU A 1 25  ? -0.449  22.325  24.506 1.00 73.50  ?  17  LEU A CD1 1 
ATOM   72   C CD2 . LEU A 1 25  ? -0.884  24.743  24.577 1.00 78.84  ?  17  LEU A CD2 1 
ATOM   73   N N   . HIS A 1 26  ? 4.471   24.748  24.925 1.00 73.71  ?  18  HIS A N   1 
ATOM   74   C CA  . HIS A 1 26  ? 5.753   24.814  25.565 1.00 68.99  ?  18  HIS A CA  1 
ATOM   75   C C   . HIS A 1 26  ? 6.807   24.938  24.484 1.00 75.45  ?  18  HIS A C   1 
ATOM   76   O O   . HIS A 1 26  ? 7.162   23.946  23.853 1.00 75.34  ?  18  HIS A O   1 
ATOM   77   C CB  . HIS A 1 26  ? 5.941   23.594  26.435 1.00 67.34  ?  18  HIS A CB  1 
ATOM   78   C CG  . HIS A 1 26  ? 7.357   23.299  26.813 1.00 64.08  ?  18  HIS A CG  1 
ATOM   79   N ND1 . HIS A 1 26  ? 7.983   23.900  27.880 1.00 67.64  ?  18  HIS A ND1 1 
ATOM   80   C CD2 . HIS A 1 26  ? 8.236   22.392  26.327 1.00 67.63  ?  18  HIS A CD2 1 
ATOM   81   C CE1 . HIS A 1 26  ? 9.203   23.407  28.010 1.00 70.74  ?  18  HIS A CE1 1 
ATOM   82   N NE2 . HIS A 1 26  ? 9.389   22.498  27.070 1.00 69.84  ?  18  HIS A NE2 1 
ATOM   83   N N   . GLY A 1 27  ? 7.255   26.190  24.280 1.00 81.86  ?  19  GLY A N   1 
ATOM   84   C CA  . GLY A 1 27  ? 8.338   26.592  23.375 1.00 69.72  ?  19  GLY A CA  1 
ATOM   85   C C   . GLY A 1 27  ? 9.557   25.759  23.625 1.00 70.60  ?  19  GLY A C   1 
ATOM   86   O O   . GLY A 1 27  ? 9.836   25.398  24.755 1.00 83.57  ?  19  GLY A O   1 
ATOM   87   N N   . GLY A 1 28  ? 10.267  25.410  22.567 1.00 73.42  ?  20  GLY A N   1 
ATOM   88   C CA  . GLY A 1 28  ? 11.381  24.503  22.700 1.00 82.51  ?  20  GLY A CA  1 
ATOM   89   C C   . GLY A 1 28  ? 12.656  25.282  22.568 1.00 99.73  ?  20  GLY A C   1 
ATOM   90   O O   . GLY A 1 28  ? 12.631  26.476  22.240 1.00 95.76  ?  20  GLY A O   1 
ATOM   91   N N   . THR A 1 29  ? 13.772  24.605  22.816 1.00 110.10 ?  21  THR A N   1 
ATOM   92   C CA  . THR A 1 29  ? 15.084  25.225  22.653 1.00 126.30 ?  21  THR A CA  1 
ATOM   93   C C   . THR A 1 29  ? 15.395  25.467  21.153 1.00 132.52 ?  21  THR A C   1 
ATOM   94   O O   . THR A 1 29  ? 14.850  24.788  20.261 1.00 121.78 ?  21  THR A O   1 
ATOM   95   C CB  . THR A 1 29  ? 16.222  24.419  23.348 1.00 130.47 ?  21  THR A CB  1 
ATOM   96   O OG1 . THR A 1 29  ? 16.369  23.131  22.739 1.00 133.18 ?  21  THR A OG1 1 
ATOM   97   C CG2 . THR A 1 29  ? 15.958  24.256  24.859 1.00 121.77 ?  21  THR A CG2 1 
ATOM   98   N N   . GLY A 1 30  ? 16.235  26.476  20.903 1.00 123.62 ?  22  GLY A N   1 
ATOM   99   C CA  . GLY A 1 30  ? 16.674  26.836  19.569 1.00 111.09 ?  22  GLY A CA  1 
ATOM   100  C C   . GLY A 1 30  ? 15.574  27.406  18.696 1.00 121.20 ?  22  GLY A C   1 
ATOM   101  O O   . GLY A 1 30  ? 14.406  27.515  19.121 1.00 101.56 ?  22  GLY A O   1 
ATOM   102  N N   . GLU A 1 31  ? 15.985  27.760  17.470 1.00 129.19 ?  23  GLU A N   1 
ATOM   103  C CA  . GLU A 1 31  ? 15.111  28.234  16.383 1.00 126.78 ?  23  GLU A CA  1 
ATOM   104  C C   . GLU A 1 31  ? 14.856  27.095  15.378 1.00 126.14 ?  23  GLU A C   1 
ATOM   105  O O   . GLU A 1 31  ? 15.580  26.088  15.394 1.00 108.65 ?  23  GLU A O   1 
ATOM   106  C CB  . GLU A 1 31  ? 15.773  29.430  15.675 1.00 128.71 ?  23  GLU A CB  1 
ATOM   107  C CG  . GLU A 1 31  ? 16.474  29.170  14.315 1.00 132.75 ?  23  GLU A CG  1 
ATOM   108  C CD  . GLU A 1 31  ? 17.686  28.251  14.357 1.00 128.36 ?  23  GLU A CD  1 
ATOM   109  O OE1 . GLU A 1 31  ? 18.020  27.759  15.462 1.00 124.40 ?  23  GLU A OE1 1 
ATOM   110  O OE2 . GLU A 1 31  ? 18.292  28.029  13.266 1.00 103.86 -1 23  GLU A OE2 1 
ATOM   111  N N   . LEU A 1 32  ? 13.893  27.272  14.495 1.00 119.55 ?  24  LEU A N   1 
ATOM   112  C CA  . LEU A 1 32  ? 13.580  26.264  13.509 1.00 112.99 ?  24  LEU A CA  1 
ATOM   113  C C   . LEU A 1 32  ? 14.774  25.453  13.115 1.00 106.62 ?  24  LEU A C   1 
ATOM   114  O O   . LEU A 1 32  ? 15.822  26.003  12.860 1.00 109.27 ?  24  LEU A O   1 
ATOM   115  C CB  . LEU A 1 32  ? 13.031  26.917  12.260 1.00 115.98 ?  24  LEU A CB  1 
ATOM   116  C CG  . LEU A 1 32  ? 11.632  26.428  11.941 1.00 121.92 ?  24  LEU A CG  1 
ATOM   117  C CD1 . LEU A 1 32  ? 10.695  26.853  13.048 1.00 117.48 ?  24  LEU A CD1 1 
ATOM   118  C CD2 . LEU A 1 32  ? 11.153  26.949  10.599 1.00 117.75 ?  24  LEU A CD2 1 
ATOM   119  N N   . PRO A 1 33  ? 14.579  24.080  13.079 1.00 100.39 ?  25  PRO A N   1 
ATOM   120  C CA  . PRO A 1 33  ? 15.745  23.318  12.642 1.00 94.77  ?  25  PRO A CA  1 
ATOM   121  C C   . PRO A 1 33  ? 15.766  23.186  11.134 1.00 88.74  ?  25  PRO A C   1 
ATOM   122  O O   . PRO A 1 33  ? 15.009  23.849  10.453 1.00 69.98  ?  25  PRO A O   1 
ATOM   123  C CB  . PRO A 1 33  ? 15.537  21.962  13.279 1.00 98.26  ?  25  PRO A CB  1 
ATOM   124  C CG  . PRO A 1 33  ? 14.096  21.757  13.166 1.00 99.31  ?  25  PRO A CG  1 
ATOM   125  C CD  . PRO A 1 33  ? 13.525  23.073  13.548 1.00 101.99 ?  25  PRO A CD  1 
ATOM   126  N N   . ASN A 1 34  ? 16.640  22.326  10.638 1.00 82.17  ?  26  ASN A N   1 
ATOM   127  C CA  . ASN A 1 34  ? 16.832  22.109  9.220  1.00 84.90  ?  26  ASN A CA  1 
ATOM   128  C C   . ASN A 1 34  ? 15.882  21.006  8.732  1.00 87.84  ?  26  ASN A C   1 
ATOM   129  O O   . ASN A 1 34  ? 16.229  19.821  8.715  1.00 83.41  ?  26  ASN A O   1 
ATOM   130  C CB  . ASN A 1 34  ? 18.297  21.750  8.946  1.00 85.73  ?  26  ASN A CB  1 
ATOM   131  C CG  . ASN A 1 34  ? 18.591  21.579  7.472  1.00 93.01  ?  26  ASN A CG  1 
ATOM   132  O OD1 . ASN A 1 34  ? 17.962  22.205  6.616  1.00 102.87 ?  26  ASN A OD1 1 
ATOM   133  N ND2 . ASN A 1 34  ? 19.544  20.713  7.164  1.00 99.41  ?  26  ASN A ND2 1 
ATOM   134  N N   . PHE A 1 35  ? 14.677  21.418  8.337  1.00 87.78  ?  27  PHE A N   1 
ATOM   135  C CA  . PHE A 1 35  ? 13.689  20.523  7.738  1.00 80.07  ?  27  PHE A CA  1 
ATOM   136  C C   . PHE A 1 35  ? 13.986  20.378  6.246  1.00 78.81  ?  27  PHE A C   1 
ATOM   137  O O   . PHE A 1 35  ? 13.153  20.752  5.395  1.00 63.40  ?  27  PHE A O   1 
ATOM   138  C CB  . PHE A 1 35  ? 12.252  21.052  7.939  1.00 76.94  ?  27  PHE A CB  1 
ATOM   139  C CG  . PHE A 1 35  ? 11.784  21.058  9.370  1.00 70.16  ?  27  PHE A CG  1 
ATOM   140  C CD1 . PHE A 1 35  ? 11.591  19.878  10.041 1.00 67.00  ?  27  PHE A CD1 1 
ATOM   141  C CD2 . PHE A 1 35  ? 11.495  22.247  10.020 1.00 65.44  ?  27  PHE A CD2 1 
ATOM   142  C CE1 . PHE A 1 35  ? 11.147  19.874  11.348 1.00 69.06  ?  27  PHE A CE1 1 
ATOM   143  C CE2 . PHE A 1 35  ? 11.035  22.255  11.315 1.00 70.09  ?  27  PHE A CE2 1 
ATOM   144  C CZ  . PHE A 1 35  ? 10.850  21.062  11.984 1.00 72.37  ?  27  PHE A CZ  1 
ATOM   145  N N   . ILE A 1 36  ? 15.162  19.820  5.929  1.00 80.09  ?  28  ILE A N   1 
ATOM   146  C CA  . ILE A 1 36  ? 15.556  19.596  4.533  1.00 85.51  ?  28  ILE A CA  1 
ATOM   147  C C   . ILE A 1 36  ? 15.004  18.249  4.061  1.00 89.16  ?  28  ILE A C   1 
ATOM   148  O O   . ILE A 1 36  ? 14.865  17.317  4.859  1.00 103.23 ?  28  ILE A O   1 
ATOM   149  C CB  . ILE A 1 36  ? 17.101  19.744  4.307  1.00 89.08  ?  28  ILE A CB  1 
ATOM   150  C CG1 . ILE A 1 36  ? 17.372  20.299  2.899  1.00 104.84 ?  28  ILE A CG1 1 
ATOM   151  C CG2 . ILE A 1 36  ? 17.889  18.443  4.523  1.00 78.72  ?  28  ILE A CG2 1 
ATOM   152  C CD1 . ILE A 1 36  ? 18.733  20.938  2.735  1.00 116.20 ?  28  ILE A CD1 1 
ATOM   153  N N   . THR A 1 37  ? 14.682  18.168  2.771  1.00 89.26  ?  29  THR A N   1 
ATOM   154  C CA  . THR A 1 37  ? 14.175  16.948  2.136  1.00 87.94  ?  29  THR A CA  1 
ATOM   155  C C   . THR A 1 37  ? 14.973  15.689  2.507  1.00 90.16  ?  29  THR A C   1 
ATOM   156  O O   . THR A 1 37  ? 16.209  15.695  2.440  1.00 82.79  ?  29  THR A O   1 
ATOM   157  C CB  . THR A 1 37  ? 14.141  17.130  0.610  1.00 87.62  ?  29  THR A CB  1 
ATOM   158  O OG1 . THR A 1 37  ? 13.094  18.052  0.285  1.00 86.40  ?  29  THR A OG1 1 
ATOM   159  C CG2 . THR A 1 37  ? 13.894  15.815  -0.117 1.00 88.43  ?  29  THR A CG2 1 
ATOM   160  N N   . GLY A 1 38  ? 14.247  14.636  2.918  1.00 89.13  ?  30  GLY A N   1 
ATOM   161  C CA  . GLY A 1 38  ? 14.847  13.375  3.398  1.00 92.82  ?  30  GLY A CA  1 
ATOM   162  C C   . GLY A 1 38  ? 15.188  13.309  4.893  1.00 94.80  ?  30  GLY A C   1 
ATOM   163  O O   . GLY A 1 38  ? 15.611  12.250  5.403  1.00 89.71  ?  30  GLY A O   1 
ATOM   164  N N   . SER A 1 39  ? 15.020  14.426  5.605  1.00 90.98  ?  31  SER A N   1 
ATOM   165  C CA  . SER A 1 39  ? 15.109  14.407  7.062  1.00 92.94  ?  31  SER A CA  1 
ATOM   166  C C   . SER A 1 39  ? 14.029  13.484  7.639  1.00 95.36  ?  31  SER A C   1 
ATOM   167  O O   . SER A 1 39  ? 12.936  13.379  7.052  1.00 79.35  ?  31  SER A O   1 
ATOM   168  C CB  . SER A 1 39  ? 14.941  15.811  7.644  1.00 94.42  ?  31  SER A CB  1 
ATOM   169  O OG  . SER A 1 39  ? 16.052  16.633  7.335  1.00 96.30  ?  31  SER A OG  1 
ATOM   170  N N   . ARG A 1 40  ? 14.369  12.799  8.742  1.00 91.14  ?  32  ARG A N   1 
ATOM   171  C CA  . ARG A 1 40  ? 13.407  12.054  9.567  1.00 91.65  ?  32  ARG A CA  1 
ATOM   172  C C   . ARG A 1 40  ? 13.011  12.912  10.786 1.00 86.82  ?  32  ARG A C   1 
ATOM   173  O O   . ARG A 1 40  ? 13.873  13.367  11.547 1.00 79.81  ?  32  ARG A O   1 
ATOM   174  C CB  . ARG A 1 40  ? 13.972  10.694  10.015 1.00 92.02  ?  32  ARG A CB  1 
ATOM   175  N N   . VAL A 1 41  ? 11.707  13.137  10.962 1.00 85.37  ?  33  VAL A N   1 
ATOM   176  C CA  . VAL A 1 41  ? 11.163  13.961  12.070 1.00 74.10  ?  33  VAL A CA  1 
ATOM   177  C C   . VAL A 1 41  ? 10.501  13.009  13.076 1.00 79.02  ?  33  VAL A C   1 
ATOM   178  O O   . VAL A 1 41  ? 9.640   12.190  12.705 1.00 75.58  ?  33  VAL A O   1 
ATOM   179  C CB  . VAL A 1 41  ? 10.111  14.948  11.551 1.00 71.18  ?  33  VAL A CB  1 
ATOM   180  C CG1 . VAL A 1 41  ? 9.771   15.994  12.593 1.00 71.99  ?  33  VAL A CG1 1 
ATOM   181  C CG2 . VAL A 1 41  ? 10.590  15.599  10.261 1.00 68.50  ?  33  VAL A CG2 1 
ATOM   182  N N   . ILE A 1 42  ? 10.915  13.120  14.339 1.00 76.08  ?  34  ILE A N   1 
ATOM   183  C CA  . ILE A 1 42  ? 10.517  12.194  15.393 1.00 67.31  ?  34  ILE A CA  1 
ATOM   184  C C   . ILE A 1 42  ? 9.662   12.970  16.371 1.00 65.35  ?  34  ILE A C   1 
ATOM   185  O O   . ILE A 1 42  ? 10.056  14.038  16.821 1.00 69.57  ?  34  ILE A O   1 
ATOM   186  C CB  . ILE A 1 42  ? 11.752  11.562  16.054 1.00 67.52  ?  34  ILE A CB  1 
ATOM   187  C CG1 . ILE A 1 42  ? 12.437  10.633  15.041 1.00 76.61  ?  34  ILE A CG1 1 
ATOM   188  C CG2 . ILE A 1 42  ? 11.362  10.744  17.277 1.00 67.88  ?  34  ILE A CG2 1 
ATOM   189  C CD1 . ILE A 1 42  ? 13.883  10.319  15.351 1.00 84.59  ?  34  ILE A CD1 1 
ATOM   190  N N   . PHE A 1 43  ? 8.478   12.458  16.692 1.00 67.44  ?  35  PHE A N   1 
ATOM   191  C CA  . PHE A 1 43  ? 7.519   13.244  17.486 1.00 66.26  ?  35  PHE A CA  1 
ATOM   192  C C   . PHE A 1 43  ? 6.481   12.380  18.179 1.00 64.11  ?  35  PHE A C   1 
ATOM   193  O O   . PHE A 1 43  ? 6.411   11.179  17.953 1.00 74.83  ?  35  PHE A O   1 
ATOM   194  C CB  . PHE A 1 43  ? 6.811   14.275  16.592 1.00 66.64  ?  35  PHE A CB  1 
ATOM   195  C CG  . PHE A 1 43  ? 6.010   13.658  15.466 1.00 59.83  ?  35  PHE A CG  1 
ATOM   196  C CD1 . PHE A 1 43  ? 6.647   13.082  14.377 1.00 63.44  ?  35  PHE A CD1 1 
ATOM   197  C CD2 . PHE A 1 43  ? 4.638   13.657  15.501 1.00 54.86  ?  35  PHE A CD2 1 
ATOM   198  C CE1 . PHE A 1 43  ? 5.928   12.502  13.361 1.00 58.41  ?  35  PHE A CE1 1 
ATOM   199  C CE2 . PHE A 1 43  ? 3.918   13.102  14.488 1.00 54.09  ?  35  PHE A CE2 1 
ATOM   200  C CZ  . PHE A 1 43  ? 4.562   12.525  13.412 1.00 56.66  ?  35  PHE A CZ  1 
ATOM   201  N N   . HIS A 1 44  ? 5.687   13.027  19.021 1.00 54.87  ?  36  HIS A N   1 
ATOM   202  C CA  . HIS A 1 44  ? 4.545   12.434  19.668 1.00 51.95  ?  36  HIS A CA  1 
ATOM   203  C C   . HIS A 1 44  ? 3.356   13.285  19.288 1.00 56.40  ?  36  HIS A C   1 
ATOM   204  O O   . HIS A 1 44  ? 3.451   14.519  19.158 1.00 56.99  ?  36  HIS A O   1 
ATOM   205  C CB  . HIS A 1 44  ? 4.689   12.408  21.200 1.00 53.47  ?  36  HIS A CB  1 
ATOM   206  C CG  . HIS A 1 44  ? 5.337   11.161  21.735 1.00 55.75  ?  36  HIS A CG  1 
ATOM   207  N ND1 . HIS A 1 44  ? 4.903   9.896   21.411 1.00 67.36  ?  36  HIS A ND1 1 
ATOM   208  C CD2 . HIS A 1 44  ? 6.351   10.990  22.609 1.00 56.75  ?  36  HIS A CD2 1 
ATOM   209  C CE1 . HIS A 1 44  ? 5.643   8.999   22.033 1.00 65.89  ?  36  HIS A CE1 1 
ATOM   210  N NE2 . HIS A 1 44  ? 6.534   9.638   22.763 1.00 60.58  ?  36  HIS A NE2 1 
ATOM   211  N N   . PHE A 1 45  ? 2.227   12.614  19.101 1.00 54.17  ?  37  PHE A N   1 
ATOM   212  C CA  . PHE A 1 45  ? 1.012   13.287  18.821 1.00 49.23  ?  37  PHE A CA  1 
ATOM   213  C C   . PHE A 1 45  ? -0.129  12.618  19.576 1.00 50.98  ?  37  PHE A C   1 
ATOM   214  O O   . PHE A 1 45  ? -0.050  11.450  20.041 1.00 45.24  ?  37  PHE A O   1 
ATOM   215  C CB  . PHE A 1 45  ? 0.759   13.292  17.317 1.00 53.70  ?  37  PHE A CB  1 
ATOM   216  C CG  . PHE A 1 45  ? 0.278   11.991  16.804 1.00 51.37  ?  37  PHE A CG  1 
ATOM   217  C CD1 . PHE A 1 45  ? 1.164   10.968  16.581 1.00 49.99  ?  37  PHE A CD1 1 
ATOM   218  C CD2 . PHE A 1 45  ? -1.067  11.789  16.568 1.00 49.60  ?  37  PHE A CD2 1 
ATOM   219  C CE1 . PHE A 1 45  ? 0.712   9.747   16.111 1.00 54.61  ?  37  PHE A CE1 1 
ATOM   220  C CE2 . PHE A 1 45  ? -1.521  10.572  16.124 1.00 51.23  ?  37  PHE A CE2 1 
ATOM   221  C CZ  . PHE A 1 45  ? -0.629  9.542   15.874 1.00 48.20  ?  37  PHE A CZ  1 
ATOM   222  N N   . ARG A 1 46  ? -1.169  13.412  19.741 1.00 47.15  ?  38  ARG A N   1 
ATOM   223  C CA  . ARG A 1 46  ? -2.350  12.976  20.372 1.00 53.00  ?  38  ARG A CA  1 
ATOM   224  C C   . ARG A 1 46  ? -3.380  13.672  19.536 1.00 59.21  ?  38  ARG A C   1 
ATOM   225  O O   . ARG A 1 46  ? -3.272  14.884  19.313 1.00 55.11  ?  38  ARG A O   1 
ATOM   226  C CB  . ARG A 1 46  ? -2.414  13.436  21.814 1.00 51.25  ?  38  ARG A CB  1 
ATOM   227  C CG  . ARG A 1 46  ? -3.761  13.123  22.448 1.00 65.34  ?  38  ARG A CG  1 
ATOM   228  C CD  . ARG A 1 46  ? -3.802  13.152  23.979 1.00 71.09  ?  38  ARG A CD  1 
ATOM   229  N NE  . ARG A 1 46  ? -4.104  14.483  24.520 1.00 67.55  ?  38  ARG A NE  1 
ATOM   230  C CZ  . ARG A 1 46  ? -3.199  15.391  24.913 1.00 75.39  ?  38  ARG A CZ  1 
ATOM   231  N NH1 . ARG A 1 46  ? -1.872  15.163  24.836 1.00 71.20  ?  38  ARG A NH1 1 
ATOM   232  N NH2 . ARG A 1 46  ? -3.629  16.568  25.386 1.00 72.89  ?  38  ARG A NH2 1 
ATOM   233  N N   . THR A 1 47  ? -4.367  12.910  19.068 1.00 59.42  ?  39  THR A N   1 
ATOM   234  C CA  . THR A 1 47  ? -5.345  13.410  18.128 1.00 54.90  ?  39  THR A CA  1 
ATOM   235  C C   . THR A 1 47  ? -6.671  13.389  18.822 1.00 50.89  ?  39  THR A C   1 
ATOM   236  O O   . THR A 1 47  ? -7.061  12.348  19.354 1.00 53.35  ?  39  THR A O   1 
ATOM   237  C CB  . THR A 1 47  ? -5.420  12.488  16.894 1.00 61.49  ?  39  THR A CB  1 
ATOM   238  O OG1 . THR A 1 47  ? -4.237  12.636  16.066 1.00 50.48  ?  39  THR A OG1 1 
ATOM   239  C CG2 . THR A 1 47  ? -6.685  12.799  16.096 1.00 63.09  ?  39  THR A CG2 1 
ATOM   240  N N   . MET A 1 48  ? -7.386  14.511  18.783 1.00 51.58  ?  40  MET A N   1 
ATOM   241  C CA  . MET A 1 48  ? -8.661  14.641  19.514 1.00 60.16  ?  40  MET A CA  1 
ATOM   242  C C   . MET A 1 48  ? -9.721  15.345  18.701 1.00 62.24  ?  40  MET A C   1 
ATOM   243  O O   . MET A 1 48  ? -9.454  16.283  17.935 1.00 56.97  ?  40  MET A O   1 
ATOM   244  C CB  . MET A 1 48  ? -8.528  15.439  20.841 1.00 56.99  ?  40  MET A CB  1 
ATOM   245  C CG  . MET A 1 48  ? -7.647  14.793  21.912 1.00 64.21  ?  40  MET A CG  1 
ATOM   246  S SD  . MET A 1 48  ? -6.777  15.971  22.989 1.00 64.36  ?  40  MET A SD  1 
ATOM   247  C CE  . MET A 1 48  ? -5.962  17.103  21.878 1.00 57.37  ?  40  MET A CE  1 
ATOM   248  N N   . LYS A 1 49  ? -10.947 14.931  18.963 1.00 63.64  ?  41  LYS A N   1 
ATOM   249  C CA  . LYS A 1 49  ? -12.089 15.673  18.518 1.00 70.04  ?  41  LYS A CA  1 
ATOM   250  C C   . LYS A 1 49  ? -12.178 17.050  19.196 1.00 76.55  ?  41  LYS A C   1 
ATOM   251  O O   . LYS A 1 49  ? -11.549 17.280  20.230 1.00 77.71  ?  41  LYS A O   1 
ATOM   252  C CB  . LYS A 1 49  ? -13.337 14.858  18.802 1.00 71.20  ?  41  LYS A CB  1 
ATOM   253  C CG  . LYS A 1 49  ? -13.341 13.500  18.108 1.00 67.76  ?  41  LYS A CG  1 
ATOM   254  C CD  . LYS A 1 49  ? -14.752 13.059  17.748 1.00 71.46  ?  41  LYS A CD  1 
ATOM   255  C CE  . LYS A 1 49  ? -15.025 11.614  18.126 1.00 83.53  ?  41  LYS A CE  1 
ATOM   256  N NZ  . LYS A 1 49  ? -16.406 11.480  18.647 1.00 82.68  ?  41  LYS A NZ  1 
ATOM   257  N N   . CYS A 1 50  ? -12.948 17.959  18.591 1.00 82.27  ?  42  CYS A N   1 
ATOM   258  C CA  . CYS A 1 50  ? -13.319 19.241  19.210 1.00 82.77  ?  42  CYS A CA  1 
ATOM   259  C C   . CYS A 1 50  ? -14.670 19.237  19.972 1.00 91.31  ?  42  CYS A C   1 
ATOM   260  O O   . CYS A 1 50  ? -15.373 20.252  19.984 1.00 108.01 ?  42  CYS A O   1 
ATOM   261  C CB  . CYS A 1 50  ? -13.355 20.336  18.156 1.00 78.69  ?  42  CYS A CB  1 
ATOM   262  S SG  . CYS A 1 50  ? -11.766 20.601  17.374 1.00 93.52  ?  42  CYS A SG  1 
ATOM   263  N N   . ASP A 1 51  ? -15.026 18.128  20.615 1.00 82.44  ?  43  ASP A N   1 
ATOM   264  C CA  . ASP A 1 51  ? -16.178 18.105  21.536 1.00 89.65  ?  43  ASP A CA  1 
ATOM   265  C C   . ASP A 1 51  ? -15.767 18.531  22.971 1.00 106.79 ?  43  ASP A C   1 
ATOM   266  O O   . ASP A 1 51  ? -14.633 18.986  23.171 1.00 118.67 ?  43  ASP A O   1 
ATOM   267  C CB  . ASP A 1 51  ? -16.832 16.728  21.510 1.00 87.54  ?  43  ASP A CB  1 
ATOM   268  C CG  . ASP A 1 51  ? -15.847 15.618  21.678 1.00 85.57  ?  43  ASP A CG  1 
ATOM   269  O OD1 . ASP A 1 51  ? -14.621 15.887  21.705 1.00 90.88  ?  43  ASP A OD1 1 
ATOM   270  O OD2 . ASP A 1 51  ? -16.300 14.472  21.754 1.00 78.88  -1 43  ASP A OD2 1 
ATOM   271  N N   . GLU A 1 52  ? -16.678 18.417  23.952 1.00 118.70 ?  44  GLU A N   1 
ATOM   272  C CA  . GLU A 1 52  ? -16.415 18.829  25.356 1.00 113.60 ?  44  GLU A CA  1 
ATOM   273  C C   . GLU A 1 52  ? -15.444 17.866  26.035 1.00 106.86 ?  44  GLU A C   1 
ATOM   274  O O   . GLU A 1 52  ? -14.378 18.277  26.515 1.00 109.06 ?  44  GLU A O   1 
ATOM   275  C CB  . GLU A 1 52  ? -17.725 18.921  26.166 1.00 105.56 ?  44  GLU A CB  1 
ATOM   276  N N   . GLU A 1 53  ? -15.810 16.583  26.023 1.00 97.53  ?  45  GLU A N   1 
ATOM   277  C CA  . GLU A 1 53  ? -14.956 15.486  26.511 1.00 95.24  ?  45  GLU A CA  1 
ATOM   278  C C   . GLU A 1 53  ? -13.575 15.433  25.821 1.00 94.35  ?  45  GLU A C   1 
ATOM   279  O O   . GLU A 1 53  ? -12.685 14.678  26.255 1.00 92.85  ?  45  GLU A O   1 
ATOM   280  C CB  . GLU A 1 53  ? -15.675 14.117  26.345 1.00 92.91  ?  45  GLU A CB  1 
ATOM   281  N N   . ARG A 1 54  ? -13.427 16.183  24.721 1.00 92.72  ?  46  ARG A N   1 
ATOM   282  C CA  . ARG A 1 54  ? -12.179 16.301  23.953 1.00 85.19  ?  46  ARG A CA  1 
ATOM   283  C C   . ARG A 1 54  ? -11.602 14.942  23.554 1.00 76.85  ?  46  ARG A C   1 
ATOM   284  O O   . ARG A 1 54  ? -10.417 14.668  23.685 1.00 73.78  ?  46  ARG A O   1 
ATOM   285  C CB  . ARG A 1 54  ? -11.184 17.161  24.713 1.00 87.44  ?  46  ARG A CB  1 
ATOM   286  C CG  . ARG A 1 54  ? -10.993 18.532  24.094 1.00 90.67  ?  46  ARG A CG  1 
ATOM   287  C CD  . ARG A 1 54  ? -9.582  19.003  24.336 1.00 88.78  ?  46  ARG A CD  1 
ATOM   288  N NE  . ARG A 1 54  ? -9.177  20.058  23.427 1.00 84.31  ?  46  ARG A NE  1 
ATOM   289  C CZ  . ARG A 1 54  ? -8.007  20.687  23.511 1.00 88.41  ?  46  ARG A CZ  1 
ATOM   290  N NH1 . ARG A 1 54  ? -7.101  20.381  24.464 1.00 104.49 ?  46  ARG A NH1 1 
ATOM   291  N NH2 . ARG A 1 54  ? -7.739  21.640  22.650 1.00 77.50  ?  46  ARG A NH2 1 
ATOM   292  N N   . THR A 1 55  ? -12.494 14.121  23.028 1.00 67.72  ?  47  THR A N   1 
ATOM   293  C CA  . THR A 1 55  ? -12.280 12.702  22.860 1.00 74.65  ?  47  THR A CA  1 
ATOM   294  C C   . THR A 1 55  ? -11.025 12.365  22.080 1.00 68.15  ?  47  THR A C   1 
ATOM   295  O O   . THR A 1 55  ? -10.847 12.860  20.975 1.00 78.70  ?  47  THR A O   1 
ATOM   296  C CB  . THR A 1 55  ? -13.486 12.095  22.119 1.00 75.79  ?  47  THR A CB  1 
ATOM   297  O OG1 . THR A 1 55  ? -14.687 12.622  22.700 1.00 69.21  ?  47  THR A OG1 1 
ATOM   298  C CG2 . THR A 1 55  ? -13.465 10.549  22.187 1.00 70.07  ?  47  THR A CG2 1 
ATOM   299  N N   . VAL A 1 56  ? -10.166 11.535  22.668 1.00 65.50  ?  48  VAL A N   1 
ATOM   300  C CA  . VAL A 1 56  ? -8.902  11.151  22.047 1.00 61.52  ?  48  VAL A CA  1 
ATOM   301  C C   . VAL A 1 56  ? -9.239  10.090  21.048 1.00 61.85  ?  48  VAL A C   1 
ATOM   302  O O   . VAL A 1 56  ? -10.058 9.247   21.329 1.00 68.87  ?  48  VAL A O   1 
ATOM   303  C CB  . VAL A 1 56  ? -7.874  10.600  23.077 1.00 59.25  ?  48  VAL A CB  1 
ATOM   304  C CG1 . VAL A 1 56  ? -6.728  9.875   22.412 1.00 63.96  ?  48  VAL A CG1 1 
ATOM   305  C CG2 . VAL A 1 56  ? -7.273  11.724  23.893 1.00 67.27  ?  48  VAL A CG2 1 
ATOM   306  N N   . ILE A 1 57  ? -8.594  10.148  19.888 1.00 62.15  ?  49  ILE A N   1 
ATOM   307  C CA  . ILE A 1 57  ? -8.686  9.114   18.869 1.00 59.96  ?  49  ILE A CA  1 
ATOM   308  C C   . ILE A 1 57  ? -7.372  8.341   18.723 1.00 57.03  ?  49  ILE A C   1 
ATOM   309  O O   . ILE A 1 57  ? -7.384  7.165   18.446 1.00 57.93  ?  49  ILE A O   1 
ATOM   310  C CB  . ILE A 1 57  ? -9.131  9.755   17.544 1.00 66.44  ?  49  ILE A CB  1 
ATOM   311  C CG1 . ILE A 1 57  ? -10.576 10.237  17.678 1.00 71.54  ?  49  ILE A CG1 1 
ATOM   312  C CG2 . ILE A 1 57  ? -9.062  8.771   16.396 1.00 71.50  ?  49  ILE A CG2 1 
ATOM   313  C CD1 . ILE A 1 57  ? -10.913 11.393  16.785 1.00 74.65  ?  49  ILE A CD1 1 
ATOM   314  N N   . ASP A 1 58  ? -6.232  8.997   18.873 1.00 56.92  ?  50  ASP A N   1 
ATOM   315  C CA  . ASP A 1 58  ? -4.945  8.308   18.770 1.00 55.19  ?  50  ASP A CA  1 
ATOM   316  C C   . ASP A 1 58  ? -3.947  9.023   19.661 1.00 52.79  ?  50  ASP A C   1 
ATOM   317  O O   . ASP A 1 58  ? -3.992  10.245  19.784 1.00 55.28  ?  50  ASP A O   1 
ATOM   318  C CB  . ASP A 1 58  ? -4.420  8.335   17.337 1.00 57.67  ?  50  ASP A CB  1 
ATOM   319  C CG  . ASP A 1 58  ? -5.174  7.413   16.407 1.00 65.20  ?  50  ASP A CG  1 
ATOM   320  O OD1 . ASP A 1 58  ? -5.183  6.179   16.645 1.00 61.83  ?  50  ASP A OD1 1 
ATOM   321  O OD2 . ASP A 1 58  ? -5.751  7.936   15.427 1.00 67.55  -1 50  ASP A OD2 1 
ATOM   322  N N   . ASP A 1 59  ? -3.031  8.269   20.243 1.00 52.66  ?  51  ASP A N   1 
ATOM   323  C CA  . ASP A 1 59  ? -2.036  8.823   21.145 1.00 55.18  ?  51  ASP A CA  1 
ATOM   324  C C   . ASP A 1 59  ? -0.804  7.934   21.090 1.00 53.50  ?  51  ASP A C   1 
ATOM   325  O O   . ASP A 1 59  ? -0.828  6.786   21.524 1.00 53.82  ?  51  ASP A O   1 
ATOM   326  C CB  . ASP A 1 59  ? -2.607  8.901   22.563 1.00 60.87  ?  51  ASP A CB  1 
ATOM   327  C CG  . ASP A 1 59  ? -1.677  9.661   23.566 1.00 72.08  ?  51  ASP A CG  1 
ATOM   328  O OD1 . ASP A 1 59  ? -0.469  9.844   23.279 1.00 70.36  ?  51  ASP A OD1 1 
ATOM   329  O OD2 . ASP A 1 59  ? -2.174  10.058  24.658 1.00 65.90  -1 51  ASP A OD2 1 
ATOM   330  N N   . SER A 1 60  ? 0.273   8.467   20.543 1.00 51.42  ?  52  SER A N   1 
ATOM   331  C CA  . SER A 1 60  ? 1.529   7.735   20.454 1.00 54.26  ?  52  SER A CA  1 
ATOM   332  C C   . SER A 1 60  ? 2.101   7.376   21.823 1.00 52.34  ?  52  SER A C   1 
ATOM   333  O O   . SER A 1 60  ? 2.809   6.390   21.939 1.00 66.13  ?  52  SER A O   1 
ATOM   334  C CB  . SER A 1 60  ? 2.573   8.549   19.664 1.00 52.39  ?  52  SER A CB  1 
ATOM   335  O OG  . SER A 1 60  ? 2.572   9.897   20.102 1.00 50.81  ?  52  SER A OG  1 
ATOM   336  N N   . ARG A 1 61  ? 1.807   8.159   22.849 1.00 52.54  ?  53  ARG A N   1 
ATOM   337  C CA  . ARG A 1 61  ? 2.288   7.851   24.233 1.00 63.95  ?  53  ARG A CA  1 
ATOM   338  C C   . ARG A 1 61  ? 1.580   6.638   24.806 1.00 69.67  ?  53  ARG A C   1 
ATOM   339  O O   . ARG A 1 61  ? 2.205   5.815   25.495 1.00 77.66  ?  53  ARG A O   1 
ATOM   340  C CB  . ARG A 1 61  ? 2.140   9.051   25.210 1.00 62.47  ?  53  ARG A CB  1 
ATOM   341  C CG  . ARG A 1 61  ? 3.167   10.168  24.964 1.00 60.39  ?  53  ARG A CG  1 
ATOM   342  C CD  . ARG A 1 61  ? 2.963   11.367  25.861 1.00 66.57  ?  53  ARG A CD  1 
ATOM   343  N NE  . ARG A 1 61  ? 3.742   12.506  25.395 1.00 67.31  ?  53  ARG A NE  1 
ATOM   344  C CZ  . ARG A 1 61  ? 5.058   12.621  25.503 1.00 72.58  ?  53  ARG A CZ  1 
ATOM   345  N NH1 . ARG A 1 61  ? 5.800   11.691  26.105 1.00 68.05  ?  53  ARG A NH1 1 
ATOM   346  N NH2 . ARG A 1 61  ? 5.640   13.698  24.994 1.00 83.80  ?  53  ARG A NH2 1 
ATOM   347  N N   . GLN A 1 62  ? 0.292   6.522   24.484 1.00 65.70  ?  54  GLN A N   1 
ATOM   348  C CA  . GLN A 1 62  ? -0.497  5.344   24.812 1.00 63.01  ?  54  GLN A CA  1 
ATOM   349  C C   . GLN A 1 62  ? 0.102   4.099   24.205 1.00 59.90  ?  54  GLN A C   1 
ATOM   350  O O   . GLN A 1 62  ? 0.264   3.116   24.884 1.00 70.25  ?  54  GLN A O   1 
ATOM   351  C CB  . GLN A 1 62  ? -1.942  5.543   24.346 1.00 71.67  ?  54  GLN A CB  1 
ATOM   352  C CG  . GLN A 1 62  ? -2.967  4.505   24.784 1.00 72.40  ?  54  GLN A CG  1 
ATOM   353  C CD  . GLN A 1 62  ? -3.091  3.325   23.825 1.00 79.47  ?  54  GLN A CD  1 
ATOM   354  O OE1 . GLN A 1 62  ? -3.023  3.485   22.590 1.00 86.07  ?  54  GLN A OE1 1 
ATOM   355  N NE2 . GLN A 1 62  ? -3.273  2.123   24.392 1.00 72.66  ?  54  GLN A NE2 1 
ATOM   356  N N   . VAL A 1 63  ? 0.473   4.126   22.941 1.00 67.06  ?  55  VAL A N   1 
ATOM   357  C CA  . VAL A 1 63  ? 1.055   2.923   22.320 1.00 68.85  ?  55  VAL A CA  1 
ATOM   358  C C   . VAL A 1 63  ? 2.516   2.657   22.737 1.00 70.71  ?  55  VAL A C   1 
ATOM   359  O O   . VAL A 1 63  ? 3.046   1.611   22.425 1.00 74.03  ?  55  VAL A O   1 
ATOM   360  C CB  . VAL A 1 63  ? 0.978   2.958   20.767 1.00 71.94  ?  55  VAL A CB  1 
ATOM   361  C CG1 . VAL A 1 63  ? -0.405  3.362   20.286 1.00 67.42  ?  55  VAL A CG1 1 
ATOM   362  C CG2 . VAL A 1 63  ? 2.009   3.910   20.188 1.00 80.43  ?  55  VAL A CG2 1 
ATOM   363  N N   . GLY A 1 64  ? 3.194   3.616   23.362 1.00 83.35  ?  56  GLY A N   1 
ATOM   364  C CA  . GLY A 1 64  ? 4.583   3.425   23.790 1.00 81.92  ?  56  GLY A CA  1 
ATOM   365  C C   . GLY A 1 64  ? 5.613   4.139   22.942 1.00 78.11  ?  56  GLY A C   1 
ATOM   366  O O   . GLY A 1 64  ? 6.349   4.958   23.459 1.00 98.02  ?  56  GLY A O   1 
ATOM   367  N N   . GLN A 1 65  ? 5.675   3.839   21.652 1.00 79.96  ?  57  GLN A N   1 
ATOM   368  C CA  . GLN A 1 65  ? 6.738   4.357   20.777 1.00 81.75  ?  57  GLN A CA  1 
ATOM   369  C C   . GLN A 1 65  ? 6.326   5.682   20.155 1.00 85.51  ?  57  GLN A C   1 
ATOM   370  O O   . GLN A 1 65  ? 5.133   5.899   19.903 1.00 85.27  ?  57  GLN A O   1 
ATOM   371  C CB  . GLN A 1 65  ? 7.057   3.387   19.627 1.00 95.48  ?  57  GLN A CB  1 
ATOM   372  C CG  . GLN A 1 65  ? 7.349   1.934   20.010 1.00 113.85 ?  57  GLN A CG  1 
ATOM   373  C CD  . GLN A 1 65  ? 8.629   1.733   20.831 1.00 126.34 ?  57  GLN A CD  1 
ATOM   374  O OE1 . GLN A 1 65  ? 8.619   1.032   21.852 1.00 121.76 ?  57  GLN A OE1 1 
ATOM   375  N NE2 . GLN A 1 65  ? 9.738   2.326   20.379 1.00 124.90 ?  57  GLN A NE2 1 
ATOM   376  N N   . PRO A 1 66  ? 7.310   6.573   19.894 1.00 89.10  ?  58  PRO A N   1 
ATOM   377  C CA  . PRO A 1 66  ? 7.058   7.794   19.125 1.00 82.65  ?  58  PRO A CA  1 
ATOM   378  C C   . PRO A 1 66  ? 7.088   7.598   17.618 1.00 72.92  ?  58  PRO A C   1 
ATOM   379  O O   . PRO A 1 66  ? 7.640   6.624   17.111 1.00 76.54  ?  58  PRO A O   1 
ATOM   380  C CB  . PRO A 1 66  ? 8.175   8.756   19.580 1.00 86.93  ?  58  PRO A CB  1 
ATOM   381  C CG  . PRO A 1 66  ? 9.264   7.895   20.078 1.00 88.32  ?  58  PRO A CG  1 
ATOM   382  C CD  . PRO A 1 66  ? 8.632   6.610   20.553 1.00 94.95  ?  58  PRO A CD  1 
ATOM   383  N N   . MET A 1 67  ? 6.478   8.551   16.926 1.00 71.95  ?  59  MET A N   1 
ATOM   384  C CA  . MET A 1 67  ? 6.280   8.508   15.478 1.00 73.63  ?  59  MET A CA  1 
ATOM   385  C C   . MET A 1 67  ? 7.482   9.056   14.697 1.00 72.94  ?  59  MET A C   1 
ATOM   386  O O   . MET A 1 67  ? 8.235   9.896   15.194 1.00 75.13  ?  59  MET A O   1 
ATOM   387  C CB  . MET A 1 67  ? 5.028   9.307   15.146 1.00 78.53  ?  59  MET A CB  1 
ATOM   388  C CG  . MET A 1 67  ? 4.489   9.161   13.728 1.00 92.27  ?  59  MET A CG  1 
ATOM   389  S SD  . MET A 1 67  ? 4.155   7.484   13.151 1.00 89.58  ?  59  MET A SD  1 
ATOM   390  C CE  . MET A 1 67  ? 3.483   6.736   14.662 1.00 94.41  ?  59  MET A CE  1 
ATOM   391  N N   . HIS A 1 68  ? 7.643   8.539   13.482 1.00 77.88  ?  60  HIS A N   1 
ATOM   392  C CA  . HIS A 1 68  ? 8.788   8.776   12.579 1.00 78.47  ?  60  HIS A CA  1 
ATOM   393  C C   . HIS A 1 68  ? 8.153   9.099   11.227 1.00 76.59  ?  60  HIS A C   1 
ATOM   394  O O   . HIS A 1 68  ? 7.374   8.316   10.700 1.00 76.73  ?  60  HIS A O   1 
ATOM   395  C CB  . HIS A 1 68  ? 9.660   7.507   12.418 1.00 74.75  ?  60  HIS A CB  1 
ATOM   396  C CG  . HIS A 1 68  ? 10.396  7.093   13.665 1.00 104.56 ?  60  HIS A CG  1 
ATOM   397  N ND1 . HIS A 1 68  ? 10.158  7.650   14.909 1.00 122.13 ?  60  HIS A ND1 1 
ATOM   398  C CD2 . HIS A 1 68  ? 11.363  6.158   13.859 1.00 117.38 ?  60  HIS A CD2 1 
ATOM   399  C CE1 . HIS A 1 68  ? 10.955  7.090   15.808 1.00 121.49 ?  60  HIS A CE1 1 
ATOM   400  N NE2 . HIS A 1 68  ? 11.697  6.181   15.197 1.00 119.22 ?  60  HIS A NE2 1 
ATOM   401  N N   . ILE A 1 69  ? 8.426   10.276  10.684 1.00 78.97  ?  61  ILE A N   1 
ATOM   402  C CA  . ILE A 1 69  ? 8.184   10.496  9.265  1.00 74.75  ?  61  ILE A CA  1 
ATOM   403  C C   . ILE A 1 69  ? 9.464   10.972  8.620  1.00 77.97  ?  61  ILE A C   1 
ATOM   404  O O   . ILE A 1 69  ? 10.438  11.343  9.304  1.00 72.36  ?  61  ILE A O   1 
ATOM   405  C CB  . ILE A 1 69  ? 7.021   11.468  8.961  1.00 70.04  ?  61  ILE A CB  1 
ATOM   406  C CG1 . ILE A 1 69  ? 7.374   12.905  9.333  1.00 73.85  ?  61  ILE A CG1 1 
ATOM   407  C CG2 . ILE A 1 69  ? 5.754   11.015  9.648  1.00 69.86  ?  61  ILE A CG2 1 
ATOM   408  C CD1 . ILE A 1 69  ? 7.891   13.729  8.169  1.00 73.64  ?  61  ILE A CD1 1 
ATOM   409  N N   . ILE A 1 70  ? 9.479   10.967  7.291  1.00 77.81  ?  62  ILE A N   1 
ATOM   410  C CA  . ILE A 1 70  ? 10.648  11.401  6.536  1.00 77.57  ?  62  ILE A CA  1 
ATOM   411  C C   . ILE A 1 70  ? 10.252  12.321  5.387  1.00 82.32  ?  62  ILE A C   1 
ATOM   412  O O   . ILE A 1 70  ? 9.673   11.878  4.395  1.00 82.52  ?  62  ILE A O   1 
ATOM   413  C CB  . ILE A 1 70  ? 11.433  10.202  5.974  1.00 74.95  ?  62  ILE A CB  1 
ATOM   414  C CG1 . ILE A 1 70  ? 11.964  9.330   7.113  1.00 78.38  ?  62  ILE A CG1 1 
ATOM   415  C CG2 . ILE A 1 70  ? 12.573  10.680  5.087  1.00 77.87  ?  62  ILE A CG2 1 
ATOM   416  C CD1 . ILE A 1 70  ? 12.825  8.175   6.649  1.00 84.99  ?  62  ILE A CD1 1 
ATOM   417  N N   . ILE A 1 71  ? 10.567  13.605  5.527  1.00 88.41  ?  63  ILE A N   1 
ATOM   418  C CA  . ILE A 1 71  ? 10.245  14.590  4.501  1.00 78.53  ?  63  ILE A CA  1 
ATOM   419  C C   . ILE A 1 71  ? 10.669  14.106  3.119  1.00 79.38  ?  63  ILE A C   1 
ATOM   420  O O   . ILE A 1 71  ? 11.830  13.762  2.900  1.00 66.80  ?  63  ILE A O   1 
ATOM   421  C CB  . ILE A 1 71  ? 10.918  15.945  4.789  1.00 76.00  ?  63  ILE A CB  1 
ATOM   422  C CG1 . ILE A 1 71  ? 10.945  16.218  6.294  1.00 77.45  ?  63  ILE A CG1 1 
ATOM   423  C CG2 . ILE A 1 71  ? 10.198  17.064  4.052  1.00 78.87  ?  63  ILE A CG2 1 
ATOM   424  C CD1 . ILE A 1 71  ? 9.638   16.750  6.842  1.00 81.07  ?  63  ILE A CD1 1 
ATOM   425  N N   . GLY A 1 72  ? 9.719   14.081  2.189  1.00 69.22  ?  64  GLY A N   1 
ATOM   426  C CA  . GLY A 1 72  ? 9.991   13.641  0.833  1.00 76.12  ?  64  GLY A CA  1 
ATOM   427  C C   . GLY A 1 72  ? 10.381  14.787  -0.080 1.00 84.82  ?  64  GLY A C   1 
ATOM   428  O O   . GLY A 1 72  ? 11.432  14.753  -0.720 1.00 74.40  ?  64  GLY A O   1 
ATOM   429  N N   . ASN A 1 73  ? 9.530   15.806  -0.139 1.00 89.78  ?  65  ASN A N   1 
ATOM   430  C CA  . ASN A 1 73  ? 9.785   16.971  -0.978 1.00 82.84  ?  65  ASN A CA  1 
ATOM   431  C C   . ASN A 1 73  ? 9.538   18.279  -0.235 1.00 79.59  ?  65  ASN A C   1 
ATOM   432  O O   . ASN A 1 73  ? 8.413   18.778  -0.194 1.00 78.81  ?  65  ASN A O   1 
ATOM   433  C CB  . ASN A 1 73  ? 8.931   16.916  -2.246 1.00 85.29  ?  65  ASN A CB  1 
ATOM   434  C CG  . ASN A 1 73  ? 9.307   17.988  -3.249 1.00 92.80  ?  65  ASN A CG  1 
ATOM   435  O OD1 . ASN A 1 73  ? 10.441  18.468  -3.266 1.00 86.45  ?  65  ASN A OD1 1 
ATOM   436  N ND2 . ASN A 1 73  ? 8.355   18.370  -4.092 1.00 100.51 ?  65  ASN A ND2 1 
ATOM   437  N N   . MET A 1 74  ? 10.596  18.831  0.350  1.00 75.94  ?  66  MET A N   1 
ATOM   438  C CA  . MET A 1 74  ? 10.494  20.097  1.101  1.00 72.64  ?  66  MET A CA  1 
ATOM   439  C C   . MET A 1 74  ? 9.795   21.247  0.359  1.00 67.22  ?  66  MET A C   1 
ATOM   440  O O   . MET A 1 74  ? 9.319   22.153  0.997  1.00 62.23  ?  66  MET A O   1 
ATOM   441  C CB  . MET A 1 74  ? 11.841  20.560  1.598  1.00 66.99  ?  66  MET A CB  1 
ATOM   442  C CG  . MET A 1 74  ? 12.752  21.103  0.528  1.00 67.41  ?  66  MET A CG  1 
ATOM   443  S SD  . MET A 1 74  ? 14.407  21.367  1.193  1.00 66.37  ?  66  MET A SD  1 
ATOM   444  C CE  . MET A 1 74  ? 14.056  22.855  2.140  1.00 64.84  ?  66  MET A CE  1 
ATOM   445  N N   . PHE A 1 75  ? 9.727   21.208  -0.969 1.00 69.42  ?  67  PHE A N   1 
ATOM   446  C CA  . PHE A 1 75  ? 8.983   22.214  -1.740 1.00 75.54  ?  67  PHE A CA  1 
ATOM   447  C C   . PHE A 1 75  ? 7.515   21.834  -2.086 1.00 83.42  ?  67  PHE A C   1 
ATOM   448  O O   . PHE A 1 75  ? 6.725   22.701  -2.512 1.00 77.34  ?  67  PHE A O   1 
ATOM   449  C CB  . PHE A 1 75  ? 9.776   22.593  -3.007 1.00 75.15  ?  67  PHE A CB  1 
ATOM   450  C CG  . PHE A 1 75  ? 11.231  22.933  -2.747 1.00 66.00  ?  67  PHE A CG  1 
ATOM   451  C CD1 . PHE A 1 75  ? 11.595  24.186  -2.274 1.00 70.04  ?  67  PHE A CD1 1 
ATOM   452  C CD2 . PHE A 1 75  ? 12.231  21.978  -2.958 1.00 67.78  ?  67  PHE A CD2 1 
ATOM   453  C CE1 . PHE A 1 75  ? 12.932  24.479  -2.011 1.00 77.56  ?  67  PHE A CE1 1 
ATOM   454  C CE2 . PHE A 1 75  ? 13.570  22.252  -2.711 1.00 67.71  ?  67  PHE A CE2 1 
ATOM   455  C CZ  . PHE A 1 75  ? 13.926  23.507  -2.230 1.00 73.93  ?  67  PHE A CZ  1 
ATOM   456  N N   . LYS A 1 76  ? 7.179   20.590  -1.790 1.00 80.61  ?  68  LYS A N   1 
ATOM   457  C CA  . LYS A 1 76  ? 5.846   20.067  -1.942 1.00 91.42  ?  68  LYS A CA  1 
ATOM   458  C C   . LYS A 1 76  ? 5.642   19.310  -0.645 1.00 95.21  ?  68  LYS A C   1 
ATOM   459  O O   . LYS A 1 76  ? 6.044   18.169  -0.536 1.00 97.25  ?  68  LYS A O   1 
ATOM   460  C CB  . LYS A 1 76  ? 5.767   19.121  -3.130 1.00 77.89  ?  68  LYS A CB  1 
ATOM   461  N N   . LEU A 1 77  ? 5.035   19.946  0.348  1.00 87.59  ?  69  LEU A N   1 
ATOM   462  C CA  . LEU A 1 77  ? 4.841   19.309  1.642  1.00 83.48  ?  69  LEU A CA  1 
ATOM   463  C C   . LEU A 1 77  ? 3.466   18.760  1.887  1.00 78.51  ?  69  LEU A C   1 
ATOM   464  O O   . LEU A 1 77  ? 2.504   19.213  1.309  1.00 85.27  ?  69  LEU A O   1 
ATOM   465  C CB  . LEU A 1 77  ? 5.111   20.291  2.772  1.00 81.73  ?  69  LEU A CB  1 
ATOM   466  C CG  . LEU A 1 77  ? 6.382   21.095  2.928  1.00 75.07  ?  69  LEU A CG  1 
ATOM   467  C CD1 . LEU A 1 77  ? 6.011   22.360  3.652  1.00 80.83  ?  69  LEU A CD1 1 
ATOM   468  C CD2 . LEU A 1 77  ? 7.406   20.343  3.728  1.00 68.39  ?  69  LEU A CD2 1 
ATOM   469  N N   . GLU A 1 78  ? 3.385   17.790  2.785  1.00 80.33  ?  70  GLU A N   1 
ATOM   470  C CA  . GLU A 1 78  ? 2.110   17.209  3.142  1.00 86.33  ?  70  GLU A CA  1 
ATOM   471  C C   . GLU A 1 78  ? 1.616   17.949  4.351  1.00 80.22  ?  70  GLU A C   1 
ATOM   472  O O   . GLU A 1 78  ? 2.385   18.373  5.187  1.00 61.38  ?  70  GLU A O   1 
ATOM   473  C CB  . GLU A 1 78  ? 2.196   15.720  3.461  1.00 85.57  ?  70  GLU A CB  1 
ATOM   474  C CG  . GLU A 1 78  ? 3.226   14.934  2.692  1.00 80.61  ?  70  GLU A CG  1 
ATOM   475  C CD  . GLU A 1 78  ? 2.691   14.368  1.411  1.00 88.38  ?  70  GLU A CD  1 
ATOM   476  O OE1 . GLU A 1 78  ? 1.546   14.666  1.060  1.00 83.49  ?  70  GLU A OE1 1 
ATOM   477  O OE2 . GLU A 1 78  ? 3.435   13.638  0.747  1.00 88.89  -1 70  GLU A OE2 1 
ATOM   478  N N   . PHE A 1 79  ? 0.310   18.087  4.425  1.00 75.13  ?  71  PHE A N   1 
ATOM   479  C CA  . PHE A 1 79  ? -0.335  18.797  5.493  1.00 72.46  ?  71  PHE A CA  1 
ATOM   480  C C   . PHE A 1 79  ? 0.209   18.532  6.864  1.00 67.25  ?  71  PHE A C   1 
ATOM   481  O O   . PHE A 1 79  ? 0.197   19.397  7.682  1.00 66.59  ?  71  PHE A O   1 
ATOM   482  C CB  . PHE A 1 79  ? -1.810  18.509  5.482  1.00 74.58  ?  71  PHE A CB  1 
ATOM   483  C CG  . PHE A 1 79  ? -2.565  19.283  6.488  1.00 72.05  ?  71  PHE A CG  1 
ATOM   484  C CD1 . PHE A 1 79  ? -3.059  20.511  6.185  1.00 69.89  ?  71  PHE A CD1 1 
ATOM   485  C CD2 . PHE A 1 79  ? -2.778  18.773  7.729  1.00 72.22  ?  71  PHE A CD2 1 
ATOM   486  C CE1 . PHE A 1 79  ? -3.757  21.227  7.106  1.00 73.47  ?  71  PHE A CE1 1 
ATOM   487  C CE2 . PHE A 1 79  ? -3.476  19.477  8.657  1.00 69.90  ?  71  PHE A CE2 1 
ATOM   488  C CZ  . PHE A 1 79  ? -3.966  20.707  8.346  1.00 72.05  ?  71  PHE A CZ  1 
ATOM   489  N N   . TRP A 1 80  ? 0.673   17.337  7.131  1.00 62.32  ?  72  TRP A N   1 
ATOM   490  C CA  . TRP A 1 80  ? 1.227   17.087  8.440  1.00 61.65  ?  72  TRP A CA  1 
ATOM   491  C C   . TRP A 1 80  ? 2.587   17.699  8.522  1.00 63.99  ?  72  TRP A C   1 
ATOM   492  O O   . TRP A 1 80  ? 3.011   18.148  9.594  1.00 61.63  ?  72  TRP A O   1 
ATOM   493  C CB  . TRP A 1 80  ? 1.291   15.608  8.791  1.00 66.30  ?  72  TRP A CB  1 
ATOM   494  C CG  . TRP A 1 80  ? 2.014   14.701  7.846  1.00 74.59  ?  72  TRP A CG  1 
ATOM   495  C CD1 . TRP A 1 80  ? 3.339   14.307  7.897  1.00 70.11  ?  72  TRP A CD1 1 
ATOM   496  C CD2 . TRP A 1 80  ? 1.429   13.999  6.747  1.00 75.69  ?  72  TRP A CD2 1 
ATOM   497  N NE1 . TRP A 1 80  ? 3.610   13.448  6.853  1.00 69.83  ?  72  TRP A NE1 1 
ATOM   498  C CE2 . TRP A 1 80  ? 2.458   13.240  6.139  1.00 71.38  ?  72  TRP A CE2 1 
ATOM   499  C CE3 . TRP A 1 80  ? 0.135   13.948  6.207  1.00 71.39  ?  72  TRP A CE3 1 
ATOM   500  C CZ2 . TRP A 1 80  ? 2.223   12.429  5.044  1.00 70.79  ?  72  TRP A CZ2 1 
ATOM   501  C CZ3 . TRP A 1 80  ? -0.081  13.169  5.096  1.00 68.72  ?  72  TRP A CZ3 1 
ATOM   502  C CH2 . TRP A 1 80  ? 0.953   12.421  4.527  1.00 69.64  ?  72  TRP A CH2 1 
ATOM   503  N N   . GLU A 1 81  ? 3.259   17.734  7.384  1.00 60.42  ?  73  GLU A N   1 
ATOM   504  C CA  . GLU A 1 81  ? 4.592   18.318  7.299  1.00 65.87  ?  73  GLU A CA  1 
ATOM   505  C C   . GLU A 1 81  ? 4.523   19.844  7.444  1.00 62.49  ?  73  GLU A C   1 
ATOM   506  O O   . GLU A 1 81  ? 5.396   20.422  8.048  1.00 55.25  ?  73  GLU A O   1 
ATOM   507  C CB  . GLU A 1 81  ? 5.271   17.918  5.987  1.00 63.38  ?  73  GLU A CB  1 
ATOM   508  C CG  . GLU A 1 81  ? 5.508   16.428  5.805  1.00 55.95  ?  73  GLU A CG  1 
ATOM   509  C CD  . GLU A 1 81  ? 5.935   16.075  4.393  1.00 60.35  ?  73  GLU A CD  1 
ATOM   510  O OE1 . GLU A 1 81  ? 5.352   16.661  3.479  1.00 59.65  ?  73  GLU A OE1 1 
ATOM   511  O OE2 . GLU A 1 81  ? 6.836   15.205  4.178  1.00 66.78  -1 73  GLU A OE2 1 
ATOM   512  N N   . ILE A 1 82  ? 3.454   20.464  6.925  1.00 68.27  ?  74  ILE A N   1 
ATOM   513  C CA  . ILE A 1 82  ? 3.148   21.895  7.151  1.00 64.36  ?  74  ILE A CA  1 
ATOM   514  C C   . ILE A 1 82  ? 3.189   22.172  8.668  1.00 72.12  ?  74  ILE A C   1 
ATOM   515  O O   . ILE A 1 82  ? 3.860   23.133  9.111  1.00 75.21  ?  74  ILE A O   1 
ATOM   516  C CB  . ILE A 1 82  ? 1.738   22.269  6.613  1.00 68.15  ?  74  ILE A CB  1 
ATOM   517  C CG1 . ILE A 1 82  ? 1.645   22.166  5.078  1.00 75.89  ?  74  ILE A CG1 1 
ATOM   518  C CG2 . ILE A 1 82  ? 1.290   23.653  7.073  1.00 74.79  ?  74  ILE A CG2 1 
ATOM   519  C CD1 . ILE A 1 82  ? 1.996   23.410  4.301  1.00 83.12  ?  74  ILE A CD1 1 
ATOM   520  N N   . LEU A 1 83  ? 2.481   21.316  9.437  1.00 64.13  ?  75  LEU A N   1 
ATOM   521  C CA  . LEU A 1 83  ? 2.362   21.397  10.893 1.00 55.09  ?  75  LEU A CA  1 
ATOM   522  C C   . LEU A 1 83  ? 3.664   21.163  11.588 1.00 60.30  ?  75  LEU A C   1 
ATOM   523  O O   . LEU A 1 83  ? 4.069   21.976  12.423 1.00 66.67  ?  75  LEU A O   1 
ATOM   524  C CB  . LEU A 1 83  ? 1.367   20.369  11.443 1.00 51.92  ?  75  LEU A CB  1 
ATOM   525  C CG  . LEU A 1 83  ? -0.032  20.433  10.870 1.00 56.14  ?  75  LEU A CG  1 
ATOM   526  C CD1 . LEU A 1 83  ? -1.019  19.811  11.828 1.00 59.12  ?  75  LEU A CD1 1 
ATOM   527  C CD2 . LEU A 1 83  ? -0.499  21.841  10.561 1.00 57.14  ?  75  LEU A CD2 1 
ATOM   528  N N   . LEU A 1 84  ? 4.308   20.046  11.267 1.00 55.75  ?  76  LEU A N   1 
ATOM   529  C CA  . LEU A 1 84  ? 5.547   19.692  11.920 1.00 57.00  ?  76  LEU A CA  1 
ATOM   530  C C   . LEU A 1 84  ? 6.673   20.655  11.592 1.00 61.44  ?  76  LEU A C   1 
ATOM   531  O O   . LEU A 1 84  ? 7.445   21.015  12.467 1.00 57.60  ?  76  LEU A O   1 
ATOM   532  C CB  . LEU A 1 84  ? 6.015   18.317  11.479 1.00 62.21  ?  76  LEU A CB  1 
ATOM   533  C CG  . LEU A 1 84  ? 5.194   17.084  11.844 1.00 62.47  ?  76  LEU A CG  1 
ATOM   534  C CD1 . LEU A 1 84  ? 5.785   15.866  11.115 1.00 62.15  ?  76  LEU A CD1 1 
ATOM   535  C CD2 . LEU A 1 84  ? 5.164   16.904  13.354 1.00 65.18  ?  76  LEU A CD2 1 
ATOM   536  N N   . THR A 1 85  ? 6.777   21.056  10.321 1.00 65.48  ?  77  THR A N   1 
ATOM   537  C CA  . THR A 1 85  ? 7.882   21.921  9.870  1.00 66.33  ?  77  THR A CA  1 
ATOM   538  C C   . THR A 1 85  ? 7.860   23.327  10.474 1.00 68.24  ?  77  THR A C   1 
ATOM   539  O O   . THR A 1 85  ? 8.837   24.061  10.357 1.00 73.71  ?  77  THR A O   1 
ATOM   540  C CB  . THR A 1 85  ? 7.963   22.050  8.325  1.00 67.97  ?  77  THR A CB  1 
ATOM   541  O OG1 . THR A 1 85  ? 6.716   22.516  7.773  1.00 66.60  ?  77  THR A OG1 1 
ATOM   542  C CG2 . THR A 1 85  ? 8.342   20.737  7.716  1.00 66.45  ?  77  THR A CG2 1 
ATOM   543  N N   . SER A 1 86  ? 6.745   23.689  11.104 1.00 64.74  ?  78  SER A N   1 
ATOM   544  C CA  . SER A 1 86  ? 6.592   24.951  11.797 1.00 59.19  ?  78  SER A CA  1 
ATOM   545  C C   . SER A 1 86  ? 7.002   24.875  13.252 1.00 60.41  ?  78  SER A C   1 
ATOM   546  O O   . SER A 1 86  ? 6.566   25.736  14.016 1.00 65.50  ?  78  SER A O   1 
ATOM   547  C CB  . SER A 1 86  ? 5.112   25.391  11.762 1.00 57.02  ?  78  SER A CB  1 
ATOM   548  O OG  . SER A 1 86  ? 4.357   24.813  12.834 1.00 59.33  ?  78  SER A OG  1 
ATOM   549  N N   . MET A 1 87  ? 7.802   23.886  13.659 1.00 58.73  ?  79  MET A N   1 
ATOM   550  C CA  . MET A 1 87  ? 8.030   23.630  15.093 1.00 66.83  ?  79  MET A CA  1 
ATOM   551  C C   . MET A 1 87  ? 9.516   23.582  15.444 1.00 70.42  ?  79  MET A C   1 
ATOM   552  O O   . MET A 1 87  ? 10.314  23.005  14.702 1.00 68.25  ?  79  MET A O   1 
ATOM   553  C CB  . MET A 1 87  ? 7.379   22.286  15.516 1.00 68.48  ?  79  MET A CB  1 
ATOM   554  C CG  . MET A 1 87  ? 5.859   22.238  15.401 1.00 68.80  ?  79  MET A CG  1 
ATOM   555  S SD  . MET A 1 87  ? 5.156   20.720  16.080 1.00 68.05  ?  79  MET A SD  1 
ATOM   556  C CE  . MET A 1 87  ? 5.481   20.942  17.832 1.00 74.13  ?  79  MET A CE  1 
ATOM   557  N N   . ARG A 1 88  ? 9.868   24.127  16.607 1.00 77.13  ?  80  ARG A N   1 
ATOM   558  C CA  . ARG A 1 88  ? 11.224  24.010  17.131 1.00 79.22  ?  80  ARG A CA  1 
ATOM   559  C C   . ARG A 1 88  ? 11.329  22.698  17.927 1.00 70.58  ?  80  ARG A C   1 
ATOM   560  O O   . ARG A 1 88  ? 10.337  22.176  18.357 1.00 72.59  ?  80  ARG A O   1 
ATOM   561  C CB  . ARG A 1 88  ? 11.554  25.255  17.974 1.00 77.47  ?  80  ARG A CB  1 
ATOM   562  N N   . VAL A 1 89  ? 12.529  22.163  18.120 1.00 69.12  ?  81  VAL A N   1 
ATOM   563  C CA  . VAL A 1 89  ? 12.726  20.970  18.961 1.00 61.52  ?  81  VAL A CA  1 
ATOM   564  C C   . VAL A 1 89  ? 12.337  21.207  20.427 1.00 72.41  ?  81  VAL A C   1 
ATOM   565  O O   . VAL A 1 89  ? 12.584  22.292  20.965 1.00 76.52  ?  81  VAL A O   1 
ATOM   566  C CB  . VAL A 1 89  ? 14.169  20.439  18.895 1.00 57.12  ?  81  VAL A CB  1 
ATOM   567  C CG1 . VAL A 1 89  ? 14.475  19.349  19.929 1.00 65.45  ?  81  VAL A CG1 1 
ATOM   568  C CG2 . VAL A 1 89  ? 14.404  19.839  17.549 1.00 59.62  ?  81  VAL A CG2 1 
ATOM   569  N N   . HIS A 1 90  ? 11.745  20.152  21.028 1.00 68.79  ?  82  HIS A N   1 
ATOM   570  C CA  . HIS A 1 90  ? 11.001  20.135  22.299 1.00 57.62  ?  82  HIS A CA  1 
ATOM   571  C C   . HIS A 1 90  ? 9.797   21.044  22.344 1.00 59.13  ?  82  HIS A C   1 
ATOM   572  O O   . HIS A 1 90  ? 9.227   21.225  23.411 1.00 67.70  ?  82  HIS A O   1 
ATOM   573  C CB  . HIS A 1 90  ? 11.908  20.366  23.491 1.00 65.32  ?  82  HIS A CB  1 
ATOM   574  C CG  . HIS A 1 90  ? 13.142  19.512  23.478 1.00 75.57  ?  82  HIS A CG  1 
ATOM   575  N ND1 . HIS A 1 90  ? 14.417  20.040  23.484 1.00 74.90  ?  82  HIS A ND1 1 
ATOM   576  C CD2 . HIS A 1 90  ? 13.294  18.169  23.421 1.00 78.66  ?  82  HIS A CD2 1 
ATOM   577  C CE1 . HIS A 1 90  ? 15.298  19.057  23.454 1.00 76.40  ?  82  HIS A CE1 1 
ATOM   578  N NE2 . HIS A 1 90  ? 14.642  17.913  23.407 1.00 79.12  ?  82  HIS A NE2 1 
ATOM   579  N N   . GLU A 1 91  ? 9.357   21.579  21.204 1.00 57.52  ?  83  GLU A N   1 
ATOM   580  C CA  . GLU A 1 91  ? 8.117   22.358  21.181 1.00 61.87  ?  83  GLU A CA  1 
ATOM   581  C C   . GLU A 1 91  ? 6.944   21.392  21.400 1.00 63.64  ?  83  GLU A C   1 
ATOM   582  O O   . GLU A 1 91  ? 7.002   20.246  20.982 1.00 65.68  ?  83  GLU A O   1 
ATOM   583  C CB  . GLU A 1 91  ? 7.946   23.100  19.852 1.00 67.36  ?  83  GLU A CB  1 
ATOM   584  C CG  . GLU A 1 91  ? 6.674   23.938  19.763 1.00 78.84  ?  83  GLU A CG  1 
ATOM   585  C CD  . GLU A 1 91  ? 6.712   24.985  18.653 1.00 88.02  ?  83  GLU A CD  1 
ATOM   586  O OE1 . GLU A 1 91  ? 7.748   25.692  18.508 1.00 100.60 ?  83  GLU A OE1 1 
ATOM   587  O OE2 . GLU A 1 91  ? 5.686   25.118  17.942 1.00 74.66  -1 83  GLU A OE2 1 
ATOM   588  N N   . VAL A 1 92  ? 5.928   21.856  22.107 1.00 60.19  ?  84  VAL A N   1 
ATOM   589  C CA  . VAL A 1 92  ? 4.671   21.172  22.232 1.00 60.75  ?  84  VAL A CA  1 
ATOM   590  C C   . VAL A 1 92  ? 3.686   22.175  21.739 1.00 59.75  ?  84  VAL A C   1 
ATOM   591  O O   . VAL A 1 92  ? 3.619   23.266  22.296 1.00 63.14  ?  84  VAL A O   1 
ATOM   592  C CB  . VAL A 1 92  ? 4.279   20.825  23.696 1.00 68.73  ?  84  VAL A CB  1 
ATOM   593  C CG1 . VAL A 1 92  ? 2.860   20.234  23.754 1.00 67.98  ?  84  VAL A CG1 1 
ATOM   594  C CG2 . VAL A 1 92  ? 5.268   19.855  24.322 1.00 70.79  ?  84  VAL A CG2 1 
ATOM   595  N N   . ALA A 1 93  ? 2.907   21.805  20.723 1.00 62.67  ?  85  ALA A N   1 
ATOM   596  C CA  . ALA A 1 93  ? 1.994   22.733  20.039 1.00 59.46  ?  85  ALA A CA  1 
ATOM   597  C C   . ALA A 1 93  ? 0.656   22.065  19.805 1.00 60.17  ?  85  ALA A C   1 
ATOM   598  O O   . ALA A 1 93  ? 0.566   20.858  19.641 1.00 60.01  ?  85  ALA A O   1 
ATOM   599  C CB  . ALA A 1 93  ? 2.588   23.150  18.724 1.00 56.97  ?  85  ALA A CB  1 
ATOM   600  N N   . GLU A 1 94  ? -0.382  22.873  19.827 1.00 61.99  ?  86  GLU A N   1 
ATOM   601  C CA  . GLU A 1 94  ? -1.716  22.425  19.601 1.00 61.19  ?  86  GLU A CA  1 
ATOM   602  C C   . GLU A 1 94  ? -2.106  22.999  18.277 1.00 61.73  ?  86  GLU A C   1 
ATOM   603  O O   . GLU A 1 94  ? -2.007  24.198  18.098 1.00 72.10  ?  86  GLU A O   1 
ATOM   604  C CB  . GLU A 1 94  ? -2.642  22.946  20.666 1.00 63.90  ?  86  GLU A CB  1 
ATOM   605  C CG  . GLU A 1 94  ? -4.023  22.333  20.561 1.00 73.33  ?  86  GLU A CG  1 
ATOM   606  C CD  . GLU A 1 94  ? -4.983  22.785  21.656 1.00 74.57  ?  86  GLU A CD  1 
ATOM   607  O OE1 . GLU A 1 94  ? -5.957  23.538  21.361 1.00 69.25  ?  86  GLU A OE1 1 
ATOM   608  O OE2 . GLU A 1 94  ? -4.792  22.346  22.809 1.00 87.83  -1 86  GLU A OE2 1 
ATOM   609  N N   . PHE A 1 95  ? -2.532  22.135  17.352 1.00 69.43  ?  87  PHE A N   1 
ATOM   610  C CA  . PHE A 1 95  ? -2.989  22.524  16.009 1.00 68.73  ?  87  PHE A CA  1 
ATOM   611  C C   . PHE A 1 95  ? -4.471  22.182  15.816 1.00 71.36  ?  87  PHE A C   1 
ATOM   612  O O   . PHE A 1 95  ? -4.830  20.996  15.692 1.00 67.64  ?  87  PHE A O   1 
ATOM   613  C CB  . PHE A 1 95  ? -2.199  21.784  14.950 1.00 62.80  ?  87  PHE A CB  1 
ATOM   614  C CG  . PHE A 1 95  ? -0.704  22.076  14.925 1.00 60.41  ?  87  PHE A CG  1 
ATOM   615  C CD1 . PHE A 1 95  ? 0.185   21.295  15.653 1.00 61.80  ?  87  PHE A CD1 1 
ATOM   616  C CD2 . PHE A 1 95  ? -0.176  23.027  14.064 1.00 57.80  ?  87  PHE A CD2 1 
ATOM   617  C CE1 . PHE A 1 95  ? 1.570   21.483  15.568 1.00 58.09  ?  87  PHE A CE1 1 
ATOM   618  C CE2 . PHE A 1 95  ? 1.205   23.213  13.971 1.00 61.40  ?  87  PHE A CE2 1 
ATOM   619  C CZ  . PHE A 1 95  ? 2.081   22.443  14.730 1.00 58.85  ?  87  PHE A CZ  1 
ATOM   620  N N   . TRP A 1 96  ? -5.320  23.217  15.820 1.00 67.81  ?  88  TRP A N   1 
ATOM   621  C CA  . TRP A 1 96  ? -6.729  23.065  15.470 1.00 70.67  ?  88  TRP A CA  1 
ATOM   622  C C   . TRP A 1 96  ? -6.861  23.053  13.965 1.00 69.25  ?  88  TRP A C   1 
ATOM   623  O O   . TRP A 1 96  ? -6.252  23.891  13.312 1.00 68.37  ?  88  TRP A O   1 
ATOM   624  C CB  . TRP A 1 96  ? -7.558  24.214  15.998 1.00 76.14  ?  88  TRP A CB  1 
ATOM   625  C CG  . TRP A 1 96  ? -8.952  24.045  15.594 1.00 77.90  ?  88  TRP A CG  1 
ATOM   626  C CD1 . TRP A 1 96  ? -9.887  23.265  16.195 1.00 82.96  ?  88  TRP A CD1 1 
ATOM   627  C CD2 . TRP A 1 96  ? -9.567  24.614  14.450 1.00 84.10  ?  88  TRP A CD2 1 
ATOM   628  N NE1 . TRP A 1 96  ? -11.076 23.335  15.507 1.00 87.43  ?  88  TRP A NE1 1 
ATOM   629  C CE2 . TRP A 1 96  ? -10.910 24.156  14.429 1.00 81.38  ?  88  TRP A CE2 1 
ATOM   630  C CE3 . TRP A 1 96  ? -9.121  25.493  13.441 1.00 86.00  ?  88  TRP A CE3 1 
ATOM   631  C CZ2 . TRP A 1 96  ? -11.819 24.537  13.442 1.00 83.29  ?  88  TRP A CZ2 1 
ATOM   632  C CZ3 . TRP A 1 96  ? -10.022 25.875  12.441 1.00 89.32  ?  88  TRP A CZ3 1 
ATOM   633  C CH2 . TRP A 1 96  ? -11.363 25.390  12.449 1.00 90.62  ?  88  TRP A CH2 1 
ATOM   634  N N   . CYS A 1 97  ? -7.673  22.140  13.423 1.00 71.99  ?  89  CYS A N   1 
ATOM   635  C CA  . CYS A 1 97  ? -7.714  21.896  11.961 1.00 73.00  ?  89  CYS A CA  1 
ATOM   636  C C   . CYS A 1 97  ? -9.152  21.743  11.462 1.00 77.71  ?  89  CYS A C   1 
ATOM   637  O O   . CYS A 1 97  ? -9.922  20.920  11.974 1.00 67.76  ?  89  CYS A O   1 
ATOM   638  C CB  . CYS A 1 97  ? -6.899  20.651  11.587 1.00 70.84  ?  89  CYS A CB  1 
ATOM   639  S SG  . CYS A 1 97  ? -5.132  20.756  11.964 1.00 71.61  ?  89  CYS A SG  1 
ATOM   640  N N   . ASP A 1 98  ? -9.473  22.528  10.432 1.00 90.86  ?  90  ASP A N   1 
ATOM   641  C CA  . ASP A 1 98  ? -10.836 22.672  9.905  1.00 98.99  ?  90  ASP A CA  1 
ATOM   642  C C   . ASP A 1 98  ? -11.128 21.471  9.033  1.00 90.85  ?  90  ASP A C   1 
ATOM   643  O O   . ASP A 1 98  ? -10.206 20.877  8.483  1.00 93.05  ?  90  ASP A O   1 
ATOM   644  C CB  . ASP A 1 98  ? -10.955 23.985  9.082  1.00 104.35 ?  90  ASP A CB  1 
ATOM   645  C CG  . ASP A 1 98  ? -12.375 24.599  9.093  1.00 103.50 ?  90  ASP A CG  1 
ATOM   646  O OD1 . ASP A 1 98  ? -13.392 23.874  9.231  1.00 91.94  ?  90  ASP A OD1 1 
ATOM   647  O OD2 . ASP A 1 98  ? -12.461 25.842  8.948  1.00 107.99 -1 90  ASP A OD2 1 
ATOM   648  N N   . THR A 1 99  ? -12.401 21.110  8.913  1.00 87.44  ?  91  THR A N   1 
ATOM   649  C CA  . THR A 1 99  ? -12.814 19.958  8.112  1.00 82.23  ?  91  THR A CA  1 
ATOM   650  C C   . THR A 1 99  ? -11.954 19.707  6.871  1.00 73.07  ?  91  THR A C   1 
ATOM   651  O O   . THR A 1 99  ? -11.461 18.598  6.664  1.00 72.44  ?  91  THR A O   1 
ATOM   652  C CB  . THR A 1 99  ? -14.288 20.080  7.676  1.00 83.95  ?  91  THR A CB  1 
ATOM   653  O OG1 . THR A 1 99  ? -15.061 20.636  8.747  1.00 85.35  ?  91  THR A OG1 1 
ATOM   654  C CG2 . THR A 1 99  ? -14.849 18.715  7.307  1.00 83.40  ?  91  THR A CG2 1 
ATOM   655  N N   . ILE A 1 100 ? -11.788 20.740  6.051  1.00 81.34  ?  92  ILE A N   1 
ATOM   656  C CA  . ILE A 1 100 ? -11.009 20.656  4.813  1.00 89.83  ?  92  ILE A CA  1 
ATOM   657  C C   . ILE A 1 100 ? -9.790  19.731  4.867  1.00 92.62  ?  92  ILE A C   1 
ATOM   658  O O   . ILE A 1 100 ? -9.455  19.080  3.878  1.00 92.04  ?  92  ILE A O   1 
ATOM   659  C CB  . ILE A 1 100 ? -10.548 22.067  4.402  1.00 30.00  ?  92  ILE A CB  1 
ATOM   660  N N   . HIS A 1 101 ? -9.130  19.679  6.019  1.00 88.99  ?  93  HIS A N   1 
ATOM   661  C CA  . HIS A 1 101 ? -7.937  18.842  6.191  1.00 80.97  ?  93  HIS A CA  1 
ATOM   662  C C   . HIS A 1 101 ? -8.038  17.575  7.051  1.00 70.32  ?  93  HIS A C   1 
ATOM   663  O O   . HIS A 1 101 ? -7.045  16.865  7.207  1.00 64.96  ?  93  HIS A O   1 
ATOM   664  C CB  . HIS A 1 101 ? -6.768  19.700  6.691  1.00 78.44  ?  93  HIS A CB  1 
ATOM   665  C CG  . HIS A 1 101 ? -6.820  21.122  6.225  1.00 81.99  ?  93  HIS A CG  1 
ATOM   666  N ND1 . HIS A 1 101 ? -5.894  21.654  5.355  1.00 82.49  ?  93  HIS A ND1 1 
ATOM   667  C CD2 . HIS A 1 101 ? -7.687  22.122  6.509  1.00 83.81  ?  93  HIS A CD2 1 
ATOM   668  C CE1 . HIS A 1 101 ? -6.188  22.921  5.122  1.00 83.25  ?  93  HIS A CE1 1 
ATOM   669  N NE2 . HIS A 1 101 ? -7.272  23.230  5.811  1.00 89.58  ?  93  HIS A NE2 1 
ATOM   670  N N   . THR A 1 102 ? -9.208  17.281  7.606  1.00 63.53  ?  94  THR A N   1 
ATOM   671  C CA  . THR A 1 102 ? -9.341  16.099  8.419  1.00 64.34  ?  94  THR A CA  1 
ATOM   672  C C   . THR A 1 102 ? -9.936  14.899  7.744  1.00 68.26  ?  94  THR A C   1 
ATOM   673  O O   . THR A 1 102 ? -10.008 13.854  8.337  1.00 70.47  ?  94  THR A O   1 
ATOM   674  C CB  . THR A 1 102 ? -10.162 16.384  9.667  1.00 73.64  ?  94  THR A CB  1 
ATOM   675  O OG1 . THR A 1 102 ? -11.545 16.379  9.334  1.00 77.96  ?  94  THR A OG1 1 
ATOM   676  C CG2 . THR A 1 102 ? -9.810  17.714  10.224 1.00 81.46  ?  94  THR A CG2 1 
ATOM   677  N N   . GLY A 1 103 ? -10.356 15.038  6.502  1.00 72.48  ?  95  GLY A N   1 
ATOM   678  C CA  . GLY A 1 103 ? -10.976 13.943  5.784  1.00 62.41  ?  95  GLY A CA  1 
ATOM   679  C C   . GLY A 1 103 ? -10.206 12.665  5.598  1.00 56.02  ?  95  GLY A C   1 
ATOM   680  O O   . GLY A 1 103 ? -10.763 11.590  5.615  1.00 57.63  ?  95  GLY A O   1 
ATOM   681  N N   . VAL A 1 104 ? -8.915  12.788  5.407  1.00 55.09  ?  96  VAL A N   1 
ATOM   682  C CA  . VAL A 1 104 ? -8.099  11.631  5.200  1.00 62.01  ?  96  VAL A CA  1 
ATOM   683  C C   . VAL A 1 104 ? -7.622  11.044  6.494  1.00 56.35  ?  96  VAL A C   1 
ATOM   684  O O   . VAL A 1 104 ? -7.098  9.967   6.510  1.00 60.10  ?  96  VAL A O   1 
ATOM   685  C CB  . VAL A 1 104 ? -6.892  11.987  4.342  1.00 69.79  ?  96  VAL A CB  1 
ATOM   686  C CG1 . VAL A 1 104 ? -6.125  13.128  4.962  1.00 74.63  ?  96  VAL A CG1 1 
ATOM   687  C CG2 . VAL A 1 104 ? -5.998  10.786  4.163  1.00 78.68  ?  96  VAL A CG2 1 
ATOM   688  N N   . TYR A 1 105 ? -7.819  11.747  7.588  1.00 56.04  ?  97  TYR A N   1 
ATOM   689  C CA  . TYR A 1 105 ? -7.305  11.230  8.877  1.00 53.25  ?  97  TYR A CA  1 
ATOM   690  C C   . TYR A 1 105 ? -7.648  9.758   9.142  1.00 54.63  ?  97  TYR A C   1 
ATOM   691  O O   . TYR A 1 105 ? -6.752  8.975   9.487  1.00 57.67  ?  97  TYR A O   1 
ATOM   692  C CB  . TYR A 1 105 ? -7.647  12.121  10.113 1.00 55.28  ?  97  TYR A CB  1 
ATOM   693  C CG  . TYR A 1 105 ? -6.889  11.631  11.354 1.00 57.63  ?  97  TYR A CG  1 
ATOM   694  C CD1 . TYR A 1 105 ? -5.530  11.824  11.477 1.00 55.94  ?  97  TYR A CD1 1 
ATOM   695  C CD2 . TYR A 1 105 ? -7.509  10.888  12.332 1.00 59.77  ?  97  TYR A CD2 1 
ATOM   696  C CE1 . TYR A 1 105 ? -4.825  11.333  12.554 1.00 56.50  ?  97  TYR A CE1 1 
ATOM   697  C CE2 . TYR A 1 105 ? -6.807  10.404  13.420 1.00 63.25  ?  97  TYR A CE2 1 
ATOM   698  C CZ  . TYR A 1 105 ? -5.455  10.636  13.522 1.00 56.93  ?  97  TYR A CZ  1 
ATOM   699  O OH  . TYR A 1 105 ? -4.738  10.161  14.599 1.00 54.87  ?  97  TYR A OH  1 
ATOM   700  N N   . PRO A 1 106 ? -8.917  9.349   8.946  1.00 55.16  ?  98  PRO A N   1 
ATOM   701  C CA  . PRO A 1 106 ? -9.198  7.940   9.295  1.00 52.52  ?  98  PRO A CA  1 
ATOM   702  C C   . PRO A 1 106 ? -8.389  6.943   8.514  1.00 57.82  ?  98  PRO A C   1 
ATOM   703  O O   . PRO A 1 106 ? -7.981  5.932   9.085  1.00 68.69  ?  98  PRO A O   1 
ATOM   704  C CB  . PRO A 1 106 ? -10.678 7.782   9.027  1.00 53.22  ?  98  PRO A CB  1 
ATOM   705  C CG  . PRO A 1 106 ? -11.204 9.153   9.298  1.00 61.26  ?  98  PRO A CG  1 
ATOM   706  C CD  . PRO A 1 106 ? -10.151 10.131  8.797  1.00 55.11  ?  98  PRO A CD  1 
ATOM   707  N N   . ILE A 1 107 ? -8.068  7.234   7.254  1.00 60.24  ?  99  ILE A N   1 
ATOM   708  C CA  . ILE A 1 107 ? -7.271  6.271   6.498  1.00 58.44  ?  99  ILE A CA  1 
ATOM   709  C C   . ILE A 1 107 ? -5.847  6.296   6.978  1.00 58.49  ?  99  ILE A C   1 
ATOM   710  O O   . ILE A 1 107 ? -5.159  5.283   6.999  1.00 58.07  ?  99  ILE A O   1 
ATOM   711  C CB  . ILE A 1 107 ? -7.392  6.484   4.990  1.00 61.44  ?  99  ILE A CB  1 
ATOM   712  C CG1 . ILE A 1 107 ? -8.797  6.035   4.528  1.00 67.68  ?  99  ILE A CG1 1 
ATOM   713  C CG2 . ILE A 1 107 ? -6.329  5.693   4.249  1.00 59.61  ?  99  ILE A CG2 1 
ATOM   714  C CD1 . ILE A 1 107 ? -9.406  6.958   3.501  1.00 72.56  ?  99  ILE A CD1 1 
ATOM   715  N N   . LEU A 1 108 ? -5.404  7.485   7.379  1.00 62.90  ?  100 LEU A N   1 
ATOM   716  C CA  . LEU A 1 108 ? -4.059  7.663   7.902  1.00 66.26  ?  100 LEU A CA  1 
ATOM   717  C C   . LEU A 1 108 ? -3.993  6.830   9.168  1.00 62.80  ?  100 LEU A C   1 
ATOM   718  O O   . LEU A 1 108 ? -3.178  5.914   9.282  1.00 65.96  ?  100 LEU A O   1 
ATOM   719  C CB  . LEU A 1 108 ? -3.789  9.134   8.216  1.00 84.52  ?  100 LEU A CB  1 
ATOM   720  C CG  . LEU A 1 108 ? -2.321  9.536   8.372  1.00 96.44  ?  100 LEU A CG  1 
ATOM   721  C CD1 . LEU A 1 108 ? -1.436  8.704   7.457  1.00 109.78 ?  100 LEU A CD1 1 
ATOM   722  C CD2 . LEU A 1 108 ? -2.138  11.021  8.097  1.00 98.21  ?  100 LEU A CD2 1 
ATOM   723  N N   . SER A 1 109 ? -4.869  7.145   10.118 1.00 53.80  ?  101 SER A N   1 
ATOM   724  C CA  . SER A 1 109 ? -4.934  6.384   11.369 1.00 54.23  ?  101 SER A CA  1 
ATOM   725  C C   . SER A 1 109 ? -4.976  4.890   11.188 1.00 56.42  ?  101 SER A C   1 
ATOM   726  O O   . SER A 1 109 ? -4.247  4.161   11.864 1.00 63.42  ?  101 SER A O   1 
ATOM   727  C CB  . SER A 1 109 ? -6.180  6.770   12.163 1.00 57.76  ?  101 SER A CB  1 
ATOM   728  O OG  . SER A 1 109 ? -6.196  6.094   13.408 1.00 59.13  ?  101 SER A OG  1 
ATOM   729  N N   . ARG A 1 110 ? -5.865  4.410   10.320 1.00 57.99  ?  102 ARG A N   1 
ATOM   730  C CA  . ARG A 1 110 ? -5.882  2.980   10.028 1.00 65.14  ?  102 ARG A CA  1 
ATOM   731  C C   . ARG A 1 110 ? -4.457  2.489   9.764  1.00 57.41  ?  102 ARG A C   1 
ATOM   732  O O   . ARG A 1 110 ? -4.031  1.547   10.370 1.00 60.75  ?  102 ARG A O   1 
ATOM   733  C CB  . ARG A 1 110 ? -6.768  2.664   8.825  1.00 74.65  ?  102 ARG A CB  1 
ATOM   734  C CG  . ARG A 1 110 ? -6.838  1.184   8.451  1.00 79.59  ?  102 ARG A CG  1 
ATOM   735  C CD  . ARG A 1 110 ? -7.646  0.998   7.169  1.00 89.70  ?  102 ARG A CD  1 
ATOM   736  N NE  . ARG A 1 110 ? -7.290  -0.237  6.478  1.00 96.85  ?  102 ARG A NE  1 
ATOM   737  C CZ  . ARG A 1 110 ? -6.148  -0.439  5.815  1.00 114.12 ?  102 ARG A CZ  1 
ATOM   738  N NH1 . ARG A 1 110 ? -5.201  0.513   5.737  1.00 119.44 ?  102 ARG A NH1 1 
ATOM   739  N NH2 . ARG A 1 110 ? -5.943  -1.614  5.227  1.00 115.39 ?  102 ARG A NH2 1 
ATOM   740  N N   . SER A 1 111 ? -3.722  3.197   8.913  1.00 58.71  ?  103 SER A N   1 
ATOM   741  C CA  . SER A 1 111 ? -2.366  2.827   8.533  1.00 65.70  ?  103 SER A CA  1 
ATOM   742  C C   . SER A 1 111 ? -1.395  2.835   9.703  1.00 66.51  ?  103 SER A C   1 
ATOM   743  O O   . SER A 1 111 ? -0.543  1.948   9.801  1.00 63.59  ?  103 SER A O   1 
ATOM   744  C CB  . SER A 1 111 ? -1.867  3.692   7.361  1.00 68.38  ?  103 SER A CB  1 
ATOM   745  O OG  . SER A 1 111 ? -2.654  3.405   6.196  1.00 74.09  ?  103 SER A OG  1 
ATOM   746  N N   . LEU A 1 112 ? -1.562  3.782   10.617 1.00 68.15  ?  104 LEU A N   1 
ATOM   747  C CA  . LEU A 1 112 ? -0.680  3.863   11.803 1.00 71.75  ?  104 LEU A CA  1 
ATOM   748  C C   . LEU A 1 112 ? -0.952  2.717   12.729 1.00 70.54  ?  104 LEU A C   1 
ATOM   749  O O   . LEU A 1 112 ? -0.026  2.038   13.170 1.00 72.01  ?  104 LEU A O   1 
ATOM   750  C CB  . LEU A 1 112 ? -0.815  5.200   12.568 1.00 67.36  ?  104 LEU A CB  1 
ATOM   751  C CG  . LEU A 1 112 ? -0.611  6.436   11.687 1.00 73.13  ?  104 LEU A CG  1 
ATOM   752  C CD1 . LEU A 1 112 ? -0.888  7.715   12.462 1.00 75.53  ?  104 LEU A CD1 1 
ATOM   753  C CD2 . LEU A 1 112 ? 0.745   6.452   10.965 1.00 71.11  ?  104 LEU A CD2 1 
ATOM   754  N N   . ARG A 1 113 ? -2.224  2.472   12.997 1.00 67.50  ?  105 ARG A N   1 
ATOM   755  C CA  . ARG A 1 113 ? -2.572  1.341   13.842 1.00 59.63  ?  105 ARG A CA  1 
ATOM   756  C C   . ARG A 1 113 ? -2.019  0.011   13.333 1.00 58.10  ?  105 ARG A C   1 
ATOM   757  O O   . ARG A 1 113 ? -1.588  -0.804  14.148 1.00 69.25  ?  105 ARG A O   1 
ATOM   758  C CB  . ARG A 1 113 ? -4.066  1.288   14.078 1.00 54.00  ?  105 ARG A CB  1 
ATOM   759  C CG  . ARG A 1 113 ? -4.547  2.486   14.886 1.00 51.77  ?  105 ARG A CG  1 
ATOM   760  C CD  . ARG A 1 113 ? -6.060  2.503   14.998 1.00 53.49  ?  105 ARG A CD  1 
ATOM   761  N NE  . ARG A 1 113 ? -6.562  3.771   15.497 1.00 50.71  ?  105 ARG A NE  1 
ATOM   762  C CZ  . ARG A 1 113 ? -7.791  3.979   15.943 1.00 57.90  ?  105 ARG A CZ  1 
ATOM   763  N NH1 . ARG A 1 113 ? -8.707  3.005   15.925 1.00 62.70  ?  105 ARG A NH1 1 
ATOM   764  N NH2 . ARG A 1 113 ? -8.119  5.182   16.407 1.00 62.36  ?  105 ARG A NH2 1 
ATOM   765  N N   . GLN A 1 114 ? -1.978  -0.200  12.015 1.00 63.16  ?  106 GLN A N   1 
ATOM   766  C CA  . GLN A 1 114 ? -1.362  -1.414  11.454 1.00 69.00  ?  106 GLN A CA  1 
ATOM   767  C C   . GLN A 1 114 ? 0.151   -1.449  11.675 1.00 77.88  ?  106 GLN A C   1 
ATOM   768  O O   . GLN A 1 114 ? 0.682   -2.474  12.065 1.00 89.92  ?  106 GLN A O   1 
ATOM   769  C CB  . GLN A 1 114 ? -1.630  -1.528  9.971  1.00 70.04  ?  106 GLN A CB  1 
ATOM   770  C CG  . GLN A 1 114 ? -3.006  -2.029  9.605  1.00 74.61  ?  106 GLN A CG  1 
ATOM   771  C CD  . GLN A 1 114 ? -3.244  -1.901  8.102  1.00 92.12  ?  106 GLN A CD  1 
ATOM   772  O OE1 . GLN A 1 114 ? -2.436  -1.304  7.378  1.00 84.58  ?  106 GLN A OE1 1 
ATOM   773  N NE2 . GLN A 1 114 ? -4.357  -2.459  7.622  1.00 104.18 ?  106 GLN A NE2 1 
ATOM   774  N N   . MET A 1 115 ? 0.838   -0.336  11.410 1.00 90.71  ?  107 MET A N   1 
ATOM   775  C CA  . MET A 1 115 ? 2.281   -0.211  11.677 1.00 92.61  ?  107 MET A CA  1 
ATOM   776  C C   . MET A 1 115 ? 2.587   -0.434  13.169 1.00 94.42  ?  107 MET A C   1 
ATOM   777  O O   . MET A 1 115 ? 3.592   -1.068  13.511 1.00 107.83 ?  107 MET A O   1 
ATOM   778  C CB  . MET A 1 115 ? 2.817   1.152   11.215 1.00 94.85  ?  107 MET A CB  1 
ATOM   779  N N   . ALA A 1 116 ? 1.705   0.039   14.049 1.00 87.64  ?  108 ALA A N   1 
ATOM   780  C CA  . ALA A 1 116 ? 1.843   -0.205  15.499 1.00 84.13  ?  108 ALA A CA  1 
ATOM   781  C C   . ALA A 1 116 ? 1.781   -1.680  15.924 1.00 85.62  ?  108 ALA A C   1 
ATOM   782  O O   . ALA A 1 116 ? 2.263   -2.015  16.988 1.00 90.74  ?  108 ALA A O   1 
ATOM   783  C CB  . ALA A 1 116 ? 0.829   0.610   16.299 1.00 76.31  ?  108 ALA A CB  1 
ATOM   784  N N   . GLN A 1 117 ? 1.190   -2.556  15.118 1.00 94.69  ?  109 GLN A N   1 
ATOM   785  C CA  . GLN A 1 117 ? 1.243   -3.999  15.380 1.00 95.68  ?  109 GLN A CA  1 
ATOM   786  C C   . GLN A 1 117 ? 2.342   -4.680  14.535 1.00 99.16  ?  109 GLN A C   1 
ATOM   787  O O   . GLN A 1 117 ? 2.242   -5.872  14.237 1.00 94.24  ?  109 GLN A O   1 
ATOM   788  C CB  . GLN A 1 117 ? -0.107  -4.636  15.061 1.00 94.90  ?  109 GLN A CB  1 
ATOM   789  C CG  . GLN A 1 117 ? -1.339  -3.924  15.627 1.00 100.97 ?  109 GLN A CG  1 
ATOM   790  C CD  . GLN A 1 117 ? -2.581  -4.143  14.762 1.00 102.34 ?  109 GLN A CD  1 
ATOM   791  O OE1 . GLN A 1 117 ? -2.564  -4.963  13.845 1.00 102.18 ?  109 GLN A OE1 1 
ATOM   792  N NE2 . GLN A 1 117 ? -3.657  -3.400  15.039 1.00 97.97  ?  109 GLN A NE2 1 
ATOM   793  N N   . GLY A 1 118 ? 3.363   -3.927  14.112 1.00 98.56  ?  110 GLY A N   1 
ATOM   794  C CA  . GLY A 1 118 ? 4.397   -4.452  13.222 1.00 102.88 ?  110 GLY A CA  1 
ATOM   795  C C   . GLY A 1 118 ? 3.930   -5.050  11.895 1.00 115.37 ?  110 GLY A C   1 
ATOM   796  O O   . GLY A 1 118 ? 4.733   -5.688  11.205 1.00 118.31 ?  110 GLY A O   1 
ATOM   797  N N   . LYS A 1 119 ? 2.646   -4.877  11.538 1.00 118.53 ?  111 LYS A N   1 
ATOM   798  C CA  . LYS A 1 119 ? 2.147   -5.204  10.198 1.00 107.18 ?  111 LYS A CA  1 
ATOM   799  C C   . LYS A 1 119 ? 2.671   -4.063  9.341  1.00 104.31 ?  111 LYS A C   1 
ATOM   800  O O   . LYS A 1 119 ? 2.716   -2.913  9.800  1.00 98.02  ?  111 LYS A O   1 
ATOM   801  C CB  . LYS A 1 119 ? 0.608   -5.284  10.153 1.00 91.79  ?  111 LYS A CB  1 
ATOM   802  N N   . ASP A 1 120 ? 3.120   -4.398  8.135  1.00 108.91 ?  112 ASP A N   1 
ATOM   803  C CA  . ASP A 1 120 ? 3.712   -3.433  7.216  1.00 117.06 ?  112 ASP A CA  1 
ATOM   804  C C   . ASP A 1 120 ? 2.612   -2.961  6.248  1.00 129.26 ?  112 ASP A C   1 
ATOM   805  O O   . ASP A 1 120 ? 2.287   -3.695  5.304  1.00 132.99 ?  112 ASP A O   1 
ATOM   806  C CB  . ASP A 1 120 ? 4.881   -4.102  6.476  1.00 123.02 ?  112 ASP A CB  1 
ATOM   807  C CG  . ASP A 1 120 ? 5.608   -3.161  5.508  1.00 132.96 ?  112 ASP A CG  1 
ATOM   808  O OD1 . ASP A 1 120 ? 5.339   -1.933  5.495  1.00 120.92 -1 112 ASP A OD1 1 
ATOM   809  O OD2 . ASP A 1 120 ? 6.466   -3.672  4.749  1.00 142.10 ?  112 ASP A OD2 1 
ATOM   810  N N   . PRO A 1 121 ? 2.038   -1.739  6.469  1.00 135.01 ?  113 PRO A N   1 
ATOM   811  C CA  . PRO A 1 121 ? 0.894   -1.269  5.655  1.00 133.02 ?  113 PRO A CA  1 
ATOM   812  C C   . PRO A 1 121 ? 1.182   -0.950  4.178  1.00 133.50 ?  113 PRO A C   1 
ATOM   813  O O   . PRO A 1 121 ? 0.245   -0.600  3.455  1.00 144.39 ?  113 PRO A O   1 
ATOM   814  C CB  . PRO A 1 121 ? 0.425   -0.001  6.391  1.00 127.32 ?  113 PRO A CB  1 
ATOM   815  C CG  . PRO A 1 121 ? 1.624   0.487   7.098  1.00 130.34 ?  113 PRO A CG  1 
ATOM   816  C CD  . PRO A 1 121 ? 2.382   -0.746  7.509  1.00 138.60 ?  113 PRO A CD  1 
ATOM   817  N N   . THR A 1 122 ? 2.443   -1.040  3.746  1.00 120.57 ?  114 THR A N   1 
ATOM   818  C CA  . THR A 1 122 ? 2.790   -0.998  2.324  1.00 125.92 ?  114 THR A CA  1 
ATOM   819  C C   . THR A 1 122 ? 3.479   -2.295  1.828  1.00 124.06 ?  114 THR A C   1 
ATOM   820  O O   . THR A 1 122 ? 4.004   -2.331  0.718  1.00 127.65 ?  114 THR A O   1 
ATOM   821  C CB  . THR A 1 122 ? 3.638   0.259   1.987  1.00 129.31 ?  114 THR A CB  1 
ATOM   822  O OG1 . THR A 1 122 ? 4.877   0.236   2.714  1.00 138.28 ?  114 THR A OG1 1 
ATOM   823  C CG2 . THR A 1 122 ? 2.860   1.544   2.323  1.00 125.13 ?  114 THR A CG2 1 
ATOM   824  N N   . GLU A 1 123 ? 3.469   -3.357  2.632  1.00 122.52 ?  115 GLU A N   1 
ATOM   825  C CA  . GLU A 1 123 ? 3.801   -4.691  2.126  1.00 131.32 ?  115 GLU A CA  1 
ATOM   826  C C   . GLU A 1 123 ? 2.559   -5.209  1.398  1.00 132.11 ?  115 GLU A C   1 
ATOM   827  O O   . GLU A 1 123 ? 1.432   -4.852  1.758  1.00 118.02 ?  115 GLU A O   1 
ATOM   828  C CB  . GLU A 1 123 ? 4.229   -5.628  3.265  1.00 130.64 ?  115 GLU A CB  1 
ATOM   829  C CG  . GLU A 1 123 ? 4.765   -6.989  2.833  1.00 127.80 ?  115 GLU A CG  1 
ATOM   830  C CD  . GLU A 1 123 ? 3.731   -8.102  2.911  1.00 137.94 ?  115 GLU A CD  1 
ATOM   831  O OE1 . GLU A 1 123 ? 3.009   -8.181  3.930  1.00 139.56 ?  115 GLU A OE1 1 
ATOM   832  O OE2 . GLU A 1 123 ? 3.643   -8.912  1.956  1.00 140.21 -1 115 GLU A OE2 1 
ATOM   833  N N   . TRP A 1 124 ? 2.774   -6.032  0.368  1.00 137.94 ?  116 TRP A N   1 
ATOM   834  C CA  . TRP A 1 124 ? 1.695   -6.489  -0.515 1.00 131.82 ?  116 TRP A CA  1 
ATOM   835  C C   . TRP A 1 124 ? 0.607   -7.248  0.271  1.00 134.16 ?  116 TRP A C   1 
ATOM   836  O O   . TRP A 1 124 ? -0.548  -6.822  0.311  1.00 149.03 ?  116 TRP A O   1 
ATOM   837  C CB  . TRP A 1 124 ? 2.252   -7.332  -1.699 1.00 124.47 ?  116 TRP A CB  1 
ATOM   838  C CG  . TRP A 1 124 ? 1.221   -7.585  -2.777 1.00 125.50 ?  116 TRP A CG  1 
ATOM   839  C CD1 . TRP A 1 124 ? 0.993   -6.835  -3.915 1.00 124.19 ?  116 TRP A CD1 1 
ATOM   840  C CD2 . TRP A 1 124 ? 0.246   -8.638  -2.788 1.00 121.29 ?  116 TRP A CD2 1 
ATOM   841  N NE1 . TRP A 1 124 ? -0.061  -7.368  -4.628 1.00 120.99 ?  116 TRP A NE1 1 
ATOM   842  C CE2 . TRP A 1 124 ? -0.541  -8.470  -3.959 1.00 120.97 ?  116 TRP A CE2 1 
ATOM   843  C CE3 . TRP A 1 124 ? -0.042  -9.709  -1.918 1.00 113.04 ?  116 TRP A CE3 1 
ATOM   844  C CZ2 . TRP A 1 124 ? -1.602  -9.345  -4.280 1.00 115.32 ?  116 TRP A CZ2 1 
ATOM   845  C CZ3 . TRP A 1 124 ? -1.099  -10.574 -2.234 1.00 115.54 ?  116 TRP A CZ3 1 
ATOM   846  C CH2 . TRP A 1 124 ? -1.861  -10.387 -3.410 1.00 116.28 ?  116 TRP A CH2 1 
ATOM   847  N N   . HIS A 1 125 ? 0.994   -8.343  0.913  1.00 132.99 ?  117 HIS A N   1 
ATOM   848  C CA  . HIS A 1 125 ? 0.056   -9.248  1.602  1.00 132.94 ?  117 HIS A CA  1 
ATOM   849  C C   . HIS A 1 125 ? -0.924  -8.580  2.596  1.00 129.40 ?  117 HIS A C   1 
ATOM   850  O O   . HIS A 1 125 ? -2.044  -9.077  2.796  1.00 114.42 ?  117 HIS A O   1 
ATOM   851  C CB  . HIS A 1 125 ? 0.844   -10.363 2.306  1.00 139.79 ?  117 HIS A CB  1 
ATOM   852  C CG  . HIS A 1 125 ? 0.135   -11.678 2.335  1.00 146.20 ?  117 HIS A CG  1 
ATOM   853  N ND1 . HIS A 1 125 ? 0.253   -12.603 1.318  1.00 148.80 ?  117 HIS A ND1 1 
ATOM   854  C CD2 . HIS A 1 125 ? -0.688  -12.230 3.257  1.00 137.13 ?  117 HIS A CD2 1 
ATOM   855  C CE1 . HIS A 1 125 ? -0.470  -13.668 1.613  1.00 142.95 ?  117 HIS A CE1 1 
ATOM   856  N NE2 . HIS A 1 125 ? -1.049  -13.468 2.784  1.00 143.47 ?  117 HIS A NE2 1 
ATOM   857  N N   . VAL A 1 126 ? -0.500  -7.471  3.209  1.00 116.14 ?  118 VAL A N   1 
ATOM   858  C CA  . VAL A 1 126 ? -1.340  -6.705  4.142  1.00 119.61 ?  118 VAL A CA  1 
ATOM   859  C C   . VAL A 1 126 ? -2.125  -5.599  3.413  1.00 117.25 ?  118 VAL A C   1 
ATOM   860  O O   . VAL A 1 126 ? -3.309  -5.357  3.709  1.00 104.04 ?  118 VAL A O   1 
ATOM   861  C CB  . VAL A 1 126 ? -0.486  -6.095  5.281  1.00 125.44 ?  118 VAL A CB  1 
ATOM   862  C CG1 . VAL A 1 126 ? -1.360  -5.333  6.272  1.00 132.90 ?  118 VAL A CG1 1 
ATOM   863  C CG2 . VAL A 1 126 ? 0.290   -7.186  6.003  1.00 131.36 ?  118 VAL A CG2 1 
ATOM   864  N N   . HIS A 1 127 ? -1.448  -4.915  2.488  1.00 110.76 ?  119 HIS A N   1 
ATOM   865  C CA  . HIS A 1 127 ? -2.089  -3.972  1.570  1.00 110.95 ?  119 HIS A CA  1 
ATOM   866  C C   . HIS A 1 127 ? -3.303  -4.622  0.874  1.00 97.93  ?  119 HIS A C   1 
ATOM   867  O O   . HIS A 1 127 ? -4.395  -4.064  0.853  1.00 98.02  ?  119 HIS A O   1 
ATOM   868  C CB  . HIS A 1 127 ? -1.058  -3.460  0.545  1.00 119.51 ?  119 HIS A CB  1 
ATOM   869  C CG  . HIS A 1 127 ? -1.642  -2.638  -0.563 1.00 130.90 ?  119 HIS A CG  1 
ATOM   870  N ND1 . HIS A 1 127 ? -1.453  -2.941  -1.897 1.00 132.19 ?  119 HIS A ND1 1 
ATOM   871  C CD2 . HIS A 1 127 ? -2.412  -1.525  -0.533 1.00 133.10 ?  119 HIS A CD2 1 
ATOM   872  C CE1 . HIS A 1 127 ? -2.083  -2.047  -2.639 1.00 140.68 ?  119 HIS A CE1 1 
ATOM   873  N NE2 . HIS A 1 127 ? -2.673  -1.177  -1.836 1.00 139.03 ?  119 HIS A NE2 1 
ATOM   874  N N   . THR A 1 128 ? -3.111  -5.821  0.357  1.00 87.80  ?  120 THR A N   1 
ATOM   875  C CA  . THR A 1 128 ? -4.155  -6.516  -0.375 1.00 88.56  ?  120 THR A CA  1 
ATOM   876  C C   . THR A 1 128 ? -5.282  -7.041  0.523  1.00 88.13  ?  120 THR A C   1 
ATOM   877  O O   . THR A 1 128 ? -6.448  -6.886  0.177  1.00 85.90  ?  120 THR A O   1 
ATOM   878  C CB  . THR A 1 128 ? -3.534  -7.615  -1.248 1.00 85.15  ?  120 THR A CB  1 
ATOM   879  O OG1 . THR A 1 128 ? -2.605  -6.992  -2.151 1.00 79.73  ?  120 THR A OG1 1 
ATOM   880  C CG2 . THR A 1 128 ? -4.601  -8.363  -2.040 1.00 84.48  ?  120 THR A CG2 1 
ATOM   881  N N   . CYS A 1 129 ? -4.949  -7.648  1.660  1.00 96.77  ?  121 CYS A N   1 
ATOM   882  C CA  . CYS A 1 129 ? -5.969  -7.982  2.695  1.00 105.88 ?  121 CYS A CA  1 
ATOM   883  C C   . CYS A 1 129 ? -6.772  -6.746  3.136  1.00 96.84  ?  121 CYS A C   1 
ATOM   884  O O   . CYS A 1 129 ? -7.981  -6.841  3.402  1.00 93.85  ?  121 CYS A O   1 
ATOM   885  C CB  . CYS A 1 129 ? -5.332  -8.609  3.960  1.00 118.76 ?  121 CYS A CB  1 
ATOM   886  S SG  . CYS A 1 129 ? -5.186  -10.416 4.007  1.00 128.50 ?  121 CYS A SG  1 
ATOM   887  N N   . GLY A 1 130 ? -6.084  -5.610  3.250  1.00 74.98  ?  122 GLY A N   1 
ATOM   888  C CA  . GLY A 1 130 ? -6.724  -4.362  3.621  1.00 77.84  ?  122 GLY A CA  1 
ATOM   889  C C   . GLY A 1 130 ? -7.780  -3.879  2.643  1.00 80.85  ?  122 GLY A C   1 
ATOM   890  O O   . GLY A 1 130 ? -8.877  -3.456  3.048  1.00 77.24  ?  122 GLY A O   1 
ATOM   891  N N   . LEU A 1 131 ? -7.434  -3.922  1.351  1.00 78.78  ?  123 LEU A N   1 
ATOM   892  C CA  . LEU A 1 131 ? -8.360  -3.543  0.281  1.00 71.46  ?  123 LEU A CA  1 
ATOM   893  C C   . LEU A 1 131 ? -9.469  -4.577  0.240  1.00 67.67  ?  123 LEU A C   1 
ATOM   894  O O   . LEU A 1 131 ? -10.647 -4.243  0.109  1.00 67.17  ?  123 LEU A O   1 
ATOM   895  C CB  . LEU A 1 131 ? -7.653  -3.434  -1.089 1.00 70.71  ?  123 LEU A CB  1 
ATOM   896  C CG  . LEU A 1 131 ? -6.603  -2.314  -1.230 1.00 77.42  ?  123 LEU A CG  1 
ATOM   897  C CD1 . LEU A 1 131 ? -5.650  -2.522  -2.400 1.00 75.47  ?  123 LEU A CD1 1 
ATOM   898  C CD2 . LEU A 1 131 ? -7.280  -0.963  -1.375 1.00 90.70  ?  123 LEU A CD2 1 
ATOM   899  N N   . ALA A 1 132 ? -9.086  -5.842  0.366  1.00 71.82  ?  124 ALA A N   1 
ATOM   900  C CA  . ALA A 1 132 ? -10.054 -6.930  0.427  1.00 70.34  ?  124 ALA A CA  1 
ATOM   901  C C   . ALA A 1 132 ? -11.165 -6.602  1.444  1.00 71.45  ?  124 ALA A C   1 
ATOM   902  O O   . ALA A 1 132 ? -12.338 -6.448  1.062  1.00 70.05  ?  124 ALA A O   1 
ATOM   903  C CB  . ALA A 1 132 ? -9.353  -8.238  0.776  1.00 69.61  ?  124 ALA A CB  1 
ATOM   904  N N   . ASN A 1 133 ? -10.783 -6.443  2.716  1.00 62.77  ?  125 ASN A N   1 
ATOM   905  C CA  . ASN A 1 133 ? -11.752 -6.203  3.757  1.00 63.54  ?  125 ASN A CA  1 
ATOM   906  C C   . ASN A 1 133 ? -12.450 -4.895  3.566  1.00 66.44  ?  125 ASN A C   1 
ATOM   907  O O   . ASN A 1 133 ? -13.675 -4.828  3.734  1.00 66.11  ?  125 ASN A O   1 
ATOM   908  C CB  . ASN A 1 133 ? -11.124 -6.268  5.143  1.00 70.54  ?  125 ASN A CB  1 
ATOM   909  C CG  . ASN A 1 133 ? -10.900 -7.680  5.567  1.00 77.08  ?  125 ASN A CG  1 
ATOM   910  O OD1 . ASN A 1 133 ? -11.699 -8.255  6.320  1.00 84.77  ?  125 ASN A OD1 1 
ATOM   911  N ND2 . ASN A 1 133 ? -9.864  -8.293  5.006  1.00 89.38  ?  125 ASN A ND2 1 
ATOM   912  N N   . MET A 1 134 ? -11.699 -3.856  3.200  1.00 69.96  ?  126 MET A N   1 
ATOM   913  C CA  . MET A 1 134 ? -12.316 -2.554  3.066  1.00 76.22  ?  126 MET A CA  1 
ATOM   914  C C   . MET A 1 134 ? -13.478 -2.650  2.081  1.00 72.06  ?  126 MET A C   1 
ATOM   915  O O   . MET A 1 134 ? -14.562 -2.099  2.332  1.00 68.01  ?  126 MET A O   1 
ATOM   916  C CB  . MET A 1 134 ? -11.324 -1.486  2.623  1.00 87.36  ?  126 MET A CB  1 
ATOM   917  C CG  . MET A 1 134 ? -12.028 -0.197  2.188  1.00 99.17  ?  126 MET A CG  1 
ATOM   918  S SD  . MET A 1 134 ? -11.012 1.281   2.232  1.00 120.77 ?  126 MET A SD  1 
ATOM   919  C CE  . MET A 1 134 ? -10.570 1.340   3.966  1.00 119.40 ?  126 MET A CE  1 
ATOM   920  N N   . PHE A 1 135 ? -13.224 -3.358  0.980  1.00 65.40  ?  127 PHE A N   1 
ATOM   921  C CA  . PHE A 1 135 ? -14.163 -3.459  -0.131 1.00 70.12  ?  127 PHE A CA  1 
ATOM   922  C C   . PHE A 1 135 ? -15.322 -4.419  0.255  1.00 65.60  ?  127 PHE A C   1 
ATOM   923  O O   . PHE A 1 135 ? -16.482 -4.080  0.101  1.00 66.21  ?  127 PHE A O   1 
ATOM   924  C CB  . PHE A 1 135 ? -13.417 -3.900  -1.413 1.00 71.03  ?  127 PHE A CB  1 
ATOM   925  C CG  . PHE A 1 135 ? -14.200 -3.692  -2.669 1.00 78.97  ?  127 PHE A CG  1 
ATOM   926  C CD1 . PHE A 1 135 ? -15.181 -4.608  -3.049 1.00 93.49  ?  127 PHE A CD1 1 
ATOM   927  C CD2 . PHE A 1 135 ? -13.990 -2.590  -3.455 1.00 77.17  ?  127 PHE A CD2 1 
ATOM   928  C CE1 . PHE A 1 135 ? -15.934 -4.421  -4.193 1.00 91.02  ?  127 PHE A CE1 1 
ATOM   929  C CE2 . PHE A 1 135 ? -14.736 -2.388  -4.599 1.00 86.91  ?  127 PHE A CE2 1 
ATOM   930  C CZ  . PHE A 1 135 ? -15.707 -3.306  -4.972 1.00 91.12  ?  127 PHE A CZ  1 
ATOM   931  N N   . ALA A 1 136 ? -15.000 -5.589  0.788  1.00 55.17  ?  128 ALA A N   1 
ATOM   932  C CA  . ALA A 1 136 ? -16.016 -6.550  1.210  1.00 62.62  ?  128 ALA A CA  1 
ATOM   933  C C   . ALA A 1 136 ? -16.963 -6.029  2.298  1.00 70.87  ?  128 ALA A C   1 
ATOM   934  O O   . ALA A 1 136 ? -18.158 -6.275  2.247  1.00 67.44  ?  128 ALA A O   1 
ATOM   935  C CB  . ALA A 1 136 ? -15.327 -7.810  1.715  1.00 61.80  ?  128 ALA A CB  1 
ATOM   936  N N   . TYR A 1 137 ? -16.410 -5.333  3.296  1.00 74.62  ?  129 TYR A N   1 
ATOM   937  C CA  . TYR A 1 137 ? -17.142 -5.040  4.541  1.00 63.33  ?  129 TYR A CA  1 
ATOM   938  C C   . TYR A 1 137 ? -17.456 -3.579  4.781  1.00 63.48  ?  129 TYR A C   1 
ATOM   939  O O   . TYR A 1 137 ? -18.218 -3.293  5.698  1.00 69.67  ?  129 TYR A O   1 
ATOM   940  C CB  . TYR A 1 137 ? -16.398 -5.647  5.737  1.00 54.83  ?  129 TYR A CB  1 
ATOM   941  C CG  . TYR A 1 137 ? -16.148 -7.129  5.574  1.00 55.78  ?  129 TYR A CG  1 
ATOM   942  C CD1 . TYR A 1 137 ? -17.241 -8.008  5.324  1.00 61.87  ?  129 TYR A CD1 1 
ATOM   943  C CD2 . TYR A 1 137 ? -14.861 -7.688  5.672  1.00 53.33  ?  129 TYR A CD2 1 
ATOM   944  C CE1 . TYR A 1 137 ? -17.064 -9.388  5.177  1.00 52.46  ?  129 TYR A CE1 1 
ATOM   945  C CE2 . TYR A 1 137 ? -14.670 -9.087  5.523  1.00 57.67  ?  129 TYR A CE2 1 
ATOM   946  C CZ  . TYR A 1 137 ? -15.797 -9.925  5.287  1.00 55.32  ?  129 TYR A CZ  1 
ATOM   947  O OH  . TYR A 1 137 ? -15.720 -11.273 5.118  1.00 56.09  ?  129 TYR A OH  1 
ATOM   948  N N   . HIS A 1 138 ? -16.902 -2.668  3.968  1.00 70.68  ?  130 HIS A N   1 
ATOM   949  C CA  . HIS A 1 138 ? -17.176 -1.214  4.067  1.00 78.59  ?  130 HIS A CA  1 
ATOM   950  C C   . HIS A 1 138 ? -16.760 -0.652  5.436  1.00 73.78  ?  130 HIS A C   1 
ATOM   951  O O   . HIS A 1 138 ? -17.521 0.047   6.109  1.00 75.21  ?  130 HIS A O   1 
ATOM   952  C CB  . HIS A 1 138 ? -18.652 -0.902  3.748  1.00 88.90  ?  130 HIS A CB  1 
ATOM   953  C CG  . HIS A 1 138 ? -19.176 -1.627  2.540  1.00 107.61 ?  130 HIS A CG  1 
ATOM   954  N ND1 . HIS A 1 138 ? -18.717 -1.374  1.257  1.00 109.34 ?  130 HIS A ND1 1 
ATOM   955  C CD2 . HIS A 1 138 ? -20.108 -2.608  2.422  1.00 98.04  ?  130 HIS A CD2 1 
ATOM   956  C CE1 . HIS A 1 138 ? -19.349 -2.165  0.407  1.00 100.70 ?  130 HIS A CE1 1 
ATOM   957  N NE2 . HIS A 1 138 ? -20.195 -2.923  1.088  1.00 98.32  ?  130 HIS A NE2 1 
ATOM   958  N N   . THR A 1 139 ? -15.537 -0.985  5.826  1.00 70.36  ?  131 THR A N   1 
ATOM   959  C CA  . THR A 1 139 ? -14.983 -0.567  7.095  1.00 77.23  ?  131 THR A CA  1 
ATOM   960  C C   . THR A 1 139 ? -13.480 -0.321  7.001  1.00 79.66  ?  131 THR A C   1 
ATOM   961  O O   . THR A 1 139 ? -12.746 -1.059  6.332  1.00 73.27  ?  131 THR A O   1 
ATOM   962  C CB  . THR A 1 139 ? -15.208 -1.625  8.214  1.00 80.60  ?  131 THR A CB  1 
ATOM   963  O OG1 . THR A 1 139 ? -14.769 -1.087  9.485  1.00 81.39  ?  131 THR A OG1 1 
ATOM   964  C CG2 . THR A 1 139 ? -14.442 -2.956  7.920  1.00 69.83  ?  131 THR A CG2 1 
ATOM   965  N N   . LEU A 1 140 ? -13.028 0.681   7.746  1.00 77.82  ?  132 LEU A N   1 
ATOM   966  C CA  . LEU A 1 140 ? -11.603 0.853   8.029  1.00 76.09  ?  132 LEU A CA  1 
ATOM   967  C C   . LEU A 1 140 ? -11.071 -0.184  9.057  1.00 70.60  ?  132 LEU A C   1 
ATOM   968  O O   . LEU A 1 140 ? -9.859  -0.379  9.189  1.00 65.71  ?  132 LEU A O   1 
ATOM   969  C CB  . LEU A 1 140 ? -11.376 2.274   8.510  1.00 74.04  ?  132 LEU A CB  1 
ATOM   970  C CG  . LEU A 1 140 ? -11.752 3.321   7.471  1.00 75.67  ?  132 LEU A CG  1 
ATOM   971  C CD1 . LEU A 1 140 ? -12.269 4.588   8.125  1.00 83.72  ?  132 LEU A CD1 1 
ATOM   972  C CD2 . LEU A 1 140 ? -10.559 3.601   6.579  1.00 79.49  ?  132 LEU A CD2 1 
ATOM   973  N N   . GLY A 1 141 ? -11.971 -0.847  9.788  1.00 74.85  ?  133 GLY A N   1 
ATOM   974  C CA  . GLY A 1 141 ? -11.579 -1.872  10.773 1.00 72.40  ?  133 GLY A CA  1 
ATOM   975  C C   . GLY A 1 141 ? -11.843 -1.491  12.221 1.00 68.50  ?  133 GLY A C   1 
ATOM   976  O O   . GLY A 1 141 ? -11.883 -2.343  13.083 1.00 75.96  ?  133 GLY A O   1 
ATOM   977  N N   . TYR A 1 142 ? -12.052 -0.216  12.499 1.00 62.99  ?  134 TYR A N   1 
ATOM   978  C CA  . TYR A 1 142 ? -12.232 0.224   13.850 1.00 62.06  ?  134 TYR A CA  1 
ATOM   979  C C   . TYR A 1 142 ? -13.456 1.135   13.863 1.00 63.40  ?  134 TYR A C   1 
ATOM   980  O O   . TYR A 1 142 ? -13.659 1.949   12.924 1.00 64.15  ?  134 TYR A O   1 
ATOM   981  C CB  . TYR A 1 142 ? -10.948 0.941   14.349 1.00 67.13  ?  134 TYR A CB  1 
ATOM   982  C CG  . TYR A 1 142 ? -9.593  0.214   14.125 1.00 60.57  ?  134 TYR A CG  1 
ATOM   983  C CD1 . TYR A 1 142 ? -8.904  0.347   12.931 1.00 57.84  ?  134 TYR A CD1 1 
ATOM   984  C CD2 . TYR A 1 142 ? -8.970  -0.528  15.154 1.00 65.01  ?  134 TYR A CD2 1 
ATOM   985  C CE1 . TYR A 1 142 ? -7.654  -0.271  12.731 1.00 64.29  ?  134 TYR A CE1 1 
ATOM   986  C CE2 . TYR A 1 142 ? -7.720  -1.165  14.964 1.00 60.05  ?  134 TYR A CE2 1 
ATOM   987  C CZ  . TYR A 1 142 ? -7.069  -1.034  13.745 1.00 65.55  ?  134 TYR A CZ  1 
ATOM   988  O OH  . TYR A 1 142 ? -5.845  -1.652  13.514 1.00 71.26  ?  134 TYR A OH  1 
ATOM   989  N N   . GLU A 1 143 ? -14.279 0.981   14.912 1.00 72.50  ?  135 GLU A N   1 
ATOM   990  C CA  . GLU A 1 143 ? -15.566 1.702   15.018 1.00 77.23  ?  135 GLU A CA  1 
ATOM   991  C C   . GLU A 1 143 ? -15.375 3.232   15.075 1.00 77.70  ?  135 GLU A C   1 
ATOM   992  O O   . GLU A 1 143 ? -16.123 3.971   14.413 1.00 83.85  ?  135 GLU A O   1 
ATOM   993  C CB  . GLU A 1 143 ? -16.401 1.179   16.200 1.00 76.17  ?  135 GLU A CB  1 
ATOM   994  N N   . ASP A 1 144 ? -14.370 3.696   15.831 1.00 72.93  ?  136 ASP A N   1 
ATOM   995  C CA  . ASP A 1 144 ? -14.080 5.142   15.924 1.00 68.07  ?  136 ASP A CA  1 
ATOM   996  C C   . ASP A 1 144 ? -13.760 5.748   14.588 1.00 66.13  ?  136 ASP A C   1 
ATOM   997  O O   . ASP A 1 144 ? -14.288 6.816   14.241 1.00 66.51  ?  136 ASP A O   1 
ATOM   998  C CB  . ASP A 1 144 ? -12.995 5.528   16.971 1.00 69.22  ?  136 ASP A CB  1 
ATOM   999  C CG  . ASP A 1 144 ? -11.754 4.591   16.994 1.00 77.53  ?  136 ASP A CG  1 
ATOM   1000 O OD1 . ASP A 1 144 ? -11.777 3.508   16.371 1.00 75.61  ?  136 ASP A OD1 1 
ATOM   1001 O OD2 . ASP A 1 144 ? -10.755 4.942   17.693 1.00 79.06  -1 136 ASP A OD2 1 
ATOM   1002 N N   . LEU A 1 145 ? -12.910 5.077   13.820 1.00 67.04  ?  137 LEU A N   1 
ATOM   1003 C CA  . LEU A 1 145 ? -12.502 5.632   12.515 1.00 70.81  ?  137 LEU A CA  1 
ATOM   1004 C C   . LEU A 1 145 ? -13.683 5.673   11.502 1.00 76.05  ?  137 LEU A C   1 
ATOM   1005 O O   . LEU A 1 145 ? -13.829 6.643   10.723 1.00 56.94  ?  137 LEU A O   1 
ATOM   1006 C CB  . LEU A 1 145 ? -11.309 4.863   11.972 1.00 63.30  ?  137 LEU A CB  1 
ATOM   1007 C CG  . LEU A 1 145 ? -10.080 4.782   12.886 1.00 63.80  ?  137 LEU A CG  1 
ATOM   1008 C CD1 . LEU A 1 145 ? -8.994  3.965   12.216 1.00 66.22  ?  137 LEU A CD1 1 
ATOM   1009 C CD2 . LEU A 1 145 ? -9.522  6.143   13.241 1.00 64.59  ?  137 LEU A CD2 1 
ATOM   1010 N N   . ASP A 1 146 ? -14.517 4.622   11.562 1.00 83.23  ?  138 ASP A N   1 
ATOM   1011 C CA  . ASP A 1 146 ? -15.770 4.526   10.792 1.00 81.48  ?  138 ASP A CA  1 
ATOM   1012 C C   . ASP A 1 146 ? -16.811 5.558   11.177 1.00 82.98  ?  138 ASP A C   1 
ATOM   1013 O O   . ASP A 1 146 ? -17.443 6.152   10.286 1.00 84.78  ?  138 ASP A O   1 
ATOM   1014 C CB  . ASP A 1 146 ? -16.391 3.129   10.914 1.00 72.99  ?  138 ASP A CB  1 
ATOM   1015 C CG  . ASP A 1 146 ? -15.769 2.146   9.975  1.00 76.70  ?  138 ASP A CG  1 
ATOM   1016 O OD1 . ASP A 1 146 ? -15.327 2.606   8.900  1.00 84.36  ?  138 ASP A OD1 1 
ATOM   1017 O OD2 . ASP A 1 146 ? -15.719 0.930   10.297 1.00 67.72  -1 138 ASP A OD2 1 
ATOM   1018 N N   . GLU A 1 147 ? -17.015 5.746   12.481 1.00 82.05  ?  139 GLU A N   1 
ATOM   1019 C CA  . GLU A 1 147 ? -17.855 6.861   12.961 1.00 93.63  ?  139 GLU A CA  1 
ATOM   1020 C C   . GLU A 1 147 ? -17.260 8.170   12.436 1.00 91.19  ?  139 GLU A C   1 
ATOM   1021 O O   . GLU A 1 147 ? -17.970 9.003   11.873 1.00 107.44 ?  139 GLU A O   1 
ATOM   1022 C CB  . GLU A 1 147 ? -17.992 6.901   14.505 1.00 84.60  ?  139 GLU A CB  1 
ATOM   1023 N N   . LEU A 1 148 ? -15.956 8.340   12.625 1.00 83.61  ?  140 LEU A N   1 
ATOM   1024 C CA  . LEU A 1 148 ? -15.265 9.544   12.175 1.00 81.31  ?  140 LEU A CA  1 
ATOM   1025 C C   . LEU A 1 148 ? -15.368 9.723   10.663 1.00 73.21  ?  140 LEU A C   1 
ATOM   1026 O O   . LEU A 1 148 ? -15.327 10.845  10.158 1.00 70.85  ?  140 LEU A O   1 
ATOM   1027 C CB  . LEU A 1 148 ? -13.796 9.509   12.602 1.00 88.00  ?  140 LEU A CB  1 
ATOM   1028 C CG  . LEU A 1 148 ? -13.014 10.815  12.448 1.00 81.42  ?  140 LEU A CG  1 
ATOM   1029 C CD1 . LEU A 1 148 ? -13.633 11.916  13.294 1.00 78.38  ?  140 LEU A CD1 1 
ATOM   1030 C CD2 . LEU A 1 148 ? -11.551 10.611  12.813 1.00 82.20  ?  140 LEU A CD2 1 
ATOM   1031 N N   . GLN A 1 149 ? -15.500 8.612   9.946  1.00 79.24  ?  141 GLN A N   1 
ATOM   1032 C CA  . GLN A 1 149 ? -15.605 8.647   8.491  1.00 87.38  ?  141 GLN A CA  1 
ATOM   1033 C C   . GLN A 1 149 ? -17.004 9.054   8.041  1.00 87.59  ?  141 GLN A C   1 
ATOM   1034 O O   . GLN A 1 149 ? -17.176 9.646   6.975  1.00 77.93  ?  141 GLN A O   1 
ATOM   1035 C CB  . GLN A 1 149 ? -15.235 7.288   7.895  1.00 79.60  ?  141 GLN A CB  1 
ATOM   1036 C CG  . GLN A 1 149 ? -15.041 7.304   6.387  1.00 82.65  ?  141 GLN A CG  1 
ATOM   1037 C CD  . GLN A 1 149 ? -13.583 7.431   5.989  1.00 86.43  ?  141 GLN A CD  1 
ATOM   1038 O OE1 . GLN A 1 149 ? -12.957 8.468   6.205  1.00 95.51  ?  141 GLN A OE1 1 
ATOM   1039 N NE2 . GLN A 1 149 ? -13.036 6.372   5.404  1.00 78.21  ?  141 GLN A NE2 1 
ATOM   1040 N N   . LYS A 1 150 ? -18.001 8.731   8.858  1.00 92.92  ?  142 LYS A N   1 
ATOM   1041 C CA  . LYS A 1 150 ? -19.377 9.057   8.548  1.00 95.76  ?  142 LYS A CA  1 
ATOM   1042 C C   . LYS A 1 150 ? -19.909 10.305  9.201  1.00 99.10  ?  142 LYS A C   1 
ATOM   1043 O O   . LYS A 1 150 ? -21.094 10.558  9.148  1.00 106.00 ?  142 LYS A O   1 
ATOM   1044 C CB  . LYS A 1 150 ? -20.284 7.894   8.913  1.00 91.17  ?  142 LYS A CB  1 
ATOM   1045 N N   . GLU A 1 151 ? -19.046 11.089  9.819  1.00 104.84 ?  143 GLU A N   1 
ATOM   1046 C CA  . GLU A 1 151 ? -19.487 12.308  10.473 1.00 101.30 ?  143 GLU A CA  1 
ATOM   1047 C C   . GLU A 1 151 ? -18.334 13.259  10.454 1.00 91.90  ?  143 GLU A C   1 
ATOM   1048 O O   . GLU A 1 151 ? -17.680 13.483  11.445 1.00 87.43  ?  143 GLU A O   1 
ATOM   1049 C CB  . GLU A 1 151 ? -19.907 12.022  11.906 1.00 90.53  ?  143 GLU A CB  1 
ATOM   1050 N N   . PRO A 1 152 ? -18.092 13.822  9.298  1.00 83.30  ?  144 PRO A N   1 
ATOM   1051 C CA  . PRO A 1 152 ? -16.940 14.708  9.122  1.00 85.63  ?  144 PRO A CA  1 
ATOM   1052 C C   . PRO A 1 152 ? -16.884 15.872  10.101 1.00 89.62  ?  144 PRO A C   1 
ATOM   1053 O O   . PRO A 1 152 ? -17.922 16.314  10.582 1.00 96.68  ?  144 PRO A O   1 
ATOM   1054 C CB  . PRO A 1 152 ? -17.110 15.214  7.694  1.00 80.72  ?  144 PRO A CB  1 
ATOM   1055 C CG  . PRO A 1 152 ? -17.771 14.085  7.006  1.00 89.62  ?  144 PRO A CG  1 
ATOM   1056 C CD  . PRO A 1 152 ? -18.750 13.549  8.006  1.00 92.02  ?  144 PRO A CD  1 
ATOM   1057 N N   . GLN A 1 153 ? -15.673 16.349  10.393 1.00 86.20  ?  145 GLN A N   1 
ATOM   1058 C CA  . GLN A 1 153 ? -15.465 17.346  11.456 1.00 88.27  ?  145 GLN A CA  1 
ATOM   1059 C C   . GLN A 1 153 ? -14.023 17.858  11.582 1.00 83.83  ?  145 GLN A C   1 
ATOM   1060 O O   . GLN A 1 153 ? -13.103 17.297  10.992 1.00 78.75  ?  145 GLN A O   1 
ATOM   1061 C CB  . GLN A 1 153 ? -15.872 16.748  12.803 1.00 79.14  ?  145 GLN A CB  1 
ATOM   1062 C CG  . GLN A 1 153 ? -15.436 15.310  12.945 1.00 75.95  ?  145 GLN A CG  1 
ATOM   1063 C CD  . GLN A 1 153 ? -15.962 14.700  14.196 1.00 74.94  ?  145 GLN A CD  1 
ATOM   1064 O OE1 . GLN A 1 153 ? -15.823 15.283  15.268 1.00 78.56  ?  145 GLN A OE1 1 
ATOM   1065 N NE2 . GLN A 1 153 ? -16.548 13.507  14.086 1.00 74.46  ?  145 GLN A NE2 1 
ATOM   1066 N N   . PRO A 1 154 ? -13.821 18.932  12.363 1.00 81.06  ?  146 PRO A N   1 
ATOM   1067 C CA  . PRO A 1 154 ? -12.444 19.349  12.636 1.00 84.12  ?  146 PRO A CA  1 
ATOM   1068 C C   . PRO A 1 154 ? -11.789 18.450  13.721 1.00 86.96  ?  146 PRO A C   1 
ATOM   1069 O O   . PRO A 1 154 ? -12.472 17.604  14.374 1.00 79.08  ?  146 PRO A O   1 
ATOM   1070 C CB  . PRO A 1 154 ? -12.596 20.813  13.098 1.00 81.33  ?  146 PRO A CB  1 
ATOM   1071 C CG  . PRO A 1 154 ? -14.037 21.158  12.915 1.00 82.86  ?  146 PRO A CG  1 
ATOM   1072 C CD  . PRO A 1 154 ? -14.787 19.864  12.955 1.00 76.37  ?  146 PRO A CD  1 
ATOM   1073 N N   . LEU A 1 155 ? -10.474 18.606  13.877 1.00 79.19  ?  147 LEU A N   1 
ATOM   1074 C CA  . LEU A 1 155 ? -9.712  17.856  14.887 1.00 76.17  ?  147 LEU A CA  1 
ATOM   1075 C C   . LEU A 1 155 ? -8.595  18.698  15.449 1.00 73.93  ?  147 LEU A C   1 
ATOM   1076 O O   . LEU A 1 155 ? -7.993  19.519  14.720 1.00 69.48  ?  147 LEU A O   1 
ATOM   1077 C CB  . LEU A 1 155 ? -9.050  16.615  14.287 1.00 75.12  ?  147 LEU A CB  1 
ATOM   1078 C CG  . LEU A 1 155 ? -9.882  15.578  13.555 1.00 73.81  ?  147 LEU A CG  1 
ATOM   1079 C CD1 . LEU A 1 155 ? -8.949  14.655  12.795 1.00 79.14  ?  147 LEU A CD1 1 
ATOM   1080 C CD2 . LEU A 1 155 ? -10.765 14.775  14.491 1.00 75.94  ?  147 LEU A CD2 1 
ATOM   1081 N N   . VAL A 1 156 ? -8.283  18.436  16.721 1.00 69.16  ?  148 VAL A N   1 
ATOM   1082 C CA  . VAL A 1 156 ? -7.118  19.019  17.361 1.00 68.89  ?  148 VAL A CA  1 
ATOM   1083 C C   . VAL A 1 156 ? -6.042  17.961  17.501 1.00 66.37  ?  148 VAL A C   1 
ATOM   1084 O O   . VAL A 1 156 ? -6.288  16.867  18.004 1.00 62.61  ?  148 VAL A O   1 
ATOM   1085 C CB  . VAL A 1 156 ? -7.385  19.567  18.772 1.00 74.01  ?  148 VAL A CB  1 
ATOM   1086 C CG1 . VAL A 1 156 ? -6.345  20.629  19.071 1.00 85.65  ?  148 VAL A CG1 1 
ATOM   1087 C CG2 . VAL A 1 156 ? -8.755  20.181  18.889 1.00 75.18  ?  148 VAL A CG2 1 
ATOM   1088 N N   . PHE A 1 157 ? -4.851  18.310  17.049 1.00 61.88  ?  149 PHE A N   1 
ATOM   1089 C CA  . PHE A 1 157 ? -3.692  17.482  17.208 1.00 61.91  ?  149 PHE A CA  1 
ATOM   1090 C C   . PHE A 1 157 ? -2.868  18.238  18.202 1.00 65.95  ?  149 PHE A C   1 
ATOM   1091 O O   . PHE A 1 157 ? -2.783  19.453  18.077 1.00 69.98  ?  149 PHE A O   1 
ATOM   1092 C CB  . PHE A 1 157 ? -2.955  17.339  15.868 1.00 64.11  ?  149 PHE A CB  1 
ATOM   1093 C CG  . PHE A 1 157 ? -3.804  16.721  14.806 1.00 64.14  ?  149 PHE A CG  1 
ATOM   1094 C CD1 . PHE A 1 157 ? -4.026  15.371  14.806 1.00 67.03  ?  149 PHE A CD1 1 
ATOM   1095 C CD2 . PHE A 1 157 ? -4.467  17.503  13.876 1.00 68.25  ?  149 PHE A CD2 1 
ATOM   1096 C CE1 . PHE A 1 157 ? -4.854  14.796  13.869 1.00 68.20  ?  149 PHE A CE1 1 
ATOM   1097 C CE2 . PHE A 1 157 ? -5.308  16.941  12.936 1.00 66.16  ?  149 PHE A CE2 1 
ATOM   1098 C CZ  . PHE A 1 157 ? -5.498  15.581  12.926 1.00 63.79  ?  149 PHE A CZ  1 
ATOM   1099 N N   . VAL A 1 158 ? -2.329  17.544  19.208 1.00 66.43  ?  150 VAL A N   1 
ATOM   1100 C CA  . VAL A 1 158 ? -1.291  18.088  20.105 1.00 60.92  ?  150 VAL A CA  1 
ATOM   1101 C C   . VAL A 1 158 ? -0.032  17.309  19.821 1.00 54.78  ?  150 VAL A C   1 
ATOM   1102 O O   . VAL A 1 158 ? -0.058  16.089  19.870 1.00 53.38  ?  150 VAL A O   1 
ATOM   1103 C CB  . VAL A 1 158 ? -1.660  17.967  21.610 1.00 63.69  ?  150 VAL A CB  1 
ATOM   1104 C CG1 . VAL A 1 158 ? -0.449  18.163  22.524 1.00 60.85  ?  150 VAL A CG1 1 
ATOM   1105 C CG2 . VAL A 1 158 ? -2.694  19.010  21.974 1.00 67.82  ?  150 VAL A CG2 1 
ATOM   1106 N N   . ILE A 1 159 ? 1.061   18.018  19.557 1.00 52.20  ?  151 ILE A N   1 
ATOM   1107 C CA  . ILE A 1 159 ? 2.258   17.415  18.994 1.00 57.70  ?  151 ILE A CA  1 
ATOM   1108 C C   . ILE A 1 159 ? 3.462   17.928  19.753 1.00 58.05  ?  151 ILE A C   1 
ATOM   1109 O O   . ILE A 1 159 ? 3.453   19.083  20.121 1.00 56.76  ?  151 ILE A O   1 
ATOM   1110 C CB  . ILE A 1 159 ? 2.397   17.799  17.499 1.00 64.62  ?  151 ILE A CB  1 
ATOM   1111 C CG1 . ILE A 1 159 ? 1.138   17.345  16.726 1.00 61.42  ?  151 ILE A CG1 1 
ATOM   1112 C CG2 . ILE A 1 159 ? 3.695   17.222  16.886 1.00 61.46  ?  151 ILE A CG2 1 
ATOM   1113 C CD1 . ILE A 1 159 ? 1.164   17.737  15.286 1.00 64.43  ?  151 ILE A CD1 1 
ATOM   1114 N N   . GLU A 1 160 ? 4.458   17.063  19.982 1.00 54.98  ?  152 GLU A N   1 
ATOM   1115 C CA  . GLU A 1 160 ? 5.712   17.386  20.657 1.00 58.92  ?  152 GLU A CA  1 
ATOM   1116 C C   . GLU A 1 160 ? 6.811   16.927  19.746 1.00 65.12  ?  152 GLU A C   1 
ATOM   1117 O O   . GLU A 1 160 ? 6.934   15.721  19.465 1.00 57.43  ?  152 GLU A O   1 
ATOM   1118 C CB  . GLU A 1 160 ? 5.911   16.686  22.025 1.00 66.03  ?  152 GLU A CB  1 
ATOM   1119 C CG  . GLU A 1 160 ? 7.359   16.779  22.606 1.00 76.79  ?  152 GLU A CG  1 
ATOM   1120 C CD  . GLU A 1 160 ? 7.525   16.616  24.145 1.00 86.77  ?  152 GLU A CD  1 
ATOM   1121 O OE1 . GLU A 1 160 ? 6.581   16.133  24.801 1.00 95.59  ?  152 GLU A OE1 1 
ATOM   1122 O OE2 . GLU A 1 160 ? 8.616   16.969  24.714 1.00 97.39  -1 152 GLU A OE2 1 
ATOM   1123 N N   . LEU A 1 161 ? 7.640   17.871  19.302 1.00 67.88  ?  153 LEU A N   1 
ATOM   1124 C CA  . LEU A 1 161 ? 8.683   17.511  18.366 1.00 70.69  ?  153 LEU A CA  1 
ATOM   1125 C C   . LEU A 1 161 ? 9.898   17.064  19.190 1.00 63.03  ?  153 LEU A C   1 
ATOM   1126 O O   . LEU A 1 161 ? 10.302  17.777  20.057 1.00 57.62  ?  153 LEU A O   1 
ATOM   1127 C CB  . LEU A 1 161 ? 8.940   18.690  17.447 1.00 71.44  ?  153 LEU A CB  1 
ATOM   1128 C CG  . LEU A 1 161 ? 10.100  18.556  16.475 1.00 74.50  ?  153 LEU A CG  1 
ATOM   1129 C CD1 . LEU A 1 161 ? 9.964   17.365  15.560 1.00 70.62  ?  153 LEU A CD1 1 
ATOM   1130 C CD2 . LEU A 1 161 ? 10.140  19.824  15.660 1.00 86.69  ?  153 LEU A CD2 1 
ATOM   1131 N N   . LEU A 1 162 ? 10.434  15.866  18.954 1.00 63.92  ?  154 LEU A N   1 
ATOM   1132 C CA  . LEU A 1 162 ? 11.505  15.296  19.819 1.00 71.40  ?  154 LEU A CA  1 
ATOM   1133 C C   . LEU A 1 162 ? 12.900  15.378  19.235 1.00 75.10  ?  154 LEU A C   1 
ATOM   1134 O O   . LEU A 1 162 ? 13.881  15.607  19.947 1.00 90.43  ?  154 LEU A O   1 
ATOM   1135 C CB  . LEU A 1 162 ? 11.276  13.808  20.100 1.00 70.10  ?  154 LEU A CB  1 
ATOM   1136 C CG  . LEU A 1 162 ? 9.951   13.300  20.677 1.00 72.29  ?  154 LEU A CG  1 
ATOM   1137 C CD1 . LEU A 1 162 ? 9.933   11.765  20.641 1.00 74.11  ?  154 LEU A CD1 1 
ATOM   1138 C CD2 . LEU A 1 162 ? 9.705   13.853  22.070 1.00 62.92  ?  154 LEU A CD2 1 
ATOM   1139 N N   . GLN A 1 163 ? 12.993  15.109  17.947 1.00 77.49  ?  155 GLN A N   1 
ATOM   1140 C CA  . GLN A 1 163 ? 14.265  15.087  17.274 1.00 78.68  ?  155 GLN A CA  1 
ATOM   1141 C C   . GLN A 1 163 ? 14.057  15.283  15.773 1.00 86.07  ?  155 GLN A C   1 
ATOM   1142 O O   . GLN A 1 163 ? 13.014  14.873  15.238 1.00 90.24  ?  155 GLN A O   1 
ATOM   1143 C CB  . GLN A 1 163 ? 14.930  13.762  17.590 1.00 82.82  ?  155 GLN A CB  1 
ATOM   1144 C CG  . GLN A 1 163 ? 16.192  13.432  16.815 1.00 85.44  ?  155 GLN A CG  1 
ATOM   1145 C CD  . GLN A 1 163 ? 16.857  12.203  17.380 1.00 85.19  ?  155 GLN A CD  1 
ATOM   1146 O OE1 . GLN A 1 163 ? 17.109  12.127  18.586 1.00 88.35  ?  155 GLN A OE1 1 
ATOM   1147 N NE2 . GLN A 1 163 ? 17.107  11.218  16.529 1.00 84.79  ?  155 GLN A NE2 1 
ATOM   1148 N N   . VAL A 1 164 ? 15.024  15.948  15.120 1.00 83.62  ?  156 VAL A N   1 
ATOM   1149 C CA  . VAL A 1 164 ? 15.086  16.049  13.651 1.00 83.00  ?  156 VAL A CA  1 
ATOM   1150 C C   . VAL A 1 164 ? 16.481  15.630  13.219 1.00 82.49  ?  156 VAL A C   1 
ATOM   1151 O O   . VAL A 1 164 ? 17.448  16.144  13.752 1.00 89.18  ?  156 VAL A O   1 
ATOM   1152 C CB  . VAL A 1 164 ? 14.769  17.476  13.132 1.00 78.53  ?  156 VAL A CB  1 
ATOM   1153 C CG1 . VAL A 1 164 ? 14.516  17.469  11.621 1.00 79.09  ?  156 VAL A CG1 1 
ATOM   1154 C CG2 . VAL A 1 164 ? 13.538  18.044  13.832 1.00 84.38  ?  156 VAL A CG2 1 
ATOM   1155 N N   . ASP A 1 165 ? 16.567  14.680  12.281 1.00 83.42  ?  157 ASP A N   1 
ATOM   1156 C CA  . ASP A 1 165 ? 17.846  14.145  11.757 1.00 89.28  ?  157 ASP A CA  1 
ATOM   1157 C C   . ASP A 1 165 ? 17.879  14.245  10.214 1.00 91.46  ?  157 ASP A C   1 
ATOM   1158 O O   . ASP A 1 165 ? 16.868  14.023  9.553  1.00 103.84 ?  157 ASP A O   1 
ATOM   1159 C CB  . ASP A 1 165 ? 18.049  12.680  12.200 1.00 86.40  ?  157 ASP A CB  1 
ATOM   1160 C CG  . ASP A 1 165 ? 17.773  12.463  13.688 1.00 91.44  ?  157 ASP A CG  1 
ATOM   1161 O OD1 . ASP A 1 165 ? 18.213  13.306  14.518 1.00 88.79  ?  157 ASP A OD1 1 
ATOM   1162 O OD2 . ASP A 1 165 ? 17.104  11.447  14.018 1.00 87.90  -1 157 ASP A OD2 1 
ATOM   1163 N N   . ALA A 1 166 ? 19.032  14.585  9.645  1.00 90.29  ?  158 ALA A N   1 
ATOM   1164 C CA  . ALA A 1 166 ? 19.134  14.818  8.208  1.00 94.67  ?  158 ALA A CA  1 
ATOM   1165 C C   . ALA A 1 166 ? 19.723  13.582  7.484  1.00 94.92  ?  158 ALA A C   1 
ATOM   1166 O O   . ALA A 1 166 ? 20.343  12.738  8.139  1.00 99.59  ?  158 ALA A O   1 
ATOM   1167 C CB  . ALA A 1 166 ? 19.957  16.071  7.967  1.00 95.48  ?  158 ALA A CB  1 
ATOM   1168 N N   . PRO A 1 167 ? 19.515  13.459  6.141  1.00 99.32  ?  159 PRO A N   1 
ATOM   1169 C CA  . PRO A 1 167 ? 20.001  12.275  5.390  1.00 95.32  ?  159 PRO A CA  1 
ATOM   1170 C C   . PRO A 1 167 ? 21.494  11.927  5.583  1.00 98.99  ?  159 PRO A C   1 
ATOM   1171 O O   . PRO A 1 167 ? 21.871  10.747  5.545  1.00 103.04 ?  159 PRO A O   1 
ATOM   1172 C CB  . PRO A 1 167 ? 19.732  12.653  3.919  1.00 97.74  ?  159 PRO A CB  1 
ATOM   1173 C CG  . PRO A 1 167 ? 18.645  13.666  3.950  1.00 95.01  ?  159 PRO A CG  1 
ATOM   1174 C CD  . PRO A 1 167 ? 18.793  14.409  5.256  1.00 98.47  ?  159 PRO A CD  1 
HETATM 1175 C C1  . FAR B 2 .   ? 7.096   8.686   5.510  1.00 84.66  ?  201 FAR A C1  1 
HETATM 1176 C C2  . FAR B 2 .   ? 5.673   9.136   5.653  1.00 101.52 ?  201 FAR A C2  1 
HETATM 1177 C C3  . FAR B 2 .   ? 4.745   8.366   6.286  1.00 112.86 ?  201 FAR A C3  1 
HETATM 1178 C C5  . FAR B 2 .   ? 3.303   8.868   6.429  1.00 100.78 ?  201 FAR A C5  1 
HETATM 1179 C C6  . FAR B 2 .   ? 3.045   8.935   7.966  1.00 100.56 ?  201 FAR A C6  1 
HETATM 1180 C C7  . FAR B 2 .   ? 2.006   9.986   8.340  1.00 101.43 ?  201 FAR A C7  1 
HETATM 1181 C C8  . FAR B 2 .   ? 1.709   10.277  9.637  1.00 104.36 ?  201 FAR A C8  1 
HETATM 1182 C C9  . FAR B 2 .   ? 0.655   11.309  9.966  1.00 89.65  ?  201 FAR A C9  1 
HETATM 1183 C C11 . FAR B 2 .   ? 1.215   12.296  11.032 1.00 84.60  ?  201 FAR A C11 1 
HETATM 1184 C C12 . FAR B 2 .   ? 0.265   12.367  12.202 1.00 81.55  ?  201 FAR A C12 1 
HETATM 1185 C C13 . FAR B 2 .   ? -0.471  13.449  12.532 1.00 83.07  ?  201 FAR A C13 1 
HETATM 1186 C C14 . FAR B 2 .   ? -0.510  14.730  11.793 1.00 87.72  ?  201 FAR A C14 1 
HETATM 1187 C C15 . FAR B 2 .   ? -1.351  13.416  13.675 1.00 94.34  ?  201 FAR A C15 1 
HETATM 1188 C C4  . FAR B 2 .   ? 5.040   7.005   6.910  1.00 106.91 ?  201 FAR A C4  1 
HETATM 1189 C C10 . FAR B 2 .   ? 2.360   9.608   10.847 1.00 119.10 ?  201 FAR A C10 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -7  ?   ?   ?   A . n 
A 1 2   GLY 2   -6  ?   ?   ?   A . n 
A 1 3   HIS 3   -5  ?   ?   ?   A . n 
A 1 4   HIS 4   -4  ?   ?   ?   A . n 
A 1 5   HIS 5   -3  ?   ?   ?   A . n 
A 1 6   HIS 6   -2  ?   ?   ?   A . n 
A 1 7   HIS 7   -1  ?   ?   ?   A . n 
A 1 8   HIS 8   0   ?   ?   ?   A . n 
A 1 9   GLY 9   1   ?   ?   ?   A . n 
A 1 10  ASP 10  2   ?   ?   ?   A . n 
A 1 11  ALA 11  3   ?   ?   ?   A . n 
A 1 12  ALA 12  4   ?   ?   ?   A . n 
A 1 13  LEU 13  5   ?   ?   ?   A . n 
A 1 14  LEU 14  6   ?   ?   ?   A . n 
A 1 15  LEU 15  7   ?   ?   ?   A . n 
A 1 16  ASN 16  8   8   ASN ASN A . n 
A 1 17  VAL 17  9   9   VAL VAL A . n 
A 1 18  GLU 18  10  10  GLU GLU A . n 
A 1 19  GLY 19  11  11  GLY GLY A . n 
A 1 20  VAL 20  12  12  VAL VAL A . n 
A 1 21  LYS 21  13  13  LYS LYS A . n 
A 1 22  LYS 22  14  14  LYS LYS A . n 
A 1 23  THR 23  15  15  THR THR A . n 
A 1 24  ILE 24  16  16  ILE ILE A . n 
A 1 25  LEU 25  17  17  LEU LEU A . n 
A 1 26  HIS 26  18  18  HIS HIS A . n 
A 1 27  GLY 27  19  19  GLY GLY A . n 
A 1 28  GLY 28  20  20  GLY GLY A . n 
A 1 29  THR 29  21  21  THR THR A . n 
A 1 30  GLY 30  22  22  GLY GLY A . n 
A 1 31  GLU 31  23  23  GLU GLU A . n 
A 1 32  LEU 32  24  24  LEU LEU A . n 
A 1 33  PRO 33  25  25  PRO PRO A . n 
A 1 34  ASN 34  26  26  ASN ASN A . n 
A 1 35  PHE 35  27  27  PHE PHE A . n 
A 1 36  ILE 36  28  28  ILE ILE A . n 
A 1 37  THR 37  29  29  THR THR A . n 
A 1 38  GLY 38  30  30  GLY GLY A . n 
A 1 39  SER 39  31  31  SER SER A . n 
A 1 40  ARG 40  32  32  ARG ARG A . n 
A 1 41  VAL 41  33  33  VAL VAL A . n 
A 1 42  ILE 42  34  34  ILE ILE A . n 
A 1 43  PHE 43  35  35  PHE PHE A . n 
A 1 44  HIS 44  36  36  HIS HIS A . n 
A 1 45  PHE 45  37  37  PHE PHE A . n 
A 1 46  ARG 46  38  38  ARG ARG A . n 
A 1 47  THR 47  39  39  THR THR A . n 
A 1 48  MET 48  40  40  MET MET A . n 
A 1 49  LYS 49  41  41  LYS LYS A . n 
A 1 50  CYS 50  42  42  CYS CYS A . n 
A 1 51  ASP 51  43  43  ASP ASP A . n 
A 1 52  GLU 52  44  44  GLU GLU A . n 
A 1 53  GLU 53  45  45  GLU GLU A . n 
A 1 54  ARG 54  46  46  ARG ARG A . n 
A 1 55  THR 55  47  47  THR THR A . n 
A 1 56  VAL 56  48  48  VAL VAL A . n 
A 1 57  ILE 57  49  49  ILE ILE A . n 
A 1 58  ASP 58  50  50  ASP ASP A . n 
A 1 59  ASP 59  51  51  ASP ASP A . n 
A 1 60  SER 60  52  52  SER SER A . n 
A 1 61  ARG 61  53  53  ARG ARG A . n 
A 1 62  GLN 62  54  54  GLN GLN A . n 
A 1 63  VAL 63  55  55  VAL VAL A . n 
A 1 64  GLY 64  56  56  GLY GLY A . n 
A 1 65  GLN 65  57  57  GLN GLN A . n 
A 1 66  PRO 66  58  58  PRO PRO A . n 
A 1 67  MET 67  59  59  MET MET A . n 
A 1 68  HIS 68  60  60  HIS HIS A . n 
A 1 69  ILE 69  61  61  ILE ILE A . n 
A 1 70  ILE 70  62  62  ILE ILE A . n 
A 1 71  ILE 71  63  63  ILE ILE A . n 
A 1 72  GLY 72  64  64  GLY GLY A . n 
A 1 73  ASN 73  65  65  ASN ASN A . n 
A 1 74  MET 74  66  66  MET MET A . n 
A 1 75  PHE 75  67  67  PHE PHE A . n 
A 1 76  LYS 76  68  68  LYS LYS A . n 
A 1 77  LEU 77  69  69  LEU LEU A . n 
A 1 78  GLU 78  70  70  GLU GLU A . n 
A 1 79  PHE 79  71  71  PHE PHE A . n 
A 1 80  TRP 80  72  72  TRP TRP A . n 
A 1 81  GLU 81  73  73  GLU GLU A . n 
A 1 82  ILE 82  74  74  ILE ILE A . n 
A 1 83  LEU 83  75  75  LEU LEU A . n 
A 1 84  LEU 84  76  76  LEU LEU A . n 
A 1 85  THR 85  77  77  THR THR A . n 
A 1 86  SER 86  78  78  SER SER A . n 
A 1 87  MET 87  79  79  MET MET A . n 
A 1 88  ARG 88  80  80  ARG ARG A . n 
A 1 89  VAL 89  81  81  VAL VAL A . n 
A 1 90  HIS 90  82  82  HIS HIS A . n 
A 1 91  GLU 91  83  83  GLU GLU A . n 
A 1 92  VAL 92  84  84  VAL VAL A . n 
A 1 93  ALA 93  85  85  ALA ALA A . n 
A 1 94  GLU 94  86  86  GLU GLU A . n 
A 1 95  PHE 95  87  87  PHE PHE A . n 
A 1 96  TRP 96  88  88  TRP TRP A . n 
A 1 97  CYS 97  89  89  CYS CYS A . n 
A 1 98  ASP 98  90  90  ASP ASP A . n 
A 1 99  THR 99  91  91  THR THR A . n 
A 1 100 ILE 100 92  92  ILE ILE A . n 
A 1 101 HIS 101 93  93  HIS HIS A . n 
A 1 102 THR 102 94  94  THR THR A . n 
A 1 103 GLY 103 95  95  GLY GLY A . n 
A 1 104 VAL 104 96  96  VAL VAL A . n 
A 1 105 TYR 105 97  97  TYR TYR A . n 
A 1 106 PRO 106 98  98  PRO PRO A . n 
A 1 107 ILE 107 99  99  ILE ILE A . n 
A 1 108 LEU 108 100 100 LEU LEU A . n 
A 1 109 SER 109 101 101 SER SER A . n 
A 1 110 ARG 110 102 102 ARG ARG A . n 
A 1 111 SER 111 103 103 SER SER A . n 
A 1 112 LEU 112 104 104 LEU LEU A . n 
A 1 113 ARG 113 105 105 ARG ARG A . n 
A 1 114 GLN 114 106 106 GLN GLN A . n 
A 1 115 MET 115 107 107 MET MET A . n 
A 1 116 ALA 116 108 108 ALA ALA A . n 
A 1 117 GLN 117 109 109 GLN GLN A . n 
A 1 118 GLY 118 110 110 GLY GLY A . n 
A 1 119 LYS 119 111 111 LYS LYS A . n 
A 1 120 ASP 120 112 112 ASP ASP A . n 
A 1 121 PRO 121 113 113 PRO PRO A . n 
A 1 122 THR 122 114 114 THR THR A . n 
A 1 123 GLU 123 115 115 GLU GLU A . n 
A 1 124 TRP 124 116 116 TRP TRP A . n 
A 1 125 HIS 125 117 117 HIS HIS A . n 
A 1 126 VAL 126 118 118 VAL VAL A . n 
A 1 127 HIS 127 119 119 HIS HIS A . n 
A 1 128 THR 128 120 120 THR THR A . n 
A 1 129 CYS 129 121 121 CYS CYS A . n 
A 1 130 GLY 130 122 122 GLY GLY A . n 
A 1 131 LEU 131 123 123 LEU LEU A . n 
A 1 132 ALA 132 124 124 ALA ALA A . n 
A 1 133 ASN 133 125 125 ASN ASN A . n 
A 1 134 MET 134 126 126 MET MET A . n 
A 1 135 PHE 135 127 127 PHE PHE A . n 
A 1 136 ALA 136 128 128 ALA ALA A . n 
A 1 137 TYR 137 129 129 TYR TYR A . n 
A 1 138 HIS 138 130 130 HIS HIS A . n 
A 1 139 THR 139 131 131 THR THR A . n 
A 1 140 LEU 140 132 132 LEU LEU A . n 
A 1 141 GLY 141 133 133 GLY GLY A . n 
A 1 142 TYR 142 134 134 TYR TYR A . n 
A 1 143 GLU 143 135 135 GLU GLU A . n 
A 1 144 ASP 144 136 136 ASP ASP A . n 
A 1 145 LEU 145 137 137 LEU LEU A . n 
A 1 146 ASP 146 138 138 ASP ASP A . n 
A 1 147 GLU 147 139 139 GLU GLU A . n 
A 1 148 LEU 148 140 140 LEU LEU A . n 
A 1 149 GLN 149 141 141 GLN GLN A . n 
A 1 150 LYS 150 142 142 LYS LYS A . n 
A 1 151 GLU 151 143 143 GLU GLU A . n 
A 1 152 PRO 152 144 144 PRO PRO A . n 
A 1 153 GLN 153 145 145 GLN GLN A . n 
A 1 154 PRO 154 146 146 PRO PRO A . n 
A 1 155 LEU 155 147 147 LEU LEU A . n 
A 1 156 VAL 156 148 148 VAL VAL A . n 
A 1 157 PHE 157 149 149 PHE PHE A . n 
A 1 158 VAL 158 150 150 VAL VAL A . n 
A 1 159 ILE 159 151 151 ILE ILE A . n 
A 1 160 GLU 160 152 152 GLU GLU A . n 
A 1 161 LEU 161 153 153 LEU LEU A . n 
A 1 162 LEU 162 154 154 LEU LEU A . n 
A 1 163 GLN 163 155 155 GLN GLN A . n 
A 1 164 VAL 164 156 156 VAL VAL A . n 
A 1 165 ASP 165 157 157 ASP ASP A . n 
A 1 166 ALA 166 158 158 ALA ALA A . n 
A 1 167 PRO 167 159 159 PRO PRO A . n 
A 1 168 SER 168 160 ?   ?   ?   A . n 
A 1 169 ASP 169 161 ?   ?   ?   A . n 
# 
_pdbx_nonpoly_scheme.asym_id         B 
_pdbx_nonpoly_scheme.entity_id       2 
_pdbx_nonpoly_scheme.mon_id          FAR 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     201 
_pdbx_nonpoly_scheme.auth_seq_num    302 
_pdbx_nonpoly_scheme.pdb_mon_id      FAR 
_pdbx_nonpoly_scheme.auth_mon_id     FAR 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3310  ? 
1 MORE         -19   ? 
1 'SSA (A^2)'  15230 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-07-26 
2 'Structure model' 1 1 2017-08-09 
3 'Structure model' 1 2 2017-08-23 
4 'Structure model' 1 3 2017-11-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Database references'    
3 4 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
3 3 'Structure model' citation        
4 4 'Structure model' software        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_abbrev'          
2 2 'Structure model' '_citation.pdbx_database_id_PubMed' 
3 2 'Structure model' '_citation.title'                   
4 2 'Structure model' '_citation_author.name'             
5 3 'Structure model' '_citation.journal_volume'          
6 3 'Structure model' '_citation.page_first'              
7 3 'Structure model' '_citation.page_last'               
8 4 'Structure model' '_software.classification'          
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? REFMAC  ? ? ? 5.8.0158 1 
? 'data collection' ? ? ? ? ? ? ? ? ? ? ? Blu-Ice ? ? ? .        2 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? XDS     ? ? ? .        3 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER  ? ? ? .        4 
? 'model building'  ? ? ? ? ? ? ? ? ? ? ? Coot    ? ? ? .        5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 24  ? ? -30.23  133.47 
2 1 CYS A 42  ? ? -93.44  34.72  
3 1 HIS A 82  ? ? 59.17   12.29  
4 1 ILE A 92  ? ? -34.64  -35.30 
5 1 GLU A 143 ? ? -152.13 75.34  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 13  ? CG  ? A LYS 21  CG  
2  1 Y 1 A LYS 13  ? CD  ? A LYS 21  CD  
3  1 Y 1 A LYS 13  ? CE  ? A LYS 21  CE  
4  1 Y 1 A LYS 13  ? NZ  ? A LYS 21  NZ  
5  1 Y 1 A ARG 32  ? CG  ? A ARG 40  CG  
6  1 Y 1 A ARG 32  ? CD  ? A ARG 40  CD  
7  1 Y 1 A ARG 32  ? NE  ? A ARG 40  NE  
8  1 Y 1 A ARG 32  ? CZ  ? A ARG 40  CZ  
9  1 Y 1 A ARG 32  ? NH1 ? A ARG 40  NH1 
10 1 Y 1 A ARG 32  ? NH2 ? A ARG 40  NH2 
11 1 Y 1 A GLU 44  ? CG  ? A GLU 52  CG  
12 1 Y 1 A GLU 44  ? CD  ? A GLU 52  CD  
13 1 Y 1 A GLU 44  ? OE1 ? A GLU 52  OE1 
14 1 Y 1 A GLU 44  ? OE2 ? A GLU 52  OE2 
15 1 Y 1 A GLU 45  ? CG  ? A GLU 53  CG  
16 1 Y 1 A GLU 45  ? CD  ? A GLU 53  CD  
17 1 Y 1 A GLU 45  ? OE1 ? A GLU 53  OE1 
18 1 Y 1 A GLU 45  ? OE2 ? A GLU 53  OE2 
19 1 Y 1 A LYS 68  ? CG  ? A LYS 76  CG  
20 1 Y 1 A LYS 68  ? CD  ? A LYS 76  CD  
21 1 Y 1 A LYS 68  ? CE  ? A LYS 76  CE  
22 1 Y 1 A LYS 68  ? NZ  ? A LYS 76  NZ  
23 1 Y 1 A ARG 80  ? CG  ? A ARG 88  CG  
24 1 Y 1 A ARG 80  ? CD  ? A ARG 88  CD  
25 1 Y 1 A ARG 80  ? NE  ? A ARG 88  NE  
26 1 Y 1 A ARG 80  ? CZ  ? A ARG 88  CZ  
27 1 Y 1 A ARG 80  ? NH1 ? A ARG 88  NH1 
28 1 Y 1 A ARG 80  ? NH2 ? A ARG 88  NH2 
29 1 Y 1 A ILE 92  ? CG1 ? A ILE 100 CG1 
30 1 Y 1 A ILE 92  ? CG2 ? A ILE 100 CG2 
31 1 Y 1 A ILE 92  ? CD1 ? A ILE 100 CD1 
32 1 Y 1 A MET 107 ? CG  ? A MET 115 CG  
33 1 Y 1 A MET 107 ? SD  ? A MET 115 SD  
34 1 Y 1 A MET 107 ? CE  ? A MET 115 CE  
35 1 Y 1 A LYS 111 ? CG  ? A LYS 119 CG  
36 1 Y 1 A LYS 111 ? CD  ? A LYS 119 CD  
37 1 Y 1 A LYS 111 ? CE  ? A LYS 119 CE  
38 1 Y 1 A LYS 111 ? NZ  ? A LYS 119 NZ  
39 1 Y 1 A GLU 135 ? CG  ? A GLU 143 CG  
40 1 Y 1 A GLU 135 ? CD  ? A GLU 143 CD  
41 1 Y 1 A GLU 135 ? OE1 ? A GLU 143 OE1 
42 1 Y 1 A GLU 135 ? OE2 ? A GLU 143 OE2 
43 1 Y 1 A GLU 139 ? CG  ? A GLU 147 CG  
44 1 Y 1 A GLU 139 ? CD  ? A GLU 147 CD  
45 1 Y 1 A GLU 139 ? OE1 ? A GLU 147 OE1 
46 1 Y 1 A GLU 139 ? OE2 ? A GLU 147 OE2 
47 1 Y 1 A LYS 142 ? CG  ? A LYS 150 CG  
48 1 Y 1 A LYS 142 ? CD  ? A LYS 150 CD  
49 1 Y 1 A LYS 142 ? CE  ? A LYS 150 CE  
50 1 Y 1 A LYS 142 ? NZ  ? A LYS 150 NZ  
51 1 Y 1 A GLU 143 ? CG  ? A GLU 151 CG  
52 1 Y 1 A GLU 143 ? CD  ? A GLU 151 CD  
53 1 Y 1 A GLU 143 ? OE1 ? A GLU 151 OE1 
54 1 Y 1 A GLU 143 ? OE2 ? A GLU 151 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -7  ? A MET 1   
2  1 Y 1 A GLY -6  ? A GLY 2   
3  1 Y 1 A HIS -5  ? A HIS 3   
4  1 Y 1 A HIS -4  ? A HIS 4   
5  1 Y 1 A HIS -3  ? A HIS 5   
6  1 Y 1 A HIS -2  ? A HIS 6   
7  1 Y 1 A HIS -1  ? A HIS 7   
8  1 Y 1 A HIS 0   ? A HIS 8   
9  1 Y 1 A GLY 1   ? A GLY 9   
10 1 Y 1 A ASP 2   ? A ASP 10  
11 1 Y 1 A ALA 3   ? A ALA 11  
12 1 Y 1 A ALA 4   ? A ALA 12  
13 1 Y 1 A LEU 5   ? A LEU 13  
14 1 Y 1 A LEU 6   ? A LEU 14  
15 1 Y 1 A LEU 7   ? A LEU 15  
16 1 Y 1 A SER 160 ? A SER 168 
17 1 Y 1 A ASP 161 ? A ASP 169 
# 
_pdbx_audit_support.funding_organization   'National Institutes of Health/National Eye Institute' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           EY-10843 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        FARNESYL 
_pdbx_entity_nonpoly.comp_id     FAR 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                no 
#