data_5V8V
# 
_entry.id   5V8V 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5V8V         
WWPDB D_1000227043 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5V8V 
_pdbx_database_status.recvd_initial_deposition_date   2017-03-22 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Concha, N.' 1 ? 
'Zhao, B.'   2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Bioorg. Med. Chem. Lett.' 
_citation.journal_id_ASTM           BMCLE8 
_citation.journal_id_CSD            1127 
_citation.journal_id_ISSN           1464-3405 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            27 
_citation.language                  ? 
_citation.page_first                4838 
_citation.page_last                 4843 
_citation.title                     
'Discovery of renin inhibitors containing a simple aspartate binding moiety that imparts reduced P450 inhibition.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.bmcl.2017.09.046 
_citation.pdbx_database_id_PubMed   28985999 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Lawhorn, B.G.'   1  ? 
primary 'Tran, T.'        2  ? 
primary 'Hong, V.S.'      3  ? 
primary 'Morgan, L.A.'    4  ? 
primary 'Le, B.T.'        5  ? 
primary 'Harpel, M.R.'    6  ? 
primary 'Jolivette, L.'   7  ? 
primary 'Diaz, E.'        8  ? 
primary 'Schwartz, B.'    9  ? 
primary 'Gross, J.W.'     10 ? 
primary 'Tomaszek, T.'    11 ? 
primary 'Semus, S.'       12 ? 
primary 'Concha, N.'      13 ? 
primary 'Smallwood, A.'   14 ? 
primary 'Holt, D.A.'      15 ? 
primary 'Kallander, L.S.' 16 ? 
# 
_cell.entry_id           5V8V 
_cell.length_a           54.367 
_cell.length_b           99.014 
_cell.length_c           147.031 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5V8V 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Renin 36939.594 2  3.4.23.15 ? 'UNP residues 70-406' ? 
2 non-polymer syn 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   2  ?         ? ?                     ? 
3 non-polymer syn 
;methyl [(4S)-4-(3'-ethyl-6-fluoro[1,1'-biphenyl]-2-yl)-4-hydroxy-4-{(3R)-1-[4-(methylamino)butanoyl]piperidin-3-yl}butyl]carbamate
;
527.671   4  ?         ? ?                     ? 
4 water       nat water 18.015    69 ?         ? ?                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Angiotensinogenase 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRY
STGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYN
RDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLM
EALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKF
YTEFDRRNNRIGFALAR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRY
STGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYN
RDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLM
EALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKF
YTEFDRRNNRIGFALAR
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ASN n 
1 3   THR n 
1 4   THR n 
1 5   SER n 
1 6   SER n 
1 7   VAL n 
1 8   ILE n 
1 9   LEU n 
1 10  THR n 
1 11  ASN n 
1 12  TYR n 
1 13  MET n 
1 14  ASP n 
1 15  THR n 
1 16  GLN n 
1 17  TYR n 
1 18  TYR n 
1 19  GLY n 
1 20  GLU n 
1 21  ILE n 
1 22  GLY n 
1 23  ILE n 
1 24  GLY n 
1 25  THR n 
1 26  PRO n 
1 27  PRO n 
1 28  GLN n 
1 29  THR n 
1 30  PHE n 
1 31  LYS n 
1 32  VAL n 
1 33  VAL n 
1 34  PHE n 
1 35  ASP n 
1 36  THR n 
1 37  GLY n 
1 38  SER n 
1 39  SER n 
1 40  ASN n 
1 41  VAL n 
1 42  TRP n 
1 43  VAL n 
1 44  PRO n 
1 45  SER n 
1 46  SER n 
1 47  LYS n 
1 48  CYS n 
1 49  SER n 
1 50  ARG n 
1 51  LEU n 
1 52  TYR n 
1 53  THR n 
1 54  ALA n 
1 55  CYS n 
1 56  VAL n 
1 57  TYR n 
1 58  HIS n 
1 59  LYS n 
1 60  LEU n 
1 61  PHE n 
1 62  ASP n 
1 63  ALA n 
1 64  SER n 
1 65  ASP n 
1 66  SER n 
1 67  SER n 
1 68  SER n 
1 69  TYR n 
1 70  LYS n 
1 71  HIS n 
1 72  ASN n 
1 73  GLY n 
1 74  THR n 
1 75  GLU n 
1 76  LEU n 
1 77  THR n 
1 78  LEU n 
1 79  ARG n 
1 80  TYR n 
1 81  SER n 
1 82  THR n 
1 83  GLY n 
1 84  THR n 
1 85  VAL n 
1 86  SER n 
1 87  GLY n 
1 88  PHE n 
1 89  LEU n 
1 90  SER n 
1 91  GLN n 
1 92  ASP n 
1 93  ILE n 
1 94  ILE n 
1 95  THR n 
1 96  VAL n 
1 97  GLY n 
1 98  GLY n 
1 99  ILE n 
1 100 THR n 
1 101 VAL n 
1 102 THR n 
1 103 GLN n 
1 104 MET n 
1 105 PHE n 
1 106 GLY n 
1 107 GLU n 
1 108 VAL n 
1 109 THR n 
1 110 GLU n 
1 111 MET n 
1 112 PRO n 
1 113 ALA n 
1 114 LEU n 
1 115 PRO n 
1 116 PHE n 
1 117 MET n 
1 118 LEU n 
1 119 ALA n 
1 120 GLU n 
1 121 PHE n 
1 122 ASP n 
1 123 GLY n 
1 124 VAL n 
1 125 VAL n 
1 126 GLY n 
1 127 MET n 
1 128 GLY n 
1 129 PHE n 
1 130 ILE n 
1 131 GLU n 
1 132 GLN n 
1 133 ALA n 
1 134 ILE n 
1 135 GLY n 
1 136 ARG n 
1 137 VAL n 
1 138 THR n 
1 139 PRO n 
1 140 ILE n 
1 141 PHE n 
1 142 ASP n 
1 143 ASN n 
1 144 ILE n 
1 145 ILE n 
1 146 SER n 
1 147 GLN n 
1 148 GLY n 
1 149 VAL n 
1 150 LEU n 
1 151 LYS n 
1 152 GLU n 
1 153 ASP n 
1 154 VAL n 
1 155 PHE n 
1 156 SER n 
1 157 PHE n 
1 158 TYR n 
1 159 TYR n 
1 160 ASN n 
1 161 ARG n 
1 162 ASP n 
1 163 SER n 
1 164 GLU n 
1 165 ASN n 
1 166 SER n 
1 167 GLN n 
1 168 SER n 
1 169 LEU n 
1 170 GLY n 
1 171 GLY n 
1 172 GLN n 
1 173 ILE n 
1 174 VAL n 
1 175 LEU n 
1 176 GLY n 
1 177 GLY n 
1 178 SER n 
1 179 ASP n 
1 180 PRO n 
1 181 GLN n 
1 182 HIS n 
1 183 TYR n 
1 184 GLU n 
1 185 GLY n 
1 186 ASN n 
1 187 PHE n 
1 188 HIS n 
1 189 TYR n 
1 190 ILE n 
1 191 ASN n 
1 192 LEU n 
1 193 ILE n 
1 194 LYS n 
1 195 THR n 
1 196 GLY n 
1 197 VAL n 
1 198 TRP n 
1 199 GLN n 
1 200 ILE n 
1 201 GLN n 
1 202 MET n 
1 203 LYS n 
1 204 GLY n 
1 205 VAL n 
1 206 SER n 
1 207 VAL n 
1 208 GLY n 
1 209 SER n 
1 210 SER n 
1 211 THR n 
1 212 LEU n 
1 213 LEU n 
1 214 CYS n 
1 215 GLU n 
1 216 ASP n 
1 217 GLY n 
1 218 CYS n 
1 219 LEU n 
1 220 ALA n 
1 221 LEU n 
1 222 VAL n 
1 223 ASP n 
1 224 THR n 
1 225 GLY n 
1 226 ALA n 
1 227 SER n 
1 228 TYR n 
1 229 ILE n 
1 230 SER n 
1 231 GLY n 
1 232 SER n 
1 233 THR n 
1 234 SER n 
1 235 SER n 
1 236 ILE n 
1 237 GLU n 
1 238 LYS n 
1 239 LEU n 
1 240 MET n 
1 241 GLU n 
1 242 ALA n 
1 243 LEU n 
1 244 GLY n 
1 245 ALA n 
1 246 LYS n 
1 247 LYS n 
1 248 ARG n 
1 249 LEU n 
1 250 PHE n 
1 251 ASP n 
1 252 TYR n 
1 253 VAL n 
1 254 VAL n 
1 255 LYS n 
1 256 CYS n 
1 257 ASN n 
1 258 GLU n 
1 259 GLY n 
1 260 PRO n 
1 261 THR n 
1 262 LEU n 
1 263 PRO n 
1 264 ASP n 
1 265 ILE n 
1 266 SER n 
1 267 PHE n 
1 268 HIS n 
1 269 LEU n 
1 270 GLY n 
1 271 GLY n 
1 272 LYS n 
1 273 GLU n 
1 274 TYR n 
1 275 THR n 
1 276 LEU n 
1 277 THR n 
1 278 SER n 
1 279 ALA n 
1 280 ASP n 
1 281 TYR n 
1 282 VAL n 
1 283 PHE n 
1 284 GLN n 
1 285 GLU n 
1 286 SER n 
1 287 TYR n 
1 288 SER n 
1 289 SER n 
1 290 LYS n 
1 291 LYS n 
1 292 LEU n 
1 293 CYS n 
1 294 THR n 
1 295 LEU n 
1 296 ALA n 
1 297 ILE n 
1 298 HIS n 
1 299 ALA n 
1 300 MET n 
1 301 ASP n 
1 302 ILE n 
1 303 PRO n 
1 304 PRO n 
1 305 PRO n 
1 306 THR n 
1 307 GLY n 
1 308 PRO n 
1 309 THR n 
1 310 TRP n 
1 311 ALA n 
1 312 LEU n 
1 313 GLY n 
1 314 ALA n 
1 315 THR n 
1 316 PHE n 
1 317 ILE n 
1 318 ARG n 
1 319 LYS n 
1 320 PHE n 
1 321 TYR n 
1 322 THR n 
1 323 GLU n 
1 324 PHE n 
1 325 ASP n 
1 326 ARG n 
1 327 ARG n 
1 328 ASN n 
1 329 ASN n 
1 330 ARG n 
1 331 ILE n 
1 332 GLY n 
1 333 PHE n 
1 334 ALA n 
1 335 LEU n 
1 336 ALA n 
1 337 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   337 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 REN 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      Baculoviridae 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     10442 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 HEK-F 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          baculovirus 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RENI_HUMAN 
_struct_ref.pdbx_db_accession          P00797 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRY
STGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYN
RDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLM
EALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKF
YTEFDRRNNRIGFALAR
;
_struct_ref.pdbx_align_begin           70 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5V8V A 1 ? 337 ? P00797 70 ? 406 ? 70 406 
2 1 5V8V B 1 ? 337 ? P00797 70 ? 406 ? 70 406 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
90D non-polymer                  . 
;methyl [(4S)-4-(3'-ethyl-6-fluoro[1,1'-biphenyl]-2-yl)-4-hydroxy-4-{(3R)-1-[4-(methylamino)butanoyl]piperidin-3-yl}butyl]carbamate
;
? 'C30 H42 F N3 O4' 527.671 
ALA 'L-peptide linking'          y ALANINE ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking'          y ARGININE ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking'          y ASPARAGINE ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID' ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking'          y CYSTEINE ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking'          y GLUTAMINE ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID' ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'            y GLYCINE ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking'          y HISTIDINE ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer                  . WATER ? 'H2 O'            18.015  
ILE 'L-peptide linking'          y ISOLEUCINE ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking'          y LEUCINE ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking'          y LYSINE ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking'          y METHIONINE ? 'C5 H11 N O2 S'   149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'     221.208 
PHE 'L-peptide linking'          y PHENYLALANINE ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking'          y PROLINE ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking'          y SERINE ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking'          y THREONINE ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking'          y TYROSINE ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking'          y VALINE ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5V8V 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.70 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         54.51 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '19-22% PEG3350, 200mM ammonium sulfate, 100mM TRIS-HCl, pH 7.5, 2mM inhibitor, 1% DMSO' 
_exptl_crystal_grow.pdbx_pH_range   '7.0 - 8.5' 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 210' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2007-06-20 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5V8V 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.60 
_reflns.d_resolution_low                 50.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       25373 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       2 
_reflns.percent_possible_obs             99.6 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.6 
_reflns.pdbx_Rmerge_I_obs                .0118 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            6.7 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  . 
_reflns_shell.d_res_low                   ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5V8V 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     23801 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             45.334 
_refine.ls_d_res_high                            2.600 
_refine.ls_percent_reflns_obs                    94.60 
_refine.ls_R_factor_obs                          0.1897 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1858 
_refine.ls_R_factor_R_free                       0.2533 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.91 
_refine.ls_number_reflns_R_free                  1406 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      4ryc 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.39 
_refine.pdbx_overall_phase_error                 25.74 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5106 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         180 
_refine_hist.number_atoms_solvent             69 
_refine_hist.number_atoms_total               5355 
_refine_hist.d_res_high                       2.600 
_refine_hist.d_res_low                        45.334 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.005  ? ? 5421 'X-RAY DIFFRACTION' ? 
f_angle_d          0.764  ? ? 7371 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 14.794 ? ? 3104 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.052  ? ? 820  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.004  ? ? 928  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.6000 2.6929  1868 0.3303 80.00 0.3976 . . 115 . . 
'X-RAY DIFFRACTION' . 2.6929 2.8007  2067 0.2708 90.00 0.3962 . . 144 . . 
'X-RAY DIFFRACTION' . 2.8007 2.9282  2118 0.2355 92.00 0.2988 . . 147 . . 
'X-RAY DIFFRACTION' . 2.9282 3.0825  2245 0.2214 95.00 0.2904 . . 125 . . 
'X-RAY DIFFRACTION' . 3.0825 3.2756  2284 0.2170 97.00 0.3240 . . 133 . . 
'X-RAY DIFFRACTION' . 3.2756 3.5284  2283 0.2023 97.00 0.2543 . . 140 . . 
'X-RAY DIFFRACTION' . 3.5284 3.8833  2313 0.1728 98.00 0.2512 . . 152 . . 
'X-RAY DIFFRACTION' . 3.8833 4.4448  2332 0.1399 98.00 0.2108 . . 143 . . 
'X-RAY DIFFRACTION' . 4.4448 5.5984  2401 0.1352 99.00 0.1758 . . 153 . . 
'X-RAY DIFFRACTION' . 5.5984 45.3407 2484 0.1771 98.00 0.2288 . . 154 . . 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? 1.000000 0.000000  0.000000  0.000000  1.000000  0.000000  0.000000 0.000000 1.000000  0.00000  0.00000  0.00000  
2 given ? 0.500410 -0.861258 -0.088455 -0.864659 -0.491923 -0.101870 0.044224 0.127460 -0.990857 41.63481 71.12656 34.11816 
# 
_struct.entry_id                     5V8V 
_struct.title                        'Crystal Structure of Human Renin in Complex with a biphenylpipderidinylcarbinol' 
_struct.pdbx_descriptor              'Renin (E.C.3.4.23.15)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5V8V 
_struct_keywords.text            'renin inhibitor, biphenyl, hypertension, Cyp 3A4, HYDROLASE-HYDROLASE inhibitor complex' 
_struct_keywords.pdbx_keywords   'HYDROLASE/HYDROLASE inhibitor' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
I N N 4 ? 
J N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 TYR A 52  ? HIS A 58  ? TYR A 121 HIS A 127 1 ? 7  
HELX_P HELX_P2  AA2 ASP A 62  ? SER A 66  ? ASP A 131 SER A 135 5 ? 5  
HELX_P HELX_P3  AA3 PRO A 112 ? MET A 117 ? PRO A 181 MET A 186 1 ? 6  
HELX_P HELX_P4  AA4 PHE A 129 ? VAL A 137 ? PHE A 198 VAL A 206 5 ? 9  
HELX_P HELX_P5  AA5 PRO A 139 ? GLN A 147 ? PRO A 208 GLN A 216 1 ? 9  
HELX_P HELX_P6  AA6 ASP A 179 ? GLN A 181 ? ASP A 248 GLN A 250 5 ? 3  
HELX_P HELX_P7  AA7 SER A 232 ? GLY A 244 ? SER A 301 GLY A 313 1 ? 13 
HELX_P HELX_P8  AA8 ASN A 257 ? GLY A 259 ? ASN A 326 GLY A 328 5 ? 3  
HELX_P HELX_P9  AA9 THR A 277 ? VAL A 282 ? THR A 346 VAL A 351 1 ? 6  
HELX_P HELX_P10 AB1 GLY A 313 ? ARG A 318 ? GLY A 382 ARG A 387 1 ? 6  
HELX_P HELX_P11 AB2 THR B 53  ? HIS B 58  ? THR B 122 HIS B 127 1 ? 6  
HELX_P HELX_P12 AB3 ASP B 62  ? SER B 66  ? ASP B 131 SER B 135 5 ? 5  
HELX_P HELX_P13 AB4 PRO B 112 ? MET B 117 ? PRO B 181 MET B 186 1 ? 6  
HELX_P HELX_P14 AB5 PHE B 129 ? VAL B 137 ? PHE B 198 VAL B 206 5 ? 9  
HELX_P HELX_P15 AB6 PRO B 139 ? GLN B 147 ? PRO B 208 GLN B 216 1 ? 9  
HELX_P HELX_P16 AB7 ASP B 179 ? GLN B 181 ? ASP B 248 GLN B 250 5 ? 3  
HELX_P HELX_P17 AB8 SER B 232 ? GLY B 244 ? SER B 301 GLY B 313 1 ? 13 
HELX_P HELX_P18 AB9 ASN B 257 ? LEU B 262 ? ASN B 326 LEU B 331 5 ? 6  
HELX_P HELX_P19 AC1 THR B 277 ? VAL B 282 ? THR B 346 VAL B 351 1 ? 6  
HELX_P HELX_P20 AC2 GLY B 313 ? ARG B 318 ? GLY B 382 ARG B 387 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 48  SG  ? ? ? 1_555 A CYS 55  SG ? ? A CYS 117 A CYS 124 1_555 ? ? ? ? ? ? ? 2.026 ? ?               
disulf2 disulf ?   ? A CYS 214 SG  ? ? ? 1_555 A CYS 218 SG ? ? A CYS 283 A CYS 287 1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf3 disulf ?   ? A CYS 256 SG  ? ? ? 1_555 A CYS 293 SG ? ? A CYS 325 A CYS 362 1_555 ? ? ? ? ? ? ? 2.048 ? ?               
disulf4 disulf ?   ? B CYS 48  SG  ? ? ? 1_555 B CYS 55  SG ? ? B CYS 117 B CYS 124 1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf5 disulf ?   ? B CYS 214 SG  ? ? ? 1_555 B CYS 218 SG ? ? B CYS 283 B CYS 287 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf6 disulf ?   ? B CYS 256 SG  ? ? ? 1_555 B CYS 293 SG ? ? B CYS 325 B CYS 362 1_555 ? ? ? ? ? ? ? 2.047 ? ?               
covale1 covale one ? A ASN 72  ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 141 A NAG 501 1_555 ? ? ? ? ? ? ? 1.430 ? N-Glycosylation 
covale2 covale one ? B ASN 72  ND2 ? ? ? 1_555 F NAG .   C1 ? ? B ASN 141 B NAG 501 1_555 ? ? ? ? ? ? ? 1.448 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 25  A . ? THR 94  A PRO 26  A ? PRO 95  A 1 -3.09 
2 LEU 114 A . ? LEU 183 A PRO 115 A ? PRO 184 A 1 9.64  
3 PRO 304 A . ? PRO 373 A PRO 305 A ? PRO 374 A 1 8.19  
4 GLY 307 A . ? GLY 376 A PRO 308 A ? PRO 377 A 1 0.86  
5 THR 25  B . ? THR 94  B PRO 26  B ? PRO 95  B 1 2.71  
6 LEU 114 B . ? LEU 183 B PRO 115 B ? PRO 184 B 1 11.92 
7 SER 163 B . ? SER 232 B GLU 164 B ? GLU 233 B 1 13.29 
8 PRO 304 B . ? PRO 373 B PRO 305 B ? PRO 374 B 1 2.60  
9 GLY 307 B . ? GLY 376 B PRO 308 B ? PRO 377 B 1 -1.57 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 9  ? 
AA2 ? 13 ? 
AA3 ? 3  ? 
AA4 ? 4  ? 
AA5 ? 2  ? 
AA6 ? 3  ? 
AA7 ? 9  ? 
AA8 ? 13 ? 
AA9 ? 4  ? 
AB1 ? 4  ? 
AB2 ? 2  ? 
AB3 ? 3  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? anti-parallel 
AA1 3  4  ? anti-parallel 
AA1 4  5  ? anti-parallel 
AA1 5  6  ? anti-parallel 
AA1 6  7  ? anti-parallel 
AA1 7  8  ? anti-parallel 
AA1 8  9  ? anti-parallel 
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? parallel      
AA2 4  5  ? anti-parallel 
AA2 5  6  ? parallel      
AA2 6  7  ? anti-parallel 
AA2 7  8  ? anti-parallel 
AA2 8  9  ? anti-parallel 
AA2 9  10 ? anti-parallel 
AA2 10 11 ? anti-parallel 
AA2 11 12 ? anti-parallel 
AA2 12 13 ? anti-parallel 
AA3 1  2  ? anti-parallel 
AA3 2  3  ? parallel      
AA4 1  2  ? anti-parallel 
AA4 2  3  ? anti-parallel 
AA4 3  4  ? anti-parallel 
AA5 1  2  ? parallel      
AA6 1  2  ? anti-parallel 
AA6 2  3  ? anti-parallel 
AA7 1  2  ? anti-parallel 
AA7 2  3  ? anti-parallel 
AA7 3  4  ? anti-parallel 
AA7 4  5  ? anti-parallel 
AA7 5  6  ? anti-parallel 
AA7 6  7  ? anti-parallel 
AA7 7  8  ? anti-parallel 
AA7 8  9  ? anti-parallel 
AA8 1  2  ? anti-parallel 
AA8 2  3  ? anti-parallel 
AA8 3  4  ? parallel      
AA8 4  5  ? anti-parallel 
AA8 5  6  ? parallel      
AA8 6  7  ? anti-parallel 
AA8 7  8  ? anti-parallel 
AA8 8  9  ? anti-parallel 
AA8 9  10 ? anti-parallel 
AA8 10 11 ? anti-parallel 
AA8 11 12 ? anti-parallel 
AA8 12 13 ? anti-parallel 
AA9 1  2  ? anti-parallel 
AA9 2  3  ? anti-parallel 
AA9 3  4  ? anti-parallel 
AB1 1  2  ? anti-parallel 
AB1 2  3  ? anti-parallel 
AB1 3  4  ? parallel      
AB2 1  2  ? parallel      
AB3 1  2  ? anti-parallel 
AB3 2  3  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LYS A 70  ? ARG A 79  ? LYS A 139 ARG A 148 
AA1 2  THR A 84  ? VAL A 96  ? THR A 153 VAL A 165 
AA1 3  GLN A 16  ? ILE A 23  ? GLN A 85  ILE A 92  
AA1 4  SER A 5   ? TYR A 12  ? SER A 74  TYR A 81  
AA1 5  GLY A 171 ? LEU A 175 ? GLY A 240 LEU A 244 
AA1 6  VAL A 154 ? TYR A 159 ? VAL A 223 TYR A 228 
AA1 7  PHE A 320 ? ASP A 325 ? PHE A 389 ASP A 394 
AA1 8  ARG A 330 ? ALA A 336 ? ARG A 399 ALA A 405 
AA1 9  TYR A 183 ? ASN A 191 ? TYR A 252 ASN A 260 
AA2 1  LYS A 70  ? ARG A 79  ? LYS A 139 ARG A 148 
AA2 2  THR A 84  ? VAL A 96  ? THR A 153 VAL A 165 
AA2 3  ILE A 99  ? GLU A 110 ? ILE A 168 GLU A 179 
AA2 4  VAL A 41  ? PRO A 44  ? VAL A 110 PRO A 113 
AA2 5  GLY A 123 ? GLY A 126 ? GLY A 192 GLY A 195 
AA2 6  GLN A 28  ? ASP A 35  ? GLN A 97  ASP A 104 
AA2 7  GLN A 16  ? ILE A 23  ? GLN A 85  ILE A 92  
AA2 8  SER A 5   ? TYR A 12  ? SER A 74  TYR A 81  
AA2 9  GLY A 171 ? LEU A 175 ? GLY A 240 LEU A 244 
AA2 10 VAL A 154 ? TYR A 159 ? VAL A 223 TYR A 228 
AA2 11 PHE A 320 ? ASP A 325 ? PHE A 389 ASP A 394 
AA2 12 ARG A 330 ? ALA A 336 ? ARG A 399 ALA A 405 
AA2 13 TYR A 183 ? ASN A 191 ? TYR A 252 ASN A 260 
AA3 1  GLN A 199 ? MET A 202 ? GLN A 268 MET A 271 
AA3 2  CYS A 218 ? VAL A 222 ? CYS A 287 VAL A 291 
AA3 3  TRP A 310 ? LEU A 312 ? TRP A 379 LEU A 381 
AA4 1  SER A 210 ? LEU A 213 ? SER A 279 LEU A 282 
AA4 2  GLY A 204 ? VAL A 207 ? GLY A 273 VAL A 276 
AA4 3  ILE A 265 ? LEU A 269 ? ILE A 334 LEU A 338 
AA4 4  LYS A 272 ? LEU A 276 ? LYS A 341 LEU A 345 
AA5 1  ILE A 229 ? GLY A 231 ? ILE A 298 GLY A 300 
AA5 2  ILE A 297 ? ALA A 299 ? ILE A 366 ALA A 368 
AA6 1  LYS A 246 ? LYS A 247 ? LYS A 315 LYS A 316 
AA6 2  TYR A 252 ? LYS A 255 ? TYR A 321 LYS A 324 
AA6 3  LEU A 292 ? THR A 294 ? LEU A 361 THR A 363 
AA7 1  LYS B 70  ? TYR B 80  ? LYS B 139 TYR B 149 
AA7 2  GLY B 83  ? VAL B 96  ? GLY B 152 VAL B 165 
AA7 3  GLN B 16  ? ILE B 23  ? GLN B 85  ILE B 92  
AA7 4  SER B 5   ? TYR B 12  ? SER B 74  TYR B 81  
AA7 5  GLY B 171 ? LEU B 175 ? GLY B 240 LEU B 244 
AA7 6  VAL B 154 ? TYR B 159 ? VAL B 223 TYR B 228 
AA7 7  PHE B 320 ? ASP B 325 ? PHE B 389 ASP B 394 
AA7 8  ARG B 330 ? ALA B 336 ? ARG B 399 ALA B 405 
AA7 9  TYR B 183 ? ASN B 191 ? TYR B 252 ASN B 260 
AA8 1  LYS B 70  ? TYR B 80  ? LYS B 139 TYR B 149 
AA8 2  GLY B 83  ? VAL B 96  ? GLY B 152 VAL B 165 
AA8 3  ILE B 99  ? GLU B 110 ? ILE B 168 GLU B 179 
AA8 4  VAL B 41  ? PRO B 44  ? VAL B 110 PRO B 113 
AA8 5  GLY B 123 ? GLY B 126 ? GLY B 192 GLY B 195 
AA8 6  GLN B 28  ? ASP B 35  ? GLN B 97  ASP B 104 
AA8 7  GLN B 16  ? ILE B 23  ? GLN B 85  ILE B 92  
AA8 8  SER B 5   ? TYR B 12  ? SER B 74  TYR B 81  
AA8 9  GLY B 171 ? LEU B 175 ? GLY B 240 LEU B 244 
AA8 10 VAL B 154 ? TYR B 159 ? VAL B 223 TYR B 228 
AA8 11 PHE B 320 ? ASP B 325 ? PHE B 389 ASP B 394 
AA8 12 ARG B 330 ? ALA B 336 ? ARG B 399 ALA B 405 
AA8 13 TYR B 183 ? ASN B 191 ? TYR B 252 ASN B 260 
AA9 1  SER B 210 ? LEU B 213 ? SER B 279 LEU B 282 
AA9 2  GLN B 199 ? VAL B 207 ? GLN B 268 VAL B 276 
AA9 3  ILE B 265 ? LEU B 269 ? ILE B 334 LEU B 338 
AA9 4  LYS B 272 ? LEU B 276 ? LYS B 341 LEU B 345 
AB1 1  SER B 210 ? LEU B 213 ? SER B 279 LEU B 282 
AB1 2  GLN B 199 ? VAL B 207 ? GLN B 268 VAL B 276 
AB1 3  CYS B 218 ? VAL B 222 ? CYS B 287 VAL B 291 
AB1 4  TRP B 310 ? LEU B 312 ? TRP B 379 LEU B 381 
AB2 1  ILE B 229 ? GLY B 231 ? ILE B 298 GLY B 300 
AB2 2  ILE B 297 ? ALA B 299 ? ILE B 366 ALA B 368 
AB3 1  LYS B 246 ? LYS B 247 ? LYS B 315 LYS B 316 
AB3 2  TYR B 252 ? LYS B 255 ? TYR B 321 LYS B 324 
AB3 3  LEU B 292 ? THR B 294 ? LEU B 361 THR B 363 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N LEU A 76  ? N LEU A 145 O GLY A 87  ? O GLY A 156 
AA1 2  3  O THR A 95  ? O THR A 164 N GLY A 22  ? N GLY A 91  
AA1 3  4  O TYR A 18  ? O TYR A 87  N THR A 10  ? N THR A 79  
AA1 4  5  N SER A 5   ? N SER A 74  O LEU A 175 ? O LEU A 244 
AA1 5  6  O GLN A 172 ? O GLN A 241 N TYR A 158 ? N TYR A 227 
AA1 6  7  N PHE A 155 ? N PHE A 224 O PHE A 324 ? O PHE A 393 
AA1 7  8  N GLU A 323 ? N GLU A 392 O GLY A 332 ? O GLY A 401 
AA1 8  9  O PHE A 333 ? O PHE A 402 N HIS A 188 ? N HIS A 257 
AA2 1  2  N LEU A 76  ? N LEU A 145 O GLY A 87  ? O GLY A 156 
AA2 2  3  N ILE A 94  ? N ILE A 163 O VAL A 101 ? O VAL A 170 
AA2 3  4  O GLY A 106 ? O GLY A 175 N VAL A 41  ? N VAL A 110 
AA2 4  5  N TRP A 42  ? N TRP A 111 O VAL A 124 ? O VAL A 193 
AA2 5  6  O VAL A 125 ? O VAL A 194 N VAL A 33  ? N VAL A 102 
AA2 6  7  O VAL A 32  ? O VAL A 101 N GLY A 19  ? N GLY A 88  
AA2 7  8  O TYR A 18  ? O TYR A 87  N THR A 10  ? N THR A 79  
AA2 8  9  N SER A 5   ? N SER A 74  O LEU A 175 ? O LEU A 244 
AA2 9  10 O GLN A 172 ? O GLN A 241 N TYR A 158 ? N TYR A 227 
AA2 10 11 N PHE A 155 ? N PHE A 224 O PHE A 324 ? O PHE A 393 
AA2 11 12 N GLU A 323 ? N GLU A 392 O GLY A 332 ? O GLY A 401 
AA2 12 13 O PHE A 333 ? O PHE A 402 N HIS A 188 ? N HIS A 257 
AA3 1  2  N ILE A 200 ? N ILE A 269 O ALA A 220 ? O ALA A 289 
AA3 2  3  N LEU A 221 ? N LEU A 290 O LEU A 312 ? O LEU A 381 
AA4 1  2  O LEU A 213 ? O LEU A 282 N VAL A 205 ? N VAL A 274 
AA4 2  3  N GLY A 204 ? N GLY A 273 O HIS A 268 ? O HIS A 337 
AA4 3  4  N ILE A 265 ? N ILE A 334 O LEU A 276 ? O LEU A 345 
AA5 1  2  N ILE A 229 ? N ILE A 298 O HIS A 298 ? O HIS A 367 
AA6 1  2  N LYS A 246 ? N LYS A 315 O VAL A 253 ? O VAL A 322 
AA6 2  3  N VAL A 254 ? N VAL A 323 O CYS A 293 ? O CYS A 362 
AA7 1  2  N TYR B 80  ? N TYR B 149 O GLY B 83  ? O GLY B 152 
AA7 2  3  O THR B 95  ? O THR B 164 N GLY B 22  ? N GLY B 91  
AA7 3  4  O TYR B 18  ? O TYR B 87  N THR B 10  ? N THR B 79  
AA7 4  5  N SER B 5   ? N SER B 74  O LEU B 175 ? O LEU B 244 
AA7 5  6  O GLN B 172 ? O GLN B 241 N TYR B 158 ? N TYR B 227 
AA7 6  7  N PHE B 155 ? N PHE B 224 O PHE B 324 ? O PHE B 393 
AA7 7  8  N GLU B 323 ? N GLU B 392 O GLY B 332 ? O GLY B 401 
AA7 8  9  O ILE B 331 ? O ILE B 400 N ILE B 190 ? N ILE B 259 
AA8 1  2  N TYR B 80  ? N TYR B 149 O GLY B 83  ? O GLY B 152 
AA8 2  3  N SER B 86  ? N SER B 155 O THR B 109 ? O THR B 178 
AA8 3  4  O GLY B 106 ? O GLY B 175 N VAL B 41  ? N VAL B 110 
AA8 4  5  N TRP B 42  ? N TRP B 111 O VAL B 124 ? O VAL B 193 
AA8 5  6  O VAL B 125 ? O VAL B 194 N VAL B 33  ? N VAL B 102 
AA8 6  7  O VAL B 32  ? O VAL B 101 N GLY B 19  ? N GLY B 88  
AA8 7  8  O TYR B 18  ? O TYR B 87  N THR B 10  ? N THR B 79  
AA8 8  9  N SER B 5   ? N SER B 74  O LEU B 175 ? O LEU B 244 
AA8 9  10 O GLN B 172 ? O GLN B 241 N TYR B 158 ? N TYR B 227 
AA8 10 11 N PHE B 155 ? N PHE B 224 O PHE B 324 ? O PHE B 393 
AA8 11 12 N GLU B 323 ? N GLU B 392 O GLY B 332 ? O GLY B 401 
AA8 12 13 O ILE B 331 ? O ILE B 400 N ILE B 190 ? N ILE B 259 
AA9 1  2  O SER B 210 ? O SER B 279 N VAL B 207 ? N VAL B 276 
AA9 2  3  N GLY B 204 ? N GLY B 273 O HIS B 268 ? O HIS B 337 
AA9 3  4  N ILE B 265 ? N ILE B 334 O LEU B 276 ? O LEU B 345 
AB1 1  2  O SER B 210 ? O SER B 279 N VAL B 207 ? N VAL B 276 
AB1 2  3  N MET B 202 ? N MET B 271 O CYS B 218 ? O CYS B 287 
AB1 3  4  N LEU B 221 ? N LEU B 290 O LEU B 312 ? O LEU B 381 
AB2 1  2  N ILE B 229 ? N ILE B 298 O HIS B 298 ? O HIS B 367 
AB3 1  2  N LYS B 246 ? N LYS B 315 O VAL B 253 ? O VAL B 322 
AB3 2  3  N VAL B 254 ? N VAL B 323 O CYS B 293 ? O CYS B 362 
# 
_atom_sites.entry_id                    5V8V 
_atom_sites.fract_transf_matrix[1][1]   0.018394 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010100 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006801 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
F 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLY A 1 1   ? 31.193 65.824 -10.063 1.00 62.64  ? 70  GLY A N   1 
ATOM   2    C CA  . GLY A 1 1   ? 30.415 66.400 -8.984  1.00 68.45  ? 70  GLY A CA  1 
ATOM   3    C C   . GLY A 1 1   ? 31.283 66.838 -7.822  1.00 73.79  ? 70  GLY A C   1 
ATOM   4    O O   . GLY A 1 1   ? 32.507 66.727 -7.882  1.00 74.95  ? 70  GLY A O   1 
ATOM   5    N N   . ASN A 1 2   ? 30.645 67.346 -6.764  1.00 73.11  ? 71  ASN A N   1 
ATOM   6    C CA  . ASN A 1 2   ? 31.369 67.763 -5.570  1.00 77.13  ? 71  ASN A CA  1 
ATOM   7    C C   . ASN A 1 2   ? 30.650 67.367 -4.284  1.00 81.53  ? 71  ASN A C   1 
ATOM   8    O O   . ASN A 1 2   ? 30.991 67.895 -3.217  1.00 83.81  ? 71  ASN A O   1 
ATOM   9    C CB  . ASN A 1 2   ? 31.610 69.279 -5.585  1.00 76.34  ? 71  ASN A CB  1 
ATOM   10   N N   . THR A 1 3   ? 29.680 66.455 -4.348  1.00 74.15  ? 72  THR A N   1 
ATOM   11   C CA  . THR A 1 3   ? 28.870 66.106 -3.187  1.00 64.81  ? 72  THR A CA  1 
ATOM   12   C C   . THR A 1 3   ? 29.597 65.106 -2.296  1.00 60.82  ? 72  THR A C   1 
ATOM   13   O O   . THR A 1 3   ? 30.161 64.120 -2.779  1.00 64.99  ? 72  THR A O   1 
ATOM   14   C CB  . THR A 1 3   ? 27.526 65.525 -3.632  1.00 61.74  ? 72  THR A CB  1 
ATOM   15   O OG1 . THR A 1 3   ? 26.724 66.559 -4.213  1.00 71.46  ? 72  THR A OG1 1 
ATOM   16   C CG2 . THR A 1 3   ? 26.779 64.917 -2.450  1.00 56.08  ? 72  THR A CG2 1 
ATOM   17   N N   . THR A 1 4   ? 29.588 65.371 -0.991  1.00 50.06  ? 73  THR A N   1 
ATOM   18   C CA  . THR A 1 4   ? 30.046 64.430 0.025   1.00 45.87  ? 73  THR A CA  1 
ATOM   19   C C   . THR A 1 4   ? 28.988 64.464 1.125   1.00 62.79  ? 73  THR A C   1 
ATOM   20   O O   . THR A 1 4   ? 29.094 65.245 2.075   1.00 69.60  ? 73  THR A O   1 
ATOM   21   C CB  . THR A 1 4   ? 31.439 64.791 0.544   1.00 35.55  ? 73  THR A CB  1 
ATOM   22   N N   . SER A 1 5   ? 27.961 63.626 0.982   1.00 61.90  ? 74  SER A N   1 
ATOM   23   C CA  . SER A 1 5   ? 26.860 63.562 1.933   1.00 53.80  ? 74  SER A CA  1 
ATOM   24   C C   . SER A 1 5   ? 27.134 62.519 3.019   1.00 45.60  ? 74  SER A C   1 
ATOM   25   O O   . SER A 1 5   ? 27.892 61.564 2.827   1.00 42.64  ? 74  SER A O   1 
ATOM   26   C CB  . SER A 1 5   ? 25.545 63.252 1.212   1.00 54.59  ? 74  SER A CB  1 
ATOM   27   O OG  . SER A 1 5   ? 25.255 61.865 1.220   1.00 59.57  ? 74  SER A OG  1 
ATOM   28   N N   . SER A 1 6   ? 26.492 62.713 4.171   1.00 43.37  ? 75  SER A N   1 
ATOM   29   C CA  . SER A 1 6   ? 26.735 61.907 5.359   1.00 42.17  ? 75  SER A CA  1 
ATOM   30   C C   . SER A 1 6   ? 25.423 61.382 5.935   1.00 47.87  ? 75  SER A C   1 
ATOM   31   O O   . SER A 1 6   ? 24.353 61.963 5.736   1.00 54.87  ? 75  SER A O   1 
ATOM   32   C CB  . SER A 1 6   ? 27.467 62.715 6.431   1.00 44.44  ? 75  SER A CB  1 
ATOM   33   O OG  . SER A 1 6   ? 26.545 63.226 7.378   1.00 47.54  ? 75  SER A OG  1 
ATOM   34   N N   . VAL A 1 7   ? 25.526 60.280 6.681   1.00 37.45  ? 76  VAL A N   1 
ATOM   35   C CA  . VAL A 1 7   ? 24.386 59.641 7.328   1.00 28.27  ? 76  VAL A CA  1 
ATOM   36   C C   . VAL A 1 7   ? 24.721 59.426 8.796   1.00 35.05  ? 76  VAL A C   1 
ATOM   37   O O   . VAL A 1 7   ? 25.678 58.711 9.120   1.00 37.04  ? 76  VAL A O   1 
ATOM   38   C CB  . VAL A 1 7   ? 24.022 58.301 6.666   1.00 36.87  ? 76  VAL A CB  1 
ATOM   39   C CG1 . VAL A 1 7   ? 22.841 57.665 7.379   1.00 31.50  ? 76  VAL A CG1 1 
ATOM   40   C CG2 . VAL A 1 7   ? 23.711 58.502 5.196   1.00 44.86  ? 76  VAL A CG2 1 
ATOM   41   N N   . ILE A 1 8   ? 23.929 60.030 9.681   1.00 30.72  ? 77  ILE A N   1 
ATOM   42   C CA  . ILE A 1 8   ? 24.103 59.811 11.110  1.00 28.95  ? 77  ILE A CA  1 
ATOM   43   C C   . ILE A 1 8   ? 23.744 58.371 11.454  1.00 28.34  ? 77  ILE A C   1 
ATOM   44   O O   . ILE A 1 8   ? 22.733 57.834 10.983  1.00 33.38  ? 77  ILE A O   1 
ATOM   45   C CB  . ILE A 1 8   ? 23.243 60.806 11.907  1.00 33.71  ? 77  ILE A CB  1 
ATOM   46   C CG1 . ILE A 1 8   ? 23.691 62.233 11.620  1.00 37.65  ? 77  ILE A CG1 1 
ATOM   47   C CG2 . ILE A 1 8   ? 23.351 60.538 13.401  1.00 33.72  ? 77  ILE A CG2 1 
ATOM   48   C CD1 . ILE A 1 8   ? 25.135 62.487 11.978  1.00 47.27  ? 77  ILE A CD1 1 
ATOM   49   N N   . LEU A 1 9   ? 24.571 57.735 12.279  1.00 27.72  ? 78  LEU A N   1 
ATOM   50   C CA  . LEU A 1 9   ? 24.338 56.365 12.705  1.00 30.38  ? 78  LEU A CA  1 
ATOM   51   C C   . LEU A 1 9   ? 24.042 56.313 14.197  1.00 31.01  ? 78  LEU A C   1 
ATOM   52   O O   . LEU A 1 9   ? 24.579 57.093 14.990  1.00 26.47  ? 78  LEU A O   1 
ATOM   53   C CB  . LEU A 1 9   ? 25.539 55.464 12.402  1.00 31.80  ? 78  LEU A CB  1 
ATOM   54   C CG  . LEU A 1 9   ? 26.084 55.357 10.975  1.00 33.89  ? 78  LEU A CG  1 
ATOM   55   C CD1 . LEU A 1 9   ? 27.276 54.417 10.962  1.00 27.88  ? 78  LEU A CD1 1 
ATOM   56   C CD2 . LEU A 1 9   ? 25.026 54.897 9.973   1.00 24.98  ? 78  LEU A CD2 1 
ATOM   57   N N   . THR A 1 10  ? 23.179 55.374 14.565  1.00 19.04  ? 79  THR A N   1 
ATOM   58   C CA  . THR A 1 10  ? 22.880 55.089 15.955  1.00 25.97  ? 79  THR A CA  1 
ATOM   59   C C   . THR A 1 10  ? 23.795 53.980 16.447  1.00 27.18  ? 79  THR A C   1 
ATOM   60   O O   . THR A 1 10  ? 24.110 53.048 15.704  1.00 32.94  ? 79  THR A O   1 
ATOM   61   C CB  . THR A 1 10  ? 21.419 54.673 16.115  1.00 29.80  ? 79  THR A CB  1 
ATOM   62   O OG1 . THR A 1 10  ? 20.579 55.662 15.512  1.00 27.11  ? 79  THR A OG1 1 
ATOM   63   C CG2 . THR A 1 10  ? 21.055 54.529 17.581  1.00 14.53  ? 79  THR A CG2 1 
ATOM   64   N N   . ASN A 1 11  ? 24.220 54.085 17.700  1.00 22.04  ? 80  ASN A N   1 
ATOM   65   C CA  . ASN A 1 11  ? 25.081 53.089 18.322  1.00 26.79  ? 80  ASN A CA  1 
ATOM   66   C C   . ASN A 1 11  ? 24.289 52.418 19.435  1.00 24.31  ? 80  ASN A C   1 
ATOM   67   O O   . ASN A 1 11  ? 24.095 53.003 20.503  1.00 33.80  ? 80  ASN A O   1 
ATOM   68   C CB  . ASN A 1 11  ? 26.365 53.726 18.855  1.00 26.43  ? 80  ASN A CB  1 
ATOM   69   C CG  . ASN A 1 11  ? 27.301 52.716 19.505  1.00 36.20  ? 80  ASN A CG  1 
ATOM   70   O OD1 . ASN A 1 11  ? 26.917 51.581 19.791  1.00 36.35  ? 80  ASN A OD1 1 
ATOM   71   N ND2 . ASN A 1 11  ? 28.541 53.130 19.742  1.00 39.30  ? 80  ASN A ND2 1 
ATOM   72   N N   . TYR A 1 12  ? 23.846 51.189 19.188  1.00 23.60  ? 81  TYR A N   1 
ATOM   73   C CA  . TYR A 1 12  ? 23.214 50.378 20.222  1.00 22.43  ? 81  TYR A CA  1 
ATOM   74   C C   . TYR A 1 12  ? 24.285 49.502 20.854  1.00 32.96  ? 81  TYR A C   1 
ATOM   75   O O   . TYR A 1 12  ? 24.638 48.448 20.319  1.00 33.81  ? 81  TYR A O   1 
ATOM   76   C CB  . TYR A 1 12  ? 22.080 49.535 19.654  1.00 16.21  ? 81  TYR A CB  1 
ATOM   77   C CG  . TYR A 1 12  ? 21.472 48.578 20.660  1.00 17.56  ? 81  TYR A CG  1 
ATOM   78   C CD1 . TYR A 1 12  ? 20.535 49.014 21.591  1.00 19.56  ? 81  TYR A CD1 1 
ATOM   79   C CD2 . TYR A 1 12  ? 21.838 47.237 20.683  1.00 23.77  ? 81  TYR A CD2 1 
ATOM   80   C CE1 . TYR A 1 12  ? 19.970 48.130 22.512  1.00 28.43  ? 81  TYR A CE1 1 
ATOM   81   C CE2 . TYR A 1 12  ? 21.286 46.352 21.600  1.00 31.17  ? 81  TYR A CE2 1 
ATOM   82   C CZ  . TYR A 1 12  ? 20.352 46.800 22.508  1.00 34.01  ? 81  TYR A CZ  1 
ATOM   83   O OH  . TYR A 1 12  ? 19.807 45.913 23.415  1.00 38.04  ? 81  TYR A OH  1 
ATOM   84   N N   . MET A 1 13  ? 24.822 49.961 21.983  1.00 36.28  ? 82  MET A N   1 
ATOM   85   C CA  . MET A 1 13  ? 25.601 49.120 22.892  1.00 31.82  ? 82  MET A CA  1 
ATOM   86   C C   . MET A 1 13  ? 26.858 48.566 22.229  1.00 27.46  ? 82  MET A C   1 
ATOM   87   O O   . MET A 1 13  ? 27.260 47.428 22.475  1.00 35.94  ? 82  MET A O   1 
ATOM   88   C CB  . MET A 1 13  ? 24.737 47.990 23.449  1.00 34.01  ? 82  MET A CB  1 
ATOM   89   C CG  . MET A 1 13  ? 23.452 48.479 24.093  1.00 37.13  ? 82  MET A CG  1 
ATOM   90   S SD  . MET A 1 13  ? 23.195 47.756 25.712  1.00 50.32  ? 82  MET A SD  1 
ATOM   91   C CE  . MET A 1 13  ? 22.418 46.204 25.285  1.00 51.05  ? 82  MET A CE  1 
ATOM   92   N N   . ASP A 1 14  ? 27.477 49.371 21.372  1.00 31.15  ? 83  ASP A N   1 
ATOM   93   C CA  . ASP A 1 14  ? 28.742 49.058 20.712  1.00 31.69  ? 83  ASP A CA  1 
ATOM   94   C C   . ASP A 1 14  ? 28.679 47.809 19.832  1.00 32.60  ? 83  ASP A C   1 
ATOM   95   O O   . ASP A 1 14  ? 29.726 47.327 19.374  1.00 31.11  ? 83  ASP A O   1 
ATOM   96   C CB  . ASP A 1 14  ? 29.876 48.921 21.736  1.00 30.75  ? 83  ASP A CB  1 
ATOM   97   C CG  . ASP A 1 14  ? 30.285 50.255 22.330  1.00 41.83  ? 83  ASP A CG  1 
ATOM   98   O OD1 . ASP A 1 14  ? 30.321 51.257 21.584  1.00 42.42  ? 83  ASP A OD1 1 
ATOM   99   O OD2 . ASP A 1 14  ? 30.548 50.305 23.550  1.00 47.82  ? 83  ASP A OD2 1 
ATOM   100  N N   . THR A 1 15  ? 27.484 47.276 19.560  1.00 24.62  ? 84  THR A N   1 
ATOM   101  C CA  . THR A 1 15  ? 27.363 46.077 18.742  1.00 23.96  ? 84  THR A CA  1 
ATOM   102  C C   . THR A 1 15  ? 26.445 46.215 17.535  1.00 27.36  ? 84  THR A C   1 
ATOM   103  O O   . THR A 1 15  ? 26.436 45.310 16.692  1.00 30.57  ? 84  THR A O   1 
ATOM   104  C CB  . THR A 1 15  ? 26.880 44.899 19.593  1.00 29.10  ? 84  THR A CB  1 
ATOM   105  O OG1 . THR A 1 15  ? 25.724 45.298 20.338  1.00 39.63  ? 84  THR A OG1 1 
ATOM   106  C CG2 . THR A 1 15  ? 27.970 44.465 20.552  1.00 29.69  ? 84  THR A CG2 1 
ATOM   107  N N   . GLN A 1 16  ? 25.678 47.298 17.417  1.00 26.33  ? 85  GLN A N   1 
ATOM   108  C CA  . GLN A 1 16  ? 24.798 47.505 16.269  1.00 20.96  ? 85  GLN A CA  1 
ATOM   109  C C   . GLN A 1 16  ? 24.840 48.976 15.886  1.00 22.82  ? 85  GLN A C   1 
ATOM   110  O O   . GLN A 1 16  ? 24.401 49.835 16.655  1.00 37.49  ? 85  GLN A O   1 
ATOM   111  C CB  . GLN A 1 16  ? 23.369 47.062 16.573  1.00 16.42  ? 85  GLN A CB  1 
ATOM   112  C CG  . GLN A 1 16  ? 23.171 45.557 16.563  1.00 20.30  ? 85  GLN A CG  1 
ATOM   113  C CD  . GLN A 1 16  ? 21.759 45.152 16.936  1.00 27.07  ? 85  GLN A CD  1 
ATOM   114  O OE1 . GLN A 1 16  ? 20.784 45.764 16.491  1.00 26.28  ? 85  GLN A OE1 1 
ATOM   115  N NE2 . GLN A 1 16  ? 21.641 44.118 17.763  1.00 19.56  ? 85  GLN A NE2 1 
ATOM   116  N N   . TYR A 1 17  ? 25.365 49.260 14.702  1.00 18.24  ? 86  TYR A N   1 
ATOM   117  C CA  . TYR A 1 17  ? 25.450 50.609 14.158  1.00 26.45  ? 86  TYR A CA  1 
ATOM   118  C C   . TYR A 1 17  ? 24.545 50.689 12.934  1.00 32.04  ? 86  TYR A C   1 
ATOM   119  O O   . TYR A 1 17  ? 24.739 49.944 11.965  1.00 30.05  ? 86  TYR A O   1 
ATOM   120  C CB  . TYR A 1 17  ? 26.895 50.957 13.792  1.00 12.24  ? 86  TYR A CB  1 
ATOM   121  C CG  . TYR A 1 17  ? 27.821 51.041 14.981  1.00 24.31  ? 86  TYR A CG  1 
ATOM   122  C CD1 . TYR A 1 17  ? 28.268 49.896 15.623  1.00 27.28  ? 86  TYR A CD1 1 
ATOM   123  C CD2 . TYR A 1 17  ? 28.239 52.272 15.471  1.00 30.80  ? 86  TYR A CD2 1 
ATOM   124  C CE1 . TYR A 1 17  ? 29.103 49.975 16.721  1.00 24.37  ? 86  TYR A CE1 1 
ATOM   125  C CE2 . TYR A 1 17  ? 29.079 52.362 16.561  1.00 28.05  ? 86  TYR A CE2 1 
ATOM   126  C CZ  . TYR A 1 17  ? 29.511 51.212 17.181  1.00 25.04  ? 86  TYR A CZ  1 
ATOM   127  O OH  . TYR A 1 17  ? 30.347 51.300 18.272  1.00 22.07  ? 86  TYR A OH  1 
ATOM   128  N N   . TYR A 1 18  ? 23.553 51.575 12.976  1.00 26.77  ? 87  TYR A N   1 
ATOM   129  C CA  . TYR A 1 18  ? 22.593 51.646 11.886  1.00 17.32  ? 87  TYR A CA  1 
ATOM   130  C C   . TYR A 1 18  ? 22.177 53.086 11.629  1.00 17.44  ? 87  TYR A C   1 
ATOM   131  O O   . TYR A 1 18  ? 22.209 53.931 12.524  1.00 33.07  ? 87  TYR A O   1 
ATOM   132  C CB  . TYR A 1 18  ? 21.355 50.777 12.167  1.00 14.62  ? 87  TYR A CB  1 
ATOM   133  C CG  . TYR A 1 18  ? 20.659 51.040 13.481  1.00 18.69  ? 87  TYR A CG  1 
ATOM   134  C CD1 . TYR A 1 18  ? 21.021 50.356 14.635  1.00 22.03  ? 87  TYR A CD1 1 
ATOM   135  C CD2 . TYR A 1 18  ? 19.618 51.957 13.564  1.00 26.83  ? 87  TYR A CD2 1 
ATOM   136  C CE1 . TYR A 1 18  ? 20.371 50.589 15.838  1.00 24.49  ? 87  TYR A CE1 1 
ATOM   137  C CE2 . TYR A 1 18  ? 18.965 52.198 14.762  1.00 19.22  ? 87  TYR A CE2 1 
ATOM   138  C CZ  . TYR A 1 18  ? 19.343 51.513 15.893  1.00 26.33  ? 87  TYR A CZ  1 
ATOM   139  O OH  . TYR A 1 18  ? 18.693 51.755 17.081  1.00 31.24  ? 87  TYR A OH  1 
ATOM   140  N N   . GLY A 1 19  ? 21.799 53.352 10.382  1.00 23.90  ? 88  GLY A N   1 
ATOM   141  C CA  . GLY A 1 19  ? 21.288 54.647 9.979   1.00 18.24  ? 88  GLY A CA  1 
ATOM   142  C C   . GLY A 1 19  ? 19.962 54.500 9.262   1.00 26.94  ? 88  GLY A C   1 
ATOM   143  O O   . GLY A 1 19  ? 19.367 53.418 9.273   1.00 23.42  ? 88  GLY A O   1 
ATOM   144  N N   . GLU A 1 20  ? 19.502 55.562 8.608   1.00 33.81  ? 89  GLU A N   1 
ATOM   145  C CA  . GLU A 1 20  ? 18.185 55.596 7.984   1.00 36.47  ? 89  GLU A CA  1 
ATOM   146  C C   . GLU A 1 20  ? 18.299 55.687 6.468   1.00 33.58  ? 89  GLU A C   1 
ATOM   147  O O   . GLU A 1 20  ? 19.182 56.370 5.940   1.00 37.37  ? 89  GLU A O   1 
ATOM   148  C CB  . GLU A 1 20  ? 17.381 56.786 8.503   1.00 30.53  ? 89  GLU A CB  1 
ATOM   149  C CG  . GLU A 1 20  ? 15.996 56.452 8.998   1.00 38.49  ? 89  GLU A CG  1 
ATOM   150  C CD  . GLU A 1 20  ? 15.184 57.700 9.257   1.00 51.42  ? 89  GLU A CD  1 
ATOM   151  O OE1 . GLU A 1 20  ? 14.402 58.094 8.372   1.00 54.74  ? 89  GLU A OE1 1 
ATOM   152  O OE2 . GLU A 1 20  ? 15.342 58.296 10.343  1.00 65.37  ? 89  GLU A OE2 1 
ATOM   153  N N   . ILE A 1 21  ? 17.398 54.990 5.772   1.00 32.33  ? 90  ILE A N   1 
ATOM   154  C CA  . ILE A 1 21  ? 17.183 55.172 4.342   1.00 24.82  ? 90  ILE A CA  1 
ATOM   155  C C   . ILE A 1 21  ? 15.688 55.291 4.099   1.00 28.84  ? 90  ILE A C   1 
ATOM   156  O O   . ILE A 1 21  ? 14.864 54.886 4.922   1.00 38.78  ? 90  ILE A O   1 
ATOM   157  C CB  . ILE A 1 21  ? 17.757 54.028 3.476   1.00 25.85  ? 90  ILE A CB  1 
ATOM   158  C CG1 . ILE A 1 21  ? 17.166 52.684 3.906   1.00 26.38  ? 90  ILE A CG1 1 
ATOM   159  C CG2 . ILE A 1 21  ? 19.276 54.020 3.516   1.00 25.16  ? 90  ILE A CG2 1 
ATOM   160  C CD1 . ILE A 1 21  ? 17.390 51.576 2.903   1.00 33.05  ? 90  ILE A CD1 1 
ATOM   161  N N   . GLY A 1 22  ? 15.345 55.854 2.946   1.00 32.75  ? 91  GLY A N   1 
ATOM   162  C CA  . GLY A 1 22  ? 13.958 55.997 2.555   1.00 22.24  ? 91  GLY A CA  1 
ATOM   163  C C   . GLY A 1 22  ? 13.698 55.313 1.235   1.00 45.65  ? 91  GLY A C   1 
ATOM   164  O O   . GLY A 1 22  ? 14.459 55.497 0.282   1.00 59.54  ? 91  GLY A O   1 
ATOM   165  N N   . ILE A 1 23  ? 12.633 54.519 1.164   1.00 51.68  ? 92  ILE A N   1 
ATOM   166  C CA  . ILE A 1 23  ? 12.308 53.728 -0.017  1.00 33.22  ? 92  ILE A CA  1 
ATOM   167  C C   . ILE A 1 23  ? 10.918 54.124 -0.501  1.00 39.44  ? 92  ILE A C   1 
ATOM   168  O O   . ILE A 1 23  ? 9.941  54.015 0.250   1.00 39.92  ? 92  ILE A O   1 
ATOM   169  C CB  . ILE A 1 23  ? 12.376 52.222 0.280   1.00 22.32  ? 92  ILE A CB  1 
ATOM   170  C CG1 . ILE A 1 23  ? 13.696 51.877 0.979   1.00 23.37  ? 92  ILE A CG1 1 
ATOM   171  C CG2 . ILE A 1 23  ? 12.209 51.416 -0.996  1.00 20.41  ? 92  ILE A CG2 1 
ATOM   172  C CD1 . ILE A 1 23  ? 13.885 50.401 1.227   1.00 17.55  ? 92  ILE A CD1 1 
ATOM   173  N N   . GLY A 1 24  ? 10.832 54.592 -1.747  1.00 32.56  ? 93  GLY A N   1 
ATOM   174  C CA  . GLY A 1 24  ? 9.557  54.777 -2.416  1.00 34.05  ? 93  GLY A CA  1 
ATOM   175  C C   . GLY A 1 24  ? 9.055  56.211 -2.391  1.00 44.89  ? 93  GLY A C   1 
ATOM   176  O O   . GLY A 1 24  ? 9.656  57.122 -1.812  1.00 42.61  ? 93  GLY A O   1 
ATOM   177  N N   . THR A 1 25  ? 7.912  56.393 -3.045  1.00 49.10  ? 94  THR A N   1 
ATOM   178  C CA  . THR A 1 25  ? 7.227  57.685 -3.122  1.00 44.53  ? 94  THR A CA  1 
ATOM   179  C C   . THR A 1 25  ? 5.835  57.548 -2.525  1.00 39.84  ? 94  THR A C   1 
ATOM   180  O O   . THR A 1 25  ? 4.982  56.859 -3.117  1.00 50.63  ? 94  THR A O   1 
ATOM   181  C CB  . THR A 1 25  ? 7.133  58.168 -4.571  1.00 38.98  ? 94  THR A CB  1 
ATOM   182  O OG1 . THR A 1 25  ? 8.445  58.240 -5.142  1.00 40.20  ? 94  THR A OG1 1 
ATOM   183  C CG2 . THR A 1 25  ? 6.485  59.534 -4.634  1.00 29.94  ? 94  THR A CG2 1 
ATOM   184  N N   . PRO A 1 26  ? 5.544  58.154 -1.359  1.00 36.21  ? 95  PRO A N   1 
ATOM   185  C CA  . PRO A 1 26  ? 6.461  58.924 -0.510  1.00 31.83  ? 95  PRO A CA  1 
ATOM   186  C C   . PRO A 1 26  ? 7.434  57.980 0.210   1.00 38.30  ? 95  PRO A C   1 
ATOM   187  O O   . PRO A 1 26  ? 7.199  56.774 0.180   1.00 34.55  ? 95  PRO A O   1 
ATOM   188  C CB  . PRO A 1 26  ? 5.514  59.627 0.464   1.00 24.76  ? 95  PRO A CB  1 
ATOM   189  C CG  . PRO A 1 26  ? 4.364  58.684 0.599   1.00 23.45  ? 95  PRO A CG  1 
ATOM   190  C CD  . PRO A 1 26  ? 4.202  58.039 -0.753  1.00 26.58  ? 95  PRO A CD  1 
ATOM   191  N N   . PRO A 1 27  ? 8.501  58.501 0.822   1.00 38.75  ? 96  PRO A N   1 
ATOM   192  C CA  . PRO A 1 27  ? 9.540  57.608 1.361   1.00 38.38  ? 96  PRO A CA  1 
ATOM   193  C C   . PRO A 1 27  ? 9.051  56.820 2.570   1.00 38.59  ? 96  PRO A C   1 
ATOM   194  O O   . PRO A 1 27  ? 8.489  57.385 3.511   1.00 32.73  ? 96  PRO A O   1 
ATOM   195  C CB  . PRO A 1 27  ? 10.677 58.566 1.741   1.00 30.38  ? 96  PRO A CB  1 
ATOM   196  C CG  . PRO A 1 27  ? 10.358 59.857 1.052   1.00 34.72  ? 96  PRO A CG  1 
ATOM   197  C CD  . PRO A 1 27  ? 8.876  59.917 0.963   1.00 36.57  ? 96  PRO A CD  1 
ATOM   198  N N   . GLN A 1 28  ? 9.275  55.505 2.530   1.00 34.00  ? 97  GLN A N   1 
ATOM   199  C CA  . GLN A 1 28  ? 9.123  54.625 3.681   1.00 33.73  ? 97  GLN A CA  1 
ATOM   200  C C   . GLN A 1 28  ? 10.481 54.442 4.355   1.00 40.67  ? 97  GLN A C   1 
ATOM   201  O O   . GLN A 1 28  ? 11.504 54.262 3.684   1.00 41.71  ? 97  GLN A O   1 
ATOM   202  C CB  . GLN A 1 28  ? 8.539  53.273 3.265   1.00 28.38  ? 97  GLN A CB  1 
ATOM   203  C CG  . GLN A 1 28  ? 7.154  53.384 2.649   1.00 24.78  ? 97  GLN A CG  1 
ATOM   204  C CD  . GLN A 1 28  ? 6.587  52.049 2.183   1.00 33.20  ? 97  GLN A CD  1 
ATOM   205  O OE1 . GLN A 1 28  ? 6.688  51.034 2.876   1.00 39.33  ? 97  GLN A OE1 1 
ATOM   206  N NE2 . GLN A 1 28  ? 5.981  52.051 0.999   1.00 35.79  ? 97  GLN A NE2 1 
ATOM   207  N N   . THR A 1 29  ? 10.487 54.493 5.682   1.00 34.33  ? 98  THR A N   1 
ATOM   208  C CA  . THR A 1 29  ? 11.707 54.680 6.458   1.00 29.39  ? 98  THR A CA  1 
ATOM   209  C C   . THR A 1 29  ? 12.158 53.381 7.117   1.00 43.76  ? 98  THR A C   1 
ATOM   210  O O   . THR A 1 29  ? 11.353 52.681 7.744   1.00 53.95  ? 98  THR A O   1 
ATOM   211  C CB  . THR A 1 29  ? 11.482 55.758 7.515   1.00 27.84  ? 98  THR A CB  1 
ATOM   212  O OG1 . THR A 1 29  ? 11.642 57.043 6.907   1.00 34.34  ? 98  THR A OG1 1 
ATOM   213  C CG2 . THR A 1 29  ? 12.453 55.603 8.669   1.00 44.18  ? 98  THR A CG2 1 
ATOM   214  N N   . PHE A 1 30  ? 13.451 53.077 6.994   1.00 27.48  ? 99  PHE A N   1 
ATOM   215  C CA  . PHE A 1 30  ? 14.021 51.874 7.583   1.00 25.18  ? 99  PHE A CA  1 
ATOM   216  C C   . PHE A 1 30  ? 15.366 52.192 8.220   1.00 27.53  ? 99  PHE A C   1 
ATOM   217  O O   . PHE A 1 30  ? 16.194 52.892 7.626   1.00 26.46  ? 99  PHE A O   1 
ATOM   218  C CB  . PHE A 1 30  ? 14.189 50.776 6.532   1.00 28.57  ? 99  PHE A CB  1 
ATOM   219  C CG  . PHE A 1 30  ? 12.939 50.486 5.764   1.00 33.92  ? 99  PHE A CG  1 
ATOM   220  C CD1 . PHE A 1 30  ? 12.613 51.229 4.643   1.00 32.99  ? 99  PHE A CD1 1 
ATOM   221  C CD2 . PHE A 1 30  ? 12.086 49.471 6.163   1.00 33.23  ? 99  PHE A CD2 1 
ATOM   222  C CE1 . PHE A 1 30  ? 11.456 50.970 3.937   1.00 36.97  ? 99  PHE A CE1 1 
ATOM   223  C CE2 . PHE A 1 30  ? 10.931 49.210 5.462   1.00 29.13  ? 99  PHE A CE2 1 
ATOM   224  C CZ  . PHE A 1 30  ? 10.617 49.958 4.346   1.00 33.89  ? 99  PHE A CZ  1 
ATOM   225  N N   . LYS A 1 31  ? 15.562 51.683 9.436   1.00 20.72  ? 100 LYS A N   1 
ATOM   226  C CA  . LYS A 1 31  ? 16.877 51.597 10.053  1.00 26.08  ? 100 LYS A CA  1 
ATOM   227  C C   . LYS A 1 31  ? 17.639 50.422 9.453   1.00 30.98  ? 100 LYS A C   1 
ATOM   228  O O   . LYS A 1 31  ? 17.174 49.280 9.511   1.00 23.93  ? 100 LYS A O   1 
ATOM   229  C CB  . LYS A 1 31  ? 16.759 51.452 11.564  1.00 15.21  ? 100 LYS A CB  1 
ATOM   230  C CG  . LYS A 1 31  ? 15.744 52.382 12.201  1.00 21.19  ? 100 LYS A CG  1 
ATOM   231  C CD  . LYS A 1 31  ? 15.499 52.007 13.653  1.00 19.92  ? 100 LYS A CD  1 
ATOM   232  C CE  . LYS A 1 31  ? 14.300 52.723 14.224  1.00 30.34  ? 100 LYS A CE  1 
ATOM   233  N NZ  . LYS A 1 31  ? 13.893 52.045 15.475  1.00 39.23  ? 100 LYS A NZ  1 
ATOM   234  N N   . VAL A 1 32  ? 18.805 50.691 8.865   1.00 29.78  ? 101 VAL A N   1 
ATOM   235  C CA  . VAL A 1 32  ? 19.549 49.656 8.161   1.00 29.63  ? 101 VAL A CA  1 
ATOM   236  C C   . VAL A 1 32  ? 21.011 49.703 8.574   1.00 28.29  ? 101 VAL A C   1 
ATOM   237  O O   . VAL A 1 32  ? 21.542 50.759 8.934   1.00 29.63  ? 101 VAL A O   1 
ATOM   238  C CB  . VAL A 1 32  ? 19.423 49.790 6.626   1.00 28.41  ? 101 VAL A CB  1 
ATOM   239  C CG1 . VAL A 1 32  ? 17.980 49.615 6.192   1.00 31.74  ? 101 VAL A CG1 1 
ATOM   240  C CG2 . VAL A 1 32  ? 19.965 51.132 6.160   1.00 19.67  ? 101 VAL A CG2 1 
ATOM   241  N N   . VAL A 1 33  ? 21.661 48.540 8.514   1.00 22.94  ? 102 VAL A N   1 
ATOM   242  C CA  . VAL A 1 33  ? 23.097 48.425 8.761   1.00 21.21  ? 102 VAL A CA  1 
ATOM   243  C C   . VAL A 1 33  ? 23.818 48.525 7.426   1.00 22.97  ? 102 VAL A C   1 
ATOM   244  O O   . VAL A 1 33  ? 23.422 47.879 6.451   1.00 30.67  ? 102 VAL A O   1 
ATOM   245  C CB  . VAL A 1 33  ? 23.440 47.098 9.463   1.00 26.70  ? 102 VAL A CB  1 
ATOM   246  C CG1 . VAL A 1 33  ? 24.946 46.885 9.472   1.00 19.54  ? 102 VAL A CG1 1 
ATOM   247  C CG2 . VAL A 1 33  ? 22.881 47.058 10.877  1.00 23.19  ? 102 VAL A CG2 1 
ATOM   248  N N   . PHE A 1 34  ? 24.871 49.335 7.374   1.00 21.66  ? 103 PHE A N   1 
ATOM   249  C CA  . PHE A 1 34  ? 25.686 49.480 6.172   1.00 25.80  ? 103 PHE A CA  1 
ATOM   250  C C   . PHE A 1 34  ? 26.877 48.529 6.292   1.00 34.12  ? 103 PHE A C   1 
ATOM   251  O O   . PHE A 1 34  ? 27.757 48.721 7.141   1.00 29.08  ? 103 PHE A O   1 
ATOM   252  C CB  . PHE A 1 34  ? 26.129 50.929 5.983   1.00 21.70  ? 103 PHE A CB  1 
ATOM   253  C CG  . PHE A 1 34  ? 24.988 51.884 5.759   1.00 24.22  ? 103 PHE A CG  1 
ATOM   254  C CD1 . PHE A 1 34  ? 24.307 52.440 6.840   1.00 25.44  ? 103 PHE A CD1 1 
ATOM   255  C CD2 . PHE A 1 34  ? 24.590 52.225 4.472   1.00 20.86  ? 103 PHE A CD2 1 
ATOM   256  C CE1 . PHE A 1 34  ? 23.249 53.320 6.644   1.00 24.61  ? 103 PHE A CE1 1 
ATOM   257  C CE2 . PHE A 1 34  ? 23.532 53.105 4.266   1.00 24.71  ? 103 PHE A CE2 1 
ATOM   258  C CZ  . PHE A 1 34  ? 22.863 53.655 5.357   1.00 27.58  ? 103 PHE A CZ  1 
ATOM   259  N N   . ASP A 1 35  ? 26.899 47.507 5.436   1.00 29.58  ? 104 ASP A N   1 
ATOM   260  C CA  . ASP A 1 35  ? 27.741 46.326 5.609   1.00 24.50  ? 104 ASP A CA  1 
ATOM   261  C C   . ASP A 1 35  ? 28.697 46.185 4.429   1.00 28.86  ? 104 ASP A C   1 
ATOM   262  O O   . ASP A 1 35  ? 28.271 45.848 3.317   1.00 17.26  ? 104 ASP A O   1 
ATOM   263  C CB  . ASP A 1 35  ? 26.870 45.078 5.750   1.00 12.77  ? 104 ASP A CB  1 
ATOM   264  C CG  . ASP A 1 35  ? 27.682 43.830 5.998   1.00 26.06  ? 104 ASP A CG  1 
ATOM   265  O OD1 . ASP A 1 35  ? 28.887 43.958 6.294   1.00 36.65  ? 104 ASP A OD1 1 
ATOM   266  O OD2 . ASP A 1 35  ? 27.121 42.720 5.893   1.00 28.49  ? 104 ASP A OD2 1 
ATOM   267  N N   . THR A 1 36  ? 29.994 46.406 4.680   1.00 25.70  ? 105 THR A N   1 
ATOM   268  C CA  . THR A 1 36  ? 31.007 46.207 3.646   1.00 26.99  ? 105 THR A CA  1 
ATOM   269  C C   . THR A 1 36  ? 31.258 44.735 3.338   1.00 30.84  ? 105 THR A C   1 
ATOM   270  O O   . THR A 1 36  ? 31.961 44.435 2.368   1.00 33.30  ? 105 THR A O   1 
ATOM   271  C CB  . THR A 1 36  ? 32.330 46.863 4.049   1.00 22.92  ? 105 THR A CB  1 
ATOM   272  O OG1 . THR A 1 36  ? 32.651 46.516 5.402   1.00 21.02  ? 105 THR A OG1 1 
ATOM   273  C CG2 . THR A 1 36  ? 32.245 48.372 3.916   1.00 20.44  ? 105 THR A CG2 1 
ATOM   274  N N   . GLY A 1 37  ? 30.717 43.819 4.135   1.00 22.44  ? 106 GLY A N   1 
ATOM   275  C CA  . GLY A 1 37  ? 30.859 42.400 3.897   1.00 19.41  ? 106 GLY A CA  1 
ATOM   276  C C   . GLY A 1 37  ? 29.730 41.739 3.135   1.00 19.14  ? 106 GLY A C   1 
ATOM   277  O O   . GLY A 1 37  ? 29.751 40.518 2.963   1.00 22.69  ? 106 GLY A O   1 
ATOM   278  N N   . SER A 1 38  ? 28.729 42.491 2.685   1.00 11.35  ? 107 SER A N   1 
ATOM   279  C CA  . SER A 1 38  ? 27.700 41.957 1.804   1.00 18.52  ? 107 SER A CA  1 
ATOM   280  C C   . SER A 1 38  ? 27.385 43.013 0.752   1.00 19.94  ? 107 SER A C   1 
ATOM   281  O O   . SER A 1 38  ? 27.805 44.169 0.864   1.00 22.34  ? 107 SER A O   1 
ATOM   282  C CB  . SER A 1 38  ? 26.446 41.533 2.584   1.00 25.00  ? 107 SER A CB  1 
ATOM   283  O OG  . SER A 1 38  ? 25.865 42.617 3.284   1.00 31.08  ? 107 SER A OG  1 
ATOM   284  N N   . SER A 1 39  ? 26.652 42.608 -0.294  1.00 21.71  ? 108 SER A N   1 
ATOM   285  C CA  . SER A 1 39  ? 26.476 43.461 -1.464  1.00 21.95  ? 108 SER A CA  1 
ATOM   286  C C   . SER A 1 39  ? 25.027 43.607 -1.914  1.00 31.26  ? 108 SER A C   1 
ATOM   287  O O   . SER A 1 39  ? 24.785 44.167 -2.989  1.00 37.08  ? 108 SER A O   1 
ATOM   288  C CB  . SER A 1 39  ? 27.320 42.944 -2.632  1.00 18.47  ? 108 SER A CB  1 
ATOM   289  O OG  . SER A 1 39  ? 28.620 42.585 -2.199  1.00 29.97  ? 108 SER A OG  1 
ATOM   290  N N   . ASN A 1 40  ? 24.061 43.135 -1.135  1.00 38.78  ? 109 ASN A N   1 
ATOM   291  C CA  . ASN A 1 40  ? 22.652 43.289 -1.466  1.00 30.38  ? 109 ASN A CA  1 
ATOM   292  C C   . ASN A 1 40  ? 21.972 44.218 -0.470  1.00 27.18  ? 109 ASN A C   1 
ATOM   293  O O   . ASN A 1 40  ? 22.375 44.305 0.692   1.00 28.58  ? 109 ASN A O   1 
ATOM   294  C CB  . ASN A 1 40  ? 21.936 41.938 -1.473  1.00 25.44  ? 109 ASN A CB  1 
ATOM   295  C CG  . ASN A 1 40  ? 22.376 41.049 -2.615  1.00 25.98  ? 109 ASN A CG  1 
ATOM   296  O OD1 . ASN A 1 40  ? 23.499 40.546 -2.630  1.00 39.81  ? 109 ASN A OD1 1 
ATOM   297  N ND2 . ASN A 1 40  ? 21.483 40.835 -3.574  1.00 18.82  ? 109 ASN A ND2 1 
ATOM   298  N N   . VAL A 1 41  ? 20.937 44.918 -0.937  1.00 30.63  ? 110 VAL A N   1 
ATOM   299  C CA  . VAL A 1 41  ? 20.056 45.709 -0.079  1.00 22.79  ? 110 VAL A CA  1 
ATOM   300  C C   . VAL A 1 41  ? 18.815 44.884 0.208   1.00 22.59  ? 110 VAL A C   1 
ATOM   301  O O   . VAL A 1 41  ? 18.210 44.330 -0.719  1.00 30.99  ? 110 VAL A O   1 
ATOM   302  C CB  . VAL A 1 41  ? 19.655 47.039 -0.739  1.00 22.68  ? 110 VAL A CB  1 
ATOM   303  C CG1 . VAL A 1 41  ? 18.718 47.821 0.189   1.00 13.07  ? 110 VAL A CG1 1 
ATOM   304  C CG2 . VAL A 1 41  ? 20.869 47.857 -1.148  1.00 12.96  ? 110 VAL A CG2 1 
ATOM   305  N N   . TRP A 1 42  ? 18.410 44.813 1.475   1.00 22.65  ? 111 TRP A N   1 
ATOM   306  C CA  . TRP A 1 42  ? 17.135 44.170 1.755   1.00 22.49  ? 111 TRP A CA  1 
ATOM   307  C C   . TRP A 1 42  ? 16.442 44.822 2.945   1.00 22.24  ? 111 TRP A C   1 
ATOM   308  O O   . TRP A 1 42  ? 17.090 45.351 3.852   1.00 17.93  ? 111 TRP A O   1 
ATOM   309  C CB  . TRP A 1 42  ? 17.307 42.664 1.970   1.00 16.00  ? 111 TRP A CB  1 
ATOM   310  C CG  . TRP A 1 42  ? 18.122 42.251 3.155   1.00 25.56  ? 111 TRP A CG  1 
ATOM   311  C CD1 . TRP A 1 42  ? 19.454 41.959 3.172   1.00 21.72  ? 111 TRP A CD1 1 
ATOM   312  C CD2 . TRP A 1 42  ? 17.644 42.027 4.490   1.00 27.20  ? 111 TRP A CD2 1 
ATOM   313  N NE1 . TRP A 1 42  ? 19.841 41.589 4.438   1.00 28.49  ? 111 TRP A NE1 1 
ATOM   314  C CE2 . TRP A 1 42  ? 18.748 41.618 5.264   1.00 22.94  ? 111 TRP A CE2 1 
ATOM   315  C CE3 . TRP A 1 42  ? 16.394 42.149 5.107   1.00 23.72  ? 111 TRP A CE3 1 
ATOM   316  C CZ2 . TRP A 1 42  ? 18.639 41.325 6.618   1.00 18.14  ? 111 TRP A CZ2 1 
ATOM   317  C CZ3 . TRP A 1 42  ? 16.288 41.858 6.453   1.00 24.91  ? 111 TRP A CZ3 1 
ATOM   318  C CH2 . TRP A 1 42  ? 17.404 41.450 7.195   1.00 22.94  ? 111 TRP A CH2 1 
ATOM   319  N N   . VAL A 1 43  ? 15.111 44.798 2.905   1.00 13.12  ? 112 VAL A N   1 
ATOM   320  C CA  . VAL A 1 43  ? 14.250 45.252 3.997   1.00 20.35  ? 112 VAL A CA  1 
ATOM   321  C C   . VAL A 1 43  ? 13.101 44.269 4.143   1.00 21.39  ? 112 VAL A C   1 
ATOM   322  O O   . VAL A 1 43  ? 12.750 43.560 3.191   1.00 22.79  ? 112 VAL A O   1 
ATOM   323  C CB  . VAL A 1 43  ? 13.695 46.673 3.755   1.00 29.27  ? 112 VAL A CB  1 
ATOM   324  C CG1 . VAL A 1 43  ? 14.802 47.728 3.845   1.00 20.29  ? 112 VAL A CG1 1 
ATOM   325  C CG2 . VAL A 1 43  ? 12.951 46.744 2.427   1.00 14.08  ? 112 VAL A CG2 1 
ATOM   326  N N   . PRO A 1 44  ? 12.498 44.198 5.331   1.00 22.13  ? 113 PRO A N   1 
ATOM   327  C CA  . PRO A 1 44  ? 11.361 43.287 5.518   1.00 19.82  ? 113 PRO A CA  1 
ATOM   328  C C   . PRO A 1 44  ? 10.162 43.709 4.679   1.00 28.45  ? 113 PRO A C   1 
ATOM   329  O O   . PRO A 1 44  ? 9.907  44.897 4.465   1.00 25.47  ? 113 PRO A O   1 
ATOM   330  C CB  . PRO A 1 44  ? 11.057 43.394 7.017   1.00 22.16  ? 113 PRO A CB  1 
ATOM   331  C CG  . PRO A 1 44  ? 12.304 43.969 7.631   1.00 29.12  ? 113 PRO A CG  1 
ATOM   332  C CD  . PRO A 1 44  ? 12.881 44.867 6.588   1.00 23.20  ? 113 PRO A CD  1 
ATOM   333  N N   . SER A 1 45  ? 9.420  42.715 4.200   1.00 22.81  ? 114 SER A N   1 
ATOM   334  C CA  . SER A 1 45  ? 8.316  42.955 3.283   1.00 29.71  ? 114 SER A CA  1 
ATOM   335  C C   . SER A 1 45  ? 6.972  42.837 3.991   1.00 28.02  ? 114 SER A C   1 
ATOM   336  O O   . SER A 1 45  ? 6.805  42.049 4.925   1.00 33.03  ? 114 SER A O   1 
ATOM   337  C CB  . SER A 1 45  ? 8.362  41.976 2.106   1.00 32.34  ? 114 SER A CB  1 
ATOM   338  O OG  . SER A 1 45  ? 7.439  42.358 1.097   1.00 38.69  ? 114 SER A OG  1 
ATOM   339  N N   . SER A 1 46  ? 6.003  43.626 3.515   1.00 30.29  ? 115 SER A N   1 
ATOM   340  C CA  . SER A 1 46  ? 4.629  43.501 3.996   1.00 29.24  ? 115 SER A CA  1 
ATOM   341  C C   . SER A 1 46  ? 4.051  42.122 3.702   1.00 26.95  ? 115 SER A C   1 
ATOM   342  O O   . SER A 1 46  ? 3.174  41.650 4.433   1.00 39.25  ? 115 SER A O   1 
ATOM   343  C CB  . SER A 1 46  ? 3.750  44.582 3.365   1.00 27.87  ? 115 SER A CB  1 
ATOM   344  O OG  . SER A 1 46  ? 3.483  44.292 2.002   1.00 33.87  ? 115 SER A OG  1 
ATOM   345  N N   . LYS A 1 47  ? 4.519  41.465 2.641   1.00 26.11  ? 116 LYS A N   1 
ATOM   346  C CA  . LYS A 1 47  ? 4.081  40.114 2.314   1.00 29.82  ? 116 LYS A CA  1 
ATOM   347  C C   . LYS A 1 47  ? 4.714  39.055 3.203   1.00 38.66  ? 116 LYS A C   1 
ATOM   348  O O   . LYS A 1 47  ? 4.467  37.863 2.988   1.00 45.05  ? 116 LYS A O   1 
ATOM   349  C CB  . LYS A 1 47  ? 4.383  39.798 0.845   1.00 29.99  ? 116 LYS A CB  1 
ATOM   350  C CG  . LYS A 1 47  ? 3.664  40.708 -0.135  1.00 36.59  ? 116 LYS A CG  1 
ATOM   351  C CD  . LYS A 1 47  ? 4.513  40.988 -1.350  1.00 42.88  ? 116 LYS A CD  1 
ATOM   352  C CE  . LYS A 1 47  ? 4.120  42.303 -2.017  1.00 53.73  ? 116 LYS A CE  1 
ATOM   353  N NZ  . LYS A 1 47  ? 2.693  42.321 -2.449  1.00 52.92  ? 116 LYS A NZ  1 
ATOM   354  N N   . CYS A 1 48  ? 5.522  39.452 4.183   1.00 41.43  ? 117 CYS A N   1 
ATOM   355  C CA  . CYS A 1 48  ? 6.093  38.504 5.130   1.00 41.50  ? 117 CYS A CA  1 
ATOM   356  C C   . CYS A 1 48  ? 5.036  38.088 6.146   1.00 41.46  ? 117 CYS A C   1 
ATOM   357  O O   . CYS A 1 48  ? 4.398  38.937 6.778   1.00 39.39  ? 117 CYS A O   1 
ATOM   358  C CB  . CYS A 1 48  ? 7.301  39.116 5.837   1.00 39.48  ? 117 CYS A CB  1 
ATOM   359  S SG  . CYS A 1 48  ? 8.041  38.065 7.118   1.00 48.07  ? 117 CYS A SG  1 
ATOM   360  N N   . SER A 1 49  ? 4.852  36.780 6.299   1.00 41.69  ? 118 SER A N   1 
ATOM   361  C CA  . SER A 1 49  ? 3.851  36.272 7.224   1.00 37.14  ? 118 SER A CA  1 
ATOM   362  C C   . SER A 1 49  ? 4.149  36.731 8.645   1.00 40.54  ? 118 SER A C   1 
ATOM   363  O O   . SER A 1 49  ? 5.308  36.837 9.055   1.00 46.71  ? 118 SER A O   1 
ATOM   364  C CB  . SER A 1 49  ? 3.804  34.743 7.164   1.00 39.61  ? 118 SER A CB  1 
ATOM   365  O OG  . SER A 1 49  ? 2.974  34.217 8.189   1.00 47.59  ? 118 SER A OG  1 
ATOM   366  N N   . ARG A 1 50  ? 3.090  37.014 9.401   1.00 38.72  ? 119 ARG A N   1 
ATOM   367  C CA  . ARG A 1 50  ? 3.259  37.333 10.809  1.00 36.14  ? 119 ARG A CA  1 
ATOM   368  C C   . ARG A 1 50  ? 3.651  36.117 11.641  1.00 38.23  ? 119 ARG A C   1 
ATOM   369  O O   . ARG A 1 50  ? 3.889  36.260 12.845  1.00 29.75  ? 119 ARG A O   1 
ATOM   370  C CB  . ARG A 1 50  ? 1.978  37.968 11.348  1.00 37.26  ? 119 ARG A CB  1 
ATOM   371  C CG  . ARG A 1 50  ? 1.704  39.338 10.752  1.00 48.55  ? 119 ARG A CG  1 
ATOM   372  C CD  . ARG A 1 50  ? 0.529  40.024 11.424  1.00 58.19  ? 119 ARG A CD  1 
ATOM   373  N NE  . ARG A 1 50  ? 0.782  40.330 12.831  1.00 65.01  ? 119 ARG A NE  1 
ATOM   374  C CZ  . ARG A 1 50  ? 1.160  41.521 13.288  1.00 56.70  ? 119 ARG A CZ  1 
ATOM   375  N NH1 . ARG A 1 50  ? 1.359  41.706 14.587  1.00 52.24  ? 119 ARG A NH1 1 
ATOM   376  N NH2 . ARG A 1 50  ? 1.337  42.531 12.449  1.00 45.80  ? 119 ARG A NH2 1 
ATOM   377  N N   . LEU A 1 51  ? 3.720  34.931 11.028  1.00 42.61  ? 120 LEU A N   1 
ATOM   378  C CA  . LEU A 1 51  ? 4.284  33.775 11.715  1.00 41.77  ? 120 LEU A CA  1 
ATOM   379  C C   . LEU A 1 51  ? 5.738  34.022 12.085  1.00 39.49  ? 120 LEU A C   1 
ATOM   380  O O   . LEU A 1 51  ? 6.208  33.556 13.128  1.00 35.55  ? 120 LEU A O   1 
ATOM   381  C CB  . LEU A 1 51  ? 4.165  32.530 10.839  1.00 43.19  ? 120 LEU A CB  1 
ATOM   382  C CG  . LEU A 1 51  ? 2.833  31.793 10.901  1.00 50.97  ? 120 LEU A CG  1 
ATOM   383  C CD1 . LEU A 1 51  ? 2.921  30.512 10.088  1.00 55.25  ? 120 LEU A CD1 1 
ATOM   384  C CD2 . LEU A 1 51  ? 2.428  31.511 12.350  1.00 44.99  ? 120 LEU A CD2 1 
ATOM   385  N N   . TYR A 1 52  ? 6.471  34.729 11.226  1.00 47.11  ? 121 TYR A N   1 
ATOM   386  C CA  . TYR A 1 52  ? 7.822  35.185 11.538  1.00 43.34  ? 121 TYR A CA  1 
ATOM   387  C C   . TYR A 1 52  ? 7.718  36.375 12.481  1.00 38.50  ? 121 TYR A C   1 
ATOM   388  O O   . TYR A 1 52  ? 7.240  37.444 12.090  1.00 43.78  ? 121 TYR A O   1 
ATOM   389  C CB  . TYR A 1 52  ? 8.577  35.559 10.265  1.00 35.93  ? 121 TYR A CB  1 
ATOM   390  C CG  . TYR A 1 52  ? 8.864  34.384 9.365   1.00 35.22  ? 121 TYR A CG  1 
ATOM   391  C CD1 . TYR A 1 52  ? 9.896  33.502 9.650   1.00 35.61  ? 121 TYR A CD1 1 
ATOM   392  C CD2 . TYR A 1 52  ? 8.101  34.154 8.230   1.00 37.80  ? 121 TYR A CD2 1 
ATOM   393  C CE1 . TYR A 1 52  ? 10.157 32.421 8.825   1.00 42.16  ? 121 TYR A CE1 1 
ATOM   394  C CE2 . TYR A 1 52  ? 8.354  33.077 7.405   1.00 39.61  ? 121 TYR A CE2 1 
ATOM   395  C CZ  . TYR A 1 52  ? 9.381  32.213 7.705   1.00 40.96  ? 121 TYR A CZ  1 
ATOM   396  O OH  . TYR A 1 52  ? 9.629  31.140 6.876   1.00 50.16  ? 121 TYR A OH  1 
ATOM   397  N N   . THR A 1 53  ? 8.160  36.188 13.725  1.00 42.07  ? 122 THR A N   1 
ATOM   398  C CA  . THR A 1 53  ? 7.999  37.235 14.729  1.00 40.98  ? 122 THR A CA  1 
ATOM   399  C C   . THR A 1 53  ? 8.849  38.460 14.412  1.00 39.18  ? 122 THR A C   1 
ATOM   400  O O   . THR A 1 53  ? 8.495  39.578 14.809  1.00 38.74  ? 122 THR A O   1 
ATOM   401  C CB  . THR A 1 53  ? 8.333  36.676 16.112  1.00 39.41  ? 122 THR A CB  1 
ATOM   402  O OG1 . THR A 1 53  ? 7.587  35.469 16.324  1.00 40.91  ? 122 THR A OG1 1 
ATOM   403  C CG2 . THR A 1 53  ? 7.977  37.678 17.198  1.00 41.26  ? 122 THR A CG2 1 
ATOM   404  N N   . ALA A 1 54  ? 9.959  38.280 13.690  1.00 35.37  ? 123 ALA A N   1 
ATOM   405  C CA  . ALA A 1 54  ? 10.776 39.427 13.304  1.00 29.10  ? 123 ALA A CA  1 
ATOM   406  C C   . ALA A 1 54  ? 9.985  40.398 12.439  1.00 31.78  ? 123 ALA A C   1 
ATOM   407  O O   . ALA A 1 54  ? 10.127 41.618 12.574  1.00 44.51  ? 123 ALA A O   1 
ATOM   408  C CB  . ALA A 1 54  ? 12.035 38.957 12.575  1.00 26.01  ? 123 ALA A CB  1 
ATOM   409  N N   . CYS A 1 55  ? 9.138  39.874 11.548  1.00 31.34  ? 124 CYS A N   1 
ATOM   410  C CA  . CYS A 1 55  ? 8.322  40.730 10.694  1.00 44.42  ? 124 CYS A CA  1 
ATOM   411  C C   . CYS A 1 55  ? 7.218  41.441 11.471  1.00 44.19  ? 124 CYS A C   1 
ATOM   412  O O   . CYS A 1 55  ? 6.675  42.438 10.981  1.00 50.99  ? 124 CYS A O   1 
ATOM   413  C CB  . CYS A 1 55  ? 7.732  39.907 9.542   1.00 46.59  ? 124 CYS A CB  1 
ATOM   414  S SG  . CYS A 1 55  ? 8.985  39.386 8.330   1.00 44.45  ? 124 CYS A SG  1 
ATOM   415  N N   . VAL A 1 56  ? 6.877  40.957 12.664  1.00 30.29  ? 125 VAL A N   1 
ATOM   416  C CA  . VAL A 1 56  ? 5.958  41.695 13.521  1.00 35.30  ? 125 VAL A CA  1 
ATOM   417  C C   . VAL A 1 56  ? 6.687  42.815 14.257  1.00 32.38  ? 125 VAL A C   1 
ATOM   418  O O   . VAL A 1 56  ? 6.117  43.890 14.480  1.00 29.39  ? 125 VAL A O   1 
ATOM   419  C CB  . VAL A 1 56  ? 5.257  40.729 14.493  1.00 40.77  ? 125 VAL A CB  1 
ATOM   420  C CG1 . VAL A 1 56  ? 4.567  41.484 15.619  1.00 21.99  ? 125 VAL A CG1 1 
ATOM   421  C CG2 . VAL A 1 56  ? 4.256  39.860 13.737  1.00 47.04  ? 125 VAL A CG2 1 
ATOM   422  N N   . TYR A 1 57  ? 7.952  42.602 14.619  1.00 42.28  ? 126 TYR A N   1 
ATOM   423  C CA  . TYR A 1 57  ? 8.691  43.567 15.423  1.00 45.06  ? 126 TYR A CA  1 
ATOM   424  C C   . TYR A 1 57  ? 9.347  44.673 14.604  1.00 35.74  ? 126 TYR A C   1 
ATOM   425  O O   . TYR A 1 57  ? 9.658  45.728 15.165  1.00 32.39  ? 126 TYR A O   1 
ATOM   426  C CB  . TYR A 1 57  ? 9.764  42.853 16.257  1.00 39.79  ? 126 TYR A CB  1 
ATOM   427  N N   . HIS A 1 58  ? 9.550  44.483 13.305  1.00 32.76  ? 127 HIS A N   1 
ATOM   428  C CA  . HIS A 1 58  ? 10.270 45.457 12.495  1.00 32.77  ? 127 HIS A CA  1 
ATOM   429  C C   . HIS A 1 58  ? 9.349  46.116 11.473  1.00 29.71  ? 127 HIS A C   1 
ATOM   430  O O   . HIS A 1 58  ? 8.212  45.695 11.254  1.00 35.84  ? 127 HIS A O   1 
ATOM   431  C CB  . HIS A 1 58  ? 11.465 44.799 11.795  1.00 30.24  ? 127 HIS A CB  1 
ATOM   432  C CG  . HIS A 1 58  ? 12.553 44.385 12.732  1.00 28.75  ? 127 HIS A CG  1 
ATOM   433  N ND1 . HIS A 1 58  ? 12.997 43.084 12.828  1.00 30.25  ? 127 HIS A ND1 1 
ATOM   434  C CD2 . HIS A 1 58  ? 13.280 45.098 13.624  1.00 29.85  ? 127 HIS A CD2 1 
ATOM   435  C CE1 . HIS A 1 58  ? 13.952 43.013 13.738  1.00 22.68  ? 127 HIS A CE1 1 
ATOM   436  N NE2 . HIS A 1 58  ? 14.145 44.222 14.235  1.00 25.93  ? 127 HIS A NE2 1 
ATOM   437  N N   . LYS A 1 59  ? 9.873  47.163 10.838  1.00 30.62  ? 128 LYS A N   1 
ATOM   438  C CA  . LYS A 1 59  ? 9.121  47.935 9.856   1.00 39.34  ? 128 LYS A CA  1 
ATOM   439  C C   . LYS A 1 59  ? 9.110  47.236 8.503   1.00 38.08  ? 128 LYS A C   1 
ATOM   440  O O   . LYS A 1 59  ? 10.138 46.737 8.037   1.00 40.27  ? 128 LYS A O   1 
ATOM   441  C CB  . LYS A 1 59  ? 9.722  49.332 9.712   1.00 39.96  ? 128 LYS A CB  1 
ATOM   442  C CG  . LYS A 1 59  ? 8.856  50.298 8.938   1.00 44.07  ? 128 LYS A CG  1 
ATOM   443  C CD  . LYS A 1 59  ? 8.971  51.701 9.504   1.00 37.90  ? 128 LYS A CD  1 
ATOM   444  C CE  . LYS A 1 59  ? 8.295  52.709 8.597   1.00 30.22  ? 128 LYS A CE  1 
ATOM   445  N NZ  . LYS A 1 59  ? 8.974  54.028 8.694   1.00 40.43  ? 128 LYS A NZ  1 
ATOM   446  N N   . LEU A 1 60  ? 7.942  47.220 7.865   1.00 29.86  ? 129 LEU A N   1 
ATOM   447  C CA  . LEU A 1 60  ? 7.717  46.467 6.638   1.00 28.59  ? 129 LEU A CA  1 
ATOM   448  C C   . LEU A 1 60  ? 7.541  47.403 5.450   1.00 31.57  ? 129 LEU A C   1 
ATOM   449  O O   . LEU A 1 60  ? 6.892  48.448 5.556   1.00 39.77  ? 129 LEU A O   1 
ATOM   450  C CB  . LEU A 1 60  ? 6.487  45.566 6.768   1.00 26.53  ? 129 LEU A CB  1 
ATOM   451  C CG  . LEU A 1 60  ? 6.444  44.708 8.036   1.00 35.13  ? 129 LEU A CG  1 
ATOM   452  C CD1 . LEU A 1 60  ? 5.227  43.798 8.042   1.00 29.02  ? 129 LEU A CD1 1 
ATOM   453  C CD2 . LEU A 1 60  ? 7.724  43.895 8.171   1.00 39.41  ? 129 LEU A CD2 1 
ATOM   454  N N   . PHE A 1 61  ? 8.123  47.023 4.317   1.00 28.90  ? 130 PHE A N   1 
ATOM   455  C CA  . PHE A 1 61  ? 7.921  47.771 3.087   1.00 34.76  ? 130 PHE A CA  1 
ATOM   456  C C   . PHE A 1 61  ? 6.615  47.338 2.438   1.00 38.95  ? 130 PHE A C   1 
ATOM   457  O O   . PHE A 1 61  ? 6.345  46.140 2.307   1.00 39.97  ? 130 PHE A O   1 
ATOM   458  C CB  . PHE A 1 61  ? 9.084  47.561 2.120   1.00 33.63  ? 130 PHE A CB  1 
ATOM   459  C CG  . PHE A 1 61  ? 8.936  48.319 0.831   1.00 31.00  ? 130 PHE A CG  1 
ATOM   460  C CD1 . PHE A 1 61  ? 9.102  49.696 0.797   1.00 32.14  ? 130 PHE A CD1 1 
ATOM   461  C CD2 . PHE A 1 61  ? 8.618  47.660 -0.342  1.00 30.16  ? 130 PHE A CD2 1 
ATOM   462  C CE1 . PHE A 1 61  ? 8.962  50.401 -0.388  1.00 33.44  ? 130 PHE A CE1 1 
ATOM   463  C CE2 . PHE A 1 61  ? 8.479  48.360 -1.532  1.00 37.40  ? 130 PHE A CE2 1 
ATOM   464  C CZ  . PHE A 1 61  ? 8.654  49.732 -1.553  1.00 33.16  ? 130 PHE A CZ  1 
ATOM   465  N N   . ASP A 1 62  ? 5.806  48.316 2.043   1.00 36.98  ? 131 ASP A N   1 
ATOM   466  C CA  . ASP A 1 62  ? 4.535  48.081 1.365   1.00 42.27  ? 131 ASP A CA  1 
ATOM   467  C C   . ASP A 1 62  ? 4.656  48.605 -0.064  1.00 38.31  ? 131 ASP A C   1 
ATOM   468  O O   . ASP A 1 62  ? 4.641  49.821 -0.288  1.00 30.56  ? 131 ASP A O   1 
ATOM   469  C CB  . ASP A 1 62  ? 3.394  48.767 2.114   1.00 49.50  ? 131 ASP A CB  1 
ATOM   470  C CG  . ASP A 1 62  ? 2.030  48.320 1.638   1.00 58.15  ? 131 ASP A CG  1 
ATOM   471  O OD1 . ASP A 1 62  ? 1.713  48.529 0.447   1.00 54.09  ? 131 ASP A OD1 1 
ATOM   472  O OD2 . ASP A 1 62  ? 1.270  47.768 2.460   1.00 63.85  ? 131 ASP A OD2 1 
ATOM   473  N N   . ALA A 1 63  ? 4.774  47.688 -1.029  1.00 36.11  ? 132 ALA A N   1 
ATOM   474  C CA  . ALA A 1 63  ? 4.979  48.101 -2.416  1.00 30.18  ? 132 ALA A CA  1 
ATOM   475  C C   . ALA A 1 63  ? 3.792  48.898 -2.945  1.00 33.98  ? 132 ALA A C   1 
ATOM   476  O O   . ALA A 1 63  ? 3.969  49.877 -3.679  1.00 40.55  ? 132 ALA A O   1 
ATOM   477  C CB  . ALA A 1 63  ? 5.241  46.880 -3.296  1.00 20.75  ? 132 ALA A CB  1 
ATOM   478  N N   . SER A 1 64  ? 2.573  48.507 -2.571  1.00 36.50  ? 133 SER A N   1 
ATOM   479  C CA  . SER A 1 64  ? 1.380  49.157 -3.104  1.00 40.74  ? 133 SER A CA  1 
ATOM   480  C C   . SER A 1 64  ? 1.195  50.582 -2.596  1.00 44.19  ? 133 SER A C   1 
ATOM   481  O O   . SER A 1 64  ? 0.293  51.276 -3.074  1.00 50.72  ? 133 SER A O   1 
ATOM   482  C CB  . SER A 1 64  ? 0.140  48.329 -2.772  1.00 29.98  ? 133 SER A CB  1 
ATOM   483  O OG  . SER A 1 64  ? -0.259 48.555 -1.435  1.00 40.46  ? 133 SER A OG  1 
ATOM   484  N N   . ASP A 1 65  ? 2.010  51.031 -1.647  1.00 40.34  ? 134 ASP A N   1 
ATOM   485  C CA  . ASP A 1 65  ? 1.954  52.398 -1.153  1.00 36.04  ? 134 ASP A CA  1 
ATOM   486  C C   . ASP A 1 65  ? 2.963  53.317 -1.831  1.00 40.83  ? 134 ASP A C   1 
ATOM   487  O O   . ASP A 1 65  ? 3.118  54.466 -1.407  1.00 48.11  ? 134 ASP A O   1 
ATOM   488  C CB  . ASP A 1 65  ? 2.179  52.420 0.358   1.00 33.84  ? 134 ASP A CB  1 
ATOM   489  C CG  . ASP A 1 65  ? 0.958  51.985 1.133   1.00 39.50  ? 134 ASP A CG  1 
ATOM   490  O OD1 . ASP A 1 65  ? -0.158 52.055 0.577   1.00 50.27  ? 134 ASP A OD1 1 
ATOM   491  O OD2 . ASP A 1 65  ? 1.112  51.577 2.301   1.00 45.05  ? 134 ASP A OD2 1 
ATOM   492  N N   . SER A 1 66  ? 3.653  52.845 -2.866  1.00 29.78  ? 135 SER A N   1 
ATOM   493  C CA  . SER A 1 66  ? 4.712  53.611 -3.505  1.00 32.40  ? 135 SER A CA  1 
ATOM   494  C C   . SER A 1 66  ? 4.406  53.765 -4.987  1.00 35.66  ? 135 SER A C   1 
ATOM   495  O O   . SER A 1 66  ? 4.225  52.769 -5.696  1.00 33.08  ? 135 SER A O   1 
ATOM   496  C CB  . SER A 1 66  ? 6.071  52.938 -3.304  1.00 36.80  ? 135 SER A CB  1 
ATOM   497  O OG  . SER A 1 66  ? 7.080  53.626 -4.022  1.00 34.04  ? 135 SER A OG  1 
ATOM   498  N N   . SER A 1 67  ? 4.362  55.013 -5.453  1.00 44.14  ? 136 SER A N   1 
ATOM   499  C CA  . SER A 1 67  ? 4.119  55.258 -6.869  1.00 52.62  ? 136 SER A CA  1 
ATOM   500  C C   . SER A 1 67  ? 5.351  54.953 -7.709  1.00 51.19  ? 136 SER A C   1 
ATOM   501  O O   . SER A 1 67  ? 5.221  54.569 -8.877  1.00 43.08  ? 136 SER A O   1 
ATOM   502  C CB  . SER A 1 67  ? 3.672  56.703 -7.083  1.00 43.46  ? 136 SER A CB  1 
ATOM   503  O OG  . SER A 1 67  ? 4.311  57.564 -6.161  1.00 49.68  ? 136 SER A OG  1 
ATOM   504  N N   . SER A 1 68  ? 6.546  55.106 -7.137  1.00 44.60  ? 137 SER A N   1 
ATOM   505  C CA  . SER A 1 68  ? 7.774  54.816 -7.866  1.00 31.47  ? 137 SER A CA  1 
ATOM   506  C C   . SER A 1 68  ? 8.153  53.342 -7.821  1.00 33.00  ? 137 SER A C   1 
ATOM   507  O O   . SER A 1 68  ? 9.155  52.962 -8.430  1.00 37.58  ? 137 SER A O   1 
ATOM   508  C CB  . SER A 1 68  ? 8.928  55.669 -7.331  1.00 32.10  ? 137 SER A CB  1 
ATOM   509  O OG  . SER A 1 68  ? 8.944  55.693 -5.913  1.00 44.57  ? 137 SER A OG  1 
ATOM   510  N N   . TYR A 1 69  ? 7.375  52.507 -7.136  1.00 39.16  ? 138 TYR A N   1 
ATOM   511  C CA  . TYR A 1 69  ? 7.667  51.081 -7.091  1.00 39.47  ? 138 TYR A CA  1 
ATOM   512  C C   . TYR A 1 69  ? 7.519  50.460 -8.474  1.00 43.16  ? 138 TYR A C   1 
ATOM   513  O O   . TYR A 1 69  ? 6.654  50.854 -9.262  1.00 44.33  ? 138 TYR A O   1 
ATOM   514  C CB  . TYR A 1 69  ? 6.735  50.386 -6.099  1.00 30.65  ? 138 TYR A CB  1 
ATOM   515  C CG  . TYR A 1 69  ? 6.689  48.879 -6.219  1.00 25.67  ? 138 TYR A CG  1 
ATOM   516  C CD1 . TYR A 1 69  ? 5.570  48.238 -6.742  1.00 23.95  ? 138 TYR A CD1 1 
ATOM   517  C CD2 . TYR A 1 69  ? 7.752  48.091 -5.786  1.00 24.34  ? 138 TYR A CD2 1 
ATOM   518  C CE1 . TYR A 1 69  ? 5.512  46.856 -6.847  1.00 24.44  ? 138 TYR A CE1 1 
ATOM   519  C CE2 . TYR A 1 69  ? 7.704  46.698 -5.883  1.00 26.24  ? 138 TYR A CE2 1 
ATOM   520  C CZ  . TYR A 1 69  ? 6.577  46.091 -6.415  1.00 31.46  ? 138 TYR A CZ  1 
ATOM   521  O OH  . TYR A 1 69  ? 6.520  44.720 -6.518  1.00 35.94  ? 138 TYR A OH  1 
ATOM   522  N N   . LYS A 1 70  ? 8.376  49.480 -8.764  1.00 47.36  ? 139 LYS A N   1 
ATOM   523  C CA  . LYS A 1 70  ? 8.363  48.770 -10.040 1.00 43.47  ? 139 LYS A CA  1 
ATOM   524  C C   . LYS A 1 70  ? 8.621  47.295 -9.771  1.00 34.22  ? 139 LYS A C   1 
ATOM   525  O O   . LYS A 1 70  ? 9.668  46.933 -9.230  1.00 37.41  ? 139 LYS A O   1 
ATOM   526  C CB  . LYS A 1 70  ? 9.405  49.337 -11.008 1.00 50.23  ? 139 LYS A CB  1 
ATOM   527  C CG  . LYS A 1 70  ? 9.126  49.039 -12.471 1.00 59.20  ? 139 LYS A CG  1 
ATOM   528  C CD  . LYS A 1 70  ? 10.203 49.647 -13.359 1.00 66.23  ? 139 LYS A CD  1 
ATOM   529  C CE  . LYS A 1 70  ? 9.800  49.632 -14.825 1.00 75.64  ? 139 LYS A CE  1 
ATOM   530  N NZ  . LYS A 1 70  ? 8.512  50.344 -15.051 1.00 75.34  ? 139 LYS A NZ  1 
ATOM   531  N N   . HIS A 1 71  ? 7.670  46.451 -10.151 1.00 39.97  ? 140 HIS A N   1 
ATOM   532  C CA  . HIS A 1 71  ? 7.678  45.045 -9.755  1.00 35.43  ? 140 HIS A CA  1 
ATOM   533  C C   . HIS A 1 71  ? 8.770  44.254 -10.473 1.00 33.72  ? 140 HIS A C   1 
ATOM   534  O O   . HIS A 1 71  ? 8.991  44.443 -11.668 1.00 37.25  ? 140 HIS A O   1 
ATOM   535  C CB  . HIS A 1 71  ? 6.320  44.435 -10.088 1.00 19.76  ? 140 HIS A CB  1 
ATOM   536  C CG  . HIS A 1 71  ? 6.123  43.049 -9.566  1.00 26.78  ? 140 HIS A CG  1 
ATOM   537  N ND1 . HIS A 1 71  ? 6.628  41.931 -10.194 1.00 29.83  ? 140 HIS A ND1 1 
ATOM   538  C CD2 . HIS A 1 71  ? 5.434  42.600 -8.491  1.00 26.30  ? 140 HIS A CD2 1 
ATOM   539  C CE1 . HIS A 1 71  ? 6.271  40.853 -9.518  1.00 32.19  ? 140 HIS A CE1 1 
ATOM   540  N NE2 . HIS A 1 71  ? 5.547  41.232 -8.480  1.00 28.75  ? 140 HIS A NE2 1 
ATOM   541  N N   . ASN A 1 72  ? 9.467  43.359 -9.765  1.00 27.35  ? 141 ASN A N   1 
ATOM   542  C CA  . ASN A 1 72  ? 10.248 42.347 -10.477 1.00 30.80  ? 141 ASN A CA  1 
ATOM   543  C C   . ASN A 1 72  ? 9.830  40.938 -10.069 1.00 40.00  ? 141 ASN A C   1 
ATOM   544  O O   . ASN A 1 72  ? 9.401  40.173 -10.934 1.00 18.78  ? 141 ASN A O   1 
ATOM   545  C CB  . ASN A 1 72  ? 11.779 42.615 -10.312 1.00 24.46  ? 141 ASN A CB  1 
ATOM   546  C CG  . ASN A 1 72  ? 12.648 41.597 -11.065 1.00 35.06  ? 141 ASN A CG  1 
ATOM   547  O OD1 . ASN A 1 72  ? 12.853 40.456 -10.632 1.00 43.62  ? 141 ASN A OD1 1 
ATOM   548  N ND2 . ASN A 1 72  ? 13.103 41.976 -12.248 1.00 44.09  ? 141 ASN A ND2 1 
ATOM   549  N N   . GLY A 1 73  ? 9.857  40.591 -8.772  1.00 36.46  ? 142 GLY A N   1 
ATOM   550  C CA  . GLY A 1 73  ? 9.325  39.325 -8.316  1.00 26.29  ? 142 GLY A CA  1 
ATOM   551  C C   . GLY A 1 73  ? 10.283 38.152 -8.335  1.00 33.07  ? 142 GLY A C   1 
ATOM   552  O O   . GLY A 1 73  ? 9.934  37.094 -7.802  1.00 36.58  ? 142 GLY A O   1 
ATOM   553  N N   . THR A 1 74  ? 11.471 38.289 -8.924  1.00 28.96  ? 143 THR A N   1 
ATOM   554  C CA  . THR A 1 74  ? 12.417 37.176 -8.948  1.00 26.21  ? 143 THR A CA  1 
ATOM   555  C C   . THR A 1 74  ? 12.892 36.833 -7.540  1.00 27.38  ? 143 THR A C   1 
ATOM   556  O O   . THR A 1 74  ? 13.230 37.713 -6.746  1.00 27.11  ? 143 THR A O   1 
ATOM   557  C CB  . THR A 1 74  ? 13.614 37.505 -9.837  1.00 30.02  ? 143 THR A CB  1 
ATOM   558  O OG1 . THR A 1 74  ? 13.165 37.624 -11.190 1.00 32.39  ? 143 THR A OG1 1 
ATOM   559  C CG2 . THR A 1 74  ? 14.685 36.416 -9.751  1.00 17.03  ? 143 THR A CG2 1 
ATOM   560  N N   . GLU A 1 75  ? 12.925 35.537 -7.241  1.00 27.10  ? 144 GLU A N   1 
ATOM   561  C CA  . GLU A 1 75  ? 13.232 35.072 -5.899  1.00 19.31  ? 144 GLU A CA  1 
ATOM   562  C C   . GLU A 1 75  ? 14.692 35.342 -5.548  1.00 19.22  ? 144 GLU A C   1 
ATOM   563  O O   . GLU A 1 75  ? 15.579 35.330 -6.404  1.00 42.58  ? 144 GLU A O   1 
ATOM   564  C CB  . GLU A 1 75  ? 12.915 33.580 -5.773  1.00 19.98  ? 144 GLU A CB  1 
ATOM   565  N N   . LEU A 1 76  ? 14.931 35.599 -4.269  1.00 20.67  ? 145 LEU A N   1 
ATOM   566  C CA  . LEU A 1 76  ? 16.250 35.937 -3.764  1.00 17.78  ? 145 LEU A CA  1 
ATOM   567  C C   . LEU A 1 76  ? 16.457 35.273 -2.412  1.00 29.17  ? 145 LEU A C   1 
ATOM   568  O O   . LEU A 1 76  ? 15.582 35.325 -1.543  1.00 37.10  ? 145 LEU A O   1 
ATOM   569  C CB  . LEU A 1 76  ? 16.412 37.449 -3.620  1.00 14.36  ? 145 LEU A CB  1 
ATOM   570  C CG  . LEU A 1 76  ? 17.774 37.941 -3.143  1.00 26.12  ? 145 LEU A CG  1 
ATOM   571  C CD1 . LEU A 1 76  ? 18.714 38.088 -4.324  1.00 25.44  ? 145 LEU A CD1 1 
ATOM   572  C CD2 . LEU A 1 76  ? 17.637 39.250 -2.393  1.00 19.65  ? 145 LEU A CD2 1 
ATOM   573  N N   . THR A 1 77  ? 17.618 34.653 -2.237  1.00 30.86  ? 146 THR A N   1 
ATOM   574  C CA  . THR A 1 77  ? 18.001 34.076 -0.959  1.00 27.90  ? 146 THR A CA  1 
ATOM   575  C C   . THR A 1 77  ? 19.403 34.552 -0.624  1.00 25.32  ? 146 THR A C   1 
ATOM   576  O O   . THR A 1 77  ? 20.294 34.505 -1.479  1.00 26.46  ? 146 THR A O   1 
ATOM   577  C CB  . THR A 1 77  ? 17.937 32.550 -1.000  1.00 33.47  ? 146 THR A CB  1 
ATOM   578  O OG1 . THR A 1 77  ? 16.565 32.137 -0.963  1.00 46.96  ? 146 THR A OG1 1 
ATOM   579  C CG2 . THR A 1 77  ? 18.659 31.958 0.189   1.00 39.80  ? 146 THR A CG2 1 
ATOM   580  N N   . LEU A 1 78  ? 19.588 35.028 0.610   1.00 23.55  ? 147 LEU A N   1 
ATOM   581  C CA  . LEU A 1 78  ? 20.857 35.581 1.071   1.00 31.61  ? 147 LEU A CA  1 
ATOM   582  C C   . LEU A 1 78  ? 21.440 34.691 2.160   1.00 34.99  ? 147 LEU A C   1 
ATOM   583  O O   . LEU A 1 78  ? 20.781 34.428 3.172   1.00 35.88  ? 147 LEU A O   1 
ATOM   584  C CB  . LEU A 1 78  ? 20.677 37.008 1.589   1.00 28.72  ? 147 LEU A CB  1 
ATOM   585  C CG  . LEU A 1 78  ? 20.154 37.987 0.548   1.00 30.60  ? 147 LEU A CG  1 
ATOM   586  C CD1 . LEU A 1 78  ? 20.201 39.403 1.078   1.00 29.85  ? 147 LEU A CD1 1 
ATOM   587  C CD2 . LEU A 1 78  ? 20.964 37.851 -0.721  1.00 28.17  ? 147 LEU A CD2 1 
ATOM   588  N N   . ARG A 1 79  ? 22.678 34.247 1.953   1.00 38.05  ? 148 ARG A N   1 
ATOM   589  C CA  . ARG A 1 79  ? 23.390 33.378 2.883   1.00 40.66  ? 148 ARG A CA  1 
ATOM   590  C C   . ARG A 1 79  ? 24.278 34.214 3.793   1.00 41.77  ? 148 ARG A C   1 
ATOM   591  O O   . ARG A 1 79  ? 25.057 35.043 3.317   1.00 45.28  ? 148 ARG A O   1 
ATOM   592  C CB  . ARG A 1 79  ? 24.240 32.359 2.125   1.00 55.77  ? 148 ARG A CB  1 
ATOM   593  C CG  . ARG A 1 79  ? 24.799 31.228 2.979   1.00 60.28  ? 148 ARG A CG  1 
ATOM   594  C CD  . ARG A 1 79  ? 25.627 30.275 2.124   1.00 62.49  ? 148 ARG A CD  1 
ATOM   595  N NE  . ARG A 1 79  ? 24.791 29.264 1.482   1.00 65.93  ? 148 ARG A NE  1 
ATOM   596  C CZ  . ARG A 1 79  ? 25.253 28.150 0.924   1.00 61.92  ? 148 ARG A CZ  1 
ATOM   597  N NH1 . ARG A 1 79  ? 24.406 27.293 0.368   1.00 64.02  ? 148 ARG A NH1 1 
ATOM   598  N NH2 . ARG A 1 79  ? 26.556 27.898 0.908   1.00 49.72  ? 148 ARG A NH2 1 
ATOM   599  N N   . TYR A 1 80  ? 24.156 34.004 5.094   1.00 50.23  ? 149 TYR A N   1 
ATOM   600  C CA  . TYR A 1 80  ? 25.039 34.623 6.067   1.00 50.63  ? 149 TYR A CA  1 
ATOM   601  C C   . TYR A 1 80  ? 25.676 33.531 6.926   1.00 64.41  ? 149 TYR A C   1 
ATOM   602  O O   . TYR A 1 80  ? 25.343 32.348 6.818   1.00 66.60  ? 149 TYR A O   1 
ATOM   603  C CB  . TYR A 1 80  ? 24.288 35.635 6.939   1.00 44.63  ? 149 TYR A CB  1 
ATOM   604  C CG  . TYR A 1 80  ? 23.850 36.917 6.247   1.00 47.73  ? 149 TYR A CG  1 
ATOM   605  C CD1 . TYR A 1 80  ? 24.769 37.907 5.906   1.00 44.52  ? 149 TYR A CD1 1 
ATOM   606  C CD2 . TYR A 1 80  ? 22.506 37.154 5.974   1.00 49.25  ? 149 TYR A CD2 1 
ATOM   607  C CE1 . TYR A 1 80  ? 24.361 39.087 5.287   1.00 35.43  ? 149 TYR A CE1 1 
ATOM   608  C CE2 . TYR A 1 80  ? 22.091 38.324 5.359   1.00 41.65  ? 149 TYR A CE2 1 
ATOM   609  C CZ  . TYR A 1 80  ? 23.019 39.286 5.019   1.00 35.33  ? 149 TYR A CZ  1 
ATOM   610  O OH  . TYR A 1 80  ? 22.586 40.444 4.413   1.00 29.48  ? 149 TYR A OH  1 
ATOM   611  N N   . SER A 1 81  ? 26.614 33.944 7.781   1.00 66.59  ? 150 SER A N   1 
ATOM   612  C CA  . SER A 1 81  ? 27.187 33.021 8.753   1.00 64.04  ? 150 SER A CA  1 
ATOM   613  C C   . SER A 1 81  ? 26.112 32.444 9.662   1.00 60.36  ? 150 SER A C   1 
ATOM   614  O O   . SER A 1 81  ? 26.136 31.252 9.989   1.00 60.26  ? 150 SER A O   1 
ATOM   615  C CB  . SER A 1 81  ? 28.235 33.738 9.593   1.00 73.40  ? 150 SER A CB  1 
ATOM   616  O OG  . SER A 1 81  ? 27.602 34.433 10.655  1.00 71.42  ? 150 SER A OG  1 
ATOM   617  N N   . THR A 1 82  ? 25.169 33.282 10.093  1.00 59.27  ? 151 THR A N   1 
ATOM   618  C CA  . THR A 1 82  ? 24.134 32.833 11.013  1.00 67.38  ? 151 THR A CA  1 
ATOM   619  C C   . THR A 1 82  ? 23.027 32.052 10.315  1.00 75.20  ? 151 THR A C   1 
ATOM   620  O O   . THR A 1 82  ? 22.361 31.230 10.955  1.00 83.41  ? 151 THR A O   1 
ATOM   621  C CB  . THR A 1 82  ? 23.525 34.024 11.748  1.00 65.29  ? 151 THR A CB  1 
ATOM   622  O OG1 . THR A 1 82  ? 22.603 33.546 12.736  1.00 71.51  ? 151 THR A OG1 1 
ATOM   623  C CG2 . THR A 1 82  ? 22.793 34.945 10.765  1.00 57.42  ? 151 THR A CG2 1 
ATOM   624  N N   . GLY A 1 83  ? 22.807 32.289 9.026   1.00 71.01  ? 152 GLY A N   1 
ATOM   625  C CA  . GLY A 1 83  ? 21.684 31.667 8.361   1.00 68.69  ? 152 GLY A CA  1 
ATOM   626  C C   . GLY A 1 83  ? 21.240 32.358 7.090   1.00 64.99  ? 152 GLY A C   1 
ATOM   627  O O   . GLY A 1 83  ? 22.060 32.655 6.217   1.00 73.49  ? 152 GLY A O   1 
ATOM   628  N N   . THR A 1 84  ? 19.943 32.630 6.975   1.00 54.27  ? 153 THR A N   1 
ATOM   629  C CA  . THR A 1 84  ? 19.374 32.914 5.667   1.00 45.21  ? 153 THR A CA  1 
ATOM   630  C C   . THR A 1 84  ? 18.129 33.777 5.785   1.00 38.69  ? 153 THR A C   1 
ATOM   631  O O   . THR A 1 84  ? 17.257 33.502 6.612   1.00 35.76  ? 153 THR A O   1 
ATOM   632  C CB  . THR A 1 84  ? 19.040 31.600 4.948   1.00 42.79  ? 153 THR A CB  1 
ATOM   633  O OG1 . THR A 1 84  ? 20.226 31.076 4.337   1.00 49.34  ? 153 THR A OG1 1 
ATOM   634  C CG2 . THR A 1 84  ? 17.970 31.808 3.890   1.00 43.16  ? 153 THR A CG2 1 
ATOM   635  N N   . VAL A 1 85  ? 18.061 34.822 4.964   1.00 36.60  ? 154 VAL A N   1 
ATOM   636  C CA  . VAL A 1 85  ? 16.809 35.495 4.661   1.00 29.25  ? 154 VAL A CA  1 
ATOM   637  C C   . VAL A 1 85  ? 16.434 35.151 3.230   1.00 33.09  ? 154 VAL A C   1 
ATOM   638  O O   . VAL A 1 85  ? 17.282 34.815 2.396   1.00 38.85  ? 154 VAL A O   1 
ATOM   639  C CB  . VAL A 1 85  ? 16.882 37.022 4.843   1.00 29.22  ? 154 VAL A CB  1 
ATOM   640  C CG1 . VAL A 1 85  ? 17.219 37.368 6.282   1.00 36.15  ? 154 VAL A CG1 1 
ATOM   641  C CG2 . VAL A 1 85  ? 17.881 37.622 3.868   1.00 18.16  ? 154 VAL A CG2 1 
ATOM   642  N N   . SER A 1 86  ? 15.140 35.244 2.942   1.00 29.56  ? 155 SER A N   1 
ATOM   643  C CA  . SER A 1 86  ? 14.632 34.909 1.624   1.00 23.06  ? 155 SER A CA  1 
ATOM   644  C C   . SER A 1 86  ? 13.524 35.877 1.245   1.00 26.20  ? 155 SER A C   1 
ATOM   645  O O   . SER A 1 86  ? 12.885 36.496 2.100   1.00 33.19  ? 155 SER A O   1 
ATOM   646  C CB  . SER A 1 86  ? 14.119 33.465 1.574   1.00 35.17  ? 155 SER A CB  1 
ATOM   647  O OG  . SER A 1 86  ? 15.192 32.549 1.716   1.00 52.24  ? 155 SER A OG  1 
ATOM   648  N N   . GLY A 1 87  ? 13.300 35.994 -0.057  1.00 23.29  ? 156 GLY A N   1 
ATOM   649  C CA  . GLY A 1 87  ? 12.246 36.865 -0.549  1.00 27.60  ? 156 GLY A CA  1 
ATOM   650  C C   . GLY A 1 87  ? 12.359 37.050 -2.043  1.00 26.36  ? 156 GLY A C   1 
ATOM   651  O O   . GLY A 1 87  ? 12.857 36.174 -2.757  1.00 28.82  ? 156 GLY A O   1 
ATOM   652  N N   . PHE A 1 88  ? 11.904 38.208 -2.506  1.00 18.69  ? 157 PHE A N   1 
ATOM   653  C CA  . PHE A 1 88  ? 11.876 38.499 -3.928  1.00 25.24  ? 157 PHE A CA  1 
ATOM   654  C C   . PHE A 1 88  ? 12.475 39.870 -4.184  1.00 19.80  ? 157 PHE A C   1 
ATOM   655  O O   . PHE A 1 88  ? 12.555 40.715 -3.290  1.00 21.98  ? 157 PHE A O   1 
ATOM   656  C CB  . PHE A 1 88  ? 10.448 38.434 -4.494  1.00 16.32  ? 157 PHE A CB  1 
ATOM   657  C CG  . PHE A 1 88  ? 9.474  39.332 -3.787  1.00 22.35  ? 157 PHE A CG  1 
ATOM   658  C CD1 . PHE A 1 88  ? 8.846  38.920 -2.621  1.00 23.40  ? 157 PHE A CD1 1 
ATOM   659  C CD2 . PHE A 1 88  ? 9.179  40.587 -4.292  1.00 26.50  ? 157 PHE A CD2 1 
ATOM   660  C CE1 . PHE A 1 88  ? 7.947  39.743 -1.977  1.00 22.27  ? 157 PHE A CE1 1 
ATOM   661  C CE2 . PHE A 1 88  ? 8.280  41.414 -3.648  1.00 28.23  ? 157 PHE A CE2 1 
ATOM   662  C CZ  . PHE A 1 88  ? 7.667  40.992 -2.492  1.00 27.67  ? 157 PHE A CZ  1 
ATOM   663  N N   . LEU A 1 89  ? 12.887 40.078 -5.431  1.00 24.21  ? 158 LEU A N   1 
ATOM   664  C CA  . LEU A 1 89  ? 13.463 41.346 -5.844  1.00 21.16  ? 158 LEU A CA  1 
ATOM   665  C C   . LEU A 1 89  ? 12.370 42.359 -6.145  1.00 26.01  ? 158 LEU A C   1 
ATOM   666  O O   . LEU A 1 89  ? 11.296 42.015 -6.648  1.00 35.36  ? 158 LEU A O   1 
ATOM   667  C CB  . LEU A 1 89  ? 14.342 41.160 -7.076  1.00 25.58  ? 158 LEU A CB  1 
ATOM   668  C CG  . LEU A 1 89  ? 15.634 40.365 -6.910  1.00 31.89  ? 158 LEU A CG  1 
ATOM   669  C CD1 . LEU A 1 89  ? 16.255 40.089 -8.272  1.00 28.32  ? 158 LEU A CD1 1 
ATOM   670  C CD2 . LEU A 1 89  ? 16.604 41.124 -6.020  1.00 30.11  ? 158 LEU A CD2 1 
ATOM   671  N N   . SER A 1 90  ? 12.658 43.616 -5.830  1.00 21.42  ? 159 SER A N   1 
ATOM   672  C CA  . SER A 1 90  ? 11.775 44.733 -6.108  1.00 20.08  ? 159 SER A CA  1 
ATOM   673  C C   . SER A 1 90  ? 12.650 45.915 -6.481  1.00 28.79  ? 159 SER A C   1 
ATOM   674  O O   . SER A 1 90  ? 13.846 45.943 -6.176  1.00 26.67  ? 159 SER A O   1 
ATOM   675  C CB  . SER A 1 90  ? 10.903 45.082 -4.894  1.00 16.14  ? 159 SER A CB  1 
ATOM   676  O OG  . SER A 1 90  ? 9.832  44.165 -4.746  1.00 28.85  ? 159 SER A OG  1 
ATOM   677  N N   . GLN A 1 91  ? 12.050 46.903 -7.133  1.00 25.83  ? 160 GLN A N   1 
ATOM   678  C CA  . GLN A 1 91  ? 12.775 48.104 -7.511  1.00 20.09  ? 160 GLN A CA  1 
ATOM   679  C C   . GLN A 1 91  ? 11.980 49.326 -7.094  1.00 22.21  ? 160 GLN A C   1 
ATOM   680  O O   . GLN A 1 91  ? 10.762 49.379 -7.282  1.00 24.39  ? 160 GLN A O   1 
ATOM   681  C CB  . GLN A 1 91  ? 13.051 48.143 -9.009  1.00 17.47  ? 160 GLN A CB  1 
ATOM   682  C CG  . GLN A 1 91  ? 14.001 49.244 -9.443  1.00 27.92  ? 160 GLN A CG  1 
ATOM   683  C CD  . GLN A 1 91  ? 13.706 49.730 -10.850 1.00 41.19  ? 160 GLN A CD  1 
ATOM   684  O OE1 . GLN A 1 91  ? 12.790 50.526 -11.067 1.00 55.03  ? 160 GLN A OE1 1 
ATOM   685  N NE2 . GLN A 1 91  ? 14.470 49.239 -11.815 1.00 32.41  ? 160 GLN A NE2 1 
ATOM   686  N N   . ASP A 1 92  ? 12.676 50.296 -6.510  1.00 22.43  ? 161 ASP A N   1 
ATOM   687  C CA  . ASP A 1 92  ? 12.059 51.551 -6.112  1.00 17.27  ? 161 ASP A CA  1 
ATOM   688  C C   . ASP A 1 92  ? 13.164 52.570 -5.893  1.00 28.27  ? 161 ASP A C   1 
ATOM   689  O O   . ASP A 1 92  ? 14.351 52.239 -5.909  1.00 41.57  ? 161 ASP A O   1 
ATOM   690  C CB  . ASP A 1 92  ? 11.204 51.383 -4.859  1.00 31.85  ? 161 ASP A CB  1 
ATOM   691  C CG  . ASP A 1 92  ? 10.064 52.369 -4.802  1.00 35.74  ? 161 ASP A CG  1 
ATOM   692  O OD1 . ASP A 1 92  ? 10.216 53.489 -5.328  1.00 36.16  ? 161 ASP A OD1 1 
ATOM   693  O OD2 . ASP A 1 92  ? 9.013  52.025 -4.228  1.00 42.45  ? 161 ASP A OD2 1 
ATOM   694  N N   . ILE A 1 93  ? 12.759 53.821 -5.714  1.00 29.94  ? 162 ILE A N   1 
ATOM   695  C CA  . ILE A 1 93  ? 13.705 54.889 -5.422  1.00 36.06  ? 162 ILE A CA  1 
ATOM   696  C C   . ILE A 1 93  ? 14.126 54.769 -3.964  1.00 39.79  ? 162 ILE A C   1 
ATOM   697  O O   . ILE A 1 93  ? 13.283 54.621 -3.071  1.00 43.61  ? 162 ILE A O   1 
ATOM   698  C CB  . ILE A 1 93  ? 13.088 56.266 -5.719  1.00 30.44  ? 162 ILE A CB  1 
ATOM   699  C CG1 . ILE A 1 93  ? 12.640 56.351 -7.176  1.00 40.21  ? 162 ILE A CG1 1 
ATOM   700  C CG2 . ILE A 1 93  ? 14.094 57.365 -5.452  1.00 35.90  ? 162 ILE A CG2 1 
ATOM   701  N N   . ILE A 1 94  ? 15.431 54.810 -3.720  1.00 35.31  ? 163 ILE A N   1 
ATOM   702  C CA  . ILE A 1 94  ? 15.989 54.733 -2.377  1.00 29.29  ? 163 ILE A CA  1 
ATOM   703  C C   . ILE A 1 94  ? 16.801 55.991 -2.127  1.00 32.45  ? 163 ILE A C   1 
ATOM   704  O O   . ILE A 1 94  ? 17.669 56.352 -2.932  1.00 31.48  ? 163 ILE A O   1 
ATOM   705  C CB  . ILE A 1 94  ? 16.862 53.482 -2.182  1.00 30.43  ? 163 ILE A CB  1 
ATOM   706  C CG1 . ILE A 1 94  ? 16.008 52.214 -2.256  1.00 35.66  ? 163 ILE A CG1 1 
ATOM   707  C CG2 . ILE A 1 94  ? 17.581 53.563 -0.857  1.00 21.07  ? 163 ILE A CG2 1 
ATOM   708  C CD1 . ILE A 1 94  ? 16.765 50.952 -1.920  1.00 30.21  ? 163 ILE A CD1 1 
ATOM   709  N N   . THR A 1 95  ? 16.522 56.648 -1.012  1.00 40.28  ? 164 THR A N   1 
ATOM   710  C CA  . THR A 1 95  ? 17.223 57.851 -0.598  1.00 41.14  ? 164 THR A CA  1 
ATOM   711  C C   . THR A 1 95  ? 18.151 57.504 0.560   1.00 39.58  ? 164 THR A C   1 
ATOM   712  O O   . THR A 1 95  ? 17.736 56.839 1.516   1.00 43.94  ? 164 THR A O   1 
ATOM   713  C CB  . THR A 1 95  ? 16.219 58.931 -0.191  1.00 38.43  ? 164 THR A CB  1 
ATOM   714  O OG1 . THR A 1 95  ? 15.659 58.598 1.081   1.00 37.69  ? 164 THR A OG1 1 
ATOM   715  C CG2 . THR A 1 95  ? 15.081 59.001 -1.203  1.00 46.31  ? 164 THR A CG2 1 
ATOM   716  N N   . VAL A 1 96  ? 19.412 57.918 0.458   1.00 35.00  ? 165 VAL A N   1 
ATOM   717  C CA  . VAL A 1 96  ? 20.376 57.746 1.542   1.00 39.88  ? 165 VAL A CA  1 
ATOM   718  C C   . VAL A 1 96  ? 21.200 59.024 1.641   1.00 44.87  ? 165 VAL A C   1 
ATOM   719  O O   . VAL A 1 96  ? 21.920 59.382 0.701   1.00 50.36  ? 165 VAL A O   1 
ATOM   720  C CB  . VAL A 1 96  ? 21.284 56.516 1.345   1.00 38.56  ? 165 VAL A CB  1 
ATOM   721  C CG1 . VAL A 1 96  ? 21.834 56.447 -0.077  1.00 36.84  ? 165 VAL A CG1 1 
ATOM   722  C CG2 . VAL A 1 96  ? 22.414 56.522 2.370   1.00 37.26  ? 165 VAL A CG2 1 
ATOM   723  N N   . GLY A 1 97  ? 21.093 59.713 2.770   1.00 47.39  ? 166 GLY A N   1 
ATOM   724  C CA  . GLY A 1 97  ? 21.666 61.045 2.844   1.00 49.39  ? 166 GLY A CA  1 
ATOM   725  C C   . GLY A 1 97  ? 20.944 61.950 1.869   1.00 52.24  ? 166 GLY A C   1 
ATOM   726  O O   . GLY A 1 97  ? 19.715 61.922 1.759   1.00 58.34  ? 166 GLY A O   1 
ATOM   727  N N   . GLY A 1 98  ? 21.703 62.751 1.134   1.00 54.33  ? 167 GLY A N   1 
ATOM   728  C CA  . GLY A 1 98  ? 21.114 63.613 0.134   1.00 57.82  ? 167 GLY A CA  1 
ATOM   729  C C   . GLY A 1 98  ? 21.037 63.004 -1.245  1.00 60.92  ? 167 GLY A C   1 
ATOM   730  O O   . GLY A 1 98  ? 20.673 63.694 -2.202  1.00 58.99  ? 167 GLY A O   1 
ATOM   731  N N   . ILE A 1 99  ? 21.360 61.722 -1.373  1.00 59.31  ? 168 ILE A N   1 
ATOM   732  C CA  . ILE A 1 99  ? 21.466 61.048 -2.658  1.00 48.49  ? 168 ILE A CA  1 
ATOM   733  C C   . ILE A 1 99  ? 20.257 60.141 -2.829  1.00 54.93  ? 168 ILE A C   1 
ATOM   734  O O   . ILE A 1 99  ? 19.885 59.408 -1.903  1.00 56.90  ? 168 ILE A O   1 
ATOM   735  C CB  . ILE A 1 99  ? 22.781 60.256 -2.756  1.00 44.29  ? 168 ILE A CB  1 
ATOM   736  C CG1 . ILE A 1 99  ? 23.964 61.224 -2.841  1.00 41.55  ? 168 ILE A CG1 1 
ATOM   737  C CG2 . ILE A 1 99  ? 22.758 59.312 -3.946  1.00 50.61  ? 168 ILE A CG2 1 
ATOM   738  C CD1 . ILE A 1 99  ? 25.316 60.565 -2.750  1.00 36.88  ? 168 ILE A CD1 1 
ATOM   739  N N   . THR A 1 100 ? 19.635 60.204 -4.003  1.00 53.24  ? 169 THR A N   1 
ATOM   740  C CA  . THR A 1 100 ? 18.532 59.323 -4.358  1.00 49.76  ? 169 THR A CA  1 
ATOM   741  C C   . THR A 1 100 ? 18.945 58.479 -5.554  1.00 43.12  ? 169 THR A C   1 
ATOM   742  O O   . THR A 1 100 ? 19.596 58.976 -6.478  1.00 40.22  ? 169 THR A O   1 
ATOM   743  C CB  . THR A 1 100 ? 17.259 60.117 -4.676  1.00 42.89  ? 169 THR A CB  1 
ATOM   744  O OG1 . THR A 1 100 ? 17.491 60.966 -5.803  1.00 51.87  ? 169 THR A OG1 1 
ATOM   745  C CG2 . THR A 1 100 ? 16.873 60.985 -3.492  1.00 33.97  ? 169 THR A CG2 1 
ATOM   746  N N   . VAL A 1 101 ? 18.590 57.194 -5.522  1.00 35.41  ? 170 VAL A N   1 
ATOM   747  C CA  . VAL A 1 101 ? 18.922 56.267 -6.595  1.00 30.28  ? 170 VAL A CA  1 
ATOM   748  C C   . VAL A 1 101 ? 17.765 55.307 -6.790  1.00 36.66  ? 170 VAL A C   1 
ATOM   749  O O   . VAL A 1 101 ? 17.088 54.915 -5.834  1.00 37.90  ? 170 VAL A O   1 
ATOM   750  C CB  . VAL A 1 101 ? 20.205 55.455 -6.316  1.00 25.25  ? 170 VAL A CB  1 
ATOM   751  C CG1 . VAL A 1 101 ? 21.435 56.247 -6.682  1.00 38.00  ? 170 VAL A CG1 1 
ATOM   752  C CG2 . VAL A 1 101 ? 20.248 55.038 -4.866  1.00 33.12  ? 170 VAL A CG2 1 
ATOM   753  N N   . THR A 1 102 ? 17.547 54.922 -8.041  1.00 30.46  ? 171 THR A N   1 
ATOM   754  C CA  . THR A 1 102 ? 16.684 53.790 -8.325  1.00 35.54  ? 171 THR A CA  1 
ATOM   755  C C   . THR A 1 102 ? 17.487 52.522 -8.067  1.00 32.09  ? 171 THR A C   1 
ATOM   756  O O   . THR A 1 102 ? 18.560 52.332 -8.651  1.00 28.37  ? 171 THR A O   1 
ATOM   757  C CB  . THR A 1 102 ? 16.163 53.845 -9.758  1.00 38.36  ? 171 THR A CB  1 
ATOM   758  O OG1 . THR A 1 102 ? 15.204 54.905 -9.878  1.00 45.01  ? 171 THR A OG1 1 
ATOM   759  C CG2 . THR A 1 102 ? 15.497 52.533 -10.123 1.00 30.83  ? 171 THR A CG2 1 
ATOM   760  N N   . GLN A 1 103 ? 16.982 51.672 -7.174  1.00 23.83  ? 172 GLN A N   1 
ATOM   761  C CA  . GLN A 1 103 ? 17.724 50.521 -6.690  1.00 21.02  ? 172 GLN A CA  1 
ATOM   762  C C   . GLN A 1 103 ? 16.869 49.267 -6.746  1.00 26.74  ? 172 GLN A C   1 
ATOM   763  O O   . GLN A 1 103 ? 15.669 49.304 -6.453  1.00 32.17  ? 172 GLN A O   1 
ATOM   764  C CB  . GLN A 1 103 ? 18.214 50.738 -5.251  1.00 15.06  ? 172 GLN A CB  1 
ATOM   765  C CG  . GLN A 1 103 ? 18.915 49.527 -4.676  1.00 20.01  ? 172 GLN A CG  1 
ATOM   766  C CD  . GLN A 1 103 ? 20.315 49.386 -5.232  1.00 27.80  ? 172 GLN A CD  1 
ATOM   767  O OE1 . GLN A 1 103 ? 20.853 48.285 -5.336  1.00 33.31  ? 172 GLN A OE1 1 
ATOM   768  N NE2 . GLN A 1 103 ? 20.902 50.511 -5.623  1.00 31.83  ? 172 GLN A NE2 1 
ATOM   769  N N   . MET A 1 104 ? 17.498 48.159 -7.129  1.00 31.18  ? 173 MET A N   1 
ATOM   770  C CA  . MET A 1 104 ? 16.904 46.836 -7.002  1.00 29.37  ? 173 MET A CA  1 
ATOM   771  C C   . MET A 1 104 ? 17.322 46.255 -5.650  1.00 30.50  ? 173 MET A C   1 
ATOM   772  O O   . MET A 1 104 ? 18.516 46.153 -5.352  1.00 32.22  ? 173 MET A O   1 
ATOM   773  C CB  . MET A 1 104 ? 17.337 45.941 -8.163  1.00 22.70  ? 173 MET A CB  1 
ATOM   774  C CG  . MET A 1 104 ? 16.674 44.579 -8.179  1.00 48.30  ? 173 MET A CG  1 
ATOM   775  S SD  . MET A 1 104 ? 15.048 44.639 -8.985  1.00 62.05  ? 173 MET A SD  1 
ATOM   776  C CE  . MET A 1 104 ? 15.474 45.150 -10.628 1.00 51.66  ? 173 MET A CE  1 
ATOM   777  N N   . PHE A 1 105 ? 16.341 45.904 -4.823  1.00 19.66  ? 174 PHE A N   1 
ATOM   778  C CA  . PHE A 1 105 ? 16.590 45.437 -3.468  1.00 19.54  ? 174 PHE A CA  1 
ATOM   779  C C   . PHE A 1 105 ? 15.705 44.231 -3.193  1.00 24.32  ? 174 PHE A C   1 
ATOM   780  O O   . PHE A 1 105 ? 14.744 43.964 -3.916  1.00 31.33  ? 174 PHE A O   1 
ATOM   781  C CB  . PHE A 1 105 ? 16.333 46.547 -2.430  1.00 23.37  ? 174 PHE A CB  1 
ATOM   782  C CG  . PHE A 1 105 ? 14.897 47.012 -2.367  1.00 18.80  ? 174 PHE A CG  1 
ATOM   783  C CD1 . PHE A 1 105 ? 14.340 47.733 -3.413  1.00 24.87  ? 174 PHE A CD1 1 
ATOM   784  C CD2 . PHE A 1 105 ? 14.110 46.736 -1.257  1.00 17.68  ? 174 PHE A CD2 1 
ATOM   785  C CE1 . PHE A 1 105 ? 13.021 48.159 -3.367  1.00 22.38  ? 174 PHE A CE1 1 
ATOM   786  C CE2 . PHE A 1 105 ? 12.789 47.164 -1.198  1.00 20.94  ? 174 PHE A CE2 1 
ATOM   787  C CZ  . PHE A 1 105 ? 12.245 47.877 -2.258  1.00 22.91  ? 174 PHE A CZ  1 
ATOM   788  N N   . GLY A 1 106 ? 16.039 43.491 -2.143  1.00 19.28  ? 175 GLY A N   1 
ATOM   789  C CA  . GLY A 1 106 ? 15.241 42.347 -1.748  1.00 18.16  ? 175 GLY A CA  1 
ATOM   790  C C   . GLY A 1 106 ? 14.135 42.740 -0.788  1.00 22.85  ? 175 GLY A C   1 
ATOM   791  O O   . GLY A 1 106 ? 14.375 43.432 0.207   1.00 30.27  ? 175 GLY A O   1 
ATOM   792  N N   . GLU A 1 107 ? 12.918 42.312 -1.101  1.00 14.59  ? 176 GLU A N   1 
ATOM   793  C CA  . GLU A 1 107 ? 11.803 42.366 -0.160  1.00 22.30  ? 176 GLU A CA  1 
ATOM   794  C C   . GLU A 1 107 ? 11.734 41.013 0.543   1.00 25.33  ? 176 GLU A C   1 
ATOM   795  O O   . GLU A 1 107 ? 11.392 40.000 -0.077  1.00 35.92  ? 176 GLU A O   1 
ATOM   796  C CB  . GLU A 1 107 ? 10.495 42.677 -0.879  1.00 25.18  ? 176 GLU A CB  1 
ATOM   797  C CG  . GLU A 1 107 ? 10.208 44.139 -1.139  1.00 17.12  ? 176 GLU A CG  1 
ATOM   798  C CD  . GLU A 1 107 ? 8.734  44.351 -1.470  1.00 33.80  ? 176 GLU A CD  1 
ATOM   799  O OE1 . GLU A 1 107 ? 8.421  44.658 -2.642  1.00 36.19  ? 176 GLU A OE1 1 
ATOM   800  O OE2 . GLU A 1 107 ? 7.886  44.181 -0.563  1.00 31.37  ? 176 GLU A OE2 1 
ATOM   801  N N   . VAL A 1 108 ? 12.054 40.992 1.830   1.00 17.78  ? 177 VAL A N   1 
ATOM   802  C CA  . VAL A 1 108 ? 12.329 39.748 2.541   1.00 24.61  ? 177 VAL A CA  1 
ATOM   803  C C   . VAL A 1 108 ? 11.047 39.227 3.186   1.00 26.24  ? 177 VAL A C   1 
ATOM   804  O O   . VAL A 1 108 ? 10.351 39.958 3.901   1.00 24.56  ? 177 VAL A O   1 
ATOM   805  C CB  . VAL A 1 108 ? 13.440 39.959 3.585   1.00 29.38  ? 177 VAL A CB  1 
ATOM   806  C CG1 . VAL A 1 108 ? 13.376 38.908 4.677   1.00 24.75  ? 177 VAL A CG1 1 
ATOM   807  C CG2 . VAL A 1 108 ? 14.797 39.944 2.906   1.00 17.08  ? 177 VAL A CG2 1 
ATOM   808  N N   . THR A 1 109 ? 10.733 37.958 2.931   1.00 24.91  ? 178 THR A N   1 
ATOM   809  C CA  . THR A 1 109 ? 9.529  37.333 3.460   1.00 28.59  ? 178 THR A CA  1 
ATOM   810  C C   . THR A 1 109 ? 9.819  36.216 4.452   1.00 35.64  ? 178 THR A C   1 
ATOM   811  O O   . THR A 1 109 ? 8.879  35.634 4.998   1.00 43.42  ? 178 THR A O   1 
ATOM   812  C CB  . THR A 1 109 ? 8.663  36.787 2.319   1.00 30.42  ? 178 THR A CB  1 
ATOM   813  O OG1 . THR A 1 109 ? 9.440  35.904 1.498   1.00 30.33  ? 178 THR A OG1 1 
ATOM   814  C CG2 . THR A 1 109 ? 8.142  37.925 1.471   1.00 34.95  ? 178 THR A CG2 1 
ATOM   815  N N   . GLU A 1 110 ? 11.085 35.891 4.695   1.00 39.41  ? 179 GLU A N   1 
ATOM   816  C CA  . GLU A 1 110 ? 11.456 34.894 5.696   1.00 36.24  ? 179 GLU A CA  1 
ATOM   817  C C   . GLU A 1 110 ? 12.605 35.470 6.511   1.00 39.01  ? 179 GLU A C   1 
ATOM   818  O O   . GLU A 1 110 ? 13.747 35.498 6.042   1.00 38.44  ? 179 GLU A O   1 
ATOM   819  C CB  . GLU A 1 110 ? 11.838 33.573 5.048   1.00 42.79  ? 179 GLU A CB  1 
ATOM   820  C CG  . GLU A 1 110 ? 10.728 32.974 4.219   1.00 53.73  ? 179 GLU A CG  1 
ATOM   821  C CD  . GLU A 1 110 ? 11.102 31.634 3.644   1.00 65.52  ? 179 GLU A CD  1 
ATOM   822  O OE1 . GLU A 1 110 ? 10.181 30.883 3.259   1.00 59.86  ? 179 GLU A OE1 1 
ATOM   823  O OE2 . GLU A 1 110 ? 12.315 31.337 3.579   1.00 72.74  ? 179 GLU A OE2 1 
ATOM   824  N N   . MET A 1 111 ? 12.285 35.945 7.715   1.00 44.71  ? 180 MET A N   1 
ATOM   825  C CA  . MET A 1 111 ? 13.261 36.430 8.683   1.00 38.93  ? 180 MET A CA  1 
ATOM   826  C C   . MET A 1 111 ? 13.253 35.514 9.896   1.00 36.96  ? 180 MET A C   1 
ATOM   827  O O   . MET A 1 111 ? 12.290 35.549 10.681  1.00 41.97  ? 180 MET A O   1 
ATOM   828  C CB  . MET A 1 111 ? 12.935 37.862 9.105   1.00 41.08  ? 180 MET A CB  1 
ATOM   829  C CG  . MET A 1 111 ? 13.471 38.920 8.184   1.00 36.03  ? 180 MET A CG  1 
ATOM   830  S SD  . MET A 1 111 ? 13.567 40.509 9.008   1.00 41.33  ? 180 MET A SD  1 
ATOM   831  C CE  . MET A 1 111 ? 11.857 40.792 9.369   1.00 32.52  ? 180 MET A CE  1 
ATOM   832  N N   . PRO A 1 112 ? 14.282 34.692 10.102  1.00 27.76  ? 181 PRO A N   1 
ATOM   833  C CA  . PRO A 1 112 ? 14.301 33.817 11.280  1.00 26.69  ? 181 PRO A CA  1 
ATOM   834  C C   . PRO A 1 112 ? 14.505 34.612 12.565  1.00 27.47  ? 181 PRO A C   1 
ATOM   835  O O   . PRO A 1 112 ? 15.140 35.669 12.575  1.00 32.10  ? 181 PRO A O   1 
ATOM   836  C CB  . PRO A 1 112 ? 15.484 32.880 11.004  1.00 15.96  ? 181 PRO A CB  1 
ATOM   837  C CG  . PRO A 1 112 ? 16.382 33.673 10.112  1.00 17.52  ? 181 PRO A CG  1 
ATOM   838  C CD  . PRO A 1 112 ? 15.480 34.524 9.262   1.00 21.92  ? 181 PRO A CD  1 
ATOM   839  N N   . ALA A 1 113 ? 13.947 34.086 13.662  1.00 28.76  ? 182 ALA A N   1 
ATOM   840  C CA  . ALA A 1 113 ? 14.030 34.781 14.945  1.00 29.55  ? 182 ALA A CA  1 
ATOM   841  C C   . ALA A 1 113 ? 15.476 34.881 15.429  1.00 33.92  ? 182 ALA A C   1 
ATOM   842  O O   . ALA A 1 113 ? 15.915 35.936 15.900  1.00 36.96  ? 182 ALA A O   1 
ATOM   843  C CB  . ALA A 1 113 ? 13.151 34.081 15.984  1.00 20.49  ? 182 ALA A CB  1 
ATOM   844  N N   . LEU A 1 114 ? 16.230 33.786 15.333  1.00 23.65  ? 183 LEU A N   1 
ATOM   845  C CA  . LEU A 1 114 ? 17.674 33.847 15.506  1.00 26.44  ? 183 LEU A CA  1 
ATOM   846  C C   . LEU A 1 114 ? 18.290 34.117 14.139  1.00 34.61  ? 183 LEU A C   1 
ATOM   847  O O   . LEU A 1 114 ? 18.262 33.226 13.275  1.00 38.40  ? 183 LEU A O   1 
ATOM   848  C CB  . LEU A 1 114 ? 18.208 32.548 16.093  1.00 25.74  ? 183 LEU A CB  1 
ATOM   849  C CG  . LEU A 1 114 ? 19.722 32.469 16.319  1.00 34.86  ? 183 LEU A CG  1 
ATOM   850  C CD1 . LEU A 1 114 ? 20.178 33.414 17.417  1.00 26.57  ? 183 LEU A CD1 1 
ATOM   851  C CD2 . LEU A 1 114 ? 20.137 31.043 16.652  1.00 39.45  ? 183 LEU A CD2 1 
ATOM   852  N N   . PRO A 1 115 ? 18.874 35.305 13.896  1.00 32.37  ? 184 PRO A N   1 
ATOM   853  C CA  . PRO A 1 115 ? 19.165 36.339 14.891  1.00 28.05  ? 184 PRO A CA  1 
ATOM   854  C C   . PRO A 1 115 ? 18.291 37.595 14.861  1.00 22.54  ? 184 PRO A C   1 
ATOM   855  O O   . PRO A 1 115 ? 18.451 38.447 15.734  1.00 21.30  ? 184 PRO A O   1 
ATOM   856  C CB  . PRO A 1 115 ? 20.595 36.724 14.530  1.00 31.20  ? 184 PRO A CB  1 
ATOM   857  C CG  . PRO A 1 115 ? 20.573 36.662 13.005  1.00 23.63  ? 184 PRO A CG  1 
ATOM   858  C CD  . PRO A 1 115 ? 19.538 35.612 12.617  1.00 23.11  ? 184 PRO A CD  1 
ATOM   859  N N   . PHE A 1 116 ? 17.394 37.726 13.885  1.00 19.38  ? 185 PHE A N   1 
ATOM   860  C CA  . PHE A 1 116 ? 16.807 39.035 13.621  1.00 18.04  ? 185 PHE A CA  1 
ATOM   861  C C   . PHE A 1 116 ? 15.817 39.497 14.686  1.00 22.24  ? 185 PHE A C   1 
ATOM   862  O O   . PHE A 1 116 ? 15.459 40.678 14.691  1.00 23.16  ? 185 PHE A O   1 
ATOM   863  C CB  . PHE A 1 116 ? 16.164 39.025 12.241  1.00 20.13  ? 185 PHE A CB  1 
ATOM   864  C CG  . PHE A 1 116 ? 17.161 38.834 11.142  1.00 20.05  ? 185 PHE A CG  1 
ATOM   865  C CD1 . PHE A 1 116 ? 17.992 39.875 10.759  1.00 20.00  ? 185 PHE A CD1 1 
ATOM   866  C CD2 . PHE A 1 116 ? 17.308 37.605 10.526  1.00 23.97  ? 185 PHE A CD2 1 
ATOM   867  C CE1 . PHE A 1 116 ? 18.931 39.705 9.761   1.00 22.93  ? 185 PHE A CE1 1 
ATOM   868  C CE2 . PHE A 1 116 ? 18.250 37.429 9.527   1.00 32.10  ? 185 PHE A CE2 1 
ATOM   869  C CZ  . PHE A 1 116 ? 19.059 38.483 9.142   1.00 27.74  ? 185 PHE A CZ  1 
ATOM   870  N N   . MET A 1 117 ? 15.387 38.626 15.600  1.00 22.92  ? 186 MET A N   1 
ATOM   871  C CA  . MET A 1 117 ? 14.599 39.097 16.735  1.00 25.53  ? 186 MET A CA  1 
ATOM   872  C C   . MET A 1 117 ? 15.437 39.858 17.757  1.00 30.44  ? 186 MET A C   1 
ATOM   873  O O   . MET A 1 117 ? 14.873 40.374 18.727  1.00 31.85  ? 186 MET A O   1 
ATOM   874  C CB  . MET A 1 117 ? 13.891 37.925 17.422  1.00 23.42  ? 186 MET A CB  1 
ATOM   875  C CG  . MET A 1 117 ? 12.520 37.635 16.856  1.00 24.10  ? 186 MET A CG  1 
ATOM   876  S SD  . MET A 1 117 ? 11.475 39.108 16.854  1.00 30.24  ? 186 MET A SD  1 
ATOM   877  C CE  . MET A 1 117 ? 10.968 39.174 18.571  1.00 25.90  ? 186 MET A CE  1 
ATOM   878  N N   . LEU A 1 118 ? 16.758 39.916 17.569  1.00 25.60  ? 187 LEU A N   1 
ATOM   879  C CA  . LEU A 1 118 ? 17.665 40.715 18.382  1.00 25.57  ? 187 LEU A CA  1 
ATOM   880  C C   . LEU A 1 118 ? 18.203 41.924 17.631  1.00 34.55  ? 187 LEU A C   1 
ATOM   881  O O   . LEU A 1 118 ? 19.125 42.587 18.116  1.00 38.78  ? 187 LEU A O   1 
ATOM   882  C CB  . LEU A 1 118 ? 18.835 39.866 18.880  1.00 21.10  ? 187 LEU A CB  1 
ATOM   883  C CG  . LEU A 1 118 ? 18.534 38.434 19.312  1.00 20.20  ? 187 LEU A CG  1 
ATOM   884  C CD1 . LEU A 1 118 ? 19.833 37.651 19.366  1.00 12.64  ? 187 LEU A CD1 1 
ATOM   885  C CD2 . LEU A 1 118 ? 17.794 38.405 20.657  1.00 25.97  ? 187 LEU A CD2 1 
ATOM   886  N N   . ALA A 1 119 ? 17.664 42.219 16.455  1.00 30.70  ? 188 ALA A N   1 
ATOM   887  C CA  . ALA A 1 119 ? 18.152 43.320 15.639  1.00 28.17  ? 188 ALA A CA  1 
ATOM   888  C C   . ALA A 1 119 ? 17.375 44.584 15.978  1.00 32.56  ? 188 ALA A C   1 
ATOM   889  O O   . ALA A 1 119 ? 16.141 44.602 15.901  1.00 29.61  ? 188 ALA A O   1 
ATOM   890  C CB  . ALA A 1 119 ? 18.019 42.987 14.155  1.00 28.13  ? 188 ALA A CB  1 
ATOM   891  N N   . GLU A 1 120 ? 18.092 45.631 16.375  1.00 30.52  ? 189 GLU A N   1 
ATOM   892  C CA  . GLU A 1 120 ? 17.476 46.942 16.503  1.00 23.22  ? 189 GLU A CA  1 
ATOM   893  C C   . GLU A 1 120 ? 17.285 47.609 15.153  1.00 25.17  ? 189 GLU A C   1 
ATOM   894  O O   . GLU A 1 120 ? 16.692 48.689 15.086  1.00 32.74  ? 189 GLU A O   1 
ATOM   895  C CB  . GLU A 1 120 ? 18.322 47.841 17.408  1.00 20.82  ? 189 GLU A CB  1 
ATOM   896  C CG  . GLU A 1 120 ? 18.636 47.237 18.760  1.00 25.04  ? 189 GLU A CG  1 
ATOM   897  C CD  . GLU A 1 120 ? 17.386 46.979 19.567  1.00 41.24  ? 189 GLU A CD  1 
ATOM   898  O OE1 . GLU A 1 120 ? 16.548 47.899 19.658  1.00 43.55  ? 189 GLU A OE1 1 
ATOM   899  O OE2 . GLU A 1 120 ? 17.236 45.860 20.103  1.00 45.32  ? 189 GLU A OE2 1 
ATOM   900  N N   . PHE A 1 121 ? 17.792 47.003 14.091  1.00 30.53  ? 190 PHE A N   1 
ATOM   901  C CA  . PHE A 1 121 ? 17.662 47.511 12.737  1.00 31.27  ? 190 PHE A CA  1 
ATOM   902  C C   . PHE A 1 121 ? 16.631 46.684 11.981  1.00 29.59  ? 190 PHE A C   1 
ATOM   903  O O   . PHE A 1 121 ? 16.192 45.618 12.429  1.00 20.25  ? 190 PHE A O   1 
ATOM   904  C CB  . PHE A 1 121 ? 19.013 47.476 12.015  1.00 20.16  ? 190 PHE A CB  1 
ATOM   905  C CG  . PHE A 1 121 ? 19.653 46.126 12.017  1.00 18.29  ? 190 PHE A CG  1 
ATOM   906  C CD1 . PHE A 1 121 ? 20.496 45.751 13.044  1.00 11.67  ? 190 PHE A CD1 1 
ATOM   907  C CD2 . PHE A 1 121 ? 19.386 45.220 11.007  1.00 11.71  ? 190 PHE A CD2 1 
ATOM   908  C CE1 . PHE A 1 121 ? 21.074 44.506 13.055  1.00 19.50  ? 190 PHE A CE1 1 
ATOM   909  C CE2 . PHE A 1 121 ? 19.957 43.970 11.013  1.00 14.14  ? 190 PHE A CE2 1 
ATOM   910  C CZ  . PHE A 1 121 ? 20.804 43.611 12.034  1.00 16.79  ? 190 PHE A CZ  1 
ATOM   911  N N   . ASP A 1 122 ? 16.255 47.190 10.808  1.00 26.66  ? 191 ASP A N   1 
ATOM   912  C CA  . ASP A 1 122 ? 15.249 46.552 9.972   1.00 29.06  ? 191 ASP A CA  1 
ATOM   913  C C   . ASP A 1 122 ? 15.873 45.725 8.857   1.00 26.48  ? 191 ASP A C   1 
ATOM   914  O O   . ASP A 1 122 ? 15.509 44.559 8.665   1.00 16.41  ? 191 ASP A O   1 
ATOM   915  C CB  . ASP A 1 122 ? 14.307 47.611 9.382   1.00 28.66  ? 191 ASP A CB  1 
ATOM   916  C CG  . ASP A 1 122 ? 13.540 48.376 10.453  1.00 30.40  ? 191 ASP A CG  1 
ATOM   917  O OD1 . ASP A 1 122 ? 12.816 47.733 11.241  1.00 32.36  ? 191 ASP A OD1 1 
ATOM   918  O OD2 . ASP A 1 122 ? 13.656 49.621 10.505  1.00 28.54  ? 191 ASP A OD2 1 
ATOM   919  N N   . GLY A 1 123 ? 16.814 46.306 8.123   1.00 22.52  ? 192 GLY A N   1 
ATOM   920  C CA  . GLY A 1 123 ? 17.425 45.624 7.004   1.00 18.74  ? 192 GLY A CA  1 
ATOM   921  C C   . GLY A 1 123 ? 18.881 45.993 6.825   1.00 26.99  ? 192 GLY A C   1 
ATOM   922  O O   . GLY A 1 123 ? 19.494 46.591 7.714   1.00 27.06  ? 192 GLY A O   1 
ATOM   923  N N   . VAL A 1 124 ? 19.443 45.640 5.676   1.00 11.90  ? 193 VAL A N   1 
ATOM   924  C CA  . VAL A 1 124 ? 20.868 45.783 5.415   1.00 18.70  ? 193 VAL A CA  1 
ATOM   925  C C   . VAL A 1 124 ? 21.060 46.473 4.070   1.00 26.23  ? 193 VAL A C   1 
ATOM   926  O O   . VAL A 1 124 ? 20.328 46.213 3.106   1.00 19.66  ? 193 VAL A O   1 
ATOM   927  C CB  . VAL A 1 124 ? 21.589 44.417 5.436   1.00 22.14  ? 193 VAL A CB  1 
ATOM   928  C CG1 . VAL A 1 124 ? 23.069 44.590 5.151   1.00 30.76  ? 193 VAL A CG1 1 
ATOM   929  C CG2 . VAL A 1 124 ? 21.386 43.727 6.778   1.00 15.32  ? 193 VAL A CG2 1 
ATOM   930  N N   . VAL A 1 125 ? 22.027 47.378 4.021   1.00 15.12  ? 194 VAL A N   1 
ATOM   931  C CA  . VAL A 1 125 ? 22.471 48.002 2.787   1.00 20.09  ? 194 VAL A CA  1 
ATOM   932  C C   . VAL A 1 125 ? 23.873 47.478 2.531   1.00 23.30  ? 194 VAL A C   1 
ATOM   933  O O   . VAL A 1 125 ? 24.818 47.845 3.239   1.00 18.39  ? 194 VAL A O   1 
ATOM   934  C CB  . VAL A 1 125 ? 22.448 49.534 2.874   1.00 21.50  ? 194 VAL A CB  1 
ATOM   935  C CG1 . VAL A 1 125 ? 23.212 50.141 1.703   1.00 18.40  ? 194 VAL A CG1 1 
ATOM   936  C CG2 . VAL A 1 125 ? 21.011 50.043 2.908   1.00 15.67  ? 194 VAL A CG2 1 
ATOM   937  N N   . GLY A 1 126 ? 24.008 46.605 1.537   1.00 30.78  ? 195 GLY A N   1 
ATOM   938  C CA  . GLY A 1 126 ? 25.304 46.012 1.248   1.00 27.42  ? 195 GLY A CA  1 
ATOM   939  C C   . GLY A 1 126 ? 26.216 46.999 0.544   1.00 18.71  ? 195 GLY A C   1 
ATOM   940  O O   . GLY A 1 126 ? 25.828 47.622 -0.451  1.00 27.85  ? 195 GLY A O   1 
ATOM   941  N N   . MET A 1 127 ? 27.444 47.140 1.052   1.00 22.42  ? 196 MET A N   1 
ATOM   942  C CA  . MET A 1 127 ? 28.432 48.060 0.495   1.00 19.95  ? 196 MET A CA  1 
ATOM   943  C C   . MET A 1 127 ? 29.582 47.340 -0.204  1.00 19.58  ? 196 MET A C   1 
ATOM   944  O O   . MET A 1 127 ? 30.595 47.974 -0.523  1.00 14.68  ? 196 MET A O   1 
ATOM   945  C CB  . MET A 1 127 ? 28.990 48.974 1.590   1.00 22.95  ? 196 MET A CB  1 
ATOM   946  C CG  . MET A 1 127 ? 27.945 49.779 2.343   1.00 30.22  ? 196 MET A CG  1 
ATOM   947  S SD  . MET A 1 127 ? 27.142 51.022 1.313   1.00 31.74  ? 196 MET A SD  1 
ATOM   948  C CE  . MET A 1 127 ? 28.432 52.257 1.178   1.00 32.16  ? 196 MET A CE  1 
ATOM   949  N N   . GLY A 1 128 ? 29.460 46.036 -0.436  1.00 16.45  ? 197 GLY A N   1 
ATOM   950  C CA  . GLY A 1 128 ? 30.466 45.290 -1.159  1.00 18.07  ? 197 GLY A CA  1 
ATOM   951  C C   . GLY A 1 128 ? 30.351 45.480 -2.661  1.00 22.70  ? 197 GLY A C   1 
ATOM   952  O O   . GLY A 1 128 ? 29.657 46.366 -3.163  1.00 21.36  ? 197 GLY A O   1 
ATOM   953  N N   . PHE A 1 129 ? 31.069 44.627 -3.386  1.00 17.58  ? 198 PHE A N   1 
ATOM   954  C CA  . PHE A 1 129 ? 31.161 44.710 -4.835  1.00 26.83  ? 198 PHE A CA  1 
ATOM   955  C C   . PHE A 1 129 ? 30.118 43.808 -5.489  1.00 35.00  ? 198 PHE A C   1 
ATOM   956  O O   . PHE A 1 129 ? 29.603 42.869 -4.877  1.00 34.92  ? 198 PHE A O   1 
ATOM   957  C CB  . PHE A 1 129 ? 32.553 44.296 -5.324  1.00 33.51  ? 198 PHE A CB  1 
ATOM   958  C CG  . PHE A 1 129 ? 33.670 45.208 -4.893  1.00 28.93  ? 198 PHE A CG  1 
ATOM   959  C CD1 . PHE A 1 129 ? 34.198 45.133 -3.612  1.00 27.77  ? 198 PHE A CD1 1 
ATOM   960  C CD2 . PHE A 1 129 ? 34.233 46.107 -5.791  1.00 35.96  ? 198 PHE A CD2 1 
ATOM   961  C CE1 . PHE A 1 129 ? 35.249 45.964 -3.223  1.00 38.46  ? 198 PHE A CE1 1 
ATOM   962  C CE2 . PHE A 1 129 ? 35.284 46.944 -5.410  1.00 35.28  ? 198 PHE A CE2 1 
ATOM   963  C CZ  . PHE A 1 129 ? 35.795 46.870 -4.126  1.00 29.38  ? 198 PHE A CZ  1 
ATOM   964  N N   . ILE A 1 130 ? 29.841 44.080 -6.769  1.00 33.57  ? 199 ILE A N   1 
ATOM   965  C CA  . ILE A 1 130 ? 28.873 43.274 -7.507  1.00 36.26  ? 199 ILE A CA  1 
ATOM   966  C C   . ILE A 1 130 ? 29.321 41.826 -7.633  1.00 36.35  ? 199 ILE A C   1 
ATOM   967  O O   . ILE A 1 130 ? 28.490 40.942 -7.866  1.00 46.07  ? 199 ILE A O   1 
ATOM   968  C CB  . ILE A 1 130 ? 28.605 43.884 -8.900  1.00 34.56  ? 199 ILE A CB  1 
ATOM   969  C CG1 . ILE A 1 130 ? 27.262 43.395 -9.449  1.00 32.79  ? 199 ILE A CG1 1 
ATOM   970  C CG2 . ILE A 1 130 ? 29.707 43.512 -9.866  1.00 29.47  ? 199 ILE A CG2 1 
ATOM   971  C CD1 . ILE A 1 130 ? 26.768 44.186 -10.647 1.00 25.43  ? 199 ILE A CD1 1 
ATOM   972  N N   . GLU A 1 131 ? 30.620 41.555 -7.478  1.00 34.40  ? 200 GLU A N   1 
ATOM   973  C CA  . GLU A 1 131 ? 31.113 40.184 -7.569  1.00 33.21  ? 200 GLU A CA  1 
ATOM   974  C C   . GLU A 1 131 ? 30.493 39.287 -6.505  1.00 37.04  ? 200 GLU A C   1 
ATOM   975  O O   . GLU A 1 131 ? 30.383 38.073 -6.707  1.00 44.45  ? 200 GLU A O   1 
ATOM   976  C CB  . GLU A 1 131 ? 32.638 40.167 -7.447  1.00 43.23  ? 200 GLU A CB  1 
ATOM   977  C CG  . GLU A 1 131 ? 33.385 40.516 -8.726  1.00 38.10  ? 200 GLU A CG  1 
ATOM   978  C CD  . GLU A 1 131 ? 33.702 41.993 -8.825  1.00 46.56  ? 200 GLU A CD  1 
ATOM   979  O OE1 . GLU A 1 131 ? 32.949 42.804 -8.238  1.00 46.97  ? 200 GLU A OE1 1 
ATOM   980  O OE2 . GLU A 1 131 ? 34.706 42.342 -9.486  1.00 50.75  ? 200 GLU A OE2 1 
ATOM   981  N N   . GLN A 1 132 ? 30.082 39.858 -5.374  1.00 30.28  ? 201 GLN A N   1 
ATOM   982  C CA  . GLN A 1 132 ? 29.489 39.107 -4.277  1.00 34.56  ? 201 GLN A CA  1 
ATOM   983  C C   . GLN A 1 132 ? 27.971 39.235 -4.219  1.00 35.48  ? 201 GLN A C   1 
ATOM   984  O O   . GLN A 1 132 ? 27.350 38.671 -3.313  1.00 41.99  ? 201 GLN A O   1 
ATOM   985  C CB  . GLN A 1 132 ? 30.083 39.563 -2.936  1.00 36.39  ? 201 GLN A CB  1 
ATOM   986  C CG  . GLN A 1 132 ? 31.587 39.444 -2.822  1.00 37.07  ? 201 GLN A CG  1 
ATOM   987  C CD  . GLN A 1 132 ? 32.025 38.053 -2.432  1.00 62.52  ? 201 GLN A CD  1 
ATOM   988  O OE1 . GLN A 1 132 ? 32.071 37.150 -3.266  1.00 77.25  ? 201 GLN A OE1 1 
ATOM   989  N NE2 . GLN A 1 132 ? 32.344 37.869 -1.156  1.00 70.49  ? 201 GLN A NE2 1 
ATOM   990  N N   . ALA A 1 133 ? 27.362 39.967 -5.144  1.00 28.13  ? 202 ALA A N   1 
ATOM   991  C CA  . ALA A 1 133 ? 25.935 40.250 -5.066  1.00 27.95  ? 202 ALA A CA  1 
ATOM   992  C C   . ALA A 1 133 ? 25.137 39.059 -5.581  1.00 36.52  ? 202 ALA A C   1 
ATOM   993  O O   . ALA A 1 133 ? 25.334 38.611 -6.716  1.00 46.21  ? 202 ALA A O   1 
ATOM   994  C CB  . ALA A 1 133 ? 25.595 41.510 -5.860  1.00 19.62  ? 202 ALA A CB  1 
ATOM   995  N N   . ILE A 1 134 ? 24.231 38.553 -4.746  1.00 34.89  ? 203 ILE A N   1 
ATOM   996  C CA  . ILE A 1 134 ? 23.337 37.484 -5.164  1.00 32.43  ? 203 ILE A CA  1 
ATOM   997  C C   . ILE A 1 134 ? 22.408 38.001 -6.253  1.00 38.95  ? 203 ILE A C   1 
ATOM   998  O O   . ILE A 1 134 ? 21.887 39.120 -6.173  1.00 40.94  ? 203 ILE A O   1 
ATOM   999  C CB  . ILE A 1 134 ? 22.552 36.955 -3.953  1.00 29.73  ? 203 ILE A CB  1 
ATOM   1000 C CG1 . ILE A 1 134 ? 23.521 36.581 -2.828  1.00 27.69  ? 203 ILE A CG1 1 
ATOM   1001 C CG2 . ILE A 1 134 ? 21.682 35.778 -4.350  1.00 28.16  ? 203 ILE A CG2 1 
ATOM   1002 C CD1 . ILE A 1 134 ? 24.331 35.326 -3.098  1.00 27.94  ? 203 ILE A CD1 1 
ATOM   1003 N N   . GLY A 1 135 ? 22.201 37.187 -7.287  1.00 40.33  ? 204 GLY A N   1 
ATOM   1004 C CA  . GLY A 1 135 ? 21.478 37.647 -8.452  1.00 33.29  ? 204 GLY A CA  1 
ATOM   1005 C C   . GLY A 1 135 ? 22.248 38.605 -9.328  1.00 37.73  ? 204 GLY A C   1 
ATOM   1006 O O   . GLY A 1 135 ? 21.696 39.098 -10.316 1.00 38.82  ? 204 GLY A O   1 
ATOM   1007 N N   . ARG A 1 136 ? 23.516 38.870 -9.004  1.00 37.76  ? 205 ARG A N   1 
ATOM   1008 C CA  . ARG A 1 136 ? 24.349 39.849 -9.706  1.00 45.13  ? 205 ARG A CA  1 
ATOM   1009 C C   . ARG A 1 136 ? 23.685 41.225 -9.765  1.00 41.20  ? 205 ARG A C   1 
ATOM   1010 O O   . ARG A 1 136 ? 23.993 42.036 -10.642 1.00 30.83  ? 205 ARG A O   1 
ATOM   1011 C CB  . ARG A 1 136 ? 24.724 39.362 -11.111 1.00 44.69  ? 205 ARG A CB  1 
ATOM   1012 C CG  . ARG A 1 136 ? 25.695 38.176 -11.117 1.00 68.64  ? 205 ARG A CG  1 
ATOM   1013 C CD  . ARG A 1 136 ? 27.081 38.539 -10.557 1.00 82.14  ? 205 ARG A CD  1 
ATOM   1014 N NE  . ARG A 1 136 ? 28.082 37.519 -10.877 1.00 89.11  ? 205 ARG A NE  1 
ATOM   1015 C CZ  . ARG A 1 136 ? 29.340 37.777 -11.226 1.00 89.07  ? 205 ARG A CZ  1 
ATOM   1016 N NH1 . ARG A 1 136 ? 30.168 36.777 -11.508 1.00 86.32  ? 205 ARG A NH1 1 
ATOM   1017 N NH2 . ARG A 1 136 ? 29.772 39.031 -11.296 1.00 86.04  ? 205 ARG A NH2 1 
ATOM   1018 N N   . VAL A 1 137 ? 22.789 41.497 -8.812  1.00 34.29  ? 206 VAL A N   1 
ATOM   1019 C CA  . VAL A 1 137 ? 22.129 42.793 -8.726  1.00 30.84  ? 206 VAL A CA  1 
ATOM   1020 C C   . VAL A 1 137 ? 23.164 43.889 -8.531  1.00 38.92  ? 206 VAL A C   1 
ATOM   1021 O O   . VAL A 1 137 ? 24.145 43.721 -7.796  1.00 52.57  ? 206 VAL A O   1 
ATOM   1022 C CB  . VAL A 1 137 ? 21.113 42.780 -7.569  1.00 32.80  ? 206 VAL A CB  1 
ATOM   1023 C CG1 . VAL A 1 137 ? 20.455 44.150 -7.392  1.00 19.02  ? 206 VAL A CG1 1 
ATOM   1024 C CG2 . VAL A 1 137 ? 20.072 41.688 -7.781  1.00 27.72  ? 206 VAL A CG2 1 
ATOM   1025 N N   . THR A 1 138 ? 22.948 45.022 -9.183  1.00 34.39  ? 207 THR A N   1 
ATOM   1026 C CA  . THR A 1 138 ? 23.870 46.149 -9.064  1.00 28.83  ? 207 THR A CA  1 
ATOM   1027 C C   . THR A 1 138 ? 23.824 46.734 -7.658  1.00 26.15  ? 207 THR A C   1 
ATOM   1028 O O   . THR A 1 138 ? 22.763 47.207 -7.228  1.00 24.87  ? 207 THR A O   1 
ATOM   1029 C CB  . THR A 1 138 ? 23.528 47.225 -10.092 1.00 25.57  ? 207 THR A CB  1 
ATOM   1030 O OG1 . THR A 1 138 ? 23.718 46.708 -11.414 1.00 27.00  ? 207 THR A OG1 1 
ATOM   1031 C CG2 . THR A 1 138 ? 24.406 48.443 -9.898  1.00 21.88  ? 207 THR A CG2 1 
ATOM   1032 N N   . PRO A 1 139 ? 24.932 46.738 -6.918  1.00 25.37  ? 208 PRO A N   1 
ATOM   1033 C CA  . PRO A 1 139 ? 24.921 47.297 -5.557  1.00 26.51  ? 208 PRO A CA  1 
ATOM   1034 C C   . PRO A 1 139 ? 24.661 48.797 -5.559  1.00 35.45  ? 208 PRO A C   1 
ATOM   1035 O O   . PRO A 1 139 ? 24.799 49.482 -6.577  1.00 33.69  ? 208 PRO A O   1 
ATOM   1036 C CB  . PRO A 1 139 ? 26.326 46.983 -5.028  1.00 33.99  ? 208 PRO A CB  1 
ATOM   1037 C CG  . PRO A 1 139 ? 26.859 45.904 -5.934  1.00 35.24  ? 208 PRO A CG  1 
ATOM   1038 C CD  . PRO A 1 139 ? 26.233 46.153 -7.272  1.00 27.36  ? 208 PRO A CD  1 
ATOM   1039 N N   . ILE A 1 140 ? 24.299 49.312 -4.376  1.00 34.88  ? 209 ILE A N   1 
ATOM   1040 C CA  . ILE A 1 140 ? 23.785 50.678 -4.292  1.00 27.01  ? 209 ILE A CA  1 
ATOM   1041 C C   . ILE A 1 140 ? 24.887 51.711 -4.507  1.00 32.67  ? 209 ILE A C   1 
ATOM   1042 O O   . ILE A 1 140 ? 24.637 52.779 -5.081  1.00 41.34  ? 209 ILE A O   1 
ATOM   1043 C CB  . ILE A 1 140 ? 23.041 50.902 -2.959  1.00 22.92  ? 209 ILE A CB  1 
ATOM   1044 C CG1 . ILE A 1 140 ? 22.231 52.198 -3.009  1.00 14.22  ? 209 ILE A CG1 1 
ATOM   1045 C CG2 . ILE A 1 140 ? 23.993 50.929 -1.783  1.00 16.55  ? 209 ILE A CG2 1 
ATOM   1046 C CD1 . ILE A 1 140 ? 21.324 52.379 -1.832  1.00 20.43  ? 209 ILE A CD1 1 
ATOM   1047 N N   . PHE A 1 141 ? 26.119 51.425 -4.083  1.00 33.01  ? 210 PHE A N   1 
ATOM   1048 C CA  . PHE A 1 141 ? 27.189 52.384 -4.340  1.00 29.80  ? 210 PHE A CA  1 
ATOM   1049 C C   . PHE A 1 141 ? 27.585 52.398 -5.812  1.00 35.42  ? 210 PHE A C   1 
ATOM   1050 O O   . PHE A 1 141 ? 28.078 53.418 -6.307  1.00 42.36  ? 210 PHE A O   1 
ATOM   1051 C CB  . PHE A 1 141 ? 28.402 52.086 -3.463  1.00 15.97  ? 210 PHE A CB  1 
ATOM   1052 C CG  . PHE A 1 141 ? 29.325 53.249 -3.315  1.00 23.19  ? 210 PHE A CG  1 
ATOM   1053 C CD1 . PHE A 1 141 ? 28.939 54.365 -2.588  1.00 24.54  ? 210 PHE A CD1 1 
ATOM   1054 C CD2 . PHE A 1 141 ? 30.578 53.236 -3.911  1.00 30.15  ? 210 PHE A CD2 1 
ATOM   1055 C CE1 . PHE A 1 141 ? 29.791 55.449 -2.449  1.00 19.58  ? 210 PHE A CE1 1 
ATOM   1056 C CE2 . PHE A 1 141 ? 31.435 54.314 -3.779  1.00 31.04  ? 210 PHE A CE2 1 
ATOM   1057 C CZ  . PHE A 1 141 ? 31.039 55.424 -3.049  1.00 30.72  ? 210 PHE A CZ  1 
ATOM   1058 N N   . ASP A 1 142 ? 27.376 51.288 -6.524  1.00 35.81  ? 211 ASP A N   1 
ATOM   1059 C CA  . ASP A 1 142 ? 27.595 51.280 -7.968  1.00 47.90  ? 211 ASP A CA  1 
ATOM   1060 C C   . ASP A 1 142 ? 26.676 52.279 -8.669  1.00 46.18  ? 211 ASP A C   1 
ATOM   1061 O O   . ASP A 1 142 ? 27.129 53.091 -9.488  1.00 37.84  ? 211 ASP A O   1 
ATOM   1062 C CB  . ASP A 1 142 ? 27.379 49.870 -8.519  1.00 55.84  ? 211 ASP A CB  1 
ATOM   1063 C CG  . ASP A 1 142 ? 28.678 49.158 -8.831  1.00 56.40  ? 211 ASP A CG  1 
ATOM   1064 O OD1 . ASP A 1 142 ? 29.656 49.389 -8.103  1.00 54.96  ? 211 ASP A OD1 1 
ATOM   1065 O OD2 . ASP A 1 142 ? 28.723 48.365 -9.797  1.00 62.00  ? 211 ASP A OD2 1 
ATOM   1066 N N   . ASN A 1 143 ? 25.375 52.232 -8.355  1.00 41.71  ? 212 ASN A N   1 
ATOM   1067 C CA  . ASN A 1 143 ? 24.424 53.175 -8.938  1.00 36.68  ? 212 ASN A CA  1 
ATOM   1068 C C   . ASN A 1 143 ? 24.713 54.604 -8.508  1.00 44.25  ? 212 ASN A C   1 
ATOM   1069 O O   . ASN A 1 143 ? 24.471 55.541 -9.278  1.00 47.44  ? 212 ASN A O   1 
ATOM   1070 C CB  . ASN A 1 143 ? 22.995 52.804 -8.542  1.00 34.94  ? 212 ASN A CB  1 
ATOM   1071 C CG  . ASN A 1 143 ? 22.550 51.489 -9.134  1.00 33.35  ? 212 ASN A CG  1 
ATOM   1072 O OD1 . ASN A 1 143 ? 22.853 51.176 -10.288 1.00 41.62  ? 212 ASN A OD1 1 
ATOM   1073 N ND2 . ASN A 1 143 ? 21.828 50.704 -8.345  1.00 23.96  ? 212 ASN A ND2 1 
ATOM   1074 N N   . ILE A 1 144 ? 25.206 54.794 -7.280  1.00 46.75  ? 213 ILE A N   1 
ATOM   1075 C CA  . ILE A 1 144 ? 25.547 56.137 -6.823  1.00 42.06  ? 213 ILE A CA  1 
ATOM   1076 C C   . ILE A 1 144 ? 26.752 56.668 -7.586  1.00 41.96  ? 213 ILE A C   1 
ATOM   1077 O O   . ILE A 1 144 ? 26.778 57.835 -7.996  1.00 54.73  ? 213 ILE A O   1 
ATOM   1078 C CB  . ILE A 1 144 ? 25.783 56.144 -5.303  1.00 40.34  ? 213 ILE A CB  1 
ATOM   1079 C CG1 . ILE A 1 144 ? 24.460 55.945 -4.559  1.00 37.21  ? 213 ILE A CG1 1 
ATOM   1080 C CG2 . ILE A 1 144 ? 26.431 57.449 -4.874  1.00 31.47  ? 213 ILE A CG2 1 
ATOM   1081 C CD1 . ILE A 1 144 ? 24.598 55.974 -3.050  1.00 37.09  ? 213 ILE A CD1 1 
ATOM   1082 N N   . ILE A 1 145 ? 27.763 55.820 -7.802  1.00 28.05  ? 214 ILE A N   1 
ATOM   1083 C CA  . ILE A 1 145 ? 28.888 56.217 -8.644  1.00 42.56  ? 214 ILE A CA  1 
ATOM   1084 C C   . ILE A 1 145 ? 28.403 56.557 -10.048 1.00 43.53  ? 214 ILE A C   1 
ATOM   1085 O O   . ILE A 1 145 ? 28.900 57.493 -10.686 1.00 43.24  ? 214 ILE A O   1 
ATOM   1086 C CB  . ILE A 1 145 ? 29.959 55.111 -8.665  1.00 42.49  ? 214 ILE A CB  1 
ATOM   1087 C CG1 . ILE A 1 145 ? 30.718 55.064 -7.336  1.00 36.28  ? 214 ILE A CG1 1 
ATOM   1088 C CG2 . ILE A 1 145 ? 30.933 55.333 -9.805  1.00 32.01  ? 214 ILE A CG2 1 
ATOM   1089 C CD1 . ILE A 1 145 ? 31.672 53.888 -7.222  1.00 25.03  ? 214 ILE A CD1 1 
ATOM   1090 N N   . SER A 1 146 ? 27.404 55.819 -10.539 1.00 42.20  ? 215 SER A N   1 
ATOM   1091 C CA  . SER A 1 146 ? 26.877 56.056 -11.877 1.00 37.58  ? 215 SER A CA  1 
ATOM   1092 C C   . SER A 1 146 ? 26.266 57.438 -12.027 1.00 39.87  ? 215 SER A C   1 
ATOM   1093 O O   . SER A 1 146 ? 26.117 57.917 -13.154 1.00 50.44  ? 215 SER A O   1 
ATOM   1094 C CB  . SER A 1 146 ? 25.824 55.005 -12.223 1.00 35.44  ? 215 SER A CB  1 
ATOM   1095 O OG  . SER A 1 146 ? 26.425 53.799 -12.644 1.00 42.22  ? 215 SER A OG  1 
ATOM   1096 N N   . GLN A 1 147 ? 25.901 58.088 -10.928 1.00 33.27  ? 216 GLN A N   1 
ATOM   1097 C CA  . GLN A 1 147 ? 25.245 59.383 -11.014 1.00 30.03  ? 216 GLN A CA  1 
ATOM   1098 C C   . GLN A 1 147 ? 26.219 60.543 -11.148 1.00 41.50  ? 216 GLN A C   1 
ATOM   1099 O O   . GLN A 1 147 ? 25.770 61.685 -11.297 1.00 49.87  ? 216 GLN A O   1 
ATOM   1100 C CB  . GLN A 1 147 ? 24.357 59.602 -9.790  1.00 21.96  ? 216 GLN A CB  1 
ATOM   1101 C CG  . GLN A 1 147 ? 23.234 58.599 -9.687  1.00 31.06  ? 216 GLN A CG  1 
ATOM   1102 C CD  . GLN A 1 147 ? 22.220 58.994 -8.655  1.00 42.87  ? 216 GLN A CD  1 
ATOM   1103 O OE1 . GLN A 1 147 ? 22.543 59.691 -7.696  1.00 56.81  ? 216 GLN A OE1 1 
ATOM   1104 N NE2 . GLN A 1 147 ? 20.982 58.555 -8.839  1.00 47.39  ? 216 GLN A NE2 1 
ATOM   1105 N N   . GLY A 1 148 ? 27.525 60.288 -11.093 1.00 41.61  ? 217 GLY A N   1 
ATOM   1106 C CA  . GLY A 1 148 ? 28.502 61.356 -11.238 1.00 49.86  ? 217 GLY A CA  1 
ATOM   1107 C C   . GLY A 1 148 ? 28.320 62.501 -10.268 1.00 53.07  ? 217 GLY A C   1 
ATOM   1108 O O   . GLY A 1 148 ? 28.620 63.651 -10.606 1.00 58.54  ? 217 GLY A O   1 
ATOM   1109 N N   . VAL A 1 149 ? 27.842 62.215 -9.059  1.00 45.52  ? 218 VAL A N   1 
ATOM   1110 C CA  . VAL A 1 149 ? 27.589 63.246 -8.072  1.00 35.86  ? 218 VAL A CA  1 
ATOM   1111 C C   . VAL A 1 149 ? 28.635 63.268 -6.962  1.00 35.33  ? 218 VAL A C   1 
ATOM   1112 O O   . VAL A 1 149 ? 28.900 64.338 -6.401  1.00 35.89  ? 218 VAL A O   1 
ATOM   1113 C CB  . VAL A 1 149 ? 26.174 63.077 -7.484  1.00 34.33  ? 218 VAL A CB  1 
ATOM   1114 C CG1 . VAL A 1 149 ? 25.128 63.259 -8.568  1.00 40.86  ? 218 VAL A CG1 1 
ATOM   1115 C CG2 . VAL A 1 149 ? 26.035 61.711 -6.834  1.00 32.69  ? 218 VAL A CG2 1 
ATOM   1116 N N   . LEU A 1 150 ? 29.241 62.133 -6.633  1.00 36.21  ? 219 LEU A N   1 
ATOM   1117 C CA  . LEU A 1 150 ? 30.202 62.098 -5.542  1.00 40.10  ? 219 LEU A CA  1 
ATOM   1118 C C   . LEU A 1 150 ? 31.449 62.893 -5.901  1.00 47.97  ? 219 LEU A C   1 
ATOM   1119 O O   . LEU A 1 150 ? 31.922 62.854 -7.040  1.00 51.44  ? 219 LEU A O   1 
ATOM   1120 C CB  . LEU A 1 150 ? 30.591 60.657 -5.215  1.00 34.59  ? 219 LEU A CB  1 
ATOM   1121 C CG  . LEU A 1 150 ? 29.445 59.690 -4.924  1.00 34.04  ? 219 LEU A CG  1 
ATOM   1122 C CD1 . LEU A 1 150 ? 29.938 58.258 -5.015  1.00 24.11  ? 219 LEU A CD1 1 
ATOM   1123 C CD2 . LEU A 1 150 ? 28.838 59.973 -3.561  1.00 30.29  ? 219 LEU A CD2 1 
ATOM   1124 N N   . LYS A 1 151 ? 31.986 63.618 -4.916  1.00 44.04  ? 220 LYS A N   1 
ATOM   1125 C CA  . LYS A 1 151 ? 33.263 64.288 -5.128  1.00 46.19  ? 220 LYS A CA  1 
ATOM   1126 C C   . LYS A 1 151 ? 34.358 63.280 -5.447  1.00 49.91  ? 220 LYS A C   1 
ATOM   1127 O O   . LYS A 1 151 ? 35.169 63.501 -6.353  1.00 50.21  ? 220 LYS A O   1 
ATOM   1128 C CB  . LYS A 1 151 ? 33.623 65.130 -3.905  1.00 46.08  ? 220 LYS A CB  1 
ATOM   1129 C CG  . LYS A 1 151 ? 35.069 65.587 -3.845  1.00 56.41  ? 220 LYS A CG  1 
ATOM   1130 C CD  . LYS A 1 151 ? 35.384 66.195 -2.488  1.00 60.81  ? 220 LYS A CD  1 
ATOM   1131 C CE  . LYS A 1 151 ? 36.037 67.551 -2.650  1.00 68.81  ? 220 LYS A CE  1 
ATOM   1132 N NZ  . LYS A 1 151 ? 35.232 68.403 -3.567  1.00 77.88  ? 220 LYS A NZ  1 
ATOM   1133 N N   . GLU A 1 152 ? 34.391 62.161 -4.723  1.00 51.44  ? 221 GLU A N   1 
ATOM   1134 C CA  . GLU A 1 152 ? 35.312 61.069 -5.010  1.00 46.48  ? 221 GLU A CA  1 
ATOM   1135 C C   . GLU A 1 152 ? 34.582 59.744 -4.845  1.00 45.72  ? 221 GLU A C   1 
ATOM   1136 O O   . GLU A 1 152 ? 33.682 59.619 -4.012  1.00 45.17  ? 221 GLU A O   1 
ATOM   1137 C CB  . GLU A 1 152 ? 36.543 61.104 -4.095  1.00 40.59  ? 221 GLU A CB  1 
ATOM   1138 C CG  . GLU A 1 152 ? 37.327 62.408 -4.124  1.00 50.23  ? 221 GLU A CG  1 
ATOM   1139 C CD  . GLU A 1 152 ? 38.028 62.672 -5.456  1.00 59.45  ? 221 GLU A CD  1 
ATOM   1140 O OE1 . GLU A 1 152 ? 38.059 61.769 -6.326  1.00 56.98  ? 221 GLU A OE1 1 
ATOM   1141 O OE2 . GLU A 1 152 ? 38.562 63.790 -5.625  1.00 57.74  ? 221 GLU A OE2 1 
ATOM   1142 N N   . ASP A 1 153 ? 34.980 58.748 -5.639  1.00 44.96  ? 222 ASP A N   1 
ATOM   1143 C CA  . ASP A 1 153 ? 34.342 57.430 -5.594  1.00 41.48  ? 222 ASP A CA  1 
ATOM   1144 C C   . ASP A 1 153 ? 34.844 56.640 -4.382  1.00 36.41  ? 222 ASP A C   1 
ATOM   1145 O O   . ASP A 1 153 ? 35.501 55.606 -4.494  1.00 36.59  ? 222 ASP A O   1 
ATOM   1146 C CB  . ASP A 1 153 ? 34.585 56.673 -6.894  1.00 47.66  ? 222 ASP A CB  1 
ATOM   1147 C CG  . ASP A 1 153 ? 33.794 57.245 -8.064  1.00 51.99  ? 222 ASP A CG  1 
ATOM   1148 O OD1 . ASP A 1 153 ? 33.023 58.207 -7.855  1.00 54.87  ? 222 ASP A OD1 1 
ATOM   1149 O OD2 . ASP A 1 153 ? 33.954 56.739 -9.197  1.00 48.43  ? 222 ASP A OD2 1 
ATOM   1150 N N   . VAL A 1 154 ? 34.521 57.166 -3.198  1.00 30.23  ? 223 VAL A N   1 
ATOM   1151 C CA  . VAL A 1 154 ? 34.895 56.565 -1.926  1.00 25.90  ? 223 VAL A CA  1 
ATOM   1152 C C   . VAL A 1 154 ? 33.731 56.731 -0.962  1.00 36.82  ? 223 VAL A C   1 
ATOM   1153 O O   . VAL A 1 154 ? 32.834 57.550 -1.168  1.00 45.36  ? 223 VAL A O   1 
ATOM   1154 C CB  . VAL A 1 154 ? 36.163 57.207 -1.303  1.00 26.66  ? 223 VAL A CB  1 
ATOM   1155 C CG1 . VAL A 1 154 ? 37.391 56.959 -2.156  1.00 20.12  ? 223 VAL A CG1 1 
ATOM   1156 C CG2 . VAL A 1 154 ? 35.952 58.682 -1.094  1.00 26.49  ? 223 VAL A CG2 1 
ATOM   1157 N N   . PHE A 1 155 ? 33.762 55.943 0.110   1.00 37.98  ? 224 PHE A N   1 
ATOM   1158 C CA  . PHE A 1 155 ? 32.896 56.156 1.262   1.00 30.81  ? 224 PHE A CA  1 
ATOM   1159 C C   . PHE A 1 155 ? 33.674 55.752 2.506   1.00 34.31  ? 224 PHE A C   1 
ATOM   1160 O O   . PHE A 1 155 ? 34.621 54.963 2.435   1.00 37.58  ? 224 PHE A O   1 
ATOM   1161 C CB  . PHE A 1 155 ? 31.580 55.373 1.148   1.00 28.63  ? 224 PHE A CB  1 
ATOM   1162 C CG  . PHE A 1 155 ? 31.769 53.894 1.011   1.00 21.15  ? 224 PHE A CG  1 
ATOM   1163 C CD1 . PHE A 1 155 ? 31.995 53.326 -0.231  1.00 13.90  ? 224 PHE A CD1 1 
ATOM   1164 C CD2 . PHE A 1 155 ? 31.737 53.073 2.126   1.00 16.55  ? 224 PHE A CD2 1 
ATOM   1165 C CE1 . PHE A 1 155 ? 32.187 51.966 -0.360  1.00 24.46  ? 224 PHE A CE1 1 
ATOM   1166 C CE2 . PHE A 1 155 ? 31.924 51.708 2.003   1.00 23.49  ? 224 PHE A CE2 1 
ATOM   1167 C CZ  . PHE A 1 155 ? 32.151 51.155 0.758   1.00 24.39  ? 224 PHE A CZ  1 
ATOM   1168 N N   . SER A 1 156 ? 33.280 56.301 3.651   1.00 27.05  ? 225 SER A N   1 
ATOM   1169 C CA  . SER A 1 156 ? 34.069 56.112 4.859   1.00 31.12  ? 225 SER A CA  1 
ATOM   1170 C C   . SER A 1 156 ? 33.161 55.941 6.068   1.00 35.47  ? 225 SER A C   1 
ATOM   1171 O O   . SER A 1 156 ? 31.998 56.348 6.066   1.00 30.75  ? 225 SER A O   1 
ATOM   1172 C CB  . SER A 1 156 ? 35.043 57.280 5.084   1.00 30.31  ? 225 SER A CB  1 
ATOM   1173 O OG  . SER A 1 156 ? 34.357 58.503 5.263   1.00 29.57  ? 225 SER A OG  1 
ATOM   1174 N N   . PHE A 1 157 ? 33.724 55.343 7.116   1.00 34.10  ? 226 PHE A N   1 
ATOM   1175 C CA  . PHE A 1 157 ? 32.976 54.921 8.289   1.00 23.91  ? 226 PHE A CA  1 
ATOM   1176 C C   . PHE A 1 157 ? 33.593 55.509 9.546   1.00 31.74  ? 226 PHE A C   1 
ATOM   1177 O O   . PHE A 1 157 ? 34.817 55.615 9.656   1.00 35.83  ? 226 PHE A O   1 
ATOM   1178 C CB  . PHE A 1 157 ? 32.956 53.393 8.416   1.00 28.00  ? 226 PHE A CB  1 
ATOM   1179 C CG  . PHE A 1 157 ? 31.852 52.731 7.657   1.00 25.82  ? 226 PHE A CG  1 
ATOM   1180 C CD1 . PHE A 1 157 ? 31.962 52.518 6.299   1.00 27.27  ? 226 PHE A CD1 1 
ATOM   1181 C CD2 . PHE A 1 157 ? 30.702 52.314 8.308   1.00 33.33  ? 226 PHE A CD2 1 
ATOM   1182 C CE1 . PHE A 1 157 ? 30.942 51.907 5.597   1.00 32.38  ? 226 PHE A CE1 1 
ATOM   1183 C CE2 . PHE A 1 157 ? 29.679 51.702 7.613   1.00 31.99  ? 226 PHE A CE2 1 
ATOM   1184 C CZ  . PHE A 1 157 ? 29.800 51.498 6.257   1.00 29.90  ? 226 PHE A CZ  1 
ATOM   1185 N N   . TYR A 1 158 ? 32.735 55.875 10.496  1.00 35.24  ? 227 TYR A N   1 
ATOM   1186 C CA  . TYR A 1 158 ? 33.156 56.269 11.835  1.00 21.19  ? 227 TYR A CA  1 
ATOM   1187 C C   . TYR A 1 158 ? 32.207 55.622 12.826  1.00 22.12  ? 227 TYR A C   1 
ATOM   1188 O O   . TYR A 1 158 ? 31.000 55.862 12.767  1.00 39.30  ? 227 TYR A O   1 
ATOM   1189 C CB  . TYR A 1 158 ? 33.149 57.789 12.009  1.00 22.05  ? 227 TYR A CB  1 
ATOM   1190 C CG  . TYR A 1 158 ? 33.215 58.238 13.456  1.00 31.75  ? 227 TYR A CG  1 
ATOM   1191 C CD1 . TYR A 1 158 ? 34.398 58.138 14.183  1.00 35.43  ? 227 TYR A CD1 1 
ATOM   1192 C CD2 . TYR A 1 158 ? 32.096 58.763 14.095  1.00 34.46  ? 227 TYR A CD2 1 
ATOM   1193 C CE1 . TYR A 1 158 ? 34.465 58.548 15.502  1.00 39.16  ? 227 TYR A CE1 1 
ATOM   1194 C CE2 . TYR A 1 158 ? 32.153 59.179 15.416  1.00 36.30  ? 227 TYR A CE2 1 
ATOM   1195 C CZ  . TYR A 1 158 ? 33.339 59.068 16.114  1.00 40.37  ? 227 TYR A CZ  1 
ATOM   1196 O OH  . TYR A 1 158 ? 33.402 59.478 17.427  1.00 40.91  ? 227 TYR A OH  1 
ATOM   1197 N N   . TYR A 1 159 ? 32.743 54.799 13.718  1.00 26.36  ? 228 TYR A N   1 
ATOM   1198 C CA  . TYR A 1 159 ? 31.975 54.169 14.783  1.00 17.79  ? 228 TYR A CA  1 
ATOM   1199 C C   . TYR A 1 159 ? 32.467 54.710 16.114  1.00 19.36  ? 228 TYR A C   1 
ATOM   1200 O O   . TYR A 1 159 ? 33.625 54.484 16.484  1.00 29.68  ? 228 TYR A O   1 
ATOM   1201 C CB  . TYR A 1 159 ? 32.125 52.651 14.757  1.00 26.46  ? 228 TYR A CB  1 
ATOM   1202 C CG  . TYR A 1 159 ? 31.381 51.956 13.644  1.00 30.64  ? 228 TYR A CG  1 
ATOM   1203 C CD1 . TYR A 1 159 ? 30.498 52.648 12.830  1.00 17.97  ? 228 TYR A CD1 1 
ATOM   1204 C CD2 . TYR A 1 159 ? 31.566 50.600 13.410  1.00 29.42  ? 228 TYR A CD2 1 
ATOM   1205 C CE1 . TYR A 1 159 ? 29.823 52.005 11.815  1.00 22.40  ? 228 TYR A CE1 1 
ATOM   1206 C CE2 . TYR A 1 159 ? 30.896 49.955 12.402  1.00 22.01  ? 228 TYR A CE2 1 
ATOM   1207 C CZ  . TYR A 1 159 ? 30.025 50.658 11.610  1.00 22.49  ? 228 TYR A CZ  1 
ATOM   1208 O OH  . TYR A 1 159 ? 29.358 50.002 10.604  1.00 25.08  ? 228 TYR A OH  1 
ATOM   1209 N N   . ASN A 1 160 ? 31.590 55.406 16.832  1.00 20.36  ? 229 ASN A N   1 
ATOM   1210 C CA  . ASN A 1 160 ? 31.940 55.961 18.129  1.00 21.21  ? 229 ASN A CA  1 
ATOM   1211 C C   . ASN A 1 160 ? 31.780 54.907 19.218  1.00 21.82  ? 229 ASN A C   1 
ATOM   1212 O O   . ASN A 1 160 ? 31.174 53.851 19.014  1.00 28.93  ? 229 ASN A O   1 
ATOM   1213 C CB  . ASN A 1 160 ? 31.076 57.182 18.441  1.00 27.61  ? 229 ASN A CB  1 
ATOM   1214 C CG  . ASN A 1 160 ? 31.646 58.040 19.559  1.00 38.41  ? 229 ASN A CG  1 
ATOM   1215 O OD1 . ASN A 1 160 ? 32.743 57.784 20.055  1.00 44.70  ? 229 ASN A OD1 1 
ATOM   1216 N ND2 . ASN A 1 160 ? 30.903 59.072 19.957  1.00 34.55  ? 229 ASN A ND2 1 
ATOM   1217 N N   . ARG A 1 161 ? 32.366 55.190 20.379  1.00 34.56  ? 230 ARG A N   1 
ATOM   1218 C CA  . ARG A 1 161 ? 32.177 54.339 21.545  1.00 41.04  ? 230 ARG A CA  1 
ATOM   1219 C C   . ARG A 1 161 ? 30.875 54.713 22.235  1.00 42.44  ? 230 ARG A C   1 
ATOM   1220 O O   . ARG A 1 161 ? 30.516 55.891 22.308  1.00 50.92  ? 230 ARG A O   1 
ATOM   1221 C CB  . ARG A 1 161 ? 33.353 54.475 22.509  1.00 39.12  ? 230 ARG A CB  1 
ATOM   1222 C CG  . ARG A 1 161 ? 34.671 53.984 21.936  1.00 46.18  ? 230 ARG A CG  1 
ATOM   1223 C CD  . ARG A 1 161 ? 35.868 54.519 22.713  1.00 60.21  ? 230 ARG A CD  1 
ATOM   1224 N NE  . ARG A 1 161 ? 37.104 54.388 21.943  1.00 74.55  ? 230 ARG A NE  1 
ATOM   1225 C CZ  . ARG A 1 161 ? 37.542 55.288 21.065  1.00 75.67  ? 230 ARG A CZ  1 
ATOM   1226 N NH1 . ARG A 1 161 ? 38.675 55.075 20.408  1.00 73.26  ? 230 ARG A NH1 1 
ATOM   1227 N NH2 . ARG A 1 161 ? 36.855 56.403 20.848  1.00 71.24  ? 230 ARG A NH2 1 
ATOM   1228 N N   . ASP A 1 162 ? 30.155 53.703 22.721  1.00 44.01  ? 231 ASP A N   1 
ATOM   1229 C CA  . ASP A 1 162 ? 28.837 53.948 23.288  1.00 46.82  ? 231 ASP A CA  1 
ATOM   1230 C C   . ASP A 1 162 ? 28.942 54.811 24.537  1.00 60.88  ? 231 ASP A C   1 
ATOM   1231 O O   . ASP A 1 162 ? 29.770 54.558 25.417  1.00 64.57  ? 231 ASP A O   1 
ATOM   1232 C CB  . ASP A 1 162 ? 28.138 52.633 23.621  1.00 48.32  ? 231 ASP A CB  1 
ATOM   1233 C CG  . ASP A 1 162 ? 26.716 52.846 24.122  1.00 53.02  ? 231 ASP A CG  1 
ATOM   1234 O OD1 . ASP A 1 162 ? 26.123 53.895 23.785  1.00 48.38  ? 231 ASP A OD1 1 
ATOM   1235 O OD2 . ASP A 1 162 ? 26.195 51.973 24.855  1.00 49.89  ? 231 ASP A OD2 1 
ATOM   1236 N N   . SER A 1 163 ? 28.097 55.838 24.602  1.00 69.56  ? 232 SER A N   1 
ATOM   1237 C CA  . SER A 1 163 ? 28.038 56.758 25.728  1.00 72.82  ? 232 SER A CA  1 
ATOM   1238 C C   . SER A 1 163 ? 26.668 56.651 26.381  1.00 89.53  ? 232 SER A C   1 
ATOM   1239 O O   . SER A 1 163 ? 25.641 56.781 25.705  1.00 76.25  ? 232 SER A O   1 
ATOM   1240 C CB  . SER A 1 163 ? 28.303 58.199 25.282  1.00 58.73  ? 232 SER A CB  1 
ATOM   1241 O OG  . SER A 1 163 ? 28.662 59.016 26.381  1.00 48.45  ? 232 SER A OG  1 
ATOM   1242 N N   . GLU A 1 164 ? 26.659 56.409 27.689  1.00 121.69 ? 233 GLU A N   1 
ATOM   1243 C CA  . GLU A 1 164 ? 25.432 56.319 28.468  1.00 125.35 ? 233 GLU A CA  1 
ATOM   1244 C C   . GLU A 1 164 ? 25.174 57.659 29.143  1.00 132.16 ? 233 GLU A C   1 
ATOM   1245 O O   . GLU A 1 164 ? 26.098 58.267 29.694  1.00 131.71 ? 233 GLU A O   1 
ATOM   1246 C CB  . GLU A 1 164 ? 25.523 55.200 29.507  1.00 122.57 ? 233 GLU A CB  1 
ATOM   1247 N N   . ASN A 1 165 ? 23.922 58.118 29.074  1.00 143.00 ? 234 ASN A N   1 
ATOM   1248 C CA  . ASN A 1 165 ? 23.471 59.414 29.580  1.00 149.33 ? 234 ASN A CA  1 
ATOM   1249 C C   . ASN A 1 165 ? 24.109 60.591 28.850  1.00 149.54 ? 234 ASN A C   1 
ATOM   1250 O O   . ASN A 1 165 ? 24.131 61.707 29.377  1.00 159.84 ? 234 ASN A O   1 
ATOM   1251 C CB  . ASN A 1 165 ? 23.698 59.550 31.091  1.00 152.42 ? 234 ASN A CB  1 
ATOM   1252 N N   . SER A 1 166 ? 24.636 60.369 27.647  1.00 120.08 ? 235 SER A N   1 
ATOM   1253 C CA  . SER A 1 166 ? 25.133 61.441 26.798  1.00 96.89  ? 235 SER A CA  1 
ATOM   1254 C C   . SER A 1 166 ? 24.533 61.293 25.407  1.00 100.57 ? 235 SER A C   1 
ATOM   1255 O O   . SER A 1 166 ? 24.168 60.193 24.987  1.00 104.74 ? 235 SER A O   1 
ATOM   1256 C CB  . SER A 1 166 ? 26.667 61.440 26.715  1.00 73.21  ? 235 SER A CB  1 
ATOM   1257 N N   . GLN A 1 167 ? 24.419 62.418 24.700  1.00 96.78  ? 236 GLN A N   1 
ATOM   1258 C CA  . GLN A 1 167 ? 23.921 62.436 23.331  1.00 89.34  ? 236 GLN A CA  1 
ATOM   1259 C C   . GLN A 1 167 ? 25.046 62.407 22.300  1.00 84.69  ? 236 GLN A C   1 
ATOM   1260 O O   . GLN A 1 167 ? 24.874 62.931 21.192  1.00 75.95  ? 236 GLN A O   1 
ATOM   1261 C CB  . GLN A 1 167 ? 23.033 63.662 23.106  1.00 84.03  ? 236 GLN A CB  1 
ATOM   1262 N N   . SER A 1 168 ? 26.195 61.826 22.652  1.00 81.28  ? 237 SER A N   1 
ATOM   1263 C CA  . SER A 1 168 ? 27.326 61.744 21.738  1.00 74.39  ? 237 SER A CA  1 
ATOM   1264 C C   . SER A 1 168 ? 26.921 61.079 20.427  1.00 68.58  ? 237 SER A C   1 
ATOM   1265 O O   . SER A 1 168 ? 26.087 60.170 20.402  1.00 72.74  ? 237 SER A O   1 
ATOM   1266 C CB  . SER A 1 168 ? 28.475 60.970 22.394  1.00 71.14  ? 237 SER A CB  1 
ATOM   1267 N N   . LEU A 1 169 ? 27.508 61.557 19.333  1.00 54.81  ? 238 LEU A N   1 
ATOM   1268 C CA  . LEU A 1 169 ? 27.232 61.003 18.015  1.00 49.06  ? 238 LEU A CA  1 
ATOM   1269 C C   . LEU A 1 169 ? 27.570 59.517 17.971  1.00 49.92  ? 238 LEU A C   1 
ATOM   1270 O O   . LEU A 1 169 ? 28.705 59.124 18.247  1.00 55.12  ? 238 LEU A O   1 
ATOM   1271 C CB  . LEU A 1 169 ? 28.036 61.761 16.967  1.00 44.74  ? 238 LEU A CB  1 
ATOM   1272 C CG  . LEU A 1 169 ? 27.973 61.177 15.561  1.00 37.16  ? 238 LEU A CG  1 
ATOM   1273 C CD1 . LEU A 1 169 ? 26.546 61.232 15.045  1.00 33.93  ? 238 LEU A CD1 1 
ATOM   1274 C CD2 . LEU A 1 169 ? 28.928 61.919 14.645  1.00 31.57  ? 238 LEU A CD2 1 
ATOM   1275 N N   . GLY A 1 170 ? 26.584 58.692 17.617  1.00 42.14  ? 239 GLY A N   1 
ATOM   1276 C CA  . GLY A 1 170 ? 26.797 57.253 17.655  1.00 39.63  ? 239 GLY A CA  1 
ATOM   1277 C C   . GLY A 1 170 ? 27.752 56.777 16.578  1.00 41.73  ? 239 GLY A C   1 
ATOM   1278 O O   . GLY A 1 170 ? 28.674 55.994 16.842  1.00 36.03  ? 239 GLY A O   1 
ATOM   1279 N N   . GLY A 1 171 ? 27.541 57.238 15.350  1.00 31.93  ? 240 GLY A N   1 
ATOM   1280 C CA  . GLY A 1 171 ? 28.419 56.908 14.243  1.00 20.56  ? 240 GLY A CA  1 
ATOM   1281 C C   . GLY A 1 171 ? 28.103 57.802 13.066  1.00 26.24  ? 240 GLY A C   1 
ATOM   1282 O O   . GLY A 1 171 ? 27.142 58.575 13.090  1.00 25.90  ? 240 GLY A O   1 
ATOM   1283 N N   . GLN A 1 172 ? 28.930 57.694 12.026  1.00 20.10  ? 241 GLN A N   1 
ATOM   1284 C CA  . GLN A 1 172 ? 28.648 58.436 10.804  1.00 26.68  ? 241 GLN A CA  1 
ATOM   1285 C C   . GLN A 1 172 ? 29.377 57.813 9.627   1.00 33.10  ? 241 GLN A C   1 
ATOM   1286 O O   . GLN A 1 172 ? 30.582 57.555 9.702   1.00 39.38  ? 241 GLN A O   1 
ATOM   1287 C CB  . GLN A 1 172 ? 29.048 59.904 10.936  1.00 29.61  ? 241 GLN A CB  1 
ATOM   1288 C CG  . GLN A 1 172 ? 29.121 60.610 9.603   1.00 30.07  ? 241 GLN A CG  1 
ATOM   1289 C CD  . GLN A 1 172 ? 29.504 62.058 9.736   1.00 36.92  ? 241 GLN A CD  1 
ATOM   1290 O OE1 . GLN A 1 172 ? 28.638 62.925 9.831   1.00 46.04  ? 241 GLN A OE1 1 
ATOM   1291 N NE2 . GLN A 1 172 ? 30.808 62.335 9.732   1.00 30.65  ? 241 GLN A NE2 1 
ATOM   1292 N N   . ILE A 1 173 ? 28.644 57.587 8.543   1.00 34.49  ? 242 ILE A N   1 
ATOM   1293 C CA  . ILE A 1 173 ? 29.214 57.196 7.262   1.00 36.85  ? 242 ILE A CA  1 
ATOM   1294 C C   . ILE A 1 173 ? 29.159 58.403 6.336   1.00 33.79  ? 242 ILE A C   1 
ATOM   1295 O O   . ILE A 1 173 ? 28.223 59.206 6.406   1.00 38.93  ? 242 ILE A O   1 
ATOM   1296 C CB  . ILE A 1 173 ? 28.472 55.981 6.668   1.00 34.87  ? 242 ILE A CB  1 
ATOM   1297 C CG1 . ILE A 1 173 ? 28.923 55.701 5.235   1.00 40.52  ? 242 ILE A CG1 1 
ATOM   1298 C CG2 . ILE A 1 173 ? 26.978 56.186 6.723   1.00 43.08  ? 242 ILE A CG2 1 
ATOM   1299 C CD1 . ILE A 1 173 ? 28.264 54.478 4.624   1.00 47.73  ? 242 ILE A CD1 1 
ATOM   1300 N N   . VAL A 1 174 ? 30.183 58.554 5.499   1.00 42.83  ? 243 VAL A N   1 
ATOM   1301 C CA  . VAL A 1 174 ? 30.252 59.625 4.510   1.00 41.13  ? 243 VAL A CA  1 
ATOM   1302 C C   . VAL A 1 174 ? 30.308 59.000 3.124   1.00 38.73  ? 243 VAL A C   1 
ATOM   1303 O O   . VAL A 1 174 ? 31.145 58.127 2.866   1.00 42.54  ? 243 VAL A O   1 
ATOM   1304 C CB  . VAL A 1 174 ? 31.471 60.535 4.736   1.00 41.98  ? 243 VAL A CB  1 
ATOM   1305 C CG1 . VAL A 1 174 ? 31.420 61.720 3.783   1.00 34.48  ? 243 VAL A CG1 1 
ATOM   1306 C CG2 . VAL A 1 174 ? 31.541 60.990 6.193   1.00 50.02  ? 243 VAL A CG2 1 
ATOM   1307 N N   . LEU A 1 175 ? 29.420 59.443 2.240   1.00 31.30  ? 244 LEU A N   1 
ATOM   1308 C CA  . LEU A 1 175 ? 29.412 59.020 0.843   1.00 24.01  ? 244 LEU A CA  1 
ATOM   1309 C C   . LEU A 1 175 ? 30.096 60.101 0.016   1.00 33.79  ? 244 LEU A C   1 
ATOM   1310 O O   . LEU A 1 175 ? 29.598 61.228 -0.077  1.00 39.35  ? 244 LEU A O   1 
ATOM   1311 C CB  . LEU A 1 175 ? 27.989 58.793 0.347   1.00 22.06  ? 244 LEU A CB  1 
ATOM   1312 C CG  . LEU A 1 175 ? 27.144 57.776 1.101   1.00 21.67  ? 244 LEU A CG  1 
ATOM   1313 C CD1 . LEU A 1 175 ? 25.715 57.840 0.602   1.00 22.35  ? 244 LEU A CD1 1 
ATOM   1314 C CD2 . LEU A 1 175 ? 27.725 56.386 0.918   1.00 16.06  ? 244 LEU A CD2 1 
ATOM   1315 N N   . GLY A 1 176 ? 31.230 59.760 -0.588  1.00 29.11  ? 245 GLY A N   1 
ATOM   1316 C CA  . GLY A 1 176 ? 31.964 60.672 -1.437  1.00 33.89  ? 245 GLY A CA  1 
ATOM   1317 C C   . GLY A 1 176 ? 33.287 61.129 -0.867  1.00 39.53  ? 245 GLY A C   1 
ATOM   1318 O O   . GLY A 1 176 ? 34.129 61.633 -1.622  1.00 47.23  ? 245 GLY A O   1 
ATOM   1319 N N   . GLY A 1 177 ? 33.500 60.969 0.436   1.00 37.14  ? 246 GLY A N   1 
ATOM   1320 C CA  . GLY A 1 177 ? 34.759 61.356 1.039   1.00 36.24  ? 246 GLY A CA  1 
ATOM   1321 C C   . GLY A 1 177 ? 34.875 60.972 2.499   1.00 41.63  ? 246 GLY A C   1 
ATOM   1322 O O   . GLY A 1 177 ? 34.277 59.984 2.937   1.00 42.70  ? 246 GLY A O   1 
ATOM   1323 N N   . SER A 1 178 ? 35.638 61.753 3.263   1.00 36.76  ? 247 SER A N   1 
ATOM   1324 C CA  . SER A 1 178 ? 35.898 61.477 4.668   1.00 28.87  ? 247 SER A CA  1 
ATOM   1325 C C   . SER A 1 178 ? 35.745 62.755 5.477   1.00 31.53  ? 247 SER A C   1 
ATOM   1326 O O   . SER A 1 178 ? 35.904 63.863 4.959   1.00 44.08  ? 247 SER A O   1 
ATOM   1327 C CB  . SER A 1 178 ? 37.302 60.898 4.881   1.00 36.28  ? 247 SER A CB  1 
ATOM   1328 O OG  . SER A 1 178 ? 37.402 59.586 4.364   1.00 39.04  ? 247 SER A OG  1 
ATOM   1329 N N   . ASP A 1 179 ? 35.440 62.590 6.765   1.00 27.67  ? 248 ASP A N   1 
ATOM   1330 C CA  . ASP A 1 179 ? 35.214 63.729 7.641   1.00 33.11  ? 248 ASP A CA  1 
ATOM   1331 C C   . ASP A 1 179 ? 36.442 63.947 8.510   1.00 37.12  ? 248 ASP A C   1 
ATOM   1332 O O   . ASP A 1 179 ? 36.692 63.149 9.427   1.00 39.26  ? 248 ASP A O   1 
ATOM   1333 C CB  . ASP A 1 179 ? 33.975 63.505 8.508   1.00 44.43  ? 248 ASP A CB  1 
ATOM   1334 C CG  . ASP A 1 179 ? 33.613 64.723 9.344   1.00 46.66  ? 248 ASP A CG  1 
ATOM   1335 O OD1 . ASP A 1 179 ? 34.118 65.826 9.050   1.00 50.40  ? 248 ASP A OD1 1 
ATOM   1336 O OD2 . ASP A 1 179 ? 32.815 64.573 10.294  1.00 44.74  ? 248 ASP A OD2 1 
ATOM   1337 N N   . PRO A 1 180 ? 37.233 64.993 8.267   1.00 38.62  ? 249 PRO A N   1 
ATOM   1338 C CA  . PRO A 1 180 ? 38.429 65.216 9.094   1.00 36.71  ? 249 PRO A CA  1 
ATOM   1339 C C   . PRO A 1 180 ? 38.121 65.527 10.549  1.00 37.02  ? 249 PRO A C   1 
ATOM   1340 O O   . PRO A 1 180 ? 39.021 65.423 11.391  1.00 43.28  ? 249 PRO A O   1 
ATOM   1341 C CB  . PRO A 1 180 ? 39.122 66.394 8.398   1.00 37.15  ? 249 PRO A CB  1 
ATOM   1342 C CG  . PRO A 1 180 ? 38.054 67.053 7.596   1.00 40.53  ? 249 PRO A CG  1 
ATOM   1343 C CD  . PRO A 1 180 ? 37.140 65.954 7.157   1.00 39.39  ? 249 PRO A CD  1 
ATOM   1344 N N   . GLN A 1 181 ? 36.886 65.895 10.883  1.00 31.84  ? 250 GLN A N   1 
ATOM   1345 C CA  . GLN A 1 181 ? 36.558 66.104 12.285  1.00 39.40  ? 250 GLN A CA  1 
ATOM   1346 C C   . GLN A 1 181 ? 36.589 64.811 13.085  1.00 47.32  ? 250 GLN A C   1 
ATOM   1347 O O   . GLN A 1 181 ? 36.532 64.867 14.320  1.00 53.52  ? 250 GLN A O   1 
ATOM   1348 C CB  . GLN A 1 181 ? 35.181 66.766 12.423  1.00 35.14  ? 250 GLN A CB  1 
ATOM   1349 N N   . HIS A 1 182 ? 36.696 63.657 12.422  1.00 38.13  ? 251 HIS A N   1 
ATOM   1350 C CA  . HIS A 1 182 ? 36.657 62.375 13.112  1.00 38.44  ? 251 HIS A CA  1 
ATOM   1351 C C   . HIS A 1 182 ? 37.879 61.503 12.855  1.00 36.87  ? 251 HIS A C   1 
ATOM   1352 O O   . HIS A 1 182 ? 37.857 60.311 13.183  1.00 44.41  ? 251 HIS A O   1 
ATOM   1353 C CB  . HIS A 1 182 ? 35.374 61.635 12.744  1.00 31.68  ? 251 HIS A CB  1 
ATOM   1354 C CG  . HIS A 1 182 ? 34.163 62.207 13.404  1.00 38.43  ? 251 HIS A CG  1 
ATOM   1355 N ND1 . HIS A 1 182 ? 33.129 62.782 12.698  1.00 43.01  ? 251 HIS A ND1 1 
ATOM   1356 C CD2 . HIS A 1 182 ? 33.838 62.325 14.713  1.00 41.23  ? 251 HIS A CD2 1 
ATOM   1357 C CE1 . HIS A 1 182 ? 32.209 63.212 13.542  1.00 38.24  ? 251 HIS A CE1 1 
ATOM   1358 N NE2 . HIS A 1 182 ? 32.615 62.948 14.771  1.00 46.13  ? 251 HIS A NE2 1 
ATOM   1359 N N   . TYR A 1 183 ? 38.949 62.057 12.297  1.00 36.29  ? 252 TYR A N   1 
ATOM   1360 C CA  . TYR A 1 183 ? 40.211 61.338 12.244  1.00 34.98  ? 252 TYR A CA  1 
ATOM   1361 C C   . TYR A 1 183 ? 41.352 62.338 12.328  1.00 39.77  ? 252 TYR A C   1 
ATOM   1362 O O   . TYR A 1 183 ? 41.256 63.449 11.800  1.00 42.04  ? 252 TYR A O   1 
ATOM   1363 C CB  . TYR A 1 183 ? 40.335 60.483 10.979  1.00 26.78  ? 252 TYR A CB  1 
ATOM   1364 C CG  . TYR A 1 183 ? 40.397 61.247 9.674   1.00 29.52  ? 252 TYR A CG  1 
ATOM   1365 C CD1 . TYR A 1 183 ? 41.613 61.679 9.146   1.00 38.66  ? 252 TYR A CD1 1 
ATOM   1366 C CD2 . TYR A 1 183 ? 39.244 61.496 8.943   1.00 36.37  ? 252 TYR A CD2 1 
ATOM   1367 C CE1 . TYR A 1 183 ? 41.671 62.365 7.937   1.00 40.25  ? 252 TYR A CE1 1 
ATOM   1368 C CE2 . TYR A 1 183 ? 39.293 62.174 7.734   1.00 41.88  ? 252 TYR A CE2 1 
ATOM   1369 C CZ  . TYR A 1 183 ? 40.505 62.608 7.240   1.00 42.25  ? 252 TYR A CZ  1 
ATOM   1370 O OH  . TYR A 1 183 ? 40.543 63.281 6.043   1.00 48.90  ? 252 TYR A OH  1 
ATOM   1371 N N   . GLU A 1 184 ? 42.425 61.938 13.001  1.00 40.88  ? 253 GLU A N   1 
ATOM   1372 C CA  . GLU A 1 184 ? 43.610 62.768 13.132  1.00 46.06  ? 253 GLU A CA  1 
ATOM   1373 C C   . GLU A 1 184 ? 44.743 62.177 12.309  1.00 43.43  ? 253 GLU A C   1 
ATOM   1374 O O   . GLU A 1 184 ? 44.834 60.960 12.131  1.00 42.68  ? 253 GLU A O   1 
ATOM   1375 C CB  . GLU A 1 184 ? 44.039 62.901 14.590  1.00 45.55  ? 253 GLU A CB  1 
ATOM   1376 C CG  . GLU A 1 184 ? 44.195 61.589 15.303  1.00 56.29  ? 253 GLU A CG  1 
ATOM   1377 C CD  . GLU A 1 184 ? 44.754 61.774 16.690  1.00 72.54  ? 253 GLU A CD  1 
ATOM   1378 O OE1 . GLU A 1 184 ? 43.954 61.999 17.630  1.00 71.36  ? 253 GLU A OE1 1 
ATOM   1379 O OE2 . GLU A 1 184 ? 45.995 61.709 16.832  1.00 76.11  ? 253 GLU A OE2 1 
ATOM   1380 N N   . GLY A 1 185 ? 45.599 63.054 11.803  1.00 44.76  ? 254 GLY A N   1 
ATOM   1381 C CA  . GLY A 1 185 ? 46.652 62.627 10.919  1.00 41.64  ? 254 GLY A CA  1 
ATOM   1382 C C   . GLY A 1 185 ? 46.122 62.282 9.543   1.00 45.03  ? 254 GLY A C   1 
ATOM   1383 O O   . GLY A 1 185 ? 44.992 62.608 9.167   1.00 47.71  ? 254 GLY A O   1 
ATOM   1384 N N   . ASN A 1 186 ? 46.969 61.603 8.780   1.00 50.87  ? 255 ASN A N   1 
ATOM   1385 C CA  . ASN A 1 186 ? 46.670 61.244 7.404   1.00 51.56  ? 255 ASN A CA  1 
ATOM   1386 C C   . ASN A 1 186 ? 46.335 59.762 7.292   1.00 44.74  ? 255 ASN A C   1 
ATOM   1387 O O   . ASN A 1 186 ? 46.683 58.951 8.155   1.00 41.63  ? 255 ASN A O   1 
ATOM   1388 C CB  . ASN A 1 186 ? 47.849 61.587 6.488   1.00 53.97  ? 255 ASN A CB  1 
ATOM   1389 C CG  . ASN A 1 186 ? 47.992 63.081 6.254   1.00 55.45  ? 255 ASN A CG  1 
ATOM   1390 O OD1 . ASN A 1 186 ? 49.052 63.655 6.489   1.00 57.83  ? 255 ASN A OD1 1 
ATOM   1391 N ND2 . ASN A 1 186 ? 46.920 63.716 5.788   1.00 52.86  ? 255 ASN A ND2 1 
ATOM   1392 N N   . PHE A 1 187 ? 45.642 59.422 6.208   1.00 37.81  ? 256 PHE A N   1 
ATOM   1393 C CA  . PHE A 1 187 ? 45.280 58.038 5.945   1.00 39.42  ? 256 PHE A CA  1 
ATOM   1394 C C   . PHE A 1 187 ? 46.504 57.234 5.528   1.00 41.16  ? 256 PHE A C   1 
ATOM   1395 O O   . PHE A 1 187 ? 47.347 57.705 4.760   1.00 48.14  ? 256 PHE A O   1 
ATOM   1396 C CB  . PHE A 1 187 ? 44.219 57.962 4.842   1.00 38.03  ? 256 PHE A CB  1 
ATOM   1397 C CG  . PHE A 1 187 ? 42.820 58.267 5.307   1.00 31.49  ? 256 PHE A CG  1 
ATOM   1398 C CD1 . PHE A 1 187 ? 42.206 57.494 6.286   1.00 34.98  ? 256 PHE A CD1 1 
ATOM   1399 C CD2 . PHE A 1 187 ? 42.109 59.316 4.746   1.00 24.67  ? 256 PHE A CD2 1 
ATOM   1400 C CE1 . PHE A 1 187 ? 40.912 57.775 6.708   1.00 29.81  ? 256 PHE A CE1 1 
ATOM   1401 C CE2 . PHE A 1 187 ? 40.815 59.601 5.159   1.00 27.84  ? 256 PHE A CE2 1 
ATOM   1402 C CZ  . PHE A 1 187 ? 40.218 58.832 6.144   1.00 27.70  ? 256 PHE A CZ  1 
ATOM   1403 N N   . HIS A 1 188 ? 46.601 56.013 6.045   1.00 37.34  ? 257 HIS A N   1 
ATOM   1404 C CA  . HIS A 1 188 ? 47.544 55.021 5.549   1.00 33.27  ? 257 HIS A CA  1 
ATOM   1405 C C   . HIS A 1 188 ? 46.765 54.030 4.690   1.00 36.97  ? 257 HIS A C   1 
ATOM   1406 O O   . HIS A 1 188 ? 45.856 53.357 5.188   1.00 37.85  ? 257 HIS A O   1 
ATOM   1407 C CB  . HIS A 1 188 ? 48.257 54.296 6.689   1.00 18.04  ? 257 HIS A CB  1 
ATOM   1408 C CG  . HIS A 1 188 ? 48.991 53.070 6.242   1.00 51.36  ? 257 HIS A CG  1 
ATOM   1409 N ND1 . HIS A 1 188 ? 48.943 51.876 6.928   1.00 45.96  ? 257 HIS A ND1 1 
ATOM   1410 C CD2 . HIS A 1 188 ? 49.774 52.849 5.159   1.00 42.17  ? 257 HIS A CD2 1 
ATOM   1411 C CE1 . HIS A 1 188 ? 49.674 50.976 6.293   1.00 43.75  ? 257 HIS A CE1 1 
ATOM   1412 N NE2 . HIS A 1 188 ? 50.187 51.541 5.216   1.00 45.21  ? 257 HIS A NE2 1 
ATOM   1413 N N   . TYR A 1 189 ? 47.108 53.948 3.408   1.00 35.54  ? 258 TYR A N   1 
ATOM   1414 C CA  . TYR A 1 189 ? 46.305 53.211 2.441   1.00 34.48  ? 258 TYR A CA  1 
ATOM   1415 C C   . TYR A 1 189 ? 46.893 51.832 2.181   1.00 43.56  ? 258 TYR A C   1 
ATOM   1416 O O   . TYR A 1 189 ? 48.114 51.671 2.096   1.00 51.17  ? 258 TYR A O   1 
ATOM   1417 C CB  . TYR A 1 189 ? 46.184 53.990 1.132   1.00 28.89  ? 258 TYR A CB  1 
ATOM   1418 C CG  . TYR A 1 189 ? 45.287 55.201 1.253   1.00 37.05  ? 258 TYR A CG  1 
ATOM   1419 C CD1 . TYR A 1 189 ? 43.907 55.058 1.348   1.00 37.23  ? 258 TYR A CD1 1 
ATOM   1420 C CD2 . TYR A 1 189 ? 45.818 56.484 1.286   1.00 27.45  ? 258 TYR A CD2 1 
ATOM   1421 C CE1 . TYR A 1 189 ? 43.083 56.155 1.467   1.00 40.07  ? 258 TYR A CE1 1 
ATOM   1422 C CE2 . TYR A 1 189 ? 44.999 57.590 1.402   1.00 41.50  ? 258 TYR A CE2 1 
ATOM   1423 C CZ  . TYR A 1 189 ? 43.631 57.418 1.494   1.00 49.04  ? 258 TYR A CZ  1 
ATOM   1424 O OH  . TYR A 1 189 ? 42.805 58.511 1.617   1.00 51.64  ? 258 TYR A OH  1 
ATOM   1425 N N   . ILE A 1 190 ? 46.012 50.837 2.066   1.00 37.82  ? 259 ILE A N   1 
ATOM   1426 C CA  . ILE A 1 190 ? 46.396 49.449 1.833   1.00 29.72  ? 259 ILE A CA  1 
ATOM   1427 C C   . ILE A 1 190 ? 45.557 48.904 0.685   1.00 33.82  ? 259 ILE A C   1 
ATOM   1428 O O   . ILE A 1 190 ? 44.323 48.970 0.725   1.00 31.81  ? 259 ILE A O   1 
ATOM   1429 C CB  . ILE A 1 190 ? 46.211 48.585 3.096   1.00 35.32  ? 259 ILE A CB  1 
ATOM   1430 C CG1 . ILE A 1 190 ? 47.016 49.160 4.266   1.00 37.53  ? 259 ILE A CG1 1 
ATOM   1431 C CG2 . ILE A 1 190 ? 46.607 47.142 2.821   1.00 29.32  ? 259 ILE A CG2 1 
ATOM   1432 C CD1 . ILE A 1 190 ? 46.345 48.996 5.609   1.00 36.33  ? 259 ILE A CD1 1 
ATOM   1433 N N   . ASN A 1 191 ? 46.224 48.355 -0.328  1.00 33.14  ? 260 ASN A N   1 
ATOM   1434 C CA  . ASN A 1 191 ? 45.530 47.899 -1.524  1.00 29.46  ? 260 ASN A CA  1 
ATOM   1435 C C   . ASN A 1 191 ? 44.777 46.603 -1.265  1.00 27.26  ? 260 ASN A C   1 
ATOM   1436 O O   . ASN A 1 191 ? 45.199 45.755 -0.475  1.00 35.24  ? 260 ASN A O   1 
ATOM   1437 C CB  . ASN A 1 191 ? 46.514 47.677 -2.672  1.00 31.45  ? 260 ASN A CB  1 
ATOM   1438 C CG  . ASN A 1 191 ? 47.209 48.946 -3.092  1.00 36.61  ? 260 ASN A CG  1 
ATOM   1439 O OD1 . ASN A 1 191 ? 46.569 49.972 -3.335  1.00 37.83  ? 260 ASN A OD1 1 
ATOM   1440 N ND2 . ASN A 1 191 ? 48.533 48.890 -3.171  1.00 38.95  ? 260 ASN A ND2 1 
ATOM   1441 N N   . LEU A 1 192 ? 43.651 46.454 -1.952  1.00 21.22  ? 261 LEU A N   1 
ATOM   1442 C CA  . LEU A 1 192 ? 42.939 45.190 -1.935  1.00 29.94  ? 261 LEU A CA  1 
ATOM   1443 C C   . LEU A 1 192 ? 43.772 44.110 -2.608  1.00 31.09  ? 261 LEU A C   1 
ATOM   1444 O O   . LEU A 1 192 ? 44.528 44.371 -3.547  1.00 32.64  ? 261 LEU A O   1 
ATOM   1445 C CB  . LEU A 1 192 ? 41.599 45.312 -2.658  1.00 26.65  ? 261 LEU A CB  1 
ATOM   1446 C CG  . LEU A 1 192 ? 40.660 46.421 -2.205  1.00 19.38  ? 261 LEU A CG  1 
ATOM   1447 C CD1 . LEU A 1 192 ? 39.363 46.259 -2.937  1.00 14.35  ? 261 LEU A CD1 1 
ATOM   1448 C CD2 . LEU A 1 192 ? 40.456 46.365 -0.697  1.00 15.54  ? 261 LEU A CD2 1 
ATOM   1449 N N   . ILE A 1 193 ? 43.629 42.882 -2.113  1.00 26.34  ? 262 ILE A N   1 
ATOM   1450 C CA  . ILE A 1 193 ? 44.209 41.742 -2.812  1.00 15.82  ? 262 ILE A CA  1 
ATOM   1451 C C   . ILE A 1 193 ? 43.575 41.598 -4.184  1.00 24.18  ? 262 ILE A C   1 
ATOM   1452 O O   . ILE A 1 193 ? 44.261 41.423 -5.197  1.00 29.90  ? 262 ILE A O   1 
ATOM   1453 C CB  . ILE A 1 193 ? 44.038 40.463 -1.980  1.00 36.04  ? 262 ILE A CB  1 
ATOM   1454 C CG1 . ILE A 1 193 ? 44.794 40.590 -0.663  1.00 31.32  ? 262 ILE A CG1 1 
ATOM   1455 C CG2 . ILE A 1 193 ? 44.496 39.258 -2.774  1.00 28.37  ? 262 ILE A CG2 1 
ATOM   1456 C CD1 . ILE A 1 193 ? 44.303 39.653 0.380   1.00 40.38  ? 262 ILE A CD1 1 
ATOM   1457 N N   . LYS A 1 194 ? 42.254 41.686 -4.240  1.00 35.15  ? 263 LYS A N   1 
ATOM   1458 C CA  . LYS A 1 194 ? 41.545 41.595 -5.502  1.00 27.09  ? 263 LYS A CA  1 
ATOM   1459 C C   . LYS A 1 194 ? 40.304 42.470 -5.420  1.00 35.43  ? 263 LYS A C   1 
ATOM   1460 O O   . LYS A 1 194 ? 39.725 42.649 -4.345  1.00 46.39  ? 263 LYS A O   1 
ATOM   1461 C CB  . LYS A 1 194 ? 41.197 40.136 -5.818  1.00 18.38  ? 263 LYS A CB  1 
ATOM   1462 C CG  . LYS A 1 194 ? 40.152 39.551 -4.903  1.00 15.77  ? 263 LYS A CG  1 
ATOM   1463 C CD  . LYS A 1 194 ? 39.868 38.096 -5.228  1.00 15.39  ? 263 LYS A CD  1 
ATOM   1464 C CE  . LYS A 1 194 ? 39.932 37.239 -3.998  1.00 37.91  ? 263 LYS A CE  1 
ATOM   1465 N NZ  . LYS A 1 194 ? 39.279 37.945 -2.870  1.00 53.17  ? 263 LYS A NZ  1 
ATOM   1466 N N   . THR A 1 195 ? 39.930 43.053 -6.556  1.00 30.76  ? 264 THR A N   1 
ATOM   1467 C CA  . THR A 1 195 ? 38.642 43.720 -6.644  1.00 38.55  ? 264 THR A CA  1 
ATOM   1468 C C   . THR A 1 195 ? 37.543 42.693 -6.394  1.00 39.31  ? 264 THR A C   1 
ATOM   1469 O O   . THR A 1 195 ? 37.704 41.501 -6.674  1.00 39.60  ? 264 THR A O   1 
ATOM   1470 C CB  . THR A 1 195 ? 38.487 44.396 -8.018  1.00 54.08  ? 264 THR A CB  1 
ATOM   1471 O OG1 . THR A 1 195 ? 39.179 45.649 -8.009  1.00 62.00  ? 264 THR A OG1 1 
ATOM   1472 C CG2 . THR A 1 195 ? 37.027 44.653 -8.385  1.00 56.18  ? 264 THR A CG2 1 
ATOM   1473 N N   . GLY A 1 196 ? 36.439 43.147 -5.810  1.00 29.52  ? 265 GLY A N   1 
ATOM   1474 C CA  . GLY A 1 196 ? 35.317 42.276 -5.544  1.00 27.38  ? 265 GLY A CA  1 
ATOM   1475 C C   . GLY A 1 196 ? 35.133 41.925 -4.088  1.00 31.46  ? 265 GLY A C   1 
ATOM   1476 O O   . GLY A 1 196 ? 34.143 41.262 -3.751  1.00 36.80  ? 265 GLY A O   1 
ATOM   1477 N N   . VAL A 1 197 ? 36.051 42.335 -3.214  1.00 23.74  ? 266 VAL A N   1 
ATOM   1478 C CA  . VAL A 1 197 ? 35.898 42.086 -1.785  1.00 29.86  ? 266 VAL A CA  1 
ATOM   1479 C C   . VAL A 1 197 ? 36.783 43.056 -1.010  1.00 21.08  ? 266 VAL A C   1 
ATOM   1480 O O   . VAL A 1 197 ? 37.956 43.241 -1.344  1.00 25.03  ? 266 VAL A O   1 
ATOM   1481 C CB  . VAL A 1 197 ? 36.211 40.614 -1.452  1.00 28.23  ? 266 VAL A CB  1 
ATOM   1482 C CG1 . VAL A 1 197 ? 37.555 40.199 -2.033  1.00 37.07  ? 266 VAL A CG1 1 
ATOM   1483 C CG2 . VAL A 1 197 ? 36.154 40.373 0.033   1.00 26.59  ? 266 VAL A CG2 1 
ATOM   1484 N N   . TRP A 1 198 ? 36.222 43.701 0.017   1.00 21.86  ? 267 TRP A N   1 
ATOM   1485 C CA  . TRP A 1 198 ? 36.957 44.675 0.828   1.00 22.42  ? 267 TRP A CA  1 
ATOM   1486 C C   . TRP A 1 198 ? 37.888 43.928 1.783   1.00 22.83  ? 267 TRP A C   1 
ATOM   1487 O O   . TRP A 1 198 ? 37.704 43.891 3.001   1.00 32.20  ? 267 TRP A O   1 
ATOM   1488 C CB  . TRP A 1 198 ? 35.997 45.583 1.585   1.00 18.49  ? 267 TRP A CB  1 
ATOM   1489 C CG  . TRP A 1 198 ? 35.203 46.489 0.701   1.00 30.42  ? 267 TRP A CG  1 
ATOM   1490 C CD1 . TRP A 1 198 ? 33.873 46.393 0.414   1.00 36.47  ? 267 TRP A CD1 1 
ATOM   1491 C CD2 . TRP A 1 198 ? 35.686 47.631 -0.014  1.00 26.47  ? 267 TRP A CD2 1 
ATOM   1492 N NE1 . TRP A 1 198 ? 33.499 47.403 -0.435  1.00 35.39  ? 267 TRP A NE1 1 
ATOM   1493 C CE2 . TRP A 1 198 ? 34.594 48.177 -0.714  1.00 28.93  ? 267 TRP A CE2 1 
ATOM   1494 C CE3 . TRP A 1 198 ? 36.935 48.243 -0.129  1.00 23.83  ? 267 TRP A CE3 1 
ATOM   1495 C CZ2 . TRP A 1 198 ? 34.713 49.308 -1.520  1.00 27.83  ? 267 TRP A CZ2 1 
ATOM   1496 C CZ3 . TRP A 1 198 ? 37.050 49.369 -0.927  1.00 27.49  ? 267 TRP A CZ3 1 
ATOM   1497 C CH2 . TRP A 1 198 ? 35.945 49.890 -1.611  1.00 25.51  ? 267 TRP A CH2 1 
ATOM   1498 N N   . GLN A 1 199 ? 38.923 43.337 1.201   1.00 23.47  ? 268 GLN A N   1 
ATOM   1499 C CA  . GLN A 1 199 ? 39.805 42.430 1.914   1.00 28.23  ? 268 GLN A CA  1 
ATOM   1500 C C   . GLN A 1 199 ? 41.249 42.735 1.545   1.00 34.92  ? 268 GLN A C   1 
ATOM   1501 O O   . GLN A 1 199 ? 41.565 42.951 0.370   1.00 38.20  ? 268 GLN A O   1 
ATOM   1502 C CB  . GLN A 1 199 ? 39.446 40.987 1.575   1.00 18.81  ? 268 GLN A CB  1 
ATOM   1503 C CG  . GLN A 1 199 ? 40.113 39.927 2.397   1.00 13.78  ? 268 GLN A CG  1 
ATOM   1504 C CD  . GLN A 1 199 ? 39.648 38.555 1.967   1.00 19.05  ? 268 GLN A CD  1 
ATOM   1505 O OE1 . GLN A 1 199 ? 39.700 38.221 0.781   1.00 22.70  ? 268 GLN A OE1 1 
ATOM   1506 N NE2 . GLN A 1 199 ? 39.168 37.760 2.919   1.00 14.01  ? 268 GLN A NE2 1 
ATOM   1507 N N   . ILE A 1 200 ? 42.121 42.750 2.557   1.00 31.95  ? 269 ILE A N   1 
ATOM   1508 C CA  . ILE A 1 200 ? 43.514 43.139 2.392   1.00 33.16  ? 269 ILE A CA  1 
ATOM   1509 C C   . ILE A 1 200 ? 44.425 42.069 2.982   1.00 35.04  ? 269 ILE A C   1 
ATOM   1510 O O   . ILE A 1 200 ? 44.003 41.218 3.766   1.00 30.94  ? 269 ILE A O   1 
ATOM   1511 C CB  . ILE A 1 200 ? 43.819 44.503 3.050   1.00 30.21  ? 269 ILE A CB  1 
ATOM   1512 C CG1 . ILE A 1 200 ? 43.484 44.465 4.543   1.00 28.15  ? 269 ILE A CG1 1 
ATOM   1513 C CG2 . ILE A 1 200 ? 43.062 45.620 2.355   1.00 28.55  ? 269 ILE A CG2 1 
ATOM   1514 C CD1 . ILE A 1 200 ? 43.800 45.750 5.261   1.00 31.59  ? 269 ILE A CD1 1 
ATOM   1515 N N   . GLN A 1 201 ? 45.698 42.145 2.599   1.00 42.45  ? 270 GLN A N   1 
ATOM   1516 C CA  . GLN A 1 201 ? 46.734 41.293 3.166   1.00 40.03  ? 270 GLN A CA  1 
ATOM   1517 C C   . GLN A 1 201 ? 47.049 41.698 4.603   1.00 34.40  ? 270 GLN A C   1 
ATOM   1518 O O   . GLN A 1 201 ? 47.125 42.886 4.927   1.00 37.10  ? 270 GLN A O   1 
ATOM   1519 C CB  . GLN A 1 201 ? 47.998 41.391 2.316   1.00 48.34  ? 270 GLN A CB  1 
ATOM   1520 C CG  . GLN A 1 201 ? 49.134 40.499 2.764   1.00 56.88  ? 270 GLN A CG  1 
ATOM   1521 C CD  . GLN A 1 201 ? 49.306 39.298 1.860   1.00 57.28  ? 270 GLN A CD  1 
ATOM   1522 O OE1 . GLN A 1 201 ? 48.894 38.188 2.201   1.00 52.92  ? 270 GLN A OE1 1 
ATOM   1523 N NE2 . GLN A 1 201 ? 49.911 39.513 0.692   1.00 51.82  ? 270 GLN A NE2 1 
ATOM   1524 N N   . MET A 1 202 ? 47.236 40.705 5.467   1.00 29.11  ? 271 MET A N   1 
ATOM   1525 C CA  . MET A 1 202 ? 47.666 40.920 6.844   1.00 32.09  ? 271 MET A CA  1 
ATOM   1526 C C   . MET A 1 202 ? 48.938 40.117 7.082   1.00 31.04  ? 271 MET A C   1 
ATOM   1527 O O   . MET A 1 202 ? 49.064 38.992 6.592   1.00 37.00  ? 271 MET A O   1 
ATOM   1528 C CB  . MET A 1 202 ? 46.568 40.515 7.852   1.00 29.98  ? 271 MET A CB  1 
ATOM   1529 C CG  . MET A 1 202 ? 46.980 40.616 9.319   1.00 29.37  ? 271 MET A CG  1 
ATOM   1530 S SD  . MET A 1 202 ? 45.659 41.192 10.405  1.00 39.92  ? 271 MET A SD  1 
ATOM   1531 C CE  . MET A 1 202 ? 44.752 39.679 10.683  1.00 36.04  ? 271 MET A CE  1 
ATOM   1532 N N   . LYS A 1 203 ? 49.885 40.698 7.827   1.00 22.29  ? 272 LYS A N   1 
ATOM   1533 C CA  . LYS A 1 203 ? 51.224 40.135 7.938   1.00 23.30  ? 272 LYS A CA  1 
ATOM   1534 C C   . LYS A 1 203 ? 51.540 39.525 9.297   1.00 33.53  ? 272 LYS A C   1 
ATOM   1535 O O   . LYS A 1 203 ? 52.597 38.901 9.441   1.00 54.04  ? 272 LYS A O   1 
ATOM   1536 C CB  . LYS A 1 203 ? 52.277 41.204 7.610   1.00 32.78  ? 272 LYS A CB  1 
ATOM   1537 C CG  . LYS A 1 203 ? 53.538 40.652 6.941   1.00 40.74  ? 272 LYS A CG  1 
ATOM   1538 N N   . GLY A 1 204 ? 50.667 39.670 10.286  1.00 30.11  ? 273 GLY A N   1 
ATOM   1539 C CA  . GLY A 1 204 ? 50.910 39.072 11.586  1.00 28.01  ? 273 GLY A CA  1 
ATOM   1540 C C   . GLY A 1 204 ? 49.975 39.606 12.647  1.00 30.25  ? 273 GLY A C   1 
ATOM   1541 O O   . GLY A 1 204 ? 49.468 40.727 12.519  1.00 36.44  ? 273 GLY A O   1 
ATOM   1542 N N   . VAL A 1 205 ? 49.724 38.818 13.690  1.00 20.74  ? 274 VAL A N   1 
ATOM   1543 C CA  . VAL A 1 205 ? 48.863 39.229 14.797  1.00 25.34  ? 274 VAL A CA  1 
ATOM   1544 C C   . VAL A 1 205 ? 49.613 38.965 16.092  1.00 27.60  ? 274 VAL A C   1 
ATOM   1545 O O   . VAL A 1 205 ? 49.987 37.819 16.371  1.00 38.96  ? 274 VAL A O   1 
ATOM   1546 C CB  . VAL A 1 205 ? 47.509 38.496 14.797  1.00 30.36  ? 274 VAL A CB  1 
ATOM   1547 C CG1 . VAL A 1 205 ? 46.680 38.917 16.004  1.00 30.09  ? 274 VAL A CG1 1 
ATOM   1548 C CG2 . VAL A 1 205 ? 46.752 38.779 13.522  1.00 30.13  ? 274 VAL A CG2 1 
ATOM   1549 N N   . SER A 1 206 ? 49.826 40.017 16.881  1.00 27.47  ? 275 SER A N   1 
ATOM   1550 C CA  . SER A 1 206 ? 50.686 39.972 18.060  1.00 22.79  ? 275 SER A CA  1 
ATOM   1551 C C   . SER A 1 206 ? 49.866 40.088 19.335  1.00 28.04  ? 275 SER A C   1 
ATOM   1552 O O   . SER A 1 206 ? 48.987 40.950 19.439  1.00 34.57  ? 275 SER A O   1 
ATOM   1553 C CB  . SER A 1 206 ? 51.719 41.097 18.025  1.00 18.01  ? 275 SER A CB  1 
ATOM   1554 O OG  . SER A 1 206 ? 52.414 41.099 16.794  1.00 47.81  ? 275 SER A OG  1 
ATOM   1555 N N   . VAL A 1 207 ? 50.164 39.229 20.301  1.00 32.03  ? 276 VAL A N   1 
ATOM   1556 C CA  . VAL A 1 207 ? 49.690 39.391 21.672  1.00 31.92  ? 276 VAL A CA  1 
ATOM   1557 C C   . VAL A 1 207 ? 50.855 40.010 22.435  1.00 32.49  ? 276 VAL A C   1 
ATOM   1558 O O   . VAL A 1 207 ? 51.773 39.323 22.891  1.00 34.96  ? 276 VAL A O   1 
ATOM   1559 C CB  . VAL A 1 207 ? 49.225 38.073 22.277  1.00 34.68  ? 276 VAL A CB  1 
ATOM   1560 C CG1 . VAL A 1 207 ? 48.796 38.276 23.727  1.00 22.68  ? 276 VAL A CG1 1 
ATOM   1561 C CG2 . VAL A 1 207 ? 48.095 37.503 21.441  1.00 16.99  ? 276 VAL A CG2 1 
ATOM   1562 N N   . GLY A 1 208 ? 50.829 41.335 22.546  1.00 35.58  ? 277 GLY A N   1 
ATOM   1563 C CA  . GLY A 1 208 ? 51.914 42.069 23.157  1.00 32.40  ? 277 GLY A CA  1 
ATOM   1564 C C   . GLY A 1 208 ? 53.216 41.959 22.390  1.00 48.31  ? 277 GLY A C   1 
ATOM   1565 O O   . GLY A 1 208 ? 53.355 42.505 21.289  1.00 43.77  ? 277 GLY A O   1 
ATOM   1566 N N   . SER A 1 209 ? 54.180 41.240 22.968  1.00 65.34  ? 278 SER A N   1 
ATOM   1567 C CA  . SER A 1 209 ? 55.520 41.167 22.395  1.00 78.14  ? 278 SER A CA  1 
ATOM   1568 C C   . SER A 1 209 ? 55.593 40.167 21.246  1.00 79.32  ? 278 SER A C   1 
ATOM   1569 O O   . SER A 1 209 ? 56.054 40.505 20.151  1.00 80.69  ? 278 SER A O   1 
ATOM   1570 C CB  . SER A 1 209 ? 56.531 40.805 23.486  1.00 83.94  ? 278 SER A CB  1 
ATOM   1571 O OG  . SER A 1 209 ? 56.357 39.468 23.926  1.00 86.92  ? 278 SER A OG  1 
ATOM   1572 N N   . SER A 1 210 ? 55.145 38.935 21.475  1.00 79.17  ? 279 SER A N   1 
ATOM   1573 C CA  . SER A 1 210 ? 55.324 37.866 20.502  1.00 74.31  ? 279 SER A CA  1 
ATOM   1574 C C   . SER A 1 210 ? 54.266 37.926 19.405  1.00 73.95  ? 279 SER A C   1 
ATOM   1575 O O   . SER A 1 210 ? 53.093 38.209 19.666  1.00 68.90  ? 279 SER A O   1 
ATOM   1576 C CB  . SER A 1 210 ? 55.272 36.503 21.197  1.00 65.96  ? 279 SER A CB  1 
ATOM   1577 N N   . THR A 1 211 ? 54.693 37.653 18.170  1.00 75.43  ? 280 THR A N   1 
ATOM   1578 C CA  . THR A 1 211 ? 53.786 37.513 17.031  1.00 71.38  ? 280 THR A CA  1 
ATOM   1579 C C   . THR A 1 211 ? 53.197 36.110 17.088  1.00 67.42  ? 280 THR A C   1 
ATOM   1580 O O   . THR A 1 211 ? 53.721 35.164 16.499  1.00 59.22  ? 280 THR A O   1 
ATOM   1581 C CB  . THR A 1 211 ? 54.510 37.764 15.713  1.00 63.20  ? 280 THR A CB  1 
ATOM   1582 O OG1 . THR A 1 211 ? 55.166 39.036 15.762  1.00 60.94  ? 280 THR A OG1 1 
ATOM   1583 C CG2 . THR A 1 211 ? 53.522 37.761 14.557  1.00 62.09  ? 280 THR A CG2 1 
ATOM   1584 N N   . LEU A 1 212 ? 52.083 35.981 17.815  1.00 67.14  ? 281 LEU A N   1 
ATOM   1585 C CA  . LEU A 1 212 ? 51.538 34.663 18.120  1.00 57.92  ? 281 LEU A CA  1 
ATOM   1586 C C   . LEU A 1 212 ? 50.902 34.006 16.903  1.00 41.20  ? 281 LEU A C   1 
ATOM   1587 O O   . LEU A 1 212 ? 50.963 32.780 16.765  1.00 43.00  ? 281 LEU A O   1 
ATOM   1588 C CB  . LEU A 1 212 ? 50.517 34.767 19.258  1.00 52.96  ? 281 LEU A CB  1 
ATOM   1589 N N   . LEU A 1 213 ? 50.311 34.791 16.006  1.00 44.75  ? 282 LEU A N   1 
ATOM   1590 C CA  . LEU A 1 213 ? 49.456 34.271 14.949  1.00 44.87  ? 282 LEU A CA  1 
ATOM   1591 C C   . LEU A 1 213 ? 49.887 34.823 13.599  1.00 44.68  ? 282 LEU A C   1 
ATOM   1592 O O   . LEU A 1 213 ? 50.598 35.827 13.519  1.00 42.22  ? 282 LEU A O   1 
ATOM   1593 C CB  . LEU A 1 213 ? 47.982 34.637 15.194  1.00 45.70  ? 282 LEU A CB  1 
ATOM   1594 C CG  . LEU A 1 213 ? 47.136 33.636 15.982  1.00 52.23  ? 282 LEU A CG  1 
ATOM   1595 C CD1 . LEU A 1 213 ? 47.238 32.245 15.342  1.00 55.90  ? 282 LEU A CD1 1 
ATOM   1596 C CD2 . LEU A 1 213 ? 47.534 33.615 17.454  1.00 49.49  ? 282 LEU A CD2 1 
ATOM   1597 N N   . CYS A 1 214 ? 49.445 34.140 12.535  1.00 45.86  ? 283 CYS A N   1 
ATOM   1598 C CA  . CYS A 1 214 ? 49.441 34.698 11.179  1.00 31.58  ? 283 CYS A CA  1 
ATOM   1599 C C   . CYS A 1 214 ? 50.827 35.218 10.775  1.00 37.37  ? 283 CYS A C   1 
ATOM   1600 O O   . CYS A 1 214 ? 50.978 36.283 10.174  1.00 46.24  ? 283 CYS A O   1 
ATOM   1601 C CB  . CYS A 1 214 ? 48.359 35.783 11.072  1.00 32.05  ? 283 CYS A CB  1 
ATOM   1602 S SG  . CYS A 1 214 ? 48.195 36.603 9.472   1.00 51.07  ? 283 CYS A SG  1 
ATOM   1603 N N   . GLU A 1 215 ? 51.858 34.442 11.104  1.00 43.65  ? 284 GLU A N   1 
ATOM   1604 C CA  . GLU A 1 215 ? 53.234 34.884 10.892  1.00 48.76  ? 284 GLU A CA  1 
ATOM   1605 C C   . GLU A 1 215 ? 53.600 34.935 9.417   1.00 54.06  ? 284 GLU A C   1 
ATOM   1606 O O   . GLU A 1 215 ? 54.393 35.794 9.006   1.00 57.11  ? 284 GLU A O   1 
ATOM   1607 C CB  . GLU A 1 215 ? 54.202 33.970 11.641  1.00 54.39  ? 284 GLU A CB  1 
ATOM   1608 C CG  . GLU A 1 215 ? 53.739 33.544 13.038  1.00 64.95  ? 284 GLU A CG  1 
ATOM   1609 C CD  . GLU A 1 215 ? 52.757 32.379 13.042  1.00 76.61  ? 284 GLU A CD  1 
ATOM   1610 O OE1 . GLU A 1 215 ? 52.892 31.507 13.927  1.00 93.16  ? 284 GLU A OE1 1 
ATOM   1611 O OE2 . GLU A 1 215 ? 51.851 32.335 12.183  1.00 84.39  ? 284 GLU A OE2 1 
ATOM   1612 N N   . ASP A 1 216 ? 53.058 34.020 8.613   1.00 54.54  ? 285 ASP A N   1 
ATOM   1613 C CA  . ASP A 1 216 ? 53.316 34.000 7.181   1.00 58.06  ? 285 ASP A CA  1 
ATOM   1614 C C   . ASP A 1 216 ? 52.199 34.658 6.386   1.00 58.58  ? 285 ASP A C   1 
ATOM   1615 O O   . ASP A 1 216 ? 52.124 34.487 5.164   1.00 55.69  ? 285 ASP A O   1 
ATOM   1616 C CB  . ASP A 1 216 ? 53.543 32.567 6.701   1.00 55.58  ? 285 ASP A CB  1 
ATOM   1617 C CG  . ASP A 1 216 ? 55.007 32.191 6.684   1.00 63.12  ? 285 ASP A CG  1 
ATOM   1618 O OD1 . ASP A 1 216 ? 55.776 32.825 5.934   1.00 66.72  ? 285 ASP A OD1 1 
ATOM   1619 O OD2 . ASP A 1 216 ? 55.391 31.265 7.423   1.00 70.51  ? 285 ASP A OD2 1 
ATOM   1620 N N   . GLY A 1 217 ? 51.332 35.411 7.054   1.00 58.85  ? 286 GLY A N   1 
ATOM   1621 C CA  . GLY A 1 217 ? 50.311 36.159 6.355   1.00 52.84  ? 286 GLY A CA  1 
ATOM   1622 C C   . GLY A 1 217 ? 48.961 35.477 6.334   1.00 40.71  ? 286 GLY A C   1 
ATOM   1623 O O   . GLY A 1 217 ? 48.868 34.257 6.184   1.00 39.47  ? 286 GLY A O   1 
ATOM   1624 N N   . CYS A 1 218 ? 47.904 36.263 6.497   1.00 34.70  ? 287 CYS A N   1 
ATOM   1625 C CA  . CYS A 1 218 ? 46.544 35.768 6.398   1.00 36.98  ? 287 CYS A CA  1 
ATOM   1626 C C   . CYS A 1 218 ? 45.715 36.839 5.698   1.00 41.78  ? 287 CYS A C   1 
ATOM   1627 O O   . CYS A 1 218 ? 46.251 37.803 5.139   1.00 37.15  ? 287 CYS A O   1 
ATOM   1628 C CB  . CYS A 1 218 ? 45.996 35.394 7.781   1.00 41.94  ? 287 CYS A CB  1 
ATOM   1629 S SG  . CYS A 1 218 ? 46.210 36.656 9.053   1.00 54.03  ? 287 CYS A SG  1 
ATOM   1630 N N   . LEU A 1 219 ? 44.398 36.671 5.724   1.00 39.13  ? 288 LEU A N   1 
ATOM   1631 C CA  . LEU A 1 219 ? 43.485 37.610 5.094   1.00 31.44  ? 288 LEU A CA  1 
ATOM   1632 C C   . LEU A 1 219 ? 42.733 38.409 6.150   1.00 32.03  ? 288 LEU A C   1 
ATOM   1633 O O   . LEU A 1 219 ? 42.526 37.947 7.277   1.00 35.18  ? 288 LEU A O   1 
ATOM   1634 C CB  . LEU A 1 219 ? 42.502 36.879 4.179   1.00 27.18  ? 288 LEU A CB  1 
ATOM   1635 C CG  . LEU A 1 219 ? 43.186 36.104 3.050   1.00 32.91  ? 288 LEU A CG  1 
ATOM   1636 C CD1 . LEU A 1 219 ? 42.205 35.818 1.933   1.00 33.89  ? 288 LEU A CD1 1 
ATOM   1637 C CD2 . LEU A 1 219 ? 44.393 36.861 2.517   1.00 19.82  ? 288 LEU A CD2 1 
ATOM   1638 N N   . ALA A 1 220 ? 42.340 39.627 5.784   1.00 25.84  ? 289 ALA A N   1 
ATOM   1639 C CA  . ALA A 1 220 ? 41.591 40.504 6.679   1.00 21.43  ? 289 ALA A CA  1 
ATOM   1640 C C   . ALA A 1 220 ? 40.453 41.148 5.899   1.00 29.42  ? 289 ALA A C   1 
ATOM   1641 O O   . ALA A 1 220 ? 40.680 42.032 5.066   1.00 28.95  ? 289 ALA A O   1 
ATOM   1642 C CB  . ALA A 1 220 ? 42.489 41.566 7.303   1.00 13.49  ? 289 ALA A CB  1 
ATOM   1643 N N   . LEU A 1 221 ? 39.236 40.692 6.166   1.00 24.90  ? 290 LEU A N   1 
ATOM   1644 C CA  . LEU A 1 221 ? 38.044 41.358 5.674   1.00 19.00  ? 290 LEU A CA  1 
ATOM   1645 C C   . LEU A 1 221 ? 37.733 42.537 6.580   1.00 20.09  ? 290 LEU A C   1 
ATOM   1646 O O   . LEU A 1 221 ? 37.647 42.374 7.797   1.00 24.72  ? 290 LEU A O   1 
ATOM   1647 C CB  . LEU A 1 221 ? 36.876 40.378 5.658   1.00 16.88  ? 290 LEU A CB  1 
ATOM   1648 C CG  . LEU A 1 221 ? 35.567 40.795 5.009   1.00 23.54  ? 290 LEU A CG  1 
ATOM   1649 C CD1 . LEU A 1 221 ? 35.783 41.060 3.530   1.00 28.09  ? 290 LEU A CD1 1 
ATOM   1650 C CD2 . LEU A 1 221 ? 34.560 39.680 5.209   1.00 21.60  ? 290 LEU A CD2 1 
ATOM   1651 N N   . VAL A 1 222 ? 37.594 43.728 6.000   1.00 28.97  ? 291 VAL A N   1 
ATOM   1652 C CA  . VAL A 1 222 ? 37.199 44.911 6.764   1.00 29.38  ? 291 VAL A CA  1 
ATOM   1653 C C   . VAL A 1 222 ? 35.685 45.046 6.632   1.00 28.99  ? 291 VAL A C   1 
ATOM   1654 O O   . VAL A 1 222 ? 35.171 45.505 5.609   1.00 26.59  ? 291 VAL A O   1 
ATOM   1655 C CB  . VAL A 1 222 ? 37.943 46.165 6.312   1.00 29.63  ? 291 VAL A CB  1 
ATOM   1656 C CG1 . VAL A 1 222 ? 37.790 47.250 7.359   1.00 19.94  ? 291 VAL A CG1 1 
ATOM   1657 C CG2 . VAL A 1 222 ? 39.427 45.844 6.116   1.00 28.62  ? 291 VAL A CG2 1 
ATOM   1658 N N   . ASP A 1 223 ? 34.977 44.646 7.694   1.00 36.04  ? 292 ASP A N   1 
ATOM   1659 C CA  . ASP A 1 223 ? 33.567 44.247 7.675   1.00 24.31  ? 292 ASP A CA  1 
ATOM   1660 C C   . ASP A 1 223 ? 32.768 45.184 8.578   1.00 24.46  ? 292 ASP A C   1 
ATOM   1661 O O   . ASP A 1 223 ? 32.727 44.998 9.800   1.00 26.52  ? 292 ASP A O   1 
ATOM   1662 C CB  . ASP A 1 223 ? 33.440 42.792 8.130   1.00 30.57  ? 292 ASP A CB  1 
ATOM   1663 C CG  . ASP A 1 223 ? 32.083 42.191 7.820   1.00 39.51  ? 292 ASP A CG  1 
ATOM   1664 O OD1 . ASP A 1 223 ? 31.158 42.968 7.499   1.00 37.75  ? 292 ASP A OD1 1 
ATOM   1665 O OD2 . ASP A 1 223 ? 31.947 40.943 7.900   1.00 32.50  ? 292 ASP A OD2 1 
ATOM   1666 N N   . THR A 1 224 ? 32.127 46.190 7.985   1.00 17.37  ? 293 THR A N   1 
ATOM   1667 C CA  . THR A 1 224 ? 31.406 47.162 8.797   1.00 24.42  ? 293 THR A CA  1 
ATOM   1668 C C   . THR A 1 224 ? 30.143 46.588 9.423   1.00 27.70  ? 293 THR A C   1 
ATOM   1669 O O   . THR A 1 224 ? 29.548 47.238 10.290  1.00 27.77  ? 293 THR A O   1 
ATOM   1670 C CB  . THR A 1 224 ? 31.065 48.399 7.967   1.00 22.49  ? 293 THR A CB  1 
ATOM   1671 O OG1 . THR A 1 224 ? 30.314 48.014 6.807   1.00 21.08  ? 293 THR A OG1 1 
ATOM   1672 C CG2 . THR A 1 224 ? 32.350 49.112 7.542   1.00 23.28  ? 293 THR A CG2 1 
ATOM   1673 N N   . GLY A 1 225 ? 29.726 45.399 9.014   1.00 17.24  ? 294 GLY A N   1 
ATOM   1674 C CA  . GLY A 1 225 ? 28.595 44.746 9.623   1.00 18.90  ? 294 GLY A CA  1 
ATOM   1675 C C   . GLY A 1 225 ? 28.954 43.739 10.682  1.00 25.93  ? 294 GLY A C   1 
ATOM   1676 O O   . GLY A 1 225 ? 28.057 43.110 11.252  1.00 31.80  ? 294 GLY A O   1 
ATOM   1677 N N   . ALA A 1 226 ? 30.244 43.558 10.956  1.00 16.98  ? 295 ALA A N   1 
ATOM   1678 C CA  . ALA A 1 226 ? 30.696 42.670 12.019  1.00 21.59  ? 295 ALA A CA  1 
ATOM   1679 C C   . ALA A 1 226 ? 30.820 43.447 13.328  1.00 20.95  ? 295 ALA A C   1 
ATOM   1680 O O   . ALA A 1 226 ? 31.481 44.487 13.380  1.00 30.49  ? 295 ALA A O   1 
ATOM   1681 C CB  . ALA A 1 226 ? 32.031 42.033 11.641  1.00 11.00  ? 295 ALA A CB  1 
ATOM   1682 N N   . SER A 1 227 ? 30.172 42.948 14.382  1.00 16.82  ? 296 SER A N   1 
ATOM   1683 C CA  . SER A 1 227 ? 30.220 43.637 15.669  1.00 14.50  ? 296 SER A CA  1 
ATOM   1684 C C   . SER A 1 227 ? 31.571 43.442 16.345  1.00 18.94  ? 296 SER A C   1 
ATOM   1685 O O   . SER A 1 227 ? 32.170 44.403 16.840  1.00 22.75  ? 296 SER A O   1 
ATOM   1686 C CB  . SER A 1 227 ? 29.093 43.148 16.573  1.00 16.40  ? 296 SER A CB  1 
ATOM   1687 O OG  . SER A 1 227 ? 27.882 43.009 15.848  1.00 35.05  ? 296 SER A OG  1 
ATOM   1688 N N   . TYR A 1 228 ? 32.066 42.207 16.373  1.00 19.36  ? 297 TYR A N   1 
ATOM   1689 C CA  . TYR A 1 228 ? 33.369 41.876 16.934  1.00 24.51  ? 297 TYR A CA  1 
ATOM   1690 C C   . TYR A 1 228 ? 34.398 41.702 15.823  1.00 23.30  ? 297 TYR A C   1 
ATOM   1691 O O   . TYR A 1 228 ? 34.060 41.502 14.656  1.00 30.51  ? 297 TYR A O   1 
ATOM   1692 C CB  . TYR A 1 228 ? 33.322 40.578 17.752  1.00 15.97  ? 297 TYR A CB  1 
ATOM   1693 C CG  . TYR A 1 228 ? 32.447 40.556 18.991  1.00 24.87  ? 297 TYR A CG  1 
ATOM   1694 C CD1 . TYR A 1 228 ? 31.687 41.657 19.373  1.00 32.06  ? 297 TYR A CD1 1 
ATOM   1695 C CD2 . TYR A 1 228 ? 32.382 39.411 19.782  1.00 24.00  ? 297 TYR A CD2 1 
ATOM   1696 C CE1 . TYR A 1 228 ? 30.890 41.614 20.507  1.00 34.24  ? 297 TYR A CE1 1 
ATOM   1697 C CE2 . TYR A 1 228 ? 31.591 39.360 20.913  1.00 24.03  ? 297 TYR A CE2 1 
ATOM   1698 C CZ  . TYR A 1 228 ? 30.847 40.462 21.271  1.00 30.84  ? 297 TYR A CZ  1 
ATOM   1699 O OH  . TYR A 1 228 ? 30.057 40.409 22.397  1.00 27.44  ? 297 TYR A OH  1 
ATOM   1700 N N   . ILE A 1 229 ? 35.672 41.775 16.207  1.00 22.66  ? 298 ILE A N   1 
ATOM   1701 C CA  . ILE A 1 229 ? 36.725 41.169 15.404  1.00 14.70  ? 298 ILE A CA  1 
ATOM   1702 C C   . ILE A 1 229 ? 36.539 39.660 15.428  1.00 20.11  ? 298 ILE A C   1 
ATOM   1703 O O   . ILE A 1 229 ? 36.217 39.078 16.474  1.00 26.31  ? 298 ILE A O   1 
ATOM   1704 C CB  . ILE A 1 229 ? 38.111 41.549 15.954  1.00 20.78  ? 298 ILE A CB  1 
ATOM   1705 C CG1 . ILE A 1 229 ? 38.409 43.032 15.732  1.00 25.67  ? 298 ILE A CG1 1 
ATOM   1706 C CG2 . ILE A 1 229 ? 39.192 40.665 15.346  1.00 12.56  ? 298 ILE A CG2 1 
ATOM   1707 C CD1 . ILE A 1 229 ? 39.487 43.561 16.649  1.00 22.54  ? 298 ILE A CD1 1 
ATOM   1708 N N   . SER A 1 230 ? 36.741 39.005 14.285  1.00 23.16  ? 299 SER A N   1 
ATOM   1709 C CA  . SER A 1 230 ? 36.697 37.551 14.262  1.00 22.53  ? 299 SER A CA  1 
ATOM   1710 C C   . SER A 1 230 ? 37.906 36.990 13.531  1.00 22.02  ? 299 SER A C   1 
ATOM   1711 O O   . SER A 1 230 ? 38.488 37.637 12.657  1.00 26.46  ? 299 SER A O   1 
ATOM   1712 C CB  . SER A 1 230 ? 35.397 37.019 13.625  1.00 26.03  ? 299 SER A CB  1 
ATOM   1713 O OG  . SER A 1 230 ? 35.432 37.078 12.211  1.00 37.14  ? 299 SER A OG  1 
ATOM   1714 N N   . GLY A 1 231 ? 38.281 35.773 13.920  1.00 15.89  ? 300 GLY A N   1 
ATOM   1715 C CA  . GLY A 1 231 ? 39.268 34.995 13.203  1.00 19.52  ? 300 GLY A CA  1 
ATOM   1716 C C   . GLY A 1 231 ? 38.832 33.546 13.144  1.00 27.86  ? 300 GLY A C   1 
ATOM   1717 O O   . GLY A 1 231 ? 37.808 33.167 13.716  1.00 21.93  ? 300 GLY A O   1 
ATOM   1718 N N   . SER A 1 232 ? 39.620 32.745 12.429  1.00 30.82  ? 301 SER A N   1 
ATOM   1719 C CA  . SER A 1 232 ? 39.392 31.309 12.386  1.00 19.97  ? 301 SER A CA  1 
ATOM   1720 C C   . SER A 1 232 ? 39.385 30.728 13.796  1.00 26.95  ? 301 SER A C   1 
ATOM   1721 O O   . SER A 1 232 ? 39.971 31.287 14.728  1.00 30.98  ? 301 SER A O   1 
ATOM   1722 C CB  . SER A 1 232 ? 40.469 30.622 11.550  1.00 33.08  ? 301 SER A CB  1 
ATOM   1723 O OG  . SER A 1 232 ? 41.626 30.349 12.328  1.00 41.30  ? 301 SER A OG  1 
ATOM   1724 N N   . THR A 1 233 ? 38.705 29.587 13.945  1.00 28.46  ? 302 THR A N   1 
ATOM   1725 C CA  . THR A 1 233 ? 38.670 28.920 15.244  1.00 31.16  ? 302 THR A CA  1 
ATOM   1726 C C   . THR A 1 233 ? 40.074 28.600 15.735  1.00 33.49  ? 302 THR A C   1 
ATOM   1727 O O   . THR A 1 233 ? 40.386 28.791 16.915  1.00 32.66  ? 302 THR A O   1 
ATOM   1728 C CB  . THR A 1 233 ? 37.848 27.637 15.169  1.00 29.06  ? 302 THR A CB  1 
ATOM   1729 O OG1 . THR A 1 233 ? 36.550 27.927 14.640  1.00 28.30  ? 302 THR A OG1 1 
ATOM   1730 C CG2 . THR A 1 233 ? 37.698 27.033 16.555  1.00 32.63  ? 302 THR A CG2 1 
ATOM   1731 N N   . SER A 1 234 ? 40.931 28.107 14.840  1.00 39.19  ? 303 SER A N   1 
ATOM   1732 C CA  . SER A 1 234 ? 42.306 27.791 15.211  1.00 38.68  ? 303 SER A CA  1 
ATOM   1733 C C   . SER A 1 234 ? 43.011 29.014 15.781  1.00 40.00  ? 303 SER A C   1 
ATOM   1734 O O   . SER A 1 234 ? 43.541 28.974 16.898  1.00 27.88  ? 303 SER A O   1 
ATOM   1735 C CB  . SER A 1 234 ? 43.056 27.245 13.995  1.00 42.93  ? 303 SER A CB  1 
ATOM   1736 O OG  . SER A 1 234 ? 44.453 27.204 14.224  1.00 55.45  ? 303 SER A OG  1 
ATOM   1737 N N   . SER A 1 235 ? 43.010 30.120 15.030  1.00 45.52  ? 304 SER A N   1 
ATOM   1738 C CA  . SER A 1 235 ? 43.678 31.337 15.485  1.00 31.41  ? 304 SER A CA  1 
ATOM   1739 C C   . SER A 1 235 ? 43.115 31.807 16.819  1.00 36.91  ? 304 SER A C   1 
ATOM   1740 O O   . SER A 1 235 ? 43.867 32.063 17.767  1.00 43.40  ? 304 SER A O   1 
ATOM   1741 C CB  . SER A 1 235 ? 43.538 32.439 14.432  1.00 28.23  ? 304 SER A CB  1 
ATOM   1742 O OG  . SER A 1 235 ? 44.138 32.063 13.206  1.00 32.83  ? 304 SER A OG  1 
ATOM   1743 N N   . ILE A 1 236 ? 41.786 31.914 16.913  1.00 30.09  ? 305 ILE A N   1 
ATOM   1744 C CA  . ILE A 1 236 ? 41.161 32.494 18.098  1.00 17.71  ? 305 ILE A CA  1 
ATOM   1745 C C   . ILE A 1 236 ? 41.408 31.623 19.324  1.00 25.34  ? 305 ILE A C   1 
ATOM   1746 O O   . ILE A 1 236 ? 41.631 32.138 20.425  1.00 25.96  ? 305 ILE A O   1 
ATOM   1747 C CB  . ILE A 1 236 ? 39.659 32.724 17.848  1.00 19.71  ? 305 ILE A CB  1 
ATOM   1748 C CG1 . ILE A 1 236 ? 39.457 33.806 16.786  1.00 21.99  ? 305 ILE A CG1 1 
ATOM   1749 C CG2 . ILE A 1 236 ? 38.946 33.118 19.136  1.00 21.09  ? 305 ILE A CG2 1 
ATOM   1750 C CD1 . ILE A 1 236 ? 40.103 35.124 17.123  1.00 14.84  ? 305 ILE A CD1 1 
ATOM   1751 N N   . GLU A 1 237 ? 41.378 30.294 19.161  1.00 27.50  ? 306 GLU A N   1 
ATOM   1752 C CA  . GLU A 1 237 ? 41.695 29.412 20.283  1.00 24.66  ? 306 GLU A CA  1 
ATOM   1753 C C   . GLU A 1 237 ? 43.086 29.708 20.826  1.00 32.19  ? 306 GLU A C   1 
ATOM   1754 O O   . GLU A 1 237 ? 43.283 29.780 22.045  1.00 32.00  ? 306 GLU A O   1 
ATOM   1755 C CB  . GLU A 1 237 ? 41.583 27.943 19.865  1.00 17.88  ? 306 GLU A CB  1 
ATOM   1756 N N   . LYS A 1 238 ? 44.058 29.912 19.929  1.00 36.09  ? 307 LYS A N   1 
ATOM   1757 C CA  . LYS A 1 238 ? 45.411 30.248 20.361  1.00 36.03  ? 307 LYS A CA  1 
ATOM   1758 C C   . LYS A 1 238 ? 45.478 31.656 20.938  1.00 34.66  ? 307 LYS A C   1 
ATOM   1759 O O   . LYS A 1 238 ? 46.231 31.904 21.885  1.00 37.71  ? 307 LYS A O   1 
ATOM   1760 C CB  . LYS A 1 238 ? 46.386 30.106 19.194  1.00 32.87  ? 307 LYS A CB  1 
ATOM   1761 C CG  . LYS A 1 238 ? 46.815 28.680 18.917  1.00 42.92  ? 307 LYS A CG  1 
ATOM   1762 C CD  . LYS A 1 238 ? 47.457 28.559 17.543  1.00 56.62  ? 307 LYS A CD  1 
ATOM   1763 N N   . LEU A 1 239 ? 44.710 32.593 20.376  1.00 33.90  ? 308 LEU A N   1 
ATOM   1764 C CA  . LEU A 1 239 ? 44.728 33.963 20.882  1.00 27.21  ? 308 LEU A CA  1 
ATOM   1765 C C   . LEU A 1 239 ? 44.166 34.034 22.295  1.00 29.36  ? 308 LEU A C   1 
ATOM   1766 O O   . LEU A 1 239 ? 44.699 34.748 23.154  1.00 31.28  ? 308 LEU A O   1 
ATOM   1767 C CB  . LEU A 1 239 ? 43.936 34.877 19.947  1.00 25.93  ? 308 LEU A CB  1 
ATOM   1768 C CG  . LEU A 1 239 ? 43.564 36.260 20.483  1.00 27.12  ? 308 LEU A CG  1 
ATOM   1769 C CD1 . LEU A 1 239 ? 44.783 37.122 20.548  1.00 33.97  ? 308 LEU A CD1 1 
ATOM   1770 C CD2 . LEU A 1 239 ? 42.520 36.920 19.608  1.00 22.92  ? 308 LEU A CD2 1 
ATOM   1771 N N   . MET A 1 240 ? 43.090 33.289 22.553  1.00 27.07  ? 309 MET A N   1 
ATOM   1772 C CA  . MET A 1 240 ? 42.418 33.337 23.846  1.00 25.66  ? 309 MET A CA  1 
ATOM   1773 C C   . MET A 1 240 ? 43.229 32.622 24.920  1.00 34.33  ? 309 MET A C   1 
ATOM   1774 O O   . MET A 1 240 ? 43.222 33.041 26.085  1.00 31.74  ? 309 MET A O   1 
ATOM   1775 C CB  . MET A 1 240 ? 41.028 32.711 23.712  1.00 15.65  ? 309 MET A CB  1 
ATOM   1776 C CG  . MET A 1 240 ? 40.013 33.577 22.979  1.00 20.91  ? 309 MET A CG  1 
ATOM   1777 S SD  . MET A 1 240 ? 39.779 35.221 23.661  1.00 31.73  ? 309 MET A SD  1 
ATOM   1778 C CE  . MET A 1 240 ? 38.924 36.074 22.328  1.00 20.76  ? 309 MET A CE  1 
ATOM   1779 N N   . GLU A 1 241 ? 43.922 31.540 24.552  1.00 35.01  ? 310 GLU A N   1 
ATOM   1780 C CA  . GLU A 1 241 ? 44.818 30.891 25.501  1.00 28.86  ? 310 GLU A CA  1 
ATOM   1781 C C   . GLU A 1 241 ? 45.911 31.850 25.946  1.00 35.76  ? 310 GLU A C   1 
ATOM   1782 O O   . GLU A 1 241 ? 46.216 31.946 27.140  1.00 38.84  ? 310 GLU A O   1 
ATOM   1783 C CB  . GLU A 1 241 ? 45.419 29.628 24.884  1.00 41.60  ? 310 GLU A CB  1 
ATOM   1784 C CG  . GLU A 1 241 ? 46.085 28.695 25.887  1.00 55.51  ? 310 GLU A CG  1 
ATOM   1785 C CD  . GLU A 1 241 ? 46.516 27.377 25.262  1.00 68.27  ? 310 GLU A CD  1 
ATOM   1786 O OE1 . GLU A 1 241 ? 46.160 27.128 24.090  1.00 70.25  ? 310 GLU A OE1 1 
ATOM   1787 O OE2 . GLU A 1 241 ? 47.216 26.592 25.941  1.00 72.42  ? 310 GLU A OE2 1 
ATOM   1788 N N   . ALA A 1 242 ? 46.488 32.596 24.999  1.00 35.30  ? 311 ALA A N   1 
ATOM   1789 C CA  . ALA A 1 242 ? 47.516 33.570 25.347  1.00 26.84  ? 311 ALA A CA  1 
ATOM   1790 C C   . ALA A 1 242 ? 46.957 34.662 26.248  1.00 32.58  ? 311 ALA A C   1 
ATOM   1791 O O   . ALA A 1 242 ? 47.647 35.140 27.156  1.00 41.87  ? 311 ALA A O   1 
ATOM   1792 C CB  . ALA A 1 242 ? 48.122 34.167 24.077  1.00 21.40  ? 311 ALA A CB  1 
ATOM   1793 N N   . LEU A 1 243 ? 45.705 35.066 26.018  1.00 31.34  ? 312 LEU A N   1 
ATOM   1794 C CA  . LEU A 1 243 ? 45.062 36.051 26.879  1.00 32.31  ? 312 LEU A CA  1 
ATOM   1795 C C   . LEU A 1 243 ? 44.564 35.458 28.191  1.00 34.49  ? 312 LEU A C   1 
ATOM   1796 O O   . LEU A 1 243 ? 44.199 36.215 29.098  1.00 35.13  ? 312 LEU A O   1 
ATOM   1797 C CB  . LEU A 1 243 ? 43.892 36.712 26.148  1.00 25.30  ? 312 LEU A CB  1 
ATOM   1798 C CG  . LEU A 1 243 ? 44.238 37.596 24.951  1.00 26.87  ? 312 LEU A CG  1 
ATOM   1799 C CD1 . LEU A 1 243 ? 43.003 38.329 24.484  1.00 17.04  ? 312 LEU A CD1 1 
ATOM   1800 C CD2 . LEU A 1 243 ? 45.336 38.577 25.307  1.00 26.63  ? 312 LEU A CD2 1 
ATOM   1801 N N   . GLY A 1 244 ? 44.545 34.135 28.319  1.00 24.91  ? 313 GLY A N   1 
ATOM   1802 C CA  . GLY A 1 244 ? 44.021 33.523 29.524  1.00 35.61  ? 313 GLY A CA  1 
ATOM   1803 C C   . GLY A 1 244 ? 42.526 33.653 29.673  1.00 37.55  ? 313 GLY A C   1 
ATOM   1804 O O   . GLY A 1 244 ? 42.024 33.709 30.799  1.00 45.45  ? 313 GLY A O   1 
ATOM   1805 N N   . ALA A 1 245 ? 41.800 33.692 28.563  1.00 31.75  ? 314 ALA A N   1 
ATOM   1806 C CA  . ALA A 1 245 ? 40.362 33.900 28.562  1.00 34.11  ? 314 ALA A CA  1 
ATOM   1807 C C   . ALA A 1 245 ? 39.634 32.565 28.512  1.00 34.12  ? 314 ALA A C   1 
ATOM   1808 O O   . ALA A 1 245 ? 40.082 31.627 27.849  1.00 46.54  ? 314 ALA A O   1 
ATOM   1809 C CB  . ALA A 1 245 ? 39.946 34.763 27.371  1.00 31.32  ? 314 ALA A CB  1 
ATOM   1810 N N   . LYS A 1 246 ? 38.509 32.486 29.214  1.00 38.61  ? 315 LYS A N   1 
ATOM   1811 C CA  . LYS A 1 246 ? 37.672 31.297 29.221  1.00 41.36  ? 315 LYS A CA  1 
ATOM   1812 C C   . LYS A 1 246 ? 36.525 31.460 28.228  1.00 45.39  ? 315 LYS A C   1 
ATOM   1813 O O   . LYS A 1 246 ? 36.079 32.572 27.936  1.00 49.75  ? 315 LYS A O   1 
ATOM   1814 C CB  . LYS A 1 246 ? 37.124 31.022 30.625  1.00 45.33  ? 315 LYS A CB  1 
ATOM   1815 C CG  . LYS A 1 246 ? 38.135 30.385 31.577  1.00 55.94  ? 315 LYS A CG  1 
ATOM   1816 C CD  . LYS A 1 246 ? 38.256 28.883 31.335  1.00 66.22  ? 315 LYS A CD  1 
ATOM   1817 C CE  . LYS A 1 246 ? 39.558 28.315 31.894  1.00 68.24  ? 315 LYS A CE  1 
ATOM   1818 N NZ  . LYS A 1 246 ? 40.759 28.780 31.140  1.00 63.44  ? 315 LYS A NZ  1 
ATOM   1819 N N   . LYS A 1 247 ? 36.061 30.338 27.696  1.00 39.13  ? 316 LYS A N   1 
ATOM   1820 C CA  . LYS A 1 247 ? 34.969 30.330 26.736  1.00 36.18  ? 316 LYS A CA  1 
ATOM   1821 C C   . LYS A 1 247 ? 33.690 29.843 27.404  1.00 35.69  ? 316 LYS A C   1 
ATOM   1822 O O   . LYS A 1 247 ? 33.698 28.868 28.163  1.00 27.50  ? 316 LYS A O   1 
ATOM   1823 C CB  . LYS A 1 247 ? 35.307 29.451 25.526  1.00 28.15  ? 316 LYS A CB  1 
ATOM   1824 C CG  . LYS A 1 247 ? 34.139 29.177 24.608  1.00 33.98  ? 316 LYS A CG  1 
ATOM   1825 C CD  . LYS A 1 247 ? 34.420 29.661 23.199  1.00 52.63  ? 316 LYS A CD  1 
ATOM   1826 C CE  . LYS A 1 247 ? 33.200 29.552 22.286  1.00 65.32  ? 316 LYS A CE  1 
ATOM   1827 N NZ  . LYS A 1 247 ? 32.170 30.598 22.550  1.00 62.86  ? 316 LYS A NZ  1 
ATOM   1828 N N   . ARG A 1 248 ? 32.599 30.542 27.137  1.00 31.88  ? 317 ARG A N   1 
ATOM   1829 C CA  . ARG A 1 248 ? 31.270 30.109 27.516  1.00 33.24  ? 317 ARG A CA  1 
ATOM   1830 C C   . ARG A 1 248 ? 30.507 29.744 26.250  1.00 32.76  ? 317 ARG A C   1 
ATOM   1831 O O   . ARG A 1 248 ? 31.080 29.679 25.160  1.00 40.23  ? 317 ARG A O   1 
ATOM   1832 C CB  . ARG A 1 248 ? 30.589 31.193 28.349  1.00 37.02  ? 317 ARG A CB  1 
ATOM   1833 C CG  . ARG A 1 248 ? 31.488 31.703 29.463  1.00 41.54  ? 317 ARG A CG  1 
ATOM   1834 C CD  . ARG A 1 248 ? 30.736 32.529 30.480  1.00 41.47  ? 317 ARG A CD  1 
ATOM   1835 N NE  . ARG A 1 248 ? 30.135 33.708 29.872  1.00 45.12  ? 317 ARG A NE  1 
ATOM   1836 C CZ  . ARG A 1 248 ? 29.657 34.741 30.560  1.00 39.84  ? 317 ARG A CZ  1 
ATOM   1837 N NH1 . ARG A 1 248 ? 29.126 35.772 29.914  1.00 37.77  ? 317 ARG A NH1 1 
ATOM   1838 N NH2 . ARG A 1 248 ? 29.719 34.748 31.890  1.00 22.32  ? 317 ARG A NH2 1 
ATOM   1839 N N   . LEU A 1 249 ? 29.213 29.468 26.398  1.00 38.93  ? 318 LEU A N   1 
ATOM   1840 C CA  . LEU A 1 249 ? 28.399 29.099 25.244  1.00 32.60  ? 318 LEU A CA  1 
ATOM   1841 C C   . LEU A 1 249 ? 28.494 30.149 24.140  1.00 36.14  ? 318 LEU A C   1 
ATOM   1842 O O   . LEU A 1 249 ? 28.752 29.824 22.975  1.00 30.10  ? 318 LEU A O   1 
ATOM   1843 C CB  . LEU A 1 249 ? 26.950 28.900 25.685  1.00 30.95  ? 318 LEU A CB  1 
ATOM   1844 C CG  . LEU A 1 249 ? 25.916 28.559 24.621  1.00 26.21  ? 318 LEU A CG  1 
ATOM   1845 C CD1 . LEU A 1 249 ? 26.174 27.160 24.083  1.00 24.20  ? 318 LEU A CD1 1 
ATOM   1846 C CD2 . LEU A 1 249 ? 24.519 28.681 25.213  1.00 26.51  ? 318 LEU A CD2 1 
ATOM   1847 N N   . PHE A 1 250 ? 28.323 31.422 24.498  1.00 44.85  ? 319 PHE A N   1 
ATOM   1848 C CA  . PHE A 1 250 ? 28.327 32.509 23.522  1.00 43.36  ? 319 PHE A CA  1 
ATOM   1849 C C   . PHE A 1 250 ? 29.707 33.143 23.359  1.00 37.44  ? 319 PHE A C   1 
ATOM   1850 O O   . PHE A 1 250 ? 30.270 33.152 22.261  1.00 46.00  ? 319 PHE A O   1 
ATOM   1851 C CB  . PHE A 1 250 ? 27.313 33.584 23.935  1.00 45.77  ? 319 PHE A CB  1 
ATOM   1852 C CG  . PHE A 1 250 ? 25.882 33.141 23.857  1.00 45.24  ? 319 PHE A CG  1 
ATOM   1853 C CD1 . PHE A 1 250 ? 25.461 32.268 22.864  1.00 49.42  ? 319 PHE A CD1 1 
ATOM   1854 C CD2 . PHE A 1 250 ? 24.953 33.606 24.775  1.00 43.80  ? 319 PHE A CD2 1 
ATOM   1855 C CE1 . PHE A 1 250 ? 24.141 31.863 22.792  1.00 47.91  ? 319 PHE A CE1 1 
ATOM   1856 C CE2 . PHE A 1 250 ? 23.632 33.208 24.707  1.00 51.26  ? 319 PHE A CE2 1 
ATOM   1857 C CZ  . PHE A 1 250 ? 23.225 32.335 23.712  1.00 49.94  ? 319 PHE A CZ  1 
ATOM   1858 N N   . ASP A 1 251 ? 30.262 33.677 24.439  1.00 35.87  ? 320 ASP A N   1 
ATOM   1859 C CA  . ASP A 1 251 ? 31.357 34.632 24.358  1.00 28.79  ? 320 ASP A CA  1 
ATOM   1860 C C   . ASP A 1 251 ? 32.653 34.061 24.927  1.00 27.73  ? 320 ASP A C   1 
ATOM   1861 O O   . ASP A 1 251 ? 32.696 32.965 25.491  1.00 33.09  ? 320 ASP A O   1 
ATOM   1862 C CB  . ASP A 1 251 ? 30.983 35.932 25.091  1.00 31.21  ? 320 ASP A CB  1 
ATOM   1863 C CG  . ASP A 1 251 ? 30.310 35.683 26.445  1.00 43.50  ? 320 ASP A CG  1 
ATOM   1864 O OD1 . ASP A 1 251 ? 29.723 34.596 26.650  1.00 50.25  ? 320 ASP A OD1 1 
ATOM   1865 O OD2 . ASP A 1 251 ? 30.355 36.588 27.307  1.00 43.30  ? 320 ASP A OD2 1 
ATOM   1866 N N   . TYR A 1 252 ? 33.724 34.831 24.756  1.00 22.06  ? 321 TYR A N   1 
ATOM   1867 C CA  . TYR A 1 252 ? 34.961 34.642 25.502  1.00 26.55  ? 321 TYR A CA  1 
ATOM   1868 C C   . TYR A 1 252 ? 35.014 35.667 26.631  1.00 30.63  ? 321 TYR A C   1 
ATOM   1869 O O   . TYR A 1 252 ? 34.778 36.860 26.403  1.00 35.77  ? 321 TYR A O   1 
ATOM   1870 C CB  . TYR A 1 252 ? 36.179 34.791 24.591  1.00 24.84  ? 321 TYR A CB  1 
ATOM   1871 C CG  . TYR A 1 252 ? 36.470 33.586 23.718  1.00 26.09  ? 321 TYR A CG  1 
ATOM   1872 C CD1 . TYR A 1 252 ? 37.161 32.485 24.221  1.00 23.96  ? 321 TYR A CD1 1 
ATOM   1873 C CD2 . TYR A 1 252 ? 36.067 33.556 22.390  1.00 27.37  ? 321 TYR A CD2 1 
ATOM   1874 C CE1 . TYR A 1 252 ? 37.444 31.389 23.420  1.00 29.28  ? 321 TYR A CE1 1 
ATOM   1875 C CE2 . TYR A 1 252 ? 36.337 32.459 21.580  1.00 29.51  ? 321 TYR A CE2 1 
ATOM   1876 C CZ  . TYR A 1 252 ? 37.030 31.384 22.099  1.00 30.27  ? 321 TYR A CZ  1 
ATOM   1877 O OH  . TYR A 1 252 ? 37.297 30.295 21.303  1.00 30.86  ? 321 TYR A OH  1 
ATOM   1878 N N   . VAL A 1 253 ? 35.322 35.204 27.845  1.00 28.07  ? 322 VAL A N   1 
ATOM   1879 C CA  . VAL A 1 253 ? 35.279 36.043 29.037  1.00 24.55  ? 322 VAL A CA  1 
ATOM   1880 C C   . VAL A 1 253 ? 36.624 36.032 29.747  1.00 31.34  ? 322 VAL A C   1 
ATOM   1881 O O   . VAL A 1 253 ? 37.425 35.100 29.612  1.00 28.15  ? 322 VAL A O   1 
ATOM   1882 C CB  . VAL A 1 253 ? 34.174 35.605 30.027  1.00 28.21  ? 322 VAL A CB  1 
ATOM   1883 C CG1 . VAL A 1 253 ? 32.797 35.923 29.476  1.00 20.18  ? 322 VAL A CG1 1 
ATOM   1884 C CG2 . VAL A 1 253 ? 34.315 34.119 30.368  1.00 22.63  ? 322 VAL A CG2 1 
ATOM   1885 N N   . VAL A 1 254 ? 36.865 37.102 30.507  1.00 26.84  ? 323 VAL A N   1 
ATOM   1886 C CA  . VAL A 1 254 ? 37.878 37.149 31.550  1.00 25.50  ? 323 VAL A CA  1 
ATOM   1887 C C   . VAL A 1 254 ? 37.219 37.736 32.786  1.00 32.21  ? 323 VAL A C   1 
ATOM   1888 O O   . VAL A 1 254 ? 36.168 38.378 32.714  1.00 31.66  ? 323 VAL A O   1 
ATOM   1889 C CB  . VAL A 1 254 ? 39.118 37.983 31.165  1.00 26.86  ? 323 VAL A CB  1 
ATOM   1890 C CG1 . VAL A 1 254 ? 39.856 37.345 29.999  1.00 27.29  ? 323 VAL A CG1 1 
ATOM   1891 C CG2 . VAL A 1 254 ? 38.716 39.421 30.845  1.00 22.36  ? 323 VAL A CG2 1 
ATOM   1892 N N   . LYS A 1 255 ? 37.845 37.515 33.934  1.00 34.53  ? 324 LYS A N   1 
ATOM   1893 C CA  . LYS A 1 255 ? 37.371 38.190 35.129  1.00 32.36  ? 324 LYS A CA  1 
ATOM   1894 C C   . LYS A 1 255 ? 37.544 39.695 34.961  1.00 39.93  ? 324 LYS A C   1 
ATOM   1895 O O   . LYS A 1 255 ? 38.576 40.171 34.478  1.00 47.39  ? 324 LYS A O   1 
ATOM   1896 C CB  . LYS A 1 255 ? 38.107 37.673 36.359  1.00 31.66  ? 324 LYS A CB  1 
ATOM   1897 C CG  . LYS A 1 255 ? 37.966 36.169 36.533  1.00 44.77  ? 324 LYS A CG  1 
ATOM   1898 C CD  . LYS A 1 255 ? 39.187 35.524 37.171  1.00 64.02  ? 324 LYS A CD  1 
ATOM   1899 C CE  . LYS A 1 255 ? 39.845 36.426 38.206  1.00 71.05  ? 324 LYS A CE  1 
ATOM   1900 N NZ  . LYS A 1 255 ? 41.272 36.041 38.413  1.00 65.94  ? 324 LYS A NZ  1 
ATOM   1901 N N   . CYS A 1 256 ? 36.502 40.442 35.330  1.00 32.50  ? 325 CYS A N   1 
ATOM   1902 C CA  . CYS A 1 256 ? 36.467 41.872 35.045  1.00 31.32  ? 325 CYS A CA  1 
ATOM   1903 C C   . CYS A 1 256 ? 37.623 42.618 35.697  1.00 40.65  ? 325 CYS A C   1 
ATOM   1904 O O   . CYS A 1 256 ? 38.108 43.610 35.142  1.00 42.55  ? 325 CYS A O   1 
ATOM   1905 C CB  . CYS A 1 256 ? 35.132 42.449 35.504  1.00 31.96  ? 325 CYS A CB  1 
ATOM   1906 S SG  . CYS A 1 256 ? 33.725 41.770 34.603  1.00 38.00  ? 325 CYS A SG  1 
ATOM   1907 N N   . ASN A 1 257 ? 38.079 42.169 36.868  1.00 34.95  ? 326 ASN A N   1 
ATOM   1908 C CA  . ASN A 1 257 ? 39.213 42.829 37.504  1.00 38.30  ? 326 ASN A CA  1 
ATOM   1909 C C   . ASN A 1 257 ? 40.495 42.648 36.701  1.00 35.27  ? 326 ASN A C   1 
ATOM   1910 O O   . ASN A 1 257 ? 41.387 43.498 36.762  1.00 34.32  ? 326 ASN A O   1 
ATOM   1911 C CB  . ASN A 1 257 ? 39.403 42.302 38.922  1.00 41.99  ? 326 ASN A CB  1 
ATOM   1912 C CG  . ASN A 1 257 ? 39.950 40.892 38.947  1.00 40.84  ? 326 ASN A CG  1 
ATOM   1913 O OD1 . ASN A 1 257 ? 39.296 39.956 38.494  1.00 51.13  ? 326 ASN A OD1 1 
ATOM   1914 N ND2 . ASN A 1 257 ? 41.153 40.732 39.478  1.00 33.20  ? 326 ASN A ND2 1 
ATOM   1915 N N   . GLU A 1 258 ? 40.603 41.561 35.945  1.00 38.27  ? 327 GLU A N   1 
ATOM   1916 C CA  . GLU A 1 258 ? 41.813 41.250 35.198  1.00 33.36  ? 327 GLU A CA  1 
ATOM   1917 C C   . GLU A 1 258 ? 41.828 41.849 33.800  1.00 37.02  ? 327 GLU A C   1 
ATOM   1918 O O   . GLU A 1 258 ? 42.835 41.711 33.098  1.00 36.00  ? 327 GLU A O   1 
ATOM   1919 C CB  . GLU A 1 258 ? 41.994 39.735 35.100  1.00 36.74  ? 327 GLU A CB  1 
ATOM   1920 C CG  . GLU A 1 258 ? 42.413 39.089 36.407  1.00 54.53  ? 327 GLU A CG  1 
ATOM   1921 C CD  . GLU A 1 258 ? 42.884 37.670 36.222  1.00 63.40  ? 327 GLU A CD  1 
ATOM   1922 O OE1 . GLU A 1 258 ? 42.075 36.849 35.744  1.00 62.87  ? 327 GLU A OE1 1 
ATOM   1923 O OE2 . GLU A 1 258 ? 44.051 37.374 36.571  1.00 66.55  ? 327 GLU A OE2 1 
ATOM   1924 N N   . GLY A 1 259 ? 40.747 42.504 33.385  1.00 36.79  ? 328 GLY A N   1 
ATOM   1925 C CA  . GLY A 1 259 ? 40.627 43.049 32.054  1.00 28.74  ? 328 GLY A CA  1 
ATOM   1926 C C   . GLY A 1 259 ? 41.720 44.026 31.664  1.00 37.96  ? 328 GLY A C   1 
ATOM   1927 O O   . GLY A 1 259 ? 42.401 43.845 30.649  1.00 38.91  ? 328 GLY A O   1 
ATOM   1928 N N   . PRO A 1 260 ? 41.895 45.098 32.442  1.00 31.05  ? 329 PRO A N   1 
ATOM   1929 C CA  . PRO A 1 260 ? 42.889 46.119 32.063  1.00 31.80  ? 329 PRO A CA  1 
ATOM   1930 C C   . PRO A 1 260 ? 44.325 45.623 32.073  1.00 36.11  ? 329 PRO A C   1 
ATOM   1931 O O   . PRO A 1 260 ? 45.186 46.259 31.454  1.00 28.70  ? 329 PRO A O   1 
ATOM   1932 C CB  . PRO A 1 260 ? 42.670 47.226 33.103  1.00 30.52  ? 329 PRO A CB  1 
ATOM   1933 C CG  . PRO A 1 260 ? 41.270 47.032 33.565  1.00 31.46  ? 329 PRO A CG  1 
ATOM   1934 C CD  . PRO A 1 260 ? 41.033 45.556 33.546  1.00 23.73  ? 329 PRO A CD  1 
ATOM   1935 N N   . THR A 1 261 ? 44.615 44.517 32.755  1.00 44.11  ? 330 THR A N   1 
ATOM   1936 C CA  . THR A 1 261 ? 45.952 43.937 32.764  1.00 37.37  ? 330 THR A CA  1 
ATOM   1937 C C   . THR A 1 261 ? 46.224 43.086 31.526  1.00 37.76  ? 330 THR A C   1 
ATOM   1938 O O   . THR A 1 261 ? 47.349 42.604 31.352  1.00 35.35  ? 330 THR A O   1 
ATOM   1939 C CB  . THR A 1 261 ? 46.136 43.111 34.047  1.00 37.18  ? 330 THR A CB  1 
ATOM   1940 O OG1 . THR A 1 261 ? 45.605 43.842 35.154  1.00 45.17  ? 330 THR A OG1 1 
ATOM   1941 C CG2 . THR A 1 261 ? 47.596 42.834 34.335  1.00 51.05  ? 330 THR A CG2 1 
ATOM   1942 N N   . LEU A 1 262 ? 45.232 42.906 30.658  1.00 42.67  ? 331 LEU A N   1 
ATOM   1943 C CA  . LEU A 1 262 ? 45.408 42.059 29.489  1.00 39.23  ? 331 LEU A CA  1 
ATOM   1944 C C   . LEU A 1 262 ? 46.314 42.740 28.467  1.00 35.14  ? 331 LEU A C   1 
ATOM   1945 O O   . LEU A 1 262 ? 46.226 43.957 28.265  1.00 36.53  ? 331 LEU A O   1 
ATOM   1946 C CB  . LEU A 1 262 ? 44.061 41.740 28.853  1.00 38.13  ? 331 LEU A CB  1 
ATOM   1947 C CG  . LEU A 1 262 ? 43.190 40.772 29.645  1.00 37.37  ? 331 LEU A CG  1 
ATOM   1948 C CD1 . LEU A 1 262 ? 41.964 40.437 28.827  1.00 41.22  ? 331 LEU A CD1 1 
ATOM   1949 C CD2 . LEU A 1 262 ? 43.972 39.514 30.005  1.00 17.43  ? 331 LEU A CD2 1 
ATOM   1950 N N   . PRO A 1 263 ? 47.176 41.985 27.795  1.00 32.66  ? 332 PRO A N   1 
ATOM   1951 C CA  . PRO A 1 263 ? 48.127 42.597 26.864  1.00 18.42  ? 332 PRO A CA  1 
ATOM   1952 C C   . PRO A 1 263 ? 47.433 43.159 25.637  1.00 28.52  ? 332 PRO A C   1 
ATOM   1953 O O   . PRO A 1 263 ? 46.306 42.796 25.292  1.00 32.07  ? 332 PRO A O   1 
ATOM   1954 C CB  . PRO A 1 263 ? 49.049 41.436 26.485  1.00 23.82  ? 332 PRO A CB  1 
ATOM   1955 C CG  . PRO A 1 263 ? 48.198 40.227 26.647  1.00 27.01  ? 332 PRO A CG  1 
ATOM   1956 C CD  . PRO A 1 263 ? 47.257 40.514 27.788  1.00 31.67  ? 332 PRO A CD  1 
ATOM   1957 N N   . ASP A 1 264 ? 48.141 44.059 24.969  1.00 29.79  ? 333 ASP A N   1 
ATOM   1958 C CA  . ASP A 1 264 ? 47.638 44.623 23.733  1.00 31.18  ? 333 ASP A CA  1 
ATOM   1959 C C   . ASP A 1 264 ? 47.550 43.553 22.650  1.00 31.47  ? 333 ASP A C   1 
ATOM   1960 O O   . ASP A 1 264 ? 48.205 42.510 22.707  1.00 29.69  ? 333 ASP A O   1 
ATOM   1961 C CB  . ASP A 1 264 ? 48.538 45.761 23.262  1.00 29.78  ? 333 ASP A CB  1 
ATOM   1962 C CG  . ASP A 1 264 ? 48.476 46.962 24.168  1.00 35.29  ? 333 ASP A CG  1 
ATOM   1963 O OD1 . ASP A 1 264 ? 47.649 46.957 25.106  1.00 49.29  ? 333 ASP A OD1 1 
ATOM   1964 O OD2 . ASP A 1 264 ? 49.250 47.915 23.937  1.00 35.77  ? 333 ASP A OD2 1 
ATOM   1965 N N   . ILE A 1 265 ? 46.720 43.828 21.652  1.00 35.26  ? 334 ILE A N   1 
ATOM   1966 C CA  . ILE A 1 265 ? 46.613 43.004 20.457  1.00 33.46  ? 334 ILE A CA  1 
ATOM   1967 C C   . ILE A 1 265 ? 46.894 43.905 19.266  1.00 27.62  ? 334 ILE A C   1 
ATOM   1968 O O   . ILE A 1 265 ? 46.251 44.949 19.105  1.00 26.62  ? 334 ILE A O   1 
ATOM   1969 C CB  . ILE A 1 265 ? 45.237 42.333 20.346  1.00 31.51  ? 334 ILE A CB  1 
ATOM   1970 C CG1 . ILE A 1 265 ? 45.056 41.345 21.499  1.00 31.84  ? 334 ILE A CG1 1 
ATOM   1971 C CG2 . ILE A 1 265 ? 45.081 41.650 18.990  1.00 22.42  ? 334 ILE A CG2 1 
ATOM   1972 C CD1 . ILE A 1 265 ? 43.648 40.840 21.659  1.00 34.27  ? 334 ILE A CD1 1 
ATOM   1973 N N   . SER A 1 266 ? 47.868 43.521 18.452  1.00 27.84  ? 335 SER A N   1 
ATOM   1974 C CA  . SER A 1 266 ? 48.318 44.340 17.338  1.00 33.89  ? 335 SER A CA  1 
ATOM   1975 C C   . SER A 1 266 ? 48.113 43.590 16.032  1.00 25.55  ? 335 SER A C   1 
ATOM   1976 O O   . SER A 1 266 ? 48.478 42.415 15.915  1.00 22.16  ? 335 SER A O   1 
ATOM   1977 C CB  . SER A 1 266 ? 49.788 44.735 17.508  1.00 36.98  ? 335 SER A CB  1 
ATOM   1978 O OG  . SER A 1 266 ? 49.908 45.849 18.377  1.00 42.73  ? 335 SER A OG  1 
ATOM   1979 N N   . PHE A 1 267 ? 47.530 44.269 15.055  1.00 22.77  ? 336 PHE A N   1 
ATOM   1980 C CA  . PHE A 1 267 ? 47.349 43.722 13.721  1.00 22.07  ? 336 PHE A CA  1 
ATOM   1981 C C   . PHE A 1 267 ? 48.309 44.424 12.776  1.00 32.35  ? 336 PHE A C   1 
ATOM   1982 O O   . PHE A 1 267 ? 48.333 45.657 12.713  1.00 36.56  ? 336 PHE A O   1 
ATOM   1983 C CB  . PHE A 1 267 ? 45.908 43.893 13.247  1.00 15.01  ? 336 PHE A CB  1 
ATOM   1984 C CG  . PHE A 1 267 ? 44.903 43.314 14.179  1.00 14.39  ? 336 PHE A CG  1 
ATOM   1985 C CD1 . PHE A 1 267 ? 44.367 44.084 15.199  1.00 20.68  ? 336 PHE A CD1 1 
ATOM   1986 C CD2 . PHE A 1 267 ? 44.495 42.000 14.047  1.00 29.62  ? 336 PHE A CD2 1 
ATOM   1987 C CE1 . PHE A 1 267 ? 43.440 43.552 16.075  1.00 18.74  ? 336 PHE A CE1 1 
ATOM   1988 C CE2 . PHE A 1 267 ? 43.563 41.462 14.916  1.00 29.87  ? 336 PHE A CE2 1 
ATOM   1989 C CZ  . PHE A 1 267 ? 43.037 42.239 15.931  1.00 22.97  ? 336 PHE A CZ  1 
ATOM   1990 N N   . HIS A 1 268 ? 49.101 43.637 12.053  1.00 34.03  ? 337 HIS A N   1 
ATOM   1991 C CA  . HIS A 1 268 ? 50.161 44.159 11.198  1.00 30.51  ? 337 HIS A CA  1 
ATOM   1992 C C   . HIS A 1 268 ? 49.609 44.277 9.784   1.00 33.75  ? 337 HIS A C   1 
ATOM   1993 O O   . HIS A 1 268 ? 49.501 43.286 9.058   1.00 28.68  ? 337 HIS A O   1 
ATOM   1994 C CB  . HIS A 1 268 ? 51.394 43.266 11.285  1.00 42.08  ? 337 HIS A CB  1 
ATOM   1995 C CG  . HIS A 1 268 ? 52.028 43.276 12.643  1.00 61.30  ? 337 HIS A CG  1 
ATOM   1996 N ND1 . HIS A 1 268 ? 52.997 44.189 13.005  1.00 61.92  ? 337 HIS A ND1 1 
ATOM   1997 C CD2 . HIS A 1 268 ? 51.794 42.521 13.744  1.00 58.20  ? 337 HIS A CD2 1 
ATOM   1998 C CE1 . HIS A 1 268 ? 53.349 43.980 14.261  1.00 59.36  ? 337 HIS A CE1 1 
ATOM   1999 N NE2 . HIS A 1 268 ? 52.633 42.974 14.733  1.00 58.41  ? 337 HIS A NE2 1 
ATOM   2000 N N   . LEU A 1 269 ? 49.238 45.499 9.409   1.00 28.53  ? 338 LEU A N   1 
ATOM   2001 C CA  . LEU A 1 269 ? 48.652 45.795 8.112   1.00 22.40  ? 338 LEU A CA  1 
ATOM   2002 C C   . LEU A 1 269 ? 49.492 46.855 7.425   1.00 35.60  ? 338 LEU A C   1 
ATOM   2003 O O   . LEU A 1 269 ? 49.821 47.879 8.037   1.00 34.43  ? 338 LEU A O   1 
ATOM   2004 C CB  . LEU A 1 269 ? 47.215 46.290 8.256   1.00 32.53  ? 338 LEU A CB  1 
ATOM   2005 C CG  . LEU A 1 269 ? 46.327 45.392 9.105   1.00 34.93  ? 338 LEU A CG  1 
ATOM   2006 C CD1 . LEU A 1 269 ? 45.107 46.161 9.593   1.00 27.38  ? 338 LEU A CD1 1 
ATOM   2007 C CD2 . LEU A 1 269 ? 45.936 44.172 8.287   1.00 30.06  ? 338 LEU A CD2 1 
ATOM   2008 N N   . GLY A 1 270 ? 49.827 46.606 6.161   1.00 35.83  ? 339 GLY A N   1 
ATOM   2009 C CA  . GLY A 1 270 ? 50.575 47.568 5.369   1.00 30.74  ? 339 GLY A CA  1 
ATOM   2010 C C   . GLY A 1 270 ? 51.865 48.010 6.020   1.00 34.91  ? 339 GLY A C   1 
ATOM   2011 O O   . GLY A 1 270 ? 52.210 49.196 5.965   1.00 44.24  ? 339 GLY A O   1 
ATOM   2012 N N   . GLY A 1 271 ? 52.573 47.085 6.665   1.00 42.04  ? 340 GLY A N   1 
ATOM   2013 C CA  . GLY A 1 271 ? 53.814 47.421 7.333   1.00 44.23  ? 340 GLY A CA  1 
ATOM   2014 C C   . GLY A 1 271 ? 53.679 48.291 8.561   1.00 48.48  ? 340 GLY A C   1 
ATOM   2015 O O   . GLY A 1 271 ? 54.694 48.765 9.080   1.00 53.01  ? 340 GLY A O   1 
ATOM   2016 N N   . LYS A 1 272 ? 52.464 48.530 9.041   1.00 44.95  ? 341 LYS A N   1 
ATOM   2017 C CA  . LYS A 1 272 ? 52.252 49.308 10.249  1.00 41.05  ? 341 LYS A CA  1 
ATOM   2018 C C   . LYS A 1 272 ? 51.541 48.453 11.288  1.00 39.78  ? 341 LYS A C   1 
ATOM   2019 O O   . LYS A 1 272 ? 50.824 47.504 10.955  1.00 49.62  ? 341 LYS A O   1 
ATOM   2020 C CB  . LYS A 1 272 ? 51.450 50.586 9.962   1.00 45.13  ? 341 LYS A CB  1 
ATOM   2021 C CG  . LYS A 1 272 ? 52.166 51.550 9.020   1.00 51.46  ? 341 LYS A CG  1 
ATOM   2022 C CD  . LYS A 1 272 ? 51.558 52.949 9.043   1.00 52.93  ? 341 LYS A CD  1 
ATOM   2023 C CE  . LYS A 1 272 ? 52.353 53.912 8.166   1.00 50.18  ? 341 LYS A CE  1 
ATOM   2024 N NZ  . LYS A 1 272 ? 51.572 55.130 7.811   1.00 49.92  ? 341 LYS A NZ  1 
ATOM   2025 N N   . GLU A 1 273 ? 51.760 48.796 12.550  1.00 36.94  ? 342 GLU A N   1 
ATOM   2026 C CA  . GLU A 1 273 ? 51.240 48.052 13.692  1.00 34.04  ? 342 GLU A CA  1 
ATOM   2027 C C   . GLU A 1 273 ? 49.956 48.735 14.157  1.00 33.32  ? 342 GLU A C   1 
ATOM   2028 O O   . GLU A 1 273 ? 49.996 49.869 14.643  1.00 34.97  ? 342 GLU A O   1 
ATOM   2029 C CB  . GLU A 1 273 ? 52.292 48.014 14.801  1.00 34.94  ? 342 GLU A CB  1 
ATOM   2030 C CG  . GLU A 1 273 ? 52.250 46.814 15.728  1.00 58.89  ? 342 GLU A CG  1 
ATOM   2031 C CD  . GLU A 1 273 ? 53.074 47.026 17.003  1.00 76.89  ? 342 GLU A CD  1 
ATOM   2032 O OE1 . GLU A 1 273 ? 53.106 48.168 17.518  1.00 78.21  ? 342 GLU A OE1 1 
ATOM   2033 O OE2 . GLU A 1 273 ? 53.683 46.050 17.493  1.00 79.79  ? 342 GLU A OE2 1 
ATOM   2034 N N   . TYR A 1 274 ? 48.814 48.057 13.995  1.00 26.16  ? 343 TYR A N   1 
ATOM   2035 C CA  . TYR A 1 274 ? 47.516 48.585 14.435  1.00 31.69  ? 343 TYR A CA  1 
ATOM   2036 C C   . TYR A 1 274 ? 47.152 47.911 15.754  1.00 34.63  ? 343 TYR A C   1 
ATOM   2037 O O   . TYR A 1 274 ? 46.735 46.749 15.781  1.00 32.07  ? 343 TYR A O   1 
ATOM   2038 C CB  . TYR A 1 274 ? 46.445 48.372 13.371  1.00 33.38  ? 343 TYR A CB  1 
ATOM   2039 C CG  . TYR A 1 274 ? 46.607 49.306 12.198  1.00 26.57  ? 343 TYR A CG  1 
ATOM   2040 C CD1 . TYR A 1 274 ? 47.554 49.054 11.221  1.00 23.46  ? 343 TYR A CD1 1 
ATOM   2041 C CD2 . TYR A 1 274 ? 45.836 50.456 12.084  1.00 26.11  ? 343 TYR A CD2 1 
ATOM   2042 C CE1 . TYR A 1 274 ? 47.722 49.914 10.148  1.00 28.03  ? 343 TYR A CE1 1 
ATOM   2043 C CE2 . TYR A 1 274 ? 45.994 51.319 11.010  1.00 25.11  ? 343 TYR A CE2 1 
ATOM   2044 C CZ  . TYR A 1 274 ? 46.944 51.042 10.048  1.00 22.47  ? 343 TYR A CZ  1 
ATOM   2045 O OH  . TYR A 1 274 ? 47.123 51.887 8.977   1.00 37.15  ? 343 TYR A OH  1 
ATOM   2046 N N   . THR A 1 275 ? 47.313 48.647 16.849  1.00 40.43  ? 344 THR A N   1 
ATOM   2047 C CA  . THR A 1 275 ? 47.248 48.083 18.189  1.00 31.37  ? 344 THR A CA  1 
ATOM   2048 C C   . THR A 1 275 ? 45.913 48.386 18.854  1.00 22.49  ? 344 THR A C   1 
ATOM   2049 O O   . THR A 1 275 ? 45.410 49.510 18.781  1.00 26.78  ? 344 THR A O   1 
ATOM   2050 C CB  . THR A 1 275 ? 48.384 48.630 19.051  1.00 32.42  ? 344 THR A CB  1 
ATOM   2051 O OG1 . THR A 1 275 ? 49.641 48.321 18.437  1.00 35.68  ? 344 THR A OG1 1 
ATOM   2052 C CG2 . THR A 1 275 ? 48.331 48.025 20.448  1.00 32.09  ? 344 THR A CG2 1 
ATOM   2053 N N   . LEU A 1 276 ? 45.348 47.375 19.508  1.00 19.46  ? 345 LEU A N   1 
ATOM   2054 C CA  . LEU A 1 276 ? 44.166 47.531 20.346  1.00 27.71  ? 345 LEU A CA  1 
ATOM   2055 C C   . LEU A 1 276 ? 44.514 47.092 21.761  1.00 25.14  ? 345 LEU A C   1 
ATOM   2056 O O   . LEU A 1 276 ? 44.867 45.930 21.986  1.00 18.19  ? 345 LEU A O   1 
ATOM   2057 C CB  . LEU A 1 276 ? 42.988 46.717 19.803  1.00 24.91  ? 345 LEU A CB  1 
ATOM   2058 C CG  . LEU A 1 276 ? 42.454 47.067 18.410  1.00 31.65  ? 345 LEU A CG  1 
ATOM   2059 C CD1 . LEU A 1 276 ? 41.209 46.263 18.101  1.00 23.35  ? 345 LEU A CD1 1 
ATOM   2060 C CD2 . LEU A 1 276 ? 42.164 48.553 18.289  1.00 35.53  ? 345 LEU A CD2 1 
ATOM   2061 N N   . THR A 1 277 ? 44.417 48.020 22.708  1.00 24.48  ? 346 THR A N   1 
ATOM   2062 C CA  . THR A 1 277 ? 44.632 47.702 24.110  1.00 30.44  ? 346 THR A CA  1 
ATOM   2063 C C   . THR A 1 277 ? 43.389 47.051 24.707  1.00 35.79  ? 346 THR A C   1 
ATOM   2064 O O   . THR A 1 277 ? 42.301 47.060 24.120  1.00 28.01  ? 346 THR A O   1 
ATOM   2065 C CB  . THR A 1 277 ? 44.982 48.956 24.902  1.00 32.32  ? 346 THR A CB  1 
ATOM   2066 O OG1 . THR A 1 277 ? 43.823 49.797 24.992  1.00 34.34  ? 346 THR A OG1 1 
ATOM   2067 C CG2 . THR A 1 277 ? 46.099 49.715 24.216  1.00 17.51  ? 346 THR A CG2 1 
ATOM   2068 N N   . SER A 1 278 ? 43.560 46.476 25.899  1.00 31.83  ? 347 SER A N   1 
ATOM   2069 C CA  . SER A 1 278 ? 42.438 45.819 26.558  1.00 23.25  ? 347 SER A CA  1 
ATOM   2070 C C   . SER A 1 278 ? 41.272 46.778 26.760  1.00 34.37  ? 347 SER A C   1 
ATOM   2071 O O   . SER A 1 278 ? 40.114 46.348 26.821  1.00 34.95  ? 347 SER A O   1 
ATOM   2072 C CB  . SER A 1 278 ? 42.886 45.242 27.893  1.00 25.46  ? 347 SER A CB  1 
ATOM   2073 O OG  . SER A 1 278 ? 43.346 46.277 28.745  1.00 27.56  ? 347 SER A OG  1 
ATOM   2074 N N   . ALA A 1 279 ? 41.556 48.077 26.870  1.00 34.44  ? 348 ALA A N   1 
ATOM   2075 C CA  . ALA A 1 279 ? 40.488 49.061 26.962  1.00 40.79  ? 348 ALA A CA  1 
ATOM   2076 C C   . ALA A 1 279 ? 39.714 49.182 25.658  1.00 40.37  ? 348 ALA A C   1 
ATOM   2077 O O   . ALA A 1 279 ? 38.619 49.752 25.656  1.00 37.83  ? 348 ALA A O   1 
ATOM   2078 C CB  . ALA A 1 279 ? 41.054 50.423 27.364  1.00 39.33  ? 348 ALA A CB  1 
ATOM   2079 N N   . ASP A 1 280 ? 40.258 48.661 24.557  1.00 41.01  ? 349 ASP A N   1 
ATOM   2080 C CA  . ASP A 1 280 ? 39.588 48.704 23.263  1.00 23.76  ? 349 ASP A CA  1 
ATOM   2081 C C   . ASP A 1 280 ? 38.745 47.468 22.987  1.00 17.75  ? 349 ASP A C   1 
ATOM   2082 O O   . ASP A 1 280 ? 37.727 47.572 22.291  1.00 26.91  ? 349 ASP A O   1 
ATOM   2083 C CB  . ASP A 1 280 ? 40.613 48.865 22.138  1.00 31.13  ? 349 ASP A CB  1 
ATOM   2084 C CG  . ASP A 1 280 ? 41.251 50.243 22.116  1.00 40.39  ? 349 ASP A CG  1 
ATOM   2085 O OD1 . ASP A 1 280 ? 40.531 51.235 22.359  1.00 42.67  ? 349 ASP A OD1 1 
ATOM   2086 O OD2 . ASP A 1 280 ? 42.471 50.332 21.847  1.00 41.02  ? 349 ASP A OD2 1 
ATOM   2087 N N   . TYR A 1 281 ? 39.130 46.302 23.513  1.00 19.58  ? 350 TYR A N   1 
ATOM   2088 C CA  . TYR A 1 281 ? 38.517 45.046 23.093  1.00 24.69  ? 350 TYR A CA  1 
ATOM   2089 C C   . TYR A 1 281 ? 37.778 44.300 24.206  1.00 25.52  ? 350 TYR A C   1 
ATOM   2090 O O   . TYR A 1 281 ? 37.303 43.184 23.968  1.00 27.99  ? 350 TYR A O   1 
ATOM   2091 C CB  . TYR A 1 281 ? 39.570 44.135 22.432  1.00 17.28  ? 350 TYR A CB  1 
ATOM   2092 C CG  . TYR A 1 281 ? 40.687 43.574 23.306  1.00 28.21  ? 350 TYR A CG  1 
ATOM   2093 C CD1 . TYR A 1 281 ? 40.457 42.523 24.183  1.00 29.65  ? 350 TYR A CD1 1 
ATOM   2094 C CD2 . TYR A 1 281 ? 41.993 44.055 23.200  1.00 39.52  ? 350 TYR A CD2 1 
ATOM   2095 C CE1 . TYR A 1 281 ? 41.480 41.994 24.960  1.00 33.88  ? 350 TYR A CE1 1 
ATOM   2096 C CE2 . TYR A 1 281 ? 43.030 43.529 23.973  1.00 24.44  ? 350 TYR A CE2 1 
ATOM   2097 C CZ  . TYR A 1 281 ? 42.763 42.500 24.851  1.00 28.10  ? 350 TYR A CZ  1 
ATOM   2098 O OH  . TYR A 1 281 ? 43.769 41.966 25.623  1.00 22.50  ? 350 TYR A OH  1 
ATOM   2099 N N   . VAL A 1 282 ? 37.629 44.884 25.393  1.00 24.57  ? 351 VAL A N   1 
ATOM   2100 C CA  . VAL A 1 282 ? 36.942 44.236 26.506  1.00 31.12  ? 351 VAL A CA  1 
ATOM   2101 C C   . VAL A 1 282 ? 35.744 45.086 26.915  1.00 28.54  ? 351 VAL A C   1 
ATOM   2102 O O   . VAL A 1 282 ? 35.882 46.296 27.128  1.00 22.54  ? 351 VAL A O   1 
ATOM   2103 C CB  . VAL A 1 282 ? 37.882 44.016 27.705  1.00 33.11  ? 351 VAL A CB  1 
ATOM   2104 C CG1 . VAL A 1 282 ? 37.121 43.411 28.889  1.00 28.47  ? 351 VAL A CG1 1 
ATOM   2105 C CG2 . VAL A 1 282 ? 39.036 43.132 27.308  1.00 33.75  ? 351 VAL A CG2 1 
ATOM   2106 N N   . PHE A 1 283 ? 34.576 44.453 27.023  1.00 21.23  ? 352 PHE A N   1 
ATOM   2107 C CA  . PHE A 1 283 ? 33.374 45.113 27.536  1.00 21.00  ? 352 PHE A CA  1 
ATOM   2108 C C   . PHE A 1 283 ? 33.508 45.209 29.047  1.00 29.30  ? 352 PHE A C   1 
ATOM   2109 O O   . PHE A 1 283 ? 33.207 44.261 29.774  1.00 28.86  ? 352 PHE A O   1 
ATOM   2110 C CB  . PHE A 1 283 ? 32.115 44.347 27.158  1.00 16.39  ? 352 PHE A CB  1 
ATOM   2111 C CG  . PHE A 1 283 ? 31.782 44.404 25.707  1.00 24.73  ? 352 PHE A CG  1 
ATOM   2112 C CD1 . PHE A 1 283 ? 31.201 45.533 25.163  1.00 21.01  ? 352 PHE A CD1 1 
ATOM   2113 C CD2 . PHE A 1 283 ? 32.025 43.316 24.887  1.00 28.99  ? 352 PHE A CD2 1 
ATOM   2114 C CE1 . PHE A 1 283 ? 30.881 45.582 23.819  1.00 31.34  ? 352 PHE A CE1 1 
ATOM   2115 C CE2 . PHE A 1 283 ? 31.709 43.361 23.545  1.00 41.83  ? 352 PHE A CE2 1 
ATOM   2116 C CZ  . PHE A 1 283 ? 31.137 44.495 23.010  1.00 37.60  ? 352 PHE A CZ  1 
ATOM   2117 N N   . GLN A 1 284 ? 33.952 46.361 29.525  1.00 31.35  ? 353 GLN A N   1 
ATOM   2118 C CA  . GLN A 1 284 ? 34.343 46.512 30.921  1.00 30.79  ? 353 GLN A CA  1 
ATOM   2119 C C   . GLN A 1 284 ? 33.164 47.063 31.728  1.00 38.77  ? 353 GLN A C   1 
ATOM   2120 O O   . GLN A 1 284 ? 33.120 48.228 32.124  1.00 39.32  ? 353 GLN A O   1 
ATOM   2121 C CB  . GLN A 1 284 ? 35.580 47.399 31.010  1.00 30.42  ? 353 GLN A CB  1 
ATOM   2122 C CG  . GLN A 1 284 ? 36.460 47.144 32.202  1.00 43.67  ? 353 GLN A CG  1 
ATOM   2123 C CD  . GLN A 1 284 ? 37.268 45.861 32.111  1.00 39.68  ? 353 GLN A CD  1 
ATOM   2124 O OE1 . GLN A 1 284 ? 37.117 44.965 32.943  1.00 38.37  ? 353 GLN A OE1 1 
ATOM   2125 N NE2 . GLN A 1 284 ? 38.147 45.777 31.118  1.00 24.41  ? 353 GLN A NE2 1 
ATOM   2126 N N   . GLU A 1 285 ? 32.182 46.182 31.960  1.00 35.02  ? 354 GLU A N   1 
ATOM   2127 C CA  . GLU A 1 285 ? 30.978 46.585 32.684  1.00 41.48  ? 354 GLU A CA  1 
ATOM   2128 C C   . GLU A 1 285 ? 31.258 46.815 34.166  1.00 38.81  ? 354 GLU A C   1 
ATOM   2129 O O   . GLU A 1 285 ? 30.651 47.697 34.784  1.00 37.46  ? 354 GLU A O   1 
ATOM   2130 C CB  . GLU A 1 285 ? 29.876 45.534 32.505  1.00 35.65  ? 354 GLU A CB  1 
ATOM   2131 N N   . SER A 1 286 ? 32.167 46.041 34.745  1.00 33.52  ? 355 SER A N   1 
ATOM   2132 C CA  . SER A 1 286 ? 32.544 46.159 36.142  1.00 24.14  ? 355 SER A CA  1 
ATOM   2133 C C   . SER A 1 286 ? 34.040 45.881 36.252  1.00 32.26  ? 355 SER A C   1 
ATOM   2134 O O   . SER A 1 286 ? 34.706 45.565 35.263  1.00 40.13  ? 355 SER A O   1 
ATOM   2135 C CB  . SER A 1 286 ? 31.713 45.200 37.001  1.00 21.20  ? 355 SER A CB  1 
ATOM   2136 O OG  . SER A 1 286 ? 32.444 44.719 38.111  1.00 30.01  ? 355 SER A OG  1 
ATOM   2137 N N   . TYR A 1 287 ? 34.582 46.011 37.463  1.00 23.80  ? 356 TYR A N   1 
ATOM   2138 C CA  . TYR A 1 287 ? 35.944 45.576 37.745  1.00 24.20  ? 356 TYR A CA  1 
ATOM   2139 C C   . TYR A 1 287 ? 35.976 44.555 38.874  1.00 30.43  ? 356 TYR A C   1 
ATOM   2140 O O   . TYR A 1 287 ? 37.001 44.394 39.542  1.00 40.05  ? 356 TYR A O   1 
ATOM   2141 C CB  . TYR A 1 287 ? 36.838 46.777 38.051  1.00 23.91  ? 356 TYR A CB  1 
ATOM   2142 C CG  . TYR A 1 287 ? 36.956 47.700 36.866  1.00 27.78  ? 356 TYR A CG  1 
ATOM   2143 C CD1 . TYR A 1 287 ? 37.932 47.499 35.898  1.00 30.50  ? 356 TYR A CD1 1 
ATOM   2144 C CD2 . TYR A 1 287 ? 36.061 48.745 36.686  1.00 41.74  ? 356 TYR A CD2 1 
ATOM   2145 C CE1 . TYR A 1 287 ? 38.035 48.335 34.803  1.00 30.04  ? 356 TYR A CE1 1 
ATOM   2146 C CE2 . TYR A 1 287 ? 36.150 49.583 35.587  1.00 44.49  ? 356 TYR A CE2 1 
ATOM   2147 C CZ  . TYR A 1 287 ? 37.135 49.372 34.648  1.00 35.36  ? 356 TYR A CZ  1 
ATOM   2148 O OH  . TYR A 1 287 ? 37.217 50.204 33.560  1.00 35.88  ? 356 TYR A OH  1 
ATOM   2149 N N   . SER A 1 288 ? 34.874 43.845 39.077  1.00 28.49  ? 357 SER A N   1 
ATOM   2150 C CA  . SER A 1 288 ? 34.760 42.886 40.164  1.00 35.08  ? 357 SER A CA  1 
ATOM   2151 C C   . SER A 1 288 ? 35.455 41.577 39.810  1.00 39.96  ? 357 SER A C   1 
ATOM   2152 O O   . SER A 1 288 ? 35.286 41.047 38.705  1.00 41.06  ? 357 SER A O   1 
ATOM   2153 C CB  . SER A 1 288 ? 33.288 42.634 40.479  1.00 37.16  ? 357 SER A CB  1 
ATOM   2154 O OG  . SER A 1 288 ? 33.144 41.523 41.337  1.00 47.94  ? 357 SER A OG  1 
ATOM   2155 N N   . SER A 1 289 ? 36.230 41.052 40.758  1.00 40.76  ? 358 SER A N   1 
ATOM   2156 C CA  . SER A 1 289 ? 36.884 39.762 40.572  1.00 35.72  ? 358 SER A CA  1 
ATOM   2157 C C   . SER A 1 289 ? 35.893 38.604 40.559  1.00 37.96  ? 358 SER A C   1 
ATOM   2158 O O   . SER A 1 289 ? 36.227 37.527 40.051  1.00 38.73  ? 358 SER A O   1 
ATOM   2159 C CB  . SER A 1 289 ? 37.932 39.544 41.667  1.00 35.44  ? 358 SER A CB  1 
ATOM   2160 O OG  . SER A 1 289 ? 37.384 39.765 42.960  1.00 43.37  ? 358 SER A OG  1 
ATOM   2161 N N   . LYS A 1 290 ? 34.691 38.796 41.107  1.00 34.67  ? 359 LYS A N   1 
ATOM   2162 C CA  . LYS A 1 290 ? 33.639 37.786 41.071  1.00 45.64  ? 359 LYS A CA  1 
ATOM   2163 C C   . LYS A 1 290 ? 32.641 38.028 39.939  1.00 47.92  ? 359 LYS A C   1 
ATOM   2164 O O   . LYS A 1 290 ? 31.459 37.699 40.078  1.00 51.18  ? 359 LYS A O   1 
ATOM   2165 C CB  . LYS A 1 290 ? 32.919 37.712 42.420  1.00 56.33  ? 359 LYS A CB  1 
ATOM   2166 C CG  . LYS A 1 290 ? 32.600 39.059 43.054  1.00 67.42  ? 359 LYS A CG  1 
ATOM   2167 C CD  . LYS A 1 290 ? 32.646 39.017 44.585  1.00 74.94  ? 359 LYS A CD  1 
ATOM   2168 C CE  . LYS A 1 290 ? 31.829 37.861 45.171  1.00 76.94  ? 359 LYS A CE  1 
ATOM   2169 N NZ  . LYS A 1 290 ? 30.381 37.873 44.777  1.00 71.59  ? 359 LYS A NZ  1 
ATOM   2170 N N   . LYS A 1 291 ? 33.096 38.599 38.822  1.00 43.04  ? 360 LYS A N   1 
ATOM   2171 C CA  . LYS A 1 291 ? 32.260 38.819 37.649  1.00 44.50  ? 360 LYS A CA  1 
ATOM   2172 C C   . LYS A 1 291 ? 33.105 38.642 36.394  1.00 49.97  ? 360 LYS A C   1 
ATOM   2173 O O   . LYS A 1 291 ? 34.299 38.952 36.383  1.00 58.30  ? 360 LYS A O   1 
ATOM   2174 C CB  . LYS A 1 291 ? 31.610 40.213 37.654  1.00 44.22  ? 360 LYS A CB  1 
ATOM   2175 C CG  . LYS A 1 291 ? 30.371 40.336 38.540  1.00 53.70  ? 360 LYS A CG  1 
ATOM   2176 C CD  . LYS A 1 291 ? 29.763 41.733 38.466  1.00 59.44  ? 360 LYS A CD  1 
ATOM   2177 C CE  . LYS A 1 291 ? 28.968 42.063 39.726  1.00 59.61  ? 360 LYS A CE  1 
ATOM   2178 N NZ  . LYS A 1 291 ? 28.599 43.507 39.797  1.00 54.70  ? 360 LYS A NZ  1 
ATOM   2179 N N   . LEU A 1 292 ? 32.470 38.151 35.334  1.00 36.50  ? 361 LEU A N   1 
ATOM   2180 C CA  . LEU A 1 292 ? 33.136 37.875 34.070  1.00 31.96  ? 361 LEU A CA  1 
ATOM   2181 C C   . LEU A 1 292 ? 32.736 38.907 33.026  1.00 31.81  ? 361 LEU A C   1 
ATOM   2182 O O   . LEU A 1 292 ? 31.567 39.291 32.935  1.00 41.12  ? 361 LEU A O   1 
ATOM   2183 C CB  . LEU A 1 292 ? 32.792 36.477 33.567  1.00 33.96  ? 361 LEU A CB  1 
ATOM   2184 C CG  . LEU A 1 292 ? 33.095 35.376 34.574  1.00 28.49  ? 361 LEU A CG  1 
ATOM   2185 C CD1 . LEU A 1 292 ? 32.281 34.144 34.242  1.00 21.82  ? 361 LEU A CD1 1 
ATOM   2186 C CD2 . LEU A 1 292 ? 34.588 35.072 34.593  1.00 24.81  ? 361 LEU A CD2 1 
ATOM   2187 N N   . CYS A 1 293 ? 33.710 39.338 32.230  1.00 27.52  ? 362 CYS A N   1 
ATOM   2188 C CA  . CYS A 1 293 ? 33.538 40.413 31.265  1.00 28.17  ? 362 CYS A CA  1 
ATOM   2189 C C   . CYS A 1 293 ? 33.819 39.904 29.855  1.00 33.74  ? 362 CYS A C   1 
ATOM   2190 O O   . CYS A 1 293 ? 34.780 39.161 29.631  1.00 34.24  ? 362 CYS A O   1 
ATOM   2191 C CB  . CYS A 1 293 ? 34.460 41.589 31.605  1.00 37.61  ? 362 CYS A CB  1 
ATOM   2192 S SG  . CYS A 1 293 ? 33.767 42.761 32.811  1.00 49.32  ? 362 CYS A SG  1 
ATOM   2193 N N   . THR A 1 294 ? 32.980 40.321 28.910  1.00 35.89  ? 363 THR A N   1 
ATOM   2194 C CA  . THR A 1 294 ? 33.040 39.832 27.537  1.00 19.52  ? 363 THR A CA  1 
ATOM   2195 C C   . THR A 1 294 ? 34.152 40.519 26.749  1.00 24.97  ? 363 THR A C   1 
ATOM   2196 O O   . THR A 1 294 ? 34.321 41.740 26.818  1.00 23.11  ? 363 THR A O   1 
ATOM   2197 C CB  . THR A 1 294 ? 31.695 40.066 26.838  1.00 19.59  ? 363 THR A CB  1 
ATOM   2198 O OG1 . THR A 1 294 ? 30.669 39.297 27.482  1.00 21.44  ? 363 THR A OG1 1 
ATOM   2199 C CG2 . THR A 1 294 ? 31.764 39.677 25.365  1.00 16.96  ? 363 THR A CG2 1 
ATOM   2200 N N   . LEU A 1 295 ? 34.908 39.726 25.990  1.00 13.67  ? 364 LEU A N   1 
ATOM   2201 C CA  . LEU A 1 295 ? 35.818 40.274 24.991  1.00 26.60  ? 364 LEU A CA  1 
ATOM   2202 C C   . LEU A 1 295 ? 35.092 40.410 23.656  1.00 19.48  ? 364 LEU A C   1 
ATOM   2203 O O   . LEU A 1 295 ? 34.332 39.524 23.262  1.00 23.48  ? 364 LEU A O   1 
ATOM   2204 C CB  . LEU A 1 295 ? 37.053 39.383 24.823  1.00 21.95  ? 364 LEU A CB  1 
ATOM   2205 C CG  . LEU A 1 295 ? 37.706 38.774 26.066  1.00 25.13  ? 364 LEU A CG  1 
ATOM   2206 C CD1 . LEU A 1 295 ? 39.028 38.148 25.696  1.00 22.45  ? 364 LEU A CD1 1 
ATOM   2207 C CD2 . LEU A 1 295 ? 37.910 39.810 27.141  1.00 33.04  ? 364 LEU A CD2 1 
ATOM   2208 N N   . ALA A 1 296 ? 35.333 41.524 22.958  1.00 24.20  ? 365 ALA A N   1 
ATOM   2209 C CA  . ALA A 1 296 ? 34.696 41.761 21.663  1.00 20.94  ? 365 ALA A CA  1 
ATOM   2210 C C   . ALA A 1 296 ? 35.444 41.067 20.526  1.00 27.39  ? 365 ALA A C   1 
ATOM   2211 O O   . ALA A 1 296 ? 35.730 41.672 19.486  1.00 27.70  ? 365 ALA A O   1 
ATOM   2212 C CB  . ALA A 1 296 ? 34.593 43.261 21.388  1.00 15.86  ? 365 ALA A CB  1 
ATOM   2213 N N   . ILE A 1 297 ? 35.724 39.781 20.710  1.00 26.58  ? 366 ILE A N   1 
ATOM   2214 C CA  . ILE A 1 297 ? 36.474 38.959 19.770  1.00 23.58  ? 366 ILE A CA  1 
ATOM   2215 C C   . ILE A 1 297 ? 35.881 37.560 19.848  1.00 24.76  ? 366 ILE A C   1 
ATOM   2216 O O   . ILE A 1 297 ? 35.560 37.081 20.940  1.00 16.73  ? 366 ILE A O   1 
ATOM   2217 C CB  . ILE A 1 297 ? 37.989 38.940 20.105  1.00 23.86  ? 366 ILE A CB  1 
ATOM   2218 C CG1 . ILE A 1 297 ? 38.639 40.300 19.855  1.00 24.39  ? 366 ILE A CG1 1 
ATOM   2219 C CG2 . ILE A 1 297 ? 38.732 37.898 19.294  1.00 17.72  ? 366 ILE A CG2 1 
ATOM   2220 C CD1 . ILE A 1 297 ? 39.732 40.634 20.850  1.00 13.47  ? 366 ILE A CD1 1 
ATOM   2221 N N   . HIS A 1 298 ? 35.705 36.910 18.700  1.00 25.32  ? 367 HIS A N   1 
ATOM   2222 C CA  . HIS A 1 298 ? 35.257 35.524 18.723  1.00 30.40  ? 367 HIS A CA  1 
ATOM   2223 C C   . HIS A 1 298 ? 35.660 34.840 17.423  1.00 27.12  ? 367 HIS A C   1 
ATOM   2224 O O   . HIS A 1 298 ? 36.163 35.469 16.494  1.00 21.72  ? 367 HIS A O   1 
ATOM   2225 C CB  . HIS A 1 298 ? 33.748 35.429 18.975  1.00 44.69  ? 367 HIS A CB  1 
ATOM   2226 C CG  . HIS A 1 298 ? 32.908 35.886 17.826  1.00 75.25  ? 367 HIS A CG  1 
ATOM   2227 N ND1 . HIS A 1 298 ? 31.558 35.621 17.747  1.00 84.33  ? 367 HIS A ND1 1 
ATOM   2228 C CD2 . HIS A 1 298 ? 33.220 36.593 16.714  1.00 83.93  ? 367 HIS A CD2 1 
ATOM   2229 C CE1 . HIS A 1 298 ? 31.076 36.142 16.633  1.00 86.55  ? 367 HIS A CE1 1 
ATOM   2230 N NE2 . HIS A 1 298 ? 32.064 36.734 15.986  1.00 83.29  ? 367 HIS A NE2 1 
ATOM   2231 N N   . ALA A 1 299 ? 35.445 33.535 17.377  1.00 12.95  ? 368 ALA A N   1 
ATOM   2232 C CA  . ALA A 1 299 ? 35.811 32.745 16.220  1.00 19.57  ? 368 ALA A CA  1 
ATOM   2233 C C   . ALA A 1 299 ? 34.651 32.680 15.236  1.00 29.60  ? 368 ALA A C   1 
ATOM   2234 O O   . ALA A 1 299 ? 33.496 32.497 15.627  1.00 36.44  ? 368 ALA A O   1 
ATOM   2235 C CB  . ALA A 1 299 ? 36.221 31.334 16.641  1.00 17.66  ? 368 ALA A CB  1 
ATOM   2236 N N   . MET A 1 300 ? 34.967 32.845 13.956  1.00 27.09  ? 369 MET A N   1 
ATOM   2237 C CA  . MET A 1 300 ? 33.994 32.621 12.894  1.00 24.98  ? 369 MET A CA  1 
ATOM   2238 C C   . MET A 1 300 ? 34.754 32.062 11.701  1.00 33.50  ? 369 MET A C   1 
ATOM   2239 O O   . MET A 1 300 ? 35.592 32.756 11.118  1.00 32.12  ? 369 MET A O   1 
ATOM   2240 C CB  . MET A 1 300 ? 33.257 33.903 12.532  1.00 30.66  ? 369 MET A CB  1 
ATOM   2241 C CG  . MET A 1 300 ? 32.243 33.723 11.405  1.00 42.80  ? 369 MET A CG  1 
ATOM   2242 S SD  . MET A 1 300 ? 31.080 35.096 11.233  1.00 44.03  ? 369 MET A SD  1 
ATOM   2243 C CE  . MET A 1 300 ? 32.100 36.347 10.451  1.00 41.43  ? 369 MET A CE  1 
ATOM   2244 N N   . ASP A 1 301 ? 34.475 30.808 11.352  1.00 33.38  ? 370 ASP A N   1 
ATOM   2245 C CA  . ASP A 1 301 ? 35.138 30.150 10.230  1.00 22.43  ? 370 ASP A CA  1 
ATOM   2246 C C   . ASP A 1 301 ? 34.398 30.527 8.951   1.00 26.77  ? 370 ASP A C   1 
ATOM   2247 O O   . ASP A 1 301 ? 33.312 30.016 8.669   1.00 28.63  ? 370 ASP A O   1 
ATOM   2248 C CB  . ASP A 1 301 ? 35.176 28.643 10.440  1.00 28.86  ? 370 ASP A CB  1 
ATOM   2249 C CG  . ASP A 1 301 ? 36.118 28.237 11.555  1.00 37.68  ? 370 ASP A CG  1 
ATOM   2250 O OD1 . ASP A 1 301 ? 37.319 28.561 11.464  1.00 45.85  ? 370 ASP A OD1 1 
ATOM   2251 O OD2 . ASP A 1 301 ? 35.661 27.593 12.521  1.00 41.03  ? 370 ASP A OD2 1 
ATOM   2252 N N   . ILE A 1 302 ? 34.982 31.435 8.180   1.00 23.37  ? 371 ILE A N   1 
ATOM   2253 C CA  . ILE A 1 302 ? 34.370 31.884 6.936   1.00 23.28  ? 371 ILE A CA  1 
ATOM   2254 C C   . ILE A 1 302 ? 34.865 30.976 5.819   1.00 30.81  ? 371 ILE A C   1 
ATOM   2255 O O   . ILE A 1 302 ? 36.079 30.778 5.663   1.00 33.26  ? 371 ILE A O   1 
ATOM   2256 C CB  . ILE A 1 302 ? 34.674 33.366 6.680   1.00 25.79  ? 371 ILE A CB  1 
ATOM   2257 C CG1 . ILE A 1 302 ? 34.016 34.206 7.777   1.00 26.40  ? 371 ILE A CG1 1 
ATOM   2258 C CG2 . ILE A 1 302 ? 34.183 33.788 5.307   1.00 21.92  ? 371 ILE A CG2 1 
ATOM   2259 C CD1 . ILE A 1 302 ? 34.663 35.535 8.012   1.00 15.80  ? 371 ILE A CD1 1 
ATOM   2260 N N   . PRO A 1 303 ? 33.965 30.378 5.049   1.00 32.24  ? 372 PRO A N   1 
ATOM   2261 C CA  . PRO A 1 303 ? 34.373 29.366 4.065   1.00 32.70  ? 372 PRO A CA  1 
ATOM   2262 C C   . PRO A 1 303 ? 34.916 30.009 2.802   1.00 27.70  ? 372 PRO A C   1 
ATOM   2263 O O   . PRO A 1 303 ? 34.683 31.203 2.552   1.00 30.05  ? 372 PRO A O   1 
ATOM   2264 C CB  . PRO A 1 303 ? 33.067 28.607 3.787   1.00 29.44  ? 372 PRO A CB  1 
ATOM   2265 C CG  . PRO A 1 303 ? 31.990 29.632 4.018   1.00 21.61  ? 372 PRO A CG  1 
ATOM   2266 C CD  . PRO A 1 303 ? 32.500 30.528 5.130   1.00 28.48  ? 372 PRO A CD  1 
ATOM   2267 N N   . PRO A 1 304 ? 35.658 29.256 1.993   1.00 31.52  ? 373 PRO A N   1 
ATOM   2268 C CA  . PRO A 1 304 ? 36.074 29.753 0.672   1.00 24.16  ? 373 PRO A CA  1 
ATOM   2269 C C   . PRO A 1 304 ? 34.873 30.204 -0.136  1.00 22.56  ? 373 PRO A C   1 
ATOM   2270 O O   . PRO A 1 304 ? 33.780 29.633 -0.009  1.00 32.11  ? 373 PRO A O   1 
ATOM   2271 C CB  . PRO A 1 304 ? 36.751 28.532 0.035   1.00 16.03  ? 373 PRO A CB  1 
ATOM   2272 C CG  . PRO A 1 304 ? 37.294 27.777 1.197   1.00 26.78  ? 373 PRO A CG  1 
ATOM   2273 C CD  . PRO A 1 304 ? 36.285 27.960 2.315   1.00 29.40  ? 373 PRO A CD  1 
ATOM   2274 N N   . PRO A 1 305 ? 35.035 31.212 -1.001  1.00 35.47  ? 374 PRO A N   1 
ATOM   2275 C CA  . PRO A 1 305 ? 36.324 31.813 -1.361  1.00 36.17  ? 374 PRO A CA  1 
ATOM   2276 C C   . PRO A 1 305 ? 36.751 33.022 -0.516  1.00 35.63  ? 374 PRO A C   1 
ATOM   2277 O O   . PRO A 1 305 ? 37.936 33.358 -0.533  1.00 39.54  ? 374 PRO A O   1 
ATOM   2278 C CB  . PRO A 1 305 ? 36.093 32.232 -2.812  1.00 22.83  ? 374 PRO A CB  1 
ATOM   2279 C CG  . PRO A 1 305 ? 34.632 32.639 -2.827  1.00 24.79  ? 374 PRO A CG  1 
ATOM   2280 C CD  . PRO A 1 305 ? 33.926 31.781 -1.791  1.00 29.52  ? 374 PRO A CD  1 
ATOM   2281 N N   . THR A 1 306 ? 35.813 33.659 0.196   1.00 30.22  ? 375 THR A N   1 
ATOM   2282 C CA  . THR A 1 306 ? 36.163 34.819 1.016   1.00 31.57  ? 375 THR A CA  1 
ATOM   2283 C C   . THR A 1 306 ? 37.083 34.429 2.167   1.00 27.14  ? 375 THR A C   1 
ATOM   2284 O O   . THR A 1 306 ? 37.983 35.193 2.540   1.00 23.90  ? 375 THR A O   1 
ATOM   2285 C CB  . THR A 1 306 ? 34.897 35.491 1.549   1.00 34.61  ? 375 THR A CB  1 
ATOM   2286 O OG1 . THR A 1 306 ? 34.016 35.784 0.457   1.00 36.35  ? 375 THR A OG1 1 
ATOM   2287 C CG2 . THR A 1 306 ? 35.238 36.782 2.285   1.00 23.49  ? 375 THR A CG2 1 
ATOM   2288 N N   . GLY A 1 307 ? 36.891 33.237 2.723   1.00 24.70  ? 376 GLY A N   1 
ATOM   2289 C CA  . GLY A 1 307 ? 37.689 32.776 3.832   1.00 27.40  ? 376 GLY A CA  1 
ATOM   2290 C C   . GLY A 1 307 ? 38.589 31.618 3.463   1.00 26.52  ? 376 GLY A C   1 
ATOM   2291 O O   . GLY A 1 307 ? 38.553 31.120 2.337   1.00 39.59  ? 376 GLY A O   1 
ATOM   2292 N N   . PRO A 1 308 ? 39.411 31.143 4.417   1.00 24.29  ? 377 PRO A N   1 
ATOM   2293 C CA  . PRO A 1 308 ? 39.540 31.600 5.804   1.00 22.23  ? 377 PRO A CA  1 
ATOM   2294 C C   . PRO A 1 308 ? 40.089 33.009 5.898   1.00 35.65  ? 377 PRO A C   1 
ATOM   2295 O O   . PRO A 1 308 ? 40.995 33.377 5.151   1.00 40.69  ? 377 PRO A O   1 
ATOM   2296 C CB  . PRO A 1 308 ? 40.523 30.598 6.420   1.00 19.97  ? 377 PRO A CB  1 
ATOM   2297 C CG  . PRO A 1 308 ? 40.483 29.434 5.538   1.00 30.67  ? 377 PRO A CG  1 
ATOM   2298 C CD  . PRO A 1 308 ? 40.260 29.971 4.163   1.00 27.63  ? 377 PRO A CD  1 
ATOM   2299 N N   . THR A 1 309 ? 39.522 33.798 6.802   1.00 13.75  ? 378 THR A N   1 
ATOM   2300 C CA  . THR A 1 309 ? 39.899 35.196 6.883   1.00 21.46  ? 378 THR A CA  1 
ATOM   2301 C C   . THR A 1 309 ? 39.484 35.750 8.232   1.00 24.15  ? 378 THR A C   1 
ATOM   2302 O O   . THR A 1 309 ? 38.487 35.312 8.817   1.00 21.90  ? 378 THR A O   1 
ATOM   2303 C CB  . THR A 1 309 ? 39.263 36.019 5.758   1.00 24.53  ? 378 THR A CB  1 
ATOM   2304 O OG1 . THR A 1 309 ? 39.669 37.386 5.898   1.00 17.63  ? 378 THR A OG1 1 
ATOM   2305 C CG2 . THR A 1 309 ? 37.715 35.909 5.759   1.00 12.87  ? 378 THR A CG2 1 
ATOM   2306 N N   . TRP A 1 310 ? 40.276 36.702 8.723   1.00 23.53  ? 379 TRP A N   1 
ATOM   2307 C CA  . TRP A 1 310 ? 39.865 37.523 9.848   1.00 16.92  ? 379 TRP A CA  1 
ATOM   2308 C C   . TRP A 1 310 ? 38.811 38.523 9.391   1.00 25.66  ? 379 TRP A C   1 
ATOM   2309 O O   . TRP A 1 310 ? 38.712 38.872 8.210   1.00 23.41  ? 379 TRP A O   1 
ATOM   2310 C CB  . TRP A 1 310 ? 41.053 38.288 10.442  1.00 18.39  ? 379 TRP A CB  1 
ATOM   2311 C CG  . TRP A 1 310 ? 42.089 37.451 11.149  1.00 26.05  ? 379 TRP A CG  1 
ATOM   2312 C CD1 . TRP A 1 310 ? 43.047 36.678 10.568  1.00 26.71  ? 379 TRP A CD1 1 
ATOM   2313 C CD2 . TRP A 1 310 ? 42.282 37.326 12.569  1.00 22.14  ? 379 TRP A CD2 1 
ATOM   2314 N NE1 . TRP A 1 310 ? 43.817 36.072 11.531  1.00 32.22  ? 379 TRP A NE1 1 
ATOM   2315 C CE2 . TRP A 1 310 ? 43.370 36.451 12.767  1.00 21.02  ? 379 TRP A CE2 1 
ATOM   2316 C CE3 . TRP A 1 310 ? 41.638 37.864 13.688  1.00 16.57  ? 379 TRP A CE3 1 
ATOM   2317 C CZ2 . TRP A 1 310 ? 43.826 36.094 14.036  1.00 26.12  ? 379 TRP A CZ2 1 
ATOM   2318 C CZ3 . TRP A 1 310 ? 42.094 37.512 14.952  1.00 19.39  ? 379 TRP A CZ3 1 
ATOM   2319 C CH2 . TRP A 1 310 ? 43.177 36.635 15.114  1.00 25.05  ? 379 TRP A CH2 1 
ATOM   2320 N N   . ALA A 1 311 ? 38.020 38.993 10.346  1.00 26.02  ? 380 ALA A N   1 
ATOM   2321 C CA  . ALA A 1 311 ? 37.055 40.053 10.097  1.00 13.62  ? 380 ALA A CA  1 
ATOM   2322 C C   . ALA A 1 311 ? 37.337 41.180 11.072  1.00 22.72  ? 380 ALA A C   1 
ATOM   2323 O O   . ALA A 1 311 ? 37.229 40.997 12.290  1.00 32.81  ? 380 ALA A O   1 
ATOM   2324 C CB  . ALA A 1 311 ? 35.615 39.555 10.237  1.00 11.62  ? 380 ALA A CB  1 
ATOM   2325 N N   . LEU A 1 312 ? 37.717 42.332 10.539  1.00 11.97  ? 381 LEU A N   1 
ATOM   2326 C CA  . LEU A 1 312 ? 37.963 43.519 11.345  1.00 33.00  ? 381 LEU A CA  1 
ATOM   2327 C C   . LEU A 1 312 ? 36.656 44.298 11.382  1.00 30.28  ? 381 LEU A C   1 
ATOM   2328 O O   . LEU A 1 312 ? 36.322 45.017 10.439  1.00 30.78  ? 381 LEU A O   1 
ATOM   2329 C CB  . LEU A 1 312 ? 39.113 44.332 10.761  1.00 36.33  ? 381 LEU A CB  1 
ATOM   2330 C CG  . LEU A 1 312 ? 40.420 43.568 10.504  1.00 28.15  ? 381 LEU A CG  1 
ATOM   2331 C CD1 . LEU A 1 312 ? 41.497 44.502 9.989   1.00 28.28  ? 381 LEU A CD1 1 
ATOM   2332 C CD2 . LEU A 1 312 ? 40.902 42.861 11.754  1.00 24.98  ? 381 LEU A CD2 1 
ATOM   2333 N N   . GLY A 1 313 ? 35.905 44.133 12.464  1.00 30.29  ? 382 GLY A N   1 
ATOM   2334 C CA  . GLY A 1 313 ? 34.602 44.740 12.650  1.00 15.49  ? 382 GLY A CA  1 
ATOM   2335 C C   . GLY A 1 313 ? 34.637 45.956 13.554  1.00 23.14  ? 382 GLY A C   1 
ATOM   2336 O O   . GLY A 1 313 ? 35.666 46.630 13.687  1.00 22.72  ? 382 GLY A O   1 
ATOM   2337 N N   . ALA A 1 314 ? 33.493 46.233 14.193  1.00 18.68  ? 383 ALA A N   1 
ATOM   2338 C CA  . ALA A 1 314 ? 33.335 47.448 14.994  1.00 20.67  ? 383 ALA A CA  1 
ATOM   2339 C C   . ALA A 1 314 ? 34.410 47.573 16.066  1.00 20.61  ? 383 ALA A C   1 
ATOM   2340 O O   . ALA A 1 314 ? 34.830 48.686 16.406  1.00 25.84  ? 383 ALA A O   1 
ATOM   2341 C CB  . ALA A 1 314 ? 31.954 47.475 15.645  1.00 12.80  ? 383 ALA A CB  1 
ATOM   2342 N N   . THR A 1 315 ? 34.841 46.451 16.638  1.00 16.36  ? 384 THR A N   1 
ATOM   2343 C CA  . THR A 1 315 ? 35.912 46.502 17.626  1.00 20.81  ? 384 THR A CA  1 
ATOM   2344 C C   . THR A 1 315 ? 37.134 47.219 17.066  1.00 19.54  ? 384 THR A C   1 
ATOM   2345 O O   . THR A 1 315 ? 37.746 48.046 17.747  1.00 27.39  ? 384 THR A O   1 
ATOM   2346 C CB  . THR A 1 315 ? 36.271 45.087 18.078  1.00 26.35  ? 384 THR A CB  1 
ATOM   2347 O OG1 . THR A 1 315 ? 35.070 44.362 18.380  1.00 22.72  ? 384 THR A OG1 1 
ATOM   2348 C CG2 . THR A 1 315 ? 37.163 45.128 19.316  1.00 20.45  ? 384 THR A CG2 1 
ATOM   2349 N N   . PHE A 1 316 ? 37.469 46.948 15.804  1.00 23.87  ? 385 PHE A N   1 
ATOM   2350 C CA  . PHE A 1 316 ? 38.617 47.575 15.158  1.00 22.48  ? 385 PHE A CA  1 
ATOM   2351 C C   . PHE A 1 316 ? 38.290 48.978 14.655  1.00 27.42  ? 385 PHE A C   1 
ATOM   2352 O O   . PHE A 1 316 ? 39.077 49.911 14.850  1.00 30.49  ? 385 PHE A O   1 
ATOM   2353 C CB  . PHE A 1 316 ? 39.090 46.693 14.004  1.00 16.05  ? 385 PHE A CB  1 
ATOM   2354 C CG  . PHE A 1 316 ? 40.352 47.163 13.346  1.00 20.84  ? 385 PHE A CG  1 
ATOM   2355 C CD1 . PHE A 1 316 ? 40.313 48.085 12.320  1.00 22.35  ? 385 PHE A CD1 1 
ATOM   2356 C CD2 . PHE A 1 316 ? 41.581 46.653 13.736  1.00 35.75  ? 385 PHE A CD2 1 
ATOM   2357 C CE1 . PHE A 1 316 ? 41.479 48.508 11.709  1.00 25.61  ? 385 PHE A CE1 1 
ATOM   2358 C CE2 . PHE A 1 316 ? 42.748 47.072 13.130  1.00 29.04  ? 385 PHE A CE2 1 
ATOM   2359 C CZ  . PHE A 1 316 ? 42.696 47.999 12.116  1.00 26.23  ? 385 PHE A CZ  1 
ATOM   2360 N N   . ILE A 1 317 ? 37.136 49.141 14.002  1.00 29.39  ? 386 ILE A N   1 
ATOM   2361 C CA  . ILE A 1 317 ? 36.788 50.415 13.382  1.00 28.32  ? 386 ILE A CA  1 
ATOM   2362 C C   . ILE A 1 317 ? 36.511 51.493 14.421  1.00 21.65  ? 386 ILE A C   1 
ATOM   2363 O O   . ILE A 1 317 ? 36.643 52.684 14.120  1.00 31.60  ? 386 ILE A O   1 
ATOM   2364 C CB  . ILE A 1 317 ? 35.599 50.207 12.422  1.00 28.33  ? 386 ILE A CB  1 
ATOM   2365 C CG1 . ILE A 1 317 ? 35.911 49.044 11.477  1.00 22.40  ? 386 ILE A CG1 1 
ATOM   2366 C CG2 . ILE A 1 317 ? 35.328 51.446 11.595  1.00 24.74  ? 386 ILE A CG2 1 
ATOM   2367 C CD1 . ILE A 1 317 ? 34.834 48.736 10.479  1.00 27.60  ? 386 ILE A CD1 1 
ATOM   2368 N N   . ARG A 1 318 ? 36.166 51.109 15.653  1.00 26.72  ? 387 ARG A N   1 
ATOM   2369 C CA  . ARG A 1 318 ? 36.007 52.093 16.721  1.00 27.61  ? 387 ARG A CA  1 
ATOM   2370 C C   . ARG A 1 318 ? 37.290 52.889 16.953  1.00 27.59  ? 387 ARG A C   1 
ATOM   2371 O O   . ARG A 1 318 ? 37.232 54.074 17.300  1.00 29.63  ? 387 ARG A O   1 
ATOM   2372 C CB  . ARG A 1 318 ? 35.578 51.395 18.013  1.00 31.84  ? 387 ARG A CB  1 
ATOM   2373 C CG  . ARG A 1 318 ? 34.128 51.626 18.410  1.00 25.26  ? 387 ARG A CG  1 
ATOM   2374 C CD  . ARG A 1 318 ? 33.758 50.789 19.629  1.00 18.11  ? 387 ARG A CD  1 
ATOM   2375 N NE  . ARG A 1 318 ? 32.933 49.635 19.274  1.00 27.12  ? 387 ARG A NE  1 
ATOM   2376 C CZ  . ARG A 1 318 ? 33.164 48.391 19.684  1.00 38.05  ? 387 ARG A CZ  1 
ATOM   2377 N NH1 . ARG A 1 318 ? 32.359 47.410 19.303  1.00 43.84  ? 387 ARG A NH1 1 
ATOM   2378 N NH2 . ARG A 1 318 ? 34.195 48.126 20.478  1.00 38.16  ? 387 ARG A NH2 1 
ATOM   2379 N N   . LYS A 1 319 ? 38.453 52.269 16.758  1.00 24.44  ? 388 LYS A N   1 
ATOM   2380 C CA  . LYS A 1 319 ? 39.712 52.974 16.967  1.00 28.61  ? 388 LYS A CA  1 
ATOM   2381 C C   . LYS A 1 319 ? 40.274 53.576 15.682  1.00 31.89  ? 388 LYS A C   1 
ATOM   2382 O O   . LYS A 1 319 ? 40.969 54.600 15.738  1.00 37.43  ? 388 LYS A O   1 
ATOM   2383 C CB  . LYS A 1 319 ? 40.747 52.034 17.606  1.00 20.58  ? 388 LYS A CB  1 
ATOM   2384 C CG  . LYS A 1 319 ? 42.063 52.709 17.995  1.00 21.43  ? 388 LYS A CG  1 
ATOM   2385 C CD  . LYS A 1 319 ? 42.723 52.016 19.172  1.00 28.37  ? 388 LYS A CD  1 
ATOM   2386 C CE  . LYS A 1 319 ? 44.100 52.600 19.470  1.00 32.62  ? 388 LYS A CE  1 
ATOM   2387 N NZ  . LYS A 1 319 ? 44.629 52.159 20.800  1.00 40.19  ? 388 LYS A NZ  1 
ATOM   2388 N N   . PHE A 1 320 ? 39.980 52.991 14.524  1.00 22.67  ? 389 PHE A N   1 
ATOM   2389 C CA  . PHE A 1 320 ? 40.555 53.449 13.262  1.00 22.74  ? 389 PHE A CA  1 
ATOM   2390 C C   . PHE A 1 320 ? 39.439 53.793 12.281  1.00 26.91  ? 389 PHE A C   1 
ATOM   2391 O O   . PHE A 1 320 ? 38.780 52.898 11.742  1.00 31.72  ? 389 PHE A O   1 
ATOM   2392 C CB  . PHE A 1 320 ? 41.505 52.393 12.691  1.00 20.18  ? 389 PHE A CB  1 
ATOM   2393 C CG  . PHE A 1 320 ? 42.618 52.011 13.640  1.00 26.30  ? 389 PHE A CG  1 
ATOM   2394 C CD1 . PHE A 1 320 ? 43.702 52.852 13.832  1.00 20.95  ? 389 PHE A CD1 1 
ATOM   2395 C CD2 . PHE A 1 320 ? 42.572 50.825 14.351  1.00 29.14  ? 389 PHE A CD2 1 
ATOM   2396 C CE1 . PHE A 1 320 ? 44.719 52.517 14.716  1.00 21.81  ? 389 PHE A CE1 1 
ATOM   2397 C CE2 . PHE A 1 320 ? 43.589 50.486 15.236  1.00 32.71  ? 389 PHE A CE2 1 
ATOM   2398 C CZ  . PHE A 1 320 ? 44.662 51.335 15.417  1.00 22.82  ? 389 PHE A CZ  1 
ATOM   2399 N N   . TYR A 1 321 ? 39.228 55.093 12.069  1.00 28.06  ? 390 TYR A N   1 
ATOM   2400 C CA  . TYR A 1 321 ? 38.416 55.595 10.964  1.00 27.23  ? 390 TYR A CA  1 
ATOM   2401 C C   . TYR A 1 321 ? 38.840 54.950 9.648   1.00 31.88  ? 390 TYR A C   1 
ATOM   2402 O O   . TYR A 1 321 ? 40.029 54.902 9.323   1.00 43.55  ? 390 TYR A O   1 
ATOM   2403 C CB  . TYR A 1 321 ? 38.576 57.116 10.885  1.00 28.67  ? 390 TYR A CB  1 
ATOM   2404 C CG  . TYR A 1 321 ? 37.567 57.839 10.024  1.00 24.71  ? 390 TYR A CG  1 
ATOM   2405 C CD1 . TYR A 1 321 ? 37.733 57.926 8.645   1.00 23.68  ? 390 TYR A CD1 1 
ATOM   2406 C CD2 . TYR A 1 321 ? 36.463 58.461 10.592  1.00 21.06  ? 390 TYR A CD2 1 
ATOM   2407 C CE1 . TYR A 1 321 ? 36.815 58.596 7.854   1.00 28.23  ? 390 TYR A CE1 1 
ATOM   2408 C CE2 . TYR A 1 321 ? 35.541 59.134 9.813   1.00 19.26  ? 390 TYR A CE2 1 
ATOM   2409 C CZ  . TYR A 1 321 ? 35.717 59.198 8.443   1.00 31.94  ? 390 TYR A CZ  1 
ATOM   2410 O OH  . TYR A 1 321 ? 34.794 59.867 7.663   1.00 33.09  ? 390 TYR A OH  1 
ATOM   2411 N N   . THR A 1 322 ? 37.865 54.468 8.880   1.00 31.05  ? 391 THR A N   1 
ATOM   2412 C CA  . THR A 1 322 ? 38.131 53.643 7.707   1.00 36.36  ? 391 THR A CA  1 
ATOM   2413 C C   . THR A 1 322 ? 37.526 54.264 6.459   1.00 33.54  ? 391 THR A C   1 
ATOM   2414 O O   . THR A 1 322 ? 36.334 54.585 6.435   1.00 32.69  ? 391 THR A O   1 
ATOM   2415 C CB  . THR A 1 322 ? 37.579 52.230 7.895   1.00 35.83  ? 391 THR A CB  1 
ATOM   2416 O OG1 . THR A 1 322 ? 38.149 51.651 9.075   1.00 39.28  ? 391 THR A OG1 1 
ATOM   2417 C CG2 . THR A 1 322 ? 37.922 51.363 6.699   1.00 31.76  ? 391 THR A CG2 1 
ATOM   2418 N N   . GLU A 1 323 ? 38.344 54.408 5.419   1.00 25.65  ? 392 GLU A N   1 
ATOM   2419 C CA  . GLU A 1 323 ? 37.919 54.961 4.141   1.00 26.81  ? 392 GLU A CA  1 
ATOM   2420 C C   . GLU A 1 323 ? 38.030 53.874 3.088   1.00 35.65  ? 392 GLU A C   1 
ATOM   2421 O O   . GLU A 1 323 ? 39.117 53.326 2.873   1.00 41.50  ? 392 GLU A O   1 
ATOM   2422 C CB  . GLU A 1 323 ? 38.763 56.171 3.744   1.00 31.97  ? 392 GLU A CB  1 
ATOM   2423 C CG  . GLU A 1 323 ? 38.403 56.744 2.379   1.00 31.43  ? 392 GLU A CG  1 
ATOM   2424 C CD  . GLU A 1 323 ? 39.372 57.813 1.916   1.00 35.76  ? 392 GLU A CD  1 
ATOM   2425 O OE1 . GLU A 1 323 ? 40.233 57.514 1.064   1.00 42.97  ? 392 GLU A OE1 1 
ATOM   2426 O OE2 . GLU A 1 323 ? 39.279 58.955 2.412   1.00 45.91  ? 392 GLU A OE2 1 
ATOM   2427 N N   . PHE A 1 324 ? 36.912 53.567 2.438   1.00 29.37  ? 393 PHE A N   1 
ATOM   2428 C CA  . PHE A 1 324 ? 36.847 52.528 1.418   1.00 27.04  ? 393 PHE A CA  1 
ATOM   2429 C C   . PHE A 1 324 ? 36.938 53.208 0.056   1.00 37.75  ? 393 PHE A C   1 
ATOM   2430 O O   . PHE A 1 324 ? 36.042 53.967 -0.330  1.00 37.99  ? 393 PHE A O   1 
ATOM   2431 C CB  . PHE A 1 324 ? 35.565 51.707 1.561   1.00 22.67  ? 393 PHE A CB  1 
ATOM   2432 C CG  . PHE A 1 324 ? 35.467 50.957 2.865   1.00 22.00  ? 393 PHE A CG  1 
ATOM   2433 C CD1 . PHE A 1 324 ? 34.913 51.557 3.988   1.00 28.24  ? 393 PHE A CD1 1 
ATOM   2434 C CD2 . PHE A 1 324 ? 35.928 49.656 2.972   1.00 18.91  ? 393 PHE A CD2 1 
ATOM   2435 C CE1 . PHE A 1 324 ? 34.822 50.879 5.193   1.00 18.39  ? 393 PHE A CE1 1 
ATOM   2436 C CE2 . PHE A 1 324 ? 35.834 48.971 4.174   1.00 18.31  ? 393 PHE A CE2 1 
ATOM   2437 C CZ  . PHE A 1 324 ? 35.280 49.588 5.286   1.00 14.52  ? 393 PHE A CZ  1 
ATOM   2438 N N   . ASP A 1 325 ? 38.030 52.944 -0.663  1.00 38.46  ? 394 ASP A N   1 
ATOM   2439 C CA  . ASP A 1 325 ? 38.346 53.636 -1.907  1.00 35.75  ? 394 ASP A CA  1 
ATOM   2440 C C   . ASP A 1 325 ? 38.011 52.728 -3.081  1.00 41.59  ? 394 ASP A C   1 
ATOM   2441 O O   . ASP A 1 325 ? 38.721 51.751 -3.343  1.00 39.16  ? 394 ASP A O   1 
ATOM   2442 C CB  . ASP A 1 325 ? 39.814 54.050 -1.936  1.00 40.14  ? 394 ASP A CB  1 
ATOM   2443 C CG  . ASP A 1 325 ? 40.137 55.009 -3.069  1.00 36.32  ? 394 ASP A CG  1 
ATOM   2444 O OD1 . ASP A 1 325 ? 39.408 55.030 -4.080  1.00 30.28  ? 394 ASP A OD1 1 
ATOM   2445 O OD2 . ASP A 1 325 ? 41.133 55.751 -2.944  1.00 40.95  ? 394 ASP A OD2 1 
ATOM   2446 N N   . ARG A 1 326 ? 36.949 53.076 -3.807  1.00 40.43  ? 395 ARG A N   1 
ATOM   2447 C CA  . ARG A 1 326 ? 36.554 52.302 -4.974  1.00 29.13  ? 395 ARG A CA  1 
ATOM   2448 C C   . ARG A 1 326 ? 37.439 52.584 -6.177  1.00 33.40  ? 395 ARG A C   1 
ATOM   2449 O O   . ARG A 1 326 ? 37.800 51.658 -6.909  1.00 41.35  ? 395 ARG A O   1 
ATOM   2450 C CB  . ARG A 1 326 ? 35.103 52.597 -5.317  1.00 34.18  ? 395 ARG A CB  1 
ATOM   2451 C CG  . ARG A 1 326 ? 34.181 51.628 -4.682  1.00 38.95  ? 395 ARG A CG  1 
ATOM   2452 C CD  . ARG A 1 326 ? 34.108 50.382 -5.507  1.00 41.89  ? 395 ARG A CD  1 
ATOM   2453 N NE  . ARG A 1 326 ? 32.753 49.863 -5.473  1.00 60.76  ? 395 ARG A NE  1 
ATOM   2454 C CZ  . ARG A 1 326 ? 32.100 49.414 -6.534  1.00 58.69  ? 395 ARG A CZ  1 
ATOM   2455 N NH1 . ARG A 1 326 ? 30.860 48.961 -6.402  1.00 58.04  ? 395 ARG A NH1 1 
ATOM   2456 N NH2 . ARG A 1 326 ? 32.686 49.415 -7.722  1.00 44.27  ? 395 ARG A NH2 1 
ATOM   2457 N N   . ARG A 1 327 ? 37.784 53.854 -6.404  1.00 37.16  ? 396 ARG A N   1 
ATOM   2458 C CA  . ARG A 1 327 ? 38.552 54.210 -7.593  1.00 40.57  ? 396 ARG A CA  1 
ATOM   2459 C C   . ARG A 1 327 ? 39.916 53.527 -7.592  1.00 37.08  ? 396 ARG A C   1 
ATOM   2460 O O   . ARG A 1 327 ? 40.312 52.905 -8.584  1.00 47.63  ? 396 ARG A O   1 
ATOM   2461 C CB  . ARG A 1 327 ? 38.695 55.733 -7.687  1.00 44.26  ? 396 ARG A CB  1 
ATOM   2462 C CG  . ARG A 1 327 ? 39.764 56.209 -8.665  1.00 55.09  ? 396 ARG A CG  1 
ATOM   2463 C CD  . ARG A 1 327 ? 39.169 56.754 -9.965  1.00 65.95  ? 396 ARG A CD  1 
ATOM   2464 N NE  . ARG A 1 327 ? 38.148 57.773 -9.734  1.00 75.18  ? 396 ARG A NE  1 
ATOM   2465 C CZ  . ARG A 1 327 ? 37.617 58.534 -10.688 1.00 82.26  ? 396 ARG A CZ  1 
ATOM   2466 N NH1 . ARG A 1 327 ? 36.693 59.436 -10.381 1.00 78.19  ? 396 ARG A NH1 1 
ATOM   2467 N NH2 . ARG A 1 327 ? 38.008 58.399 -11.950 1.00 88.82  ? 396 ARG A NH2 1 
ATOM   2468 N N   . ASN A 1 328 ? 40.637 53.600 -6.479  1.00 33.99  ? 397 ASN A N   1 
ATOM   2469 C CA  . ASN A 1 328 ? 41.981 53.046 -6.403  1.00 33.04  ? 397 ASN A CA  1 
ATOM   2470 C C   . ASN A 1 328 ? 42.028 51.676 -5.736  1.00 37.53  ? 397 ASN A C   1 
ATOM   2471 O O   . ASN A 1 328 ? 43.122 51.147 -5.520  1.00 39.44  ? 397 ASN A O   1 
ATOM   2472 C CB  . ASN A 1 328 ? 42.903 54.021 -5.676  1.00 30.65  ? 397 ASN A CB  1 
ATOM   2473 C CG  . ASN A 1 328 ? 42.728 55.443 -6.160  1.00 36.91  ? 397 ASN A CG  1 
ATOM   2474 O OD1 . ASN A 1 328 ? 42.946 55.743 -7.338  1.00 39.21  ? 397 ASN A OD1 1 
ATOM   2475 N ND2 . ASN A 1 328 ? 42.322 56.329 -5.255  1.00 32.72  ? 397 ASN A ND2 1 
ATOM   2476 N N   . ASN A 1 329 ? 40.871 51.095 -5.412  1.00 42.64  ? 398 ASN A N   1 
ATOM   2477 C CA  . ASN A 1 329 ? 40.766 49.744 -4.857  1.00 37.44  ? 398 ASN A CA  1 
ATOM   2478 C C   . ASN A 1 329 ? 41.658 49.574 -3.630  1.00 36.13  ? 398 ASN A C   1 
ATOM   2479 O O   . ASN A 1 329 ? 42.541 48.717 -3.580  1.00 42.60  ? 398 ASN A O   1 
ATOM   2480 C CB  . ASN A 1 329 ? 41.101 48.690 -5.913  1.00 33.50  ? 398 ASN A CB  1 
ATOM   2481 C CG  . ASN A 1 329 ? 39.934 48.378 -6.807  1.00 41.74  ? 398 ASN A CG  1 
ATOM   2482 O OD1 . ASN A 1 329 ? 38.810 48.198 -6.341  1.00 52.75  ? 398 ASN A OD1 1 
ATOM   2483 N ND2 . ASN A 1 329 ? 40.188 48.314 -8.106  1.00 41.67  ? 398 ASN A ND2 1 
ATOM   2484 N N   . ARG A 1 330 ? 41.409 50.405 -2.624  1.00 34.67  ? 399 ARG A N   1 
ATOM   2485 C CA  . ARG A 1 330 ? 42.229 50.371 -1.425  1.00 35.53  ? 399 ARG A CA  1 
ATOM   2486 C C   . ARG A 1 330 ? 41.390 50.764 -0.221  1.00 33.48  ? 399 ARG A C   1 
ATOM   2487 O O   . ARG A 1 330 ? 40.273 51.273 -0.346  1.00 34.01  ? 399 ARG A O   1 
ATOM   2488 C CB  . ARG A 1 330 ? 43.430 51.299 -1.552  1.00 33.01  ? 399 ARG A CB  1 
ATOM   2489 C CG  . ARG A 1 330 ? 43.011 52.720 -1.786  1.00 34.44  ? 399 ARG A CG  1 
ATOM   2490 C CD  . ARG A 1 330 ? 44.176 53.599 -2.127  1.00 34.62  ? 399 ARG A CD  1 
ATOM   2491 N NE  . ARG A 1 330 ? 43.764 54.992 -2.169  1.00 27.95  ? 399 ARG A NE  1 
ATOM   2492 C CZ  . ARG A 1 330 ? 44.611 56.008 -2.171  1.00 35.36  ? 399 ARG A CZ  1 
ATOM   2493 N NH1 . ARG A 1 330 ? 44.158 57.251 -2.201  1.00 36.52  ? 399 ARG A NH1 1 
ATOM   2494 N NH2 . ARG A 1 330 ? 45.913 55.773 -2.131  1.00 44.35  ? 399 ARG A NH2 1 
ATOM   2495 N N   . ILE A 1 331 ? 41.962 50.534 0.955   1.00 30.31  ? 400 ILE A N   1 
ATOM   2496 C CA  . ILE A 1 331 ? 41.337 50.859 2.228   1.00 16.90  ? 400 ILE A CA  1 
ATOM   2497 C C   . ILE A 1 331 ? 42.275 51.771 3.000   1.00 23.81  ? 400 ILE A C   1 
ATOM   2498 O O   . ILE A 1 331 ? 43.466 51.467 3.149   1.00 31.96  ? 400 ILE A O   1 
ATOM   2499 C CB  . ILE A 1 331 ? 41.012 49.586 3.026   1.00 23.31  ? 400 ILE A CB  1 
ATOM   2500 C CG1 . ILE A 1 331 ? 39.978 48.762 2.257   1.00 17.68  ? 400 ILE A CG1 1 
ATOM   2501 C CG2 . ILE A 1 331 ? 40.528 49.935 4.433   1.00 31.28  ? 400 ILE A CG2 1 
ATOM   2502 C CD1 . ILE A 1 331 ? 39.453 47.585 3.002   1.00 25.96  ? 400 ILE A CD1 1 
ATOM   2503 N N   . GLY A 1 332 ? 41.746 52.891 3.477   1.00 25.10  ? 401 GLY A N   1 
ATOM   2504 C CA  . GLY A 1 332 ? 42.526 53.850 4.236   1.00 34.84  ? 401 GLY A CA  1 
ATOM   2505 C C   . GLY A 1 332 ? 42.197 53.774 5.717   1.00 30.55  ? 401 GLY A C   1 
ATOM   2506 O O   . GLY A 1 332 ? 41.039 53.610 6.100   1.00 27.43  ? 401 GLY A O   1 
ATOM   2507 N N   . PHE A 1 333 ? 43.231 53.899 6.542   1.00 28.70  ? 402 PHE A N   1 
ATOM   2508 C CA  . PHE A 1 333 ? 43.075 53.905 7.988   1.00 26.69  ? 402 PHE A CA  1 
ATOM   2509 C C   . PHE A 1 333 ? 43.695 55.169 8.565   1.00 35.10  ? 402 PHE A C   1 
ATOM   2510 O O   . PHE A 1 333 ? 44.766 55.603 8.129   1.00 48.24  ? 402 PHE A O   1 
ATOM   2511 C CB  . PHE A 1 333 ? 43.715 52.669 8.628   1.00 29.20  ? 402 PHE A CB  1 
ATOM   2512 C CG  . PHE A 1 333 ? 43.001 51.381 8.315   1.00 33.44  ? 402 PHE A CG  1 
ATOM   2513 C CD1 . PHE A 1 333 ? 41.680 51.193 8.699   1.00 31.83  ? 402 PHE A CD1 1 
ATOM   2514 C CD2 . PHE A 1 333 ? 43.652 50.358 7.639   1.00 26.94  ? 402 PHE A CD2 1 
ATOM   2515 C CE1 . PHE A 1 333 ? 41.021 50.007 8.421   1.00 24.47  ? 402 PHE A CE1 1 
ATOM   2516 C CE2 . PHE A 1 333 ? 43.002 49.172 7.353   1.00 28.79  ? 402 PHE A CE2 1 
ATOM   2517 C CZ  . PHE A 1 333 ? 41.681 48.995 7.744   1.00 29.95  ? 402 PHE A CZ  1 
ATOM   2518 N N   . ALA A 1 334 ? 43.004 55.759 9.536   1.00 25.95  ? 403 ALA A N   1 
ATOM   2519 C CA  . ALA A 1 334 ? 43.516 56.877 10.316  1.00 19.44  ? 403 ALA A CA  1 
ATOM   2520 C C   . ALA A 1 334 ? 42.903 56.794 11.702  1.00 25.28  ? 403 ALA A C   1 
ATOM   2521 O O   . ALA A 1 334 ? 41.765 56.342 11.865  1.00 27.92  ? 403 ALA A O   1 
ATOM   2522 C CB  . ALA A 1 334 ? 43.191 58.230 9.677   1.00 22.45  ? 403 ALA A CB  1 
ATOM   2523 N N   . LEU A 1 335 ? 43.667 57.228 12.700  1.00 27.52  ? 404 LEU A N   1 
ATOM   2524 C CA  . LEU A 1 335 ? 43.217 57.112 14.082  1.00 37.48  ? 404 LEU A CA  1 
ATOM   2525 C C   . LEU A 1 335 ? 41.910 57.871 14.289  1.00 45.48  ? 404 LEU A C   1 
ATOM   2526 O O   . LEU A 1 335 ? 41.768 59.021 13.861  1.00 48.72  ? 404 LEU A O   1 
ATOM   2527 C CB  . LEU A 1 335 ? 44.294 57.636 15.029  1.00 40.80  ? 404 LEU A CB  1 
ATOM   2528 C CG  . LEU A 1 335 ? 44.197 57.138 16.466  1.00 38.67  ? 404 LEU A CG  1 
ATOM   2529 C CD1 . LEU A 1 335 ? 44.766 55.737 16.573  1.00 39.08  ? 404 LEU A CD1 1 
ATOM   2530 C CD2 . LEU A 1 335 ? 44.913 58.095 17.397  1.00 32.04  ? 404 LEU A CD2 1 
ATOM   2531 N N   . ALA A 1 336 ? 40.949 57.219 14.934  1.00 44.99  ? 405 ALA A N   1 
ATOM   2532 C CA  . ALA A 1 336 ? 39.637 57.818 15.113  1.00 47.82  ? 405 ALA A CA  1 
ATOM   2533 C C   . ALA A 1 336 ? 39.638 58.775 16.294  1.00 45.94  ? 405 ALA A C   1 
ATOM   2534 O O   . ALA A 1 336 ? 40.311 58.551 17.303  1.00 44.39  ? 405 ALA A O   1 
ATOM   2535 C CB  . ALA A 1 336 ? 38.571 56.742 15.322  1.00 44.13  ? 405 ALA A CB  1 
ATOM   2536 N N   . ARG A 1 337 ? 38.867 59.848 16.158  1.00 43.32  ? 406 ARG A N   1 
ATOM   2537 C CA  . ARG A 1 337 ? 38.681 60.804 17.241  1.00 45.81  ? 406 ARG A CA  1 
ATOM   2538 C C   . ARG A 1 337 ? 37.277 61.388 17.181  1.00 51.72  ? 406 ARG A C   1 
ATOM   2539 O O   . ARG A 1 337 ? 36.749 61.874 18.181  1.00 58.74  ? 406 ARG A O   1 
ATOM   2540 C CB  . ARG A 1 337 ? 39.720 61.919 17.166  1.00 39.95  ? 406 ARG A CB  1 
ATOM   2541 C CG  . ARG A 1 337 ? 39.532 62.828 15.973  1.00 37.44  ? 406 ARG A CG  1 
ATOM   2542 C CD  . ARG A 1 337 ? 40.745 63.689 15.752  1.00 41.06  ? 406 ARG A CD  1 
ATOM   2543 N NE  . ARG A 1 337 ? 40.492 64.731 14.765  1.00 47.33  ? 406 ARG A NE  1 
ATOM   2544 C CZ  . ARG A 1 337 ? 39.933 65.901 15.048  1.00 58.27  ? 406 ARG A CZ  1 
ATOM   2545 N NH1 . ARG A 1 337 ? 39.742 66.796 14.089  1.00 63.64  ? 406 ARG A NH1 1 
ATOM   2546 N NH2 . ARG A 1 337 ? 39.563 66.175 16.291  1.00 62.80  ? 406 ARG A NH2 1 
ATOM   2547 O OXT . ARG A 1 337 ? 36.637 61.381 16.130  1.00 53.14  ? 406 ARG A OXT 1 
ATOM   2548 N N   . GLY B 1 1   ? -3.200 5.920  45.267  1.00 50.60  ? 70  GLY B N   1 
ATOM   2549 C CA  . GLY B 1 1   ? -2.339 6.103  44.113  1.00 53.39  ? 70  GLY B CA  1 
ATOM   2550 C C   . GLY B 1 1   ? -2.960 5.580  42.836  1.00 64.23  ? 70  GLY B C   1 
ATOM   2551 O O   . GLY B 1 1   ? -2.779 4.419  42.471  1.00 66.83  ? 70  GLY B O   1 
ATOM   2552 N N   . ASN B 1 2   ? -3.710 6.446  42.152  1.00 74.87  ? 71  ASN B N   1 
ATOM   2553 C CA  . ASN B 1 2   ? -4.441 6.023  40.964  1.00 79.11  ? 71  ASN B CA  1 
ATOM   2554 C C   . ASN B 1 2   ? -4.470 7.093  39.877  1.00 74.70  ? 71  ASN B C   1 
ATOM   2555 O O   . ASN B 1 2   ? -5.321 7.026  38.983  1.00 84.28  ? 71  ASN B O   1 
ATOM   2556 C CB  . ASN B 1 2   ? -5.875 5.641  41.343  1.00 87.05  ? 71  ASN B CB  1 
ATOM   2557 C CG  . ASN B 1 2   ? -6.518 6.651  42.285  1.00 93.52  ? 71  ASN B CG  1 
ATOM   2558 O OD1 . ASN B 1 2   ? -5.961 7.720  42.543  1.00 88.22  ? 71  ASN B OD1 1 
ATOM   2559 N ND2 . ASN B 1 2   ? -7.701 6.319  42.796  1.00 101.09 ? 71  ASN B ND2 1 
ATOM   2560 N N   . THR B 1 3   ? -3.570 8.073  39.919  1.00 60.42  ? 72  THR B N   1 
ATOM   2561 C CA  . THR B 1 3   ? -3.626 9.230  39.036  1.00 51.11  ? 72  THR B CA  1 
ATOM   2562 C C   . THR B 1 3   ? -2.435 9.220  38.089  1.00 51.26  ? 72  THR B C   1 
ATOM   2563 O O   . THR B 1 3   ? -1.288 9.094  38.530  1.00 54.49  ? 72  THR B O   1 
ATOM   2564 C CB  . THR B 1 3   ? -3.652 10.540 39.837  1.00 27.15  ? 72  THR B CB  1 
ATOM   2565 N N   . THR B 1 4   ? -2.715 9.321  36.787  1.00 40.29  ? 73  THR B N   1 
ATOM   2566 C CA  . THR B 1 4   ? -1.705 9.574  35.763  1.00 42.62  ? 73  THR B CA  1 
ATOM   2567 C C   . THR B 1 4   ? -2.264 10.620 34.810  1.00 43.91  ? 73  THR B C   1 
ATOM   2568 O O   . THR B 1 4   ? -3.153 10.316 34.010  1.00 56.16  ? 73  THR B O   1 
ATOM   2569 C CB  . THR B 1 4   ? -1.322 8.305  34.991  1.00 43.81  ? 73  THR B CB  1 
ATOM   2570 O OG1 . THR B 1 4   ? -2.286 8.056  33.963  1.00 32.62  ? 73  THR B OG1 1 
ATOM   2571 C CG2 . THR B 1 4   ? -1.243 7.095  35.907  1.00 54.58  ? 73  THR B CG2 1 
ATOM   2572 N N   . SER B 1 5   ? -1.752 11.845 34.889  1.00 37.23  ? 74  SER B N   1 
ATOM   2573 C CA  . SER B 1 5   ? -2.191 12.917 34.006  1.00 43.90  ? 74  SER B CA  1 
ATOM   2574 C C   . SER B 1 5   ? -1.202 13.115 32.862  1.00 36.92  ? 74  SER B C   1 
ATOM   2575 O O   . SER B 1 5   ? -0.012 12.819 32.982  1.00 40.41  ? 74  SER B O   1 
ATOM   2576 C CB  . SER B 1 5   ? -2.381 14.229 34.776  1.00 44.14  ? 74  SER B CB  1 
ATOM   2577 O OG  . SER B 1 5   ? -1.287 14.498 35.630  1.00 50.41  ? 74  SER B OG  1 
ATOM   2578 N N   . SER B 1 6   ? -1.719 13.602 31.737  1.00 39.12  ? 75  SER B N   1 
ATOM   2579 C CA  . SER B 1 6   ? -0.934 13.844 30.535  1.00 40.32  ? 75  SER B CA  1 
ATOM   2580 C C   . SER B 1 6   ? -1.024 15.316 30.164  1.00 46.11  ? 75  SER B C   1 
ATOM   2581 O O   . SER B 1 6   ? -2.117 15.888 30.138  1.00 55.76  ? 75  SER B O   1 
ATOM   2582 C CB  . SER B 1 6   ? -1.425 12.981 29.367  1.00 31.54  ? 75  SER B CB  1 
ATOM   2583 O OG  . SER B 1 6   ? -1.439 11.607 29.712  1.00 48.60  ? 75  SER B OG  1 
ATOM   2584 N N   . VAL B 1 7   ? 0.118  15.928 29.875  1.00 42.81  ? 76  VAL B N   1 
ATOM   2585 C CA  . VAL B 1 7   ? 0.162  17.297 29.383  1.00 45.60  ? 76  VAL B CA  1 
ATOM   2586 C C   . VAL B 1 7   ? 0.653  17.255 27.943  1.00 50.82  ? 76  VAL B C   1 
ATOM   2587 O O   . VAL B 1 7   ? 1.756  16.766 27.666  1.00 59.57  ? 76  VAL B O   1 
ATOM   2588 C CB  . VAL B 1 7   ? 1.052  18.193 30.256  1.00 45.92  ? 76  VAL B CB  1 
ATOM   2589 C CG1 . VAL B 1 7   ? 0.763  19.656 29.974  1.00 42.58  ? 76  VAL B CG1 1 
ATOM   2590 C CG2 . VAL B 1 7   ? 0.831  17.885 31.724  1.00 47.99  ? 76  VAL B CG2 1 
ATOM   2591 N N   . ILE B 1 8   ? -0.180 17.747 27.027  1.00 47.92  ? 77  ILE B N   1 
ATOM   2592 C CA  . ILE B 1 8   ? 0.200  17.836 25.624  1.00 46.12  ? 77  ILE B CA  1 
ATOM   2593 C C   . ILE B 1 8   ? 1.287  18.892 25.473  1.00 42.42  ? 77  ILE B C   1 
ATOM   2594 O O   . ILE B 1 8   ? 1.348  19.864 26.236  1.00 49.62  ? 77  ILE B O   1 
ATOM   2595 C CB  . ILE B 1 8   ? -1.038 18.166 24.766  1.00 51.44  ? 77  ILE B CB  1 
ATOM   2596 C CG1 . ILE B 1 8   ? -2.143 17.127 24.987  1.00 56.45  ? 77  ILE B CG1 1 
ATOM   2597 C CG2 . ILE B 1 8   ? -0.696 18.229 23.293  1.00 40.94  ? 77  ILE B CG2 1 
ATOM   2598 C CD1 . ILE B 1 8   ? -1.777 15.731 24.527  1.00 52.58  ? 77  ILE B CD1 1 
ATOM   2599 N N   . LEU B 1 9   ? 2.164  18.701 24.487  1.00 43.55  ? 78  LEU B N   1 
ATOM   2600 C CA  . LEU B 1 9   ? 3.245  19.640 24.217  1.00 37.33  ? 78  LEU B CA  1 
ATOM   2601 C C   . LEU B 1 9   ? 3.202  20.104 22.768  1.00 38.27  ? 78  LEU B C   1 
ATOM   2602 O O   . LEU B 1 9   ? 2.782  19.369 21.868  1.00 31.77  ? 78  LEU B O   1 
ATOM   2603 C CB  . LEU B 1 9   ? 4.619  19.026 24.505  1.00 32.76  ? 78  LEU B CB  1 
ATOM   2604 C CG  . LEU B 1 9   ? 4.851  18.425 25.892  1.00 30.21  ? 78  LEU B CG  1 
ATOM   2605 C CD1 . LEU B 1 9   ? 6.179  17.700 25.910  1.00 28.73  ? 78  LEU B CD1 1 
ATOM   2606 C CD2 . LEU B 1 9   ? 4.811  19.494 26.963  1.00 24.72  ? 78  LEU B CD2 1 
ATOM   2607 N N   . THR B 1 10  ? 3.653  21.336 22.555  1.00 38.47  ? 79  THR B N   1 
ATOM   2608 C CA  . THR B 1 10  ? 3.772  21.919 21.228  1.00 34.60  ? 79  THR B CA  1 
ATOM   2609 C C   . THR B 1 10  ? 5.219  21.820 20.759  1.00 37.80  ? 79  THR B C   1 
ATOM   2610 O O   . THR B 1 10  ? 6.135  22.251 21.466  1.00 36.19  ? 79  THR B O   1 
ATOM   2611 C CB  . THR B 1 10  ? 3.323  23.382 21.232  1.00 35.45  ? 79  THR B CB  1 
ATOM   2612 O OG1 . THR B 1 10  ? 1.899  23.449 21.377  1.00 34.74  ? 79  THR B OG1 1 
ATOM   2613 C CG2 . THR B 1 10  ? 3.736  24.067 19.935  1.00 17.29  ? 79  THR B CG2 1 
ATOM   2614 N N   . ASN B 1 11  ? 5.418  21.247 19.572  1.00 31.90  ? 80  ASN B N   1 
ATOM   2615 C CA  . ASN B 1 11  ? 6.736  21.149 18.953  1.00 20.06  ? 80  ASN B CA  1 
ATOM   2616 C C   . ASN B 1 11  ? 6.930  22.349 18.038  1.00 25.86  ? 80  ASN B C   1 
ATOM   2617 O O   . ASN B 1 11  ? 6.332  22.424 16.961  1.00 35.85  ? 80  ASN B O   1 
ATOM   2618 C CB  . ASN B 1 11  ? 6.872  19.838 18.182  1.00 26.22  ? 80  ASN B CB  1 
ATOM   2619 C CG  . ASN B 1 11  ? 8.207  19.706 17.455  1.00 29.88  ? 80  ASN B CG  1 
ATOM   2620 O OD1 . ASN B 1 11  ? 9.024  20.626 17.437  1.00 30.30  ? 80  ASN B OD1 1 
ATOM   2621 N ND2 . ASN B 1 11  ? 8.426  18.551 16.842  1.00 31.62  ? 80  ASN B ND2 1 
ATOM   2622 N N   . TYR B 1 12  ? 7.773  23.278 18.457  1.00 29.99  ? 81  TYR B N   1 
ATOM   2623 C CA  . TYR B 1 12  ? 8.157  24.414 17.629  1.00 28.79  ? 81  TYR B CA  1 
ATOM   2624 C C   . TYR B 1 12  ? 9.500  24.082 16.987  1.00 33.81  ? 81  TYR B C   1 
ATOM   2625 O O   . TYR B 1 12  ? 10.545 24.143 17.639  1.00 47.13  ? 81  TYR B O   1 
ATOM   2626 C CB  . TYR B 1 12  ? 8.221  25.693 18.457  1.00 29.29  ? 81  TYR B CB  1 
ATOM   2627 C CG  . TYR B 1 12  ? 8.786  26.884 17.718  1.00 35.84  ? 81  TYR B CG  1 
ATOM   2628 C CD1 . TYR B 1 12  ? 7.986  27.655 16.884  1.00 36.74  ? 81  TYR B CD1 1 
ATOM   2629 C CD2 . TYR B 1 12  ? 10.119 27.246 17.865  1.00 36.25  ? 81  TYR B CD2 1 
ATOM   2630 C CE1 . TYR B 1 12  ? 8.505  28.750 16.209  1.00 40.26  ? 81  TYR B CE1 1 
ATOM   2631 C CE2 . TYR B 1 12  ? 10.643 28.333 17.197  1.00 34.40  ? 81  TYR B CE2 1 
ATOM   2632 C CZ  . TYR B 1 12  ? 9.836  29.082 16.373  1.00 40.46  ? 81  TYR B CZ  1 
ATOM   2633 O OH  . TYR B 1 12  ? 10.369 30.167 15.714  1.00 45.97  ? 81  TYR B OH  1 
ATOM   2634 N N   . MET B 1 13  ? 9.457  23.689 15.713  1.00 27.99  ? 82  MET B N   1 
ATOM   2635 C CA  . MET B 1 13  ? 10.645 23.560 14.865  1.00 28.99  ? 82  MET B CA  1 
ATOM   2636 C C   . MET B 1 13  ? 11.693 22.623 15.458  1.00 28.09  ? 82  MET B C   1 
ATOM   2637 O O   . MET B 1 13  ? 12.893 22.855 15.318  1.00 37.04  ? 82  MET B O   1 
ATOM   2638 C CB  . MET B 1 13  ? 11.251 24.932 14.578  1.00 35.22  ? 82  MET B CB  1 
ATOM   2639 C CG  . MET B 1 13  ? 10.203 25.960 14.178  1.00 45.71  ? 82  MET B CG  1 
ATOM   2640 S SD  . MET B 1 13  ? 10.844 27.193 13.042  1.00 53.73  ? 82  MET B SD  1 
ATOM   2641 C CE  . MET B 1 13  ? 12.313 27.696 13.949  1.00 54.51  ? 82  MET B CE  1 
ATOM   2642 N N   . ASP B 1 14  ? 11.247 21.565 16.127  1.00 37.63  ? 83  ASP B N   1 
ATOM   2643 C CA  . ASP B 1 14  ? 12.095 20.518 16.691  1.00 31.51  ? 83  ASP B CA  1 
ATOM   2644 C C   . ASP B 1 14  ? 13.065 21.034 17.747  1.00 28.70  ? 83  ASP B C   1 
ATOM   2645 O O   . ASP B 1 14  ? 13.953 20.291 18.178  1.00 26.60  ? 83  ASP B O   1 
ATOM   2646 C CB  . ASP B 1 14  ? 12.873 19.778 15.597  1.00 32.17  ? 83  ASP B CB  1 
ATOM   2647 C CG  . ASP B 1 14  ? 11.969 19.033 14.645  1.00 44.79  ? 83  ASP B CG  1 
ATOM   2648 O OD1 . ASP B 1 14  ? 11.010 18.387 15.118  1.00 41.70  ? 83  ASP B OD1 1 
ATOM   2649 O OD2 . ASP B 1 14  ? 12.210 19.109 13.419  1.00 53.30  ? 83  ASP B OD2 1 
ATOM   2650 N N   . THR B 1 15  ? 12.929 22.283 18.185  1.00 25.16  ? 84  THR B N   1 
ATOM   2651 C CA  . THR B 1 15  ? 13.869 22.841 19.145  1.00 23.85  ? 84  THR B CA  1 
ATOM   2652 C C   . THR B 1 15  ? 13.226 23.317 20.443  1.00 27.69  ? 84  THR B C   1 
ATOM   2653 O O   . THR B 1 15  ? 13.940 23.465 21.438  1.00 27.05  ? 84  THR B O   1 
ATOM   2654 C CB  . THR B 1 15  ? 14.660 23.999 18.510  1.00 26.99  ? 84  THR B CB  1 
ATOM   2655 O OG1 . THR B 1 15  ? 13.774 25.066 18.152  1.00 29.73  ? 84  THR B OG1 1 
ATOM   2656 C CG2 . THR B 1 15  ? 15.373 23.521 17.257  1.00 39.85  ? 84  THR B CG2 1 
ATOM   2657 N N   . GLN B 1 16  ? 11.911 23.532 20.474  1.00 20.54  ? 85  GLN B N   1 
ATOM   2658 C CA  . GLN B 1 16  ? 11.219 23.979 21.677  1.00 25.97  ? 85  GLN B CA  1 
ATOM   2659 C C   . GLN B 1 16  ? 9.967  23.138 21.883  1.00 26.80  ? 85  GLN B C   1 
ATOM   2660 O O   . GLN B 1 16  ? 9.061  23.154 21.043  1.00 32.30  ? 85  GLN B O   1 
ATOM   2661 C CB  . GLN B 1 16  ? 10.865 25.464 21.582  1.00 30.04  ? 85  GLN B CB  1 
ATOM   2662 C CG  . GLN B 1 16  ? 12.034 26.341 21.172  1.00 34.95  ? 85  GLN B CG  1 
ATOM   2663 C CD  . GLN B 1 16  ? 11.836 27.788 21.559  1.00 34.83  ? 85  GLN B CD  1 
ATOM   2664 O OE1 . GLN B 1 16  ? 11.030 28.102 22.435  1.00 38.87  ? 85  GLN B OE1 1 
ATOM   2665 N NE2 . GLN B 1 16  ? 12.578 28.679 20.913  1.00 25.69  ? 85  GLN B NE2 1 
ATOM   2666 N N   . TYR B 1 17  ? 9.917  22.407 22.995  1.00 28.66  ? 86  TYR B N   1 
ATOM   2667 C CA  . TYR B 1 17  ? 8.778  21.570 23.360  1.00 30.39  ? 86  TYR B CA  1 
ATOM   2668 C C   . TYR B 1 17  ? 8.208  22.081 24.675  1.00 32.40  ? 86  TYR B C   1 
ATOM   2669 O O   . TYR B 1 17  ? 8.881  22.007 25.708  1.00 39.83  ? 86  TYR B O   1 
ATOM   2670 C CB  . TYR B 1 17  ? 9.194  20.105 23.510  1.00 24.32  ? 86  TYR B CB  1 
ATOM   2671 C CG  . TYR B 1 17  ? 9.631  19.427 22.235  1.00 27.90  ? 86  TYR B CG  1 
ATOM   2672 C CD1 . TYR B 1 17  ? 10.879 19.684 21.676  1.00 28.56  ? 86  TYR B CD1 1 
ATOM   2673 C CD2 . TYR B 1 17  ? 8.805  18.511 21.598  1.00 31.18  ? 86  TYR B CD2 1 
ATOM   2674 C CE1 . TYR B 1 17  ? 11.283 19.058 20.504  1.00 26.12  ? 86  TYR B CE1 1 
ATOM   2675 C CE2 . TYR B 1 17  ? 9.200  17.879 20.431  1.00 37.02  ? 86  TYR B CE2 1 
ATOM   2676 C CZ  . TYR B 1 17  ? 10.438 18.155 19.888  1.00 33.57  ? 86  TYR B CZ  1 
ATOM   2677 O OH  . TYR B 1 17  ? 10.830 17.521 18.732  1.00 32.46  ? 86  TYR B OH  1 
ATOM   2678 N N   . TYR B 1 18  ? 6.972  22.584 24.649  1.00 31.11  ? 87  TYR B N   1 
ATOM   2679 C CA  . TYR B 1 18  ? 6.396  23.214 25.829  1.00 34.75  ? 87  TYR B CA  1 
ATOM   2680 C C   . TYR B 1 18  ? 4.918  22.867 25.974  1.00 37.38  ? 87  TYR B C   1 
ATOM   2681 O O   . TYR B 1 18  ? 4.218  22.609 24.989  1.00 28.08  ? 87  TYR B O   1 
ATOM   2682 C CB  . TYR B 1 18  ? 6.564  24.738 25.783  1.00 32.87  ? 87  TYR B CB  1 
ATOM   2683 C CG  . TYR B 1 18  ? 6.034  25.370 24.516  1.00 33.65  ? 87  TYR B CG  1 
ATOM   2684 C CD1 . TYR B 1 18  ? 4.698  25.748 24.408  1.00 31.26  ? 87  TYR B CD1 1 
ATOM   2685 C CD2 . TYR B 1 18  ? 6.867  25.593 23.426  1.00 20.43  ? 87  TYR B CD2 1 
ATOM   2686 C CE1 . TYR B 1 18  ? 4.209  26.327 23.249  1.00 32.86  ? 87  TYR B CE1 1 
ATOM   2687 C CE2 . TYR B 1 18  ? 6.388  26.174 22.268  1.00 33.66  ? 87  TYR B CE2 1 
ATOM   2688 C CZ  . TYR B 1 18  ? 5.057  26.539 22.183  1.00 42.11  ? 87  TYR B CZ  1 
ATOM   2689 O OH  . TYR B 1 18  ? 4.577  27.116 21.027  1.00 55.84  ? 87  TYR B OH  1 
ATOM   2690 N N   . GLY B 1 19  ? 4.450  22.882 27.226  1.00 35.56  ? 88  GLY B N   1 
ATOM   2691 C CA  . GLY B 1 19  ? 3.058  22.631 27.538  1.00 31.38  ? 88  GLY B CA  1 
ATOM   2692 C C   . GLY B 1 19  ? 2.465  23.756 28.371  1.00 33.59  ? 88  GLY B C   1 
ATOM   2693 O O   . GLY B 1 19  ? 3.123  24.757 28.659  1.00 44.17  ? 88  GLY B O   1 
ATOM   2694 N N   . GLU B 1 20  ? 1.211  23.560 28.763  1.00 31.89  ? 89  GLU B N   1 
ATOM   2695 C CA  . GLU B 1 20  ? 0.448  24.585 29.462  1.00 35.11  ? 89  GLU B CA  1 
ATOM   2696 C C   . GLU B 1 20  ? 0.257  24.213 30.925  1.00 37.36  ? 89  GLU B C   1 
ATOM   2697 O O   . GLU B 1 20  ? -0.130 23.082 31.242  1.00 43.54  ? 89  GLU B O   1 
ATOM   2698 C CB  . GLU B 1 20  ? -0.912 24.797 28.797  1.00 41.60  ? 89  GLU B CB  1 
ATOM   2699 C CG  . GLU B 1 20  ? -1.700 25.963 29.359  1.00 63.44  ? 89  GLU B CG  1 
ATOM   2700 C CD  . GLU B 1 20  ? -2.789 26.426 28.414  1.00 83.16  ? 89  GLU B CD  1 
ATOM   2701 O OE1 . GLU B 1 20  ? -2.521 26.514 27.195  1.00 87.17  ? 89  GLU B OE1 1 
ATOM   2702 O OE2 . GLU B 1 20  ? -3.914 26.693 28.890  1.00 85.79  ? 89  GLU B OE2 1 
ATOM   2703 N N   . ILE B 1 21  ? 0.529  25.172 31.807  1.00 37.28  ? 90  ILE B N   1 
ATOM   2704 C CA  . ILE B 1 21  ? 0.173  25.098 33.217  1.00 42.47  ? 90  ILE B CA  1 
ATOM   2705 C C   . ILE B 1 21  ? -0.619 26.348 33.573  1.00 43.29  ? 90  ILE B C   1 
ATOM   2706 O O   . ILE B 1 21  ? -0.501 27.388 32.920  1.00 48.85  ? 90  ILE B O   1 
ATOM   2707 C CB  . ILE B 1 21  ? 1.408  24.965 34.135  1.00 34.74  ? 90  ILE B CB  1 
ATOM   2708 C CG1 . ILE B 1 21  ? 2.297  26.202 34.023  1.00 33.69  ? 90  ILE B CG1 1 
ATOM   2709 C CG2 . ILE B 1 21  ? 2.192  23.718 33.791  1.00 33.41  ? 90  ILE B CG2 1 
ATOM   2710 C CD1 . ILE B 1 21  ? 3.514  26.145 34.912  1.00 36.53  ? 90  ILE B CD1 1 
ATOM   2711 N N   . GLY B 1 22  ? -1.440 26.235 34.604  1.00 37.23  ? 91  GLY B N   1 
ATOM   2712 C CA  . GLY B 1 22  ? -2.207 27.361 35.119  1.00 35.96  ? 91  GLY B CA  1 
ATOM   2713 C C   . GLY B 1 22  ? -1.830 27.642 36.560  1.00 55.49  ? 91  GLY B C   1 
ATOM   2714 O O   . GLY B 1 22  ? -1.707 26.719 37.368  1.00 62.95  ? 91  GLY B O   1 
ATOM   2715 N N   . ILE B 1 23  ? -1.645 28.920 36.872  1.00 60.27  ? 92  ILE B N   1 
ATOM   2716 C CA  . ILE B 1 23  ? -1.205 29.348 38.192  1.00 60.49  ? 92  ILE B CA  1 
ATOM   2717 C C   . ILE B 1 23  ? -2.195 30.379 38.715  1.00 62.61  ? 92  ILE B C   1 
ATOM   2718 O O   . ILE B 1 23  ? -2.366 31.443 38.108  1.00 61.21  ? 92  ILE B O   1 
ATOM   2719 C CB  . ILE B 1 23  ? 0.218  29.931 38.158  1.00 53.17  ? 92  ILE B CB  1 
ATOM   2720 C CG1 . ILE B 1 23  ? 1.181  28.944 37.494  1.00 53.70  ? 92  ILE B CG1 1 
ATOM   2721 C CG2 . ILE B 1 23  ? 0.695  30.270 39.559  1.00 47.63  ? 92  ILE B CG2 1 
ATOM   2722 C CD1 . ILE B 1 23  ? 2.587  29.479 37.308  1.00 51.88  ? 92  ILE B CD1 1 
ATOM   2723 N N   . GLY B 1 24  ? -2.847 30.065 39.828  1.00 67.97  ? 93  GLY B N   1 
ATOM   2724 C CA  . GLY B 1 24  ? -3.661 31.025 40.548  1.00 79.00  ? 93  GLY B CA  1 
ATOM   2725 C C   . GLY B 1 24  ? -5.136 30.661 40.539  1.00 80.44  ? 93  GLY B C   1 
ATOM   2726 O O   . GLY B 1 24  ? -5.573 29.690 39.918  1.00 84.26  ? 93  GLY B O   1 
ATOM   2727 N N   . THR B 1 25  ? -5.897 31.469 41.273  1.00 74.93  ? 94  THR B N   1 
ATOM   2728 C CA  . THR B 1 25  ? -7.358 31.420 41.254  1.00 72.25  ? 94  THR B CA  1 
ATOM   2729 C C   . THR B 1 25  ? -7.849 32.826 40.947  1.00 70.21  ? 94  THR B C   1 
ATOM   2730 O O   . THR B 1 25  ? -7.806 33.704 41.826  1.00 80.53  ? 94  THR B O   1 
ATOM   2731 C CB  . THR B 1 25  ? -7.935 30.929 42.575  1.00 75.87  ? 94  THR B CB  1 
ATOM   2732 O OG1 . THR B 1 25  ? -7.316 29.688 42.936  1.00 75.69  ? 94  THR B OG1 1 
ATOM   2733 C CG2 . THR B 1 25  ? -9.437 30.727 42.454  1.00 75.71  ? 94  THR B CG2 1 
ATOM   2734 N N   . PRO B 1 26  ? -8.318 33.088 39.719  1.00 61.91  ? 95  PRO B N   1 
ATOM   2735 C CA  . PRO B 1 26  ? -8.467 32.132 38.618  1.00 63.87  ? 95  PRO B CA  1 
ATOM   2736 C C   . PRO B 1 26  ? -7.113 31.780 37.994  1.00 60.76  ? 95  PRO B C   1 
ATOM   2737 O O   . PRO B 1 26  ? -6.149 32.518 38.208  1.00 56.88  ? 95  PRO B O   1 
ATOM   2738 C CB  . PRO B 1 26  ? -9.366 32.885 37.634  1.00 61.28  ? 95  PRO B CB  1 
ATOM   2739 C CG  . PRO B 1 26  ? -9.020 34.320 37.850  1.00 58.45  ? 95  PRO B CG  1 
ATOM   2740 C CD  . PRO B 1 26  ? -8.664 34.461 39.309  1.00 58.13  ? 95  PRO B CD  1 
ATOM   2741 N N   . PRO B 1 27  ? -7.032 30.666 37.253  1.00 59.67  ? 96  PRO B N   1 
ATOM   2742 C CA  . PRO B 1 27  ? -5.735 30.188 36.756  1.00 68.69  ? 96  PRO B CA  1 
ATOM   2743 C C   . PRO B 1 27  ? -5.253 30.994 35.560  1.00 68.40  ? 96  PRO B C   1 
ATOM   2744 O O   . PRO B 1 27  ? -5.877 30.982 34.490  1.00 65.14  ? 96  PRO B O   1 
ATOM   2745 C CB  . PRO B 1 27  ? -6.017 28.724 36.388  1.00 65.36  ? 96  PRO B CB  1 
ATOM   2746 C CG  . PRO B 1 27  ? -7.402 28.421 36.910  1.00 55.55  ? 96  PRO B CG  1 
ATOM   2747 C CD  . PRO B 1 27  ? -8.113 29.724 36.922  1.00 54.14  ? 96  PRO B CD  1 
ATOM   2748 N N   . GLN B 1 28  ? -4.140 31.706 35.735  1.00 63.62  ? 97  GLN B N   1 
ATOM   2749 C CA  . GLN B 1 28  ? -3.465 32.372 34.628  1.00 59.55  ? 97  GLN B CA  1 
ATOM   2750 C C   . GLN B 1 28  ? -2.528 31.375 33.956  1.00 57.60  ? 97  GLN B C   1 
ATOM   2751 O O   . GLN B 1 28  ? -1.595 30.867 34.590  1.00 48.06  ? 97  GLN B O   1 
ATOM   2752 C CB  . GLN B 1 28  ? -2.693 33.597 35.115  1.00 63.92  ? 97  GLN B CB  1 
ATOM   2753 C CG  . GLN B 1 28  ? -3.310 34.289 36.321  1.00 71.07  ? 97  GLN B CG  1 
ATOM   2754 C CD  . GLN B 1 28  ? -2.482 35.463 36.820  1.00 73.29  ? 97  GLN B CD  1 
ATOM   2755 O OE1 . GLN B 1 28  ? -1.821 36.150 36.039  1.00 74.32  ? 97  GLN B OE1 1 
ATOM   2756 N NE2 . GLN B 1 28  ? -2.525 35.705 38.129  1.00 68.97  ? 97  GLN B NE2 1 
ATOM   2757 N N   . THR B 1 29  ? -2.778 31.096 32.680  1.00 58.79  ? 98  THR B N   1 
ATOM   2758 C CA  . THR B 1 29  ? -2.093 30.031 31.964  1.00 51.89  ? 98  THR B CA  1 
ATOM   2759 C C   . THR B 1 29  ? -0.769 30.508 31.382  1.00 52.49  ? 98  THR B C   1 
ATOM   2760 O O   . THR B 1 29  ? -0.628 31.661 30.962  1.00 47.98  ? 98  THR B O   1 
ATOM   2761 C CB  . THR B 1 29  ? -2.972 29.487 30.841  1.00 51.50  ? 98  THR B CB  1 
ATOM   2762 O OG1 . THR B 1 29  ? -3.431 30.574 30.028  1.00 56.54  ? 98  THR B OG1 1 
ATOM   2763 C CG2 . THR B 1 29  ? -4.162 28.743 31.425  1.00 44.32  ? 98  THR B CG2 1 
ATOM   2764 N N   . PHE B 1 30  ? 0.198  29.589 31.344  1.00 58.00  ? 99  PHE B N   1 
ATOM   2765 C CA  . PHE B 1 30  ? 1.537  29.876 30.850  1.00 53.04  ? 99  PHE B CA  1 
ATOM   2766 C C   . PHE B 1 30  ? 2.043  28.710 30.014  1.00 45.66  ? 99  PHE B C   1 
ATOM   2767 O O   . PHE B 1 30  ? 1.702  27.551 30.267  1.00 43.09  ? 99  PHE B O   1 
ATOM   2768 C CB  . PHE B 1 30  ? 2.519  30.136 31.998  1.00 49.33  ? 99  PHE B CB  1 
ATOM   2769 C CG  . PHE B 1 30  ? 2.233  31.389 32.761  1.00 57.89  ? 99  PHE B CG  1 
ATOM   2770 C CD1 . PHE B 1 30  ? 2.722  32.606 32.326  1.00 61.43  ? 99  PHE B CD1 1 
ATOM   2771 C CD2 . PHE B 1 30  ? 1.471  31.353 33.915  1.00 64.69  ? 99  PHE B CD2 1 
ATOM   2772 C CE1 . PHE B 1 30  ? 2.459  33.764 33.030  1.00 63.08  ? 99  PHE B CE1 1 
ATOM   2773 C CE2 . PHE B 1 30  ? 1.201  32.508 34.620  1.00 64.09  ? 99  PHE B CE2 1 
ATOM   2774 C CZ  . PHE B 1 30  ? 1.695  33.714 34.176  1.00 59.84  ? 99  PHE B CZ  1 
ATOM   2775 N N   . LYS B 1 31  ? 2.865  29.032 29.016  1.00 36.90  ? 100 LYS B N   1 
ATOM   2776 C CA  . LYS B 1 31  ? 3.594  28.028 28.252  1.00 34.41  ? 100 LYS B CA  1 
ATOM   2777 C C   . LYS B 1 31  ? 4.931  27.766 28.940  1.00 38.21  ? 100 LYS B C   1 
ATOM   2778 O O   . LYS B 1 31  ? 5.728  28.693 29.126  1.00 39.35  ? 100 LYS B O   1 
ATOM   2779 C CB  . LYS B 1 31  ? 3.822  28.492 26.815  1.00 37.55  ? 100 LYS B CB  1 
ATOM   2780 C CG  . LYS B 1 31  ? 2.576  28.670 25.974  1.00 37.88  ? 100 LYS B CG  1 
ATOM   2781 C CD  . LYS B 1 31  ? 2.923  29.455 24.711  1.00 42.54  ? 100 LYS B CD  1 
ATOM   2782 C CE  . LYS B 1 31  ? 1.719  29.658 23.812  1.00 44.32  ? 100 LYS B CE  1 
ATOM   2783 N NZ  . LYS B 1 31  ? 1.776  30.979 23.127  1.00 39.02  ? 100 LYS B NZ  1 
ATOM   2784 N N   . VAL B 1 32  ? 5.185  26.507 29.303  1.00 29.74  ? 101 VAL B N   1 
ATOM   2785 C CA  . VAL B 1 32  ? 6.394  26.151 30.034  1.00 37.01  ? 101 VAL B CA  1 
ATOM   2786 C C   . VAL B 1 32  ? 7.067  24.941 29.402  1.00 36.13  ? 101 VAL B C   1 
ATOM   2787 O O   . VAL B 1 32  ? 6.412  24.036 28.874  1.00 33.78  ? 101 VAL B O   1 
ATOM   2788 C CB  . VAL B 1 32  ? 6.111  25.880 31.530  1.00 35.31  ? 101 VAL B CB  1 
ATOM   2789 C CG1 . VAL B 1 32  ? 5.740  27.170 32.233  1.00 32.06  ? 101 VAL B CG1 1 
ATOM   2790 C CG2 . VAL B 1 32  ? 5.023  24.831 31.697  1.00 30.23  ? 101 VAL B CG2 1 
ATOM   2791 N N   . VAL B 1 33  ? 8.396  24.945 29.457  1.00 32.30  ? 102 VAL B N   1 
ATOM   2792 C CA  . VAL B 1 33  ? 9.220  23.802 29.079  1.00 27.50  ? 102 VAL B CA  1 
ATOM   2793 C C   . VAL B 1 33  ? 9.464  22.956 30.323  1.00 33.91  ? 102 VAL B C   1 
ATOM   2794 O O   . VAL B 1 33  ? 9.850  23.480 31.378  1.00 29.24  ? 102 VAL B O   1 
ATOM   2795 C CB  . VAL B 1 33  ? 10.550 24.269 28.463  1.00 31.16  ? 102 VAL B CB  1 
ATOM   2796 C CG1 . VAL B 1 33  ? 11.530 23.108 28.336  1.00 31.29  ? 102 VAL B CG1 1 
ATOM   2797 C CG2 . VAL B 1 33  ? 10.310 24.924 27.117  1.00 40.59  ? 102 VAL B CG2 1 
ATOM   2798 N N   . PHE B 1 34  ? 9.239  21.648 30.206  1.00 31.18  ? 103 PHE B N   1 
ATOM   2799 C CA  . PHE B 1 34  ? 9.470  20.718 31.310  1.00 35.64  ? 103 PHE B CA  1 
ATOM   2800 C C   . PHE B 1 34  ? 10.893 20.174 31.203  1.00 34.79  ? 103 PHE B C   1 
ATOM   2801 O O   . PHE B 1 34  ? 11.190 19.360 30.323  1.00 33.31  ? 103 PHE B O   1 
ATOM   2802 C CB  . PHE B 1 34  ? 8.430  19.602 31.293  1.00 28.77  ? 103 PHE B CB  1 
ATOM   2803 C CG  . PHE B 1 34  ? 7.022  20.095 31.471  1.00 31.70  ? 103 PHE B CG  1 
ATOM   2804 C CD1 . PHE B 1 34  ? 6.514  20.330 32.732  1.00 31.20  ? 103 PHE B CD1 1 
ATOM   2805 C CD2 . PHE B 1 34  ? 6.215  20.344 30.372  1.00 35.63  ? 103 PHE B CD2 1 
ATOM   2806 C CE1 . PHE B 1 34  ? 5.220  20.789 32.897  1.00 33.42  ? 103 PHE B CE1 1 
ATOM   2807 C CE2 . PHE B 1 34  ? 4.921  20.805 30.533  1.00 38.65  ? 103 PHE B CE2 1 
ATOM   2808 C CZ  . PHE B 1 34  ? 4.425  21.026 31.798  1.00 31.94  ? 103 PHE B CZ  1 
ATOM   2809 N N   . ASP B 1 35  ? 11.761 20.609 32.120  1.00 26.86  ? 104 ASP B N   1 
ATOM   2810 C CA  . ASP B 1 35  ? 13.211 20.486 31.991  1.00 19.10  ? 104 ASP B CA  1 
ATOM   2811 C C   . ASP B 1 35  ? 13.766 19.663 33.152  1.00 27.90  ? 104 ASP B C   1 
ATOM   2812 O O   . ASP B 1 35  ? 13.834 20.143 34.291  1.00 27.27  ? 104 ASP B O   1 
ATOM   2813 C CB  . ASP B 1 35  ? 13.839 21.881 31.932  1.00 24.64  ? 104 ASP B CB  1 
ATOM   2814 C CG  . ASP B 1 35  ? 15.350 21.869 32.110  1.00 36.29  ? 104 ASP B CG  1 
ATOM   2815 O OD1 . ASP B 1 35  ? 16.003 20.901 31.670  1.00 38.82  ? 104 ASP B OD1 1 
ATOM   2816 O OD2 . ASP B 1 35  ? 15.892 22.856 32.652  1.00 35.00  ? 104 ASP B OD2 1 
ATOM   2817 N N   . THR B 1 36  ? 14.170 18.422 32.868  1.00 23.67  ? 105 THR B N   1 
ATOM   2818 C CA  . THR B 1 36  ? 14.811 17.596 33.885  1.00 26.68  ? 105 THR B CA  1 
ATOM   2819 C C   . THR B 1 36  ? 16.203 18.087 34.255  1.00 31.37  ? 105 THR B C   1 
ATOM   2820 O O   . THR B 1 36  ? 16.804 17.532 35.181  1.00 27.48  ? 105 THR B O   1 
ATOM   2821 C CB  . THR B 1 36  ? 14.922 16.147 33.416  1.00 27.98  ? 105 THR B CB  1 
ATOM   2822 O OG1 . THR B 1 36  ? 15.482 16.118 32.090  1.00 26.13  ? 105 THR B OG1 1 
ATOM   2823 C CG2 . THR B 1 36  ? 13.560 15.484 33.430  1.00 20.46  ? 105 THR B CG2 1 
ATOM   2824 N N   . GLY B 1 37  ? 16.733 19.083 33.545  1.00 29.57  ? 106 GLY B N   1 
ATOM   2825 C CA  . GLY B 1 37  ? 18.035 19.660 33.791  1.00 22.91  ? 106 GLY B CA  1 
ATOM   2826 C C   . GLY B 1 37  ? 18.067 20.811 34.768  1.00 30.86  ? 106 GLY B C   1 
ATOM   2827 O O   . GLY B 1 37  ? 19.153 21.310 35.085  1.00 31.76  ? 106 GLY B O   1 
ATOM   2828 N N   . SER B 1 38  ? 16.910 21.260 35.251  1.00 30.89  ? 107 SER B N   1 
ATOM   2829 C CA  . SER B 1 38  ? 16.837 22.284 36.281  1.00 35.66  ? 107 SER B CA  1 
ATOM   2830 C C   . SER B 1 38  ? 15.774 21.872 37.292  1.00 39.55  ? 107 SER B C   1 
ATOM   2831 O O   . SER B 1 38  ? 15.067 20.877 37.107  1.00 37.67  ? 107 SER B O   1 
ATOM   2832 C CB  . SER B 1 38  ? 16.553 23.667 35.679  1.00 37.99  ? 107 SER B CB  1 
ATOM   2833 O OG  . SER B 1 38  ? 15.318 23.685 34.989  1.00 46.61  ? 107 SER B OG  1 
ATOM   2834 N N   . SER B 1 39  ? 15.662 22.640 38.380  1.00 42.68  ? 108 SER B N   1 
ATOM   2835 C CA  . SER B 1 39  ? 14.818 22.228 39.494  1.00 49.05  ? 108 SER B CA  1 
ATOM   2836 C C   . SER B 1 39  ? 13.820 23.273 39.986  1.00 47.91  ? 108 SER B C   1 
ATOM   2837 O O   . SER B 1 39  ? 13.007 22.952 40.861  1.00 51.88  ? 108 SER B O   1 
ATOM   2838 C CB  . SER B 1 39  ? 15.694 21.778 40.674  1.00 41.07  ? 108 SER B CB  1 
ATOM   2839 O OG  . SER B 1 39  ? 16.384 20.579 40.360  1.00 38.28  ? 108 SER B OG  1 
ATOM   2840 N N   . ASN B 1 40  ? 13.838 24.494 39.459  1.00 37.22  ? 109 ASN B N   1 
ATOM   2841 C CA  . ASN B 1 40  ? 12.937 25.542 39.915  1.00 32.21  ? 109 ASN B CA  1 
ATOM   2842 C C   . ASN B 1 40  ? 11.843 25.796 38.888  1.00 38.08  ? 109 ASN B C   1 
ATOM   2843 O O   . ASN B 1 40  ? 12.054 25.647 37.683  1.00 46.21  ? 109 ASN B O   1 
ATOM   2844 C CB  . ASN B 1 40  ? 13.691 26.848 40.183  1.00 26.28  ? 109 ASN B CB  1 
ATOM   2845 C CG  . ASN B 1 40  ? 14.732 26.704 41.269  1.00 30.26  ? 109 ASN B CG  1 
ATOM   2846 O OD1 . ASN B 1 40  ? 15.782 26.099 41.058  1.00 29.59  ? 109 ASN B OD1 1 
ATOM   2847 N ND2 . ASN B 1 40  ? 14.445 27.258 42.444  1.00 36.68  ? 109 ASN B ND2 1 
ATOM   2848 N N   . VAL B 1 41  ? 10.666 26.176 39.379  1.00 38.43  ? 110 VAL B N   1 
ATOM   2849 C CA  . VAL B 1 41  ? 9.589  26.661 38.522  1.00 39.69  ? 110 VAL B CA  1 
ATOM   2850 C C   . VAL B 1 41  ? 9.673  28.179 38.474  1.00 42.74  ? 110 VAL B C   1 
ATOM   2851 O O   . VAL B 1 41  ? 9.712  28.836 39.522  1.00 46.26  ? 110 VAL B O   1 
ATOM   2852 C CB  . VAL B 1 41  ? 8.212  26.206 39.037  1.00 27.62  ? 110 VAL B CB  1 
ATOM   2853 C CG1 . VAL B 1 41  ? 7.119  26.714 38.118  1.00 27.76  ? 110 VAL B CG1 1 
ATOM   2854 C CG2 . VAL B 1 41  ? 8.138  24.702 39.141  1.00 23.73  ? 110 VAL B CG2 1 
ATOM   2855 N N   . TRP B 1 42  ? 9.710  28.742 37.263  1.00 30.27  ? 111 TRP B N   1 
ATOM   2856 C CA  . TRP B 1 42  ? 9.681  30.191 37.109  1.00 28.45  ? 111 TRP B CA  1 
ATOM   2857 C C   . TRP B 1 42  ? 8.845  30.581 35.904  1.00 37.59  ? 111 TRP B C   1 
ATOM   2858 O O   . TRP B 1 42  ? 8.839  29.885 34.885  1.00 36.75  ? 111 TRP B O   1 
ATOM   2859 C CB  . TRP B 1 42  ? 11.089 30.804 36.989  1.00 25.52  ? 111 TRP B CB  1 
ATOM   2860 C CG  . TRP B 1 42  ? 11.866 30.495 35.733  1.00 38.89  ? 111 TRP B CG  1 
ATOM   2861 C CD1 . TRP B 1 42  ? 12.828 29.536 35.583  1.00 46.65  ? 111 TRP B CD1 1 
ATOM   2862 C CD2 . TRP B 1 42  ? 11.786 31.178 34.474  1.00 40.91  ? 111 TRP B CD2 1 
ATOM   2863 N NE1 . TRP B 1 42  ? 13.337 29.568 34.307  1.00 49.12  ? 111 TRP B NE1 1 
ATOM   2864 C CE2 . TRP B 1 42  ? 12.712 30.566 33.606  1.00 43.95  ? 111 TRP B CE2 1 
ATOM   2865 C CE3 . TRP B 1 42  ? 11.008 32.234 33.990  1.00 46.85  ? 111 TRP B CE3 1 
ATOM   2866 C CZ2 . TRP B 1 42  ? 12.885 30.979 32.290  1.00 51.90  ? 111 TRP B CZ2 1 
ATOM   2867 C CZ3 . TRP B 1 42  ? 11.182 32.643 32.686  1.00 53.32  ? 111 TRP B CZ3 1 
ATOM   2868 C CH2 . TRP B 1 42  ? 12.112 32.017 31.848  1.00 54.97  ? 111 TRP B CH2 1 
ATOM   2869 N N   . VAL B 1 43  ? 8.128  31.693 36.048  1.00 42.65  ? 112 VAL B N   1 
ATOM   2870 C CA  . VAL B 1 43  ? 7.389  32.324 34.958  1.00 42.96  ? 112 VAL B CA  1 
ATOM   2871 C C   . VAL B 1 43  ? 7.682  33.821 35.002  1.00 46.87  ? 112 VAL B C   1 
ATOM   2872 O O   . VAL B 1 43  ? 8.159  34.343 36.023  1.00 48.50  ? 112 VAL B O   1 
ATOM   2873 C CB  . VAL B 1 43  ? 5.870  32.048 35.060  1.00 40.48  ? 112 VAL B CB  1 
ATOM   2874 C CG1 . VAL B 1 43  ? 5.586  30.552 34.952  1.00 31.41  ? 112 VAL B CG1 1 
ATOM   2875 C CG2 . VAL B 1 43  ? 5.312  32.617 36.350  1.00 35.00  ? 112 VAL B CG2 1 
ATOM   2876 N N   . PRO B 1 44  ? 7.433  34.535 33.903  1.00 39.72  ? 113 PRO B N   1 
ATOM   2877 C CA  . PRO B 1 44  ? 7.635  35.990 33.927  1.00 42.51  ? 113 PRO B CA  1 
ATOM   2878 C C   . PRO B 1 44  ? 6.608  36.672 34.816  1.00 48.88  ? 113 PRO B C   1 
ATOM   2879 O O   . PRO B 1 44  ? 5.424  36.325 34.811  1.00 51.85  ? 113 PRO B O   1 
ATOM   2880 C CB  . PRO B 1 44  ? 7.470  36.401 32.458  1.00 39.76  ? 113 PRO B CB  1 
ATOM   2881 C CG  . PRO B 1 44  ? 7.693  35.139 31.679  1.00 38.78  ? 113 PRO B CG  1 
ATOM   2882 C CD  . PRO B 1 44  ? 7.144  34.047 32.545  1.00 32.96  ? 113 PRO B CD  1 
ATOM   2883 N N   . SER B 1 45  ? 7.073  37.648 35.587  1.00 54.67  ? 114 SER B N   1 
ATOM   2884 C CA  . SER B 1 45  ? 6.214  38.338 36.536  1.00 67.48  ? 114 SER B CA  1 
ATOM   2885 C C   . SER B 1 45  ? 5.617  39.598 35.925  1.00 74.61  ? 114 SER B C   1 
ATOM   2886 O O   . SER B 1 45  ? 6.155  40.178 34.978  1.00 70.79  ? 114 SER B O   1 
ATOM   2887 C CB  . SER B 1 45  ? 6.987  38.709 37.798  1.00 70.81  ? 114 SER B CB  1 
ATOM   2888 O OG  . SER B 1 45  ? 6.144  39.391 38.709  1.00 76.77  ? 114 SER B OG  1 
ATOM   2889 N N   . SER B 1 46  ? 4.481  40.018 36.490  1.00 78.13  ? 115 SER B N   1 
ATOM   2890 C CA  . SER B 1 46  ? 3.913  41.312 36.128  1.00 68.78  ? 115 SER B CA  1 
ATOM   2891 C C   . SER B 1 46  ? 4.831  42.450 36.542  1.00 65.21  ? 115 SER B C   1 
ATOM   2892 O O   . SER B 1 46  ? 4.897  43.474 35.855  1.00 69.99  ? 115 SER B O   1 
ATOM   2893 C CB  . SER B 1 46  ? 2.540  41.486 36.772  1.00 59.88  ? 115 SER B CB  1 
ATOM   2894 O OG  . SER B 1 46  ? 2.640  41.427 38.186  1.00 57.82  ? 115 SER B OG  1 
ATOM   2895 N N   . LYS B 1 47  ? 5.547  42.289 37.647  1.00 65.90  ? 116 LYS B N   1 
ATOM   2896 C CA  . LYS B 1 47  ? 6.516  43.284 38.087  1.00 68.97  ? 116 LYS B CA  1 
ATOM   2897 C C   . LYS B 1 47  ? 7.779  43.293 37.236  1.00 67.87  ? 116 LYS B C   1 
ATOM   2898 O O   . LYS B 1 47  ? 8.721  44.022 37.576  1.00 67.39  ? 116 LYS B O   1 
ATOM   2899 C CB  . LYS B 1 47  ? 6.872  43.053 39.556  1.00 68.40  ? 116 LYS B CB  1 
ATOM   2900 C CG  . LYS B 1 47  ? 5.817  43.539 40.532  1.00 70.12  ? 116 LYS B CG  1 
ATOM   2901 C CD  . LYS B 1 47  ? 4.852  42.424 40.901  1.00 74.38  ? 116 LYS B CD  1 
ATOM   2902 C CE  . LYS B 1 47  ? 3.955  42.834 42.060  1.00 82.86  ? 116 LYS B CE  1 
ATOM   2903 N NZ  . LYS B 1 47  ? 3.236  41.669 42.652  1.00 85.08  ? 116 LYS B NZ  1 
ATOM   2904 N N   . CYS B 1 48  ? 7.868  42.522 36.156  1.00 71.21  ? 117 CYS B N   1 
ATOM   2905 C CA  . CYS B 1 48  ? 9.023  42.629 35.278  1.00 71.11  ? 117 CYS B CA  1 
ATOM   2906 C C   . CYS B 1 48  ? 9.028  43.983 34.586  1.00 67.85  ? 117 CYS B C   1 
ATOM   2907 O O   . CYS B 1 48  ? 7.977  44.521 34.230  1.00 69.87  ? 117 CYS B O   1 
ATOM   2908 C CB  . CYS B 1 48  ? 9.030  41.519 34.228  1.00 69.59  ? 117 CYS B CB  1 
ATOM   2909 S SG  . CYS B 1 48  ? 10.373 41.750 33.038  1.00 64.09  ? 117 CYS B SG  1 
ATOM   2910 N N   . SER B 1 49  ? 10.221 44.528 34.391  1.00 69.44  ? 118 SER B N   1 
ATOM   2911 C CA  . SER B 1 49  ? 10.356 45.838 33.776  1.00 70.20  ? 118 SER B CA  1 
ATOM   2912 C C   . SER B 1 49  ? 9.901  45.819 32.319  1.00 72.16  ? 118 SER B C   1 
ATOM   2913 O O   . SER B 1 49  ? 10.064 44.828 31.603  1.00 64.47  ? 118 SER B O   1 
ATOM   2914 C CB  . SER B 1 49  ? 11.804 46.309 33.861  1.00 67.59  ? 118 SER B CB  1 
ATOM   2915 O OG  . SER B 1 49  ? 11.974 47.521 33.161  1.00 65.27  ? 118 SER B OG  1 
ATOM   2916 N N   . ARG B 1 50  ? 9.314  46.937 31.885  1.00 81.64  ? 119 ARG B N   1 
ATOM   2917 C CA  . ARG B 1 50  ? 8.941  47.093 30.483  1.00 77.65  ? 119 ARG B CA  1 
ATOM   2918 C C   . ARG B 1 50  ? 10.155 47.311 29.591  1.00 68.42  ? 119 ARG B C   1 
ATOM   2919 O O   . ARG B 1 50  ? 10.040 47.184 28.368  1.00 65.78  ? 119 ARG B O   1 
ATOM   2920 C CB  . ARG B 1 50  ? 7.964  48.259 30.323  1.00 81.43  ? 119 ARG B CB  1 
ATOM   2921 N N   . LEU B 1 51  ? 11.307 47.636 30.174  1.00 65.73  ? 120 LEU B N   1 
ATOM   2922 C CA  . LEU B 1 51  ? 12.529 47.855 29.415  1.00 64.36  ? 120 LEU B CA  1 
ATOM   2923 C C   . LEU B 1 51  ? 13.265 46.558 29.096  1.00 68.42  ? 120 LEU B C   1 
ATOM   2924 O O   . LEU B 1 51  ? 14.325 46.601 28.460  1.00 69.63  ? 120 LEU B O   1 
ATOM   2925 C CB  . LEU B 1 51  ? 13.437 48.829 30.174  1.00 66.44  ? 120 LEU B CB  1 
ATOM   2926 C CG  . LEU B 1 51  ? 12.748 50.158 30.528  1.00 68.65  ? 120 LEU B CG  1 
ATOM   2927 C CD1 . LEU B 1 51  ? 12.470 50.284 32.014  1.00 65.63  ? 120 LEU B CD1 1 
ATOM   2928 C CD2 . LEU B 1 51  ? 13.554 51.351 30.041  1.00 70.49  ? 120 LEU B CD2 1 
ATOM   2929 N N   . TYR B 1 52  ? 12.733 45.415 29.525  1.00 63.32  ? 121 TYR B N   1 
ATOM   2930 C CA  . TYR B 1 52  ? 13.164 44.105 29.050  1.00 52.76  ? 121 TYR B CA  1 
ATOM   2931 C C   . TYR B 1 52  ? 12.152 43.658 28.002  1.00 52.79  ? 121 TYR B C   1 
ATOM   2932 O O   . TYR B 1 52  ? 11.003 43.353 28.335  1.00 60.76  ? 121 TYR B O   1 
ATOM   2933 C CB  . TYR B 1 52  ? 13.252 43.099 30.196  1.00 46.00  ? 121 TYR B CB  1 
ATOM   2934 C CG  . TYR B 1 52  ? 14.470 43.265 31.073  1.00 56.83  ? 121 TYR B CG  1 
ATOM   2935 C CD1 . TYR B 1 52  ? 15.746 43.083 30.559  1.00 59.11  ? 121 TYR B CD1 1 
ATOM   2936 C CD2 . TYR B 1 52  ? 14.347 43.594 32.418  1.00 59.15  ? 121 TYR B CD2 1 
ATOM   2937 C CE1 . TYR B 1 52  ? 16.863 43.231 31.355  1.00 56.02  ? 121 TYR B CE1 1 
ATOM   2938 C CE2 . TYR B 1 52  ? 15.463 43.741 33.223  1.00 53.01  ? 121 TYR B CE2 1 
ATOM   2939 C CZ  . TYR B 1 52  ? 16.716 43.558 32.684  1.00 47.31  ? 121 TYR B CZ  1 
ATOM   2940 O OH  . TYR B 1 52  ? 17.834 43.702 33.468  1.00 54.92  ? 121 TYR B OH  1 
ATOM   2941 N N   . THR B 1 53  ? 12.578 43.623 26.737  1.00 45.75  ? 122 THR B N   1 
ATOM   2942 C CA  . THR B 1 53  ? 11.628 43.417 25.646  1.00 51.49  ? 122 THR B CA  1 
ATOM   2943 C C   . THR B 1 53  ? 10.950 42.055 25.730  1.00 59.03  ? 122 THR B C   1 
ATOM   2944 O O   . THR B 1 53  ? 9.792  41.914 25.321  1.00 58.36  ? 122 THR B O   1 
ATOM   2945 C CB  . THR B 1 53  ? 12.324 43.579 24.293  1.00 46.69  ? 122 THR B CB  1 
ATOM   2946 O OG1 . THR B 1 53  ? 13.308 44.615 24.377  1.00 59.62  ? 122 THR B OG1 1 
ATOM   2947 C CG2 . THR B 1 53  ? 11.317 43.956 23.227  1.00 49.12  ? 122 THR B CG2 1 
ATOM   2948 N N   . ALA B 1 54  ? 11.646 41.045 26.259  1.00 60.35  ? 123 ALA B N   1 
ATOM   2949 C CA  . ALA B 1 54  ? 11.039 39.725 26.392  1.00 61.80  ? 123 ALA B CA  1 
ATOM   2950 C C   . ALA B 1 54  ? 9.759  39.783 27.218  1.00 60.64  ? 123 ALA B C   1 
ATOM   2951 O O   . ALA B 1 54  ? 8.798  39.057 26.941  1.00 66.45  ? 123 ALA B O   1 
ATOM   2952 C CB  . ALA B 1 54  ? 12.037 38.749 27.014  1.00 63.34  ? 123 ALA B CB  1 
ATOM   2953 N N   . CYS B 1 55  ? 9.719  40.656 28.224  1.00 57.37  ? 124 CYS B N   1 
ATOM   2954 C CA  . CYS B 1 55  ? 8.550  40.761 29.087  1.00 55.78  ? 124 CYS B CA  1 
ATOM   2955 C C   . CYS B 1 55  ? 7.359  41.419 28.403  1.00 63.97  ? 124 CYS B C   1 
ATOM   2956 O O   . CYS B 1 55  ? 6.250  41.367 28.944  1.00 68.17  ? 124 CYS B O   1 
ATOM   2957 C CB  . CYS B 1 55  ? 8.923  41.525 30.357  1.00 52.58  ? 124 CYS B CB  1 
ATOM   2958 S SG  . CYS B 1 55  ? 9.950  40.536 31.469  1.00 55.18  ? 124 CYS B SG  1 
ATOM   2959 N N   . VAL B 1 56  ? 7.555  42.028 27.236  1.00 63.89  ? 125 VAL B N   1 
ATOM   2960 C CA  . VAL B 1 56  ? 6.433  42.576 26.484  1.00 61.13  ? 125 VAL B CA  1 
ATOM   2961 C C   . VAL B 1 56  ? 5.744  41.483 25.676  1.00 63.30  ? 125 VAL B C   1 
ATOM   2962 O O   . VAL B 1 56  ? 4.516  41.479 25.531  1.00 54.53  ? 125 VAL B O   1 
ATOM   2963 C CB  . VAL B 1 56  ? 6.920  43.729 25.583  1.00 57.49  ? 125 VAL B CB  1 
ATOM   2964 C CG1 . VAL B 1 56  ? 5.834  44.150 24.602  1.00 52.21  ? 125 VAL B CG1 1 
ATOM   2965 C CG2 . VAL B 1 56  ? 7.382  44.912 26.428  1.00 50.46  ? 125 VAL B CG2 1 
ATOM   2966 N N   . TYR B 1 57  ? 6.518  40.531 25.155  1.00 71.92  ? 126 TYR B N   1 
ATOM   2967 C CA  . TYR B 1 57  ? 6.028  39.539 24.209  1.00 67.97  ? 126 TYR B CA  1 
ATOM   2968 C C   . TYR B 1 57  ? 5.606  38.228 24.863  1.00 57.84  ? 126 TYR B C   1 
ATOM   2969 O O   . TYR B 1 57  ? 5.206  37.304 24.149  1.00 57.49  ? 126 TYR B O   1 
ATOM   2970 C CB  . TYR B 1 57  ? 7.101  39.255 23.151  1.00 70.20  ? 126 TYR B CB  1 
ATOM   2971 C CG  . TYR B 1 57  ? 7.074  40.172 21.943  1.00 73.94  ? 126 TYR B CG  1 
ATOM   2972 C CD1 . TYR B 1 57  ? 7.540  41.482 22.021  1.00 75.36  ? 126 TYR B CD1 1 
ATOM   2973 C CD2 . TYR B 1 57  ? 6.606  39.717 20.716  1.00 79.51  ? 126 TYR B CD2 1 
ATOM   2974 C CE1 . TYR B 1 57  ? 7.525  42.318 20.907  1.00 77.32  ? 126 TYR B CE1 1 
ATOM   2975 C CE2 . TYR B 1 57  ? 6.588  40.542 19.599  1.00 83.54  ? 126 TYR B CE2 1 
ATOM   2976 C CZ  . TYR B 1 57  ? 7.048  41.839 19.698  1.00 80.06  ? 126 TYR B CZ  1 
ATOM   2977 O OH  . TYR B 1 57  ? 7.024  42.649 18.584  1.00 73.65  ? 126 TYR B OH  1 
ATOM   2978 N N   . HIS B 1 58  ? 5.681  38.117 26.187  1.00 51.37  ? 127 HIS B N   1 
ATOM   2979 C CA  . HIS B 1 58  ? 5.363  36.880 26.886  1.00 54.43  ? 127 HIS B CA  1 
ATOM   2980 C C   . HIS B 1 58  ? 4.268  37.118 27.917  1.00 57.99  ? 127 HIS B C   1 
ATOM   2981 O O   . HIS B 1 58  ? 4.041  38.245 28.367  1.00 71.74  ? 127 HIS B O   1 
ATOM   2982 C CB  . HIS B 1 58  ? 6.600  36.295 27.587  1.00 54.36  ? 127 HIS B CB  1 
ATOM   2983 C CG  . HIS B 1 58  ? 7.574  35.642 26.660  1.00 47.77  ? 127 HIS B CG  1 
ATOM   2984 N ND1 . HIS B 1 58  ? 8.653  36.310 26.123  1.00 46.72  ? 127 HIS B ND1 1 
ATOM   2985 C CD2 . HIS B 1 58  ? 7.636  34.379 26.177  1.00 46.50  ? 127 HIS B CD2 1 
ATOM   2986 C CE1 . HIS B 1 58  ? 9.338  35.488 25.347  1.00 39.87  ? 127 HIS B CE1 1 
ATOM   2987 N NE2 . HIS B 1 58  ? 8.742  34.310 25.361  1.00 42.49  ? 127 HIS B NE2 1 
ATOM   2988 N N   . LYS B 1 59  ? 3.592  36.036 28.298  1.00 41.88  ? 128 LYS B N   1 
ATOM   2989 C CA  . LYS B 1 59  ? 2.593  36.123 29.352  1.00 39.87  ? 128 LYS B CA  1 
ATOM   2990 C C   . LYS B 1 59  ? 3.257  36.494 30.672  1.00 49.38  ? 128 LYS B C   1 
ATOM   2991 O O   . LYS B 1 59  ? 4.397  36.114 30.946  1.00 58.69  ? 128 LYS B O   1 
ATOM   2992 C CB  . LYS B 1 59  ? 1.846  34.796 29.492  1.00 43.74  ? 128 LYS B CB  1 
ATOM   2993 C CG  . LYS B 1 59  ? 0.549  34.886 30.288  1.00 45.98  ? 128 LYS B CG  1 
ATOM   2994 C CD  . LYS B 1 59  ? -0.603 35.389 29.439  1.00 47.78  ? 128 LYS B CD  1 
ATOM   2995 C CE  . LYS B 1 59  ? -1.229 34.252 28.649  1.00 55.00  ? 128 LYS B CE  1 
ATOM   2996 N NZ  . LYS B 1 59  ? -2.209 33.489 29.467  1.00 54.46  ? 128 LYS B NZ  1 
ATOM   2997 N N   . LEU B 1 60  ? 2.536  37.257 31.491  1.00 48.52  ? 129 LEU B N   1 
ATOM   2998 C CA  . LEU B 1 60  ? 3.031  37.694 32.788  1.00 56.69  ? 129 LEU B CA  1 
ATOM   2999 C C   . LEU B 1 60  ? 2.091  37.219 33.887  1.00 62.85  ? 129 LEU B C   1 
ATOM   3000 O O   . LEU B 1 60  ? 0.892  37.031 33.662  1.00 67.13  ? 129 LEU B O   1 
ATOM   3001 C CB  . LEU B 1 60  ? 3.177  39.219 32.842  1.00 53.25  ? 129 LEU B CB  1 
ATOM   3002 C CG  . LEU B 1 60  ? 3.823  39.859 31.612  1.00 56.67  ? 129 LEU B CG  1 
ATOM   3003 C CD1 . LEU B 1 60  ? 3.924  41.364 31.781  1.00 56.04  ? 129 LEU B CD1 1 
ATOM   3004 C CD2 . LEU B 1 60  ? 5.195  39.258 31.336  1.00 59.43  ? 129 LEU B CD2 1 
ATOM   3005 N N   . PHE B 1 61  ? 2.643  37.017 35.080  1.00 56.48  ? 130 PHE B N   1 
ATOM   3006 C CA  . PHE B 1 61  ? 1.868  36.563 36.228  1.00 57.41  ? 130 PHE B CA  1 
ATOM   3007 C C   . PHE B 1 61  ? 1.570  37.758 37.123  1.00 71.37  ? 130 PHE B C   1 
ATOM   3008 O O   . PHE B 1 61  ? 2.484  38.344 37.714  1.00 77.67  ? 130 PHE B O   1 
ATOM   3009 C CB  . PHE B 1 61  ? 2.610  35.480 37.004  1.00 51.37  ? 130 PHE B CB  1 
ATOM   3010 C CG  . PHE B 1 61  ? 1.951  35.118 38.302  1.00 47.68  ? 130 PHE B CG  1 
ATOM   3011 C CD1 . PHE B 1 61  ? 0.782  34.374 38.315  1.00 48.87  ? 130 PHE B CD1 1 
ATOM   3012 C CD2 . PHE B 1 61  ? 2.490  35.535 39.508  1.00 43.12  ? 130 PHE B CD2 1 
ATOM   3013 C CE1 . PHE B 1 61  ? 0.170  34.040 39.505  1.00 42.74  ? 130 PHE B CE1 1 
ATOM   3014 C CE2 . PHE B 1 61  ? 1.883  35.205 40.702  1.00 44.58  ? 130 PHE B CE2 1 
ATOM   3015 C CZ  . PHE B 1 61  ? 0.718  34.459 40.701  1.00 46.78  ? 130 PHE B CZ  1 
ATOM   3016 N N   . ASP B 1 62  ? 0.290  38.108 37.229  1.00 74.33  ? 131 ASP B N   1 
ATOM   3017 C CA  . ASP B 1 62  ? -0.154 39.197 38.090  1.00 74.41  ? 131 ASP B CA  1 
ATOM   3018 C C   . ASP B 1 62  ? -0.477 38.627 39.467  1.00 69.93  ? 131 ASP B C   1 
ATOM   3019 O O   . ASP B 1 62  ? -1.469 37.908 39.633  1.00 60.01  ? 131 ASP B O   1 
ATOM   3020 C CB  . ASP B 1 62  ? -1.363 39.904 37.487  1.00 74.90  ? 131 ASP B CB  1 
ATOM   3021 C CG  . ASP B 1 62  ? -1.538 41.302 38.025  1.00 77.66  ? 131 ASP B CG  1 
ATOM   3022 O OD1 . ASP B 1 62  ? -1.423 41.474 39.258  1.00 82.96  ? 131 ASP B OD1 1 
ATOM   3023 O OD2 . ASP B 1 62  ? -1.781 42.226 37.220  1.00 72.94  ? 131 ASP B OD2 1 
ATOM   3024 N N   . ALA B 1 63  ? 0.363  38.954 40.453  1.00 70.91  ? 132 ALA B N   1 
ATOM   3025 C CA  . ALA B 1 63  ? 0.188  38.403 41.792  1.00 68.04  ? 132 ALA B CA  1 
ATOM   3026 C C   . ALA B 1 63  ? -1.100 38.904 42.436  1.00 72.05  ? 132 ALA B C   1 
ATOM   3027 O O   . ALA B 1 63  ? -1.844 38.122 43.040  1.00 64.89  ? 132 ALA B O   1 
ATOM   3028 C CB  . ALA B 1 63  ? 1.398  38.749 42.661  1.00 61.20  ? 132 ALA B CB  1 
ATOM   3029 N N   . SER B 1 64  ? -1.389 40.195 42.307  1.00 75.62  ? 133 SER B N   1 
ATOM   3030 C CA  . SER B 1 64  ? -2.593 40.763 42.905  1.00 82.04  ? 133 SER B CA  1 
ATOM   3031 C C   . SER B 1 64  ? -3.882 40.357 42.182  1.00 87.47  ? 133 SER B C   1 
ATOM   3032 O O   . SER B 1 64  ? -4.934 40.905 42.533  1.00 95.23  ? 133 SER B O   1 
ATOM   3033 C CB  . SER B 1 64  ? -2.478 42.287 42.947  1.00 80.99  ? 133 SER B CB  1 
ATOM   3034 O OG  . SER B 1 64  ? -2.668 42.843 41.658  1.00 77.54  ? 133 SER B OG  1 
ATOM   3035 N N   . ASP B 1 65  ? -3.857 39.444 41.207  1.00 80.43  ? 134 ASP B N   1 
ATOM   3036 C CA  . ASP B 1 65  ? -5.051 39.044 40.472  1.00 70.79  ? 134 ASP B CA  1 
ATOM   3037 C C   . ASP B 1 65  ? -5.433 37.593 40.727  1.00 65.62  ? 134 ASP B C   1 
ATOM   3038 O O   . ASP B 1 65  ? -6.179 37.008 39.936  1.00 72.44  ? 134 ASP B O   1 
ATOM   3039 C CB  . ASP B 1 65  ? -4.859 39.270 38.972  1.00 76.45  ? 134 ASP B CB  1 
ATOM   3040 C CG  . ASP B 1 65  ? -4.886 40.735 38.596  1.00 84.76  ? 134 ASP B CG  1 
ATOM   3041 O OD1 . ASP B 1 65  ? -4.821 41.586 39.511  1.00 83.96  ? 134 ASP B OD1 1 
ATOM   3042 O OD2 . ASP B 1 65  ? -4.969 41.034 37.384  1.00 87.78  ? 134 ASP B OD2 1 
ATOM   3043 N N   . SER B 1 66  ? -4.933 36.996 41.806  1.00 56.74  ? 135 SER B N   1 
ATOM   3044 C CA  . SER B 1 66  ? -5.267 35.616 42.129  1.00 57.89  ? 135 SER B CA  1 
ATOM   3045 C C   . SER B 1 66  ? -5.419 35.476 43.635  1.00 59.95  ? 135 SER B C   1 
ATOM   3046 O O   . SER B 1 66  ? -4.521 35.852 44.394  1.00 55.94  ? 135 SER B O   1 
ATOM   3047 C CB  . SER B 1 66  ? -4.207 34.638 41.602  1.00 54.00  ? 135 SER B CB  1 
ATOM   3048 O OG  . SER B 1 66  ? -3.307 34.247 42.623  1.00 51.42  ? 135 SER B OG  1 
ATOM   3049 N N   . SER B 1 67  ? -6.562 34.932 44.057  1.00 67.47  ? 136 SER B N   1 
ATOM   3050 C CA  . SER B 1 67  ? -6.842 34.802 45.480  1.00 65.29  ? 136 SER B CA  1 
ATOM   3051 C C   . SER B 1 67  ? -5.847 33.877 46.165  1.00 68.63  ? 136 SER B C   1 
ATOM   3052 O O   . SER B 1 67  ? -5.577 34.032 47.362  1.00 65.26  ? 136 SER B O   1 
ATOM   3053 C CB  . SER B 1 67  ? -8.270 34.294 45.683  1.00 53.99  ? 136 SER B CB  1 
ATOM   3054 N N   . SER B 1 68  ? -5.278 32.926 45.426  1.00 69.60  ? 137 SER B N   1 
ATOM   3055 C CA  . SER B 1 68  ? -4.416 31.920 46.031  1.00 63.86  ? 137 SER B CA  1 
ATOM   3056 C C   . SER B 1 68  ? -3.003 32.418 46.300  1.00 66.84  ? 137 SER B C   1 
ATOM   3057 O O   . SER B 1 68  ? -2.246 31.720 46.983  1.00 71.13  ? 137 SER B O   1 
ATOM   3058 C CB  . SER B 1 68  ? -4.352 30.682 45.137  1.00 57.79  ? 137 SER B CB  1 
ATOM   3059 O OG  . SER B 1 68  ? -5.598 30.437 44.517  1.00 56.08  ? 137 SER B OG  1 
ATOM   3060 N N   . TYR B 1 69  ? -2.629 33.591 45.792  1.00 67.80  ? 138 TYR B N   1 
ATOM   3061 C CA  . TYR B 1 69  ? -1.252 34.051 45.917  1.00 69.86  ? 138 TYR B CA  1 
ATOM   3062 C C   . TYR B 1 69  ? -0.887 34.287 47.380  1.00 73.94  ? 138 TYR B C   1 
ATOM   3063 O O   . TYR B 1 69  ? -1.727 34.654 48.206  1.00 77.65  ? 138 TYR B O   1 
ATOM   3064 C CB  . TYR B 1 69  ? -1.043 35.329 45.095  1.00 70.81  ? 138 TYR B CB  1 
ATOM   3065 C CG  . TYR B 1 69  ? 0.222  36.096 45.429  1.00 74.48  ? 138 TYR B CG  1 
ATOM   3066 C CD1 . TYR B 1 69  ? 1.477  35.562 45.168  1.00 72.26  ? 138 TYR B CD1 1 
ATOM   3067 C CD2 . TYR B 1 69  ? 0.158  37.358 46.003  1.00 82.93  ? 138 TYR B CD2 1 
ATOM   3068 C CE1 . TYR B 1 69  ? 2.631  36.263 45.477  1.00 77.72  ? 138 TYR B CE1 1 
ATOM   3069 C CE2 . TYR B 1 69  ? 1.305  38.066 46.313  1.00 83.24  ? 138 TYR B CE2 1 
ATOM   3070 C CZ  . TYR B 1 69  ? 2.537  37.515 46.049  1.00 81.98  ? 138 TYR B CZ  1 
ATOM   3071 O OH  . TYR B 1 69  ? 3.676  38.220 46.360  1.00 83.13  ? 138 TYR B OH  1 
ATOM   3072 N N   . LYS B 1 70  ? 0.383  34.040 47.700  1.00 74.58  ? 139 LYS B N   1 
ATOM   3073 C CA  . LYS B 1 70  ? 0.931  34.272 49.028  1.00 68.56  ? 139 LYS B CA  1 
ATOM   3074 C C   . LYS B 1 70  ? 2.347  34.812 48.885  1.00 67.93  ? 139 LYS B C   1 
ATOM   3075 O O   . LYS B 1 70  ? 3.123  34.336 48.053  1.00 73.27  ? 139 LYS B O   1 
ATOM   3076 C CB  . LYS B 1 70  ? 0.921  32.990 49.872  1.00 56.24  ? 139 LYS B CB  1 
ATOM   3077 C CG  . LYS B 1 70  ? 0.733  33.225 51.359  1.00 57.16  ? 139 LYS B CG  1 
ATOM   3078 C CD  . LYS B 1 70  ? 2.066  33.268 52.094  1.00 56.29  ? 139 LYS B CD  1 
ATOM   3079 N N   . HIS B 1 71  ? 2.677  35.806 49.700  1.00 68.73  ? 140 HIS B N   1 
ATOM   3080 C CA  . HIS B 1 71  ? 3.920  36.545 49.539  1.00 77.77  ? 140 HIS B CA  1 
ATOM   3081 C C   . HIS B 1 71  ? 5.083  35.815 50.201  1.00 82.87  ? 140 HIS B C   1 
ATOM   3082 O O   . HIS B 1 71  ? 4.971  35.358 51.342  1.00 94.73  ? 140 HIS B O   1 
ATOM   3083 C CB  . HIS B 1 71  ? 3.768  37.942 50.140  1.00 80.75  ? 140 HIS B CB  1 
ATOM   3084 C CG  . HIS B 1 71  ? 4.985  38.801 49.999  1.00 83.88  ? 140 HIS B CG  1 
ATOM   3085 N ND1 . HIS B 1 71  ? 5.957  38.879 50.973  1.00 85.19  ? 140 HIS B ND1 1 
ATOM   3086 C CD2 . HIS B 1 71  ? 5.380  39.630 49.005  1.00 85.88  ? 140 HIS B CD2 1 
ATOM   3087 C CE1 . HIS B 1 71  ? 6.904  39.713 50.581  1.00 85.06  ? 140 HIS B CE1 1 
ATOM   3088 N NE2 . HIS B 1 71  ? 6.577  40.184 49.391  1.00 85.60  ? 140 HIS B NE2 1 
ATOM   3089 N N   . ASN B 1 72  ? 6.189  35.676 49.473  1.00 71.98  ? 141 ASN B N   1 
ATOM   3090 C CA  . ASN B 1 72  ? 7.470  35.364 50.095  1.00 73.24  ? 141 ASN B CA  1 
ATOM   3091 C C   . ASN B 1 72  ? 8.534  36.402 49.773  1.00 74.46  ? 141 ASN B C   1 
ATOM   3092 O O   . ASN B 1 72  ? 9.196  36.908 50.686  1.00 86.22  ? 141 ASN B O   1 
ATOM   3093 C CB  . ASN B 1 72  ? 7.939  33.964 49.679  1.00 75.17  ? 141 ASN B CB  1 
ATOM   3094 C CG  . ASN B 1 72  ? 9.180  33.512 50.433  1.00 82.74  ? 141 ASN B CG  1 
ATOM   3095 O OD1 . ASN B 1 72  ? 10.286 33.971 50.146  1.00 83.19  ? 141 ASN B OD1 1 
ATOM   3096 N ND2 . ASN B 1 72  ? 9.006  32.605 51.399  1.00 90.31  ? 141 ASN B ND2 1 
ATOM   3097 N N   . GLY B 1 73  ? 8.713  36.742 48.498  1.00 59.94  ? 142 GLY B N   1 
ATOM   3098 C CA  . GLY B 1 73  ? 9.541  37.871 48.119  1.00 56.98  ? 142 GLY B CA  1 
ATOM   3099 C C   . GLY B 1 73  ? 11.040 37.685 48.221  1.00 64.32  ? 142 GLY B C   1 
ATOM   3100 O O   . GLY B 1 73  ? 11.775 38.661 48.047  1.00 71.73  ? 142 GLY B O   1 
ATOM   3101 N N   . THR B 1 74  ? 11.525 36.475 48.491  1.00 57.98  ? 143 THR B N   1 
ATOM   3102 C CA  . THR B 1 74  ? 12.965 36.241 48.551  1.00 53.77  ? 143 THR B CA  1 
ATOM   3103 C C   . THR B 1 74  ? 13.589 36.382 47.168  1.00 63.69  ? 143 THR B C   1 
ATOM   3104 O O   . THR B 1 74  ? 13.063 35.852 46.187  1.00 59.95  ? 143 THR B O   1 
ATOM   3105 C CB  . THR B 1 74  ? 13.253 34.847 49.098  1.00 48.73  ? 143 THR B CB  1 
ATOM   3106 O OG1 . THR B 1 74  ? 12.494 34.632 50.295  1.00 50.53  ? 143 THR B OG1 1 
ATOM   3107 C CG2 . THR B 1 74  ? 14.742 34.681 49.376  1.00 40.20  ? 143 THR B CG2 1 
ATOM   3108 N N   . GLU B 1 75  ? 14.724 37.076 47.092  1.00 72.31  ? 144 GLU B N   1 
ATOM   3109 C CA  . GLU B 1 75  ? 15.396 37.266 45.813  1.00 72.47  ? 144 GLU B CA  1 
ATOM   3110 C C   . GLU B 1 75  ? 15.935 35.940 45.283  1.00 67.92  ? 144 GLU B C   1 
ATOM   3111 O O   . GLU B 1 75  ? 16.449 35.112 46.039  1.00 67.89  ? 144 GLU B O   1 
ATOM   3112 C CB  . GLU B 1 75  ? 16.534 38.281 45.947  1.00 78.68  ? 144 GLU B CB  1 
ATOM   3113 C CG  . GLU B 1 75  ? 16.371 39.536 45.081  1.00 92.35  ? 144 GLU B CG  1 
ATOM   3114 C CD  . GLU B 1 75  ? 16.541 39.273 43.579  1.00 100.60 ? 144 GLU B CD  1 
ATOM   3115 O OE1 . GLU B 1 75  ? 16.262 40.196 42.779  1.00 99.27  ? 144 GLU B OE1 1 
ATOM   3116 O OE2 . GLU B 1 75  ? 16.957 38.156 43.193  1.00 99.57  ? 144 GLU B OE2 1 
ATOM   3117 N N   . LEU B 1 76  ? 15.818 35.748 43.968  1.00 67.60  ? 145 LEU B N   1 
ATOM   3118 C CA  . LEU B 1 76  ? 16.165 34.493 43.312  1.00 63.89  ? 145 LEU B CA  1 
ATOM   3119 C C   . LEU B 1 76  ? 16.943 34.775 42.034  1.00 57.86  ? 145 LEU B C   1 
ATOM   3120 O O   . LEU B 1 76  ? 16.582 35.670 41.263  1.00 52.36  ? 145 LEU B O   1 
ATOM   3121 C CB  . LEU B 1 76  ? 14.900 33.683 42.986  1.00 57.68  ? 145 LEU B CB  1 
ATOM   3122 C CG  . LEU B 1 76  ? 15.027 32.327 42.292  1.00 52.80  ? 145 LEU B CG  1 
ATOM   3123 C CD1 . LEU B 1 76  ? 15.516 31.270 43.261  1.00 52.76  ? 145 LEU B CD1 1 
ATOM   3124 C CD2 . LEU B 1 76  ? 13.695 31.920 41.689  1.00 52.17  ? 145 LEU B CD2 1 
ATOM   3125 N N   . THR B 1 77  ? 18.006 34.004 41.806  1.00 51.25  ? 146 THR B N   1 
ATOM   3126 C CA  . THR B 1 77  ? 18.794 34.123 40.584  1.00 44.96  ? 146 THR B CA  1 
ATOM   3127 C C   . THR B 1 77  ? 19.092 32.735 40.041  1.00 43.41  ? 146 THR B C   1 
ATOM   3128 O O   . THR B 1 77  ? 19.739 31.926 40.712  1.00 41.09  ? 146 THR B O   1 
ATOM   3129 C CB  . THR B 1 77  ? 20.097 34.887 40.828  1.00 41.61  ? 146 THR B CB  1 
ATOM   3130 O OG1 . THR B 1 77  ? 19.798 36.255 41.130  1.00 47.35  ? 146 THR B OG1 1 
ATOM   3131 C CG2 . THR B 1 77  ? 20.990 34.815 39.589  1.00 28.56  ? 146 THR B CG2 1 
ATOM   3132 N N   . LEU B 1 78  ? 18.625 32.462 38.828  1.00 42.83  ? 147 LEU B N   1 
ATOM   3133 C CA  . LEU B 1 78  ? 18.880 31.199 38.156  1.00 36.16  ? 147 LEU B CA  1 
ATOM   3134 C C   . LEU B 1 78  ? 19.820 31.429 36.983  1.00 32.60  ? 147 LEU B C   1 
ATOM   3135 O O   . LEU B 1 78  ? 19.680 32.408 36.243  1.00 27.93  ? 147 LEU B O   1 
ATOM   3136 C CB  . LEU B 1 78  ? 17.580 30.563 37.667  1.00 35.90  ? 147 LEU B CB  1 
ATOM   3137 C CG  . LEU B 1 78  ? 16.427 30.575 38.664  1.00 38.72  ? 147 LEU B CG  1 
ATOM   3138 C CD1 . LEU B 1 78  ? 15.106 30.448 37.920  1.00 34.74  ? 147 LEU B CD1 1 
ATOM   3139 C CD2 . LEU B 1 78  ? 16.594 29.461 39.685  1.00 38.80  ? 147 LEU B CD2 1 
ATOM   3140 N N   . ARG B 1 79  ? 20.769 30.517 36.811  1.00 30.70  ? 148 ARG B N   1 
ATOM   3141 C CA  . ARG B 1 79  ? 21.784 30.630 35.777  1.00 33.85  ? 148 ARG B CA  1 
ATOM   3142 C C   . ARG B 1 79  ? 21.688 29.429 34.849  1.00 39.18  ? 148 ARG B C   1 
ATOM   3143 O O   . ARG B 1 79  ? 21.772 28.282 35.298  1.00 38.34  ? 148 ARG B O   1 
ATOM   3144 C CB  . ARG B 1 79  ? 23.178 30.730 36.392  1.00 32.45  ? 148 ARG B CB  1 
ATOM   3145 C CG  . ARG B 1 79  ? 24.303 30.270 35.471  1.00 40.74  ? 148 ARG B CG  1 
ATOM   3146 C CD  . ARG B 1 79  ? 25.661 30.405 36.156  1.00 43.52  ? 148 ARG B CD  1 
ATOM   3147 N NE  . ARG B 1 79  ? 25.844 31.749 36.695  1.00 57.88  ? 148 ARG B NE  1 
ATOM   3148 C CZ  . ARG B 1 79  ? 26.262 32.791 35.983  1.00 60.36  ? 148 ARG B CZ  1 
ATOM   3149 N NH1 . ARG B 1 79  ? 26.389 33.982 36.555  1.00 55.43  ? 148 ARG B NH1 1 
ATOM   3150 N NH2 . ARG B 1 79  ? 26.558 32.641 34.699  1.00 64.61  ? 148 ARG B NH2 1 
ATOM   3151 N N   . TYR B 1 80  ? 21.503 29.697 33.562  1.00 38.32  ? 149 TYR B N   1 
ATOM   3152 C CA  . TYR B 1 80  ? 21.567 28.695 32.513  1.00 26.45  ? 149 TYR B CA  1 
ATOM   3153 C C   . TYR B 1 80  ? 22.830 28.917 31.694  1.00 33.08  ? 149 TYR B C   1 
ATOM   3154 O O   . TYR B 1 80  ? 23.620 29.830 31.961  1.00 38.85  ? 149 TYR B O   1 
ATOM   3155 C CB  . TYR B 1 80  ? 20.327 28.749 31.620  1.00 26.11  ? 149 TYR B CB  1 
ATOM   3156 C CG  . TYR B 1 80  ? 19.030 28.508 32.347  1.00 31.86  ? 149 TYR B CG  1 
ATOM   3157 C CD1 . TYR B 1 80  ? 18.687 27.236 32.793  1.00 26.41  ? 149 TYR B CD1 1 
ATOM   3158 C CD2 . TYR B 1 80  ? 18.142 29.551 32.584  1.00 31.50  ? 149 TYR B CD2 1 
ATOM   3159 C CE1 . TYR B 1 80  ? 17.494 27.011 33.452  1.00 29.43  ? 149 TYR B CE1 1 
ATOM   3160 C CE2 . TYR B 1 80  ? 16.948 29.333 33.250  1.00 40.77  ? 149 TYR B CE2 1 
ATOM   3161 C CZ  . TYR B 1 80  ? 16.631 28.062 33.681  1.00 40.61  ? 149 TYR B CZ  1 
ATOM   3162 O OH  . TYR B 1 80  ? 15.446 27.844 34.344  1.00 51.07  ? 149 TYR B OH  1 
ATOM   3163 N N   . SER B 1 81  ? 23.005 28.068 30.677  1.00 33.32  ? 150 SER B N   1 
ATOM   3164 C CA  . SER B 1 81  ? 24.157 28.194 29.790  1.00 29.56  ? 150 SER B CA  1 
ATOM   3165 C C   . SER B 1 81  ? 24.153 29.520 29.045  1.00 28.70  ? 150 SER B C   1 
ATOM   3166 O O   . SER B 1 81  ? 25.218 30.007 28.654  1.00 35.90  ? 150 SER B O   1 
ATOM   3167 C CB  . SER B 1 81  ? 24.180 27.043 28.789  1.00 30.89  ? 150 SER B CB  1 
ATOM   3168 O OG  . SER B 1 81  ? 23.169 27.218 27.813  1.00 33.00  ? 150 SER B OG  1 
ATOM   3169 N N   . THR B 1 82  ? 22.975 30.116 28.839  1.00 27.48  ? 151 THR B N   1 
ATOM   3170 C CA  . THR B 1 82  ? 22.867 31.385 28.129  1.00 33.91  ? 151 THR B CA  1 
ATOM   3171 C C   . THR B 1 82  ? 23.029 32.603 29.026  1.00 39.33  ? 151 THR B C   1 
ATOM   3172 O O   . THR B 1 82  ? 23.258 33.704 28.513  1.00 45.25  ? 151 THR B O   1 
ATOM   3173 C CB  . THR B 1 82  ? 21.514 31.492 27.423  1.00 35.80  ? 151 THR B CB  1 
ATOM   3174 O OG1 . THR B 1 82  ? 20.470 31.160 28.348  1.00 42.18  ? 151 THR B OG1 1 
ATOM   3175 C CG2 . THR B 1 82  ? 21.459 30.567 26.219  1.00 27.54  ? 151 THR B CG2 1 
ATOM   3176 N N   . GLY B 1 83  ? 22.893 32.453 30.327  1.00 43.30  ? 152 GLY B N   1 
ATOM   3177 C CA  . GLY B 1 83  ? 22.996 33.594 31.207  1.00 35.65  ? 152 GLY B CA  1 
ATOM   3178 C C   . GLY B 1 83  ? 22.119 33.412 32.439  1.00 37.94  ? 152 GLY B C   1 
ATOM   3179 O O   . GLY B 1 83  ? 21.981 32.301 32.957  1.00 35.79  ? 152 GLY B O   1 
ATOM   3180 N N   . THR B 1 84  ? 21.517 34.518 32.871  1.00 42.08  ? 153 THR B N   1 
ATOM   3181 C CA  . THR B 1 84  ? 20.925 34.649 34.193  1.00 26.94  ? 153 THR B CA  1 
ATOM   3182 C C   . THR B 1 84  ? 19.526 35.240 34.098  1.00 33.91  ? 153 THR B C   1 
ATOM   3183 O O   . THR B 1 84  ? 19.291 36.173 33.326  1.00 47.46  ? 153 THR B O   1 
ATOM   3184 C CB  . THR B 1 84  ? 21.826 35.539 35.063  1.00 33.81  ? 153 THR B CB  1 
ATOM   3185 O OG1 . THR B 1 84  ? 22.904 34.753 35.590  1.00 46.82  ? 153 THR B OG1 1 
ATOM   3186 C CG2 . THR B 1 84  ? 21.048 36.207 36.191  1.00 39.13  ? 153 THR B CG2 1 
ATOM   3187 N N   . VAL B 1 85  ? 18.596 34.688 34.878  1.00 35.72  ? 154 VAL B N   1 
ATOM   3188 C CA  . VAL B 1 85  ? 17.314 35.330 35.134  1.00 36.33  ? 154 VAL B CA  1 
ATOM   3189 C C   . VAL B 1 85  ? 17.254 35.672 36.614  1.00 44.14  ? 154 VAL B C   1 
ATOM   3190 O O   . VAL B 1 85  ? 17.934 35.065 37.446  1.00 39.86  ? 154 VAL B O   1 
ATOM   3191 C CB  . VAL B 1 85  ? 16.105 34.462 34.733  1.00 28.06  ? 154 VAL B CB  1 
ATOM   3192 C CG1 . VAL B 1 85  ? 15.955 34.439 33.226  1.00 35.58  ? 154 VAL B CG1 1 
ATOM   3193 C CG2 . VAL B 1 85  ? 16.263 33.060 35.273  1.00 26.61  ? 154 VAL B CG2 1 
ATOM   3194 N N   . SER B 1 86  ? 16.425 36.661 36.937  1.00 47.63  ? 155 SER B N   1 
ATOM   3195 C CA  . SER B 1 86  ? 16.314 37.142 38.304  1.00 46.59  ? 155 SER B CA  1 
ATOM   3196 C C   . SER B 1 86  ? 14.865 37.479 38.614  1.00 55.35  ? 155 SER B C   1 
ATOM   3197 O O   . SER B 1 86  ? 14.089 37.852 37.728  1.00 56.44  ? 155 SER B O   1 
ATOM   3198 C CB  . SER B 1 86  ? 17.193 38.371 38.545  1.00 55.51  ? 155 SER B CB  1 
ATOM   3199 O OG  . SER B 1 86  ? 18.561 38.041 38.399  1.00 72.98  ? 155 SER B OG  1 
ATOM   3200 N N   . GLY B 1 87  ? 14.516 37.351 39.890  1.00 52.30  ? 156 GLY B N   1 
ATOM   3201 C CA  . GLY B 1 87  ? 13.173 37.626 40.352  1.00 47.43  ? 156 GLY B CA  1 
ATOM   3202 C C   . GLY B 1 87  ? 13.018 37.383 41.837  1.00 44.33  ? 156 GLY B C   1 
ATOM   3203 O O   . GLY B 1 87  ? 13.945 37.638 42.609  1.00 49.40  ? 156 GLY B O   1 
ATOM   3204 N N   . PHE B 1 88  ? 11.857 36.881 42.252  1.00 44.15  ? 157 PHE B N   1 
ATOM   3205 C CA  . PHE B 1 88  ? 11.600 36.634 43.661  1.00 54.40  ? 157 PHE B CA  1 
ATOM   3206 C C   . PHE B 1 88  ? 10.662 35.444 43.794  1.00 53.13  ? 157 PHE B C   1 
ATOM   3207 O O   . PHE B 1 88  ? 9.934  35.093 42.863  1.00 49.73  ? 157 PHE B O   1 
ATOM   3208 C CB  . PHE B 1 88  ? 11.008 37.870 44.358  1.00 57.11  ? 157 PHE B CB  1 
ATOM   3209 C CG  . PHE B 1 88  ? 9.916  38.540 43.573  1.00 58.67  ? 157 PHE B CG  1 
ATOM   3210 C CD1 . PHE B 1 88  ? 8.601  38.113 43.682  1.00 52.13  ? 157 PHE B CD1 1 
ATOM   3211 C CD2 . PHE B 1 88  ? 10.208 39.588 42.710  1.00 58.93  ? 157 PHE B CD2 1 
ATOM   3212 C CE1 . PHE B 1 88  ? 7.593  38.725 42.948  1.00 52.73  ? 157 PHE B CE1 1 
ATOM   3213 C CE2 . PHE B 1 88  ? 9.205  40.201 41.970  1.00 54.92  ? 157 PHE B CE2 1 
ATOM   3214 C CZ  . PHE B 1 88  ? 7.898  39.768 42.087  1.00 54.12  ? 157 PHE B CZ  1 
ATOM   3215 N N   . LEU B 1 89  ? 10.692 34.825 44.969  1.00 54.51  ? 158 LEU B N   1 
ATOM   3216 C CA  . LEU B 1 89  ? 9.818  33.696 45.234  1.00 58.28  ? 158 LEU B CA  1 
ATOM   3217 C C   . LEU B 1 89  ? 8.375  34.158 45.414  1.00 54.86  ? 158 LEU B C   1 
ATOM   3218 O O   . LEU B 1 89  ? 8.095  35.313 45.747  1.00 56.66  ? 158 LEU B O   1 
ATOM   3219 C CB  . LEU B 1 89  ? 10.280 32.938 46.477  1.00 61.60  ? 158 LEU B CB  1 
ATOM   3220 C CG  . LEU B 1 89  ? 11.670 32.312 46.400  1.00 63.98  ? 158 LEU B CG  1 
ATOM   3221 C CD1 . LEU B 1 89  ? 11.879 31.370 47.566  1.00 72.73  ? 158 LEU B CD1 1 
ATOM   3222 C CD2 . LEU B 1 89  ? 11.849 31.580 45.082  1.00 66.87  ? 158 LEU B CD2 1 
ATOM   3223 N N   . SER B 1 90  ? 7.454  33.229 45.181  1.00 49.09  ? 159 SER B N   1 
ATOM   3224 C CA  . SER B 1 90  ? 6.030  33.457 45.361  1.00 47.66  ? 159 SER B CA  1 
ATOM   3225 C C   . SER B 1 90  ? 5.362  32.101 45.511  1.00 53.34  ? 159 SER B C   1 
ATOM   3226 O O   . SER B 1 90  ? 5.856  31.097 44.994  1.00 65.15  ? 159 SER B O   1 
ATOM   3227 C CB  . SER B 1 90  ? 5.417  34.228 44.185  1.00 43.82  ? 159 SER B CB  1 
ATOM   3228 O OG  . SER B 1 90  ? 5.846  35.579 44.161  1.00 42.87  ? 159 SER B OG  1 
ATOM   3229 N N   . GLN B 1 91  ? 4.238  32.079 46.219  1.00 49.89  ? 160 GLN B N   1 
ATOM   3230 C CA  . GLN B 1 91  ? 3.489  30.851 46.438  1.00 50.98  ? 160 GLN B CA  1 
ATOM   3231 C C   . GLN B 1 91  ? 2.106  30.980 45.821  1.00 60.61  ? 160 GLN B C   1 
ATOM   3232 O O   . GLN B 1 91  ? 1.451  32.019 45.958  1.00 69.01  ? 160 GLN B O   1 
ATOM   3233 C CB  . GLN B 1 91  ? 3.374  30.533 47.932  1.00 41.36  ? 160 GLN B CB  1 
ATOM   3234 C CG  . GLN B 1 91  ? 2.998  29.092 48.233  1.00 52.58  ? 160 GLN B CG  1 
ATOM   3235 C CD  . GLN B 1 91  ? 2.919  28.800 49.723  1.00 62.13  ? 160 GLN B CD  1 
ATOM   3236 O OE1 . GLN B 1 91  ? 2.309  27.816 50.142  1.00 64.77  ? 160 GLN B OE1 1 
ATOM   3237 N NE2 . GLN B 1 91  ? 3.540  29.653 50.530  1.00 61.55  ? 160 GLN B NE2 1 
ATOM   3238 N N   . ASP B 1 92  ? 1.668  29.923 45.138  1.00 56.06  ? 161 ASP B N   1 
ATOM   3239 C CA  . ASP B 1 92  ? 0.327  29.870 44.566  1.00 53.24  ? 161 ASP B CA  1 
ATOM   3240 C C   . ASP B 1 92  ? 0.046  28.440 44.121  1.00 51.13  ? 161 ASP B C   1 
ATOM   3241 O O   . ASP B 1 92  ? 0.935  27.585 44.112  1.00 61.54  ? 161 ASP B O   1 
ATOM   3242 C CB  . ASP B 1 92  ? 0.170  30.852 43.403  1.00 60.27  ? 161 ASP B CB  1 
ATOM   3243 C CG  . ASP B 1 92  ? -1.276 31.219 43.143  1.00 66.92  ? 161 ASP B CG  1 
ATOM   3244 O OD1 . ASP B 1 92  ? -2.118 30.298 43.102  1.00 68.98  ? 161 ASP B OD1 1 
ATOM   3245 O OD2 . ASP B 1 92  ? -1.569 32.422 42.975  1.00 67.23  ? 161 ASP B OD2 1 
ATOM   3246 N N   . ILE B 1 93  ? -1.213 28.188 43.767  1.00 52.14  ? 162 ILE B N   1 
ATOM   3247 C CA  . ILE B 1 93  ? -1.631 26.879 43.279  1.00 44.86  ? 162 ILE B CA  1 
ATOM   3248 C C   . ILE B 1 93  ? -1.283 26.768 41.802  1.00 58.10  ? 162 ILE B C   1 
ATOM   3249 O O   . ILE B 1 93  ? -1.458 27.720 41.031  1.00 66.68  ? 162 ILE B O   1 
ATOM   3250 C CB  . ILE B 1 93  ? -3.137 26.667 43.520  1.00 32.07  ? 162 ILE B CB  1 
ATOM   3251 N N   . ILE B 1 94  ? -0.789 25.603 41.396  1.00 53.70  ? 163 ILE B N   1 
ATOM   3252 C CA  . ILE B 1 94  ? -0.364 25.373 40.022  1.00 48.86  ? 163 ILE B CA  1 
ATOM   3253 C C   . ILE B 1 94  ? -1.050 24.118 39.508  1.00 38.97  ? 163 ILE B C   1 
ATOM   3254 O O   . ILE B 1 94  ? -0.970 23.059 40.141  1.00 39.53  ? 163 ILE B O   1 
ATOM   3255 C CB  . ILE B 1 94  ? 1.169  25.246 39.916  1.00 56.42  ? 163 ILE B CB  1 
ATOM   3256 C CG1 . ILE B 1 94  ? 1.837  26.577 40.280  1.00 55.31  ? 163 ILE B CG1 1 
ATOM   3257 C CG2 . ILE B 1 94  ? 1.579  24.795 38.519  1.00 50.55  ? 163 ILE B CG2 1 
ATOM   3258 C CD1 . ILE B 1 94  ? 3.329  26.610 40.037  1.00 51.52  ? 163 ILE B CD1 1 
ATOM   3259 N N   . THR B 1 95  ? -1.730 24.241 38.372  1.00 39.14  ? 164 THR B N   1 
ATOM   3260 C CA  . THR B 1 95  ? -2.418 23.127 37.731  1.00 56.86  ? 164 THR B CA  1 
ATOM   3261 C C   . THR B 1 95  ? -1.525 22.553 36.636  1.00 51.17  ? 164 THR B C   1 
ATOM   3262 O O   . THR B 1 95  ? -1.136 23.271 35.708  1.00 53.35  ? 164 THR B O   1 
ATOM   3263 C CB  . THR B 1 95  ? -3.757 23.568 37.131  1.00 68.80  ? 164 THR B CB  1 
ATOM   3264 O OG1 . THR B 1 95  ? -3.605 24.842 36.496  1.00 85.25  ? 164 THR B OG1 1 
ATOM   3265 C CG2 . THR B 1 95  ? -4.826 23.682 38.194  1.00 55.23  ? 164 THR B CG2 1 
ATOM   3266 N N   . VAL B 1 96  ? -1.205 21.267 36.743  1.00 40.66  ? 165 VAL B N   1 
ATOM   3267 C CA  . VAL B 1 96  ? -0.457 20.540 35.723  1.00 37.03  ? 165 VAL B CA  1 
ATOM   3268 C C   . VAL B 1 96  ? -1.270 19.302 35.382  1.00 45.03  ? 165 VAL B C   1 
ATOM   3269 O O   . VAL B 1 96  ? -1.437 18.413 36.227  1.00 44.46  ? 165 VAL B O   1 
ATOM   3270 C CB  . VAL B 1 96  ? 0.953  20.150 36.186  1.00 42.29  ? 165 VAL B CB  1 
ATOM   3271 C CG1 . VAL B 1 96  ? 1.810  19.781 34.985  1.00 36.98  ? 165 VAL B CG1 1 
ATOM   3272 C CG2 . VAL B 1 96  ? 1.593  21.281 36.977  1.00 49.76  ? 165 VAL B CG2 1 
ATOM   3273 N N   . GLY B 1 97  ? -1.761 19.233 34.148  1.00 48.06  ? 166 GLY B N   1 
ATOM   3274 C CA  . GLY B 1 97  ? -2.679 18.163 33.798  1.00 50.20  ? 166 GLY B CA  1 
ATOM   3275 C C   . GLY B 1 97  ? -3.910 18.250 34.677  1.00 64.29  ? 166 GLY B C   1 
ATOM   3276 O O   . GLY B 1 97  ? -4.543 19.304 34.803  1.00 62.41  ? 166 GLY B O   1 
ATOM   3277 N N   . GLY B 1 98  ? -4.253 17.136 35.313  1.00 72.43  ? 167 GLY B N   1 
ATOM   3278 C CA  . GLY B 1 98  ? -5.359 17.135 36.246  1.00 74.49  ? 167 GLY B CA  1 
ATOM   3279 C C   . GLY B 1 98  ? -4.893 17.191 37.683  1.00 66.32  ? 167 GLY B C   1 
ATOM   3280 O O   . GLY B 1 98  ? -5.589 16.718 38.586  1.00 66.27  ? 167 GLY B O   1 
ATOM   3281 N N   . ILE B 1 99  ? -3.719 17.777 37.907  1.00 55.78  ? 168 ILE B N   1 
ATOM   3282 C CA  . ILE B 1 99  ? -3.061 17.770 39.209  1.00 46.20  ? 168 ILE B CA  1 
ATOM   3283 C C   . ILE B 1 99  ? -2.850 19.210 39.659  1.00 45.34  ? 168 ILE B C   1 
ATOM   3284 O O   . ILE B 1 99  ? -2.431 20.061 38.866  1.00 48.67  ? 168 ILE B O   1 
ATOM   3285 C CB  . ILE B 1 99  ? -1.730 16.997 39.153  1.00 43.78  ? 168 ILE B CB  1 
ATOM   3286 C CG1 . ILE B 1 99  ? -2.001 15.503 38.961  1.00 37.67  ? 168 ILE B CG1 1 
ATOM   3287 C CG2 . ILE B 1 99  ? -0.894 17.241 40.397  1.00 44.05  ? 168 ILE B CG2 1 
ATOM   3288 C CD1 . ILE B 1 99  ? -0.765 14.653 38.998  1.00 39.90  ? 168 ILE B CD1 1 
ATOM   3289 N N   . THR B 1 100 ? -3.168 19.483 40.922  1.00 44.25  ? 169 THR B N   1 
ATOM   3290 C CA  . THR B 1 100 ? -2.964 20.783 41.544  1.00 50.28  ? 169 THR B CA  1 
ATOM   3291 C C   . THR B 1 100 ? -1.955 20.634 42.672  1.00 53.60  ? 169 THR B C   1 
ATOM   3292 O O   . THR B 1 100 ? -1.997 19.653 43.422  1.00 60.70  ? 169 THR B O   1 
ATOM   3293 C CB  . THR B 1 100 ? -4.271 21.344 42.114  1.00 59.33  ? 169 THR B CB  1 
ATOM   3294 O OG1 . THR B 1 100 ? -4.943 20.318 42.853  1.00 80.37  ? 169 THR B OG1 1 
ATOM   3295 C CG2 . THR B 1 100 ? -5.179 21.808 41.019  1.00 52.94  ? 169 THR B CG2 1 
ATOM   3296 N N   . VAL B 1 101 ? -1.056 21.606 42.801  1.00 43.41  ? 170 VAL B N   1 
ATOM   3297 C CA  . VAL B 1 101 ? -0.087 21.618 43.891  1.00 43.92  ? 170 VAL B CA  1 
ATOM   3298 C C   . VAL B 1 101 ? 0.075  23.039 44.402  1.00 51.50  ? 170 VAL B C   1 
ATOM   3299 O O   . VAL B 1 101 ? 0.095  23.997 43.621  1.00 51.20  ? 170 VAL B O   1 
ATOM   3300 C CB  . VAL B 1 101 ? 1.288  21.054 43.472  1.00 47.02  ? 170 VAL B CB  1 
ATOM   3301 C CG1 . VAL B 1 101 ? 1.225  19.553 43.311  1.00 52.28  ? 170 VAL B CG1 1 
ATOM   3302 C CG2 . VAL B 1 101 ? 1.778  21.719 42.195  1.00 52.48  ? 170 VAL B CG2 1 
ATOM   3303 N N   . THR B 1 102 ? 0.175  23.171 45.721  1.00 58.03  ? 171 THR B N   1 
ATOM   3304 C CA  . THR B 1 102 ? 0.712  24.382 46.321  1.00 58.10  ? 171 THR B CA  1 
ATOM   3305 C C   . THR B 1 102 ? 2.207  24.411 46.044  1.00 60.73  ? 171 THR B C   1 
ATOM   3306 O O   . THR B 1 102 ? 2.958  23.588 46.577  1.00 60.09  ? 171 THR B O   1 
ATOM   3307 C CB  . THR B 1 102 ? 0.433  24.401 47.819  1.00 63.26  ? 171 THR B CB  1 
ATOM   3308 O OG1 . THR B 1 102 ? -0.860 23.835 48.067  1.00 75.68  ? 171 THR B OG1 1 
ATOM   3309 C CG2 . THR B 1 102 ? 0.487  25.824 48.352  1.00 57.85  ? 171 THR B CG2 1 
ATOM   3310 N N   . GLN B 1 103 ? 2.645  25.338 45.199  1.00 59.00  ? 172 GLN B N   1 
ATOM   3311 C CA  . GLN B 1 103 ? 4.007  25.316 44.691  1.00 56.52  ? 172 GLN B CA  1 
ATOM   3312 C C   . GLN B 1 103 ? 4.689  26.655 44.925  1.00 48.12  ? 172 GLN B C   1 
ATOM   3313 O O   . GLN B 1 103 ? 4.076  27.713 44.764  1.00 55.32  ? 172 GLN B O   1 
ATOM   3314 C CB  . GLN B 1 103 ? 4.025  24.969 43.197  1.00 59.09  ? 172 GLN B CB  1 
ATOM   3315 C CG  . GLN B 1 103 ? 5.408  24.982 42.565  1.00 56.93  ? 172 GLN B CG  1 
ATOM   3316 C CD  . GLN B 1 103 ? 6.390  24.089 43.290  1.00 52.36  ? 172 GLN B CD  1 
ATOM   3317 O OE1 . GLN B 1 103 ? 6.037  23.007 43.759  1.00 53.78  ? 172 GLN B OE1 1 
ATOM   3318 N NE2 . GLN B 1 103 ? 7.636  24.537 43.383  1.00 52.60  ? 172 GLN B NE2 1 
ATOM   3319 N N   . MET B 1 104 ? 5.959  26.597 45.319  1.00 40.90  ? 173 MET B N   1 
ATOM   3320 C CA  . MET B 1 104 ? 6.801  27.781 45.420  1.00 42.03  ? 173 MET B CA  1 
ATOM   3321 C C   . MET B 1 104 ? 7.537  27.978 44.100  1.00 38.45  ? 173 MET B C   1 
ATOM   3322 O O   . MET B 1 104 ? 8.269  27.088 43.652  1.00 29.32  ? 173 MET B O   1 
ATOM   3323 C CB  . MET B 1 104 ? 7.791  27.642 46.570  1.00 48.44  ? 173 MET B CB  1 
ATOM   3324 C CG  . MET B 1 104 ? 8.505  28.924 46.912  1.00 63.26  ? 173 MET B CG  1 
ATOM   3325 S SD  . MET B 1 104 ? 7.466  29.974 47.931  1.00 79.92  ? 173 MET B SD  1 
ATOM   3326 C CE  . MET B 1 104 ? 8.639  30.398 49.201  1.00 81.26  ? 173 MET B CE  1 
ATOM   3327 N N   . PHE B 1 105 ? 7.348  29.141 43.482  1.00 45.59  ? 174 PHE B N   1 
ATOM   3328 C CA  . PHE B 1 105 ? 7.880  29.395 42.153  1.00 46.64  ? 174 PHE B CA  1 
ATOM   3329 C C   . PHE B 1 105 ? 8.470  30.793 42.100  1.00 52.00  ? 174 PHE B C   1 
ATOM   3330 O O   . PHE B 1 105 ? 8.214  31.635 42.963  1.00 60.05  ? 174 PHE B O   1 
ATOM   3331 C CB  . PHE B 1 105 ? 6.799  29.233 41.075  1.00 46.04  ? 174 PHE B CB  1 
ATOM   3332 C CG  . PHE B 1 105 ? 5.769  30.322 41.083  1.00 46.59  ? 174 PHE B CG  1 
ATOM   3333 C CD1 . PHE B 1 105 ? 4.709  30.284 41.972  1.00 58.11  ? 174 PHE B CD1 1 
ATOM   3334 C CD2 . PHE B 1 105 ? 5.858  31.383 40.202  1.00 53.63  ? 174 PHE B CD2 1 
ATOM   3335 C CE1 . PHE B 1 105 ? 3.756  31.289 41.984  1.00 59.13  ? 174 PHE B CE1 1 
ATOM   3336 C CE2 . PHE B 1 105 ? 4.910  32.389 40.209  1.00 63.99  ? 174 PHE B CE2 1 
ATOM   3337 C CZ  . PHE B 1 105 ? 3.858  32.342 41.103  1.00 59.25  ? 174 PHE B CZ  1 
ATOM   3338 N N   . GLY B 1 106 ? 9.263  31.035 41.056  1.00 46.96  ? 175 GLY B N   1 
ATOM   3339 C CA  . GLY B 1 106 ? 9.938  32.305 40.882  1.00 48.35  ? 175 GLY B CA  1 
ATOM   3340 C C   . GLY B 1 106 ? 9.177  33.215 39.933  1.00 50.22  ? 175 GLY B C   1 
ATOM   3341 O O   . GLY B 1 106 ? 8.849  32.826 38.810  1.00 48.14  ? 175 GLY B O   1 
ATOM   3342 N N   . GLU B 1 107 ? 8.896  34.426 40.406  1.00 52.37  ? 176 GLU B N   1 
ATOM   3343 C CA  . GLU B 1 107 ? 8.353  35.487 39.564  1.00 52.91  ? 176 GLU B CA  1 
ATOM   3344 C C   . GLU B 1 107 ? 9.533  36.240 38.956  1.00 52.25  ? 176 GLU B C   1 
ATOM   3345 O O   . GLU B 1 107 ? 10.213 37.001 39.650  1.00 44.56  ? 176 GLU B O   1 
ATOM   3346 C CB  . GLU B 1 107 ? 7.458  36.419 40.376  1.00 54.80  ? 176 GLU B CB  1 
ATOM   3347 C CG  . GLU B 1 107 ? 6.016  35.962 40.548  1.00 60.45  ? 176 GLU B CG  1 
ATOM   3348 C CD  . GLU B 1 107 ? 5.136  37.043 41.166  1.00 67.52  ? 176 GLU B CD  1 
ATOM   3349 O OE1 . GLU B 1 107 ? 4.911  37.004 42.395  1.00 67.70  ? 176 GLU B OE1 1 
ATOM   3350 O OE2 . GLU B 1 107 ? 4.671  37.935 40.424  1.00 70.22  ? 176 GLU B OE2 1 
ATOM   3351 N N   . VAL B 1 108 ? 9.785  36.027 37.666  1.00 52.19  ? 177 VAL B N   1 
ATOM   3352 C CA  . VAL B 1 108 ? 11.011 36.520 37.047  1.00 43.78  ? 177 VAL B CA  1 
ATOM   3353 C C   . VAL B 1 108 ? 10.844 37.981 36.650  1.00 47.64  ? 177 VAL B C   1 
ATOM   3354 O O   . VAL B 1 108 ? 9.817  38.380 36.086  1.00 41.06  ? 177 VAL B O   1 
ATOM   3355 C CB  . VAL B 1 108 ? 11.396 35.632 35.852  1.00 37.63  ? 177 VAL B CB  1 
ATOM   3356 C CG1 . VAL B 1 108 ? 12.315 36.365 34.883  1.00 26.81  ? 177 VAL B CG1 1 
ATOM   3357 C CG2 . VAL B 1 108 ? 12.065 34.375 36.365  1.00 36.54  ? 177 VAL B CG2 1 
ATOM   3358 N N   . THR B 1 109 ? 11.865 38.787 36.955  1.00 50.05  ? 178 THR B N   1 
ATOM   3359 C CA  . THR B 1 109 ? 11.825 40.227 36.752  1.00 46.11  ? 178 THR B CA  1 
ATOM   3360 C C   . THR B 1 109 ? 12.896 40.724 35.797  1.00 52.39  ? 178 THR B C   1 
ATOM   3361 O O   . THR B 1 109 ? 12.916 41.921 35.484  1.00 52.31  ? 178 THR B O   1 
ATOM   3362 C CB  . THR B 1 109 ? 11.986 40.957 38.090  1.00 53.09  ? 178 THR B CB  1 
ATOM   3363 O OG1 . THR B 1 109 ? 13.169 40.484 38.749  1.00 67.49  ? 178 THR B OG1 1 
ATOM   3364 C CG2 . THR B 1 109 ? 10.790 40.688 38.973  1.00 53.55  ? 178 THR B CG2 1 
ATOM   3365 N N   . GLU B 1 110 ? 13.791 39.851 35.338  1.00 53.96  ? 179 GLU B N   1 
ATOM   3366 C CA  . GLU B 1 110 ? 14.829 40.211 34.376  1.00 53.78  ? 179 GLU B CA  1 
ATOM   3367 C C   . GLU B 1 110 ? 14.951 39.066 33.382  1.00 55.70  ? 179 GLU B C   1 
ATOM   3368 O O   . GLU B 1 110 ? 15.344 37.957 33.758  1.00 59.97  ? 179 GLU B O   1 
ATOM   3369 C CB  . GLU B 1 110 ? 16.163 40.478 35.069  1.00 62.18  ? 179 GLU B CB  1 
ATOM   3370 C CG  . GLU B 1 110 ? 16.142 41.652 36.035  1.00 77.15  ? 179 GLU B CG  1 
ATOM   3371 C CD  . GLU B 1 110 ? 17.476 41.866 36.722  1.00 83.42  ? 179 GLU B CD  1 
ATOM   3372 O OE1 . GLU B 1 110 ? 17.575 42.785 37.566  1.00 78.51  ? 179 GLU B OE1 1 
ATOM   3373 O OE2 . GLU B 1 110 ? 18.426 41.112 36.418  1.00 86.76  ? 179 GLU B OE2 1 
ATOM   3374 N N   . MET B 1 111 ? 14.603 39.331 32.122  1.00 54.65  ? 180 MET B N   1 
ATOM   3375 C CA  . MET B 1 111 ? 14.680 38.347 31.040  1.00 43.80  ? 180 MET B CA  1 
ATOM   3376 C C   . MET B 1 111 ? 15.442 38.954 29.869  1.00 43.08  ? 180 MET B C   1 
ATOM   3377 O O   . MET B 1 111 ? 14.848 39.623 29.010  1.00 53.50  ? 180 MET B O   1 
ATOM   3378 C CB  . MET B 1 111 ? 13.289 37.900 30.599  1.00 38.83  ? 180 MET B CB  1 
ATOM   3379 C CG  . MET B 1 111 ? 12.717 36.741 31.382  1.00 45.69  ? 180 MET B CG  1 
ATOM   3380 S SD  . MET B 1 111 ? 11.007 36.374 30.938  1.00 51.13  ? 180 MET B SD  1 
ATOM   3381 C CE  . MET B 1 111 ? 11.223 35.516 29.382  1.00 53.96  ? 180 MET B CE  1 
ATOM   3382 N N   . PRO B 1 112 ? 16.757 38.739 29.799  1.00 31.45  ? 181 PRO B N   1 
ATOM   3383 C CA  . PRO B 1 112 ? 17.542 39.297 28.689  1.00 34.60  ? 181 PRO B CA  1 
ATOM   3384 C C   . PRO B 1 112 ? 16.973 38.900 27.335  1.00 40.50  ? 181 PRO B C   1 
ATOM   3385 O O   . PRO B 1 112 ? 16.368 37.836 27.177  1.00 43.27  ? 181 PRO B O   1 
ATOM   3386 C CB  . PRO B 1 112 ? 18.936 38.695 28.904  1.00 20.37  ? 181 PRO B CB  1 
ATOM   3387 C CG  . PRO B 1 112 ? 18.995 38.415 30.370  1.00 26.76  ? 181 PRO B CG  1 
ATOM   3388 C CD  . PRO B 1 112 ? 17.599 38.016 30.766  1.00 30.73  ? 181 PRO B CD  1 
ATOM   3389 N N   . ALA B 1 113 ? 17.163 39.787 26.354  1.00 34.22  ? 182 ALA B N   1 
ATOM   3390 C CA  . ALA B 1 113 ? 16.675 39.518 25.004  1.00 27.32  ? 182 ALA B CA  1 
ATOM   3391 C C   . ALA B 1 113 ? 17.344 38.281 24.409  1.00 31.70  ? 182 ALA B C   1 
ATOM   3392 O O   . ALA B 1 113 ? 16.681 37.455 23.771  1.00 32.16  ? 182 ALA B O   1 
ATOM   3393 C CB  . ALA B 1 113 ? 16.901 40.736 24.114  1.00 18.09  ? 182 ALA B CB  1 
ATOM   3394 N N   . LEU B 1 114 ? 18.658 38.141 24.598  1.00 25.70  ? 183 LEU B N   1 
ATOM   3395 C CA  . LEU B 1 114 ? 19.343 36.892 24.293  1.00 24.16  ? 183 LEU B CA  1 
ATOM   3396 C C   . LEU B 1 114 ? 19.417 36.074 25.574  1.00 34.05  ? 183 LEU B C   1 
ATOM   3397 O O   . LEU B 1 114 ? 20.180 36.438 26.483  1.00 39.68  ? 183 LEU B O   1 
ATOM   3398 C CB  . LEU B 1 114 ? 20.739 37.157 23.743  1.00 18.48  ? 183 LEU B CB  1 
ATOM   3399 C CG  . LEU B 1 114 ? 21.621 35.929 23.479  1.00 24.57  ? 183 LEU B CG  1 
ATOM   3400 C CD1 . LEU B 1 114 ? 20.990 35.016 22.455  1.00 28.68  ? 183 LEU B CD1 1 
ATOM   3401 C CD2 . LEU B 1 114 ? 23.013 36.340 23.033  1.00 20.03  ? 183 LEU B CD2 1 
ATOM   3402 N N   . PRO B 1 115 ? 18.688 34.953 25.688  1.00 33.72  ? 184 PRO B N   1 
ATOM   3403 C CA  . PRO B 1 115 ? 17.979 34.263 24.607  1.00 34.15  ? 184 PRO B CA  1 
ATOM   3404 C C   . PRO B 1 115 ? 16.459 34.442 24.536  1.00 36.71  ? 184 PRO B C   1 
ATOM   3405 O O   . PRO B 1 115 ? 15.857 33.973 23.571  1.00 47.33  ? 184 PRO B O   1 
ATOM   3406 C CB  . PRO B 1 115 ? 18.286 32.805 24.920  1.00 32.60  ? 184 PRO B CB  1 
ATOM   3407 C CG  . PRO B 1 115 ? 18.206 32.781 26.445  1.00 26.81  ? 184 PRO B CG  1 
ATOM   3408 C CD  . PRO B 1 115 ? 18.666 34.153 26.926  1.00 18.48  ? 184 PRO B CD  1 
ATOM   3409 N N   . PHE B 1 116 ? 15.842 35.089 25.522  1.00 25.41  ? 185 PHE B N   1 
ATOM   3410 C CA  . PHE B 1 116 ? 14.410 34.895 25.727  1.00 23.30  ? 185 PHE B CA  1 
ATOM   3411 C C   . PHE B 1 116 ? 13.526 35.633 24.730  1.00 35.70  ? 185 PHE B C   1 
ATOM   3412 O O   . PHE B 1 116 ? 12.314 35.398 24.720  1.00 43.05  ? 185 PHE B O   1 
ATOM   3413 C CB  . PHE B 1 116 ? 14.056 35.259 27.168  1.00 19.94  ? 185 PHE B CB  1 
ATOM   3414 C CG  . PHE B 1 116 ? 14.615 34.284 28.149  1.00 29.02  ? 185 PHE B CG  1 
ATOM   3415 C CD1 . PHE B 1 116 ? 14.105 32.997 28.218  1.00 26.38  ? 185 PHE B CD1 1 
ATOM   3416 C CD2 . PHE B 1 116 ? 15.702 34.612 28.936  1.00 27.77  ? 185 PHE B CD2 1 
ATOM   3417 C CE1 . PHE B 1 116 ? 14.642 32.073 29.087  1.00 31.07  ? 185 PHE B CE1 1 
ATOM   3418 C CE2 . PHE B 1 116 ? 16.241 33.690 29.804  1.00 20.72  ? 185 PHE B CE2 1 
ATOM   3419 C CZ  . PHE B 1 116 ? 15.708 32.420 29.883  1.00 25.79  ? 185 PHE B CZ  1 
ATOM   3420 N N   . MET B 1 117 ? 14.087 36.484 23.875  1.00 29.95  ? 186 MET B N   1 
ATOM   3421 C CA  . MET B 1 117 ? 13.333 36.947 22.717  1.00 33.60  ? 186 MET B CA  1 
ATOM   3422 C C   . MET B 1 117 ? 13.218 35.882 21.630  1.00 32.18  ? 186 MET B C   1 
ATOM   3423 O O   . MET B 1 117 ? 12.490 36.091 20.653  1.00 27.44  ? 186 MET B O   1 
ATOM   3424 C CB  . MET B 1 117 ? 13.975 38.211 22.144  1.00 40.59  ? 186 MET B CB  1 
ATOM   3425 C CG  . MET B 1 117 ? 13.659 39.457 22.944  1.00 47.31  ? 186 MET B CG  1 
ATOM   3426 S SD  . MET B 1 117 ? 11.997 40.058 22.593  1.00 56.26  ? 186 MET B SD  1 
ATOM   3427 C CE  . MET B 1 117 ? 12.318 41.144 21.201  1.00 45.00  ? 186 MET B CE  1 
ATOM   3428 N N   . LEU B 1 118 ? 13.909 34.750 21.781  1.00 28.23  ? 187 LEU B N   1 
ATOM   3429 C CA  . LEU B 1 118 ? 13.820 33.630 20.857  1.00 20.17  ? 187 LEU B CA  1 
ATOM   3430 C C   . LEU B 1 118 ? 12.914 32.513 21.361  1.00 26.12  ? 187 LEU B C   1 
ATOM   3431 O O   . LEU B 1 118 ? 12.785 31.485 20.689  1.00 35.89  ? 187 LEU B O   1 
ATOM   3432 C CB  . LEU B 1 118 ? 15.218 33.061 20.581  1.00 21.71  ? 187 LEU B CB  1 
ATOM   3433 C CG  . LEU B 1 118 ? 16.381 34.036 20.374  1.00 27.96  ? 187 LEU B CG  1 
ATOM   3434 C CD1 . LEU B 1 118 ? 17.700 33.285 20.338  1.00 30.42  ? 187 LEU B CD1 1 
ATOM   3435 C CD2 . LEU B 1 118 ? 16.188 34.848 19.106  1.00 26.60  ? 187 LEU B CD2 1 
ATOM   3436 N N   . ALA B 1 119 ? 12.279 32.687 22.512  1.00 20.94  ? 188 ALA B N   1 
ATOM   3437 C CA  . ALA B 1 119 ? 11.537 31.615 23.160  1.00 28.02  ? 188 ALA B CA  1 
ATOM   3438 C C   . ALA B 1 119 ? 10.050 31.711 22.840  1.00 33.76  ? 188 ALA B C   1 
ATOM   3439 O O   . ALA B 1 119 ? 9.437  32.768 23.016  1.00 34.09  ? 188 ALA B O   1 
ATOM   3440 C CB  . ALA B 1 119 ? 11.748 31.655 24.672  1.00 25.52  ? 188 ALA B CB  1 
ATOM   3441 N N   . GLU B 1 120 ? 9.476  30.596 22.387  1.00 34.16  ? 189 GLU B N   1 
ATOM   3442 C CA  . GLU B 1 120 ? 8.030  30.490 22.238  1.00 38.84  ? 189 GLU B CA  1 
ATOM   3443 C C   . GLU B 1 120 ? 7.338  30.198 23.567  1.00 37.76  ? 189 GLU B C   1 
ATOM   3444 O O   . GLU B 1 120 ? 6.169  30.553 23.742  1.00 45.70  ? 189 GLU B O   1 
ATOM   3445 C CB  . GLU B 1 120 ? 7.693  29.401 21.220  1.00 46.76  ? 189 GLU B CB  1 
ATOM   3446 C CG  . GLU B 1 120 ? 8.213  29.694 19.834  1.00 56.26  ? 189 GLU B CG  1 
ATOM   3447 C CD  . GLU B 1 120 ? 7.440  30.807 19.164  1.00 69.27  ? 189 GLU B CD  1 
ATOM   3448 O OE1 . GLU B 1 120 ? 6.195  30.820 19.292  1.00 71.02  ? 189 GLU B OE1 1 
ATOM   3449 O OE2 . GLU B 1 120 ? 8.077  31.671 18.521  1.00 70.52  ? 189 GLU B OE2 1 
ATOM   3450 N N   . PHE B 1 121 ? 8.032  29.551 24.499  1.00 37.86  ? 190 PHE B N   1 
ATOM   3451 C CA  . PHE B 1 121 ? 7.517  29.300 25.835  1.00 27.87  ? 190 PHE B CA  1 
ATOM   3452 C C   . PHE B 1 121 ? 7.594  30.572 26.676  1.00 32.54  ? 190 PHE B C   1 
ATOM   3453 O O   . PHE B 1 121 ? 8.281  31.535 26.332  1.00 38.81  ? 190 PHE B O   1 
ATOM   3454 C CB  . PHE B 1 121 ? 8.307  28.174 26.503  1.00 35.29  ? 190 PHE B CB  1 
ATOM   3455 C CG  . PHE B 1 121 ? 9.775  28.489 26.691  1.00 36.16  ? 190 PHE B CG  1 
ATOM   3456 C CD1 . PHE B 1 121 ? 10.692 28.208 25.691  1.00 28.52  ? 190 PHE B CD1 1 
ATOM   3457 C CD2 . PHE B 1 121 ? 10.233 29.075 27.866  1.00 37.89  ? 190 PHE B CD2 1 
ATOM   3458 C CE1 . PHE B 1 121 ? 12.032 28.495 25.859  1.00 26.26  ? 190 PHE B CE1 1 
ATOM   3459 C CE2 . PHE B 1 121 ? 11.569 29.376 28.035  1.00 30.11  ? 190 PHE B CE2 1 
ATOM   3460 C CZ  . PHE B 1 121 ? 12.469 29.086 27.029  1.00 27.06  ? 190 PHE B CZ  1 
ATOM   3461 N N   . ASP B 1 122 ? 6.889  30.567 27.807  1.00 34.85  ? 191 ASP B N   1 
ATOM   3462 C CA  . ASP B 1 122 ? 6.940  31.686 28.744  1.00 40.59  ? 191 ASP B CA  1 
ATOM   3463 C C   . ASP B 1 122 ? 7.881  31.418 29.910  1.00 40.23  ? 191 ASP B C   1 
ATOM   3464 O O   . ASP B 1 122 ? 8.708  32.271 30.250  1.00 33.59  ? 191 ASP B O   1 
ATOM   3465 C CB  . ASP B 1 122 ? 5.538  32.004 29.282  1.00 47.16  ? 191 ASP B CB  1 
ATOM   3466 C CG  . ASP B 1 122 ? 4.545  32.324 28.181  1.00 53.83  ? 191 ASP B CG  1 
ATOM   3467 O OD1 . ASP B 1 122 ? 4.773  33.297 27.432  1.00 57.91  ? 191 ASP B OD1 1 
ATOM   3468 O OD2 . ASP B 1 122 ? 3.539  31.596 28.066  1.00 52.86  ? 191 ASP B OD2 1 
ATOM   3469 N N   . GLY B 1 123 ? 7.770  30.244 30.528  1.00 45.36  ? 192 GLY B N   1 
ATOM   3470 C CA  . GLY B 1 123 ? 8.573  29.905 31.687  1.00 39.25  ? 192 GLY B CA  1 
ATOM   3471 C C   . GLY B 1 123 ? 9.073  28.474 31.673  1.00 40.80  ? 192 GLY B C   1 
ATOM   3472 O O   . GLY B 1 123 ? 8.955  27.778 30.659  1.00 36.16  ? 192 GLY B O   1 
ATOM   3473 N N   . VAL B 1 124 ? 9.627  28.025 32.800  1.00 34.42  ? 193 VAL B N   1 
ATOM   3474 C CA  . VAL B 1 124 ? 10.251 26.712 32.924  1.00 27.14  ? 193 VAL B CA  1 
ATOM   3475 C C   . VAL B 1 124 ? 9.692  26.011 34.156  1.00 30.00  ? 193 VAL B C   1 
ATOM   3476 O O   . VAL B 1 124 ? 9.506  26.632 35.209  1.00 35.98  ? 193 VAL B O   1 
ATOM   3477 C CB  . VAL B 1 124 ? 11.790 26.825 33.018  1.00 35.84  ? 193 VAL B CB  1 
ATOM   3478 C CG1 . VAL B 1 124 ? 12.429 25.457 33.192  1.00 27.78  ? 193 VAL B CG1 1 
ATOM   3479 C CG2 . VAL B 1 124 ? 12.353 27.518 31.791  1.00 45.68  ? 193 VAL B CG2 1 
ATOM   3480 N N   . VAL B 1 125 ? 9.418  24.718 34.020  1.00 31.20  ? 194 VAL B N   1 
ATOM   3481 C CA  . VAL B 1 125 ? 9.046  23.855 35.137  1.00 32.89  ? 194 VAL B CA  1 
ATOM   3482 C C   . VAL B 1 125 ? 10.168 22.835 35.270  1.00 42.89  ? 194 VAL B C   1 
ATOM   3483 O O   . VAL B 1 125 ? 10.219 21.851 34.521  1.00 44.60  ? 194 VAL B O   1 
ATOM   3484 C CB  . VAL B 1 125 ? 7.689  23.175 34.929  1.00 28.64  ? 194 VAL B CB  1 
ATOM   3485 C CG1 . VAL B 1 125 ? 7.458  22.125 35.982  1.00 18.39  ? 194 VAL B CG1 1 
ATOM   3486 C CG2 . VAL B 1 125 ? 6.576  24.200 34.972  1.00 24.80  ? 194 VAL B CG2 1 
ATOM   3487 N N   . GLY B 1 126 ? 11.080 23.076 36.209  1.00 39.49  ? 195 GLY B N   1 
ATOM   3488 C CA  . GLY B 1 126 ? 12.226 22.206 36.378  1.00 25.22  ? 195 GLY B CA  1 
ATOM   3489 C C   . GLY B 1 126 ? 11.825 20.895 37.020  1.00 24.42  ? 195 GLY B C   1 
ATOM   3490 O O   . GLY B 1 126 ? 11.257 20.886 38.125  1.00 38.88  ? 195 GLY B O   1 
ATOM   3491 N N   . MET B 1 127 ? 12.115 19.778 36.350  1.00 22.30  ? 196 MET B N   1 
ATOM   3492 C CA  . MET B 1 127 ? 11.753 18.452 36.828  1.00 21.62  ? 196 MET B CA  1 
ATOM   3493 C C   . MET B 1 127 ? 12.906 17.756 37.540  1.00 28.12  ? 196 MET B C   1 
ATOM   3494 O O   . MET B 1 127 ? 12.898 16.526 37.668  1.00 28.26  ? 196 MET B O   1 
ATOM   3495 C CB  . MET B 1 127 ? 11.253 17.592 35.667  1.00 24.66  ? 196 MET B CB  1 
ATOM   3496 C CG  . MET B 1 127 ? 10.024 18.155 34.966  1.00 33.89  ? 196 MET B CG  1 
ATOM   3497 S SD  . MET B 1 127 ? 8.518  18.030 35.959  1.00 40.22  ? 196 MET B SD  1 
ATOM   3498 C CE  . MET B 1 127 ? 8.109  16.302 35.729  1.00 39.41  ? 196 MET B CE  1 
ATOM   3499 N N   . GLY B 1 128 ? 13.894 18.517 38.013  1.00 33.69  ? 197 GLY B N   1 
ATOM   3500 C CA  . GLY B 1 128 ? 15.050 17.943 38.665  1.00 38.06  ? 197 GLY B CA  1 
ATOM   3501 C C   . GLY B 1 128 ? 14.846 17.724 40.154  1.00 35.12  ? 197 GLY B C   1 
ATOM   3502 O O   . GLY B 1 128 ? 13.770 17.934 40.711  1.00 34.11  ? 197 GLY B O   1 
ATOM   3503 N N   . PHE B 1 129 ? 15.923 17.289 40.801  1.00 39.34  ? 198 PHE B N   1 
ATOM   3504 C CA  . PHE B 1 129 ? 15.899 16.955 42.216  1.00 37.51  ? 198 PHE B CA  1 
ATOM   3505 C C   . PHE B 1 129 ? 16.090 18.206 43.070  1.00 39.08  ? 198 PHE B C   1 
ATOM   3506 O O   . PHE B 1 129 ? 16.629 19.222 42.618  1.00 39.41  ? 198 PHE B O   1 
ATOM   3507 C CB  . PHE B 1 129 ? 16.997 15.948 42.553  1.00 31.68  ? 198 PHE B CB  1 
ATOM   3508 C CG  . PHE B 1 129 ? 16.836 14.615 41.887  1.00 34.76  ? 198 PHE B CG  1 
ATOM   3509 C CD1 . PHE B 1 129 ? 17.130 14.453 40.542  1.00 35.57  ? 198 PHE B CD1 1 
ATOM   3510 C CD2 . PHE B 1 129 ? 16.423 13.514 42.616  1.00 28.24  ? 198 PHE B CD2 1 
ATOM   3511 C CE1 . PHE B 1 129 ? 16.995 13.218 39.932  1.00 33.39  ? 198 PHE B CE1 1 
ATOM   3512 C CE2 . PHE B 1 129 ? 16.286 12.279 42.016  1.00 28.50  ? 198 PHE B CE2 1 
ATOM   3513 C CZ  . PHE B 1 129 ? 16.571 12.128 40.671  1.00 33.15  ? 198 PHE B CZ  1 
ATOM   3514 N N   . ILE B 1 130 ? 15.671 18.106 44.336  1.00 32.08  ? 199 ILE B N   1 
ATOM   3515 C CA  . ILE B 1 130 ? 15.828 19.230 45.258  1.00 37.98  ? 199 ILE B CA  1 
ATOM   3516 C C   . ILE B 1 130 ? 17.296 19.546 45.497  1.00 33.19  ? 199 ILE B C   1 
ATOM   3517 O O   . ILE B 1 130 ? 17.646 20.692 45.800  1.00 42.77  ? 199 ILE B O   1 
ATOM   3518 C CB  . ILE B 1 130 ? 15.096 18.961 46.589  1.00 44.98  ? 199 ILE B CB  1 
ATOM   3519 C CG1 . ILE B 1 130 ? 14.991 20.257 47.400  1.00 36.51  ? 199 ILE B CG1 1 
ATOM   3520 C CG2 . ILE B 1 130 ? 15.800 17.871 47.390  1.00 40.91  ? 199 ILE B CG2 1 
ATOM   3521 C CD1 . ILE B 1 130 ? 14.265 20.105 48.701  1.00 39.81  ? 199 ILE B CD1 1 
ATOM   3522 N N   . GLU B 1 131 ? 18.178 18.548 45.363  1.00 27.85  ? 200 GLU B N   1 
ATOM   3523 C CA  . GLU B 1 131 ? 19.611 18.789 45.514  1.00 31.26  ? 200 GLU B CA  1 
ATOM   3524 C C   . GLU B 1 131 ? 20.087 19.965 44.671  1.00 38.14  ? 200 GLU B C   1 
ATOM   3525 O O   . GLU B 1 131 ? 20.991 20.699 45.084  1.00 40.73  ? 200 GLU B O   1 
ATOM   3526 C CB  . GLU B 1 131 ? 20.399 17.533 45.132  1.00 28.53  ? 200 GLU B CB  1 
ATOM   3527 C CG  . GLU B 1 131 ? 20.481 16.481 46.210  1.00 25.06  ? 200 GLU B CG  1 
ATOM   3528 C CD  . GLU B 1 131 ? 19.301 15.521 46.190  1.00 44.91  ? 200 GLU B CD  1 
ATOM   3529 O OE1 . GLU B 1 131 ? 18.188 15.925 45.765  1.00 36.29  ? 200 GLU B OE1 1 
ATOM   3530 O OE2 . GLU B 1 131 ? 19.490 14.357 46.610  1.00 49.69  ? 200 GLU B OE2 1 
ATOM   3531 N N   . GLN B 1 132 ? 19.483 20.173 43.502  1.00 42.46  ? 201 GLN B N   1 
ATOM   3532 C CA  . GLN B 1 132 ? 19.925 21.186 42.555  1.00 37.49  ? 201 GLN B CA  1 
ATOM   3533 C C   . GLN B 1 132 ? 19.044 22.433 42.542  1.00 42.75  ? 201 GLN B C   1 
ATOM   3534 O O   . GLN B 1 132 ? 19.313 23.353 41.765  1.00 43.26  ? 201 GLN B O   1 
ATOM   3535 C CB  . GLN B 1 132 ? 19.989 20.584 41.151  1.00 32.46  ? 201 GLN B CB  1 
ATOM   3536 C CG  . GLN B 1 132 ? 21.086 19.556 40.959  1.00 39.19  ? 201 GLN B CG  1 
ATOM   3537 C CD  . GLN B 1 132 ? 22.158 20.037 40.013  1.00 55.88  ? 201 GLN B CD  1 
ATOM   3538 O OE1 . GLN B 1 132 ? 22.998 20.856 40.380  1.00 70.52  ? 201 GLN B OE1 1 
ATOM   3539 N NE2 . GLN B 1 132 ? 22.127 19.545 38.779  1.00 60.34  ? 201 GLN B NE2 1 
ATOM   3540 N N   . ALA B 1 133 ? 18.009 22.494 43.377  1.00 43.22  ? 202 ALA B N   1 
ATOM   3541 C CA  . ALA B 1 133 ? 17.120 23.650 43.378  1.00 39.03  ? 202 ALA B CA  1 
ATOM   3542 C C   . ALA B 1 133 ? 17.785 24.858 44.027  1.00 39.06  ? 202 ALA B C   1 
ATOM   3543 O O   . ALA B 1 133 ? 18.418 24.751 45.082  1.00 48.66  ? 202 ALA B O   1 
ATOM   3544 C CB  . ALA B 1 133 ? 15.821 23.317 44.110  1.00 35.61  ? 202 ALA B CB  1 
ATOM   3545 N N   . ILE B 1 134 ? 17.625 26.017 43.397  1.00 37.78  ? 203 ILE B N   1 
ATOM   3546 C CA  . ILE B 1 134 ? 18.148 27.267 43.937  1.00 45.84  ? 203 ILE B CA  1 
ATOM   3547 C C   . ILE B 1 134 ? 17.246 27.746 45.068  1.00 53.67  ? 203 ILE B C   1 
ATOM   3548 O O   . ILE B 1 134 ? 16.013 27.744 44.950  1.00 51.77  ? 203 ILE B O   1 
ATOM   3549 C CB  . ILE B 1 134 ? 18.270 28.325 42.825  1.00 51.03  ? 203 ILE B CB  1 
ATOM   3550 C CG1 . ILE B 1 134 ? 19.148 27.795 41.695  1.00 38.25  ? 203 ILE B CG1 1 
ATOM   3551 C CG2 . ILE B 1 134 ? 18.857 29.618 43.371  1.00 60.87  ? 203 ILE B CG2 1 
ATOM   3552 C CD1 . ILE B 1 134 ? 20.517 27.349 42.172  1.00 35.97  ? 203 ILE B CD1 1 
ATOM   3553 N N   . GLY B 1 135 ? 17.863 28.162 46.174  1.00 51.71  ? 204 GLY B N   1 
ATOM   3554 C CA  . GLY B 1 135 ? 17.115 28.532 47.360  1.00 46.43  ? 204 GLY B CA  1 
ATOM   3555 C C   . GLY B 1 135 ? 16.522 27.371 48.119  1.00 48.15  ? 204 GLY B C   1 
ATOM   3556 O O   . GLY B 1 135 ? 15.667 27.590 48.985  1.00 51.43  ? 204 GLY B O   1 
ATOM   3557 N N   . ARG B 1 136 ? 16.945 26.140 47.811  1.00 51.99  ? 205 ARG B N   1 
ATOM   3558 C CA  . ARG B 1 136 ? 16.410 24.917 48.422  1.00 58.15  ? 205 ARG B CA  1 
ATOM   3559 C C   . ARG B 1 136 ? 14.882 24.869 48.348  1.00 52.14  ? 205 ARG B C   1 
ATOM   3560 O O   . ARG B 1 136 ? 14.215 24.325 49.230  1.00 51.11  ? 205 ARG B O   1 
ATOM   3561 C CB  . ARG B 1 136 ? 16.900 24.760 49.865  1.00 73.77  ? 205 ARG B CB  1 
ATOM   3562 C CG  . ARG B 1 136 ? 16.527 23.426 50.522  1.00 86.50  ? 205 ARG B CG  1 
ATOM   3563 C CD  . ARG B 1 136 ? 16.126 23.608 51.985  1.00 96.47  ? 205 ARG B CD  1 
ATOM   3564 N NE  . ARG B 1 136 ? 17.145 23.117 52.914  1.00 99.48  ? 205 ARG B NE  1 
ATOM   3565 C CZ  . ARG B 1 136 ? 17.041 23.174 54.240  1.00 96.35  ? 205 ARG B CZ  1 
ATOM   3566 N NH1 . ARG B 1 136 ? 18.015 22.699 55.006  1.00 95.87  ? 205 ARG B NH1 1 
ATOM   3567 N NH2 . ARG B 1 136 ? 15.966 23.710 54.801  1.00 90.15  ? 205 ARG B NH2 1 
ATOM   3568 N N   . VAL B 1 137 ? 14.311 25.435 47.290  1.00 49.81  ? 206 VAL B N   1 
ATOM   3569 C CA  . VAL B 1 137 ? 12.865 25.410 47.099  1.00 44.73  ? 206 VAL B CA  1 
ATOM   3570 C C   . VAL B 1 137 ? 12.450 24.023 46.625  1.00 42.81  ? 206 VAL B C   1 
ATOM   3571 O O   . VAL B 1 137 ? 13.062 23.456 45.715  1.00 48.36  ? 206 VAL B O   1 
ATOM   3572 C CB  . VAL B 1 137 ? 12.432 26.491 46.099  1.00 39.37  ? 206 VAL B CB  1 
ATOM   3573 C CG1 . VAL B 1 137 ? 10.936 26.421 45.875  1.00 36.66  ? 206 VAL B CG1 1 
ATOM   3574 C CG2 . VAL B 1 137 ? 12.853 27.869 46.587  1.00 40.29  ? 206 VAL B CG2 1 
ATOM   3575 N N   . THR B 1 138 ? 11.410 23.476 47.235  1.00 43.44  ? 207 THR B N   1 
ATOM   3576 C CA  . THR B 1 138 ? 11.014 22.107 46.934  1.00 51.48  ? 207 THR B CA  1 
ATOM   3577 C C   . THR B 1 138 ? 10.559 21.995 45.479  1.00 56.33  ? 207 THR B C   1 
ATOM   3578 O O   . THR B 1 138 ? 9.759  22.823 45.017  1.00 64.16  ? 207 THR B O   1 
ATOM   3579 C CB  . THR B 1 138 ? 9.902  21.656 47.883  1.00 51.28  ? 207 THR B CB  1 
ATOM   3580 O OG1 . THR B 1 138 ? 10.407 21.614 49.224  1.00 53.92  ? 207 THR B OG1 1 
ATOM   3581 C CG2 . THR B 1 138 ? 9.393  20.277 47.503  1.00 52.88  ? 207 THR B CG2 1 
ATOM   3582 N N   . PRO B 1 139 ? 11.050 21.012 44.727  1.00 53.25  ? 208 PRO B N   1 
ATOM   3583 C CA  . PRO B 1 139 ? 10.632 20.868 43.329  1.00 47.55  ? 208 PRO B CA  1 
ATOM   3584 C C   . PRO B 1 139 ? 9.166  20.492 43.227  1.00 46.24  ? 208 PRO B C   1 
ATOM   3585 O O   . PRO B 1 139 ? 8.572  19.927 44.147  1.00 51.58  ? 208 PRO B O   1 
ATOM   3586 C CB  . PRO B 1 139 ? 11.524 19.741 42.798  1.00 51.65  ? 208 PRO B CB  1 
ATOM   3587 C CG  . PRO B 1 139 ? 12.632 19.620 43.785  1.00 58.74  ? 208 PRO B CG  1 
ATOM   3588 C CD  . PRO B 1 139 ? 12.050 20.005 45.105  1.00 57.82  ? 208 PRO B CD  1 
ATOM   3589 N N   . ILE B 1 140 ? 8.586  20.811 42.067  1.00 41.06  ? 209 ILE B N   1 
ATOM   3590 C CA  . ILE B 1 140 ? 7.156  20.602 41.880  1.00 35.43  ? 209 ILE B CA  1 
ATOM   3591 C C   . ILE B 1 140 ? 6.824  19.118 41.866  1.00 42.83  ? 209 ILE B C   1 
ATOM   3592 O O   . ILE B 1 140 ? 5.768  18.708 42.361  1.00 41.18  ? 209 ILE B O   1 
ATOM   3593 C CB  . ILE B 1 140 ? 6.668  21.310 40.600  1.00 29.62  ? 209 ILE B CB  1 
ATOM   3594 C CG1 . ILE B 1 140 ? 5.144  21.248 40.507  1.00 33.85  ? 209 ILE B CG1 1 
ATOM   3595 C CG2 . ILE B 1 140 ? 7.308  20.708 39.350  1.00 21.10  ? 209 ILE B CG2 1 
ATOM   3596 C CD1 . ILE B 1 140 ? 4.583  22.013 39.334  1.00 36.37  ? 209 ILE B CD1 1 
ATOM   3597 N N   . PHE B 1 141 ? 7.712  18.281 41.327  1.00 47.53  ? 210 PHE B N   1 
ATOM   3598 C CA  . PHE B 1 141 ? 7.393  16.862 41.290  1.00 43.03  ? 210 PHE B CA  1 
ATOM   3599 C C   . PHE B 1 141 ? 7.447  16.250 42.680  1.00 45.70  ? 210 PHE B C   1 
ATOM   3600 O O   . PHE B 1 141 ? 6.741  15.272 42.951  1.00 50.38  ? 210 PHE B O   1 
ATOM   3601 C CB  . PHE B 1 141 ? 8.327  16.112 40.343  1.00 26.36  ? 210 PHE B CB  1 
ATOM   3602 C CG  . PHE B 1 141 ? 7.818  14.752 39.974  1.00 22.51  ? 210 PHE B CG  1 
ATOM   3603 C CD1 . PHE B 1 141 ? 6.590  14.608 39.344  1.00 22.45  ? 210 PHE B CD1 1 
ATOM   3604 C CD2 . PHE B 1 141 ? 8.544  13.613 40.284  1.00 28.45  ? 210 PHE B CD2 1 
ATOM   3605 C CE1 . PHE B 1 141 ? 6.102  13.349 39.013  1.00 30.13  ? 210 PHE B CE1 1 
ATOM   3606 C CE2 . PHE B 1 141 ? 8.063  12.348 39.957  1.00 26.99  ? 210 PHE B CE2 1 
ATOM   3607 C CZ  . PHE B 1 141 ? 6.841  12.217 39.319  1.00 24.45  ? 210 PHE B CZ  1 
ATOM   3608 N N   . ASP B 1 142 ? 8.270  16.804 43.569  1.00 49.99  ? 211 ASP B N   1 
ATOM   3609 C CA  . ASP B 1 142 ? 8.283  16.327 44.948  1.00 49.95  ? 211 ASP B CA  1 
ATOM   3610 C C   . ASP B 1 142 ? 6.954  16.627 45.635  1.00 49.32  ? 211 ASP B C   1 
ATOM   3611 O O   . ASP B 1 142 ? 6.394  15.768 46.324  1.00 53.77  ? 211 ASP B O   1 
ATOM   3612 C CB  . ASP B 1 142 ? 9.453  16.953 45.710  1.00 49.28  ? 211 ASP B CB  1 
ATOM   3613 C CG  . ASP B 1 142 ? 10.795 16.342 45.329  1.00 59.05  ? 211 ASP B CG  1 
ATOM   3614 O OD1 . ASP B 1 142 ? 10.813 15.371 44.542  1.00 60.22  ? 211 ASP B OD1 1 
ATOM   3615 O OD2 . ASP B 1 142 ? 11.836 16.836 45.817  1.00 59.97  ? 211 ASP B OD2 1 
ATOM   3616 N N   . ASN B 1 143 ? 6.430  17.843 45.446  1.00 39.86  ? 212 ASN B N   1 
ATOM   3617 C CA  . ASN B 1 143 ? 5.113  18.179 45.978  1.00 45.07  ? 212 ASN B CA  1 
ATOM   3618 C C   . ASN B 1 143 ? 4.037  17.260 45.411  1.00 54.00  ? 212 ASN B C   1 
ATOM   3619 O O   . ASN B 1 143 ? 3.111  16.859 46.127  1.00 57.36  ? 212 ASN B O   1 
ATOM   3620 C CB  . ASN B 1 143 ? 4.778  19.640 45.672  1.00 39.79  ? 212 ASN B CB  1 
ATOM   3621 C CG  . ASN B 1 143 ? 5.589  20.615 46.500  1.00 47.40  ? 212 ASN B CG  1 
ATOM   3622 O OD1 . ASN B 1 143 ? 5.850  20.386 47.682  1.00 50.45  ? 212 ASN B OD1 1 
ATOM   3623 N ND2 . ASN B 1 143 ? 5.990  21.717 45.880  1.00 50.69  ? 212 ASN B ND2 1 
ATOM   3624 N N   . ILE B 1 144 ? 4.138  16.919 44.123  1.00 43.84  ? 213 ILE B N   1 
ATOM   3625 C CA  . ILE B 1 144 ? 3.181  16.000 43.519  1.00 34.73  ? 213 ILE B CA  1 
ATOM   3626 C C   . ILE B 1 144 ? 3.306  14.614 44.137  1.00 39.33  ? 213 ILE B C   1 
ATOM   3627 O O   . ILE B 1 144 ? 2.303  13.912 44.316  1.00 51.98  ? 213 ILE B O   1 
ATOM   3628 C CB  . ILE B 1 144 ? 3.375  15.961 41.991  1.00 43.11  ? 213 ILE B CB  1 
ATOM   3629 C CG1 . ILE B 1 144 ? 3.140  17.345 41.382  1.00 38.32  ? 213 ILE B CG1 1 
ATOM   3630 C CG2 . ILE B 1 144 ? 2.434  14.957 41.353  1.00 50.71  ? 213 ILE B CG2 1 
ATOM   3631 C CD1 . ILE B 1 144 ? 3.401  17.428 39.884  1.00 24.10  ? 213 ILE B CD1 1 
ATOM   3632 N N   . ILE B 1 145 ? 4.526  14.205 44.490  1.00 44.57  ? 214 ILE B N   1 
ATOM   3633 C CA  . ILE B 1 145 ? 4.728  12.913 45.142  1.00 45.07  ? 214 ILE B CA  1 
ATOM   3634 C C   . ILE B 1 145 ? 4.102  12.909 46.535  1.00 44.94  ? 214 ILE B C   1 
ATOM   3635 O O   . ILE B 1 145 ? 3.450  11.937 46.933  1.00 42.49  ? 214 ILE B O   1 
ATOM   3636 C CB  . ILE B 1 145 ? 6.232  12.572 45.187  1.00 39.04  ? 214 ILE B CB  1 
ATOM   3637 C CG1 . ILE B 1 145 ? 6.738  12.165 43.794  1.00 37.54  ? 214 ILE B CG1 1 
ATOM   3638 C CG2 . ILE B 1 145 ? 6.512  11.473 46.211  1.00 25.09  ? 214 ILE B CG2 1 
ATOM   3639 C CD1 . ILE B 1 145 ? 8.248  11.975 43.702  1.00 20.27  ? 214 ILE B CD1 1 
ATOM   3640 N N   . SER B 1 146 ? 4.278  14.001 47.289  1.00 45.36  ? 215 SER B N   1 
ATOM   3641 C CA  . SER B 1 146 ? 3.777  14.079 48.659  1.00 44.28  ? 215 SER B CA  1 
ATOM   3642 C C   . SER B 1 146 ? 2.269  13.886 48.748  1.00 51.90  ? 215 SER B C   1 
ATOM   3643 O O   . SER B 1 146 ? 1.771  13.478 49.804  1.00 57.15  ? 215 SER B O   1 
ATOM   3644 C CB  . SER B 1 146 ? 4.154  15.425 49.282  1.00 41.24  ? 215 SER B CB  1 
ATOM   3645 O OG  . SER B 1 146 ? 5.543  15.500 49.545  1.00 49.21  ? 215 SER B OG  1 
ATOM   3646 N N   . GLN B 1 147 ? 1.536  14.168 47.669  1.00 44.37  ? 216 GLN B N   1 
ATOM   3647 C CA  . GLN B 1 147 ? 0.085  14.033 47.659  1.00 44.66  ? 216 GLN B CA  1 
ATOM   3648 C C   . GLN B 1 147 ? -0.383 12.588 47.554  1.00 47.28  ? 216 GLN B C   1 
ATOM   3649 O O   . GLN B 1 147 ? -1.582 12.335 47.711  1.00 54.54  ? 216 GLN B O   1 
ATOM   3650 C CB  . GLN B 1 147 ? -0.509 14.841 46.503  1.00 48.41  ? 216 GLN B CB  1 
ATOM   3651 C CG  . GLN B 1 147 ? -0.200 16.324 46.563  1.00 53.57  ? 216 GLN B CG  1 
ATOM   3652 C CD  . GLN B 1 147 ? -0.965 17.128 45.534  1.00 55.96  ? 216 GLN B CD  1 
ATOM   3653 O OE1 . GLN B 1 147 ? -1.588 16.575 44.627  1.00 60.72  ? 216 GLN B OE1 1 
ATOM   3654 N NE2 . GLN B 1 147 ? -0.922 18.446 45.672  1.00 58.58  ? 216 GLN B NE2 1 
ATOM   3655 N N   . GLY B 1 148 ? 0.518  11.647 47.284  1.00 49.06  ? 217 GLY B N   1 
ATOM   3656 C CA  . GLY B 1 148 ? 0.132  10.250 47.169  1.00 43.55  ? 217 GLY B CA  1 
ATOM   3657 C C   . GLY B 1 148 ? -0.911 9.977  46.109  1.00 51.30  ? 217 GLY B C   1 
ATOM   3658 O O   . GLY B 1 148 ? -1.667 9.008  46.230  1.00 45.19  ? 217 GLY B O   1 
ATOM   3659 N N   . VAL B 1 149 ? -0.977 10.807 45.068  1.00 57.42  ? 218 VAL B N   1 
ATOM   3660 C CA  . VAL B 1 149 ? -1.979 10.608 44.027  1.00 51.10  ? 218 VAL B CA  1 
ATOM   3661 C C   . VAL B 1 149 ? -1.468 9.722  42.892  1.00 49.45  ? 218 VAL B C   1 
ATOM   3662 O O   . VAL B 1 149 ? -2.261 9.019  42.259  1.00 54.17  ? 218 VAL B O   1 
ATOM   3663 C CB  . VAL B 1 149 ? -2.470 11.961 43.477  1.00 55.40  ? 218 VAL B CB  1 
ATOM   3664 C CG1 . VAL B 1 149 ? -2.738 12.924 44.602  1.00 58.67  ? 218 VAL B CG1 1 
ATOM   3665 C CG2 . VAL B 1 149 ? -1.455 12.556 42.509  1.00 65.08  ? 218 VAL B CG2 1 
ATOM   3666 N N   . LEU B 1 150 ? -0.163 9.720  42.631  1.00 46.44  ? 219 LEU B N   1 
ATOM   3667 C CA  . LEU B 1 150 ? 0.357  9.128  41.407  1.00 45.63  ? 219 LEU B CA  1 
ATOM   3668 C C   . LEU B 1 150 ? 0.346  7.609  41.482  1.00 43.89  ? 219 LEU B C   1 
ATOM   3669 O O   . LEU B 1 150 ? 0.623  7.020  42.531  1.00 46.84  ? 219 LEU B O   1 
ATOM   3670 C CB  . LEU B 1 150 ? 1.773  9.632  41.138  1.00 41.69  ? 219 LEU B CB  1 
ATOM   3671 C CG  . LEU B 1 150 ? 1.845  11.122 40.802  1.00 44.63  ? 219 LEU B CG  1 
ATOM   3672 C CD1 . LEU B 1 150 ? 3.286  11.585 40.768  1.00 47.57  ? 219 LEU B CD1 1 
ATOM   3673 C CD2 . LEU B 1 150 ? 1.155  11.400 39.477  1.00 42.88  ? 219 LEU B CD2 1 
ATOM   3674 N N   . LYS B 1 151 ? 0.006  6.975  40.357  1.00 43.89  ? 220 LYS B N   1 
ATOM   3675 C CA  . LYS B 1 151 ? 0.058  5.519  40.289  1.00 45.34  ? 220 LYS B CA  1 
ATOM   3676 C C   . LYS B 1 151 ? 1.473  5.016  40.553  1.00 44.83  ? 220 LYS B C   1 
ATOM   3677 O O   . LYS B 1 151 ? 1.667  4.036  41.279  1.00 42.65  ? 220 LYS B O   1 
ATOM   3678 C CB  . LYS B 1 151 ? -0.454 5.039  38.931  1.00 46.52  ? 220 LYS B CB  1 
ATOM   3679 C CG  . LYS B 1 151 ? -0.502 3.529  38.782  1.00 59.82  ? 220 LYS B CG  1 
ATOM   3680 C CD  . LYS B 1 151 ? -1.002 3.122  37.407  1.00 64.88  ? 220 LYS B CD  1 
ATOM   3681 C CE  . LYS B 1 151 ? -0.152 2.003  36.823  1.00 73.79  ? 220 LYS B CE  1 
ATOM   3682 N NZ  . LYS B 1 151 ? 1.246  2.444  36.543  1.00 76.94  ? 220 LYS B NZ  1 
ATOM   3683 N N   . GLU B 1 152 ? 2.473  5.685  39.980  1.00 46.23  ? 221 GLU B N   1 
ATOM   3684 C CA  . GLU B 1 152 ? 3.878  5.469  40.299  1.00 46.39  ? 221 GLU B CA  1 
ATOM   3685 C C   . GLU B 1 152 ? 4.564  6.825  40.321  1.00 46.87  ? 221 GLU B C   1 
ATOM   3686 O O   . GLU B 1 152 ? 4.211  7.707  39.537  1.00 51.65  ? 221 GLU B O   1 
ATOM   3687 C CB  . GLU B 1 152 ? 4.564  4.547  39.282  1.00 40.96  ? 221 GLU B CB  1 
ATOM   3688 C CG  . GLU B 1 152 ? 4.018  3.130  39.244  1.00 46.59  ? 221 GLU B CG  1 
ATOM   3689 C CD  . GLU B 1 152 ? 4.281  2.364  40.535  1.00 58.51  ? 221 GLU B CD  1 
ATOM   3690 O OE1 . GLU B 1 152 ? 5.264  2.691  41.236  1.00 61.32  ? 221 GLU B OE1 1 
ATOM   3691 O OE2 . GLU B 1 152 ? 3.503  1.437  40.851  1.00 58.72  ? 221 GLU B OE2 1 
ATOM   3692 N N   . ASP B 1 153 ? 5.527  7.009  41.225  1.00 40.86  ? 222 ASP B N   1 
ATOM   3693 C CA  . ASP B 1 153 ? 6.223  8.296  41.312  1.00 44.83  ? 222 ASP B CA  1 
ATOM   3694 C C   . ASP B 1 153 ? 7.246  8.354  40.182  1.00 50.31  ? 222 ASP B C   1 
ATOM   3695 O O   . ASP B 1 153 ? 8.449  8.133  40.352  1.00 50.89  ? 222 ASP B O   1 
ATOM   3696 C CB  . ASP B 1 153 ? 6.857  8.490  42.681  1.00 53.58  ? 222 ASP B CB  1 
ATOM   3697 C CG  . ASP B 1 153 ? 5.915  8.144  43.809  1.00 57.01  ? 222 ASP B CG  1 
ATOM   3698 O OD1 . ASP B 1 153 ? 6.223  7.199  44.561  1.00 59.28  ? 222 ASP B OD1 1 
ATOM   3699 O OD2 . ASP B 1 153 ? 4.866  8.808  43.941  1.00 63.66  ? 222 ASP B OD2 1 
ATOM   3700 N N   . VAL B 1 154 ? 6.734  8.684  39.004  1.00 43.00  ? 223 VAL B N   1 
ATOM   3701 C CA  . VAL B 1 154 ? 7.420  8.495  37.735  1.00 31.13  ? 223 VAL B CA  1 
ATOM   3702 C C   . VAL B 1 154 ? 6.843  9.497  36.751  1.00 32.48  ? 223 VAL B C   1 
ATOM   3703 O O   . VAL B 1 154 ? 5.648  9.794  36.789  1.00 45.40  ? 223 VAL B O   1 
ATOM   3704 C CB  . VAL B 1 154 ? 7.239  7.043  37.233  1.00 35.27  ? 223 VAL B CB  1 
ATOM   3705 C CG1 . VAL B 1 154 ? 7.343  6.957  35.724  1.00 36.96  ? 223 VAL B CG1 1 
ATOM   3706 C CG2 . VAL B 1 154 ? 8.231  6.103  37.907  1.00 30.69  ? 223 VAL B CG2 1 
ATOM   3707 N N   . PHE B 1 155 ? 7.690  10.039 35.883  1.00 33.77  ? 224 PHE B N   1 
ATOM   3708 C CA  . PHE B 1 155 ? 7.197  10.810 34.754  1.00 27.01  ? 224 PHE B CA  1 
ATOM   3709 C C   . PHE B 1 155 ? 7.971  10.411 33.510  1.00 31.66  ? 224 PHE B C   1 
ATOM   3710 O O   . PHE B 1 155 ? 9.052  9.820  33.587  1.00 36.62  ? 224 PHE B O   1 
ATOM   3711 C CB  . PHE B 1 155 ? 7.279  12.323 35.000  1.00 27.81  ? 224 PHE B CB  1 
ATOM   3712 C CG  . PHE B 1 155 ? 8.654  12.824 35.331  1.00 24.14  ? 224 PHE B CG  1 
ATOM   3713 C CD1 . PHE B 1 155 ? 9.088  12.880 36.643  1.00 31.16  ? 224 PHE B CD1 1 
ATOM   3714 C CD2 . PHE B 1 155 ? 9.496  13.279 34.337  1.00 21.10  ? 224 PHE B CD2 1 
ATOM   3715 C CE1 . PHE B 1 155 ? 10.347 13.358 36.954  1.00 30.42  ? 224 PHE B CE1 1 
ATOM   3716 C CE2 . PHE B 1 155 ? 10.754 13.758 34.643  1.00 25.99  ? 224 PHE B CE2 1 
ATOM   3717 C CZ  . PHE B 1 155 ? 11.182 13.796 35.953  1.00 25.32  ? 224 PHE B CZ  1 
ATOM   3718 N N   . SER B 1 156 ? 7.393  10.724 32.352  1.00 27.72  ? 225 SER B N   1 
ATOM   3719 C CA  . SER B 1 156 ? 7.977  10.294 31.093  1.00 32.72  ? 225 SER B CA  1 
ATOM   3720 C C   . SER B 1 156 ? 7.727  11.349 30.027  1.00 40.40  ? 225 SER B C   1 
ATOM   3721 O O   . SER B 1 156 ? 6.787  12.143 30.116  1.00 46.72  ? 225 SER B O   1 
ATOM   3722 C CB  . SER B 1 156 ? 7.415  8.937  30.656  1.00 34.24  ? 225 SER B CB  1 
ATOM   3723 O OG  . SER B 1 156 ? 6.055  9.052  30.275  1.00 47.54  ? 225 SER B OG  1 
ATOM   3724 N N   . PHE B 1 157 ? 8.578  11.336 29.004  1.00 32.76  ? 226 PHE B N   1 
ATOM   3725 C CA  . PHE B 1 157 ? 8.542  12.325 27.937  1.00 25.73  ? 226 PHE B CA  1 
ATOM   3726 C C   . PHE B 1 157 ? 8.415  11.637 26.588  1.00 28.96  ? 226 PHE B C   1 
ATOM   3727 O O   . PHE B 1 157 ? 9.184  10.722 26.278  1.00 37.45  ? 226 PHE B O   1 
ATOM   3728 C CB  . PHE B 1 157 ? 9.800  13.192 27.952  1.00 18.31  ? 226 PHE B CB  1 
ATOM   3729 C CG  . PHE B 1 157 ? 9.757  14.309 28.954  1.00 25.74  ? 226 PHE B CG  1 
ATOM   3730 C CD1 . PHE B 1 157 ? 9.881  14.048 30.309  1.00 19.69  ? 226 PHE B CD1 1 
ATOM   3731 C CD2 . PHE B 1 157 ? 9.602  15.623 28.538  1.00 25.01  ? 226 PHE B CD2 1 
ATOM   3732 C CE1 . PHE B 1 157 ? 9.851  15.074 31.227  1.00 17.70  ? 226 PHE B CE1 1 
ATOM   3733 C CE2 . PHE B 1 157 ? 9.570  16.653 29.455  1.00 19.34  ? 226 PHE B CE2 1 
ATOM   3734 C CZ  . PHE B 1 157 ? 9.691  16.377 30.800  1.00 17.62  ? 226 PHE B CZ  1 
ATOM   3735 N N   . TYR B 1 158 ? 7.443  12.078 25.793  1.00 25.07  ? 227 TYR B N   1 
ATOM   3736 C CA  . TYR B 1 158 ? 7.367  11.759 24.375  1.00 18.88  ? 227 TYR B CA  1 
ATOM   3737 C C   . TYR B 1 158 ? 7.581  13.052 23.599  1.00 26.77  ? 227 TYR B C   1 
ATOM   3738 O O   . TYR B 1 158 ? 6.865  14.035 23.822  1.00 33.18  ? 227 TYR B O   1 
ATOM   3739 C CB  . TYR B 1 158 ? 6.024  11.122 24.011  1.00 30.51  ? 227 TYR B CB  1 
ATOM   3740 C CG  . TYR B 1 158 ? 5.747  11.117 22.522  1.00 32.72  ? 227 TYR B CG  1 
ATOM   3741 C CD1 . TYR B 1 158 ? 6.469  10.297 21.671  1.00 37.00  ? 227 TYR B CD1 1 
ATOM   3742 C CD2 . TYR B 1 158 ? 4.770  11.937 21.969  1.00 31.20  ? 227 TYR B CD2 1 
ATOM   3743 C CE1 . TYR B 1 158 ? 6.228  10.289 20.315  1.00 44.74  ? 227 TYR B CE1 1 
ATOM   3744 C CE2 . TYR B 1 158 ? 4.524  11.937 20.619  1.00 35.45  ? 227 TYR B CE2 1 
ATOM   3745 C CZ  . TYR B 1 158 ? 5.256  11.111 19.792  1.00 46.11  ? 227 TYR B CZ  1 
ATOM   3746 O OH  . TYR B 1 158 ? 5.024  11.108 18.435  1.00 44.28  ? 227 TYR B OH  1 
ATOM   3747 N N   . TYR B 1 159 ? 8.586  13.063 22.726  1.00 29.33  ? 228 TYR B N   1 
ATOM   3748 C CA  . TYR B 1 159 ? 8.828  14.166 21.804  1.00 26.84  ? 228 TYR B CA  1 
ATOM   3749 C C   . TYR B 1 159 ? 8.655  13.659 20.379  1.00 35.68  ? 228 TYR B C   1 
ATOM   3750 O O   . TYR B 1 159 ? 9.207  12.613 20.012  1.00 31.13  ? 228 TYR B O   1 
ATOM   3751 C CB  . TYR B 1 159 ? 10.231 14.750 21.965  1.00 14.14  ? 228 TYR B CB  1 
ATOM   3752 C CG  . TYR B 1 159 ? 10.437 15.680 23.134  1.00 18.97  ? 228 TYR B CG  1 
ATOM   3753 C CD1 . TYR B 1 159 ? 9.377  16.091 23.930  1.00 23.28  ? 228 TYR B CD1 1 
ATOM   3754 C CD2 . TYR B 1 159 ? 11.715 16.137 23.451  1.00 19.44  ? 228 TYR B CD2 1 
ATOM   3755 C CE1 . TYR B 1 159 ? 9.586  16.944 25.011  1.00 20.02  ? 228 TYR B CE1 1 
ATOM   3756 C CE2 . TYR B 1 159 ? 11.934 16.987 24.518  1.00 17.47  ? 228 TYR B CE2 1 
ATOM   3757 C CZ  . TYR B 1 159 ? 10.870 17.389 25.294  1.00 24.89  ? 228 TYR B CZ  1 
ATOM   3758 O OH  . TYR B 1 159 ? 11.102 18.237 26.353  1.00 32.31  ? 228 TYR B OH  1 
ATOM   3759 N N   . ASN B 1 160 ? 7.902  14.404 19.583  1.00 33.34  ? 229 ASN B N   1 
ATOM   3760 C CA  . ASN B 1 160 ? 7.598  14.051 18.207  1.00 29.35  ? 229 ASN B CA  1 
ATOM   3761 C C   . ASN B 1 160 ? 8.522  14.797 17.258  1.00 32.50  ? 229 ASN B C   1 
ATOM   3762 O O   . ASN B 1 160 ? 9.066  15.851 17.591  1.00 45.70  ? 229 ASN B O   1 
ATOM   3763 C CB  . ASN B 1 160 ? 6.140  14.385 17.888  1.00 34.34  ? 229 ASN B CB  1 
ATOM   3764 C CG  . ASN B 1 160 ? 5.590  13.580 16.729  1.00 38.84  ? 229 ASN B CG  1 
ATOM   3765 O OD1 . ASN B 1 160 ? 6.235  12.657 16.236  1.00 46.73  ? 229 ASN B OD1 1 
ATOM   3766 N ND2 . ASN B 1 160 ? 4.388  13.932 16.284  1.00 32.90  ? 229 ASN B ND2 1 
ATOM   3767 N N   . ARG B 1 161 ? 8.711  14.223 16.071  1.00 37.37  ? 230 ARG B N   1 
ATOM   3768 C CA  . ARG B 1 161 ? 9.349  14.959 14.988  1.00 33.92  ? 230 ARG B CA  1 
ATOM   3769 C C   . ARG B 1 161 ? 8.333  15.907 14.369  1.00 36.15  ? 230 ARG B C   1 
ATOM   3770 O O   . ARG B 1 161 ? 7.122  15.654 14.387  1.00 41.31  ? 230 ARG B O   1 
ATOM   3771 C CB  . ARG B 1 161 ? 9.917  14.014 13.925  1.00 32.65  ? 230 ARG B CB  1 
ATOM   3772 C CG  . ARG B 1 161 ? 10.965 14.678 13.022  1.00 51.31  ? 230 ARG B CG  1 
ATOM   3773 C CD  . ARG B 1 161 ? 11.908 13.681 12.336  1.00 54.47  ? 230 ARG B CD  1 
ATOM   3774 N NE  . ARG B 1 161 ? 13.187 14.305 11.977  1.00 53.63  ? 230 ARG B NE  1 
ATOM   3775 C CZ  . ARG B 1 161 ? 14.333 14.096 12.624  1.00 58.03  ? 230 ARG B CZ  1 
ATOM   3776 N NH1 . ARG B 1 161 ? 14.361 13.262 13.659  1.00 68.07  ? 230 ARG B NH1 1 
ATOM   3777 N NH2 . ARG B 1 161 ? 15.455 14.712 12.242  1.00 39.11  ? 230 ARG B NH2 1 
ATOM   3778 N N   . ASP B 1 162 ? 8.830  17.012 13.826  1.00 38.57  ? 231 ASP B N   1 
ATOM   3779 C CA  . ASP B 1 162 ? 7.927  18.047 13.349  1.00 51.36  ? 231 ASP B CA  1 
ATOM   3780 C C   . ASP B 1 162 ? 7.211  17.608 12.079  1.00 50.89  ? 231 ASP B C   1 
ATOM   3781 O O   . ASP B 1 162 ? 7.822  17.071 11.148  1.00 40.47  ? 231 ASP B O   1 
ATOM   3782 C CB  . ASP B 1 162 ? 8.682  19.346 13.105  1.00 56.75  ? 231 ASP B CB  1 
ATOM   3783 C CG  . ASP B 1 162 ? 7.759  20.497 12.793  1.00 57.47  ? 231 ASP B CG  1 
ATOM   3784 O OD1 . ASP B 1 162 ? 8.267  21.557 12.380  1.00 62.05  ? 231 ASP B OD1 1 
ATOM   3785 O OD2 . ASP B 1 162 ? 6.531  20.346 12.963  1.00 59.22  ? 231 ASP B OD2 1 
ATOM   3786 N N   . SER B 1 163 ? 5.901  17.848 12.063  1.00 63.96  ? 232 SER B N   1 
ATOM   3787 C CA  . SER B 1 163 ? 5.001  17.552 10.961  1.00 80.19  ? 232 SER B CA  1 
ATOM   3788 C C   . SER B 1 163 ? 4.470  18.867 10.391  1.00 95.92  ? 232 SER B C   1 
ATOM   3789 O O   . SER B 1 163 ? 4.272  19.823 11.147  1.00 96.70  ? 232 SER B O   1 
ATOM   3790 C CB  . SER B 1 163 ? 3.857  16.660 11.447  1.00 77.63  ? 232 SER B CB  1 
ATOM   3791 N N   . GLU B 1 164 ? 4.228  18.965 9.070   1.00 104.55 ? 233 GLU B N   1 
ATOM   3792 C CA  . GLU B 1 164 ? 4.129  17.949 7.991   1.00 110.05 ? 233 GLU B CA  1 
ATOM   3793 C C   . GLU B 1 164 ? 2.873  17.082 8.104   1.00 117.06 ? 233 GLU B C   1 
ATOM   3794 O O   . GLU B 1 164 ? 2.649  16.204 7.272   1.00 119.58 ? 233 GLU B O   1 
ATOM   3795 C CB  . GLU B 1 164 ? 5.376  17.053 7.886   1.00 106.28 ? 233 GLU B CB  1 
ATOM   3796 N N   . ASN B 1 165 ? 2.051  17.330 9.123   1.00 120.37 ? 234 ASN B N   1 
ATOM   3797 C CA  . ASN B 1 165 ? 0.746  16.686 9.213   1.00 119.87 ? 234 ASN B CA  1 
ATOM   3798 C C   . ASN B 1 165 ? -0.352 17.696 9.534   1.00 127.51 ? 234 ASN B C   1 
ATOM   3799 O O   . ASN B 1 165 ? -1.511 17.491 9.160   1.00 134.61 ? 234 ASN B O   1 
ATOM   3800 C CB  . ASN B 1 165 ? 0.761  15.567 10.258  1.00 113.50 ? 234 ASN B CB  1 
ATOM   3801 N N   . SER B 1 166 ? -0.004 18.769 10.250  1.00 124.97 ? 235 SER B N   1 
ATOM   3802 C CA  . SER B 1 166 ? -0.910 19.774 10.810  1.00 125.19 ? 235 SER B CA  1 
ATOM   3803 C C   . SER B 1 166 ? -1.897 19.185 11.815  1.00 127.10 ? 235 SER B C   1 
ATOM   3804 O O   . SER B 1 166 ? -2.742 19.923 12.340  1.00 126.70 ? 235 SER B O   1 
ATOM   3805 C CB  . SER B 1 166 ? -1.698 20.544 9.739   1.00 124.98 ? 235 SER B CB  1 
ATOM   3806 N N   . GLN B 1 167 ? -1.835 17.883 12.087  1.00 125.72 ? 236 GLN B N   1 
ATOM   3807 C CA  . GLN B 1 167 ? -2.625 17.255 13.138  1.00 121.01 ? 236 GLN B CA  1 
ATOM   3808 C C   . GLN B 1 167 ? -1.789 16.450 14.116  1.00 108.61 ? 236 GLN B C   1 
ATOM   3809 O O   . GLN B 1 167 ? -2.297 16.111 15.192  1.00 107.28 ? 236 GLN B O   1 
ATOM   3810 C CB  . GLN B 1 167 ? -3.700 16.335 12.537  1.00 123.69 ? 236 GLN B CB  1 
ATOM   3811 N N   . SER B 1 168 ? -0.536 16.138 13.783  1.00 96.34  ? 237 SER B N   1 
ATOM   3812 C CA  . SER B 1 168 ? 0.312  15.319 14.637  1.00 79.80  ? 237 SER B CA  1 
ATOM   3813 C C   . SER B 1 168 ? 0.441  15.928 16.029  1.00 64.80  ? 237 SER B C   1 
ATOM   3814 O O   . SER B 1 168 ? 0.415  17.149 16.210  1.00 54.29  ? 237 SER B O   1 
ATOM   3815 C CB  . SER B 1 168 ? 1.703  15.158 14.012  1.00 70.15  ? 237 SER B CB  1 
ATOM   3816 O OG  . SER B 1 168 ? 1.785  14.017 13.173  1.00 51.98  ? 237 SER B OG  1 
ATOM   3817 N N   . LEU B 1 169 ? 0.565  15.052 17.021  1.00 53.28  ? 238 LEU B N   1 
ATOM   3818 C CA  . LEU B 1 169 ? 0.831  15.485 18.383  1.00 42.86  ? 238 LEU B CA  1 
ATOM   3819 C C   . LEU B 1 169 ? 2.276  15.954 18.492  1.00 40.84  ? 238 LEU B C   1 
ATOM   3820 O O   . LEU B 1 169 ? 3.197  15.234 18.104  1.00 31.58  ? 238 LEU B O   1 
ATOM   3821 C CB  . LEU B 1 169 ? 0.571  14.331 19.352  1.00 36.44  ? 238 LEU B CB  1 
ATOM   3822 C CG  . LEU B 1 169 ? 1.177  14.379 20.757  1.00 47.02  ? 238 LEU B CG  1 
ATOM   3823 C CD1 . LEU B 1 169 ? 0.401  15.327 21.644  1.00 47.83  ? 238 LEU B CD1 1 
ATOM   3824 C CD2 . LEU B 1 169 ? 1.218  12.994 21.368  1.00 45.05  ? 238 LEU B CD2 1 
ATOM   3825 N N   . GLY B 1 170 ? 2.476  17.164 19.019  1.00 45.85  ? 239 GLY B N   1 
ATOM   3826 C CA  . GLY B 1 170 ? 3.828  17.688 19.138  1.00 45.93  ? 239 GLY B CA  1 
ATOM   3827 C C   . GLY B 1 170 ? 4.661  16.934 20.157  1.00 51.20  ? 239 GLY B C   1 
ATOM   3828 O O   . GLY B 1 170 ? 5.865  16.735 19.965  1.00 41.47  ? 239 GLY B O   1 
ATOM   3829 N N   . GLY B 1 171 ? 4.036  16.500 21.243  1.00 45.01  ? 240 GLY B N   1 
ATOM   3830 C CA  . GLY B 1 171 ? 4.728  15.760 22.279  1.00 36.57  ? 240 GLY B CA  1 
ATOM   3831 C C   . GLY B 1 171 ? 3.824  15.601 23.477  1.00 43.87  ? 240 GLY B C   1 
ATOM   3832 O O   . GLY B 1 171 ? 2.728  16.164 23.545  1.00 43.23  ? 240 GLY B O   1 
ATOM   3833 N N   . GLN B 1 172 ? 4.305  14.825 24.442  1.00 37.20  ? 241 GLN B N   1 
ATOM   3834 C CA  . GLN B 1 172 ? 3.476  14.538 25.601  1.00 37.04  ? 241 GLN B CA  1 
ATOM   3835 C C   . GLN B 1 172 ? 4.351  14.168 26.784  1.00 33.42  ? 241 GLN B C   1 
ATOM   3836 O O   . GLN B 1 172 ? 5.294  13.385 26.644  1.00 36.53  ? 241 GLN B O   1 
ATOM   3837 C CB  . GLN B 1 172 ? 2.495  13.400 25.308  1.00 36.38  ? 241 GLN B CB  1 
ATOM   3838 C CG  . GLN B 1 172 ? 1.587  13.053 26.464  1.00 29.61  ? 241 GLN B CG  1 
ATOM   3839 C CD  . GLN B 1 172 ? 0.724  11.857 26.159  1.00 36.15  ? 241 GLN B CD  1 
ATOM   3840 O OE1 . GLN B 1 172 ? -0.462 11.994 25.856  1.00 45.26  ? 241 GLN B OE1 1 
ATOM   3841 N NE2 . GLN B 1 172 ? 1.314  10.670 26.229  1.00 32.83  ? 241 GLN B NE2 1 
ATOM   3842 N N   . ILE B 1 173 ? 4.027  14.733 27.942  1.00 25.87  ? 242 ILE B N   1 
ATOM   3843 C CA  . ILE B 1 173 ? 4.596  14.313 29.216  1.00 29.49  ? 242 ILE B CA  1 
ATOM   3844 C C   . ILE B 1 173 ? 3.491  13.636 30.012  1.00 30.47  ? 242 ILE B C   1 
ATOM   3845 O O   . ILE B 1 173 ? 2.350  14.116 30.039  1.00 29.05  ? 242 ILE B O   1 
ATOM   3846 C CB  . ILE B 1 173 ? 5.212  15.493 29.989  1.00 37.18  ? 242 ILE B CB  1 
ATOM   3847 C CG1 . ILE B 1 173 ? 5.646  15.053 31.388  1.00 45.58  ? 242 ILE B CG1 1 
ATOM   3848 C CG2 . ILE B 1 173 ? 4.238  16.647 30.080  1.00 41.52  ? 242 ILE B CG2 1 
ATOM   3849 C CD1 . ILE B 1 173 ? 6.217  16.170 32.221  1.00 48.06  ? 242 ILE B CD1 1 
ATOM   3850 N N   . VAL B 1 174 ? 3.813  12.496 30.614  1.00 27.26  ? 243 VAL B N   1 
ATOM   3851 C CA  . VAL B 1 174 ? 2.902  11.781 31.498  1.00 26.49  ? 243 VAL B CA  1 
ATOM   3852 C C   . VAL B 1 174 ? 3.448  11.882 32.912  1.00 33.77  ? 243 VAL B C   1 
ATOM   3853 O O   . VAL B 1 174 ? 4.638  11.636 33.142  1.00 43.27  ? 243 VAL B O   1 
ATOM   3854 C CB  . VAL B 1 174 ? 2.733  10.311 31.078  1.00 24.12  ? 243 VAL B CB  1 
ATOM   3855 C CG1 . VAL B 1 174 ? 1.856  9.583  32.072  1.00 19.15  ? 243 VAL B CG1 1 
ATOM   3856 C CG2 . VAL B 1 174 ? 2.141  10.222 29.691  1.00 25.82  ? 243 VAL B CG2 1 
ATOM   3857 N N   . LEU B 1 175 ? 2.588  12.257 33.850  1.00 37.63  ? 244 LEU B N   1 
ATOM   3858 C CA  . LEU B 1 175 ? 2.928  12.288 35.265  1.00 32.48  ? 244 LEU B CA  1 
ATOM   3859 C C   . LEU B 1 175 ? 2.306  11.069 35.930  1.00 35.63  ? 244 LEU B C   1 
ATOM   3860 O O   . LEU B 1 175 ? 1.083  10.920 35.924  1.00 41.25  ? 244 LEU B O   1 
ATOM   3861 C CB  . LEU B 1 175 ? 2.425  13.572 35.923  1.00 31.95  ? 244 LEU B CB  1 
ATOM   3862 C CG  . LEU B 1 175 ? 2.971  14.909 35.421  1.00 32.26  ? 244 LEU B CG  1 
ATOM   3863 C CD1 . LEU B 1 175 ? 2.569  16.023 36.377  1.00 34.31  ? 244 LEU B CD1 1 
ATOM   3864 C CD2 . LEU B 1 175 ? 4.486  14.861 35.249  1.00 23.38  ? 244 LEU B CD2 1 
ATOM   3865 N N   . GLY B 1 176 ? 3.145  10.194 36.485  1.00 40.22  ? 245 GLY B N   1 
ATOM   3866 C CA  . GLY B 1 176 ? 2.677  9.013  37.180  1.00 33.99  ? 245 GLY B CA  1 
ATOM   3867 C C   . GLY B 1 176 ? 2.756  7.714  36.404  1.00 36.00  ? 245 GLY B C   1 
ATOM   3868 O O   . GLY B 1 176 ? 2.279  6.686  36.905  1.00 36.63  ? 245 GLY B O   1 
ATOM   3869 N N   . GLY B 1 177 ? 3.334  7.720  35.207  1.00 31.46  ? 246 GLY B N   1 
ATOM   3870 C CA  . GLY B 1 177 ? 3.368  6.517  34.398  1.00 28.99  ? 246 GLY B CA  1 
ATOM   3871 C C   . GLY B 1 177 ? 3.925  6.818  33.022  1.00 33.83  ? 246 GLY B C   1 
ATOM   3872 O O   . GLY B 1 177 ? 4.644  7.801  32.832  1.00 30.54  ? 246 GLY B O   1 
ATOM   3873 N N   . SER B 1 178 ? 3.580  5.953  32.070  1.00 37.29  ? 247 SER B N   1 
ATOM   3874 C CA  . SER B 1 178 ? 4.040  6.086  30.696  1.00 34.84  ? 247 SER B CA  1 
ATOM   3875 C C   . SER B 1 178 ? 2.913  5.703  29.751  1.00 36.66  ? 247 SER B C   1 
ATOM   3876 O O   . SER B 1 178 ? 1.976  4.996  30.125  1.00 42.22  ? 247 SER B O   1 
ATOM   3877 C CB  . SER B 1 178 ? 5.277  5.221  30.421  1.00 40.37  ? 247 SER B CB  1 
ATOM   3878 O OG  . SER B 1 178 ? 6.471  5.912  30.743  1.00 34.12  ? 247 SER B OG  1 
ATOM   3879 N N   . ASP B 1 179 ? 3.018  6.178  28.510  1.00 41.33  ? 248 ASP B N   1 
ATOM   3880 C CA  . ASP B 1 179 ? 1.979  5.989  27.502  1.00 36.99  ? 248 ASP B CA  1 
ATOM   3881 C C   . ASP B 1 179 ? 2.439  4.978  26.461  1.00 31.43  ? 248 ASP B C   1 
ATOM   3882 O O   . ASP B 1 179 ? 3.208  5.328  25.554  1.00 28.60  ? 248 ASP B O   1 
ATOM   3883 C CB  . ASP B 1 179 ? 1.634  7.327  26.837  1.00 40.08  ? 248 ASP B CB  1 
ATOM   3884 C CG  . ASP B 1 179 ? 0.531  7.201  25.784  1.00 44.42  ? 248 ASP B CG  1 
ATOM   3885 O OD1 . ASP B 1 179 ? 0.054  6.070  25.530  1.00 35.71  ? 248 ASP B OD1 1 
ATOM   3886 O OD2 . ASP B 1 179 ? 0.141  8.244  25.205  1.00 38.51  ? 248 ASP B OD2 1 
ATOM   3887 N N   . PRO B 1 180 ? 1.970  3.728  26.517  1.00 34.45  ? 249 PRO B N   1 
ATOM   3888 C CA  . PRO B 1 180 ? 2.420  2.725  25.535  1.00 33.83  ? 249 PRO B CA  1 
ATOM   3889 C C   . PRO B 1 180 ? 2.038  3.036  24.088  1.00 38.86  ? 249 PRO B C   1 
ATOM   3890 O O   . PRO B 1 180 ? 2.532  2.351  23.183  1.00 44.04  ? 249 PRO B O   1 
ATOM   3891 C CB  . PRO B 1 180 ? 1.755  1.428  26.022  1.00 38.22  ? 249 PRO B CB  1 
ATOM   3892 C CG  . PRO B 1 180 ? 0.643  1.870  26.930  1.00 38.46  ? 249 PRO B CG  1 
ATOM   3893 C CD  . PRO B 1 180 ? 1.100  3.149  27.553  1.00 34.44  ? 249 PRO B CD  1 
ATOM   3894 N N   . GLN B 1 181 ? 1.184  4.035  23.837  1.00 31.69  ? 250 GLN B N   1 
ATOM   3895 C CA  . GLN B 1 181 ? 0.876  4.420  22.462  1.00 37.73  ? 250 GLN B CA  1 
ATOM   3896 C C   . GLN B 1 181 ? 2.057  5.092  21.769  1.00 40.84  ? 250 GLN B C   1 
ATOM   3897 O O   . GLN B 1 181 ? 2.068  5.177  20.536  1.00 40.19  ? 250 GLN B O   1 
ATOM   3898 C CB  . GLN B 1 181 ? -0.338 5.358  22.418  1.00 38.63  ? 250 GLN B CB  1 
ATOM   3899 C CG  . GLN B 1 181 ? -1.667 4.732  22.853  1.00 48.04  ? 250 GLN B CG  1 
ATOM   3900 C CD  . GLN B 1 181 ? -2.093 3.558  21.988  1.00 53.60  ? 250 GLN B CD  1 
ATOM   3901 O OE1 . GLN B 1 181 ? -2.377 3.717  20.802  1.00 65.43  ? 250 GLN B OE1 1 
ATOM   3902 N NE2 . GLN B 1 181 ? -2.136 2.369  22.581  1.00 55.15  ? 250 GLN B NE2 1 
ATOM   3903 N N   . HIS B 1 182 ? 3.050  5.568  22.524  1.00 35.46  ? 251 HIS B N   1 
ATOM   3904 C CA  . HIS B 1 182 ? 4.167  6.308  21.949  1.00 28.84  ? 251 HIS B CA  1 
ATOM   3905 C C   . HIS B 1 182 ? 5.507  5.622  22.187  1.00 26.31  ? 251 HIS B C   1 
ATOM   3906 O O   . HIS B 1 182 ? 6.559  6.257  22.075  1.00 31.41  ? 251 HIS B O   1 
ATOM   3907 C CB  . HIS B 1 182 ? 4.169  7.737  22.485  1.00 25.94  ? 251 HIS B CB  1 
ATOM   3908 C CG  . HIS B 1 182 ? 3.025  8.553  21.976  1.00 35.15  ? 251 HIS B CG  1 
ATOM   3909 N ND1 . HIS B 1 182 ? 2.023  9.024  22.795  1.00 38.76  ? 251 HIS B ND1 1 
ATOM   3910 C CD2 . HIS B 1 182 ? 2.709  8.955  20.722  1.00 34.02  ? 251 HIS B CD2 1 
ATOM   3911 C CE1 . HIS B 1 182 ? 1.144  9.694  22.070  1.00 38.73  ? 251 HIS B CE1 1 
ATOM   3912 N NE2 . HIS B 1 182 ? 1.537  9.665  20.809  1.00 38.59  ? 251 HIS B NE2 1 
ATOM   3913 N N   . TYR B 1 183 ? 5.492  4.331  22.495  1.00 26.54  ? 252 TYR B N   1 
ATOM   3914 C CA  . TYR B 1 183 ? 6.717  3.551  22.539  1.00 29.04  ? 252 TYR B CA  1 
ATOM   3915 C C   . TYR B 1 183 ? 6.372  2.103  22.239  1.00 28.70  ? 252 TYR B C   1 
ATOM   3916 O O   . TYR B 1 183 ? 5.236  1.662  22.422  1.00 36.64  ? 252 TYR B O   1 
ATOM   3917 C CB  . TYR B 1 183 ? 7.447  3.686  23.891  1.00 30.66  ? 252 TYR B CB  1 
ATOM   3918 C CG  . TYR B 1 183 ? 6.810  2.974  25.077  1.00 21.18  ? 252 TYR B CG  1 
ATOM   3919 C CD1 . TYR B 1 183 ? 7.013  1.614  25.297  1.00 28.80  ? 252 TYR B CD1 1 
ATOM   3920 C CD2 . TYR B 1 183 ? 6.038  3.674  25.996  1.00 31.67  ? 252 TYR B CD2 1 
ATOM   3921 C CE1 . TYR B 1 183 ? 6.443  0.964  26.388  1.00 34.11  ? 252 TYR B CE1 1 
ATOM   3922 C CE2 . TYR B 1 183 ? 5.467  3.034  27.097  1.00 33.53  ? 252 TYR B CE2 1 
ATOM   3923 C CZ  . TYR B 1 183 ? 5.670  1.680  27.283  1.00 35.89  ? 252 TYR B CZ  1 
ATOM   3924 O OH  . TYR B 1 183 ? 5.105  1.044  28.366  1.00 36.52  ? 252 TYR B OH  1 
ATOM   3925 N N   . GLU B 1 184 ? 7.372  1.368  21.777  1.00 38.34  ? 253 GLU B N   1 
ATOM   3926 C CA  . GLU B 1 184 ? 7.216  -0.041 21.476  1.00 39.76  ? 253 GLU B CA  1 
ATOM   3927 C C   . GLU B 1 184 ? 8.276  -0.838 22.221  1.00 34.88  ? 253 GLU B C   1 
ATOM   3928 O O   . GLU B 1 184 ? 9.303  -0.304 22.644  1.00 42.46  ? 253 GLU B O   1 
ATOM   3929 C CB  . GLU B 1 184 ? 7.313  -0.293 19.979  1.00 39.68  ? 253 GLU B CB  1 
ATOM   3930 C CG  . GLU B 1 184 ? 8.635  0.094  19.394  1.00 43.67  ? 253 GLU B CG  1 
ATOM   3931 C CD  . GLU B 1 184 ? 8.655  -0.117 17.905  1.00 62.46  ? 253 GLU B CD  1 
ATOM   3932 O OE1 . GLU B 1 184 ? 7.772  0.444  17.217  1.00 67.21  ? 253 GLU B OE1 1 
ATOM   3933 O OE2 . GLU B 1 184 ? 9.539  -0.859 17.426  1.00 69.30  ? 253 GLU B OE2 1 
ATOM   3934 N N   . GLY B 1 185 ? 8.008  -2.131 22.379  1.00 32.91  ? 254 GLY B N   1 
ATOM   3935 C CA  . GLY B 1 185 ? 8.902  -2.969 23.144  1.00 33.06  ? 254 GLY B CA  1 
ATOM   3936 C C   . GLY B 1 185 ? 8.880  -2.612 24.623  1.00 39.14  ? 254 GLY B C   1 
ATOM   3937 O O   . GLY B 1 185 ? 7.989  -1.918 25.124  1.00 36.23  ? 254 GLY B O   1 
ATOM   3938 N N   . ASN B 1 186 ? 9.894  -3.097 25.326  1.00 40.14  ? 255 ASN B N   1 
ATOM   3939 C CA  . ASN B 1 186 ? 10.014 -2.872 26.757  1.00 35.73  ? 255 ASN B CA  1 
ATOM   3940 C C   . ASN B 1 186 ? 11.066 -1.815 27.043  1.00 25.19  ? 255 ASN B C   1 
ATOM   3941 O O   . ASN B 1 186 ? 12.009 -1.624 26.273  1.00 38.64  ? 255 ASN B O   1 
ATOM   3942 C CB  . ASN B 1 186 ? 10.375 -4.162 27.489  1.00 44.74  ? 255 ASN B CB  1 
ATOM   3943 C CG  . ASN B 1 186 ? 9.428  -5.288 27.170  1.00 54.65  ? 255 ASN B CG  1 
ATOM   3944 O OD1 . ASN B 1 186 ? 9.782  -6.228 26.456  1.00 58.58  ? 255 ASN B OD1 1 
ATOM   3945 N ND2 . ASN B 1 186 ? 8.209  -5.197 27.688  1.00 55.90  ? 255 ASN B ND2 1 
ATOM   3946 N N   . PHE B 1 187 ? 10.890 -1.124 28.161  1.00 20.18  ? 256 PHE B N   1 
ATOM   3947 C CA  . PHE B 1 187 ? 11.906 -0.188 28.610  1.00 30.30  ? 256 PHE B CA  1 
ATOM   3948 C C   . PHE B 1 187 ? 13.187 -0.928 28.974  1.00 27.83  ? 256 PHE B C   1 
ATOM   3949 O O   . PHE B 1 187 ? 13.153 -2.017 29.552  1.00 25.99  ? 256 PHE B O   1 
ATOM   3950 C CB  . PHE B 1 187 ? 11.397 0.601  29.815  1.00 33.47  ? 256 PHE B CB  1 
ATOM   3951 C CG  . PHE B 1 187 ? 10.439 1.693  29.460  1.00 33.90  ? 256 PHE B CG  1 
ATOM   3952 C CD1 . PHE B 1 187 ? 10.901 2.913  28.993  1.00 33.01  ? 256 PHE B CD1 1 
ATOM   3953 C CD2 . PHE B 1 187 ? 9.076  1.504  29.595  1.00 30.08  ? 256 PHE B CD2 1 
ATOM   3954 C CE1 . PHE B 1 187 ? 10.016 3.924  28.666  1.00 37.82  ? 256 PHE B CE1 1 
ATOM   3955 C CE2 . PHE B 1 187 ? 8.187  2.509  29.265  1.00 33.33  ? 256 PHE B CE2 1 
ATOM   3956 C CZ  . PHE B 1 187 ? 8.654  3.720  28.802  1.00 31.69  ? 256 PHE B CZ  1 
ATOM   3957 N N   . HIS B 1 188 ? 14.321 -0.333 28.626  1.00 28.22  ? 257 HIS B N   1 
ATOM   3958 C CA  . HIS B 1 188 ? 15.622 -0.776 29.109  1.00 22.55  ? 257 HIS B CA  1 
ATOM   3959 C C   . HIS B 1 188 ? 16.081 0.207  30.175  1.00 29.26  ? 257 HIS B C   1 
ATOM   3960 O O   . HIS B 1 188 ? 16.274 1.391  29.880  1.00 38.12  ? 257 HIS B O   1 
ATOM   3961 C CB  . HIS B 1 188 ? 16.640 -0.858 27.975  1.00 25.44  ? 257 HIS B CB  1 
ATOM   3962 C CG  . HIS B 1 188 ? 18.050 -1.012 28.452  1.00 46.58  ? 257 HIS B CG  1 
ATOM   3963 N ND1 . HIS B 1 188 ? 19.077 -0.201 28.018  1.00 49.04  ? 257 HIS B ND1 1 
ATOM   3964 C CD2 . HIS B 1 188 ? 18.599 -1.874 29.341  1.00 46.03  ? 257 HIS B CD2 1 
ATOM   3965 C CE1 . HIS B 1 188 ? 20.200 -0.563 28.614  1.00 48.76  ? 257 HIS B CE1 1 
ATOM   3966 N NE2 . HIS B 1 188 ? 19.937 -1.574 29.422  1.00 46.10  ? 257 HIS B NE2 1 
ATOM   3967 N N   . TYR B 1 189 ? 16.250 -0.274 31.405  1.00 28.41  ? 258 TYR B N   1 
ATOM   3968 C CA  . TYR B 1 189 ? 16.485 0.605  32.542  1.00 28.44  ? 258 TYR B CA  1 
ATOM   3969 C C   . TYR B 1 189 ? 17.965 0.686  32.891  1.00 29.79  ? 258 TYR B C   1 
ATOM   3970 O O   . TYR B 1 189 ? 18.707 -0.293 32.779  1.00 36.97  ? 258 TYR B O   1 
ATOM   3971 C CB  . TYR B 1 189 ? 15.692 0.146  33.766  1.00 20.77  ? 258 TYR B CB  1 
ATOM   3972 C CG  . TYR B 1 189 ? 14.211 0.389  33.635  1.00 23.21  ? 258 TYR B CG  1 
ATOM   3973 C CD1 . TYR B 1 189 ? 13.689 1.672  33.733  1.00 21.52  ? 258 TYR B CD1 1 
ATOM   3974 C CD2 . TYR B 1 189 ? 13.333 -0.664 33.407  1.00 21.29  ? 258 TYR B CD2 1 
ATOM   3975 C CE1 . TYR B 1 189 ? 12.331 1.902  33.610  1.00 23.27  ? 258 TYR B CE1 1 
ATOM   3976 C CE2 . TYR B 1 189 ? 11.978 -0.447 33.280  1.00 23.24  ? 258 TYR B CE2 1 
ATOM   3977 C CZ  . TYR B 1 189 ? 11.478 0.837  33.384  1.00 27.71  ? 258 TYR B CZ  1 
ATOM   3978 O OH  . TYR B 1 189 ? 10.122 1.050  33.263  1.00 24.28  ? 258 TYR B OH  1 
ATOM   3979 N N   . ILE B 1 190 ? 18.378 1.874  33.330  1.00 21.68  ? 259 ILE B N   1 
ATOM   3980 C CA  . ILE B 1 190 ? 19.761 2.172  33.679  1.00 25.05  ? 259 ILE B CA  1 
ATOM   3981 C C   . ILE B 1 190 ? 19.769 2.952  34.984  1.00 34.02  ? 259 ILE B C   1 
ATOM   3982 O O   . ILE B 1 190 ? 18.971 3.876  35.169  1.00 38.51  ? 259 ILE B O   1 
ATOM   3983 C CB  . ILE B 1 190 ? 20.466 2.981  32.571  1.00 26.67  ? 259 ILE B CB  1 
ATOM   3984 C CG1 . ILE B 1 190 ? 20.320 2.290  31.216  1.00 32.16  ? 259 ILE B CG1 1 
ATOM   3985 C CG2 . ILE B 1 190 ? 21.925 3.198  32.913  1.00 16.42  ? 259 ILE B CG2 1 
ATOM   3986 C CD1 . ILE B 1 190 ? 20.147 3.258  30.070  1.00 35.88  ? 259 ILE B CD1 1 
ATOM   3987 N N   . ASN B 1 191 ? 20.684 2.591  35.881  1.00 36.76  ? 260 ASN B N   1 
ATOM   3988 C CA  . ASN B 1 191 ? 20.816 3.291  37.151  1.00 40.10  ? 260 ASN B CA  1 
ATOM   3989 C C   . ASN B 1 191 ? 21.269 4.733  36.948  1.00 36.92  ? 260 ASN B C   1 
ATOM   3990 O O   . ASN B 1 191 ? 22.074 5.038  36.063  1.00 34.83  ? 260 ASN B O   1 
ATOM   3991 C CB  . ASN B 1 191 ? 21.834 2.589  38.052  1.00 45.84  ? 260 ASN B CB  1 
ATOM   3992 C CG  . ASN B 1 191 ? 21.322 1.283  38.611  1.00 50.99  ? 260 ASN B CG  1 
ATOM   3993 O OD1 . ASN B 1 191 ? 21.595 0.211  38.070  1.00 56.03  ? 260 ASN B OD1 1 
ATOM   3994 N ND2 . ASN B 1 191 ? 20.571 1.364  39.699  1.00 49.84  ? 260 ASN B ND2 1 
ATOM   3995 N N   . LEU B 1 192 ? 20.752 5.623  37.793  1.00 28.34  ? 261 LEU B N   1 
ATOM   3996 C CA  . LEU B 1 192 ? 21.420 6.896  38.021  1.00 27.60  ? 261 LEU B CA  1 
ATOM   3997 C C   . LEU B 1 192 ? 22.743 6.655  38.741  1.00 32.05  ? 261 LEU B C   1 
ATOM   3998 O O   . LEU B 1 192 ? 22.889 5.709  39.522  1.00 28.05  ? 261 LEU B O   1 
ATOM   3999 C CB  . LEU B 1 192 ? 20.553 7.834  38.863  1.00 25.52  ? 261 LEU B CB  1 
ATOM   4000 C CG  . LEU B 1 192 ? 19.156 8.237  38.391  1.00 28.86  ? 261 LEU B CG  1 
ATOM   4001 C CD1 . LEU B 1 192 ? 18.575 9.250  39.354  1.00 31.54  ? 261 LEU B CD1 1 
ATOM   4002 C CD2 . LEU B 1 192 ? 19.182 8.793  36.981  1.00 24.44  ? 261 LEU B CD2 1 
ATOM   4003 N N   . ILE B 1 193 ? 23.718 7.521  38.471  1.00 27.75  ? 262 ILE B N   1 
ATOM   4004 C CA  . ILE B 1 193 ? 24.994 7.426  39.172  1.00 28.24  ? 262 ILE B CA  1 
ATOM   4005 C C   . ILE B 1 193 ? 24.806 7.757  40.643  1.00 35.45  ? 262 ILE B C   1 
ATOM   4006 O O   . ILE B 1 193 ? 25.116 6.949  41.528  1.00 28.63  ? 262 ILE B O   1 
ATOM   4007 C CB  . ILE B 1 193 ? 26.039 8.346  38.525  1.00 37.29  ? 262 ILE B CB  1 
ATOM   4008 C CG1 . ILE B 1 193 ? 26.466 7.781  37.174  1.00 39.46  ? 262 ILE B CG1 1 
ATOM   4009 C CG2 . ILE B 1 193 ? 27.241 8.485  39.435  1.00 37.24  ? 262 ILE B CG2 1 
ATOM   4010 C CD1 . ILE B 1 193 ? 26.863 8.830  36.210  1.00 33.63  ? 262 ILE B CD1 1 
ATOM   4011 N N   . LYS B 1 194 ? 24.293 8.954  40.919  1.00 41.03  ? 263 LYS B N   1 
ATOM   4012 C CA  . LYS B 1 194 ? 23.929 9.370  42.262  1.00 44.32  ? 263 LYS B CA  1 
ATOM   4013 C C   . LYS B 1 194 ? 22.590 10.086 42.206  1.00 54.36  ? 263 LYS B C   1 
ATOM   4014 O O   . LYS B 1 194 ? 22.243 10.708 41.198  1.00 60.30  ? 263 LYS B O   1 
ATOM   4015 C CB  . LYS B 1 194 ? 24.993 10.286 42.886  1.00 40.80  ? 263 LYS B CB  1 
ATOM   4016 C CG  . LYS B 1 194 ? 25.079 11.660 42.262  1.00 35.60  ? 263 LYS B CG  1 
ATOM   4017 C CD  . LYS B 1 194 ? 26.055 12.532 43.021  1.00 52.47  ? 263 LYS B CD  1 
ATOM   4018 C CE  . LYS B 1 194 ? 26.137 13.910 42.400  1.00 55.84  ? 263 LYS B CE  1 
ATOM   4019 N NZ  . LYS B 1 194 ? 26.538 13.822 40.971  1.00 55.53  ? 263 LYS B NZ  1 
ATOM   4020 N N   . THR B 1 195 ? 21.827 9.971  43.290  1.00 60.79  ? 264 THR B N   1 
ATOM   4021 C CA  . THR B 1 195 ? 20.586 10.724 43.407  1.00 56.97  ? 264 THR B CA  1 
ATOM   4022 C C   . THR B 1 195 ? 20.898 12.216 43.431  1.00 50.67  ? 264 THR B C   1 
ATOM   4023 O O   . THR B 1 195 ? 21.940 12.642 43.938  1.00 54.52  ? 264 THR B O   1 
ATOM   4024 C CB  . THR B 1 195 ? 19.824 10.288 44.667  1.00 58.16  ? 264 THR B CB  1 
ATOM   4025 O OG1 . THR B 1 195 ? 19.114 9.075  44.393  1.00 66.98  ? 264 THR B OG1 1 
ATOM   4026 C CG2 . THR B 1 195 ? 18.826 11.339 45.128  1.00 49.53  ? 264 THR B CG2 1 
ATOM   4027 N N   . GLY B 1 196 ? 20.010 13.010 42.837  1.00 41.56  ? 265 GLY B N   1 
ATOM   4028 C CA  . GLY B 1 196 ? 20.177 14.447 42.740  1.00 33.87  ? 265 GLY B CA  1 
ATOM   4029 C C   . GLY B 1 196 ? 20.356 14.961 41.328  1.00 32.13  ? 265 GLY B C   1 
ATOM   4030 O O   . GLY B 1 196 ? 20.128 16.152 41.081  1.00 42.60  ? 265 GLY B O   1 
ATOM   4031 N N   . VAL B 1 197 ? 20.781 14.111 40.394  1.00 25.69  ? 266 VAL B N   1 
ATOM   4032 C CA  . VAL B 1 197 ? 20.940 14.473 38.992  1.00 29.74  ? 266 VAL B CA  1 
ATOM   4033 C C   . VAL B 1 197 ? 20.344 13.357 38.149  1.00 31.65  ? 266 VAL B C   1 
ATOM   4034 O O   . VAL B 1 197 ? 20.537 12.175 38.454  1.00 28.98  ? 266 VAL B O   1 
ATOM   4035 C CB  . VAL B 1 197 ? 22.420 14.697 38.611  1.00 37.07  ? 266 VAL B CB  1 
ATOM   4036 C CG1 . VAL B 1 197 ? 22.513 15.470 37.311  1.00 39.24  ? 266 VAL B CG1 1 
ATOM   4037 C CG2 . VAL B 1 197 ? 23.178 15.415 39.720  1.00 33.36  ? 266 VAL B CG2 1 
ATOM   4038 N N   . TRP B 1 198 ? 19.604 13.725 37.098  1.00 29.98  ? 267 TRP B N   1 
ATOM   4039 C CA  . TRP B 1 198 ? 19.134 12.742 36.119  1.00 20.02  ? 267 TRP B CA  1 
ATOM   4040 C C   . TRP B 1 198 ? 20.293 12.434 35.170  1.00 24.26  ? 267 TRP B C   1 
ATOM   4041 O O   . TRP B 1 198 ? 20.279 12.734 33.975  1.00 24.86  ? 267 TRP B O   1 
ATOM   4042 C CB  . TRP B 1 198 ? 17.906 13.241 35.373  1.00 20.84  ? 267 TRP B CB  1 
ATOM   4043 C CG  . TRP B 1 198 ? 16.668 13.358 36.213  1.00 31.04  ? 267 TRP B CG  1 
ATOM   4044 C CD1 . TRP B 1 198 ? 16.035 14.513 36.577  1.00 32.50  ? 267 TRP B CD1 1 
ATOM   4045 C CD2 . TRP B 1 198 ? 15.902 12.286 36.778  1.00 28.84  ? 267 TRP B CD2 1 
ATOM   4046 N NE1 . TRP B 1 198 ? 14.928 14.228 37.337  1.00 26.69  ? 267 TRP B NE1 1 
ATOM   4047 C CE2 . TRP B 1 198 ? 14.823 12.869 37.478  1.00 30.45  ? 267 TRP B CE2 1 
ATOM   4048 C CE3 . TRP B 1 198 ? 16.022 10.894 36.764  1.00 25.17  ? 267 TRP B CE3 1 
ATOM   4049 C CZ2 . TRP B 1 198 ? 13.872 12.105 38.162  1.00 21.97  ? 267 TRP B CZ2 1 
ATOM   4050 C CZ3 . TRP B 1 198 ? 15.073 10.133 37.448  1.00 35.78  ? 267 TRP B CZ3 1 
ATOM   4051 C CH2 . TRP B 1 198 ? 14.010 10.742 38.130  1.00 16.59  ? 267 TRP B CH2 1 
ATOM   4052 N N   . GLN B 1 199 ? 21.327 11.832 35.742  1.00 31.14  ? 268 GLN B N   1 
ATOM   4053 C CA  . GLN B 1 199 ? 22.582 11.575 35.060  1.00 27.65  ? 268 GLN B CA  1 
ATOM   4054 C C   . GLN B 1 199 ? 22.887 10.089 35.133  1.00 25.63  ? 268 GLN B C   1 
ATOM   4055 O O   . GLN B 1 199 ? 22.654 9.452  36.164  1.00 36.48  ? 268 GLN B O   1 
ATOM   4056 C CB  . GLN B 1 199 ? 23.709 12.380 35.699  1.00 30.75  ? 268 GLN B CB  1 
ATOM   4057 C CG  . GLN B 1 199 ? 24.912 12.622 34.818  1.00 30.39  ? 268 GLN B CG  1 
ATOM   4058 C CD  . GLN B 1 199 ? 25.861 13.610 35.449  1.00 30.73  ? 268 GLN B CD  1 
ATOM   4059 O OE1 . GLN B 1 199 ? 26.010 13.647 36.673  1.00 39.95  ? 268 GLN B OE1 1 
ATOM   4060 N NE2 . GLN B 1 199 ? 26.498 14.429 34.625  1.00 27.11  ? 268 GLN B NE2 1 
ATOM   4061 N N   . ILE B 1 200 ? 23.402 9.537  34.036  1.00 19.76  ? 269 ILE B N   1 
ATOM   4062 C CA  . ILE B 1 200 ? 23.707 8.117  33.963  1.00 20.57  ? 269 ILE B CA  1 
ATOM   4063 C C   . ILE B 1 200 ? 25.114 7.920  33.410  1.00 24.88  ? 269 ILE B C   1 
ATOM   4064 O O   . ILE B 1 200 ? 25.697 8.805  32.779  1.00 22.27  ? 269 ILE B O   1 
ATOM   4065 C CB  . ILE B 1 200 ? 22.679 7.347  33.108  1.00 28.63  ? 269 ILE B CB  1 
ATOM   4066 C CG1 . ILE B 1 200 ? 22.629 7.909  31.682  1.00 25.33  ? 269 ILE B CG1 1 
ATOM   4067 C CG2 . ILE B 1 200 ? 21.304 7.388  33.762  1.00 15.34  ? 269 ILE B CG2 1 
ATOM   4068 C CD1 . ILE B 1 200 ? 21.758 7.097  30.745  1.00 16.63  ? 269 ILE B CD1 1 
ATOM   4069 N N   . GLN B 1 201 ? 25.659 6.739  33.665  1.00 30.22  ? 270 GLN B N   1 
ATOM   4070 C CA  . GLN B 1 201 ? 26.979 6.398  33.163  1.00 35.61  ? 270 GLN B CA  1 
ATOM   4071 C C   . GLN B 1 201 ? 26.892 6.026  31.689  1.00 40.87  ? 270 GLN B C   1 
ATOM   4072 O O   . GLN B 1 201 ? 25.975 5.317  31.266  1.00 31.74  ? 270 GLN B O   1 
ATOM   4073 C CB  . GLN B 1 201 ? 27.575 5.241  33.967  1.00 28.60  ? 270 GLN B CB  1 
ATOM   4074 C CG  . GLN B 1 201 ? 28.989 4.873  33.571  1.00 38.11  ? 270 GLN B CG  1 
ATOM   4075 C CD  . GLN B 1 201 ? 30.007 5.870  34.085  1.00 52.79  ? 270 GLN B CD  1 
ATOM   4076 O OE1 . GLN B 1 201 ? 29.847 6.433  35.170  1.00 61.95  ? 270 GLN B OE1 1 
ATOM   4077 N NE2 . GLN B 1 201 ? 31.063 6.094  33.309  1.00 53.13  ? 270 GLN B NE2 1 
ATOM   4078 N N   . MET B 1 202 ? 27.847 6.523  30.908  1.00 44.58  ? 271 MET B N   1 
ATOM   4079 C CA  . MET B 1 202 ? 27.965 6.220  29.489  1.00 41.65  ? 271 MET B CA  1 
ATOM   4080 C C   . MET B 1 202 ? 29.356 5.658  29.242  1.00 44.16  ? 271 MET B C   1 
ATOM   4081 O O   . MET B 1 202 ? 30.350 6.247  29.679  1.00 44.38  ? 271 MET B O   1 
ATOM   4082 C CB  . MET B 1 202 ? 27.717 7.470  28.636  1.00 39.71  ? 271 MET B CB  1 
ATOM   4083 C CG  . MET B 1 202 ? 27.867 7.262  27.133  1.00 35.96  ? 271 MET B CG  1 
ATOM   4084 S SD  . MET B 1 202 ? 26.921 8.450  26.154  1.00 31.22  ? 271 MET B SD  1 
ATOM   4085 C CE  . MET B 1 202 ? 27.908 9.923  26.314  1.00 24.26  ? 271 MET B CE  1 
ATOM   4086 N N   . LYS B 1 203 ? 29.424 4.512  28.560  1.00 41.30  ? 272 LYS B N   1 
ATOM   4087 C CA  . LYS B 1 203 ? 30.673 3.782  28.375  1.00 31.27  ? 272 LYS B CA  1 
ATOM   4088 C C   . LYS B 1 203 ? 31.142 3.788  26.923  1.00 37.60  ? 272 LYS B C   1 
ATOM   4089 O O   . LYS B 1 203 ? 31.737 2.814  26.458  1.00 46.96  ? 272 LYS B O   1 
ATOM   4090 C CB  . LYS B 1 203 ? 30.529 2.346  28.876  1.00 23.59  ? 272 LYS B CB  1 
ATOM   4091 N N   . GLY B 1 204 ? 30.888 4.870  26.192  1.00 35.49  ? 273 GLY B N   1 
ATOM   4092 C CA  . GLY B 1 204 ? 31.371 4.952  24.827  1.00 28.76  ? 273 GLY B CA  1 
ATOM   4093 C C   . GLY B 1 204 ? 30.442 5.620  23.835  1.00 30.41  ? 273 GLY B C   1 
ATOM   4094 O O   . GLY B 1 204 ? 29.224 5.413  23.857  1.00 28.04  ? 273 GLY B O   1 
ATOM   4095 N N   . VAL B 1 205 ? 31.026 6.432  22.957  1.00 32.72  ? 274 VAL B N   1 
ATOM   4096 C CA  . VAL B 1 205 ? 30.333 7.050  21.834  1.00 23.98  ? 274 VAL B CA  1 
ATOM   4097 C C   . VAL B 1 205 ? 31.009 6.569  20.559  1.00 38.65  ? 274 VAL B C   1 
ATOM   4098 O O   . VAL B 1 205 ? 32.243 6.593  20.460  1.00 38.02  ? 274 VAL B O   1 
ATOM   4099 C CB  . VAL B 1 205 ? 30.355 8.587  21.925  1.00 27.24  ? 274 VAL B CB  1 
ATOM   4100 C CG1 . VAL B 1 205 ? 29.565 9.208  20.775  1.00 21.51  ? 274 VAL B CG1 1 
ATOM   4101 C CG2 . VAL B 1 205 ? 29.803 9.044  23.269  1.00 33.31  ? 274 VAL B CG2 1 
ATOM   4102 N N   . SER B 1 206 ? 30.209 6.117  19.596  1.00 40.21  ? 275 SER B N   1 
ATOM   4103 C CA  . SER B 1 206 ? 30.717 5.483  18.389  1.00 41.55  ? 275 SER B CA  1 
ATOM   4104 C C   . SER B 1 206 ? 30.242 6.215  17.140  1.00 43.82  ? 275 SER B C   1 
ATOM   4105 O O   . SER B 1 206 ? 29.121 6.729  17.092  1.00 40.81  ? 275 SER B O   1 
ATOM   4106 C CB  . SER B 1 206 ? 30.282 4.018  18.318  1.00 40.28  ? 275 SER B CB  1 
ATOM   4107 O OG  . SER B 1 206 ? 31.191 3.183  19.005  1.00 50.98  ? 275 SER B OG  1 
ATOM   4108 N N   . VAL B 1 207 ? 31.112 6.262  16.137  1.00 35.52  ? 276 VAL B N   1 
ATOM   4109 C CA  . VAL B 1 207 ? 30.774 6.710  14.794  1.00 20.62  ? 276 VAL B CA  1 
ATOM   4110 C C   . VAL B 1 207 ? 30.858 5.482  13.904  1.00 29.41  ? 276 VAL B C   1 
ATOM   4111 O O   . VAL B 1 207 ? 31.945 4.928  13.701  1.00 32.44  ? 276 VAL B O   1 
ATOM   4112 C CB  . VAL B 1 207 ? 31.717 7.814  14.300  1.00 24.97  ? 276 VAL B CB  1 
ATOM   4113 C CG1 . VAL B 1 207 ? 31.418 8.136  12.862  1.00 24.03  ? 276 VAL B CG1 1 
ATOM   4114 C CG2 . VAL B 1 207 ? 31.588 9.057  15.155  1.00 23.86  ? 276 VAL B CG2 1 
ATOM   4115 N N   . GLY B 1 208 ? 29.722 5.052  13.370  1.00 32.37  ? 277 GLY B N   1 
ATOM   4116 C CA  . GLY B 1 208 ? 29.711 3.782  12.668  1.00 23.85  ? 277 GLY B CA  1 
ATOM   4117 C C   . GLY B 1 208 ? 30.115 2.677  13.623  1.00 36.86  ? 277 GLY B C   1 
ATOM   4118 O O   . GLY B 1 208 ? 29.627 2.591  14.757  1.00 33.20  ? 277 GLY B O   1 
ATOM   4119 N N   . SER B 1 209 ? 31.032 1.822  13.173  1.00 43.32  ? 278 SER B N   1 
ATOM   4120 C CA  . SER B 1 209 ? 31.544 0.758  14.026  1.00 34.95  ? 278 SER B CA  1 
ATOM   4121 C C   . SER B 1 209 ? 32.666 1.225  14.943  1.00 38.88  ? 278 SER B C   1 
ATOM   4122 O O   . SER B 1 209 ? 33.000 0.521  15.900  1.00 58.02  ? 278 SER B O   1 
ATOM   4123 C CB  . SER B 1 209 ? 32.035 -0.403 13.165  1.00 33.01  ? 278 SER B CB  1 
ATOM   4124 O OG  . SER B 1 209 ? 33.123 -1.063 13.780  1.00 52.44  ? 278 SER B OG  1 
ATOM   4125 N N   . SER B 1 210 ? 33.243 2.389  14.680  1.00 37.57  ? 279 SER B N   1 
ATOM   4126 C CA  . SER B 1 210 ? 34.455 2.834  15.353  1.00 41.19  ? 279 SER B CA  1 
ATOM   4127 C C   . SER B 1 210 ? 34.098 3.622  16.611  1.00 39.55  ? 279 SER B C   1 
ATOM   4128 O O   . SER B 1 210 ? 33.405 4.643  16.539  1.00 42.95  ? 279 SER B O   1 
ATOM   4129 C CB  . SER B 1 210 ? 35.300 3.675  14.395  1.00 42.06  ? 279 SER B CB  1 
ATOM   4130 O OG  . SER B 1 210 ? 36.441 4.212  15.036  1.00 61.43  ? 279 SER B OG  1 
ATOM   4131 N N   . THR B 1 211 ? 34.573 3.151  17.760  1.00 36.27  ? 280 THR B N   1 
ATOM   4132 C CA  . THR B 1 211 ? 34.360 3.857  19.020  1.00 34.51  ? 280 THR B CA  1 
ATOM   4133 C C   . THR B 1 211 ? 35.437 4.920  19.169  1.00 31.69  ? 280 THR B C   1 
ATOM   4134 O O   . THR B 1 211 ? 36.620 4.600  19.309  1.00 42.19  ? 280 THR B O   1 
ATOM   4135 C CB  . THR B 1 211 ? 34.379 2.886  20.193  1.00 39.59  ? 280 THR B CB  1 
ATOM   4136 O OG1 . THR B 1 211 ? 33.598 1.732  19.860  1.00 40.81  ? 280 THR B OG1 1 
ATOM   4137 C CG2 . THR B 1 211 ? 33.794 3.554  21.438  1.00 43.76  ? 280 THR B CG2 1 
ATOM   4138 N N   . LEU B 1 212 ? 35.037 6.188  19.139  1.00 30.79  ? 281 LEU B N   1 
ATOM   4139 C CA  . LEU B 1 212 ? 36.011 7.262  19.068  1.00 27.66  ? 281 LEU B CA  1 
ATOM   4140 C C   . LEU B 1 212 ? 36.084 8.134  20.315  1.00 29.42  ? 281 LEU B C   1 
ATOM   4141 O O   . LEU B 1 212 ? 37.090 8.824  20.500  1.00 36.14  ? 281 LEU B O   1 
ATOM   4142 C CB  . LEU B 1 212 ? 35.731 8.142  17.837  1.00 28.47  ? 281 LEU B CB  1 
ATOM   4143 C CG  . LEU B 1 212 ? 34.872 9.393  17.985  1.00 36.15  ? 281 LEU B CG  1 
ATOM   4144 C CD1 . LEU B 1 212 ? 34.975 10.226 16.724  1.00 40.34  ? 281 LEU B CD1 1 
ATOM   4145 C CD2 . LEU B 1 212 ? 33.430 9.025  18.265  1.00 46.68  ? 281 LEU B CD2 1 
ATOM   4146 N N   . LEU B 1 213 ? 35.074 8.118  21.180  1.00 27.31  ? 282 LEU B N   1 
ATOM   4147 C CA  . LEU B 1 213 ? 35.095 8.957  22.368  1.00 24.02  ? 282 LEU B CA  1 
ATOM   4148 C C   . LEU B 1 213 ? 34.577 8.173  23.560  1.00 32.89  ? 282 LEU B C   1 
ATOM   4149 O O   . LEU B 1 213 ? 33.960 7.113  23.412  1.00 35.81  ? 282 LEU B O   1 
ATOM   4150 C CB  . LEU B 1 213 ? 34.255 10.228 22.189  1.00 24.42  ? 282 LEU B CB  1 
ATOM   4151 C CG  . LEU B 1 213 ? 34.818 11.258 21.214  1.00 32.55  ? 282 LEU B CG  1 
ATOM   4152 C CD1 . LEU B 1 213 ? 33.703 12.127 20.647  1.00 24.61  ? 282 LEU B CD1 1 
ATOM   4153 C CD2 . LEU B 1 213 ? 35.890 12.091 21.903  1.00 24.88  ? 282 LEU B CD2 1 
ATOM   4154 N N   . CYS B 1 214 ? 34.841 8.714  24.751  1.00 39.05  ? 283 CYS B N   1 
ATOM   4155 C CA  . CYS B 1 214 ? 34.257 8.210  25.992  1.00 45.63  ? 283 CYS B CA  1 
ATOM   4156 C C   . CYS B 1 214 ? 34.603 6.735  26.210  1.00 50.98  ? 283 CYS B C   1 
ATOM   4157 O O   . CYS B 1 214 ? 33.829 5.977  26.800  1.00 55.10  ? 283 CYS B O   1 
ATOM   4158 C CB  . CYS B 1 214 ? 32.737 8.446  25.999  1.00 39.08  ? 283 CYS B CB  1 
ATOM   4159 S SG  . CYS B 1 214 ? 31.836 8.063  27.534  1.00 60.26  ? 283 CYS B SG  1 
ATOM   4160 N N   . GLU B 1 215 ? 35.776 6.312  25.730  1.00 51.35  ? 284 GLU B N   1 
ATOM   4161 C CA  . GLU B 1 215 ? 36.132 4.898  25.808  1.00 52.25  ? 284 GLU B CA  1 
ATOM   4162 C C   . GLU B 1 215 ? 36.307 4.453  27.254  1.00 56.84  ? 284 GLU B C   1 
ATOM   4163 O O   . GLU B 1 215 ? 35.933 3.331  27.614  1.00 60.55  ? 284 GLU B O   1 
ATOM   4164 C CB  . GLU B 1 215 ? 37.400 4.626  24.999  1.00 41.01  ? 284 GLU B CB  1 
ATOM   4165 N N   . ASP B 1 216 ? 36.859 5.320  28.101  1.00 52.25  ? 285 ASP B N   1 
ATOM   4166 C CA  . ASP B 1 216 ? 37.033 5.020  29.513  1.00 50.91  ? 285 ASP B CA  1 
ATOM   4167 C C   . ASP B 1 216 ? 35.854 5.486  30.358  1.00 42.74  ? 285 ASP B C   1 
ATOM   4168 O O   . ASP B 1 216 ? 36.016 5.712  31.562  1.00 39.92  ? 285 ASP B O   1 
ATOM   4169 C CB  . ASP B 1 216 ? 38.335 5.643  30.026  1.00 52.59  ? 285 ASP B CB  1 
ATOM   4170 N N   . GLY B 1 217 ? 34.678 5.640  29.754  1.00 38.16  ? 286 GLY B N   1 
ATOM   4171 C CA  . GLY B 1 217 ? 33.491 6.059  30.470  1.00 28.19  ? 286 GLY B CA  1 
ATOM   4172 C C   . GLY B 1 217 ? 33.362 7.558  30.644  1.00 36.96  ? 286 GLY B C   1 
ATOM   4173 O O   . GLY B 1 217 ? 34.367 8.272  30.710  1.00 37.46  ? 286 GLY B O   1 
ATOM   4174 N N   . CYS B 1 218 ? 32.123 8.040  30.720  1.00 36.59  ? 287 CYS B N   1 
ATOM   4175 C CA  . CYS B 1 218 ? 31.827 9.457  30.903  1.00 35.38  ? 287 CYS B CA  1 
ATOM   4176 C C   . CYS B 1 218 ? 30.367 9.583  31.317  1.00 41.24  ? 287 CYS B C   1 
ATOM   4177 O O   . CYS B 1 218 ? 29.624 8.599  31.356  1.00 44.02  ? 287 CYS B O   1 
ATOM   4178 C CB  . CYS B 1 218 ? 32.116 10.266 29.634  1.00 36.21  ? 287 CYS B CB  1 
ATOM   4179 S SG  . CYS B 1 218 ? 31.080 9.828  28.207  1.00 59.79  ? 287 CYS B SG  1 
ATOM   4180 N N   . LEU B 1 219 ? 29.959 10.810 31.612  1.00 15.23  ? 288 LEU B N   1 
ATOM   4181 C CA  . LEU B 1 219 ? 28.626 11.085 32.117  1.00 14.99  ? 288 LEU B CA  1 
ATOM   4182 C C   . LEU B 1 219 ? 27.659 11.430 30.989  1.00 33.87  ? 288 LEU B C   1 
ATOM   4183 O O   . LEU B 1 219 ? 28.054 11.910 29.922  1.00 21.21  ? 288 LEU B O   1 
ATOM   4184 C CB  . LEU B 1 219 ? 28.681 12.230 33.126  1.00 25.08  ? 288 LEU B CB  1 
ATOM   4185 C CG  . LEU B 1 219 ? 29.679 12.013 34.265  1.00 29.05  ? 288 LEU B CG  1 
ATOM   4186 C CD1 . LEU B 1 219 ? 29.579 13.117 35.276  1.00 15.67  ? 288 LEU B CD1 1 
ATOM   4187 C CD2 . LEU B 1 219 ? 29.432 10.679 34.928  1.00 15.97  ? 288 LEU B CD2 1 
ATOM   4188 N N   . ALA B 1 220 ? 26.372 11.182 31.239  1.00 27.00  ? 289 ALA B N   1 
ATOM   4189 C CA  . ALA B 1 220 ? 25.313 11.548 30.301  1.00 19.38  ? 289 ALA B CA  1 
ATOM   4190 C C   . ALA B 1 220 ? 24.112 12.037 31.099  1.00 23.49  ? 289 ALA B C   1 
ATOM   4191 O O   . ALA B 1 220 ? 23.464 11.259 31.809  1.00 29.38  ? 289 ALA B O   1 
ATOM   4192 C CB  . ALA B 1 220 ? 24.932 10.379 29.396  1.00 19.79  ? 289 ALA B CB  1 
ATOM   4193 N N   . LEU B 1 221 ? 23.838 13.329 30.987  1.00 17.31  ? 290 LEU B N   1 
ATOM   4194 C CA  . LEU B 1 221 ? 22.660 13.957 31.565  1.00 17.60  ? 290 LEU B CA  1 
ATOM   4195 C C   . LEU B 1 221 ? 21.511 13.854 30.568  1.00 21.56  ? 290 LEU B C   1 
ATOM   4196 O O   . LEU B 1 221 ? 21.627 14.343 29.441  1.00 25.89  ? 290 LEU B O   1 
ATOM   4197 C CB  . LEU B 1 221 ? 22.974 15.417 31.889  1.00 21.93  ? 290 LEU B CB  1 
ATOM   4198 C CG  . LEU B 1 221 ? 21.874 16.312 32.441  1.00 38.46  ? 290 LEU B CG  1 
ATOM   4199 C CD1 . LEU B 1 221 ? 21.498 15.876 33.843  1.00 40.82  ? 290 LEU B CD1 1 
ATOM   4200 C CD2 . LEU B 1 221 ? 22.344 17.759 32.429  1.00 43.37  ? 290 LEU B CD2 1 
ATOM   4201 N N   . VAL B 1 222 ? 20.416 13.209 30.970  1.00 22.31  ? 291 VAL B N   1 
ATOM   4202 C CA  . VAL B 1 222 ? 19.224 13.091 30.129  1.00 22.69  ? 291 VAL B CA  1 
ATOM   4203 C C   . VAL B 1 222 ? 18.366 14.328 30.384  1.00 27.35  ? 291 VAL B C   1 
ATOM   4204 O O   . VAL B 1 222 ? 17.601 14.383 31.351  1.00 20.09  ? 291 VAL B O   1 
ATOM   4205 C CB  . VAL B 1 222 ? 18.457 11.799 30.406  1.00 32.14  ? 291 VAL B CB  1 
ATOM   4206 C CG1 . VAL B 1 222 ? 17.214 11.716 29.520  1.00 13.79  ? 291 VAL B CG1 1 
ATOM   4207 C CG2 . VAL B 1 222 ? 19.372 10.595 30.197  1.00 29.45  ? 291 VAL B CG2 1 
ATOM   4208 N N   . ASP B 1 223 ? 18.488 15.320 29.496  1.00 28.56  ? 292 ASP B N   1 
ATOM   4209 C CA  . ASP B 1 223 ? 18.055 16.698 29.740  1.00 30.79  ? 292 ASP B CA  1 
ATOM   4210 C C   . ASP B 1 223 ? 16.878 17.046 28.827  1.00 21.25  ? 292 ASP B C   1 
ATOM   4211 O O   . ASP B 1 223 ? 17.074 17.407 27.663  1.00 16.84  ? 292 ASP B O   1 
ATOM   4212 C CB  . ASP B 1 223 ? 19.239 17.645 29.525  1.00 32.08  ? 292 ASP B CB  1 
ATOM   4213 C CG  . ASP B 1 223 ? 18.950 19.084 29.954  1.00 42.71  ? 292 ASP B CG  1 
ATOM   4214 O OD1 . ASP B 1 223 ? 17.766 19.459 30.091  1.00 42.40  ? 292 ASP B OD1 1 
ATOM   4215 O OD2 . ASP B 1 223 ? 19.925 19.848 30.140  1.00 43.71  ? 292 ASP B OD2 1 
ATOM   4216 N N   . THR B 1 224 ? 15.658 16.982 29.372  1.00 21.42  ? 293 THR B N   1 
ATOM   4217 C CA  . THR B 1 224 ? 14.460 17.287 28.587  1.00 19.60  ? 293 THR B CA  1 
ATOM   4218 C C   . THR B 1 224 ? 14.347 18.758 28.202  1.00 21.00  ? 293 THR B C   1 
ATOM   4219 O O   . THR B 1 224 ? 13.488 19.094 27.379  1.00 25.03  ? 293 THR B O   1 
ATOM   4220 C CB  . THR B 1 224 ? 13.195 16.874 29.342  1.00 26.96  ? 293 THR B CB  1 
ATOM   4221 O OG1 . THR B 1 224 ? 13.202 17.456 30.652  1.00 33.47  ? 293 THR B OG1 1 
ATOM   4222 C CG2 . THR B 1 224 ? 13.107 15.353 29.454  1.00 22.53  ? 293 THR B CG2 1 
ATOM   4223 N N   . GLY B 1 225 ? 15.174 19.635 28.768  1.00 16.43  ? 294 GLY B N   1 
ATOM   4224 C CA  . GLY B 1 225 ? 15.239 21.018 28.345  1.00 28.17  ? 294 GLY B CA  1 
ATOM   4225 C C   . GLY B 1 225 ? 16.275 21.321 27.281  1.00 37.72  ? 294 GLY B C   1 
ATOM   4226 O O   . GLY B 1 225 ? 16.448 22.482 26.893  1.00 24.79  ? 294 GLY B O   1 
ATOM   4227 N N   . ALA B 1 226 ? 16.982 20.307 26.794  1.00 34.11  ? 295 ALA B N   1 
ATOM   4228 C CA  . ALA B 1 226 ? 18.017 20.499 25.790  1.00 31.75  ? 295 ALA B CA  1 
ATOM   4229 C C   . ALA B 1 226 ? 17.443 20.257 24.393  1.00 23.99  ? 295 ALA B C   1 
ATOM   4230 O O   . ALA B 1 226 ? 16.875 19.194 24.121  1.00 27.05  ? 295 ALA B O   1 
ATOM   4231 C CB  . ALA B 1 226 ? 19.197 19.565 26.071  1.00 21.83  ? 295 ALA B CB  1 
ATOM   4232 N N   . SER B 1 227 ? 17.578 21.252 23.515  1.00 14.71  ? 296 SER B N   1 
ATOM   4233 C CA  . SER B 1 227 ? 17.121 21.082 22.137  1.00 24.00  ? 296 SER B CA  1 
ATOM   4234 C C   . SER B 1 227 ? 17.986 20.065 21.397  1.00 29.84  ? 296 SER B C   1 
ATOM   4235 O O   . SER B 1 227 ? 17.468 19.173 20.714  1.00 29.50  ? 296 SER B O   1 
ATOM   4236 C CB  . SER B 1 227 ? 17.125 22.426 21.403  1.00 19.32  ? 296 SER B CB  1 
ATOM   4237 O OG  . SER B 1 227 ? 16.368 23.413 22.086  1.00 17.11  ? 296 SER B OG  1 
ATOM   4238 N N   . TYR B 1 228 ? 19.306 20.178 21.534  1.00 19.88  ? 297 TYR B N   1 
ATOM   4239 C CA  . TYR B 1 228 ? 20.262 19.312 20.858  1.00 20.54  ? 297 TYR B CA  1 
ATOM   4240 C C   . TYR B 1 228 ? 20.885 18.308 21.820  1.00 14.36  ? 297 TYR B C   1 
ATOM   4241 O O   . TYR B 1 228 ? 20.792 18.425 23.044  1.00 30.50  ? 297 TYR B O   1 
ATOM   4242 C CB  . TYR B 1 228 ? 21.391 20.129 20.223  1.00 26.22  ? 297 TYR B CB  1 
ATOM   4243 C CG  . TYR B 1 228 ? 21.010 20.980 19.044  1.00 25.40  ? 297 TYR B CG  1 
ATOM   4244 C CD1 . TYR B 1 228 ? 19.684 21.120 18.653  1.00 19.83  ? 297 TYR B CD1 1 
ATOM   4245 C CD2 . TYR B 1 228 ? 21.989 21.643 18.312  1.00 28.94  ? 297 TYR B CD2 1 
ATOM   4246 C CE1 . TYR B 1 228 ? 19.342 21.901 17.572  1.00 22.68  ? 297 TYR B CE1 1 
ATOM   4247 C CE2 . TYR B 1 228 ? 21.660 22.421 17.226  1.00 30.49  ? 297 TYR B CE2 1 
ATOM   4248 C CZ  . TYR B 1 228 ? 20.339 22.548 16.863  1.00 28.35  ? 297 TYR B CZ  1 
ATOM   4249 O OH  . TYR B 1 228 ? 20.024 23.325 15.783  1.00 30.51  ? 297 TYR B OH  1 
ATOM   4250 N N   . ILE B 1 229 ? 21.544 17.319 21.241  1.00 13.63  ? 298 ILE B N   1 
ATOM   4251 C CA  . ILE B 1 229 ? 22.558 16.566 21.964  1.00 12.08  ? 298 ILE B CA  1 
ATOM   4252 C C   . ILE B 1 229 ? 23.787 17.452 22.088  1.00 25.67  ? 298 ILE B C   1 
ATOM   4253 O O   . ILE B 1 229 ? 24.184 18.122 21.125  1.00 23.92  ? 298 ILE B O   1 
ATOM   4254 C CB  . ILE B 1 229 ? 22.893 15.261 21.225  1.00 19.33  ? 298 ILE B CB  1 
ATOM   4255 C CG1 . ILE B 1 229 ? 21.824 14.202 21.479  1.00 16.93  ? 298 ILE B CG1 1 
ATOM   4256 C CG2 . ILE B 1 229 ? 24.283 14.766 21.614  1.00 20.21  ? 298 ILE B CG2 1 
ATOM   4257 C CD1 . ILE B 1 229 ? 21.839 13.116 20.454  1.00 15.48  ? 298 ILE B CD1 1 
ATOM   4258 N N   . SER B 1 230 ? 24.382 17.487 23.274  1.00 26.46  ? 299 SER B N   1 
ATOM   4259 C CA  . SER B 1 230 ? 25.558 18.310 23.504  1.00 25.50  ? 299 SER B CA  1 
ATOM   4260 C C   . SER B 1 230 ? 26.635 17.500 24.204  1.00 29.93  ? 299 SER B C   1 
ATOM   4261 O O   . SER B 1 230 ? 26.347 16.576 24.968  1.00 40.68  ? 299 SER B O   1 
ATOM   4262 C CB  . SER B 1 230 ? 25.226 19.569 24.327  1.00 29.40  ? 299 SER B CB  1 
ATOM   4263 O OG  . SER B 1 230 ? 25.101 19.285 25.709  1.00 38.04  ? 299 SER B OG  1 
ATOM   4264 N N   . GLY B 1 231 ? 27.886 17.854 23.910  1.00 29.91  ? 300 GLY B N   1 
ATOM   4265 C CA  . GLY B 1 231 ? 29.041 17.290 24.574  1.00 22.71  ? 300 GLY B CA  1 
ATOM   4266 C C   . GLY B 1 231 ? 30.057 18.383 24.840  1.00 27.98  ? 300 GLY B C   1 
ATOM   4267 O O   . GLY B 1 231 ? 29.839 19.548 24.499  1.00 19.88  ? 300 GLY B O   1 
ATOM   4268 N N   . SER B 1 232 ? 31.161 17.993 25.475  1.00 28.40  ? 301 SER B N   1 
ATOM   4269 C CA  . SER B 1 232 ? 32.263 18.919 25.689  1.00 22.86  ? 301 SER B CA  1 
ATOM   4270 C C   . SER B 1 232 ? 32.815 19.410 24.353  1.00 27.36  ? 301 SER B C   1 
ATOM   4271 O O   . SER B 1 232 ? 32.695 18.749 23.315  1.00 20.87  ? 301 SER B O   1 
ATOM   4272 C CB  . SER B 1 232 ? 33.376 18.252 26.486  1.00 13.93  ? 301 SER B CB  1 
ATOM   4273 O OG  . SER B 1 232 ? 34.125 17.399 25.642  1.00 26.25  ? 301 SER B OG  1 
ATOM   4274 N N   . THR B 1 233 ? 33.425 20.599 24.389  1.00 22.50  ? 302 THR B N   1 
ATOM   4275 C CA  . THR B 1 233 ? 34.058 21.139 23.193  1.00 19.24  ? 302 THR B CA  1 
ATOM   4276 C C   . THR B 1 233 ? 35.124 20.192 22.655  1.00 24.53  ? 302 THR B C   1 
ATOM   4277 O O   . THR B 1 233 ? 35.300 20.075 21.437  1.00 24.14  ? 302 THR B O   1 
ATOM   4278 C CB  . THR B 1 233 ? 34.646 22.517 23.496  1.00 13.58  ? 302 THR B CB  1 
ATOM   4279 O OG1 . THR B 1 233 ? 33.588 23.415 23.846  1.00 30.00  ? 302 THR B OG1 1 
ATOM   4280 C CG2 . THR B 1 233 ? 35.384 23.072 22.289  1.00 13.65  ? 302 THR B CG2 1 
ATOM   4281 N N   . SER B 1 234 ? 35.813 19.475 23.542  1.00 31.76  ? 303 SER B N   1 
ATOM   4282 C CA  . SER B 1 234 ? 36.795 18.497 23.090  1.00 34.63  ? 303 SER B CA  1 
ATOM   4283 C C   . SER B 1 234 ? 36.125 17.355 22.332  1.00 32.38  ? 303 SER B C   1 
ATOM   4284 O O   . SER B 1 234 ? 36.526 17.023 21.211  1.00 22.41  ? 303 SER B O   1 
ATOM   4285 C CB  . SER B 1 234 ? 37.588 17.973 24.285  1.00 32.56  ? 303 SER B CB  1 
ATOM   4286 O OG  . SER B 1 234 ? 38.243 16.766 23.963  1.00 43.71  ? 303 SER B OG  1 
ATOM   4287 N N   . SER B 1 235 ? 35.085 16.756 22.919  1.00 28.95  ? 304 SER B N   1 
ATOM   4288 C CA  . SER B 1 235 ? 34.435 15.614 22.279  1.00 26.88  ? 304 SER B CA  1 
ATOM   4289 C C   . SER B 1 235 ? 33.776 16.003 20.957  1.00 26.35  ? 304 SER B C   1 
ATOM   4290 O O   . SER B 1 235 ? 33.889 15.276 19.964  1.00 27.14  ? 304 SER B O   1 
ATOM   4291 C CB  . SER B 1 235 ? 33.409 14.995 23.227  1.00 29.63  ? 304 SER B CB  1 
ATOM   4292 O OG  . SER B 1 235 ? 34.056 14.241 24.238  1.00 48.71  ? 304 SER B OG  1 
ATOM   4293 N N   . ILE B 1 236 ? 33.087 17.147 20.921  1.00 24.87  ? 305 ILE B N   1 
ATOM   4294 C CA  . ILE B 1 236 ? 32.387 17.546 19.704  1.00 26.82  ? 305 ILE B CA  1 
ATOM   4295 C C   . ILE B 1 236 ? 33.384 17.873 18.596  1.00 30.33  ? 305 ILE B C   1 
ATOM   4296 O O   . ILE B 1 236 ? 33.129 17.602 17.417  1.00 23.64  ? 305 ILE B O   1 
ATOM   4297 C CB  . ILE B 1 236 ? 31.439 18.725 19.990  1.00 19.36  ? 305 ILE B CB  1 
ATOM   4298 C CG1 . ILE B 1 236 ? 30.341 18.311 20.972  1.00 18.18  ? 305 ILE B CG1 1 
ATOM   4299 C CG2 . ILE B 1 236 ? 30.790 19.212 18.707  1.00 20.43  ? 305 ILE B CG2 1 
ATOM   4300 C CD1 . ILE B 1 236 ? 29.774 16.948 20.687  1.00 15.18  ? 305 ILE B CD1 1 
ATOM   4301 N N   . GLU B 1 237 ? 34.534 18.449 18.955  1.00 31.44  ? 306 GLU B N   1 
ATOM   4302 C CA  . GLU B 1 237 ? 35.589 18.685 17.972  1.00 36.43  ? 306 GLU B CA  1 
ATOM   4303 C C   . GLU B 1 237 ? 35.973 17.392 17.258  1.00 33.60  ? 306 GLU B C   1 
ATOM   4304 O O   . GLU B 1 237 ? 36.072 17.349 16.026  1.00 39.48  ? 306 GLU B O   1 
ATOM   4305 C CB  . GLU B 1 237 ? 36.813 19.295 18.655  1.00 45.23  ? 306 GLU B CB  1 
ATOM   4306 C CG  . GLU B 1 237 ? 36.959 20.805 18.511  1.00 55.89  ? 306 GLU B CG  1 
ATOM   4307 C CD  . GLU B 1 237 ? 38.138 21.345 19.315  1.00 68.40  ? 306 GLU B CD  1 
ATOM   4308 O OE1 . GLU B 1 237 ? 37.977 22.377 20.000  1.00 70.83  ? 306 GLU B OE1 1 
ATOM   4309 O OE2 . GLU B 1 237 ? 39.226 20.730 19.272  1.00 71.41  ? 306 GLU B OE2 1 
ATOM   4310 N N   . LYS B 1 238 ? 36.182 16.322 18.023  1.00 18.07  ? 307 LYS B N   1 
ATOM   4311 C CA  . LYS B 1 238 ? 36.599 15.060 17.430  1.00 28.63  ? 307 LYS B CA  1 
ATOM   4312 C C   . LYS B 1 238 ? 35.462 14.414 16.647  1.00 37.63  ? 307 LYS B C   1 
ATOM   4313 O O   . LYS B 1 238 ? 35.685 13.843 15.572  1.00 38.50  ? 307 LYS B O   1 
ATOM   4314 C CB  . LYS B 1 238 ? 37.110 14.123 18.523  1.00 21.18  ? 307 LYS B CB  1 
ATOM   4315 C CG  . LYS B 1 238 ? 37.774 12.866 17.998  1.00 36.63  ? 307 LYS B CG  1 
ATOM   4316 C CD  . LYS B 1 238 ? 38.998 12.510 18.822  1.00 56.03  ? 307 LYS B CD  1 
ATOM   4317 C CE  . LYS B 1 238 ? 39.476 11.101 18.517  1.00 62.09  ? 307 LYS B CE  1 
ATOM   4318 N NZ  . LYS B 1 238 ? 38.856 10.103 19.425  1.00 61.36  ? 307 LYS B NZ  1 
ATOM   4319 N N   . LEU B 1 239 ? 34.236 14.501 17.164  1.00 30.96  ? 308 LEU B N   1 
ATOM   4320 C CA  . LEU B 1 239 ? 33.111 13.877 16.481  1.00 26.17  ? 308 LEU B CA  1 
ATOM   4321 C C   . LEU B 1 239 ? 32.798 14.584 15.165  1.00 33.90  ? 308 LEU B C   1 
ATOM   4322 O O   . LEU B 1 239 ? 32.568 13.926 14.143  1.00 14.29  ? 308 LEU B O   1 
ATOM   4323 C CB  . LEU B 1 239 ? 31.882 13.859 17.397  1.00 26.77  ? 308 LEU B CB  1 
ATOM   4324 C CG  . LEU B 1 239 ? 30.540 13.539 16.728  1.00 30.71  ? 308 LEU B CG  1 
ATOM   4325 C CD1 . LEU B 1 239 ? 30.415 12.057 16.429  1.00 27.63  ? 308 LEU B CD1 1 
ATOM   4326 C CD2 . LEU B 1 239 ? 29.367 14.008 17.584  1.00 25.75  ? 308 LEU B CD2 1 
ATOM   4327 N N   . MET B 1 240 ? 32.797 15.920 15.162  1.00 13.76  ? 309 MET B N   1 
ATOM   4328 C CA  . MET B 1 240 ? 32.466 16.643 13.938  1.00 30.47  ? 309 MET B CA  1 
ATOM   4329 C C   . MET B 1 240 ? 33.529 16.429 12.870  1.00 34.37  ? 309 MET B C   1 
ATOM   4330 O O   . MET B 1 240 ? 33.208 16.303 11.682  1.00 37.15  ? 309 MET B O   1 
ATOM   4331 C CB  . MET B 1 240 ? 32.278 18.132 14.233  1.00 26.00  ? 309 MET B CB  1 
ATOM   4332 C CG  . MET B 1 240 ? 31.007 18.433 15.008  1.00 28.53  ? 309 MET B CG  1 
ATOM   4333 S SD  . MET B 1 240 ? 29.523 17.798 14.198  1.00 28.43  ? 309 MET B SD  1 
ATOM   4334 C CE  . MET B 1 240 ? 28.293 18.185 15.441  1.00 23.23  ? 309 MET B CE  1 
ATOM   4335 N N   . GLU B 1 241 ? 34.797 16.383 13.276  1.00 34.88  ? 310 GLU B N   1 
ATOM   4336 C CA  . GLU B 1 241 ? 35.863 16.038 12.344  1.00 34.91  ? 310 GLU B CA  1 
ATOM   4337 C C   . GLU B 1 241 ? 35.614 14.675 11.714  1.00 27.48  ? 310 GLU B C   1 
ATOM   4338 O O   . GLU B 1 241 ? 35.799 14.498 10.505  1.00 40.10  ? 310 GLU B O   1 
ATOM   4339 C CB  . GLU B 1 241 ? 37.209 16.070 13.070  1.00 42.90  ? 310 GLU B CB  1 
ATOM   4340 C CG  . GLU B 1 241 ? 38.380 15.515 12.292  1.00 44.74  ? 310 GLU B CG  1 
ATOM   4341 C CD  . GLU B 1 241 ? 39.711 15.886 12.920  1.00 55.96  ? 310 GLU B CD  1 
ATOM   4342 O OE1 . GLU B 1 241 ? 39.706 16.400 14.061  1.00 59.50  ? 310 GLU B OE1 1 
ATOM   4343 O OE2 . GLU B 1 241 ? 40.759 15.677 12.270  1.00 59.79  ? 310 GLU B OE2 1 
ATOM   4344 N N   . ALA B 1 242 ? 35.169 13.705 12.514  1.00 23.52  ? 311 ALA B N   1 
ATOM   4345 C CA  . ALA B 1 242 ? 34.839 12.393 11.968  1.00 28.94  ? 311 ALA B CA  1 
ATOM   4346 C C   . ALA B 1 242 ? 33.657 12.454 11.004  1.00 35.64  ? 311 ALA B C   1 
ATOM   4347 O O   . ALA B 1 242 ? 33.626 11.703 10.024  1.00 37.11  ? 311 ALA B O   1 
ATOM   4348 C CB  . ALA B 1 242 ? 34.550 11.410 13.102  1.00 19.58  ? 311 ALA B CB  1 
ATOM   4349 N N   . LEU B 1 243 ? 32.683 13.332 11.254  1.00 32.75  ? 312 LEU B N   1 
ATOM   4350 C CA  . LEU B 1 243 ? 31.516 13.441 10.385  1.00 25.62  ? 312 LEU B CA  1 
ATOM   4351 C C   . LEU B 1 243 ? 31.779 14.221 9.105   1.00 31.71  ? 312 LEU B C   1 
ATOM   4352 O O   . LEU B 1 243 ? 30.959 14.157 8.186   1.00 31.91  ? 312 LEU B O   1 
ATOM   4353 C CB  . LEU B 1 243 ? 30.362 14.119 11.124  1.00 14.60  ? 312 LEU B CB  1 
ATOM   4354 C CG  . LEU B 1 243 ? 29.832 13.455 12.388  1.00 18.43  ? 312 LEU B CG  1 
ATOM   4355 C CD1 . LEU B 1 243 ? 28.581 14.149 12.872  1.00 21.88  ? 312 LEU B CD1 1 
ATOM   4356 C CD2 . LEU B 1 243 ? 29.549 12.008 12.111  1.00 18.70  ? 312 LEU B CD2 1 
ATOM   4357 N N   . GLY B 1 244 ? 32.876 14.965 9.020   1.00 28.93  ? 313 GLY B N   1 
ATOM   4358 C CA  . GLY B 1 244 ? 33.053 15.868 7.902   1.00 22.24  ? 313 GLY B CA  1 
ATOM   4359 C C   . GLY B 1 244 ? 32.229 17.132 7.985   1.00 34.35  ? 313 GLY B C   1 
ATOM   4360 O O   . GLY B 1 244 ? 32.095 17.836 6.978   1.00 39.70  ? 313 GLY B O   1 
ATOM   4361 N N   . ALA B 1 245 ? 31.676 17.447 9.157   1.00 24.97  ? 314 ALA B N   1 
ATOM   4362 C CA  . ALA B 1 245 ? 30.889 18.655 9.333   1.00 21.72  ? 314 ALA B CA  1 
ATOM   4363 C C   . ALA B 1 245 ? 31.788 19.850 9.608   1.00 28.52  ? 314 ALA B C   1 
ATOM   4364 O O   . ALA B 1 245 ? 32.851 19.730 10.222  1.00 25.76  ? 314 ALA B O   1 
ATOM   4365 C CB  . ALA B 1 245 ? 29.894 18.496 10.478  1.00 27.94  ? 314 ALA B CB  1 
ATOM   4366 N N   . LYS B 1 246 ? 31.346 21.013 9.150   1.00 28.72  ? 315 LYS B N   1 
ATOM   4367 C CA  . LYS B 1 246 ? 32.104 22.245 9.275   1.00 28.96  ? 315 LYS B CA  1 
ATOM   4368 C C   . LYS B 1 246 ? 31.386 23.197 10.221  1.00 27.59  ? 315 LYS B C   1 
ATOM   4369 O O   . LYS B 1 246 ? 30.158 23.160 10.351  1.00 29.62  ? 315 LYS B O   1 
ATOM   4370 C CB  . LYS B 1 246 ? 32.306 22.895 7.906   1.00 25.14  ? 315 LYS B CB  1 
ATOM   4371 C CG  . LYS B 1 246 ? 33.276 22.138 7.017   1.00 28.30  ? 315 LYS B CG  1 
ATOM   4372 C CD  . LYS B 1 246 ? 34.713 22.533 7.314   1.00 51.47  ? 315 LYS B CD  1 
ATOM   4373 C CE  . LYS B 1 246 ? 35.638 22.157 6.170   1.00 58.64  ? 315 LYS B CE  1 
ATOM   4374 N NZ  . LYS B 1 246 ? 35.579 20.693 5.915   1.00 60.74  ? 315 LYS B NZ  1 
ATOM   4375 N N   . LYS B 1 247 ? 32.156 24.051 10.887  1.00 25.51  ? 316 LYS B N   1 
ATOM   4376 C CA  . LYS B 1 247 ? 31.617 24.903 11.938  1.00 29.14  ? 316 LYS B CA  1 
ATOM   4377 C C   . LYS B 1 247 ? 31.288 26.286 11.395  1.00 38.84  ? 316 LYS B C   1 
ATOM   4378 O O   . LYS B 1 247 ? 32.157 26.968 10.841  1.00 42.54  ? 316 LYS B O   1 
ATOM   4379 C CB  . LYS B 1 247 ? 32.589 25.019 13.110  1.00 22.18  ? 316 LYS B CB  1 
ATOM   4380 C CG  . LYS B 1 247 ? 31.928 25.566 14.357  1.00 30.34  ? 316 LYS B CG  1 
ATOM   4381 C CD  . LYS B 1 247 ? 32.915 25.760 15.491  1.00 39.37  ? 316 LYS B CD  1 
ATOM   4382 C CE  . LYS B 1 247 ? 32.263 26.486 16.658  1.00 46.64  ? 316 LYS B CE  1 
ATOM   4383 N NZ  . LYS B 1 247 ? 31.148 25.705 17.256  1.00 60.77  ? 316 LYS B NZ  1 
ATOM   4384 N N   . ARG B 1 248 ? 30.029 26.692 11.561  1.00 41.76  ? 317 ARG B N   1 
ATOM   4385 C CA  . ARG B 1 248 ? 29.601 28.068 11.346  1.00 36.62  ? 317 ARG B CA  1 
ATOM   4386 C C   . ARG B 1 248 ? 29.902 28.860 12.603  1.00 41.34  ? 317 ARG B C   1 
ATOM   4387 O O   . ARG B 1 248 ? 30.708 28.422 13.428  1.00 66.76  ? 317 ARG B O   1 
ATOM   4388 C CB  . ARG B 1 248 ? 28.111 28.144 11.027  1.00 38.80  ? 317 ARG B CB  1 
ATOM   4389 C CG  . ARG B 1 248 ? 27.728 27.776 9.607   1.00 29.50  ? 317 ARG B CG  1 
ATOM   4390 C CD  . ARG B 1 248 ? 26.226 27.623 9.543   1.00 39.66  ? 317 ARG B CD  1 
ATOM   4391 N NE  . ARG B 1 248 ? 25.692 27.873 8.215   1.00 55.37  ? 317 ARG B NE  1 
ATOM   4392 C CZ  . ARG B 1 248 ? 24.399 28.021 7.958   1.00 63.41  ? 317 ARG B CZ  1 
ATOM   4393 N NH1 . ARG B 1 248 ? 23.986 28.247 6.716   1.00 68.22  ? 317 ARG B NH1 1 
ATOM   4394 N NH2 . ARG B 1 248 ? 23.521 27.948 8.949   1.00 63.55  ? 317 ARG B NH2 1 
ATOM   4395 N N   . LEU B 1 249 ? 29.288 30.032 12.756  1.00 41.83  ? 318 LEU B N   1 
ATOM   4396 C CA  . LEU B 1 249 ? 29.465 30.780 13.997  1.00 49.71  ? 318 LEU B CA  1 
ATOM   4397 C C   . LEU B 1 249 ? 29.128 29.921 15.209  1.00 55.95  ? 318 LEU B C   1 
ATOM   4398 O O   . LEU B 1 249 ? 29.938 29.788 16.132  1.00 66.69  ? 318 LEU B O   1 
ATOM   4399 C CB  . LEU B 1 249 ? 28.610 32.049 13.996  1.00 50.70  ? 318 LEU B CB  1 
ATOM   4400 C CG  . LEU B 1 249 ? 28.597 32.745 15.365  1.00 44.62  ? 318 LEU B CG  1 
ATOM   4401 C CD1 . LEU B 1 249 ? 30.007 33.084 15.816  1.00 28.04  ? 318 LEU B CD1 1 
ATOM   4402 C CD2 . LEU B 1 249 ? 27.724 33.986 15.366  1.00 48.02  ? 318 LEU B CD2 1 
ATOM   4403 N N   . PHE B 1 250 ? 27.936 29.320 15.225  1.00 61.34  ? 319 PHE B N   1 
ATOM   4404 C CA  . PHE B 1 250 ? 27.515 28.575 16.400  1.00 71.12  ? 319 PHE B CA  1 
ATOM   4405 C C   . PHE B 1 250 ? 27.166 27.109 16.156  1.00 67.72  ? 319 PHE B C   1 
ATOM   4406 O O   . PHE B 1 250 ? 27.345 26.301 17.075  1.00 69.92  ? 319 PHE B O   1 
ATOM   4407 C CB  . PHE B 1 250 ? 26.330 29.278 17.093  1.00 73.68  ? 319 PHE B CB  1 
ATOM   4408 C CG  . PHE B 1 250 ? 25.258 29.800 16.157  1.00 72.82  ? 319 PHE B CG  1 
ATOM   4409 C CD1 . PHE B 1 250 ? 24.891 31.144 16.185  1.00 73.46  ? 319 PHE B CD1 1 
ATOM   4410 C CD2 . PHE B 1 250 ? 24.581 28.956 15.300  1.00 63.62  ? 319 PHE B CD2 1 
ATOM   4411 C CE1 . PHE B 1 250 ? 23.890 31.638 15.352  1.00 56.70  ? 319 PHE B CE1 1 
ATOM   4412 C CE2 . PHE B 1 250 ? 23.581 29.449 14.464  1.00 60.74  ? 319 PHE B CE2 1 
ATOM   4413 C CZ  . PHE B 1 250 ? 23.235 30.786 14.495  1.00 54.83  ? 319 PHE B CZ  1 
ATOM   4414 N N   . ASP B 1 251 ? 26.720 26.727 14.963  1.00 54.93  ? 320 ASP B N   1 
ATOM   4415 C CA  . ASP B 1 251 ? 26.369 25.337 14.704  1.00 31.29  ? 320 ASP B CA  1 
ATOM   4416 C C   . ASP B 1 251 ? 27.367 24.684 13.754  1.00 33.97  ? 320 ASP B C   1 
ATOM   4417 O O   . ASP B 1 251 ? 28.267 25.323 13.200  1.00 42.82  ? 320 ASP B O   1 
ATOM   4418 C CB  . ASP B 1 251 ? 24.951 25.212 14.134  1.00 25.54  ? 320 ASP B CB  1 
ATOM   4419 C CG  . ASP B 1 251 ? 24.741 26.037 12.880  1.00 46.09  ? 320 ASP B CG  1 
ATOM   4420 O OD1 . ASP B 1 251 ? 25.597 26.899 12.587  1.00 55.41  ? 320 ASP B OD1 1 
ATOM   4421 O OD2 . ASP B 1 251 ? 23.715 25.830 12.191  1.00 43.68  ? 320 ASP B OD2 1 
ATOM   4422 N N   . TYR B 1 252 ? 27.197 23.375 13.599  1.00 25.17  ? 321 TYR B N   1 
ATOM   4423 C CA  . TYR B 1 252 ? 27.927 22.572 12.633  1.00 25.08  ? 321 TYR B CA  1 
ATOM   4424 C C   . TYR B 1 252 ? 26.984 22.172 11.511  1.00 21.06  ? 321 TYR B C   1 
ATOM   4425 O O   . TYR B 1 252 ? 25.820 21.843 11.759  1.00 17.78  ? 321 TYR B O   1 
ATOM   4426 C CB  . TYR B 1 252 ? 28.502 21.316 13.281  1.00 27.89  ? 321 TYR B CB  1 
ATOM   4427 C CG  . TYR B 1 252 ? 29.693 21.549 14.168  1.00 32.85  ? 321 TYR B CG  1 
ATOM   4428 C CD1 . TYR B 1 252 ? 29.547 21.726 15.540  1.00 25.05  ? 321 TYR B CD1 1 
ATOM   4429 C CD2 . TYR B 1 252 ? 30.970 21.579 13.637  1.00 43.16  ? 321 TYR B CD2 1 
ATOM   4430 C CE1 . TYR B 1 252 ? 30.650 21.926 16.352  1.00 22.46  ? 321 TYR B CE1 1 
ATOM   4431 C CE2 . TYR B 1 252 ? 32.070 21.775 14.439  1.00 37.02  ? 321 TYR B CE2 1 
ATOM   4432 C CZ  . TYR B 1 252 ? 31.906 21.946 15.788  1.00 24.31  ? 321 TYR B CZ  1 
ATOM   4433 O OH  . TYR B 1 252 ? 33.016 22.143 16.564  1.00 35.64  ? 321 TYR B OH  1 
ATOM   4434 N N   . VAL B 1 253 ? 27.494 22.187 10.278  1.00 23.47  ? 322 VAL B N   1 
ATOM   4435 C CA  . VAL B 1 253 ? 26.696 21.881 9.099   1.00 21.48  ? 322 VAL B CA  1 
ATOM   4436 C C   . VAL B 1 253 ? 27.444 20.909 8.199   1.00 26.99  ? 322 VAL B C   1 
ATOM   4437 O O   . VAL B 1 253 ? 28.670 20.781 8.249   1.00 27.22  ? 322 VAL B O   1 
ATOM   4438 C CB  . VAL B 1 253 ? 26.323 23.142 8.289   1.00 29.22  ? 322 VAL B CB  1 
ATOM   4439 C CG1 . VAL B 1 253 ? 25.489 24.101 9.126   1.00 34.15  ? 322 VAL B CG1 1 
ATOM   4440 C CG2 . VAL B 1 253 ? 27.580 23.818 7.741   1.00 23.76  ? 322 VAL B CG2 1 
ATOM   4441 N N   . VAL B 1 254 ? 26.669 20.214 7.370   1.00 28.10  ? 323 VAL B N   1 
ATOM   4442 C CA  . VAL B 1 254 ? 27.174 19.464 6.231   1.00 25.59  ? 323 VAL B CA  1 
ATOM   4443 C C   . VAL B 1 254 ? 26.394 19.920 5.008   1.00 35.53  ? 323 VAL B C   1 
ATOM   4444 O O   . VAL B 1 254 ? 25.308 20.494 5.114   1.00 40.43  ? 323 VAL B O   1 
ATOM   4445 C CB  . VAL B 1 254 ? 27.025 17.946 6.419   1.00 21.77  ? 323 VAL B CB  1 
ATOM   4446 C CG1 . VAL B 1 254 ? 27.656 17.519 7.730   1.00 35.99  ? 323 VAL B CG1 1 
ATOM   4447 C CG2 . VAL B 1 254 ? 25.548 17.564 6.387   1.00 18.95  ? 323 VAL B CG2 1 
ATOM   4448 N N   . LYS B 1 255 ? 26.962 19.663 3.834   1.00 37.47  ? 324 LYS B N   1 
ATOM   4449 C CA  . LYS B 1 255 ? 26.204 19.855 2.608   1.00 37.20  ? 324 LYS B CA  1 
ATOM   4450 C C   . LYS B 1 255 ? 24.974 18.956 2.630   1.00 30.24  ? 324 LYS B C   1 
ATOM   4451 O O   . LYS B 1 255 ? 25.061 17.769 2.961   1.00 20.31  ? 324 LYS B O   1 
ATOM   4452 C CB  . LYS B 1 255 ? 27.077 19.555 1.392   1.00 47.37  ? 324 LYS B CB  1 
ATOM   4453 C CG  . LYS B 1 255 ? 28.274 20.483 1.253   1.00 51.79  ? 324 LYS B CG  1 
ATOM   4454 C CD  . LYS B 1 255 ? 29.444 19.773 0.594   1.00 60.20  ? 324 LYS B CD  1 
ATOM   4455 C CE  . LYS B 1 255 ? 30.399 20.759 -0.070  1.00 65.95  ? 324 LYS B CE  1 
ATOM   4456 N NZ  . LYS B 1 255 ? 31.571 20.074 -0.692  1.00 63.52  ? 324 LYS B NZ  1 
ATOM   4457 N N   . CYS B 1 256 ? 23.819 19.532 2.296   1.00 28.73  ? 325 CYS B N   1 
ATOM   4458 C CA  . CYS B 1 256 ? 22.559 18.815 2.474   1.00 21.56  ? 325 CYS B CA  1 
ATOM   4459 C C   . CYS B 1 256 ? 22.547 17.493 1.715   1.00 33.11  ? 325 CYS B C   1 
ATOM   4460 O O   . CYS B 1 256 ? 22.013 16.493 2.208   1.00 39.31  ? 325 CYS B O   1 
ATOM   4461 C CB  . CYS B 1 256 ? 21.398 19.702 2.044   1.00 19.89  ? 325 CYS B CB  1 
ATOM   4462 S SG  . CYS B 1 256 ? 21.144 21.075 3.164   1.00 41.96  ? 325 CYS B SG  1 
ATOM   4463 N N   . ASN B 1 257 ? 23.147 17.460 0.523   1.00 36.59  ? 326 ASN B N   1 
ATOM   4464 C CA  . ASN B 1 257 ? 23.178 16.231 -0.263  1.00 36.64  ? 326 ASN B CA  1 
ATOM   4465 C C   . ASN B 1 257 ? 24.016 15.137 0.388   1.00 36.89  ? 326 ASN B C   1 
ATOM   4466 O O   . ASN B 1 257 ? 23.802 13.956 0.092   1.00 42.96  ? 326 ASN B O   1 
ATOM   4467 C CB  . ASN B 1 257 ? 23.720 16.519 -1.660  1.00 32.92  ? 326 ASN B CB  1 
ATOM   4468 C CG  . ASN B 1 257 ? 25.183 16.884 -1.640  1.00 31.31  ? 326 ASN B CG  1 
ATOM   4469 O OD1 . ASN B 1 257 ? 25.600 17.785 -0.913  1.00 33.56  ? 326 ASN B OD1 1 
ATOM   4470 N ND2 . ASN B 1 257 ? 25.976 16.169 -2.417  1.00 26.72  ? 326 ASN B ND2 1 
ATOM   4471 N N   . GLU B 1 258 ? 24.960 15.497 1.257   1.00 31.42  ? 327 GLU B N   1 
ATOM   4472 C CA  . GLU B 1 258 ? 25.832 14.526 1.907   1.00 37.63  ? 327 GLU B CA  1 
ATOM   4473 C C   . GLU B 1 258 ? 25.255 13.975 3.203   1.00 41.95  ? 327 GLU B C   1 
ATOM   4474 O O   . GLU B 1 258 ? 25.759 12.962 3.703   1.00 36.19  ? 327 GLU B O   1 
ATOM   4475 C CB  . GLU B 1 258 ? 27.200 15.154 2.196   1.00 37.79  ? 327 GLU B CB  1 
ATOM   4476 C CG  . GLU B 1 258 ? 28.002 15.502 0.958   1.00 57.37  ? 327 GLU B CG  1 
ATOM   4477 C CD  . GLU B 1 258 ? 29.272 16.256 1.288   1.00 74.20  ? 327 GLU B CD  1 
ATOM   4478 O OE1 . GLU B 1 258 ? 29.372 16.776 2.420   1.00 78.80  ? 327 GLU B OE1 1 
ATOM   4479 O OE2 . GLU B 1 258 ? 30.169 16.329 0.420   1.00 80.74  ? 327 GLU B OE2 1 
ATOM   4480 N N   . GLY B 1 259 ? 24.225 14.618 3.752   1.00 41.97  ? 328 GLY B N   1 
ATOM   4481 C CA  . GLY B 1 259 ? 23.578 14.188 4.972   1.00 29.60  ? 328 GLY B CA  1 
ATOM   4482 C C   . GLY B 1 259 ? 23.260 12.705 5.046   1.00 35.26  ? 328 GLY B C   1 
ATOM   4483 O O   . GLY B 1 259 ? 23.606 12.032 6.022   1.00 44.09  ? 328 GLY B O   1 
ATOM   4484 N N   . PRO B 1 260 ? 22.595 12.157 4.021   1.00 23.05  ? 329 PRO B N   1 
ATOM   4485 C CA  . PRO B 1 260 ? 22.189 10.744 4.092   1.00 16.93  ? 329 PRO B CA  1 
ATOM   4486 C C   . PRO B 1 260 ? 23.339 9.748  4.063   1.00 33.25  ? 329 PRO B C   1 
ATOM   4487 O O   . PRO B 1 260 ? 23.130 8.592  4.450   1.00 30.68  ? 329 PRO B O   1 
ATOM   4488 C CB  . PRO B 1 260 ? 21.286 10.578 2.862   1.00 20.63  ? 329 PRO B CB  1 
ATOM   4489 C CG  . PRO B 1 260 ? 20.796 11.946 2.578   1.00 27.51  ? 329 PRO B CG  1 
ATOM   4490 C CD  . PRO B 1 260 ? 21.964 12.834 2.875   1.00 26.85  ? 329 PRO B CD  1 
ATOM   4491 N N   . THR B 1 261 ? 24.529 10.133 3.601   1.00 40.79  ? 330 THR B N   1 
ATOM   4492 C CA  . THR B 1 261 ? 25.672 9.227  3.612   1.00 37.10  ? 330 THR B CA  1 
ATOM   4493 C C   . THR B 1 261 ? 26.463 9.287  4.911   1.00 35.19  ? 330 THR B C   1 
ATOM   4494 O O   . THR B 1 261 ? 27.435 8.540  5.057   1.00 39.68  ? 330 THR B O   1 
ATOM   4495 C CB  . THR B 1 261 ? 26.611 9.527  2.439   1.00 34.68  ? 330 THR B CB  1 
ATOM   4496 O OG1 . THR B 1 261 ? 27.034 10.900 2.491   1.00 30.15  ? 330 THR B OG1 1 
ATOM   4497 C CG2 . THR B 1 261 ? 25.916 9.254  1.128   1.00 27.63  ? 330 THR B CG2 1 
ATOM   4498 N N   . LEU B 1 262 ? 26.080 10.155 5.845   1.00 28.54  ? 331 LEU B N   1 
ATOM   4499 C CA  . LEU B 1 262 ? 26.804 10.271 7.098   1.00 27.01  ? 331 LEU B CA  1 
ATOM   4500 C C   . LEU B 1 262 ? 26.660 8.984  7.910   1.00 24.77  ? 331 LEU B C   1 
ATOM   4501 O O   . LEU B 1 262 ? 25.667 8.265  7.786   1.00 39.12  ? 331 LEU B O   1 
ATOM   4502 C CB  . LEU B 1 262 ? 26.291 11.455 7.912   1.00 31.44  ? 331 LEU B CB  1 
ATOM   4503 C CG  . LEU B 1 262 ? 26.586 12.860 7.398   1.00 26.32  ? 331 LEU B CG  1 
ATOM   4504 C CD1 . LEU B 1 262 ? 25.883 13.894 8.249   1.00 22.60  ? 331 LEU B CD1 1 
ATOM   4505 C CD2 . LEU B 1 262 ? 28.072 13.114 7.396   1.00 28.43  ? 331 LEU B CD2 1 
ATOM   4506 N N   . PRO B 1 263 ? 27.644 8.664  8.733   1.00 23.78  ? 332 PRO B N   1 
ATOM   4507 C CA  . PRO B 1 263 ? 27.592 7.421  9.504   1.00 16.25  ? 332 PRO B CA  1 
ATOM   4508 C C   . PRO B 1 263 ? 26.714 7.554  10.743  1.00 35.48  ? 332 PRO B C   1 
ATOM   4509 O O   . PRO B 1 263 ? 26.356 8.646  11.189  1.00 26.43  ? 332 PRO B O   1 
ATOM   4510 C CB  . PRO B 1 263 ? 29.057 7.186  9.883   1.00 26.67  ? 332 PRO B CB  1 
ATOM   4511 C CG  . PRO B 1 263 ? 29.651 8.552  9.895   1.00 33.11  ? 332 PRO B CG  1 
ATOM   4512 C CD  . PRO B 1 263 ? 28.960 9.320  8.815   1.00 26.40  ? 332 PRO B CD  1 
ATOM   4513 N N   . ASP B 1 264 ? 26.370 6.394  11.294  1.00 26.50  ? 333 ASP B N   1 
ATOM   4514 C CA  . ASP B 1 264 ? 25.577 6.339  12.509  1.00 22.15  ? 333 ASP B CA  1 
ATOM   4515 C C   . ASP B 1 264 ? 26.392 6.820  13.703  1.00 17.61  ? 333 ASP B C   1 
ATOM   4516 O O   . ASP B 1 264 ? 27.614 6.661  13.754  1.00 21.76  ? 333 ASP B O   1 
ATOM   4517 C CB  . ASP B 1 264 ? 25.091 4.910  12.758  1.00 32.03  ? 333 ASP B CB  1 
ATOM   4518 C CG  . ASP B 1 264 ? 24.099 4.436  11.715  1.00 43.23  ? 333 ASP B CG  1 
ATOM   4519 O OD1 . ASP B 1 264 ? 23.627 5.273  10.916  1.00 48.93  ? 333 ASP B OD1 1 
ATOM   4520 O OD2 . ASP B 1 264 ? 23.786 3.226  11.702  1.00 49.30  ? 333 ASP B OD2 1 
ATOM   4521 N N   . ILE B 1 265 ? 25.701 7.416  14.670  1.00 16.34  ? 334 ILE B N   1 
ATOM   4522 C CA  . ILE B 1 265 ? 26.282 7.779  15.958  1.00 27.89  ? 334 ILE B CA  1 
ATOM   4523 C C   . ILE B 1 265 ? 25.597 6.945  17.036  1.00 27.20  ? 334 ILE B C   1 
ATOM   4524 O O   . ILE B 1 265 ? 24.366 6.827  17.048  1.00 23.97  ? 334 ILE B O   1 
ATOM   4525 C CB  . ILE B 1 265 ? 26.139 9.284  16.240  1.00 31.35  ? 334 ILE B CB  1 
ATOM   4526 C CG1 . ILE B 1 265 ? 26.729 10.083 15.082  1.00 31.62  ? 334 ILE B CG1 1 
ATOM   4527 C CG2 . ILE B 1 265 ? 26.831 9.655  17.548  1.00 28.58  ? 334 ILE B CG2 1 
ATOM   4528 C CD1 . ILE B 1 265 ? 26.612 11.571 15.265  1.00 39.32  ? 334 ILE B CD1 1 
ATOM   4529 N N   . SER B 1 266 ? 26.391 6.347  17.921  1.00 27.56  ? 335 SER B N   1 
ATOM   4530 C CA  . SER B 1 266 ? 25.870 5.421  18.917  1.00 27.45  ? 335 SER B CA  1 
ATOM   4531 C C   . SER B 1 266 ? 26.371 5.776  20.304  1.00 24.04  ? 335 SER B C   1 
ATOM   4532 O O   . SER B 1 266 ? 27.555 6.067  20.497  1.00 23.90  ? 335 SER B O   1 
ATOM   4533 C CB  . SER B 1 266 ? 26.251 3.981  18.599  1.00 26.39  ? 335 SER B CB  1 
ATOM   4534 O OG  . SER B 1 266 ? 25.487 3.509  17.510  1.00 39.26  ? 335 SER B OG  1 
ATOM   4535 N N   . PHE B 1 267 ? 25.461 5.736  21.267  1.00 32.72  ? 336 PHE B N   1 
ATOM   4536 C CA  . PHE B 1 267 ? 25.777 5.963  22.667  1.00 17.61  ? 336 PHE B CA  1 
ATOM   4537 C C   . PHE B 1 267 ? 25.590 4.652  23.408  1.00 31.23  ? 336 PHE B C   1 
ATOM   4538 O O   . PHE B 1 267 ? 24.528 4.026  23.308  1.00 31.62  ? 336 PHE B O   1 
ATOM   4539 C CB  . PHE B 1 267 ? 24.887 7.056  23.253  1.00 14.35  ? 336 PHE B CB  1 
ATOM   4540 C CG  . PHE B 1 267 ? 24.924 8.336  22.479  1.00 20.52  ? 336 PHE B CG  1 
ATOM   4541 C CD1 . PHE B 1 267 ? 24.165 8.489  21.324  1.00 21.26  ? 336 PHE B CD1 1 
ATOM   4542 C CD2 . PHE B 1 267 ? 25.736 9.382  22.889  1.00 23.25  ? 336 PHE B CD2 1 
ATOM   4543 C CE1 . PHE B 1 267 ? 24.206 9.662  20.603  1.00 20.69  ? 336 PHE B CE1 1 
ATOM   4544 C CE2 . PHE B 1 267 ? 25.788 10.557 22.170  1.00 20.54  ? 336 PHE B CE2 1 
ATOM   4545 C CZ  . PHE B 1 267 ? 25.018 10.699 21.028  1.00 27.05  ? 336 PHE B CZ  1 
ATOM   4546 N N   . HIS B 1 268 ? 26.629 4.225  24.121  1.00 43.78  ? 337 HIS B N   1 
ATOM   4547 C CA  . HIS B 1 268 ? 26.602 2.967  24.858  1.00 40.57  ? 337 HIS B CA  1 
ATOM   4548 C C   . HIS B 1 268 ? 26.112 3.250  26.272  1.00 39.82  ? 337 HIS B C   1 
ATOM   4549 O O   . HIS B 1 268 ? 26.856 3.786  27.098  1.00 53.28  ? 337 HIS B O   1 
ATOM   4550 C CB  . HIS B 1 268 ? 27.981 2.315  24.863  1.00 40.79  ? 337 HIS B CB  1 
ATOM   4551 C CG  . HIS B 1 268 ? 27.955 0.860  25.217  1.00 63.93  ? 337 HIS B CG  1 
ATOM   4552 N ND1 . HIS B 1 268 ? 28.145 -0.137 24.285  1.00 69.03  ? 337 HIS B ND1 1 
ATOM   4553 C CD2 . HIS B 1 268 ? 27.760 0.234  26.402  1.00 70.24  ? 337 HIS B CD2 1 
ATOM   4554 C CE1 . HIS B 1 268 ? 28.068 -1.315 24.880  1.00 69.98  ? 337 HIS B CE1 1 
ATOM   4555 N NE2 . HIS B 1 268 ? 27.836 -1.118 26.165  1.00 68.18  ? 337 HIS B NE2 1 
ATOM   4556 N N   . LEU B 1 269 ? 24.860 2.891  26.547  1.00 31.75  ? 338 LEU B N   1 
ATOM   4557 C CA  . LEU B 1 269 ? 24.229 3.145  27.835  1.00 30.81  ? 338 LEU B CA  1 
ATOM   4558 C C   . LEU B 1 269 ? 23.599 1.863  28.354  1.00 34.79  ? 338 LEU B C   1 
ATOM   4559 O O   . LEU B 1 269 ? 22.794 1.238  27.654  1.00 38.45  ? 338 LEU B O   1 
ATOM   4560 C CB  . LEU B 1 269 ? 23.159 4.234  27.722  1.00 28.15  ? 338 LEU B CB  1 
ATOM   4561 C CG  . LEU B 1 269 ? 23.536 5.459  26.900  1.00 25.74  ? 338 LEU B CG  1 
ATOM   4562 C CD1 . LEU B 1 269 ? 22.289 6.096  26.335  1.00 14.58  ? 338 LEU B CD1 1 
ATOM   4563 C CD2 . LEU B 1 269 ? 24.306 6.443  27.762  1.00 23.82  ? 338 LEU B CD2 1 
ATOM   4564 N N   . GLY B 1 270 ? 23.951 1.488  29.582  1.00 28.88  ? 339 GLY B N   1 
ATOM   4565 C CA  . GLY B 1 270 ? 23.371 0.307  30.200  1.00 26.08  ? 339 GLY B CA  1 
ATOM   4566 C C   . GLY B 1 270 ? 23.633 -0.979 29.450  1.00 31.75  ? 339 GLY B C   1 
ATOM   4567 O O   . GLY B 1 270 ? 22.780 -1.875 29.449  1.00 28.50  ? 339 GLY B O   1 
ATOM   4568 N N   . GLY B 1 271 ? 24.794 -1.100 28.806  1.00 29.19  ? 340 GLY B N   1 
ATOM   4569 C CA  . GLY B 1 271 ? 25.137 -2.288 28.060  1.00 30.31  ? 340 GLY B CA  1 
ATOM   4570 C C   . GLY B 1 271 ? 24.654 -2.317 26.624  1.00 41.23  ? 340 GLY B C   1 
ATOM   4571 O O   . GLY B 1 271 ? 25.200 -3.079 25.820  1.00 56.61  ? 340 GLY B O   1 
ATOM   4572 N N   . LYS B 1 272 ? 23.648 -1.524 26.276  1.00 40.22  ? 341 LYS B N   1 
ATOM   4573 C CA  . LYS B 1 272 ? 23.123 -1.487 24.920  1.00 33.21  ? 341 LYS B CA  1 
ATOM   4574 C C   . LYS B 1 272 ? 23.644 -0.263 24.179  1.00 33.06  ? 341 LYS B C   1 
ATOM   4575 O O   . LYS B 1 272 ? 24.077 0.724  24.781  1.00 35.56  ? 341 LYS B O   1 
ATOM   4576 C CB  . LYS B 1 272 ? 21.593 -1.476 24.927  1.00 31.48  ? 341 LYS B CB  1 
ATOM   4577 C CG  . LYS B 1 272 ? 20.960 -2.781 25.360  1.00 36.96  ? 341 LYS B CG  1 
ATOM   4578 C CD  . LYS B 1 272 ? 19.613 -2.964 24.685  1.00 47.96  ? 341 LYS B CD  1 
ATOM   4579 C CE  . LYS B 1 272 ? 18.800 -4.022 25.391  1.00 51.69  ? 341 LYS B CE  1 
ATOM   4580 N NZ  . LYS B 1 272 ? 18.696 -3.705 26.835  1.00 44.36  ? 341 LYS B NZ  1 
ATOM   4581 N N   . GLU B 1 273 ? 23.604 -0.345 22.854  1.00 29.78  ? 342 GLU B N   1 
ATOM   4582 C CA  . GLU B 1 273 ? 24.001 0.754  21.984  1.00 33.69  ? 342 GLU B CA  1 
ATOM   4583 C C   . GLU B 1 273 ? 22.743 1.467  21.505  1.00 30.49  ? 342 GLU B C   1 
ATOM   4584 O O   . GLU B 1 273 ? 21.834 0.831  20.963  1.00 33.19  ? 342 GLU B O   1 
ATOM   4585 C CB  . GLU B 1 273 ? 24.823 0.250  20.796  1.00 36.84  ? 342 GLU B CB  1 
ATOM   4586 C CG  . GLU B 1 273 ? 26.157 -0.384 21.178  1.00 57.54  ? 342 GLU B CG  1 
ATOM   4587 C CD  . GLU B 1 273 ? 27.260 0.641  21.409  1.00 67.23  ? 342 GLU B CD  1 
ATOM   4588 O OE1 . GLU B 1 273 ? 26.947 1.846  21.520  1.00 66.75  ? 342 GLU B OE1 1 
ATOM   4589 O OE2 . GLU B 1 273 ? 28.443 0.239  21.477  1.00 65.08  ? 342 GLU B OE2 1 
ATOM   4590 N N   . TYR B 1 274 ? 22.682 2.772  21.725  1.00 30.63  ? 343 TYR B N   1 
ATOM   4591 C CA  . TYR B 1 274 ? 21.557 3.585  21.286  1.00 35.19  ? 343 TYR B CA  1 
ATOM   4592 C C   . TYR B 1 274 ? 22.017 4.371  20.064  1.00 38.92  ? 343 TYR B C   1 
ATOM   4593 O O   . TYR B 1 274 ? 22.813 5.307  20.180  1.00 47.30  ? 343 TYR B O   1 
ATOM   4594 C CB  . TYR B 1 274 ? 21.070 4.491  22.415  1.00 31.44  ? 343 TYR B CB  1 
ATOM   4595 C CG  . TYR B 1 274 ? 20.298 3.729  23.474  1.00 36.51  ? 343 TYR B CG  1 
ATOM   4596 C CD1 . TYR B 1 274 ? 20.953 2.895  24.377  1.00 25.80  ? 343 TYR B CD1 1 
ATOM   4597 C CD2 . TYR B 1 274 ? 18.912 3.827  23.560  1.00 35.35  ? 343 TYR B CD2 1 
ATOM   4598 C CE1 . TYR B 1 274 ? 20.250 2.185  25.332  1.00 27.37  ? 343 TYR B CE1 1 
ATOM   4599 C CE2 . TYR B 1 274 ? 18.203 3.125  24.516  1.00 28.16  ? 343 TYR B CE2 1 
ATOM   4600 C CZ  . TYR B 1 274 ? 18.874 2.307  25.401  1.00 32.54  ? 343 TYR B CZ  1 
ATOM   4601 O OH  . TYR B 1 274 ? 18.169 1.608  26.359  1.00 35.50  ? 343 TYR B OH  1 
ATOM   4602 N N   . THR B 1 275 ? 21.524 3.973  18.894  1.00 29.25  ? 344 THR B N   1 
ATOM   4603 C CA  . THR B 1 275 ? 22.038 4.449  17.617  1.00 26.82  ? 344 THR B CA  1 
ATOM   4604 C C   . THR B 1 275 ? 21.106 5.493  17.020  1.00 30.84  ? 344 THR B C   1 
ATOM   4605 O O   . THR B 1 275 ? 19.886 5.290  16.958  1.00 27.66  ? 344 THR B O   1 
ATOM   4606 C CB  . THR B 1 275 ? 22.213 3.291  16.632  1.00 24.23  ? 344 THR B CB  1 
ATOM   4607 O OG1 . THR B 1 275 ? 22.959 2.239  17.253  1.00 33.78  ? 344 THR B OG1 1 
ATOM   4608 C CG2 . THR B 1 275 ? 22.954 3.747  15.390  1.00 20.01  ? 344 THR B CG2 1 
ATOM   4609 N N   . LEU B 1 276 ? 21.691 6.604  16.584  1.00 25.87  ? 345 LEU B N   1 
ATOM   4610 C CA  . LEU B 1 276 ? 21.009 7.635  15.821  1.00 20.76  ? 345 LEU B CA  1 
ATOM   4611 C C   . LEU B 1 276 ? 21.563 7.631  14.406  1.00 29.11  ? 345 LEU B C   1 
ATOM   4612 O O   . LEU B 1 276 ? 22.784 7.662  14.217  1.00 33.65  ? 345 LEU B O   1 
ATOM   4613 C CB  . LEU B 1 276 ? 21.212 9.009  16.456  1.00 23.64  ? 345 LEU B CB  1 
ATOM   4614 C CG  . LEU B 1 276 ? 20.553 9.283  17.803  1.00 26.29  ? 345 LEU B CG  1 
ATOM   4615 C CD1 . LEU B 1 276 ? 20.611 10.772 18.088  1.00 18.38  ? 345 LEU B CD1 1 
ATOM   4616 C CD2 . LEU B 1 276 ? 19.118 8.782  17.808  1.00 38.35  ? 345 LEU B CD2 1 
ATOM   4617 N N   . THR B 1 277 ? 20.674 7.583  13.420  1.00 29.50  ? 346 THR B N   1 
ATOM   4618 C CA  . THR B 1 277 ? 21.086 7.684  12.028  1.00 22.74  ? 346 THR B CA  1 
ATOM   4619 C C   . THR B 1 277 ? 21.097 9.145  11.602  1.00 25.10  ? 346 THR B C   1 
ATOM   4620 O O   . THR B 1 277 ? 20.489 10.005 12.243  1.00 25.00  ? 346 THR B O   1 
ATOM   4621 C CB  . THR B 1 277 ? 20.154 6.892  11.110  1.00 27.07  ? 346 THR B CB  1 
ATOM   4622 O OG1 . THR B 1 277 ? 18.831 7.434  11.194  1.00 29.73  ? 346 THR B OG1 1 
ATOM   4623 C CG2 . THR B 1 277 ? 20.122 5.421  11.509  1.00 27.30  ? 346 THR B CG2 1 
ATOM   4624 N N   . SER B 1 278 ? 21.798 9.417  10.497  1.00 29.66  ? 347 SER B N   1 
ATOM   4625 C CA  . SER B 1 278 ? 21.910 10.786 10.002  1.00 32.45  ? 347 SER B CA  1 
ATOM   4626 C C   . SER B 1 278 ? 20.548 11.463 9.904   1.00 37.71  ? 347 SER B C   1 
ATOM   4627 O O   . SER B 1 278 ? 20.403 12.636 10.270  1.00 41.99  ? 347 SER B O   1 
ATOM   4628 C CB  . SER B 1 278 ? 22.615 10.790 8.648   1.00 30.29  ? 347 SER B CB  1 
ATOM   4629 O OG  . SER B 1 278 ? 22.164 9.720  7.846   1.00 42.61  ? 347 SER B OG  1 
ATOM   4630 N N   . ALA B 1 279 ? 19.527 10.730 9.448   1.00 30.75  ? 348 ALA B N   1 
ATOM   4631 C CA  . ALA B 1 279 ? 18.169 11.270 9.466   1.00 28.23  ? 348 ALA B CA  1 
ATOM   4632 C C   . ALA B 1 279 ? 17.744 11.686 10.869  1.00 25.64  ? 348 ALA B C   1 
ATOM   4633 O O   . ALA B 1 279 ? 17.014 12.672 11.024  1.00 30.27  ? 348 ALA B O   1 
ATOM   4634 C CB  . ALA B 1 279 ? 17.181 10.246 8.903   1.00 17.25  ? 348 ALA B CB  1 
ATOM   4635 N N   . ASP B 1 280 ? 18.192 10.962 11.900  1.00 15.96  ? 349 ASP B N   1 
ATOM   4636 C CA  . ASP B 1 280 ? 17.774 11.301 13.257  1.00 22.49  ? 349 ASP B CA  1 
ATOM   4637 C C   . ASP B 1 280 ? 18.421 12.589 13.738  1.00 24.69  ? 349 ASP B C   1 
ATOM   4638 O O   . ASP B 1 280 ? 17.813 13.319 14.531  1.00 23.75  ? 349 ASP B O   1 
ATOM   4639 C CB  . ASP B 1 280 ? 18.114 10.178 14.237  1.00 13.84  ? 349 ASP B CB  1 
ATOM   4640 C CG  . ASP B 1 280 ? 17.313 8.922  14.002  1.00 32.22  ? 349 ASP B CG  1 
ATOM   4641 O OD1 . ASP B 1 280 ? 16.132 9.029  13.622  1.00 36.04  ? 349 ASP B OD1 1 
ATOM   4642 O OD2 . ASP B 1 280 ? 17.873 7.820  14.203  1.00 34.83  ? 349 ASP B OD2 1 
ATOM   4643 N N   . TYR B 1 281 ? 19.643 12.892 13.283  1.00 22.07  ? 350 TYR B N   1 
ATOM   4644 C CA  . TYR B 1 281 ? 20.398 13.997 13.868  1.00 22.56  ? 350 TYR B CA  1 
ATOM   4645 C C   . TYR B 1 281 ? 20.767 15.107 12.888  1.00 19.38  ? 350 TYR B C   1 
ATOM   4646 O O   . TYR B 1 281 ? 21.462 16.045 13.285  1.00 26.89  ? 350 TYR B O   1 
ATOM   4647 C CB  . TYR B 1 281 ? 21.656 13.472 14.576  1.00 24.24  ? 350 TYR B CB  1 
ATOM   4648 C CG  . TYR B 1 281 ? 22.751 12.872 13.707  1.00 26.35  ? 350 TYR B CG  1 
ATOM   4649 C CD1 . TYR B 1 281 ? 23.615 13.683 12.972  1.00 21.26  ? 350 TYR B CD1 1 
ATOM   4650 C CD2 . TYR B 1 281 ? 22.959 11.496 13.671  1.00 23.56  ? 350 TYR B CD2 1 
ATOM   4651 C CE1 . TYR B 1 281 ? 24.627 13.138 12.204  1.00 18.14  ? 350 TYR B CE1 1 
ATOM   4652 C CE2 . TYR B 1 281 ? 23.971 10.944 12.904  1.00 21.70  ? 350 TYR B CE2 1 
ATOM   4653 C CZ  . TYR B 1 281 ? 24.802 11.771 12.171  1.00 25.13  ? 350 TYR B CZ  1 
ATOM   4654 O OH  . TYR B 1 281 ? 25.808 11.236 11.396  1.00 26.45  ? 350 TYR B OH  1 
ATOM   4655 N N   . VAL B 1 282 ? 20.319 15.050 11.636  1.00 25.42  ? 351 VAL B N   1 
ATOM   4656 C CA  . VAL B 1 282 ? 20.510 16.146 10.690  1.00 20.42  ? 351 VAL B CA  1 
ATOM   4657 C C   . VAL B 1 282 ? 19.149 16.757 10.380  1.00 27.91  ? 351 VAL B C   1 
ATOM   4658 O O   . VAL B 1 282 ? 18.157 16.038 10.214  1.00 34.16  ? 351 VAL B O   1 
ATOM   4659 C CB  . VAL B 1 282 ? 21.212 15.680 9.397   1.00 23.99  ? 351 VAL B CB  1 
ATOM   4660 C CG1 . VAL B 1 282 ? 21.418 16.852 8.436   1.00 21.08  ? 351 VAL B CG1 1 
ATOM   4661 C CG2 . VAL B 1 282 ? 22.540 15.020 9.718   1.00 18.20  ? 351 VAL B CG2 1 
ATOM   4662 N N   . PHE B 1 283 ? 19.098 18.089 10.340  1.00 28.91  ? 352 PHE B N   1 
ATOM   4663 C CA  . PHE B 1 283 ? 17.914 18.830 9.902   1.00 25.97  ? 352 PHE B CA  1 
ATOM   4664 C C   . PHE B 1 283 ? 17.951 18.903 8.381   1.00 30.54  ? 352 PHE B C   1 
ATOM   4665 O O   . PHE B 1 283 ? 18.552 19.809 7.799   1.00 30.28  ? 352 PHE B O   1 
ATOM   4666 C CB  . PHE B 1 283 ? 17.892 20.236 10.495  1.00 24.81  ? 352 PHE B CB  1 
ATOM   4667 C CG  . PHE B 1 283 ? 17.554 20.299 11.960  1.00 25.84  ? 352 PHE B CG  1 
ATOM   4668 C CD1 . PHE B 1 283 ? 16.272 20.047 12.403  1.00 19.95  ? 352 PHE B CD1 1 
ATOM   4669 C CD2 . PHE B 1 283 ? 18.520 20.666 12.890  1.00 33.11  ? 352 PHE B CD2 1 
ATOM   4670 C CE1 . PHE B 1 283 ? 15.964 20.129 13.743  1.00 29.90  ? 352 PHE B CE1 1 
ATOM   4671 C CE2 . PHE B 1 283 ? 18.215 20.754 14.233  1.00 24.44  ? 352 PHE B CE2 1 
ATOM   4672 C CZ  . PHE B 1 283 ? 16.938 20.485 14.661  1.00 30.97  ? 352 PHE B CZ  1 
ATOM   4673 N N   . GLN B 1 284 ? 17.302 17.948 7.715   1.00 28.50  ? 353 GLN B N   1 
ATOM   4674 C CA  . GLN B 1 284 ? 17.320 17.912 6.251   1.00 19.03  ? 353 GLN B CA  1 
ATOM   4675 C C   . GLN B 1 284 ? 16.217 18.814 5.696   1.00 30.54  ? 353 GLN B C   1 
ATOM   4676 O O   . GLN B 1 284 ? 15.194 18.371 5.175   1.00 37.16  ? 353 GLN B O   1 
ATOM   4677 C CB  . GLN B 1 284 ? 17.186 16.482 5.744   1.00 27.78  ? 353 GLN B CB  1 
ATOM   4678 C CG  . GLN B 1 284 ? 18.344 15.571 6.119   1.00 21.37  ? 353 GLN B CG  1 
ATOM   4679 C CD  . GLN B 1 284 ? 19.552 15.697 5.192   1.00 19.92  ? 353 GLN B CD  1 
ATOM   4680 O OE1 . GLN B 1 284 ? 20.479 14.892 5.258   1.00 28.84  ? 353 GLN B OE1 1 
ATOM   4681 N NE2 . GLN B 1 284 ? 19.545 16.705 4.331   1.00 21.10  ? 353 GLN B NE2 1 
ATOM   4682 N N   . GLU B 1 285 ? 16.454 20.122 5.828   1.00 44.77  ? 354 GLU B N   1 
ATOM   4683 C CA  . GLU B 1 285 ? 15.628 21.121 5.157   1.00 44.39  ? 354 GLU B CA  1 
ATOM   4684 C C   . GLU B 1 285 ? 15.649 20.953 3.643   1.00 37.57  ? 354 GLU B C   1 
ATOM   4685 O O   . GLU B 1 285 ? 14.729 21.416 2.960   1.00 42.61  ? 354 GLU B O   1 
ATOM   4686 C CB  . GLU B 1 285 ? 16.114 22.525 5.523   1.00 50.09  ? 354 GLU B CB  1 
ATOM   4687 C CG  . GLU B 1 285 ? 17.512 22.823 4.972   1.00 73.20  ? 354 GLU B CG  1 
ATOM   4688 C CD  . GLU B 1 285 ? 18.111 24.126 5.480   1.00 85.25  ? 354 GLU B CD  1 
ATOM   4689 O OE1 . GLU B 1 285 ? 17.496 24.772 6.356   1.00 87.73  ? 354 GLU B OE1 1 
ATOM   4690 O OE2 . GLU B 1 285 ? 19.206 24.499 5.001   1.00 84.21  ? 354 GLU B OE2 1 
ATOM   4691 N N   . SER B 1 286 ? 16.681 20.308 3.110   1.00 31.79  ? 355 SER B N   1 
ATOM   4692 C CA  . SER B 1 286 ? 16.862 20.143 1.676   1.00 35.42  ? 355 SER B CA  1 
ATOM   4693 C C   . SER B 1 286 ? 17.847 19.002 1.476   1.00 41.59  ? 355 SER B C   1 
ATOM   4694 O O   . SER B 1 286 ? 18.484 18.537 2.422   1.00 36.41  ? 355 SER B O   1 
ATOM   4695 C CB  . SER B 1 286 ? 17.353 21.447 1.028   1.00 31.02  ? 355 SER B CB  1 
ATOM   4696 O OG  . SER B 1 286 ? 18.193 21.208 -0.087  1.00 32.88  ? 355 SER B OG  1 
ATOM   4697 N N   . TYR B 1 287 ? 17.950 18.536 0.233   1.00 39.25  ? 356 TYR B N   1 
ATOM   4698 C CA  . TYR B 1 287 ? 18.968 17.560 -0.131  1.00 24.60  ? 356 TYR B CA  1 
ATOM   4699 C C   . TYR B 1 287 ? 19.906 18.105 -1.194  1.00 27.64  ? 356 TYR B C   1 
ATOM   4700 O O   . TYR B 1 287 ? 20.659 17.334 -1.800  1.00 35.68  ? 356 TYR B O   1 
ATOM   4701 C CB  . TYR B 1 287 ? 18.319 16.252 -0.594  1.00 16.54  ? 356 TYR B CB  1 
ATOM   4702 C CG  . TYR B 1 287 ? 17.569 15.539 0.509   1.00 25.99  ? 356 TYR B CG  1 
ATOM   4703 C CD1 . TYR B 1 287 ? 18.231 14.722 1.419   1.00 35.51  ? 356 TYR B CD1 1 
ATOM   4704 C CD2 . TYR B 1 287 ? 16.202 15.711 0.665   1.00 21.51  ? 356 TYR B CD2 1 
ATOM   4705 C CE1 . TYR B 1 287 ? 17.543 14.077 2.437   1.00 29.98  ? 356 TYR B CE1 1 
ATOM   4706 C CE2 . TYR B 1 287 ? 15.510 15.074 1.675   1.00 19.26  ? 356 TYR B CE2 1 
ATOM   4707 C CZ  . TYR B 1 287 ? 16.183 14.264 2.559   1.00 27.12  ? 356 TYR B CZ  1 
ATOM   4708 O OH  . TYR B 1 287 ? 15.487 13.636 3.562   1.00 39.87  ? 356 TYR B OH  1 
ATOM   4709 N N   . SER B 1 288 ? 19.885 19.415 -1.426  1.00 30.44  ? 357 SER B N   1 
ATOM   4710 C CA  . SER B 1 288 ? 20.700 20.015 -2.474  1.00 27.12  ? 357 SER B CA  1 
ATOM   4711 C C   . SER B 1 288 ? 22.165 20.091 -2.063  1.00 35.82  ? 357 SER B C   1 
ATOM   4712 O O   . SER B 1 288 ? 22.498 20.426 -0.920  1.00 29.87  ? 357 SER B O   1 
ATOM   4713 C CB  . SER B 1 288 ? 20.190 21.417 -2.799  1.00 30.36  ? 357 SER B CB  1 
ATOM   4714 O OG  . SER B 1 288 ? 21.161 22.149 -3.528  1.00 39.62  ? 357 SER B OG  1 
ATOM   4715 N N   . SER B 1 289 ? 23.046 19.802 -3.023  1.00 34.92  ? 358 SER B N   1 
ATOM   4716 C CA  . SER B 1 289 ? 24.480 20.001 -2.862  1.00 23.98  ? 358 SER B CA  1 
ATOM   4717 C C   . SER B 1 289 ? 24.864 21.468 -2.828  1.00 30.13  ? 358 SER B C   1 
ATOM   4718 O O   . SER B 1 289 ? 26.055 21.785 -2.729  1.00 30.15  ? 358 SER B O   1 
ATOM   4719 C CB  . SER B 1 289 ? 25.238 19.304 -3.992  1.00 36.51  ? 358 SER B CB  1 
ATOM   4720 O OG  . SER B 1 289 ? 25.039 19.966 -5.230  1.00 49.58  ? 358 SER B OG  1 
ATOM   4721 N N   . LYS B 1 290 ? 23.893 22.371 -2.915  1.00 38.32  ? 359 LYS B N   1 
ATOM   4722 C CA  . LYS B 1 290 ? 24.158 23.799 -2.885  1.00 44.39  ? 359 LYS B CA  1 
ATOM   4723 C C   . LYS B 1 290 ? 23.622 24.453 -1.620  1.00 37.55  ? 359 LYS B C   1 
ATOM   4724 O O   . LYS B 1 290 ? 23.445 25.674 -1.589  1.00 36.83  ? 359 LYS B O   1 
ATOM   4725 C CB  . LYS B 1 290 ? 23.574 24.461 -4.134  1.00 53.77  ? 359 LYS B CB  1 
ATOM   4726 C CG  . LYS B 1 290 ? 24.405 24.231 -5.394  1.00 54.16  ? 359 LYS B CG  1 
ATOM   4727 C CD  . LYS B 1 290 ? 23.528 24.016 -6.619  1.00 58.89  ? 359 LYS B CD  1 
ATOM   4728 C CE  . LYS B 1 290 ? 24.222 24.485 -7.890  1.00 64.28  ? 359 LYS B CE  1 
ATOM   4729 N NZ  . LYS B 1 290 ? 23.300 25.258 -8.772  1.00 65.33  ? 359 LYS B NZ  1 
ATOM   4730 N N   . LYS B 1 291 ? 23.363 23.670 -0.572  1.00 40.66  ? 360 LYS B N   1 
ATOM   4731 C CA  . LYS B 1 291 ? 22.848 24.218 0.675   1.00 31.19  ? 360 LYS B CA  1 
ATOM   4732 C C   . LYS B 1 291 ? 23.490 23.516 1.865   1.00 28.89  ? 360 LYS B C   1 
ATOM   4733 O O   . LYS B 1 291 ? 23.965 22.381 1.770   1.00 36.16  ? 360 LYS B O   1 
ATOM   4734 C CB  . LYS B 1 291 ? 21.323 24.108 0.742   1.00 24.62  ? 360 LYS B CB  1 
ATOM   4735 C CG  . LYS B 1 291 ? 20.609 25.134 -0.129  1.00 31.32  ? 360 LYS B CG  1 
ATOM   4736 C CD  . LYS B 1 291 ? 19.243 24.639 -0.591  1.00 38.78  ? 360 LYS B CD  1 
ATOM   4737 C CE  . LYS B 1 291 ? 18.301 25.808 -0.852  1.00 50.38  ? 360 LYS B CE  1 
ATOM   4738 N NZ  . LYS B 1 291 ? 18.054 26.633 0.377   1.00 54.75  ? 360 LYS B NZ  1 
ATOM   4739 N N   . LEU B 1 292 ? 23.496 24.213 2.995   1.00 28.47  ? 361 LEU B N   1 
ATOM   4740 C CA  . LEU B 1 292 ? 24.093 23.721 4.228   1.00 34.54  ? 361 LEU B CA  1 
ATOM   4741 C C   . LEU B 1 292 ? 22.995 23.284 5.183   1.00 29.96  ? 361 LEU B C   1 
ATOM   4742 O O   . LEU B 1 292 ? 22.045 24.034 5.425   1.00 37.25  ? 361 LEU B O   1 
ATOM   4743 C CB  . LEU B 1 292 ? 24.960 24.795 4.884   1.00 30.46  ? 361 LEU B CB  1 
ATOM   4744 C CG  . LEU B 1 292 ? 26.154 25.234 4.045   1.00 39.12  ? 361 LEU B CG  1 
ATOM   4745 C CD1 . LEU B 1 292 ? 27.057 26.147 4.859   1.00 35.87  ? 361 LEU B CD1 1 
ATOM   4746 C CD2 . LEU B 1 292 ? 26.907 24.017 3.511   1.00 36.34  ? 361 LEU B CD2 1 
ATOM   4747 N N   . CYS B 1 293 ? 23.134 22.083 5.731   1.00 26.89  ? 362 CYS B N   1 
ATOM   4748 C CA  . CYS B 1 293 ? 22.139 21.502 6.621   1.00 25.46  ? 362 CYS B CA  1 
ATOM   4749 C C   . CYS B 1 293 ? 22.701 21.402 8.037   1.00 26.88  ? 362 CYS B C   1 
ATOM   4750 O O   . CYS B 1 293 ? 23.815 20.905 8.239   1.00 25.34  ? 362 CYS B O   1 
ATOM   4751 C CB  . CYS B 1 293 ? 21.699 20.132 6.095   1.00 31.64  ? 362 CYS B CB  1 
ATOM   4752 S SG  . CYS B 1 293 ? 20.358 20.206 4.842   1.00 49.34  ? 362 CYS B SG  1 
ATOM   4753 N N   . THR B 1 294 ? 21.927 21.877 9.009   1.00 29.76  ? 363 THR B N   1 
ATOM   4754 C CA  . THR B 1 294 ? 22.358 21.917 10.401  1.00 25.15  ? 363 THR B CA  1 
ATOM   4755 C C   . THR B 1 294 ? 22.283 20.538 11.052  1.00 27.52  ? 363 THR B C   1 
ATOM   4756 O O   . THR B 1 294 ? 21.323 19.790 10.847  1.00 29.99  ? 363 THR B O   1 
ATOM   4757 C CB  . THR B 1 294 ? 21.489 22.907 11.182  1.00 20.97  ? 363 THR B CB  1 
ATOM   4758 O OG1 . THR B 1 294 ? 21.675 24.227 10.658  1.00 27.06  ? 363 THR B OG1 1 
ATOM   4759 C CG2 . THR B 1 294 ? 21.854 22.916 12.652  1.00 22.74  ? 363 THR B CG2 1 
ATOM   4760 N N   . LEU B 1 295 ? 23.307 20.209 11.846  1.00 21.08  ? 364 LEU B N   1 
ATOM   4761 C CA  . LEU B 1 295 ? 23.297 19.018 12.693  1.00 25.79  ? 364 LEU B CA  1 
ATOM   4762 C C   . LEU B 1 295 ? 22.761 19.372 14.075  1.00 25.97  ? 364 LEU B C   1 
ATOM   4763 O O   . LEU B 1 295 ? 23.137 20.396 14.653  1.00 34.66  ? 364 LEU B O   1 
ATOM   4764 C CB  . LEU B 1 295 ? 24.703 18.425 12.833  1.00 19.14  ? 364 LEU B CB  1 
ATOM   4765 C CG  . LEU B 1 295 ? 25.206 17.387 11.828  1.00 20.69  ? 364 LEU B CG  1 
ATOM   4766 C CD1 . LEU B 1 295 ? 25.024 17.865 10.412  1.00 31.47  ? 364 LEU B CD1 1 
ATOM   4767 C CD2 . LEU B 1 295 ? 26.667 17.099 12.077  1.00 26.65  ? 364 LEU B CD2 1 
ATOM   4768 N N   . ALA B 1 296 ? 21.892 18.515 14.614  1.00 21.48  ? 365 ALA B N   1 
ATOM   4769 C CA  . ALA B 1 296 ? 21.288 18.798 15.912  1.00 25.15  ? 365 ALA B CA  1 
ATOM   4770 C C   . ALA B 1 296 ? 22.211 18.370 17.048  1.00 31.74  ? 365 ALA B C   1 
ATOM   4771 O O   . ALA B 1 296 ? 21.790 17.705 18.003  1.00 31.47  ? 365 ALA B O   1 
ATOM   4772 C CB  . ALA B 1 296 ? 19.928 18.111 16.030  1.00 12.07  ? 365 ALA B CB  1 
ATOM   4773 N N   . ILE B 1 297 ? 23.471 18.781 16.953  1.00 25.60  ? 366 ILE B N   1 
ATOM   4774 C CA  . ILE B 1 297 ? 24.484 18.539 17.971  1.00 25.58  ? 366 ILE B CA  1 
ATOM   4775 C C   . ILE B 1 297 ? 25.352 19.785 18.046  1.00 27.87  ? 366 ILE B C   1 
ATOM   4776 O O   . ILE B 1 297 ? 25.610 20.429 17.025  1.00 34.43  ? 366 ILE B O   1 
ATOM   4777 C CB  . ILE B 1 297 ? 25.345 17.299 17.651  1.00 22.57  ? 366 ILE B CB  1 
ATOM   4778 C CG1 . ILE B 1 297 ? 24.466 16.088 17.318  1.00 21.72  ? 366 ILE B CG1 1 
ATOM   4779 C CG2 . ILE B 1 297 ? 26.288 16.983 18.813  1.00 18.27  ? 366 ILE B CG2 1 
ATOM   4780 C CD1 . ILE B 1 297 ? 25.152 15.057 16.448  1.00 19.33  ? 366 ILE B CD1 1 
ATOM   4781 N N   . HIS B 1 298 ? 25.786 20.144 19.249  1.00 24.00  ? 367 HIS B N   1 
ATOM   4782 C CA  . HIS B 1 298 ? 26.759 21.220 19.381  1.00 30.55  ? 367 HIS B CA  1 
ATOM   4783 C C   . HIS B 1 298 ? 27.490 21.047 20.703  1.00 25.88  ? 367 HIS B C   1 
ATOM   4784 O O   . HIS B 1 298 ? 27.141 20.193 21.517  1.00 24.94  ? 367 HIS B O   1 
ATOM   4785 C CB  . HIS B 1 298 ? 26.096 22.595 19.271  1.00 35.90  ? 367 HIS B CB  1 
ATOM   4786 C CG  . HIS B 1 298 ? 25.430 23.046 20.528  1.00 54.20  ? 367 HIS B CG  1 
ATOM   4787 N ND1 . HIS B 1 298 ? 25.506 24.343 20.985  1.00 62.96  ? 367 HIS B ND1 1 
ATOM   4788 C CD2 . HIS B 1 298 ? 24.671 22.374 21.425  1.00 60.99  ? 367 HIS B CD2 1 
ATOM   4789 C CE1 . HIS B 1 298 ? 24.825 24.450 22.112  1.00 61.89  ? 367 HIS B CE1 1 
ATOM   4790 N NE2 . HIS B 1 298 ? 24.310 23.269 22.402  1.00 56.14  ? 367 HIS B NE2 1 
ATOM   4791 N N   . ALA B 1 299 ? 28.526 21.857 20.896  1.00 22.24  ? 368 ALA B N   1 
ATOM   4792 C CA  . ALA B 1 299 ? 29.357 21.768 22.087  1.00 21.91  ? 368 ALA B CA  1 
ATOM   4793 C C   . ALA B 1 299 ? 28.775 22.598 23.223  1.00 24.31  ? 368 ALA B C   1 
ATOM   4794 O O   . ALA B 1 299 ? 28.324 23.728 23.018  1.00 29.47  ? 368 ALA B O   1 
ATOM   4795 C CB  . ALA B 1 299 ? 30.779 22.239 21.788  1.00 21.28  ? 368 ALA B CB  1 
ATOM   4796 N N   . MET B 1 300 ? 28.786 22.026 24.423  1.00 23.41  ? 369 MET B N   1 
ATOM   4797 C CA  . MET B 1 300 ? 28.461 22.781 25.630  1.00 32.97  ? 369 MET B CA  1 
ATOM   4798 C C   . MET B 1 300 ? 29.296 22.249 26.782  1.00 31.88  ? 369 MET B C   1 
ATOM   4799 O O   . MET B 1 300 ? 29.147 21.089 27.175  1.00 34.93  ? 369 MET B O   1 
ATOM   4800 C CB  . MET B 1 300 ? 26.978 22.696 25.970  1.00 22.81  ? 369 MET B CB  1 
ATOM   4801 C CG  . MET B 1 300 ? 26.611 23.469 27.218  1.00 18.32  ? 369 MET B CG  1 
ATOM   4802 S SD  . MET B 1 300 ? 24.826 23.609 27.421  1.00 33.15  ? 369 MET B SD  1 
ATOM   4803 C CE  . MET B 1 300 ? 24.413 24.633 26.020  1.00 37.04  ? 369 MET B CE  1 
ATOM   4804 N N   . ASP B 1 301 ? 30.168 23.096 27.320  1.00 31.61  ? 370 ASP B N   1 
ATOM   4805 C CA  . ASP B 1 301 ? 30.985 22.736 28.476  1.00 26.76  ? 370 ASP B CA  1 
ATOM   4806 C C   . ASP B 1 301 ? 30.187 23.041 29.731  1.00 29.72  ? 370 ASP B C   1 
ATOM   4807 O O   . ASP B 1 301 ? 30.158 24.167 30.225  1.00 35.49  ? 370 ASP B O   1 
ATOM   4808 C CB  . ASP B 1 301 ? 32.314 23.468 28.435  1.00 20.74  ? 370 ASP B CB  1 
ATOM   4809 C CG  . ASP B 1 301 ? 33.233 22.881 27.398  1.00 30.59  ? 370 ASP B CG  1 
ATOM   4810 O OD1 . ASP B 1 301 ? 33.741 23.646 26.559  1.00 42.38  ? 370 ASP B OD1 1 
ATOM   4811 O OD2 . ASP B 1 301 ? 33.411 21.644 27.396  1.00 36.06  ? 370 ASP B OD2 1 
ATOM   4812 N N   . ILE B 1 302 ? 29.511 22.020 30.228  1.00 36.73  ? 371 ILE B N   1 
ATOM   4813 C CA  . ILE B 1 302 ? 28.683 22.161 31.425  1.00 35.93  ? 371 ILE B CA  1 
ATOM   4814 C C   . ILE B 1 302 ? 29.592 22.176 32.645  1.00 26.42  ? 371 ILE B C   1 
ATOM   4815 O O   . ILE B 1 302 ? 30.453 21.290 32.779  1.00 29.83  ? 371 ILE B O   1 
ATOM   4816 C CB  . ILE B 1 302 ? 27.670 21.029 31.500  1.00 30.80  ? 371 ILE B CB  1 
ATOM   4817 C CG1 . ILE B 1 302 ? 26.758 21.080 30.273  1.00 24.05  ? 371 ILE B CG1 1 
ATOM   4818 C CG2 . ILE B 1 302 ? 26.881 21.100 32.791  1.00 15.51  ? 371 ILE B CG2 1 
ATOM   4819 C CD1 . ILE B 1 302 ? 25.715 19.989 30.247  1.00 29.90  ? 371 ILE B CD1 1 
ATOM   4820 N N   . PRO B 1 303 ? 29.459 23.156 33.530  1.00 29.41  ? 372 PRO B N   1 
ATOM   4821 C CA  . PRO B 1 303 ? 30.362 23.248 34.680  1.00 37.24  ? 372 PRO B CA  1 
ATOM   4822 C C   . PRO B 1 303 ? 30.099 22.127 35.666  1.00 41.80  ? 372 PRO B C   1 
ATOM   4823 O O   . PRO B 1 303 ? 28.998 21.558 35.692  1.00 44.56  ? 372 PRO B O   1 
ATOM   4824 C CB  . PRO B 1 303 ? 30.021 24.615 35.288  1.00 37.14  ? 372 PRO B CB  1 
ATOM   4825 C CG  . PRO B 1 303 ? 28.597 24.851 34.883  1.00 36.21  ? 372 PRO B CG  1 
ATOM   4826 C CD  . PRO B 1 303 ? 28.475 24.252 33.502  1.00 29.49  ? 372 PRO B CD  1 
ATOM   4827 N N   . PRO B 1 304 ? 31.093 21.766 36.472  1.00 47.01  ? 373 PRO B N   1 
ATOM   4828 C CA  . PRO B 1 304 ? 30.846 20.886 37.618  1.00 43.67  ? 373 PRO B CA  1 
ATOM   4829 C C   . PRO B 1 304 ? 30.018 21.599 38.673  1.00 44.98  ? 373 PRO B C   1 
ATOM   4830 O O   . PRO B 1 304 ? 29.871 22.831 38.630  1.00 43.18  ? 373 PRO B O   1 
ATOM   4831 C CB  . PRO B 1 304 ? 32.260 20.561 38.127  1.00 44.43  ? 373 PRO B CB  1 
ATOM   4832 C CG  . PRO B 1 304 ? 33.131 21.625 37.563  1.00 45.80  ? 373 PRO B CG  1 
ATOM   4833 C CD  . PRO B 1 304 ? 32.528 21.999 36.250  1.00 46.31  ? 373 PRO B CD  1 
ATOM   4834 N N   . PRO B 1 305 ? 29.440 20.866 39.639  1.00 44.47  ? 374 PRO B N   1 
ATOM   4835 C CA  . PRO B 1 305 ? 29.525 19.419 39.878  1.00 41.37  ? 374 PRO B CA  1 
ATOM   4836 C C   . PRO B 1 305 ? 28.873 18.555 38.792  1.00 45.04  ? 374 PRO B C   1 
ATOM   4837 O O   . PRO B 1 305 ? 29.286 17.412 38.603  1.00 49.64  ? 374 PRO B O   1 
ATOM   4838 C CB  . PRO B 1 305 ? 28.785 19.253 41.207  1.00 27.88  ? 374 PRO B CB  1 
ATOM   4839 C CG  . PRO B 1 305 ? 27.789 20.355 41.200  1.00 31.32  ? 374 PRO B CG  1 
ATOM   4840 C CD  . PRO B 1 305 ? 28.523 21.516 40.593  1.00 37.54  ? 374 PRO B CD  1 
ATOM   4841 N N   . THR B 1 306 ? 27.878 19.095 38.085  1.00 39.15  ? 375 THR B N   1 
ATOM   4842 C CA  . THR B 1 306 ? 27.166 18.287 37.098  1.00 40.74  ? 375 THR B CA  1 
ATOM   4843 C C   . THR B 1 306 ? 28.065 17.916 35.928  1.00 37.44  ? 375 THR B C   1 
ATOM   4844 O O   . THR B 1 306 ? 28.059 16.768 35.469  1.00 37.35  ? 375 THR B O   1 
ATOM   4845 C CB  . THR B 1 306 ? 25.926 19.025 36.595  1.00 46.05  ? 375 THR B CB  1 
ATOM   4846 O OG1 . THR B 1 306 ? 25.246 19.645 37.696  1.00 52.80  ? 375 THR B OG1 1 
ATOM   4847 C CG2 . THR B 1 306 ? 24.990 18.046 35.923  1.00 34.45  ? 375 THR B CG2 1 
ATOM   4848 N N   . GLY B 1 307 ? 28.846 18.869 35.434  1.00 38.59  ? 376 GLY B N   1 
ATOM   4849 C CA  . GLY B 1 307 ? 29.732 18.617 34.328  1.00 30.05  ? 376 GLY B CA  1 
ATOM   4850 C C   . GLY B 1 307 ? 31.117 18.234 34.792  1.00 32.22  ? 376 GLY B C   1 
ATOM   4851 O O   . GLY B 1 307 ? 31.413 18.233 35.990  1.00 42.02  ? 376 GLY B O   1 
ATOM   4852 N N   . PRO B 1 308 ? 32.003 17.886 33.846  1.00 39.27  ? 377 PRO B N   1 
ATOM   4853 C CA  . PRO B 1 308 ? 31.738 17.813 32.405  1.00 35.78  ? 377 PRO B CA  1 
ATOM   4854 C C   . PRO B 1 308 ? 30.863 16.617 32.076  1.00 41.94  ? 377 PRO B C   1 
ATOM   4855 O O   . PRO B 1 308 ? 31.019 15.564 32.691  1.00 43.27  ? 377 PRO B O   1 
ATOM   4856 C CB  . PRO B 1 308 ? 33.135 17.646 31.788  1.00 32.38  ? 377 PRO B CB  1 
ATOM   4857 C CG  . PRO B 1 308 ? 34.110 17.866 32.908  1.00 32.45  ? 377 PRO B CG  1 
ATOM   4858 C CD  . PRO B 1 308 ? 33.385 17.494 34.158  1.00 36.64  ? 377 PRO B CD  1 
ATOM   4859 N N   . THR B 1 309 ? 29.949 16.774 31.125  1.00 33.51  ? 378 THR B N   1 
ATOM   4860 C CA  . THR B 1 309 ? 29.026 15.694 30.824  1.00 22.90  ? 378 THR B CA  1 
ATOM   4861 C C   . THR B 1 309 ? 28.487 15.888 29.418  1.00 19.78  ? 378 THR B C   1 
ATOM   4862 O O   . THR B 1 309 ? 28.467 17.005 28.901  1.00 34.99  ? 378 THR B O   1 
ATOM   4863 C CB  . THR B 1 309 ? 27.882 15.656 31.846  1.00 21.60  ? 378 THR B CB  1 
ATOM   4864 O OG1 . THR B 1 309 ? 27.039 14.526 31.598  1.00 28.23  ? 378 THR B OG1 1 
ATOM   4865 C CG2 . THR B 1 309 ? 27.058 16.924 31.772  1.00 13.84  ? 378 THR B CG2 1 
ATOM   4866 N N   . TRP B 1 310 ? 28.078 14.786 28.796  1.00 20.11  ? 379 TRP B N   1 
ATOM   4867 C CA  . TRP B 1 310 ? 27.180 14.899 27.659  1.00 24.09  ? 379 TRP B CA  1 
ATOM   4868 C C   . TRP B 1 310 ? 25.778 15.233 28.159  1.00 25.46  ? 379 TRP B C   1 
ATOM   4869 O O   . TRP B 1 310 ? 25.443 15.023 29.329  1.00 22.42  ? 379 TRP B O   1 
ATOM   4870 C CB  . TRP B 1 310 ? 27.130 13.605 26.847  1.00 18.81  ? 379 TRP B CB  1 
ATOM   4871 C CG  . TRP B 1 310 ? 28.402 13.246 26.166  1.00 28.45  ? 379 TRP B CG  1 
ATOM   4872 C CD1 . TRP B 1 310 ? 29.546 12.788 26.753  1.00 32.98  ? 379 TRP B CD1 1 
ATOM   4873 C CD2 . TRP B 1 310 ? 28.665 13.296 24.758  1.00 29.45  ? 379 TRP B CD2 1 
ATOM   4874 N NE1 . TRP B 1 310 ? 30.509 12.557 25.798  1.00 34.46  ? 379 TRP B NE1 1 
ATOM   4875 C CE2 . TRP B 1 310 ? 29.993 12.860 24.566  1.00 32.33  ? 379 TRP B CE2 1 
ATOM   4876 C CE3 . TRP B 1 310 ? 27.910 13.670 23.643  1.00 23.10  ? 379 TRP B CE3 1 
ATOM   4877 C CZ2 . TRP B 1 310 ? 30.581 12.790 23.304  1.00 33.49  ? 379 TRP B CZ2 1 
ATOM   4878 C CZ3 . TRP B 1 310 ? 28.494 13.602 22.392  1.00 23.75  ? 379 TRP B CZ3 1 
ATOM   4879 C CH2 . TRP B 1 310 ? 29.817 13.163 22.233  1.00 32.02  ? 379 TRP B CH2 1 
ATOM   4880 N N   . ALA B 1 311 ? 24.958 15.765 27.257  1.00 14.85  ? 380 ALA B N   1 
ATOM   4881 C CA  . ALA B 1 311 ? 23.551 16.017 27.537  1.00 14.96  ? 380 ALA B CA  1 
ATOM   4882 C C   . ALA B 1 311 ? 22.719 15.456 26.397  1.00 28.61  ? 380 ALA B C   1 
ATOM   4883 O O   . ALA B 1 311 ? 22.871 15.874 25.243  1.00 30.34  ? 380 ALA B O   1 
ATOM   4884 C CB  . ALA B 1 311 ? 23.269 17.508 27.720  1.00 12.66  ? 380 ALA B CB  1 
ATOM   4885 N N   . LEU B 1 312 ? 21.840 14.518 26.723  1.00 29.18  ? 381 LEU B N   1 
ATOM   4886 C CA  . LEU B 1 312 ? 20.950 13.906 25.744  1.00 18.72  ? 381 LEU B CA  1 
ATOM   4887 C C   . LEU B 1 312 ? 19.664 14.721 25.710  1.00 16.92  ? 381 LEU B C   1 
ATOM   4888 O O   . LEU B 1 312 ? 18.788 14.558 26.563  1.00 26.74  ? 381 LEU B O   1 
ATOM   4889 C CB  . LEU B 1 312 ? 20.691 12.447 26.102  1.00 23.40  ? 381 LEU B CB  1 
ATOM   4890 C CG  . LEU B 1 312 ? 21.916 11.537 26.233  1.00 24.39  ? 381 LEU B CG  1 
ATOM   4891 C CD1 . LEU B 1 312 ? 21.499 10.088 26.116  1.00 28.76  ? 381 LEU B CD1 1 
ATOM   4892 C CD2 . LEU B 1 312 ? 22.976 11.868 25.193  1.00 27.03  ? 381 LEU B CD2 1 
ATOM   4893 N N   . GLY B 1 313 ? 19.545 15.601 24.720  1.00 20.58  ? 382 GLY B N   1 
ATOM   4894 C CA  . GLY B 1 313 ? 18.367 16.428 24.549  1.00 12.50  ? 382 GLY B CA  1 
ATOM   4895 C C   . GLY B 1 313 ? 17.361 15.848 23.573  1.00 21.56  ? 382 GLY B C   1 
ATOM   4896 O O   . GLY B 1 313 ? 17.321 14.642 23.312  1.00 18.12  ? 382 GLY B O   1 
ATOM   4897 N N   . ALA B 1 314 ? 16.548 16.743 23.005  1.00 17.71  ? 383 ALA B N   1 
ATOM   4898 C CA  . ALA B 1 314 ? 15.444 16.322 22.142  1.00 22.35  ? 383 ALA B CA  1 
ATOM   4899 C C   . ALA B 1 314 ? 15.911 15.510 20.936  1.00 26.68  ? 383 ALA B C   1 
ATOM   4900 O O   . ALA B 1 314 ? 15.156 14.670 20.435  1.00 31.73  ? 383 ALA B O   1 
ATOM   4901 C CB  . ALA B 1 314 ? 14.649 17.542 21.673  1.00 18.33  ? 383 ALA B CB  1 
ATOM   4902 N N   . THR B 1 315 ? 17.131 15.746 20.441  1.00 22.02  ? 384 THR B N   1 
ATOM   4903 C CA  . THR B 1 315 ? 17.643 14.918 19.351  1.00 18.12  ? 384 THR B CA  1 
ATOM   4904 C C   . THR B 1 315 ? 17.612 13.444 19.730  1.00 29.62  ? 384 THR B C   1 
ATOM   4905 O O   . THR B 1 315 ? 17.310 12.583 18.895  1.00 34.44  ? 384 THR B O   1 
ATOM   4906 C CB  . THR B 1 315 ? 19.067 15.340 18.975  1.00 27.83  ? 384 THR B CB  1 
ATOM   4907 O OG1 . THR B 1 315 ? 19.152 16.771 18.902  1.00 25.65  ? 384 THR B OG1 1 
ATOM   4908 C CG2 . THR B 1 315 ? 19.483 14.726 17.626  1.00 12.43  ? 384 THR B CG2 1 
ATOM   4909 N N   . PHE B 1 316 ? 17.902 13.141 20.996  1.00 22.77  ? 385 PHE B N   1 
ATOM   4910 C CA  . PHE B 1 316 ? 17.894 11.771 21.496  1.00 18.52  ? 385 PHE B CA  1 
ATOM   4911 C C   . PHE B 1 316 ? 16.483 11.318 21.866  1.00 28.13  ? 385 PHE B C   1 
ATOM   4912 O O   . PHE B 1 316 ? 16.044 10.238 21.453  1.00 29.48  ? 385 PHE B O   1 
ATOM   4913 C CB  . PHE B 1 316 ? 18.826 11.680 22.708  1.00 18.52  ? 385 PHE B CB  1 
ATOM   4914 C CG  . PHE B 1 316 ? 19.115 10.287 23.149  1.00 18.65  ? 385 PHE B CG  1 
ATOM   4915 C CD1 . PHE B 1 316 ? 20.143 9.562  22.569  1.00 17.25  ? 385 PHE B CD1 1 
ATOM   4916 C CD2 . PHE B 1 316 ? 18.371 9.702  24.161  1.00 16.32  ? 385 PHE B CD2 1 
ATOM   4917 C CE1 . PHE B 1 316 ? 20.416 8.272  22.979  1.00 21.32  ? 385 PHE B CE1 1 
ATOM   4918 C CE2 . PHE B 1 316 ? 18.638 8.416  24.575  1.00 20.31  ? 385 PHE B CE2 1 
ATOM   4919 C CZ  . PHE B 1 316 ? 19.664 7.697  23.983  1.00 17.96  ? 385 PHE B CZ  1 
ATOM   4920 N N   . ILE B 1 317 ? 15.769 12.135 22.654  1.00 29.37  ? 386 ILE B N   1 
ATOM   4921 C CA  . ILE B 1 317 ? 14.437 11.775 23.144  1.00 26.07  ? 386 ILE B CA  1 
ATOM   4922 C C   . ILE B 1 317 ? 13.497 11.471 21.983  1.00 32.09  ? 386 ILE B C   1 
ATOM   4923 O O   . ILE B 1 317 ? 12.644 10.581 22.073  1.00 35.17  ? 386 ILE B O   1 
ATOM   4924 C CB  . ILE B 1 317 ? 13.863 12.899 24.027  1.00 20.81  ? 386 ILE B CB  1 
ATOM   4925 C CG1 . ILE B 1 317 ? 14.870 13.371 25.082  1.00 19.97  ? 386 ILE B CG1 1 
ATOM   4926 C CG2 . ILE B 1 317 ? 12.592 12.426 24.692  1.00 16.80  ? 386 ILE B CG2 1 
ATOM   4927 C CD1 . ILE B 1 317 ? 14.921 12.517 26.303  1.00 21.82  ? 386 ILE B CD1 1 
ATOM   4928 N N   . ARG B 1 318 ? 13.627 12.223 20.885  1.00 34.96  ? 387 ARG B N   1 
ATOM   4929 C CA  . ARG B 1 318 ? 12.778 12.015 19.714  1.00 32.37  ? 387 ARG B CA  1 
ATOM   4930 C C   . ARG B 1 318 ? 12.739 10.551 19.301  1.00 35.57  ? 387 ARG B C   1 
ATOM   4931 O O   . ARG B 1 318 ? 11.671 10.017 18.978  1.00 33.29  ? 387 ARG B O   1 
ATOM   4932 C CB  . ARG B 1 318 ? 13.272 12.872 18.552  1.00 17.50  ? 387 ARG B CB  1 
ATOM   4933 C CG  . ARG B 1 318 ? 12.384 14.041 18.204  1.00 23.11  ? 387 ARG B CG  1 
ATOM   4934 C CD  . ARG B 1 318 ? 13.003 14.833 17.071  1.00 27.47  ? 387 ARG B CD  1 
ATOM   4935 N NE  . ARG B 1 318 ? 13.342 16.183 17.501  1.00 33.21  ? 387 ARG B NE  1 
ATOM   4936 C CZ  . ARG B 1 318 ? 14.536 16.743 17.349  1.00 26.77  ? 387 ARG B CZ  1 
ATOM   4937 N NH1 . ARG B 1 318 ? 14.740 17.978 17.779  1.00 32.48  ? 387 ARG B NH1 1 
ATOM   4938 N NH2 . ARG B 1 318 ? 15.522 16.075 16.767  1.00 32.03  ? 387 ARG B NH2 1 
ATOM   4939 N N   . LYS B 1 319 ? 13.890 9.879  19.311  1.00 31.52  ? 388 LYS B N   1 
ATOM   4940 C CA  . LYS B 1 319 ? 13.888 8.469  18.952  1.00 23.59  ? 388 LYS B CA  1 
ATOM   4941 C C   . LYS B 1 319 ? 13.560 7.570  20.137  1.00 29.06  ? 388 LYS B C   1 
ATOM   4942 O O   . LYS B 1 319 ? 12.888 6.547  19.965  1.00 29.48  ? 388 LYS B O   1 
ATOM   4943 C CB  . LYS B 1 319 ? 15.233 8.066  18.350  1.00 14.27  ? 388 LYS B CB  1 
ATOM   4944 C CG  . LYS B 1 319 ? 15.174 6.703  17.680  1.00 35.13  ? 388 LYS B CG  1 
ATOM   4945 C CD  . LYS B 1 319 ? 16.497 6.302  17.090  1.00 39.25  ? 388 LYS B CD  1 
ATOM   4946 C CE  . LYS B 1 319 ? 16.301 5.592  15.770  1.00 42.80  ? 388 LYS B CE  1 
ATOM   4947 N NZ  . LYS B 1 319 ? 17.540 4.896  15.325  1.00 42.18  ? 388 LYS B NZ  1 
ATOM   4948 N N   . PHE B 1 320 ? 13.998 7.936  21.339  1.00 24.82  ? 389 PHE B N   1 
ATOM   4949 C CA  . PHE B 1 320 ? 13.901 7.062  22.507  1.00 23.16  ? 389 PHE B CA  1 
ATOM   4950 C C   . PHE B 1 320 ? 12.984 7.686  23.557  1.00 31.73  ? 389 PHE B C   1 
ATOM   4951 O O   . PHE B 1 320 ? 13.396 8.583  24.299  1.00 24.25  ? 389 PHE B O   1 
ATOM   4952 C CB  . PHE B 1 320 ? 15.287 6.781  23.069  1.00 28.78  ? 389 PHE B CB  1 
ATOM   4953 C CG  . PHE B 1 320 ? 16.187 6.091  22.102  1.00 30.89  ? 389 PHE B CG  1 
ATOM   4954 C CD1 . PHE B 1 320 ? 15.935 4.790  21.717  1.00 30.16  ? 389 PHE B CD1 1 
ATOM   4955 C CD2 . PHE B 1 320 ? 17.267 6.749  21.552  1.00 29.01  ? 389 PHE B CD2 1 
ATOM   4956 C CE1 . PHE B 1 320 ? 16.754 4.151  20.817  1.00 23.37  ? 389 PHE B CE1 1 
ATOM   4957 C CE2 . PHE B 1 320 ? 18.085 6.111  20.648  1.00 28.87  ? 389 PHE B CE2 1 
ATOM   4958 C CZ  . PHE B 1 320 ? 17.828 4.810  20.285  1.00 22.74  ? 389 PHE B CZ  1 
ATOM   4959 N N   . TYR B 1 321 ? 11.740 7.210  23.608  1.00 14.99  ? 390 TYR B N   1 
ATOM   4960 C CA  . TYR B 1 321 ? 10.838 7.538  24.701  1.00 19.97  ? 390 TYR B CA  1 
ATOM   4961 C C   . TYR B 1 321 ? 11.546 7.308  26.031  1.00 28.38  ? 390 TYR B C   1 
ATOM   4962 O O   . TYR B 1 321 ? 12.180 6.268  26.241  1.00 29.97  ? 390 TYR B O   1 
ATOM   4963 C CB  . TYR B 1 321 ? 9.578  6.672  24.588  1.00 21.06  ? 390 TYR B CB  1 
ATOM   4964 C CG  . TYR B 1 321 ? 8.420  7.045  25.495  1.00 26.58  ? 390 TYR B CG  1 
ATOM   4965 C CD1 . TYR B 1 321 ? 8.439  6.725  26.846  1.00 33.30  ? 390 TYR B CD1 1 
ATOM   4966 C CD2 . TYR B 1 321 ? 7.293  7.683  24.992  1.00 31.91  ? 390 TYR B CD2 1 
ATOM   4967 C CE1 . TYR B 1 321 ? 7.386  7.045  27.670  1.00 33.52  ? 390 TYR B CE1 1 
ATOM   4968 C CE2 . TYR B 1 321 ? 6.230  8.009  25.813  1.00 26.30  ? 390 TYR B CE2 1 
ATOM   4969 C CZ  . TYR B 1 321 ? 6.286  7.686  27.151  1.00 31.02  ? 390 TYR B CZ  1 
ATOM   4970 O OH  . TYR B 1 321 ? 5.243  8.003  27.986  1.00 36.19  ? 390 TYR B OH  1 
ATOM   4971 N N   . THR B 1 322 ? 11.454 8.288  26.924  1.00 24.34  ? 391 THR B N   1 
ATOM   4972 C CA  . THR B 1 322 ? 12.260 8.293  28.136  1.00 28.83  ? 391 THR B CA  1 
ATOM   4973 C C   . THR B 1 322 ? 11.372 8.372  29.367  1.00 31.20  ? 391 THR B C   1 
ATOM   4974 O O   . THR B 1 322 ? 10.508 9.250  29.458  1.00 26.77  ? 391 THR B O   1 
ATOM   4975 C CB  . THR B 1 322 ? 13.245 9.464  28.128  1.00 24.93  ? 391 THR B CB  1 
ATOM   4976 O OG1 . THR B 1 322 ? 14.157 9.311  27.034  1.00 25.14  ? 391 THR B OG1 1 
ATOM   4977 C CG2 . THR B 1 322 ? 14.028 9.490  29.417  1.00 25.76  ? 391 THR B CG2 1 
ATOM   4978 N N   . GLU B 1 323 ? 11.594 7.458  30.308  1.00 38.78  ? 392 GLU B N   1 
ATOM   4979 C CA  . GLU B 1 323 ? 10.894 7.429  31.586  1.00 32.39  ? 392 GLU B CA  1 
ATOM   4980 C C   . GLU B 1 323 ? 11.857 7.764  32.721  1.00 34.68  ? 392 GLU B C   1 
ATOM   4981 O O   . GLU B 1 323 ? 12.935 7.162  32.826  1.00 25.13  ? 392 GLU B O   1 
ATOM   4982 C CB  . GLU B 1 323 ? 10.263 6.058  31.823  1.00 25.06  ? 392 GLU B CB  1 
ATOM   4983 C CG  . GLU B 1 323 ? 9.577  5.919  33.179  1.00 19.19  ? 392 GLU B CG  1 
ATOM   4984 C CD  . GLU B 1 323 ? 9.003  4.542  33.380  1.00 28.51  ? 392 GLU B CD  1 
ATOM   4985 O OE1 . GLU B 1 323 ? 9.767  3.645  33.804  1.00 24.02  ? 392 GLU B OE1 1 
ATOM   4986 O OE2 . GLU B 1 323 ? 7.797  4.352  33.095  1.00 38.82  ? 392 GLU B OE2 1 
ATOM   4987 N N   . PHE B 1 324 ? 11.463 8.719  33.567  1.00 23.85  ? 393 PHE B N   1 
ATOM   4988 C CA  . PHE B 1 324 ? 12.235 9.125  34.737  1.00 31.13  ? 393 PHE B CA  1 
ATOM   4989 C C   . PHE B 1 324 ? 11.556 8.577  35.990  1.00 42.19  ? 393 PHE B C   1 
ATOM   4990 O O   . PHE B 1 324 ? 10.372 8.844  36.222  1.00 41.87  ? 393 PHE B O   1 
ATOM   4991 C CB  . PHE B 1 324 ? 12.357 10.649 34.808  1.00 33.22  ? 393 PHE B CB  1 
ATOM   4992 C CG  . PHE B 1 324 ? 13.049 11.268 33.615  1.00 36.51  ? 393 PHE B CG  1 
ATOM   4993 C CD1 . PHE B 1 324 ? 12.339 11.568 32.459  1.00 30.57  ? 393 PHE B CD1 1 
ATOM   4994 C CD2 . PHE B 1 324 ? 14.410 11.555 33.654  1.00 26.31  ? 393 PHE B CD2 1 
ATOM   4995 C CE1 . PHE B 1 324 ? 12.971 12.138 31.364  1.00 33.49  ? 393 PHE B CE1 1 
ATOM   4996 C CE2 . PHE B 1 324 ? 15.051 12.124 32.556  1.00 25.30  ? 393 PHE B CE2 1 
ATOM   4997 C CZ  . PHE B 1 324 ? 14.330 12.417 31.414  1.00 32.61  ? 393 PHE B CZ  1 
ATOM   4998 N N   . ASP B 1 325 ? 12.306 7.822  36.797  1.00 40.58  ? 394 ASP B N   1 
ATOM   4999 C CA  . ASP B 1 325 ? 11.743 7.011  37.875  1.00 35.67  ? 394 ASP B CA  1 
ATOM   5000 C C   . ASP B 1 325 ? 12.384 7.417  39.196  1.00 35.84  ? 394 ASP B C   1 
ATOM   5001 O O   . ASP B 1 325 ? 13.569 7.149  39.424  1.00 35.24  ? 394 ASP B O   1 
ATOM   5002 C CB  . ASP B 1 325 ? 11.956 5.525  37.576  1.00 31.68  ? 394 ASP B CB  1 
ATOM   5003 C CG  . ASP B 1 325 ? 11.413 4.605  38.654  1.00 39.95  ? 394 ASP B CG  1 
ATOM   5004 O OD1 . ASP B 1 325 ? 11.156 5.036  39.797  1.00 49.01  ? 394 ASP B OD1 1 
ATOM   5005 O OD2 . ASP B 1 325 ? 11.253 3.412  38.339  1.00 42.80  ? 394 ASP B OD2 1 
ATOM   5006 N N   . ARG B 1 326 ? 11.588 8.023  40.080  1.00 26.54  ? 395 ARG B N   1 
ATOM   5007 C CA  . ARG B 1 326 ? 12.094 8.529  41.349  1.00 26.24  ? 395 ARG B CA  1 
ATOM   5008 C C   . ARG B 1 326 ? 12.143 7.468  42.436  1.00 34.58  ? 395 ARG B C   1 
ATOM   5009 O O   . ARG B 1 326 ? 12.967 7.572  43.352  1.00 43.42  ? 395 ARG B O   1 
ATOM   5010 C CB  . ARG B 1 326 ? 11.239 9.704  41.822  1.00 32.29  ? 395 ARG B CB  1 
ATOM   5011 C CG  . ARG B 1 326 ? 11.601 11.020 41.164  1.00 39.93  ? 395 ARG B CG  1 
ATOM   5012 C CD  . ARG B 1 326 ? 13.004 11.445 41.560  1.00 39.03  ? 395 ARG B CD  1 
ATOM   5013 N NE  . ARG B 1 326 ? 13.122 11.758 42.985  1.00 43.39  ? 395 ARG B NE  1 
ATOM   5014 C CZ  . ARG B 1 326 ? 12.708 12.895 43.544  1.00 44.69  ? 395 ARG B CZ  1 
ATOM   5015 N NH1 . ARG B 1 326 ? 12.859 13.094 44.849  1.00 35.94  ? 395 ARG B NH1 1 
ATOM   5016 N NH2 . ARG B 1 326 ? 12.133 13.833 42.803  1.00 52.80  ? 395 ARG B NH2 1 
ATOM   5017 N N   . ARG B 1 327 ? 11.289 6.445  42.348  1.00 39.19  ? 396 ARG B N   1 
ATOM   5018 C CA  . ARG B 1 327 ? 11.256 5.405  43.372  1.00 32.96  ? 396 ARG B CA  1 
ATOM   5019 C C   . ARG B 1 327 ? 12.473 4.485  43.280  1.00 33.74  ? 396 ARG B C   1 
ATOM   5020 O O   . ARG B 1 327 ? 13.035 4.087  44.307  1.00 32.48  ? 396 ARG B O   1 
ATOM   5021 C CB  . ARG B 1 327 ? 9.962  4.600  43.246  1.00 24.87  ? 396 ARG B CB  1 
ATOM   5022 C CG  . ARG B 1 327 ? 9.899  3.389  44.153  1.00 32.68  ? 396 ARG B CG  1 
ATOM   5023 C CD  . ARG B 1 327 ? 9.547  2.138  43.380  1.00 29.66  ? 396 ARG B CD  1 
ATOM   5024 N NE  . ARG B 1 327 ? 9.012  1.100  44.256  1.00 39.51  ? 396 ARG B NE  1 
ATOM   5025 C CZ  . ARG B 1 327 ? 9.596  -0.074 44.476  1.00 41.27  ? 396 ARG B CZ  1 
ATOM   5026 N NH1 . ARG B 1 327 ? 9.024  -0.955 45.288  1.00 33.38  ? 396 ARG B NH1 1 
ATOM   5027 N NH2 . ARG B 1 327 ? 10.743 -0.372 43.876  1.00 36.30  ? 396 ARG B NH2 1 
ATOM   5028 N N   . ASN B 1 328 ? 12.890 4.132  42.063  1.00 31.54  ? 397 ASN B N   1 
ATOM   5029 C CA  . ASN B 1 328 ? 14.036 3.259  41.846  1.00 30.02  ? 397 ASN B CA  1 
ATOM   5030 C C   . ASN B 1 328 ? 15.292 4.013  41.408  1.00 29.71  ? 397 ASN B C   1 
ATOM   5031 O O   . ASN B 1 328 ? 16.337 3.385  41.216  1.00 33.75  ? 397 ASN B O   1 
ATOM   5032 C CB  . ASN B 1 328 ? 13.687 2.185  40.811  1.00 41.24  ? 397 ASN B CB  1 
ATOM   5033 C CG  . ASN B 1 328 ? 12.446 1.391  41.186  1.00 40.38  ? 397 ASN B CG  1 
ATOM   5034 O OD1 . ASN B 1 328 ? 12.485 0.554  42.087  1.00 29.97  ? 397 ASN B OD1 1 
ATOM   5035 N ND2 . ASN B 1 328 ? 11.341 1.640  40.485  1.00 36.19  ? 397 ASN B ND2 1 
ATOM   5036 N N   . ASN B 1 329 ? 15.218 5.336  41.271  1.00 30.71  ? 398 ASN B N   1 
ATOM   5037 C CA  . ASN B 1 329 ? 16.348 6.182  40.880  1.00 31.59  ? 398 ASN B CA  1 
ATOM   5038 C C   . ASN B 1 329 ? 17.025 5.649  39.615  1.00 29.99  ? 398 ASN B C   1 
ATOM   5039 O O   . ASN B 1 329 ? 18.214 5.328  39.587  1.00 34.98  ? 398 ASN B O   1 
ATOM   5040 C CB  . ASN B 1 329 ? 17.342 6.328  42.034  1.00 35.25  ? 398 ASN B CB  1 
ATOM   5041 C CG  . ASN B 1 329 ? 16.831 7.255  43.125  1.00 49.88  ? 398 ASN B CG  1 
ATOM   5042 O OD1 . ASN B 1 329 ? 16.803 8.476  42.961  1.00 46.79  ? 398 ASN B OD1 1 
ATOM   5043 N ND2 . ASN B 1 329 ? 16.412 6.674  44.242  1.00 61.72  ? 398 ASN B ND2 1 
ATOM   5044 N N   . ARG B 1 330 ? 16.227 5.563  38.555  1.00 21.67  ? 399 ARG B N   1 
ATOM   5045 C CA  . ARG B 1 330 ? 16.672 5.001  37.291  1.00 29.64  ? 399 ARG B CA  1 
ATOM   5046 C C   . ARG B 1 330 ? 15.986 5.728  36.143  1.00 32.57  ? 399 ARG B C   1 
ATOM   5047 O O   . ARG B 1 330 ? 14.967 6.401  36.322  1.00 29.49  ? 399 ARG B O   1 
ATOM   5048 C CB  . ARG B 1 330 ? 16.372 3.500  37.214  1.00 24.56  ? 399 ARG B CB  1 
ATOM   5049 C CG  . ARG B 1 330 ? 14.893 3.182  37.307  1.00 23.91  ? 399 ARG B CG  1 
ATOM   5050 C CD  . ARG B 1 330 ? 14.642 1.691  37.262  1.00 26.15  ? 399 ARG B CD  1 
ATOM   5051 N NE  . ARG B 1 330 ? 13.236 1.391  37.023  1.00 23.31  ? 399 ARG B NE  1 
ATOM   5052 C CZ  . ARG B 1 330 ? 12.766 0.170  36.788  1.00 29.52  ? 399 ARG B CZ  1 
ATOM   5053 N NH1 . ARG B 1 330 ? 11.467 -0.006 36.577  1.00 26.55  ? 399 ARG B NH1 1 
ATOM   5054 N NH2 . ARG B 1 330 ? 13.590 -0.876 36.773  1.00 21.60  ? 399 ARG B NH2 1 
ATOM   5055 N N   . ILE B 1 331 ? 16.558 5.570  34.952  1.00 30.78  ? 400 ILE B N   1 
ATOM   5056 C CA  . ILE B 1 331 ? 15.989 6.094  33.717  1.00 26.48  ? 400 ILE B CA  1 
ATOM   5057 C C   . ILE B 1 331 ? 15.748 4.924  32.776  1.00 27.67  ? 400 ILE B C   1 
ATOM   5058 O O   . ILE B 1 331 ? 16.586 4.021  32.672  1.00 29.59  ? 400 ILE B O   1 
ATOM   5059 C CB  . ILE B 1 331 ? 16.909 7.146  33.065  1.00 26.78  ? 400 ILE B CB  1 
ATOM   5060 C CG1 . ILE B 1 331 ? 17.041 8.370  33.971  1.00 25.97  ? 400 ILE B CG1 1 
ATOM   5061 C CG2 . ILE B 1 331 ? 16.382 7.560  31.700  1.00 33.09  ? 400 ILE B CG2 1 
ATOM   5062 C CD1 . ILE B 1 331 ? 17.893 9.476  33.384  1.00 21.90  ? 400 ILE B CD1 1 
ATOM   5063 N N   . GLY B 1 332 ? 14.600 4.927  32.111  1.00 23.43  ? 401 GLY B N   1 
ATOM   5064 C CA  . GLY B 1 332 ? 14.250 3.881  31.158  1.00 22.66  ? 401 GLY B CA  1 
ATOM   5065 C C   . GLY B 1 332 ? 14.078 4.439  29.759  1.00 21.38  ? 401 GLY B C   1 
ATOM   5066 O O   . GLY B 1 332 ? 13.561 5.546  29.583  1.00 18.84  ? 401 GLY B O   1 
ATOM   5067 N N   . PHE B 1 333 ? 14.509 3.665  28.768  1.00 19.54  ? 402 PHE B N   1 
ATOM   5068 C CA  . PHE B 1 333 ? 14.459 4.073  27.370  1.00 15.58  ? 402 PHE B CA  1 
ATOM   5069 C C   . PHE B 1 333 ? 13.702 3.035  26.560  1.00 25.05  ? 402 PHE B C   1 
ATOM   5070 O O   . PHE B 1 333 ? 14.010 1.840  26.624  1.00 30.21  ? 402 PHE B O   1 
ATOM   5071 C CB  . PHE B 1 333 ? 15.861 4.246  26.786  1.00 15.32  ? 402 PHE B CB  1 
ATOM   5072 C CG  . PHE B 1 333 ? 16.607 5.435  27.321  1.00 29.00  ? 402 PHE B CG  1 
ATOM   5073 C CD1 . PHE B 1 333 ? 16.092 6.716  27.188  1.00 14.61  ? 402 PHE B CD1 1 
ATOM   5074 C CD2 . PHE B 1 333 ? 17.841 5.271  27.937  1.00 22.63  ? 402 PHE B CD2 1 
ATOM   5075 C CE1 . PHE B 1 333 ? 16.790 7.811  27.673  1.00 26.06  ? 402 PHE B CE1 1 
ATOM   5076 C CE2 . PHE B 1 333 ? 18.542 6.362  28.418  1.00 19.95  ? 402 PHE B CE2 1 
ATOM   5077 C CZ  . PHE B 1 333 ? 18.016 7.632  28.288  1.00 14.34  ? 402 PHE B CZ  1 
ATOM   5078 N N   . ALA B 1 334 ? 12.725 3.495  25.792  1.00 30.49  ? 403 ALA B N   1 
ATOM   5079 C CA  . ALA B 1 334 ? 12.033 2.657  24.830  1.00 30.05  ? 403 ALA B CA  1 
ATOM   5080 C C   . ALA B 1 334 ? 12.104 3.324  23.468  1.00 24.00  ? 403 ALA B C   1 
ATOM   5081 O O   . ALA B 1 334 ? 12.177 4.552  23.365  1.00 21.80  ? 403 ALA B O   1 
ATOM   5082 C CB  . ALA B 1 334 ? 10.573 2.422  25.227  1.00 27.41  ? 403 ALA B CB  1 
ATOM   5083 N N   . LEU B 1 335 ? 12.100 2.506  22.424  1.00 28.70  ? 404 LEU B N   1 
ATOM   5084 C CA  . LEU B 1 335 ? 12.065 3.033  21.065  1.00 26.51  ? 404 LEU B CA  1 
ATOM   5085 C C   . LEU B 1 335 ? 10.717 3.703  20.809  1.00 25.53  ? 404 LEU B C   1 
ATOM   5086 O O   . LEU B 1 335 ? 9.674  3.042  20.826  1.00 37.27  ? 404 LEU B O   1 
ATOM   5087 C CB  . LEU B 1 335 ? 12.315 1.913  20.064  1.00 27.57  ? 404 LEU B CB  1 
ATOM   5088 C CG  . LEU B 1 335 ? 12.426 2.325  18.599  1.00 33.07  ? 404 LEU B CG  1 
ATOM   5089 C CD1 . LEU B 1 335 ? 13.806 2.895  18.306  1.00 32.06  ? 404 LEU B CD1 1 
ATOM   5090 C CD2 . LEU B 1 335 ? 12.116 1.142  17.709  1.00 24.93  ? 404 LEU B CD2 1 
ATOM   5091 N N   . ALA B 1 336 ? 10.741 5.010  20.565  1.00 28.59  ? 405 ALA B N   1 
ATOM   5092 C CA  . ALA B 1 336 ? 9.529  5.811  20.495  1.00 33.57  ? 405 ALA B CA  1 
ATOM   5093 C C   . ALA B 1 336 ? 8.783  5.601  19.183  1.00 42.03  ? 405 ALA B C   1 
ATOM   5094 O O   . ALA B 1 336 ? 9.374  5.308  18.141  1.00 49.86  ? 405 ALA B O   1 
ATOM   5095 C CB  . ALA B 1 336 ? 9.862  7.295  20.652  1.00 29.87  ? 405 ALA B CB  1 
ATOM   5096 N N   . ARG B 1 337 ? 7.469  5.778  19.244  1.00 39.83  ? 406 ARG B N   1 
ATOM   5097 C CA  . ARG B 1 337 ? 6.630  5.728  18.057  1.00 36.30  ? 406 ARG B CA  1 
ATOM   5098 C C   . ARG B 1 337 ? 5.440  6.667  18.221  1.00 40.46  ? 406 ARG B C   1 
ATOM   5099 O O   . ARG B 1 337 ? 4.591  6.760  17.336  1.00 43.81  ? 406 ARG B O   1 
ATOM   5100 C CB  . ARG B 1 337 ? 6.148  4.303  17.792  1.00 23.69  ? 406 ARG B CB  1 
ATOM   5101 C CG  . ARG B 1 337 ? 5.189  3.783  18.845  1.00 24.57  ? 406 ARG B CG  1 
ATOM   5102 C CD  . ARG B 1 337 ? 4.964  2.296  18.682  1.00 40.48  ? 406 ARG B CD  1 
ATOM   5103 N NE  . ARG B 1 337 ? 4.223  1.731  19.802  1.00 47.62  ? 406 ARG B NE  1 
ATOM   5104 C CZ  . ARG B 1 337 ? 2.900  1.624  19.837  1.00 48.49  ? 406 ARG B CZ  1 
ATOM   5105 N NH1 . ARG B 1 337 ? 2.307  1.092  20.894  1.00 45.79  ? 406 ARG B NH1 1 
ATOM   5106 N NH2 . ARG B 1 337 ? 2.172  2.058  18.816  1.00 48.00  ? 406 ARG B NH2 1 
HETATM 5107 C C1  . NAG C 2 .   ? 13.807 41.032 -13.060 1.00 39.75  ? 501 NAG A C1  1 
HETATM 5108 C C2  . NAG C 2 .   ? 13.001 41.454 -14.293 1.00 31.52  ? 501 NAG A C2  1 
HETATM 5109 C C3  . NAG C 2 .   ? 13.456 40.689 -15.509 1.00 41.56  ? 501 NAG A C3  1 
HETATM 5110 C C4  . NAG C 2 .   ? 14.941 40.940 -15.714 1.00 46.59  ? 501 NAG A C4  1 
HETATM 5111 C C5  . NAG C 2 .   ? 15.774 40.626 -14.464 1.00 39.49  ? 501 NAG A C5  1 
HETATM 5112 C C6  . NAG C 2 .   ? 17.193 41.178 -14.613 1.00 39.18  ? 501 NAG A C6  1 
HETATM 5113 C C7  . NAG C 2 .   ? 10.682 42.242 -14.374 1.00 43.94  ? 501 NAG A C7  1 
HETATM 5114 C C8  . NAG C 2 .   ? 9.257  41.940 -14.038 1.00 47.51  ? 501 NAG A C8  1 
HETATM 5115 N N2  . NAG C 2 .   ? 11.574 41.279 -14.096 1.00 44.29  ? 501 NAG A N2  1 
HETATM 5116 O O3  . NAG C 2 .   ? 12.646 41.163 -16.592 1.00 51.90  ? 501 NAG A O3  1 
HETATM 5117 O O4  . NAG C 2 .   ? 15.388 40.166 -16.814 1.00 42.80  ? 501 NAG A O4  1 
HETATM 5118 O O5  . NAG C 2 .   ? 15.186 41.240 -13.294 1.00 42.31  ? 501 NAG A O5  1 
HETATM 5119 O O6  . NAG C 2 .   ? 18.056 40.981 -13.497 1.00 47.84  ? 501 NAG A O6  1 
HETATM 5120 O O7  . NAG C 2 .   ? 11.015 43.318 -14.869 1.00 40.76  ? 501 NAG A O7  1 
HETATM 5121 C C01 . 90D D 3 .   ? 27.224 38.576 24.430  1.00 45.25  ? 502 90D A C01 1 
HETATM 5122 C C02 . 90D D 3 .   ? 27.655 37.160 24.148  1.00 47.89  ? 502 90D A C02 1 
HETATM 5123 C C03 . 90D D 3 .   ? 27.769 36.815 22.660  1.00 57.15  ? 502 90D A C03 1 
HETATM 5124 C C04 . 90D D 3 .   ? 28.930 36.255 22.144  1.00 56.63  ? 502 90D A C04 1 
HETATM 5125 C C05 . 90D D 3 .   ? 29.026 35.939 20.800  1.00 51.52  ? 502 90D A C05 1 
HETATM 5126 C C06 . 90D D 3 .   ? 27.960 36.174 19.952  1.00 52.04  ? 502 90D A C06 1 
HETATM 5127 C C07 . 90D D 3 .   ? 26.779 36.734 20.438  1.00 56.98  ? 502 90D A C07 1 
HETATM 5128 C C08 . 90D D 3 .   ? 26.703 37.039 21.797  1.00 55.87  ? 502 90D A C08 1 
HETATM 5129 C C09 . 90D D 3 .   ? 25.624 37.006 19.524  1.00 56.60  ? 502 90D A C09 1 
HETATM 5130 C C10 . 90D D 3 .   ? 24.839 35.937 19.110  1.00 55.90  ? 502 90D A C10 1 
HETATM 5131 F F11 . 90D D 3 .   ? 25.157 34.707 19.574  1.00 64.31  ? 502 90D A F11 1 
HETATM 5132 C C12 . 90D D 3 .   ? 23.766 36.059 18.271  1.00 44.03  ? 502 90D A C12 1 
HETATM 5133 C C13 . 90D D 3 .   ? 23.446 37.318 17.797  1.00 36.54  ? 502 90D A C13 1 
HETATM 5134 C C14 . 90D D 3 .   ? 24.196 38.424 18.170  1.00 38.41  ? 502 90D A C14 1 
HETATM 5135 C C15 . 90D D 3 .   ? 25.291 38.296 19.025  1.00 51.16  ? 502 90D A C15 1 
HETATM 5136 C C16 . 90D D 3 .   ? 26.101 39.557 19.419  1.00 46.79  ? 502 90D A C16 1 
HETATM 5137 O O17 . 90D D 3 .   ? 25.583 40.674 18.691  1.00 41.35  ? 502 90D A O17 1 
HETATM 5138 C C18 . 90D D 3 .   ? 27.605 39.445 19.108  1.00 36.34  ? 502 90D A C18 1 
HETATM 5139 C C19 . 90D D 3 .   ? 28.042 39.994 17.770  1.00 41.67  ? 502 90D A C19 1 
HETATM 5140 C C20 . 90D D 3 .   ? 28.484 38.929 16.787  1.00 48.78  ? 502 90D A C20 1 
HETATM 5141 N N21 . 90D D 3 .   ? 29.936 38.951 16.550  1.00 47.58  ? 502 90D A N21 1 
HETATM 5142 C C22 . 90D D 3 .   ? 30.458 39.379 15.388  1.00 42.35  ? 502 90D A C22 1 
HETATM 5143 O O23 . 90D D 3 .   ? 30.580 40.544 15.077  1.00 40.77  ? 502 90D A O23 1 
HETATM 5144 O O24 . 90D D 3 .   ? 30.830 38.347 14.616  1.00 41.40  ? 502 90D A O24 1 
HETATM 5145 C C25 . 90D D 3 .   ? 31.469 38.701 13.362  1.00 29.46  ? 502 90D A C25 1 
HETATM 5146 C C26 . 90D D 3 .   ? 25.690 40.030 20.888  1.00 51.79  ? 502 90D A C26 1 
HETATM 5147 C C28 . 90D D 3 .   ? 24.192 40.085 21.233  1.00 34.72  ? 502 90D A C28 1 
HETATM 5148 C C29 . 90D D 3 .   ? 23.964 40.540 22.676  1.00 30.47  ? 502 90D A C29 1 
HETATM 5149 C C30 . 90D D 3 .   ? 24.700 41.836 22.954  1.00 39.14  ? 502 90D A C30 1 
HETATM 5150 N N31 . 90D D 3 .   ? 26.125 41.723 22.567  1.00 53.90  ? 502 90D A N31 1 
HETATM 5151 C C32 . 90D D 3 .   ? 26.309 41.340 21.168  1.00 55.65  ? 502 90D A C32 1 
HETATM 5152 C C33 . 90D D 3 .   ? 27.172 41.929 23.396  1.00 55.53  ? 502 90D A C33 1 
HETATM 5153 O O34 . 90D D 3 .   ? 28.329 41.815 23.018  1.00 53.74  ? 502 90D A O34 1 
HETATM 5154 C C35 . 90D D 3 .   ? 26.867 42.314 24.828  1.00 46.52  ? 502 90D A C35 1 
HETATM 5155 C C36 . 90D D 3 .   ? 28.128 42.483 25.663  1.00 48.77  ? 502 90D A C36 1 
HETATM 5156 C C37 . 90D D 3 .   ? 27.942 43.430 26.834  1.00 51.30  ? 502 90D A C37 1 
HETATM 5157 N N38 . 90D D 3 .   ? 28.126 42.762 28.124  1.00 53.56  ? 502 90D A N38 1 
HETATM 5158 C C39 . 90D D 3 .   ? 28.104 43.733 29.220  1.00 61.42  ? 502 90D A C39 1 
HETATM 5159 C C01 . 90D E 3 .   ? 23.857 43.345 9.476   1.00 49.77  ? 503 90D A C01 1 
HETATM 5160 C C02 . 90D E 3 .   ? 23.840 41.969 8.872   1.00 35.31  ? 503 90D A C02 1 
HETATM 5161 C C03 . 90D E 3 .   ? 23.552 40.908 9.842   1.00 26.44  ? 503 90D A C03 1 
HETATM 5162 C C04 . 90D E 3 .   ? 23.552 39.576 9.458   1.00 22.81  ? 503 90D A C04 1 
HETATM 5163 C C05 . 90D E 3 .   ? 23.284 38.579 10.374  1.00 24.95  ? 503 90D A C05 1 
HETATM 5164 C C06 . 90D E 3 .   ? 23.013 38.898 11.692  1.00 25.61  ? 503 90D A C06 1 
HETATM 5165 C C07 . 90D E 3 .   ? 23.016 40.225 12.116  1.00 26.34  ? 503 90D A C07 1 
HETATM 5166 C C08 . 90D E 3 .   ? 23.273 41.216 11.171  1.00 25.24  ? 503 90D A C08 1 
HETATM 5167 C C09 . 90D E 3 .   ? 22.696 40.572 13.539  1.00 32.67  ? 503 90D A C09 1 
HETATM 5168 C C10 . 90D E 3 .   ? 21.364 40.495 13.923  1.00 36.00  ? 503 90D A C10 1 
HETATM 5169 F F11 . 90D E 3 .   ? 20.459 40.140 12.981  1.00 36.05  ? 503 90D A F11 1 
HETATM 5170 C C12 . 90D E 3 .   ? 20.915 40.761 15.186  1.00 29.04  ? 503 90D A C12 1 
HETATM 5171 C C13 . 90D E 3 .   ? 21.841 41.114 16.146  1.00 16.21  ? 503 90D A C13 1 
HETATM 5172 C C14 . 90D E 3 .   ? 23.185 41.203 15.826  1.00 22.47  ? 503 90D A C14 1 
HETATM 5173 C C15 . 90D E 3 .   ? 23.641 40.941 14.536  1.00 30.01  ? 503 90D A C15 1 
HETATM 5174 C C16 . 90D E 3 .   ? 25.154 41.046 14.235  1.00 24.71  ? 503 90D A C16 1 
HETATM 5175 O O17 . 90D E 3 .   ? 25.848 41.119 15.481  1.00 26.40  ? 503 90D A O17 1 
HETATM 5176 C C18 . 90D E 3 .   ? 25.530 42.290 13.413  1.00 13.52  ? 503 90D A C18 1 
HETATM 5177 C C19 . 90D E 3 .   ? 24.854 43.584 13.823  1.00 16.37  ? 503 90D A C19 1 
HETATM 5178 C C20 . 90D E 3 .   ? 24.899 44.630 12.730  1.00 11.62  ? 503 90D A C20 1 
HETATM 5179 N N21 . 90D E 3 .   ? 26.262 44.980 12.374  1.00 20.89  ? 503 90D A N21 1 
HETATM 5180 C C22 . 90D E 3 .   ? 26.890 46.026 12.931  1.00 30.21  ? 503 90D A C22 1 
HETATM 5181 O O23 . 90D E 3 .   ? 26.335 46.954 13.477  1.00 27.47  ? 503 90D A O23 1 
HETATM 5182 O O24 . 90D E 3 .   ? 28.216 45.908 12.814  1.00 30.02  ? 503 90D A O24 1 
HETATM 5183 C C25 . 90D E 3 .   ? 28.993 46.935 13.472  1.00 23.86  ? 503 90D A C25 1 
HETATM 5184 C C26 . 90D E 3 .   ? 25.713 39.652 13.709  1.00 29.13  ? 503 90D A C26 1 
HETATM 5185 C C28 . 90D E 3 .   ? 25.507 38.408 14.591  1.00 26.32  ? 503 90D A C28 1 
HETATM 5186 C C29 . 90D E 3 .   ? 26.155 37.150 13.976  1.00 23.15  ? 503 90D A C29 1 
HETATM 5187 C C30 . 90D E 3 .   ? 27.588 37.427 13.563  1.00 23.28  ? 503 90D A C30 1 
HETATM 5188 N N31 . 90D E 3 .   ? 27.646 38.597 12.699  1.00 19.58  ? 503 90D A N31 1 
HETATM 5189 C C32 . 90D E 3 .   ? 27.153 39.793 13.368  1.00 24.10  ? 503 90D A C32 1 
HETATM 5190 C C33 . 90D E 3 .   ? 28.055 38.569 11.417  1.00 19.09  ? 503 90D A C33 1 
HETATM 5191 O O34 . 90D E 3 .   ? 28.449 37.543 10.888  1.00 25.61  ? 503 90D A O34 1 
HETATM 5192 C C35 . 90D E 3 .   ? 28.024 39.861 10.649  1.00 22.10  ? 503 90D A C35 1 
HETATM 5193 C C36 . 90D E 3 .   ? 28.035 39.631 9.145   1.00 29.37  ? 503 90D A C36 1 
HETATM 5194 C C37 . 90D E 3 .   ? 27.881 40.902 8.351   1.00 29.98  ? 503 90D A C37 1 
HETATM 5195 N N38 . 90D E 3 .   ? 28.890 41.027 7.306   1.00 29.89  ? 503 90D A N38 1 
HETATM 5196 C C39 . 90D E 3 .   ? 28.675 40.031 6.249   1.00 35.40  ? 503 90D A C39 1 
HETATM 5197 C C1  . NAG F 2 .   ? 10.162 32.116 52.121  1.00 74.52  ? 501 NAG B C1  1 
HETATM 5198 C C2  . NAG F 2 .   ? 10.271 32.522 53.581  1.00 79.19  ? 501 NAG B C2  1 
HETATM 5199 C C3  . NAG F 2 .   ? 11.302 31.653 54.276  1.00 88.13  ? 501 NAG B C3  1 
HETATM 5200 C C4  . NAG F 2 .   ? 10.780 30.229 54.399  1.00 93.77  ? 501 NAG B C4  1 
HETATM 5201 C C5  . NAG F 2 .   ? 10.114 29.755 53.101  1.00 89.31  ? 501 NAG B C5  1 
HETATM 5202 C C6  . NAG F 2 .   ? 8.615  29.564 53.213  1.00 84.76  ? 501 NAG B C6  1 
HETATM 5203 C C7  . NAG F 2 .   ? 9.741  34.918 53.554  1.00 79.21  ? 501 NAG B C7  1 
HETATM 5204 C C8  . NAG F 2 .   ? 10.282 36.308 53.706  1.00 77.91  ? 501 NAG B C8  1 
HETATM 5205 N N2  . NAG F 2 .   ? 10.626 33.926 53.700  1.00 79.32  ? 501 NAG B N2  1 
HETATM 5206 O O3  . NAG F 2 .   ? 11.579 32.182 55.567  1.00 89.52  ? 501 NAG B O3  1 
HETATM 5207 O O4  . NAG F 2 .   ? 11.856 29.354 54.720  1.00 95.60  ? 501 NAG B O4  1 
HETATM 5208 O O5  . NAG F 2 .   ? 10.359 30.637 51.985  1.00 86.32  ? 501 NAG B O5  1 
HETATM 5209 O O6  . NAG F 2 .   ? 8.274  28.201 53.432  1.00 78.41  ? 501 NAG B O6  1 
HETATM 5210 O O7  . NAG F 2 .   ? 8.556  34.702 53.314  1.00 74.05  ? 501 NAG B O7  1 
HETATM 5211 C C01 . 90D G 3 .   ? 20.808 26.122 14.826  1.00 54.87  ? 502 90D B C01 1 
HETATM 5212 C C02 . 90D G 3 .   ? 22.150 26.641 15.207  1.00 64.61  ? 502 90D B C02 1 
HETATM 5213 C C03 . 90D G 3 .   ? 22.449 26.717 16.726  1.00 65.43  ? 502 90D B C03 1 
HETATM 5214 C C04 . 90D G 3 .   ? 23.541 26.060 17.277  1.00 58.64  ? 502 90D B C04 1 
HETATM 5215 C C05 . 90D G 3 .   ? 23.797 26.131 18.637  1.00 55.36  ? 502 90D B C05 1 
HETATM 5216 C C06 . 90D G 3 .   ? 22.965 26.862 19.464  1.00 53.90  ? 502 90D B C06 1 
HETATM 5217 C C07 . 90D G 3 .   ? 21.862 27.536 18.940  1.00 62.51  ? 502 90D B C07 1 
HETATM 5218 C C08 . 90D G 3 .   ? 21.635 27.460 17.567  1.00 65.61  ? 502 90D B C08 1 
HETATM 5219 C C09 . 90D G 3 .   ? 20.955 28.337 19.827  1.00 61.44  ? 502 90D B C09 1 
HETATM 5220 C C10 . 90D G 3 .   ? 21.504 29.413 20.518  1.00 58.90  ? 502 90D B C10 1 
HETATM 5221 F F11 . 90D G 3 .   ? 22.819 29.673 20.334  1.00 66.59  ? 502 90D B F11 1 
HETATM 5222 C C12 . 90D G 3 .   ? 20.795 30.220 21.367  1.00 42.75  ? 502 90D B C12 1 
HETATM 5223 C C13 . 90D G 3 .   ? 19.453 29.951 21.554  1.00 38.19  ? 502 90D B C13 1 
HETATM 5224 C C14 . 90D G 3 .   ? 18.848 28.890 20.894  1.00 51.15  ? 502 90D B C14 1 
HETATM 5225 C C15 . 90D G 3 .   ? 19.570 28.065 20.029  1.00 53.44  ? 502 90D B C15 1 
HETATM 5226 C C16 . 90D G 3 .   ? 18.840 26.894 19.305  1.00 34.32  ? 502 90D B C16 1 
HETATM 5227 O O17 . 90D G 3 .   ? 17.482 26.842 19.748  1.00 32.91  ? 502 90D B O17 1 
HETATM 5228 C C18 . 90D G 3 .   ? 19.476 25.509 19.526  1.00 22.42  ? 502 90D B C18 1 
HETATM 5229 C C19 . 90D G 3 .   ? 20.081 25.271 20.898  1.00 26.49  ? 502 90D B C19 1 
HETATM 5230 C C20 . 90D G 3 .   ? 20.926 24.019 20.936  1.00 47.69  ? 502 90D B C20 1 
HETATM 5231 N N21 . 90D G 3 .   ? 21.532 23.802 22.243  1.00 55.15  ? 502 90D B N21 1 
HETATM 5232 C C22 . 90D G 3 .   ? 21.176 22.773 23.026  1.00 47.13  ? 502 90D B C22 1 
HETATM 5233 O O23 . 90D G 3 .   ? 20.111 22.197 22.965  1.00 47.63  ? 502 90D B O23 1 
HETATM 5234 O O24 . 90D G 3 .   ? 22.154 22.467 23.889  1.00 40.80  ? 502 90D B O24 1 
HETATM 5235 C C25 . 90D G 3 .   ? 21.927 21.291 24.708  1.00 29.21  ? 502 90D B C25 1 
HETATM 5236 C C26 . 90D G 3 .   ? 18.411 27.310 17.819  1.00 39.84  ? 502 90D B C26 1 
HETATM 5237 C C28 . 90D G 3 .   ? 17.644 28.615 17.687  1.00 41.08  ? 502 90D B C28 1 
HETATM 5238 C C29 . 90D G 3 .   ? 17.295 28.903 16.240  1.00 39.08  ? 502 90D B C29 1 
HETATM 5239 C C30 . 90D G 3 .   ? 16.506 27.763 15.642  1.00 36.51  ? 502 90D B C30 1 
HETATM 5240 N N31 . 90D G 3 .   ? 17.212 26.479 15.817  1.00 48.30  ? 502 90D B N31 1 
HETATM 5241 C C32 . 90D G 3 .   ? 17.601 26.181 17.204  1.00 48.20  ? 502 90D B C32 1 
HETATM 5242 C C33 . 90D G 3 .   ? 17.447 25.623 14.797  1.00 53.26  ? 502 90D B C33 1 
HETATM 5243 O O34 . 90D G 3 .   ? 18.016 24.555 14.964  1.00 43.78  ? 502 90D B O34 1 
HETATM 5244 C C35 . 90D G 3 .   ? 16.986 26.036 13.419  1.00 60.88  ? 502 90D B C35 1 
HETATM 5245 C C36 . 90D G 3 .   ? 17.368 25.027 12.343  1.00 66.10  ? 502 90D B C36 1 
HETATM 5246 C C37 . 90D G 3 .   ? 16.923 25.451 10.950  1.00 72.22  ? 502 90D B C37 1 
HETATM 5247 N N38 . 90D G 3 .   ? 17.196 24.427 9.941   1.00 76.61  ? 502 90D B N38 1 
HETATM 5248 C C39 . 90D G 3 .   ? 16.051 23.526 9.788   1.00 78.56  ? 502 90D B C39 1 
HETATM 5249 C C01 . 90D H 3 .   ? 15.497 25.850 30.817  1.00 49.41  ? 503 90D B C01 1 
HETATM 5250 C C02 . 90D H 3 .   ? 14.922 26.310 29.509  1.00 26.12  ? 503 90D B C02 1 
HETATM 5251 C C03 . 90D H 3 .   ? 15.846 27.245 28.717  1.00 27.65  ? 503 90D B C03 1 
HETATM 5252 C C04 . 90D H 3 .   ? 16.961 27.822 29.311  1.00 28.93  ? 503 90D B C04 1 
HETATM 5253 C C05 . 90D H 3 .   ? 17.793 28.662 28.589  1.00 22.21  ? 503 90D B C05 1 
HETATM 5254 C C06 . 90D H 3 .   ? 17.521 28.937 27.262  1.00 29.89  ? 503 90D B C06 1 
HETATM 5255 C C07 . 90D H 3 .   ? 16.419 28.359 26.631  1.00 35.79  ? 503 90D B C07 1 
HETATM 5256 C C08 . 90D H 3 .   ? 15.588 27.531 27.382  1.00 31.86  ? 503 90D B C08 1 
HETATM 5257 C C09 . 90D H 3 .   ? 16.105 28.667 25.200  1.00 36.70  ? 503 90D B C09 1 
HETATM 5258 C C10 . 90D H 3 .   ? 15.556 29.910 24.933  1.00 44.11  ? 503 90D B C10 1 
HETATM 5259 F F11 . 90D H 3 .   ? 15.342 30.734 25.983  1.00 53.02  ? 503 90D B F11 1 
HETATM 5260 C C12 . 90D H 3 .   ? 15.221 30.346 23.683  1.00 42.09  ? 503 90D B C12 1 
HETATM 5261 C C13 . 90D H 3 .   ? 15.441 29.497 22.618  1.00 39.62  ? 503 90D B C13 1 
HETATM 5262 C C14 . 90D H 3 .   ? 15.990 28.242 22.821  1.00 32.51  ? 503 90D B C14 1 
HETATM 5263 C C15 . 90D H 3 .   ? 16.327 27.801 24.096  1.00 33.16  ? 503 90D B C15 1 
HETATM 5264 C C16 . 90D H 3 .   ? 16.930 26.395 24.270  1.00 31.93  ? 503 90D B C16 1 
HETATM 5265 O O17 . 90D H 3 .   ? 17.251 25.907 22.968  1.00 33.05  ? 503 90D B O17 1 
HETATM 5266 C C18 . 90D H 3 .   ? 15.943 25.402 24.922  1.00 21.48  ? 503 90D B C18 1 
HETATM 5267 C C19 . 90D H 3 .   ? 14.496 25.509 24.471  1.00 18.76  ? 503 90D B C19 1 
HETATM 5268 C C20 . 90D H 3 .   ? 13.541 24.714 25.330  1.00 18.31  ? 503 90D B C20 1 
HETATM 5269 N N21 . 90D H 3 .   ? 13.982 23.358 25.493  1.00 26.45  ? 503 90D B N21 1 
HETATM 5270 C C22 . 90D H 3 .   ? 13.425 22.351 24.812  1.00 34.52  ? 503 90D B C22 1 
HETATM 5271 O O23 . 90D H 3 .   ? 12.385 22.428 24.190  1.00 26.76  ? 503 90D B O23 1 
HETATM 5272 O O24 . 90D H 3 .   ? 14.165 21.240 24.911  1.00 30.75  ? 503 90D B O24 1 
HETATM 5273 C C25 . 90D H 3 .   ? 13.615 20.065 24.272  1.00 24.59  ? 503 90D B C25 1 
HETATM 5274 C C26 . 90D H 3 .   ? 18.407 26.516 24.852  1.00 34.23  ? 503 90D B C26 1 
HETATM 5275 C C28 . 90D H 3 .   ? 19.427 27.271 23.997  1.00 40.11  ? 503 90D B C28 1 
HETATM 5276 C C29 . 90D H 3 .   ? 20.814 27.304 24.657  1.00 31.26  ? 503 90D B C29 1 
HETATM 5277 C C30 . 90D H 3 .   ? 21.243 25.914 25.089  1.00 25.92  ? 503 90D B C30 1 
HETATM 5278 N N31 . 90D H 3 .   ? 20.191 25.282 25.882  1.00 33.44  ? 503 90D B N31 1 
HETATM 5279 C C32 . 90D H 3 .   ? 18.930 25.190 25.152  1.00 29.03  ? 503 90D B C32 1 
HETATM 5280 C C33 . 90D H 3 .   ? 20.338 24.865 27.156  1.00 33.03  ? 503 90D B C33 1 
HETATM 5281 O O34 . 90D H 3 .   ? 21.400 24.964 27.751  1.00 33.32  ? 503 90D B O34 1 
HETATM 5282 C C35 . 90D H 3 .   ? 19.135 24.256 27.830  1.00 29.88  ? 503 90D B C35 1 
HETATM 5283 C C36 . 90D H 3 .   ? 19.462 23.725 29.216  1.00 31.57  ? 503 90D B C36 1 
HETATM 5284 C C37 . 90D H 3 .   ? 18.247 23.237 29.961  1.00 34.81  ? 503 90D B C37 1 
HETATM 5285 N N38 . 90D H 3 .   ? 18.603 22.491 31.148  1.00 44.32  ? 503 90D B N38 1 
HETATM 5286 C C39 . 90D H 3 .   ? 19.268 23.357 32.125  1.00 38.02  ? 503 90D B C39 1 
HETATM 5287 O O   . HOH I 4 .   ? 36.823 34.804 11.202  1.00 13.76  ? 601 HOH A O   1 
HETATM 5288 O O   . HOH I 4 .   ? 33.877 36.778 22.658  1.00 33.23  ? 602 HOH A O   1 
HETATM 5289 O O   . HOH I 4 .   ? 31.483 45.126 19.392  1.00 23.46  ? 603 HOH A O   1 
HETATM 5290 O O   . HOH I 4 .   ? 16.585 40.205 -18.982 1.00 41.84  ? 604 HOH A O   1 
HETATM 5291 O O   . HOH I 4 .   ? 34.730 28.307 16.277  1.00 34.69  ? 605 HOH A O   1 
HETATM 5292 O O   . HOH I 4 .   ? 49.183 50.412 23.563  1.00 32.28  ? 606 HOH A O   1 
HETATM 5293 O O   . HOH I 4 .   ? 33.918 42.783 0.890   1.00 25.25  ? 607 HOH A O   1 
HETATM 5294 O O   . HOH I 4 .   ? 32.240 42.703 -2.002  1.00 31.81  ? 608 HOH A O   1 
HETATM 5295 O O   . HOH I 4 .   ? 25.470 44.854 22.957  1.00 60.49  ? 609 HOH A O   1 
HETATM 5296 O O   . HOH I 4 .   ? 30.570 46.416 -7.860  1.00 38.45  ? 610 HOH A O   1 
HETATM 5297 O O   . HOH I 4 .   ? 8.558  43.011 -6.989  1.00 21.06  ? 611 HOH A O   1 
HETATM 5298 O O   . HOH I 4 .   ? 22.821 44.522 -4.833  1.00 23.42  ? 612 HOH A O   1 
HETATM 5299 O O   . HOH I 4 .   ? 25.108 40.348 -0.328  1.00 22.54  ? 613 HOH A O   1 
HETATM 5300 O O   . HOH I 4 .   ? 36.908 49.222 20.261  1.00 22.17  ? 614 HOH A O   1 
HETATM 5301 O O   . HOH I 4 .   ? 23.912 43.320 19.613  1.00 31.41  ? 615 HOH A O   1 
HETATM 5302 O O   . HOH I 4 .   ? 32.256 59.716 9.162   1.00 26.79  ? 616 HOH A O   1 
HETATM 5303 O O   . HOH I 4 .   ? 23.293 41.998 2.205   1.00 22.80  ? 617 HOH A O   1 
HETATM 5304 O O   . HOH I 4 .   ? 37.433 59.031 -6.943  1.00 45.82  ? 618 HOH A O   1 
HETATM 5305 O O   . HOH I 4 .   ? 31.139 42.316 29.570  1.00 25.64  ? 619 HOH A O   1 
HETATM 5306 O O   . HOH I 4 .   ? 31.401 49.216 -2.905  1.00 30.49  ? 620 HOH A O   1 
HETATM 5307 O O   . HOH I 4 .   ? 26.381 50.481 9.752   1.00 20.81  ? 621 HOH A O   1 
HETATM 5308 O O   . HOH I 4 .   ? 37.649 32.260 8.616   1.00 30.83  ? 622 HOH A O   1 
HETATM 5309 O O   . HOH I 4 .   ? 48.103 51.408 17.002  1.00 23.86  ? 623 HOH A O   1 
HETATM 5310 O O   . HOH I 4 .   ? 28.291 56.838 20.737  1.00 37.20  ? 624 HOH A O   1 
HETATM 5311 O O   . HOH I 4 .   ? 37.446 70.224 -3.916  1.00 82.19  ? 625 HOH A O   1 
HETATM 5312 O O   . HOH I 4 .   ? 29.413 32.677 33.909  1.00 44.60  ? 626 HOH A O   1 
HETATM 5313 O O   . HOH I 4 .   ? 23.700 46.995 -2.359  1.00 21.27  ? 627 HOH A O   1 
HETATM 5314 O O   . HOH I 4 .   ? 15.731 42.983 11.224  1.00 44.54  ? 628 HOH A O   1 
HETATM 5315 O O   . HOH I 4 .   ? 10.873 38.495 -13.236 1.00 22.15  ? 629 HOH A O   1 
HETATM 5316 O O   . HOH I 4 .   ? 53.656 45.061 10.188  1.00 27.86  ? 630 HOH A O   1 
HETATM 5317 O O   . HOH I 4 .   ? 34.902 46.672 23.032  1.00 20.40  ? 631 HOH A O   1 
HETATM 5318 O O   . HOH I 4 .   ? 23.815 56.668 19.223  1.00 32.11  ? 632 HOH A O   1 
HETATM 5319 O O   . HOH I 4 .   ? 37.058 51.047 28.063  1.00 65.00  ? 633 HOH A O   1 
HETATM 5320 O O   . HOH I 4 .   ? 49.171 47.322 0.585   1.00 37.74  ? 634 HOH A O   1 
HETATM 5321 O O   . HOH I 4 .   ? 33.135 32.352 19.379  1.00 28.71  ? 635 HOH A O   1 
HETATM 5322 O O   . HOH I 4 .   ? 2.268  41.316 7.859   1.00 36.53  ? 636 HOH A O   1 
HETATM 5323 O O   . HOH I 4 .   ? 20.480 54.546 -10.612 1.00 26.78  ? 637 HOH A O   1 
HETATM 5324 O O   . HOH I 4 .   ? 30.067 33.729 7.078   1.00 31.66  ? 638 HOH A O   1 
HETATM 5325 O O   . HOH I 4 .   ? 27.727 48.873 25.922  1.00 55.68  ? 639 HOH A O   1 
HETATM 5326 O O   . HOH I 4 .   ? 35.731 42.829 44.082  1.00 24.52  ? 640 HOH A O   1 
HETATM 5327 O O   . HOH I 4 .   ? 28.882 36.835 35.303  1.00 24.71  ? 641 HOH A O   1 
HETATM 5328 O O   . HOH I 4 .   ? 24.645 43.660 26.773  1.00 56.51  ? 642 HOH A O   1 
HETATM 5329 O O   . HOH I 4 .   ? 18.526 43.018 -16.731 1.00 43.68  ? 643 HOH A O   1 
HETATM 5330 O O   . HOH I 4 .   ? 7.198  62.177 -0.538  1.00 52.60  ? 644 HOH A O   1 
HETATM 5331 O O   . HOH I 4 .   ? 12.390 44.218 18.728  1.00 33.02  ? 645 HOH A O   1 
HETATM 5332 O O   . HOH J 4 .   ? 2.801  3.938  36.291  1.00 51.09  ? 601 HOH B O   1 
HETATM 5333 O O   . HOH J 4 .   ? 24.950 22.053 15.388  1.00 35.33  ? 602 HOH B O   1 
HETATM 5334 O O   . HOH J 4 .   ? 16.653 19.443 18.126  1.00 14.76  ? 603 HOH B O   1 
HETATM 5335 O O   . HOH J 4 .   ? 16.872 16.181 13.644  1.00 21.55  ? 604 HOH B O   1 
HETATM 5336 O O   . HOH J 4 .   ? 19.194 22.190 8.226   1.00 29.36  ? 605 HOH B O   1 
HETATM 5337 O O   . HOH J 4 .   ? 29.835 18.726 3.937   1.00 48.13  ? 606 HOH B O   1 
HETATM 5338 O O   . HOH J 4 .   ? 15.535 0.701  24.982  1.00 45.80  ? 607 HOH B O   1 
HETATM 5339 O O   . HOH J 4 .   ? 9.123  20.402 27.957  1.00 25.16  ? 608 HOH B O   1 
HETATM 5340 O O   . HOH J 4 .   ? 27.596 18.691 27.145  1.00 21.87  ? 609 HOH B O   1 
HETATM 5341 O O   . HOH J 4 .   ? 14.431 15.892 44.992  1.00 23.65  ? 610 HOH B O   1 
HETATM 5342 O O   . HOH J 4 .   ? 9.858  10.773 22.258  1.00 29.67  ? 611 HOH B O   1 
HETATM 5343 O O   . HOH J 4 .   ? 29.675 25.694 26.845  1.00 21.44  ? 612 HOH B O   1 
HETATM 5344 O O   . HOH J 4 .   ? 29.113 23.782 19.099  1.00 24.14  ? 613 HOH B O   1 
HETATM 5345 O O   . HOH J 4 .   ? 30.065 19.090 29.593  1.00 22.17  ? 614 HOH B O   1 
HETATM 5346 O O   . HOH J 4 .   ? 12.812 21.301 11.832  1.00 32.39  ? 615 HOH B O   1 
HETATM 5347 O O   . HOH J 4 .   ? 15.884 12.991 16.543  1.00 30.73  ? 616 HOH B O   1 
HETATM 5348 O O   . HOH J 4 .   ? 4.372  10.484 27.047  1.00 28.02  ? 617 HOH B O   1 
HETATM 5349 O O   . HOH J 4 .   ? 10.684 26.263 42.222  1.00 30.42  ? 618 HOH B O   1 
HETATM 5350 O O   . HOH J 4 .   ? 2.198  41.765 45.423  1.00 38.11  ? 619 HOH B O   1 
HETATM 5351 O O   . HOH J 4 .   ? -4.423 40.877 33.933  1.00 59.42  ? 620 HOH B O   1 
HETATM 5352 O O   . HOH J 4 .   ? 6.772  48.878 33.594  1.00 54.55  ? 621 HOH B O   1 
HETATM 5353 O O   . HOH J 4 .   ? 7.653  2.434  38.508  1.00 33.67  ? 622 HOH B O   1 
HETATM 5354 O O   . HOH J 4 .   ? 18.475 -0.193 22.605  1.00 27.37  ? 623 HOH B O   1 
HETATM 5355 O O   . HOH J 4 .   ? 27.247 31.691 19.070  1.00 49.24  ? 624 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLY A 1   ? 0.8271 0.7071 0.8460 -0.0726 0.0250  0.0863  70  GLY A N   
2    C CA  . GLY A 1   ? 0.9055 0.7677 0.9276 -0.0659 0.0245  0.0840  70  GLY A CA  
3    C C   . GLY A 1   ? 0.9761 0.8266 1.0011 -0.0703 0.0261  0.0754  70  GLY A C   
4    O O   . GLY A 1   ? 0.9887 0.8453 1.0136 -0.0789 0.0275  0.0719  70  GLY A O   
5    N N   . ASN A 2   ? 0.9720 0.8064 0.9994 -0.0643 0.0259  0.0719  71  ASN A N   
6    C CA  . ASN A 2   ? 1.0261 0.8489 1.0556 -0.0680 0.0271  0.0629  71  ASN A CA  
7    C C   . ASN A 2   ? 1.0821 0.9013 1.1142 -0.0598 0.0262  0.0541  71  ASN A C   
8    O O   . ASN A 2   ? 1.1149 0.9213 1.1483 -0.0611 0.0271  0.0472  71  ASN A O   
9    C CB  . ASN A 2   ? 1.0239 0.8239 1.0526 -0.0723 0.0288  0.0684  71  ASN A CB  
10   N N   . THR A 3   ? 0.9847 0.8155 1.0173 -0.0518 0.0244  0.0541  72  THR A N   
11   C CA  . THR A 3   ? 0.8664 0.6947 0.9013 -0.0436 0.0237  0.0472  72  THR A CA  
12   C C   . THR A 3   ? 0.8120 0.6508 0.8482 -0.0463 0.0233  0.0358  72  THR A C   
13   O O   . THR A 3   ? 0.8595 0.7148 0.8950 -0.0499 0.0225  0.0342  72  THR A O   
14   C CB  . THR A 3   ? 0.8243 0.6619 0.8595 -0.0349 0.0218  0.0524  72  THR A CB  
15   O OG1 . THR A 3   ? 0.9514 0.7775 0.9863 -0.0305 0.0221  0.0625  72  THR A OG1 
16   C CG2 . THR A 3   ? 0.7510 0.5909 0.7889 -0.0275 0.0210  0.0448  72  THR A CG2 
17   N N   . THR A 4   ? 0.6783 0.5076 0.7161 -0.0442 0.0238  0.0279  73  THR A N   
18   C CA  . THR A 4   ? 0.6218 0.4604 0.6608 -0.0446 0.0231  0.0174  73  THR A CA  
19   C C   . THR A 4   ? 0.8377 0.6700 0.8780 -0.0358 0.0229  0.0135  73  THR A C   
20   O O   . THR A 4   ? 0.9285 0.7470 0.9690 -0.0354 0.0241  0.0085  73  THR A O   
21   C CB  . THR A 4   ? 0.4921 0.3273 0.5313 -0.0536 0.0242  0.0111  73  THR A CB  
22   N N   . SER A 5   ? 0.8226 0.6654 0.8637 -0.0289 0.0214  0.0156  74  SER A N   
23   C CA  . SER A 5   ? 0.7204 0.5606 0.7630 -0.0203 0.0213  0.0128  74  SER A CA  
24   C C   . SER A 5   ? 0.6131 0.4631 0.6564 -0.0202 0.0204  0.0034  74  SER A C   
25   O O   . SER A 5   ? 0.5717 0.4337 0.6145 -0.0249 0.0192  0.0007  74  SER A O   
26   C CB  . SER A 5   ? 0.7278 0.5752 0.7713 -0.0133 0.0200  0.0208  74  SER A CB  
27   O OG  . SER A 5   ? 0.7850 0.6495 0.8289 -0.0123 0.0179  0.0187  74  SER A OG  
28   N N   . SER A 6   ? 0.5863 0.4311 0.6306 -0.0143 0.0210  -0.0013 75  SER A N   
29   C CA  . SER A 6   ? 0.5687 0.4206 0.6132 -0.0140 0.0204  -0.0100 75  SER A CA  
30   C C   . SER A 6   ? 0.6383 0.4963 0.6842 -0.0055 0.0199  -0.0098 75  SER A C   
31   O O   . SER A 6   ? 0.7281 0.5813 0.7752 0.0009  0.0206  -0.0048 75  SER A O   
32   C CB  . SER A 6   ? 0.6017 0.4415 0.6452 -0.0168 0.0220  -0.0179 75  SER A CB  
33   O OG  . SER A 6   ? 0.6435 0.4755 0.6872 -0.0093 0.0232  -0.0206 75  SER A OG  
34   N N   . VAL A 7   ? 0.5026 0.3718 0.5485 -0.0056 0.0186  -0.0152 76  VAL A N   
35   C CA  . VAL A 7   ? 0.3833 0.2603 0.4305 0.0011  0.0180  -0.0154 76  VAL A CA  
36   C C   . VAL A 7   ? 0.4694 0.3468 0.5158 0.0014  0.0185  -0.0242 76  VAL A C   
37   O O   . VAL A 7   ? 0.4930 0.3762 0.5383 -0.0036 0.0173  -0.0289 76  VAL A O   
38   C CB  . VAL A 7   ? 0.4870 0.3792 0.5346 0.0005  0.0154  -0.0116 76  VAL A CB  
39   C CG1 . VAL A 7   ? 0.4158 0.3163 0.4648 0.0064  0.0148  -0.0115 76  VAL A CG1 
40   C CG2 . VAL A 7   ? 0.5879 0.4810 0.6356 -0.0002 0.0147  -0.0031 76  VAL A CG2 
41   N N   . ILE A 8   ? 0.4161 0.2882 0.4629 0.0077  0.0203  -0.0264 77  ILE A N   
42   C CA  . ILE A 8   ? 0.3935 0.2673 0.4390 0.0086  0.0208  -0.0346 77  ILE A CA  
43   C C   . ILE A 8   ? 0.3803 0.2703 0.4263 0.0093  0.0187  -0.0344 77  ILE A C   
44   O O   . ILE A 8   ? 0.4409 0.3388 0.4887 0.0128  0.0179  -0.0285 77  ILE A O   
45   C CB  . ILE A 8   ? 0.4568 0.3216 0.5022 0.0160  0.0235  -0.0368 77  ILE A CB  
46   C CG1 . ILE A 8   ? 0.5133 0.3595 0.5576 0.0147  0.0254  -0.0376 77  ILE A CG1 
47   C CG2 . ILE A 8   ? 0.4565 0.3249 0.4999 0.0171  0.0241  -0.0453 77  ILE A CG2 
48   C CD1 . ILE A 8   ? 0.6381 0.4781 0.6798 0.0063  0.0251  -0.0444 77  ILE A CD1 
49   N N   . LEU A 9   ? 0.3714 0.2662 0.4157 0.0057  0.0177  -0.0406 78  LEU A N   
50   C CA  . LEU A 9   ? 0.4006 0.3089 0.4448 0.0060  0.0157  -0.0406 78  LEU A CA  
51   C C   . LEU A 9   ? 0.4082 0.3192 0.4510 0.0093  0.0166  -0.0462 78  LEU A C   
52   O O   . LEU A 9   ? 0.3537 0.2575 0.3946 0.0087  0.0181  -0.0526 78  LEU A O   
53   C CB  . LEU A 9   ? 0.4171 0.3307 0.4603 -0.0003 0.0134  -0.0423 78  LEU A CB  
54   C CG  . LEU A 9   ? 0.4436 0.3567 0.4873 -0.0045 0.0124  -0.0380 78  LEU A CG  
55   C CD1 . LEU A 9   ? 0.3656 0.2853 0.4083 -0.0093 0.0105  -0.0411 78  LEU A CD1 
56   C CD2 . LEU A 9   ? 0.3289 0.2466 0.3738 -0.0020 0.0114  -0.0304 78  LEU A CD2 
57   N N   . THR A 10  ? 0.2527 0.1746 0.2962 0.0122  0.0157  -0.0438 79  THR A N   
58   C CA  . THR A 10  ? 0.3391 0.2668 0.3810 0.0149  0.0163  -0.0481 79  THR A CA  
59   C C   . THR A 10  ? 0.3527 0.2875 0.3925 0.0103  0.0138  -0.0509 79  THR A C   
60   O O   . THR A 10  ? 0.4240 0.3631 0.4644 0.0071  0.0114  -0.0475 79  THR A O   
61   C CB  . THR A 10  ? 0.3839 0.3206 0.4277 0.0203  0.0168  -0.0432 79  THR A CB  
62   O OG1 . THR A 10  ? 0.3508 0.2819 0.3972 0.0251  0.0189  -0.0396 79  THR A OG1 
63   C CG2 . THR A 10  ? 0.1891 0.1320 0.2310 0.0234  0.0181  -0.0476 79  THR A CG2 
64   N N   . ASN A 11  ? 0.2881 0.2242 0.3253 0.0104  0.0144  -0.0573 80  ASN A N   
65   C CA  . ASN A 11  ? 0.3464 0.2898 0.3816 0.0069  0.0119  -0.0599 80  ASN A CA  
66   C C   . ASN A 11  ? 0.3123 0.2654 0.3460 0.0102  0.0120  -0.0596 80  ASN A C   
67   O O   . ASN A 11  ? 0.4332 0.3864 0.4648 0.0127  0.0139  -0.0644 80  ASN A O   
68   C CB  . ASN A 11  ? 0.3442 0.2828 0.3773 0.0032  0.0121  -0.0672 80  ASN A CB  
69   C CG  . ASN A 11  ? 0.4656 0.4130 0.4970 0.0002  0.0094  -0.0696 80  ASN A CG  
70   O OD1 . ASN A 11  ? 0.4647 0.4206 0.4957 0.0015  0.0077  -0.0664 80  ASN A OD1 
71   N ND2 . ASN A 11  ? 0.5058 0.4512 0.5363 -0.0039 0.0089  -0.0750 80  ASN A ND2 
72   N N   . TYR A 12  ? 0.3004 0.2614 0.3348 0.0098  0.0098  -0.0542 81  TYR A N   
73   C CA  . TYR A 12  ? 0.2827 0.2538 0.3156 0.0116  0.0094  -0.0530 81  TYR A CA  
74   C C   . TYR A 12  ? 0.4158 0.3909 0.4458 0.0084  0.0067  -0.0555 81  TYR A C   
75   O O   . TYR A 12  ? 0.4258 0.4028 0.4562 0.0059  0.0040  -0.0521 81  TYR A O   
76   C CB  . TYR A 12  ? 0.2013 0.1784 0.2363 0.0124  0.0083  -0.0453 81  TYR A CB  
77   C CG  . TYR A 12  ? 0.2154 0.2031 0.2488 0.0130  0.0076  -0.0431 81  TYR A CG  
78   C CD1 . TYR A 12  ? 0.2388 0.2327 0.2718 0.0171  0.0103  -0.0437 81  TYR A CD1 
79   C CD2 . TYR A 12  ? 0.2933 0.2847 0.3251 0.0096  0.0043  -0.0403 81  TYR A CD2 
80   C CE1 . TYR A 12  ? 0.3480 0.3528 0.3794 0.0172  0.0097  -0.0410 81  TYR A CE1 
81   C CE2 . TYR A 12  ? 0.3846 0.3850 0.4147 0.0096  0.0035  -0.0374 81  TYR A CE2 
82   C CZ  . TYR A 12  ? 0.4182 0.4259 0.4481 0.0131  0.0062  -0.0375 81  TYR A CZ  
83   O OH  . TYR A 12  ? 0.4666 0.4843 0.4946 0.0125  0.0056  -0.0341 81  TYR A OH  
84   N N   . MET A 13  ? 0.4583 0.4347 0.4855 0.0086  0.0076  -0.0616 82  MET A N   
85   C CA  . MET A 13  ? 0.4006 0.3838 0.4247 0.0068  0.0052  -0.0634 82  MET A CA  
86   C C   . MET A 13  ? 0.3457 0.3271 0.3707 0.0031  0.0024  -0.0635 82  MET A C   
87   O O   . MET A 13  ? 0.4516 0.4385 0.4755 0.0022  -0.0003 -0.0613 82  MET A O   
88   C CB  . MET A 13  ? 0.4256 0.4181 0.4486 0.0082  0.0041  -0.0580 82  MET A CB  
89   C CG  . MET A 13  ? 0.4637 0.4606 0.4863 0.0121  0.0072  -0.0574 82  MET A CG  
90   S SD  . MET A 13  ? 0.6281 0.6376 0.6462 0.0131  0.0068  -0.0572 82  MET A SD  
91   C CE  . MET A 13  ? 0.6349 0.6501 0.6544 0.0114  0.0042  -0.0472 82  MET A CE  
92   N N   . ASP A 14  ? 0.3942 0.3681 0.4212 0.0011  0.0031  -0.0659 83  ASP A N   
93   C CA  . ASP A 14  ? 0.4010 0.3739 0.4291 -0.0024 0.0011  -0.0668 83  ASP A CA  
94   C C   . ASP A 14  ? 0.4115 0.3862 0.4409 -0.0026 -0.0012 -0.0611 83  ASP A C   
95   O O   . ASP A 14  ? 0.3921 0.3678 0.4222 -0.0046 -0.0030 -0.0617 83  ASP A O   
96   C CB  . ASP A 14  ? 0.3879 0.3667 0.4139 -0.0041 -0.0004 -0.0719 83  ASP A CB  
97   C CG  . ASP A 14  ? 0.5297 0.5051 0.5546 -0.0057 0.0015  -0.0789 83  ASP A CG  
98   O OD1 . ASP A 14  ? 0.5396 0.5061 0.5662 -0.0072 0.0034  -0.0802 83  ASP A OD1 
99   O OD2 . ASP A 14  ? 0.6047 0.5857 0.6265 -0.0056 0.0010  -0.0831 83  ASP A OD2 
100  N N   . THR A 15  ? 0.3102 0.2854 0.3398 -0.0008 -0.0012 -0.0556 84  THR A N   
101  C CA  . THR A 15  ? 0.3016 0.2772 0.3315 -0.0015 -0.0035 -0.0507 84  THR A CA  
102  C C   . THR A 15  ? 0.3453 0.3171 0.3772 -0.0015 -0.0028 -0.0462 84  THR A C   
103  O O   . THR A 15  ? 0.3862 0.3573 0.4180 -0.0028 -0.0048 -0.0430 84  THR A O   
104  C CB  . THR A 15  ? 0.3656 0.3470 0.3931 -0.0004 -0.0055 -0.0475 84  THR A CB  
105  O OG1 . THR A 15  ? 0.4979 0.4826 0.5251 0.0015  -0.0036 -0.0462 84  THR A OG1 
106  C CG2 . THR A 15  ? 0.3723 0.3581 0.3978 -0.0005 -0.0072 -0.0507 84  THR A CG2 
107  N N   . GLN A 16  ? 0.3326 0.3019 0.3661 0.0000  -0.0002 -0.0460 85  GLN A N   
108  C CA  . GLN A 16  ? 0.2647 0.2314 0.3002 0.0003  0.0003  -0.0414 85  GLN A CA  
109  C C   . GLN A 16  ? 0.2899 0.2502 0.3271 0.0011  0.0031  -0.0433 85  GLN A C   
110  O O   . GLN A 16  ? 0.4759 0.4352 0.5133 0.0038  0.0054  -0.0455 85  GLN A O   
111  C CB  . GLN A 16  ? 0.2053 0.1775 0.2413 0.0022  0.0003  -0.0365 85  GLN A CB  
112  C CG  . GLN A 16  ? 0.2535 0.2299 0.2879 0.0003  -0.0027 -0.0329 85  GLN A CG  
113  C CD  . GLN A 16  ? 0.3367 0.3199 0.3718 0.0013  -0.0027 -0.0280 85  GLN A CD  
114  O OE1 . GLN A 16  ? 0.3253 0.3101 0.3631 0.0029  -0.0012 -0.0251 85  GLN A OE1 
115  N NE2 . GLN A 16  ? 0.2409 0.2286 0.2738 0.0003  -0.0044 -0.0265 85  GLN A NE2 
116  N N   . TYR A 17  ? 0.2331 0.1887 0.2713 -0.0012 0.0030  -0.0424 86  TYR A N   
117  C CA  . TYR A 17  ? 0.3390 0.2872 0.3787 -0.0010 0.0053  -0.0430 86  TYR A CA  
118  C C   . TYR A 17  ? 0.4095 0.3569 0.4509 -0.0002 0.0053  -0.0367 86  TYR A C   
119  O O   . TYR A 17  ? 0.3838 0.3332 0.4249 -0.0027 0.0034  -0.0340 86  TYR A O   
120  C CB  . TYR A 17  ? 0.1604 0.1048 0.1998 -0.0051 0.0053  -0.0468 86  TYR A CB  
121  C CG  . TYR A 17  ? 0.3132 0.2592 0.3512 -0.0062 0.0052  -0.0532 86  TYR A CG  
122  C CD1 . TYR A 17  ? 0.3489 0.3021 0.3855 -0.0064 0.0029  -0.0545 86  TYR A CD1 
123  C CD2 . TYR A 17  ? 0.3976 0.3374 0.4354 -0.0071 0.0072  -0.0578 86  TYR A CD2 
124  C CE1 . TYR A 17  ? 0.3114 0.2675 0.3468 -0.0073 0.0026  -0.0599 86  TYR A CE1 
125  C CE2 . TYR A 17  ? 0.3624 0.3046 0.3987 -0.0086 0.0068  -0.0639 86  TYR A CE2 
126  C CZ  . TYR A 17  ? 0.3216 0.2728 0.3568 -0.0087 0.0045  -0.0648 86  TYR A CZ  
127  O OH  . TYR A 17  ? 0.2834 0.2383 0.3169 -0.0101 0.0039  -0.0705 86  TYR A OH  
128  N N   . TYR A 18  ? 0.3430 0.2880 0.3861 0.0035  0.0073  -0.0345 87  TYR A N   
129  C CA  . TYR A 18  ? 0.2223 0.1685 0.2673 0.0048  0.0071  -0.0279 87  TYR A CA  
130  C C   . TYR A 18  ? 0.2258 0.1644 0.2725 0.0081  0.0097  -0.0267 87  TYR A C   
131  O O   . TYR A 18  ? 0.4255 0.3591 0.4721 0.0108  0.0120  -0.0307 87  TYR A O   
132  C CB  . TYR A 18  ? 0.1847 0.1404 0.2305 0.0069  0.0058  -0.0239 87  TYR A CB  
133  C CG  . TYR A 18  ? 0.2349 0.1941 0.2813 0.0111  0.0077  -0.0258 87  TYR A CG  
134  C CD1 . TYR A 18  ? 0.2765 0.2396 0.3208 0.0103  0.0071  -0.0296 87  TYR A CD1 
135  C CD2 . TYR A 18  ? 0.3371 0.2964 0.3861 0.0165  0.0100  -0.0234 87  TYR A CD2 
136  C CE1 . TYR A 18  ? 0.3062 0.2738 0.3505 0.0141  0.0089  -0.0312 87  TYR A CE1 
137  C CE2 . TYR A 18  ? 0.2390 0.2026 0.2884 0.0209  0.0121  -0.0255 87  TYR A CE2 
138  C CZ  . TYR A 18  ? 0.3285 0.2965 0.3753 0.0194  0.0116  -0.0295 87  TYR A CZ  
139  O OH  . TYR A 18  ? 0.3890 0.3624 0.4357 0.0237  0.0138  -0.0315 87  TYR A OH  
140  N N   . GLY A 19  ? 0.3075 0.2451 0.3555 0.0080  0.0094  -0.0210 88  GLY A N   
141  C CA  . GLY A 19  ? 0.2376 0.1679 0.2874 0.0117  0.0116  -0.0180 88  GLY A CA  
142  C C   . GLY A 19  ? 0.3447 0.2821 0.3970 0.0151  0.0108  -0.0105 88  GLY A C   
143  O O   . GLY A 19  ? 0.2964 0.2444 0.3491 0.0144  0.0087  -0.0083 88  GLY A O   
144  N N   . GLU A 20  ? 0.4330 0.3647 0.4871 0.0185  0.0122  -0.0061 89  GLU A N   
145  C CA  . GLU A 20  ? 0.4632 0.4023 0.5202 0.0227  0.0116  0.0015  89  GLU A CA  
146  C C   . GLU A 20  ? 0.4268 0.3657 0.4834 0.0199  0.0100  0.0076  89  GLU A C   
147  O O   . GLU A 20  ? 0.4787 0.4076 0.5336 0.0173  0.0108  0.0072  89  GLU A O   
148  C CB  . GLU A 20  ? 0.3887 0.3229 0.4485 0.0309  0.0146  0.0023  89  GLU A CB  
149  C CG  . GLU A 20  ? 0.4841 0.4310 0.5474 0.0366  0.0147  0.0053  89  GLU A CG  
150  C CD  . GLU A 20  ? 0.6485 0.5904 0.7147 0.0456  0.0178  0.0072  89  GLU A CD  
151  O OE1 . GLU A 20  ? 0.6886 0.6337 0.7577 0.0494  0.0173  0.0147  89  GLU A OE1 
152  O OE2 . GLU A 20  ? 0.8279 0.7628 0.8932 0.0493  0.0206  0.0009  89  GLU A OE2 
153  N N   . ILE A 21  ? 0.4066 0.3572 0.4644 0.0198  0.0076  0.0135  90  ILE A N   
154  C CA  . ILE A 21  ? 0.3110 0.2636 0.3686 0.0185  0.0060  0.0205  90  ILE A CA  
155  C C   . ILE A 21  ? 0.3571 0.3201 0.4187 0.0240  0.0053  0.0276  90  ILE A C   
156  O O   . ILE A 21  ? 0.4793 0.4506 0.5436 0.0270  0.0054  0.0269  90  ILE A O   
157  C CB  . ILE A 21  ? 0.3233 0.2816 0.3772 0.0111  0.0030  0.0203  90  ILE A CB  
158  C CG1 . ILE A 21  ? 0.3262 0.2958 0.3802 0.0093  0.0006  0.0192  90  ILE A CG1 
159  C CG2 . ILE A 21  ? 0.3186 0.2680 0.3692 0.0062  0.0038  0.0144  90  ILE A CG2 
160  C CD1 . ILE A 21  ? 0.4098 0.3855 0.4603 0.0031  -0.0027 0.0201  90  ILE A CD1 
161  N N   . GLY A 22  ? 0.4062 0.3697 0.4684 0.0251  0.0046  0.0348  91  GLY A N   
162  C CA  . GLY A 22  ? 0.2679 0.2428 0.3342 0.0303  0.0035  0.0424  91  GLY A CA  
163  C C   . GLY A 22  ? 0.5616 0.5470 0.6261 0.0254  -0.0002 0.0481  91  GLY A C   
164  O O   . GLY A 22  ? 0.7405 0.7204 0.8013 0.0213  -0.0008 0.0495  91  GLY A O   
165  N N   . ILE A 23  ? 0.6319 0.6330 0.6987 0.0252  -0.0028 0.0514  92  ILE A N   
166  C CA  . ILE A 23  ? 0.3951 0.4074 0.4597 0.0197  -0.0068 0.0558  92  ILE A CA  
167  C C   . ILE A 23  ? 0.4678 0.4935 0.5373 0.0250  -0.0081 0.0648  92  ILE A C   
168  O O   . ILE A 23  ? 0.4690 0.5042 0.5436 0.0292  -0.0078 0.0659  92  ILE A O   
169  C CB  . ILE A 23  ? 0.2555 0.2748 0.3176 0.0128  -0.0093 0.0510  92  ILE A CB  
170  C CG1 . ILE A 23  ? 0.2743 0.2811 0.3326 0.0094  -0.0077 0.0422  92  ILE A CG1 
171  C CG2 . ILE A 23  ? 0.2296 0.2579 0.2879 0.0063  -0.0134 0.0542  92  ILE A CG2 
172  C CD1 . ILE A 23  ? 0.2001 0.2113 0.2553 0.0029  -0.0102 0.0376  92  ILE A CD1 
173  N N   . GLY A 24  ? 0.3805 0.4080 0.4487 0.0249  -0.0096 0.0715  93  GLY A N   
174  C CA  . GLY A 24  ? 0.3928 0.4358 0.4651 0.0285  -0.0119 0.0806  93  GLY A CA  
175  C C   . GLY A 24  ? 0.5299 0.5687 0.6070 0.0388  -0.0094 0.0870  93  GLY A C   
176  O O   . GLY A 24  ? 0.5065 0.5289 0.5836 0.0433  -0.0056 0.0840  93  GLY A O   
177  N N   . THR A 25  ? 0.5768 0.6308 0.6578 0.0426  -0.0117 0.0959  94  THR A N   
178  C CA  . THR A 25  ? 0.5176 0.5704 0.6038 0.0536  -0.0099 0.1035  94  THR A CA  
179  C C   . THR A 25  ? 0.4496 0.5205 0.5436 0.0601  -0.0102 0.1067  94  THR A C   
180  O O   . THR A 25  ? 0.5789 0.6700 0.6748 0.0570  -0.0141 0.1118  94  THR A O   
181  C CB  . THR A 25  ? 0.4469 0.5030 0.5311 0.0534  -0.0124 0.1129  94  THR A CB  
182  O OG1 . THR A 25  ? 0.4698 0.5111 0.5467 0.0466  -0.0119 0.1099  94  THR A OG1 
183  C CG2 . THR A 25  ? 0.3319 0.3845 0.4212 0.0654  -0.0104 0.1211  94  THR A CG2 
184  N N   . PRO A 26  ? 0.4039 0.4694 0.5025 0.0687  -0.0062 0.1038  95  PRO A N   
185  C CA  . PRO A 26  ? 0.3568 0.3995 0.4533 0.0721  -0.0016 0.0968  95  PRO A CA  
186  C C   . PRO A 26  ? 0.4424 0.4785 0.5341 0.0631  -0.0012 0.0863  95  PRO A C   
187  O O   . PRO A 26  ? 0.3907 0.4402 0.4817 0.0560  -0.0041 0.0849  95  PRO A O   
188  C CB  . PRO A 26  ? 0.2636 0.3099 0.3671 0.0842  0.0017  0.0975  95  PRO A CB  
189  C CG  . PRO A 26  ? 0.2367 0.3089 0.3452 0.0832  -0.0008 0.1004  95  PRO A CG  
190  C CD  . PRO A 26  ? 0.2730 0.3576 0.3795 0.0755  -0.0060 0.1069  95  PRO A CD  
191  N N   . PRO A 27  ? 0.4561 0.4720 0.5444 0.0631  0.0020  0.0792  96  PRO A N   
192  C CA  . PRO A 27  ? 0.4550 0.4649 0.5384 0.0542  0.0020  0.0700  96  PRO A CA  
193  C C   . PRO A 27  ? 0.4535 0.4732 0.5394 0.0544  0.0026  0.0649  96  PRO A C   
194  O O   . PRO A 27  ? 0.3779 0.3979 0.4678 0.0625  0.0056  0.0637  96  PRO A O   
195  C CB  . PRO A 27  ? 0.3623 0.3495 0.4425 0.0554  0.0054  0.0648  96  PRO A CB  
196  C CG  . PRO A 27  ? 0.4191 0.3990 0.5011 0.0626  0.0065  0.0724  96  PRO A CG  
197  C CD  . PRO A 27  ? 0.4348 0.4318 0.5231 0.0703  0.0056  0.0796  96  PRO A CD  
198  N N   . GLN A 28  ? 0.3937 0.4212 0.4768 0.0455  -0.0003 0.0620  97  GLN A N   
199  C CA  . GLN A 28  ? 0.3881 0.4217 0.4717 0.0434  0.0001  0.0564  97  GLN A CA  
200  C C   . GLN A 28  ? 0.4829 0.5009 0.5614 0.0391  0.0017  0.0473  97  GLN A C   
201  O O   . GLN A 28  ? 0.5007 0.5098 0.5744 0.0332  0.0005  0.0454  97  GLN A O   
202  C CB  . GLN A 28  ? 0.3149 0.3651 0.3984 0.0360  -0.0042 0.0590  97  GLN A CB  
203  C CG  . GLN A 28  ? 0.2613 0.3298 0.3503 0.0395  -0.0061 0.0679  97  GLN A CG  
204  C CD  . GLN A 28  ? 0.3628 0.4473 0.4512 0.0309  -0.0108 0.0703  97  GLN A CD  
205  O OE1 . GLN A 28  ? 0.4402 0.5270 0.5270 0.0253  -0.0115 0.0658  97  GLN A OE1 
206  N NE2 . GLN A 28  ? 0.3917 0.4870 0.4811 0.0296  -0.0140 0.0774  97  GLN A NE2 
207  N N   . THR A 29  ? 0.4029 0.4189 0.4824 0.0423  0.0044  0.0418  98  THR A N   
208  C CA  . THR A 29  ? 0.3468 0.3476 0.4223 0.0406  0.0066  0.0334  98  THR A CA  
209  C C   . THR A 29  ? 0.5286 0.5331 0.6011 0.0337  0.0050  0.0282  98  THR A C   
210  O O   . THR A 29  ? 0.6526 0.6697 0.7273 0.0338  0.0045  0.0291  98  THR A O   
211  C CB  . THR A 29  ? 0.3285 0.3228 0.4063 0.0493  0.0109  0.0303  98  THR A CB  
212  O OG1 . THR A 29  ? 0.4147 0.3969 0.4930 0.0541  0.0126  0.0329  98  THR A OG1 
213  C CG2 . THR A 29  ? 0.5397 0.5249 0.6138 0.0469  0.0127  0.0210  98  THR A CG2 
214  N N   . PHE A 30  ? 0.3274 0.3214 0.3951 0.0279  0.0044  0.0232  99  PHE A N   
215  C CA  . PHE A 30  ? 0.2989 0.2944 0.3633 0.0219  0.0029  0.0182  99  PHE A CA  
216  C C   . PHE A 30  ? 0.3342 0.3165 0.3953 0.0207  0.0047  0.0107  99  PHE A C   
217  O O   . PHE A 30  ? 0.3247 0.2966 0.3842 0.0199  0.0055  0.0097  99  PHE A O   
218  C CB  . PHE A 30  ? 0.3413 0.3412 0.4029 0.0146  -0.0011 0.0205  99  PHE A CB  
219  C CG  . PHE A 30  ? 0.4038 0.4169 0.4683 0.0146  -0.0035 0.0279  99  PHE A CG  
220  C CD1 . PHE A 30  ? 0.3913 0.4052 0.4571 0.0166  -0.0038 0.0335  99  PHE A CD1 
221  C CD2 . PHE A 30  ? 0.3904 0.4158 0.4562 0.0120  -0.0055 0.0296  99  PHE A CD2 
222  C CE1 . PHE A 30  ? 0.4361 0.4638 0.5047 0.0165  -0.0063 0.0405  99  PHE A CE1 
223  C CE2 . PHE A 30  ? 0.3331 0.3720 0.4017 0.0113  -0.0079 0.0364  99  PHE A CE2 
224  C CZ  . PHE A 30  ? 0.3924 0.4330 0.4625 0.0137  -0.0084 0.0417  99  PHE A CZ  
225  N N   . LYS A 31  ? 0.2478 0.2315 0.3078 0.0203  0.0053  0.0058  100 LYS A N   
226  C CA  . LYS A 31  ? 0.3199 0.2946 0.3764 0.0175  0.0060  -0.0014 100 LYS A CA  
227  C C   . LYS A 31  ? 0.3830 0.3580 0.4360 0.0106  0.0028  -0.0021 100 LYS A C   
228  O O   . LYS A 31  ? 0.2913 0.2742 0.3438 0.0079  0.0004  -0.0004 100 LYS A O   
229  C CB  . LYS A 31  ? 0.1814 0.1588 0.2376 0.0199  0.0076  -0.0058 100 LYS A CB  
230  C CG  . LYS A 31  ? 0.2551 0.2354 0.3146 0.0274  0.0107  -0.0048 100 LYS A CG  
231  C CD  . LYS A 31  ? 0.2371 0.2238 0.2959 0.0290  0.0120  -0.0085 100 LYS A CD  
232  C CE  . LYS A 31  ? 0.3656 0.3590 0.4281 0.0368  0.0150  -0.0068 100 LYS A CE  
233  N NZ  . LYS A 31  ? 0.4749 0.4788 0.5367 0.0371  0.0156  -0.0085 100 LYS A NZ  
234  N N   . VAL A 32  ? 0.3715 0.3379 0.4223 0.0077  0.0028  -0.0048 101 VAL A N   
235  C CA  . VAL A 32  ? 0.3705 0.3373 0.4180 0.0021  0.0001  -0.0056 101 VAL A CA  
236  C C   . VAL A 32  ? 0.3567 0.3164 0.4020 0.0000  0.0009  -0.0120 101 VAL A C   
237  O O   . VAL A 32  ? 0.3757 0.3286 0.4216 0.0015  0.0033  -0.0149 101 VAL A O   
238  C CB  . VAL A 32  ? 0.3550 0.3223 0.4021 0.0001  -0.0011 -0.0009 101 VAL A CB  
239  C CG1 . VAL A 32  ? 0.3934 0.3699 0.4428 0.0017  -0.0025 0.0057  101 VAL A CG1 
240  C CG2 . VAL A 32  ? 0.2470 0.2059 0.2947 0.0016  0.0013  -0.0006 101 VAL A CG2 
241  N N   . VAL A 33  ? 0.2893 0.2506 0.3318 -0.0037 -0.0014 -0.0143 102 VAL A N   
242  C CA  . VAL A 33  ? 0.2694 0.2263 0.3100 -0.0058 -0.0011 -0.0199 102 VAL A CA  
243  C C   . VAL A 33  ? 0.2930 0.2477 0.3322 -0.0088 -0.0014 -0.0192 102 VAL A C   
244  O O   . VAL A 33  ? 0.3899 0.3478 0.4277 -0.0105 -0.0033 -0.0160 102 VAL A O   
245  C CB  . VAL A 33  ? 0.3388 0.2987 0.3772 -0.0071 -0.0032 -0.0226 102 VAL A CB  
246  C CG1 . VAL A 33  ? 0.2495 0.2067 0.2863 -0.0090 -0.0033 -0.0276 102 VAL A CG1 
247  C CG2 . VAL A 33  ? 0.2931 0.2558 0.3324 -0.0045 -0.0026 -0.0235 102 VAL A CG2 
248  N N   . PHE A 34  ? 0.2779 0.2277 0.3173 -0.0099 0.0004  -0.0222 103 PHE A N   
249  C CA  . PHE A 34  ? 0.3311 0.2799 0.3693 -0.0131 0.0006  -0.0216 103 PHE A CA  
250  C C   . PHE A 34  ? 0.4364 0.3876 0.4727 -0.0152 -0.0005 -0.0265 103 PHE A C   
251  O O   . PHE A 34  ? 0.3726 0.3227 0.4096 -0.0154 0.0003  -0.0311 103 PHE A O   
252  C CB  . PHE A 34  ? 0.2807 0.2233 0.3205 -0.0136 0.0032  -0.0213 103 PHE A CB  
253  C CG  . PHE A 34  ? 0.3131 0.2524 0.3547 -0.0105 0.0043  -0.0161 103 PHE A CG  
254  C CD1 . PHE A 34  ? 0.3289 0.2654 0.3724 -0.0065 0.0056  -0.0170 103 PHE A CD1 
255  C CD2 . PHE A 34  ? 0.2706 0.2104 0.3118 -0.0112 0.0041  -0.0102 103 PHE A CD2 
256  C CE1 . PHE A 34  ? 0.3185 0.2524 0.3640 -0.0026 0.0068  -0.0122 103 PHE A CE1 
257  C CE2 . PHE A 34  ? 0.3195 0.2568 0.3627 -0.0076 0.0050  -0.0048 103 PHE A CE2 
258  C CZ  . PHE A 34  ? 0.3561 0.2903 0.4017 -0.0030 0.0064  -0.0059 103 PHE A CZ  
259  N N   . ASP A 35  ? 0.3786 0.3332 0.4123 -0.0166 -0.0024 -0.0256 104 ASP A N   
260  C CA  . ASP A 35  ? 0.3141 0.2709 0.3457 -0.0171 -0.0040 -0.0298 104 ASP A CA  
261  C C   . ASP A 35  ? 0.3695 0.3281 0.3991 -0.0194 -0.0036 -0.0309 104 ASP A C   
262  O O   . ASP A 35  ? 0.2228 0.1829 0.2499 -0.0206 -0.0044 -0.0283 104 ASP A O   
263  C CB  . ASP A 35  ? 0.1659 0.1240 0.1953 -0.0164 -0.0067 -0.0285 104 ASP A CB  
264  C CG  . ASP A 35  ? 0.3350 0.2933 0.3619 -0.0162 -0.0084 -0.0325 104 ASP A CG  
265  O OD1 . ASP A 35  ? 0.4686 0.4276 0.4963 -0.0158 -0.0074 -0.0364 104 ASP A OD1 
266  O OD2 . ASP A 35  ? 0.3668 0.3246 0.3910 -0.0164 -0.0109 -0.0316 104 ASP A OD2 
267  N N   . THR A 36  ? 0.3286 0.2885 0.3593 -0.0202 -0.0023 -0.0350 105 THR A N   
268  C CA  . THR A 36  ? 0.3442 0.3079 0.3734 -0.0220 -0.0016 -0.0365 105 THR A CA  
269  C C   . THR A 36  ? 0.3934 0.3593 0.4191 -0.0206 -0.0036 -0.0391 105 THR A C   
270  O O   . THR A 36  ? 0.4239 0.3936 0.4477 -0.0215 -0.0030 -0.0405 105 THR A O   
271  C CB  . THR A 36  ? 0.2909 0.2570 0.3229 -0.0235 0.0003  -0.0400 105 THR A CB  
272  O OG1 . THR A 36  ? 0.2663 0.2325 0.2998 -0.0215 -0.0005 -0.0437 105 THR A OG1 
273  C CG2 . THR A 36  ? 0.2599 0.2225 0.2942 -0.0262 0.0026  -0.0373 105 THR A CG2 
274  N N   . GLY A 37  ? 0.2880 0.2516 0.3128 -0.0184 -0.0058 -0.0398 106 GLY A N   
275  C CA  . GLY A 37  ? 0.2511 0.2143 0.2722 -0.0170 -0.0080 -0.0420 106 GLY A CA  
276  C C   . GLY A 37  ? 0.2498 0.2105 0.2670 -0.0181 -0.0100 -0.0393 106 GLY A C   
277  O O   . GLY A 37  ? 0.2968 0.2552 0.3103 -0.0173 -0.0121 -0.0413 106 GLY A O   
278  N N   . SER A 38  ? 0.1508 0.1118 0.1687 -0.0200 -0.0097 -0.0346 107 SER A N   
279  C CA  . SER A 38  ? 0.2428 0.2037 0.2571 -0.0218 -0.0117 -0.0318 107 SER A CA  
280  C C   . SER A 38  ? 0.2596 0.2237 0.2743 -0.0237 -0.0103 -0.0278 107 SER A C   
281  O O   . SER A 38  ? 0.2886 0.2534 0.3067 -0.0236 -0.0078 -0.0266 107 SER A O   
282  C CB  . SER A 38  ? 0.3253 0.2843 0.3403 -0.0218 -0.0139 -0.0289 107 SER A CB  
283  O OG  . SER A 38  ? 0.4003 0.3605 0.4200 -0.0208 -0.0124 -0.0255 107 SER A OG  
284  N N   . SER A 39  ? 0.2826 0.2485 0.2936 -0.0258 -0.0120 -0.0255 108 SER A N   
285  C CA  . SER A 39  ? 0.2846 0.2545 0.2948 -0.0277 -0.0109 -0.0215 108 SER A CA  
286  C C   . SER A 39  ? 0.4018 0.3744 0.4117 -0.0290 -0.0129 -0.0157 108 SER A C   
287  O O   . SER A 39  ? 0.4746 0.4512 0.4830 -0.0306 -0.0126 -0.0119 108 SER A O   
288  C CB  . SER A 39  ? 0.2414 0.2140 0.2463 -0.0291 -0.0106 -0.0249 108 SER A CB  
289  O OG  . SER A 39  ? 0.3872 0.3589 0.3925 -0.0274 -0.0092 -0.0306 108 SER A OG  
290  N N   . ASN A 40  ? 0.4969 0.4684 0.5082 -0.0286 -0.0149 -0.0144 109 ASN A N   
291  C CA  . ASN A 40  ? 0.3887 0.3648 0.4009 -0.0297 -0.0168 -0.0086 109 ASN A CA  
292  C C   . ASN A 40  ? 0.3460 0.3224 0.3644 -0.0267 -0.0154 -0.0047 109 ASN A C   
293  O O   . ASN A 40  ? 0.3641 0.3366 0.3852 -0.0244 -0.0141 -0.0075 109 ASN A O   
294  C CB  . ASN A 40  ? 0.3272 0.3036 0.3358 -0.0324 -0.0205 -0.0097 109 ASN A CB  
295  C CG  . ASN A 40  ? 0.3365 0.3125 0.3380 -0.0354 -0.0221 -0.0133 109 ASN A CG  
296  O OD1 . ASN A 40  ? 0.5142 0.4857 0.5128 -0.0346 -0.0212 -0.0190 109 ASN A OD1 
297  N ND2 . ASN A 40  ? 0.2451 0.2264 0.2435 -0.0388 -0.0246 -0.0102 109 ASN A ND2 
298  N N   . VAL A 41  ? 0.3872 0.3687 0.4078 -0.0263 -0.0158 0.0016  110 VAL A N   
299  C CA  . VAL A 41  ? 0.2855 0.2685 0.3119 -0.0228 -0.0147 0.0056  110 VAL A CA  
300  C C   . VAL A 41  ? 0.2808 0.2698 0.3078 -0.0241 -0.0177 0.0080  110 VAL A C   
301  O O   . VAL A 41  ? 0.3862 0.3808 0.4104 -0.0275 -0.0205 0.0104  110 VAL A O   
302  C CB  . VAL A 41  ? 0.2825 0.2676 0.3114 -0.0206 -0.0132 0.0116  110 VAL A CB  
303  C CG1 . VAL A 41  ? 0.1585 0.1448 0.1934 -0.0159 -0.0119 0.0152  110 VAL A CG1 
304  C CG2 . VAL A 41  ? 0.1618 0.1410 0.1897 -0.0206 -0.0105 0.0101  110 VAL A CG2 
305  N N   . TRP A 42  ? 0.2804 0.2693 0.3109 -0.0219 -0.0170 0.0075  111 TRP A N   
306  C CA  . TRP A 42  ? 0.2753 0.2718 0.3073 -0.0234 -0.0195 0.0110  111 TRP A CA  
307  C C   . TRP A 42  ? 0.2692 0.2688 0.3070 -0.0188 -0.0175 0.0132  111 TRP A C   
308  O O   . TRP A 42  ? 0.2160 0.2098 0.2554 -0.0154 -0.0147 0.0099  111 TRP A O   
309  C CB  . TRP A 42  ? 0.1955 0.1894 0.2231 -0.0279 -0.0223 0.0073  111 TRP A CB  
310  C CG  . TRP A 42  ? 0.3190 0.3059 0.3463 -0.0265 -0.0211 0.0023  111 TRP A CG  
311  C CD1 . TRP A 42  ? 0.2741 0.2530 0.2982 -0.0263 -0.0204 -0.0034 111 TRP A CD1 
312  C CD2 . TRP A 42  ? 0.3383 0.3268 0.3685 -0.0252 -0.0207 0.0028  111 TRP A CD2 
313  N NE1 . TRP A 42  ? 0.3608 0.3362 0.3856 -0.0248 -0.0197 -0.0062 111 TRP A NE1 
314  C CE2 . TRP A 42  ? 0.2875 0.2684 0.3156 -0.0242 -0.0199 -0.0025 111 TRP A CE2 
315  C CE3 . TRP A 42  ? 0.2900 0.2870 0.3243 -0.0245 -0.0209 0.0075  111 TRP A CE3 
316  C CZ2 . TRP A 42  ? 0.2262 0.2071 0.2558 -0.0229 -0.0195 -0.0031 111 TRP A CZ2 
317  C CZ3 . TRP A 42  ? 0.3045 0.3018 0.3403 -0.0233 -0.0201 0.0066  111 TRP A CZ3 
318  C CH2 . TRP A 42  ? 0.2832 0.2722 0.3164 -0.0226 -0.0195 0.0014  111 TRP A CH2 
319  N N   . VAL A 43  ? 0.1492 0.1591 0.1903 -0.0188 -0.0188 0.0187  112 VAL A N   
320  C CA  . VAL A 43  ? 0.2370 0.2527 0.2836 -0.0145 -0.0171 0.0212  112 VAL A CA  
321  C C   . VAL A 43  ? 0.2463 0.2727 0.2938 -0.0185 -0.0201 0.0247  112 VAL A C   
322  O O   . VAL A 43  ? 0.2636 0.2940 0.3084 -0.0238 -0.0235 0.0265  112 VAL A O   
323  C CB  . VAL A 43  ? 0.3472 0.3664 0.3986 -0.0084 -0.0147 0.0258  112 VAL A CB  
324  C CG1 . VAL A 43  ? 0.2375 0.2449 0.2884 -0.0047 -0.0114 0.0224  112 VAL A CG1 
325  C CG2 . VAL A 43  ? 0.1520 0.1796 0.2036 -0.0101 -0.0172 0.0319  112 VAL A CG2 
326  N N   . PRO A 44  ? 0.2527 0.2844 0.3038 -0.0165 -0.0189 0.0255  113 PRO A N   
327  C CA  . PRO A 44  ? 0.2192 0.2622 0.2717 -0.0209 -0.0216 0.0294  113 PRO A CA  
328  C C   . PRO A 44  ? 0.3225 0.3792 0.3791 -0.0205 -0.0230 0.0363  113 PRO A C   
329  O O   . PRO A 44  ? 0.2825 0.3422 0.3432 -0.0141 -0.0207 0.0390  113 PRO A O   
330  C CB  . PRO A 44  ? 0.2465 0.2930 0.3024 -0.0174 -0.0190 0.0290  113 PRO A CB  
331  C CG  . PRO A 44  ? 0.3395 0.3733 0.3935 -0.0132 -0.0159 0.0230  113 PRO A CG  
332  C CD  . PRO A 44  ? 0.2669 0.2943 0.3202 -0.0108 -0.0151 0.0224  113 PRO A CD  
333  N N   . SER A 45  ? 0.2487 0.3137 0.3042 -0.0275 -0.0270 0.0392  114 SER A N   
334  C CA  . SER A 45  ? 0.3303 0.4096 0.3890 -0.0286 -0.0292 0.0456  114 SER A CA  
335  C C   . SER A 45  ? 0.3010 0.3974 0.3663 -0.0284 -0.0293 0.0510  114 SER A C   
336  O O   . SER A 45  ? 0.3641 0.4616 0.4292 -0.0318 -0.0295 0.0500  114 SER A O   
337  C CB  . SER A 45  ? 0.3657 0.4444 0.4185 -0.0373 -0.0340 0.0451  114 SER A CB  
338  O OG  . SER A 45  ? 0.4407 0.5331 0.4962 -0.0378 -0.0361 0.0512  114 SER A OG  
339  N N   . SER A 46  ? 0.3230 0.4337 0.3941 -0.0243 -0.0292 0.0573  115 SER A N   
340  C CA  . SER A 46  ? 0.3008 0.4313 0.3788 -0.0244 -0.0297 0.0633  115 SER A CA  
341  C C   . SER A 46  ? 0.2701 0.4083 0.3457 -0.0360 -0.0347 0.0649  115 SER A C   
342  O O   . SER A 46  ? 0.4202 0.5713 0.4998 -0.0387 -0.0350 0.0681  115 SER A O   
343  C CB  . SER A 46  ? 0.2765 0.4212 0.3611 -0.0176 -0.0291 0.0700  115 SER A CB  
344  O OG  . SER A 46  ? 0.3515 0.5018 0.4338 -0.0232 -0.0336 0.0731  115 SER A OG  
345  N N   . LYS A 47  ? 0.2642 0.3948 0.3330 -0.0431 -0.0385 0.0626  116 LYS A N   
346  C CA  . LYS A 47  ? 0.3112 0.4456 0.3763 -0.0547 -0.0434 0.0629  116 LYS A CA  
347  C C   . LYS A 47  ? 0.4294 0.5501 0.4895 -0.0597 -0.0435 0.0579  116 LYS A C   
348  O O   . LYS A 47  ? 0.5119 0.6318 0.5678 -0.0697 -0.0476 0.0575  116 LYS A O   
349  C CB  . LYS A 47  ? 0.3169 0.4472 0.3756 -0.0602 -0.0474 0.0615  116 LYS A CB  
350  C CG  . LYS A 47  ? 0.3940 0.5394 0.4570 -0.0566 -0.0483 0.0676  116 LYS A CG  
351  C CD  . LYS A 47  ? 0.4792 0.6145 0.5356 -0.0563 -0.0491 0.0648  116 LYS A CD  
352  C CE  . LYS A 47  ? 0.6115 0.7571 0.6729 -0.0483 -0.0479 0.0708  116 LYS A CE  
353  N NZ  . LYS A 47  ? 0.5914 0.7607 0.6586 -0.0506 -0.0512 0.0788  116 LYS A NZ  
354  N N   . CYS A 48  ? 0.4681 0.5780 0.5282 -0.0532 -0.0393 0.0541  117 CYS A N   
355  C CA  . CYS A 48  ? 0.4742 0.5725 0.5301 -0.0570 -0.0393 0.0502  117 CYS A CA  
356  C C   . CYS A 48  ? 0.4673 0.5798 0.5282 -0.0599 -0.0392 0.0551  117 CYS A C   
357  O O   . CYS A 48  ? 0.4343 0.5600 0.5024 -0.0532 -0.0359 0.0587  117 CYS A O   
358  C CB  . CYS A 48  ? 0.4538 0.5379 0.5083 -0.0492 -0.0350 0.0447  117 CYS A CB  
359  S SG  . CYS A 48  ? 0.5685 0.6398 0.6183 -0.0521 -0.0347 0.0406  117 CYS A SG  
360  N N   . SER A 49  ? 0.4725 0.5822 0.5293 -0.0697 -0.0427 0.0553  118 SER A N   
361  C CA  . SER A 49  ? 0.4089 0.5323 0.4699 -0.0741 -0.0429 0.0605  118 SER A CA  
362  C C   . SER A 49  ? 0.4512 0.5741 0.5149 -0.0668 -0.0381 0.0597  118 SER A C   
363  O O   . SER A 49  ? 0.5363 0.6427 0.5956 -0.0625 -0.0361 0.0541  118 SER A O   
364  C CB  . SER A 49  ? 0.4449 0.5605 0.4997 -0.0864 -0.0476 0.0603  118 SER A CB  
365  O OG  . SER A 49  ? 0.5410 0.6680 0.5992 -0.0911 -0.0475 0.0654  118 SER A OG  
366  N N   . ARG A 50  ? 0.4194 0.5617 0.4901 -0.0654 -0.0361 0.0653  119 ARG A N   
367  C CA  . ARG A 50  ? 0.3857 0.5293 0.4582 -0.0595 -0.0317 0.0647  119 ARG A CA  
368  C C   . ARG A 50  ? 0.4173 0.5511 0.4841 -0.0667 -0.0332 0.0639  119 ARG A C   
369  O O   . ARG A 50  ? 0.3098 0.4438 0.3769 -0.0626 -0.0298 0.0633  119 ARG A O   
370  C CB  . ARG A 50  ? 0.3885 0.5571 0.4701 -0.0555 -0.0289 0.0708  119 ARG A CB  
371  C CG  . ARG A 50  ? 0.5271 0.7034 0.6144 -0.0455 -0.0265 0.0713  119 ARG A CG  
372  C CD  . ARG A 50  ? 0.6382 0.8384 0.7345 -0.0394 -0.0230 0.0765  119 ARG A CD  
373  N NE  . ARG A 50  ? 0.7247 0.9244 0.8211 -0.0334 -0.0181 0.0741  119 ARG A NE  
374  C CZ  . ARG A 50  ? 0.6201 0.8161 0.7182 -0.0216 -0.0133 0.0703  119 ARG A CZ  
375  N NH1 . ARG A 50  ? 0.5637 0.7602 0.6611 -0.0172 -0.0092 0.0678  119 ARG A NH1 
376  N NH2 . ARG A 50  ? 0.4829 0.6744 0.5828 -0.0144 -0.0125 0.0690  119 ARG A NH2 
377  N N   . LEU A 51  ? 0.4775 0.6024 0.5389 -0.0772 -0.0381 0.0641  120 LEU A N   
378  C CA  . LEU A 51  ? 0.4738 0.5846 0.5287 -0.0832 -0.0398 0.0629  120 LEU A CA  
379  C C   . LEU A 51  ? 0.4530 0.5445 0.5029 -0.0761 -0.0376 0.0560  120 LEU A C   
380  O O   . LEU A 51  ? 0.4063 0.4913 0.4533 -0.0760 -0.0366 0.0555  120 LEU A O   
381  C CB  . LEU A 51  ? 0.4966 0.5985 0.5459 -0.0950 -0.0456 0.0633  120 LEU A CB  
382  C CG  . LEU A 51  ? 0.5889 0.7067 0.6412 -0.1059 -0.0485 0.0706  120 LEU A CG  
383  C CD1 . LEU A 51  ? 0.6501 0.7539 0.6951 -0.1177 -0.0544 0.0694  120 LEU A CD1 
384  C CD2 . LEU A 51  ? 0.5094 0.6360 0.5641 -0.1069 -0.0462 0.0754  120 LEU A CD2 
385  N N   . TYR A 52  ? 0.5527 0.6358 0.6015 -0.0704 -0.0369 0.0509  121 TYR A N   
386  C CA  . TYR A 52  ? 0.5110 0.5790 0.5565 -0.0629 -0.0344 0.0445  121 TYR A CA  
387  C C   . TYR A 52  ? 0.4446 0.5225 0.4955 -0.0536 -0.0292 0.0445  121 TYR A C   
388  O O   . TYR A 52  ? 0.5065 0.5943 0.5627 -0.0482 -0.0271 0.0455  121 TYR A O   
389  C CB  . TYR A 52  ? 0.4216 0.4790 0.4644 -0.0608 -0.0353 0.0396  121 TYR A CB  
390  C CG  . TYR A 52  ? 0.4190 0.4643 0.4551 -0.0690 -0.0400 0.0378  121 TYR A CG  
391  C CD1 . TYR A 52  ? 0.4320 0.4597 0.4614 -0.0705 -0.0413 0.0337  121 TYR A CD1 
392  C CD2 . TYR A 52  ? 0.4494 0.5011 0.4857 -0.0750 -0.0433 0.0402  121 TYR A CD2 
393  C CE1 . TYR A 52  ? 0.5213 0.5367 0.5441 -0.0774 -0.0454 0.0314  121 TYR A CE1 
394  C CE2 . TYR A 52  ? 0.4786 0.5186 0.5079 -0.0827 -0.0477 0.0377  121 TYR A CE2 
395  C CZ  . TYR A 52  ? 0.5042 0.5254 0.5267 -0.0836 -0.0486 0.0331  121 TYR A CZ  
396  O OH  . TYR A 52  ? 0.6274 0.6358 0.6426 -0.0905 -0.0527 0.0301  121 TYR A OH  
397  N N   . THR A 53  ? 0.4915 0.5662 0.5406 -0.0516 -0.0272 0.0434  122 THR A N   
398  C CA  . THR A 53  ? 0.4730 0.5575 0.5264 -0.0434 -0.0223 0.0431  122 THR A CA  
399  C C   . THR A 53  ? 0.4526 0.5294 0.5065 -0.0346 -0.0195 0.0372  122 THR A C   
400  O O   . THR A 53  ? 0.4426 0.5282 0.5012 -0.0273 -0.0156 0.0370  122 THR A O   
401  C CB  . THR A 53  ? 0.4548 0.5377 0.5051 -0.0440 -0.0213 0.0431  122 THR A CB  
402  O OG1 . THR A 53  ? 0.4723 0.5604 0.5215 -0.0533 -0.0244 0.0491  122 THR A OG1 
403  C CG2 . THR A 53  ? 0.4726 0.5682 0.5270 -0.0363 -0.0163 0.0430  122 THR A CG2 
404  N N   . ALA A 54  ? 0.4113 0.4719 0.4607 -0.0352 -0.0212 0.0324  123 ALA A N   
405  C CA  . ALA A 54  ? 0.3341 0.3875 0.3840 -0.0281 -0.0187 0.0274  123 ALA A CA  
406  C C   . ALA A 54  ? 0.3633 0.4257 0.4184 -0.0249 -0.0176 0.0300  123 ALA A C   
407  O O   . ALA A 54  ? 0.5234 0.5863 0.5814 -0.0174 -0.0141 0.0281  123 ALA A O   
408  C CB  . ALA A 54  ? 0.3024 0.3391 0.3466 -0.0302 -0.0209 0.0225  123 ALA A CB  
409  N N   . CYS A 55  ? 0.3549 0.4245 0.4113 -0.0305 -0.0208 0.0347  124 CYS A N   
410  C CA  . CYS A 55  ? 0.5155 0.5954 0.5770 -0.0276 -0.0204 0.0382  124 CYS A CA  
411  C C   . CYS A 55  ? 0.5045 0.6016 0.5730 -0.0223 -0.0172 0.0423  124 CYS A C   
412  O O   . CYS A 55  ? 0.5865 0.6910 0.6598 -0.0166 -0.0156 0.0446  124 CYS A O   
413  C CB  . CYS A 55  ? 0.5420 0.6259 0.6024 -0.0358 -0.0251 0.0419  124 CYS A CB  
414  S SG  . CYS A 55  ? 0.5238 0.5888 0.5764 -0.0398 -0.0282 0.0365  124 CYS A SG  
415  N N   . VAL A 56  ? 0.3261 0.4297 0.3950 -0.0235 -0.0161 0.0435  125 VAL A N   
416  C CA  . VAL A 56  ? 0.3822 0.5019 0.4571 -0.0173 -0.0122 0.0463  125 VAL A CA  
417  C C   . VAL A 56  ? 0.3480 0.4599 0.4225 -0.0077 -0.0075 0.0405  125 VAL A C   
418  O O   . VAL A 56  ? 0.3055 0.4260 0.3851 0.0004  -0.0039 0.0412  125 VAL A O   
419  C CB  . VAL A 56  ? 0.4474 0.5790 0.5227 -0.0230 -0.0127 0.0503  125 VAL A CB  
420  C CG1 . VAL A 56  ? 0.2029 0.3495 0.2831 -0.0155 -0.0078 0.0514  125 VAL A CG1 
421  C CG2 . VAL A 56  ? 0.5223 0.6654 0.5998 -0.0320 -0.0170 0.0568  125 VAL A CG2 
422  N N   . TYR A 57  ? 0.4806 0.5764 0.5493 -0.0084 -0.0075 0.0346  126 TYR A N   
423  C CA  . TYR A 57  ? 0.5187 0.6073 0.5863 -0.0008 -0.0035 0.0287  126 TYR A CA  
424  C C   . TYR A 57  ? 0.4044 0.4815 0.4722 0.0044  -0.0023 0.0251  126 TYR A C   
425  O O   . TYR A 57  ? 0.3630 0.4364 0.4314 0.0116  0.0015  0.0210  126 TYR A O   
426  C CB  . TYR A 57  ? 0.4574 0.5356 0.5188 -0.0038 -0.0041 0.0243  126 TYR A CB  
427  N N   . HIS A 58  ? 0.3686 0.4403 0.4357 0.0008  -0.0053 0.0265  127 HIS A N   
428  C CA  . HIS A 58  ? 0.3728 0.4331 0.4394 0.0047  -0.0043 0.0236  127 HIS A CA  
429  C C   . HIS A 58  ? 0.3297 0.3980 0.4012 0.0075  -0.0045 0.0290  127 HIS A C   
430  O O   . HIS A 58  ? 0.4012 0.4842 0.4763 0.0054  -0.0061 0.0348  127 HIS A O   
431  C CB  . HIS A 58  ? 0.3472 0.3937 0.4081 -0.0010 -0.0072 0.0202  127 HIS A CB  
432  C CG  . HIS A 58  ? 0.3329 0.3703 0.3894 -0.0020 -0.0067 0.0145  127 HIS A CG  
433  N ND1 . HIS A 58  ? 0.3545 0.3881 0.4067 -0.0083 -0.0098 0.0139  127 HIS A ND1 
434  C CD2 . HIS A 58  ? 0.3490 0.3805 0.4046 0.0026  -0.0036 0.0093  127 HIS A CD2 
435  C CE1 . HIS A 58  ? 0.2619 0.2887 0.3111 -0.0071 -0.0087 0.0091  127 HIS A CE1 
436  N NE2 . HIS A 58  ? 0.3028 0.3286 0.3539 -0.0009 -0.0050 0.0060  127 HIS A NE2 
437  N N   . LYS A 59  ? 0.3443 0.4031 0.4158 0.0119  -0.0031 0.0273  128 LYS A N   
438  C CA  . LYS A 59  ? 0.4514 0.5161 0.5273 0.0157  -0.0031 0.0326  128 LYS A CA  
439  C C   . LYS A 59  ? 0.4357 0.5014 0.5096 0.0087  -0.0076 0.0360  128 LYS A C   
440  O O   . LYS A 59  ? 0.4690 0.5234 0.5376 0.0037  -0.0094 0.0324  128 LYS A O   
441  C CB  . LYS A 59  ? 0.4633 0.5158 0.5393 0.0228  0.0001  0.0299  128 LYS A CB  
442  C CG  . LYS A 59  ? 0.5116 0.5702 0.5927 0.0289  0.0008  0.0358  128 LYS A CG  
443  C CD  . LYS A 59  ? 0.4356 0.4861 0.5185 0.0385  0.0054  0.0332  128 LYS A CD  
444  C CE  . LYS A 59  ? 0.3360 0.3889 0.4232 0.0449  0.0059  0.0394  128 LYS A CE  
445  N NZ  . LYS A 59  ? 0.4714 0.5072 0.5574 0.0512  0.0093  0.0359  128 LYS A NZ  
446  N N   . LEU A 60  ? 0.3254 0.4056 0.4036 0.0087  -0.0093 0.0428  129 LEU A N   
447  C CA  . LEU A 60  ? 0.3086 0.3930 0.3849 0.0014  -0.0139 0.0462  129 LEU A CA  
448  C C   . LEU A 60  ? 0.3455 0.4306 0.4236 0.0052  -0.0142 0.0503  129 LEU A C   
449  O O   . LEU A 60  ? 0.4454 0.5365 0.5290 0.0133  -0.0117 0.0539  129 LEU A O   
450  C CB  . LEU A 60  ? 0.2754 0.3778 0.3549 -0.0035 -0.0165 0.0514  129 LEU A CB  
451  C CG  . LEU A 60  ? 0.3840 0.4883 0.4626 -0.0068 -0.0160 0.0491  129 LEU A CG  
452  C CD1 . LEU A 60  ? 0.2996 0.4217 0.3813 -0.0131 -0.0190 0.0548  129 LEU A CD1 
453  C CD2 . LEU A 60  ? 0.4463 0.5336 0.5173 -0.0123 -0.0173 0.0428  129 LEU A CD2 
454  N N   . PHE A 61  ? 0.3153 0.3943 0.3885 -0.0004 -0.0171 0.0498  130 PHE A N   
455  C CA  . PHE A 61  ? 0.3884 0.4697 0.4625 0.0019  -0.0180 0.0546  130 PHE A CA  
456  C C   . PHE A 61  ? 0.4340 0.5344 0.5114 -0.0010 -0.0216 0.0617  130 PHE A C   
457  O O   . PHE A 61  ? 0.4458 0.5520 0.5208 -0.0094 -0.0252 0.0614  130 PHE A O   
458  C CB  . PHE A 61  ? 0.3808 0.4493 0.4478 -0.0028 -0.0195 0.0512  130 PHE A CB  
459  C CG  . PHE A 61  ? 0.3467 0.4175 0.4138 -0.0010 -0.0204 0.0565  130 PHE A CG  
460  C CD1 . PHE A 61  ? 0.3622 0.4270 0.4320 0.0070  -0.0171 0.0586  130 PHE A CD1 
461  C CD2 . PHE A 61  ? 0.3344 0.4131 0.3983 -0.0074 -0.0247 0.0594  130 PHE A CD2 
462  C CE1 . PHE A 61  ? 0.3780 0.4447 0.4477 0.0088  -0.0181 0.0644  130 PHE A CE1 
463  C CE2 . PHE A 61  ? 0.4252 0.5071 0.4887 -0.0057 -0.0257 0.0648  130 PHE A CE2 
464  C CZ  . PHE A 61  ? 0.3724 0.4484 0.4390 0.0025  -0.0223 0.0677  130 PHE A CZ  
465  N N   . ASP A 62  ? 0.4039 0.5140 0.4870 0.0058  -0.0208 0.0682  131 ASP A N   
466  C CA  . ASP A 62  ? 0.4628 0.5933 0.5500 0.0041  -0.0243 0.0758  131 ASP A CA  
467  C C   . ASP A 62  ? 0.4135 0.5437 0.4986 0.0043  -0.0263 0.0801  131 ASP A C   
468  O O   . ASP A 62  ? 0.3153 0.4426 0.4033 0.0129  -0.0239 0.0835  131 ASP A O   
469  C CB  . ASP A 62  ? 0.5464 0.6916 0.6426 0.0127  -0.0217 0.0807  131 ASP A CB  
470  C CG  . ASP A 62  ? 0.6461 0.8157 0.7476 0.0097  -0.0254 0.0882  131 ASP A CG  
471  O OD1 . ASP A 62  ? 0.5924 0.7689 0.6938 0.0089  -0.0284 0.0935  131 ASP A OD1 
472  O OD2 . ASP A 62  ? 0.7126 0.8953 0.8182 0.0080  -0.0252 0.0891  131 ASP A OD2 
473  N N   . ALA A 63  ? 0.3865 0.5193 0.4661 -0.0051 -0.0308 0.0798  132 ALA A N   
474  C CA  . ALA A 63  ? 0.3127 0.4453 0.3888 -0.0058 -0.0329 0.0834  132 ALA A CA  
475  C C   . ALA A 63  ? 0.3525 0.5029 0.4356 0.0003  -0.0339 0.0931  132 ALA A C   
476  O O   . ALA A 63  ? 0.4369 0.5841 0.5199 0.0057  -0.0332 0.0974  132 ALA A O   
477  C CB  . ALA A 63  ? 0.1955 0.3290 0.2640 -0.0172 -0.0376 0.0806  132 ALA A CB  
478  N N   . SER A 64  ? 0.3759 0.5456 0.4652 -0.0003 -0.0356 0.0972  133 SER A N   
479  C CA  . SER A 64  ? 0.4207 0.6104 0.5170 0.0052  -0.0371 0.1069  133 SER A CA  
480  C C   . SER A 64  ? 0.4632 0.6498 0.5662 0.0192  -0.0323 0.1105  133 SER A C   
481  O O   . SER A 64  ? 0.5389 0.7402 0.6479 0.0258  -0.0331 0.1189  133 SER A O   
482  C CB  . SER A 64  ? 0.2749 0.4874 0.3767 0.0004  -0.0400 0.1101  133 SER A CB  
483  O OG  . SER A 64  ? 0.4044 0.6200 0.5128 0.0066  -0.0360 0.1092  133 SER A OG  
484  N N   . ASP A 65  ? 0.4209 0.5890 0.5228 0.0240  -0.0275 0.1042  134 ASP A N   
485  C CA  . ASP A 65  ? 0.3671 0.5284 0.4740 0.0369  -0.0227 0.1063  134 ASP A CA  
486  C C   . ASP A 65  ? 0.4359 0.5777 0.5379 0.0400  -0.0212 0.1061  134 ASP A C   
487  O O   . ASP A 65  ? 0.5308 0.6618 0.6354 0.0499  -0.0171 0.1065  134 ASP A O   
488  C CB  . ASP A 65  ? 0.3411 0.4947 0.4498 0.0405  -0.0182 0.0995  134 ASP A CB  
489  C CG  . ASP A 65  ? 0.4033 0.5783 0.5193 0.0420  -0.0182 0.1020  134 ASP A CG  
490  O OD1 . ASP A 65  ? 0.5308 0.7267 0.6526 0.0439  -0.0207 0.1101  134 ASP A OD1 
491  O OD2 . ASP A 65  ? 0.4745 0.6467 0.5905 0.0411  -0.0158 0.0963  134 ASP A OD2 
492  N N   . SER A 66  ? 0.3000 0.4368 0.3948 0.0316  -0.0243 0.1053  135 SER A N   
493  C CA  . SER A 66  ? 0.3409 0.4596 0.4304 0.0328  -0.0228 0.1048  135 SER A CA  
494  C C   . SER A 66  ? 0.3798 0.5080 0.4672 0.0308  -0.0267 0.1129  135 SER A C   
495  O O   . SER A 66  ? 0.3446 0.4839 0.4283 0.0218  -0.0311 0.1130  135 SER A O   
496  C CB  . SER A 66  ? 0.4048 0.5068 0.4865 0.0247  -0.0222 0.0952  135 SER A CB  
497  O OG  . SER A 66  ? 0.3765 0.4637 0.4532 0.0248  -0.0210 0.0953  135 SER A OG  
498  N N   . SER A 67  ? 0.4882 0.6115 0.5775 0.0391  -0.0251 0.1196  136 SER A N   
499  C CA  . SER A 67  ? 0.5935 0.7255 0.6804 0.0378  -0.0286 0.1280  136 SER A CA  
500  C C   . SER A 67  ? 0.5826 0.7025 0.6597 0.0293  -0.0295 0.1243  136 SER A C   
501  O O   . SER A 67  ? 0.4779 0.6083 0.5507 0.0236  -0.0335 0.1283  136 SER A O   
502  C CB  . SER A 67  ? 0.4765 0.6063 0.5685 0.0499  -0.0266 0.1371  136 SER A CB  
503  O OG  . SER A 67  ? 0.5619 0.6706 0.6550 0.0566  -0.0213 0.1327  136 SER A OG  
504  N N   . SER A 68  ? 0.5072 0.6065 0.5807 0.0281  -0.0258 0.1165  137 SER A N   
505  C CA  . SER A 68  ? 0.3473 0.4361 0.4122 0.0203  -0.0261 0.1125  137 SER A CA  
506  C C   . SER A 68  ? 0.3674 0.4595 0.4270 0.0100  -0.0285 0.1041  137 SER A C   
507  O O   . SER A 68  ? 0.4303 0.5153 0.4824 0.0036  -0.0288 0.1000  137 SER A O   
508  C CB  . SER A 68  ? 0.3634 0.4294 0.4268 0.0233  -0.0213 0.1083  137 SER A CB  
509  O OG  . SER A 68  ? 0.5224 0.5810 0.5901 0.0271  -0.0182 0.1019  137 SER A OG  
510  N N   . TYR A 69  ? 0.4407 0.5434 0.5038 0.0085  -0.0301 0.1018  138 TYR A N   
511  C CA  . TYR A 69  ? 0.4456 0.5503 0.5036 -0.0013 -0.0326 0.0943  138 TYR A CA  
512  C C   . TYR A 69  ? 0.4908 0.6064 0.5425 -0.0087 -0.0373 0.0968  138 TYR A C   
513  O O   . TYR A 69  ? 0.5002 0.6301 0.5540 -0.0068 -0.0399 0.1054  138 TYR A O   
514  C CB  . TYR A 69  ? 0.3286 0.4436 0.3922 -0.0016 -0.0335 0.0929  138 TYR A CB  
515  C CG  . TYR A 69  ? 0.2653 0.3858 0.3241 -0.0120 -0.0373 0.0877  138 TYR A CG  
516  C CD1 . TYR A 69  ? 0.2368 0.3764 0.2968 -0.0167 -0.0420 0.0921  138 TYR A CD1 
517  C CD2 . TYR A 69  ? 0.2552 0.3615 0.3083 -0.0172 -0.0363 0.0783  138 TYR A CD2 
518  C CE1 . TYR A 69  ? 0.2436 0.3864 0.2987 -0.0268 -0.0456 0.0871  138 TYR A CE1 
519  C CE2 . TYR A 69  ? 0.2798 0.3890 0.3281 -0.0264 -0.0398 0.0735  138 TYR A CE2 
520  C CZ  . TYR A 69  ? 0.3398 0.4665 0.3889 -0.0314 -0.0445 0.0778  138 TYR A CZ  
521  O OH  . TYR A 69  ? 0.3980 0.5258 0.4419 -0.0410 -0.0480 0.0729  138 TYR A OH  
522  N N   . LYS A 70  ? 0.5488 0.6579 0.5927 -0.0169 -0.0384 0.0891  139 LYS A N   
523  C CA  . LYS A 70  ? 0.4993 0.6170 0.5356 -0.0247 -0.0426 0.0894  139 LYS A CA  
524  C C   . LYS A 70  ? 0.3846 0.4999 0.4158 -0.0332 -0.0447 0.0803  139 LYS A C   
525  O O   . LYS A 70  ? 0.4309 0.5313 0.4590 -0.0344 -0.0422 0.0723  139 LYS A O   
526  C CB  . LYS A 70  ? 0.5898 0.6993 0.6195 -0.0250 -0.0411 0.0899  139 LYS A CB  
527  C CG  . LYS A 70  ? 0.7013 0.8237 0.7245 -0.0305 -0.0453 0.0937  139 LYS A CG  
528  C CD  . LYS A 70  ? 0.7950 0.9095 0.8118 -0.0306 -0.0432 0.0945  139 LYS A CD  
529  C CE  . LYS A 70  ? 0.9112 1.0405 0.9221 -0.0343 -0.0471 0.1006  139 LYS A CE  
530  N NZ  . LYS A 70  ? 0.9003 1.0445 0.9178 -0.0292 -0.0494 0.1120  139 LYS A NZ  
531  N N   . HIS A 71  ? 0.4529 0.5826 0.4832 -0.0392 -0.0495 0.0817  140 HIS A N   
532  C CA  . HIS A 71  ? 0.3974 0.5249 0.4240 -0.0471 -0.0518 0.0741  140 HIS A CA  
533  C C   . HIS A 71  ? 0.3827 0.4998 0.3985 -0.0535 -0.0526 0.0660  140 HIS A C   
534  O O   . HIS A 71  ? 0.4281 0.5493 0.4380 -0.0554 -0.0539 0.0677  140 HIS A O   
535  C CB  . HIS A 71  ? 0.1918 0.3385 0.2203 -0.0525 -0.0570 0.0785  140 HIS A CB  
536  C CG  . HIS A 71  ? 0.2822 0.4271 0.3082 -0.0608 -0.0596 0.0721  140 HIS A CG  
537  N ND1 . HIS A 71  ? 0.3263 0.4650 0.3422 -0.0696 -0.0625 0.0648  140 HIS A ND1 
538  C CD2 . HIS A 71  ? 0.2729 0.4216 0.3049 -0.0617 -0.0599 0.0722  140 HIS A CD2 
539  C CE1 . HIS A 71  ? 0.3567 0.4938 0.3725 -0.0756 -0.0645 0.0608  140 HIS A CE1 
540  N NE2 . HIS A 71  ? 0.3077 0.4514 0.3332 -0.0713 -0.0629 0.0656  140 HIS A NE2 
541  N N   . ASN A 72  ? 0.3076 0.4115 0.3202 -0.0565 -0.0516 0.0572  141 ASN A N   
542  C CA  . ASN A 72  ? 0.3571 0.4538 0.3593 -0.0632 -0.0533 0.0492  141 ASN A CA  
543  C C   . ASN A 72  ? 0.4751 0.5704 0.4745 -0.0707 -0.0568 0.0439  141 ASN A C   
544  O O   . ASN A 72  ? 0.2061 0.3080 0.1993 -0.0781 -0.0612 0.0426  141 ASN A O   
545  C CB  . ASN A 72  ? 0.2834 0.3637 0.2822 -0.0597 -0.0487 0.0432  141 ASN A CB  
546  C CG  . ASN A 72  ? 0.4236 0.4968 0.4117 -0.0654 -0.0500 0.0346  141 ASN A CG  
547  O OD1 . ASN A 72  ? 0.5359 0.6012 0.5204 -0.0693 -0.0513 0.0275  141 ASN A OD1 
548  N ND2 . ASN A 72  ? 0.5388 0.6155 0.5211 -0.0659 -0.0498 0.0354  141 ASN A ND2 
549  N N   . GLY A 73  ? 0.4313 0.5190 0.4352 -0.0693 -0.0552 0.0414  142 GLY A N   
550  C CA  . GLY A 73  ? 0.3033 0.3903 0.3055 -0.0765 -0.0585 0.0381  142 GLY A CA  
551  C C   . GLY A 73  ? 0.3975 0.4682 0.3907 -0.0810 -0.0591 0.0282  142 GLY A C   
552  O O   . GLY A 73  ? 0.4438 0.5106 0.4357 -0.0866 -0.0615 0.0254  142 GLY A O   
553  N N   . THR A 74  ? 0.3506 0.4119 0.3378 -0.0788 -0.0569 0.0231  143 THR A N   
554  C CA  . THR A 74  ? 0.3237 0.3697 0.3025 -0.0818 -0.0572 0.0135  143 THR A CA  
555  C C   . THR A 74  ? 0.3414 0.3751 0.3240 -0.0788 -0.0548 0.0105  143 THR A C   
556  O O   . THR A 74  ? 0.3361 0.3685 0.3255 -0.0720 -0.0509 0.0129  143 THR A O   
557  C CB  . THR A 74  ? 0.3758 0.4166 0.3483 -0.0790 -0.0547 0.0092  143 THR A CB  
558  O OG1 . THR A 74  ? 0.4038 0.4559 0.3711 -0.0830 -0.0575 0.0114  143 THR A OG1 
559  C CG2 . THR A 74  ? 0.2191 0.2440 0.1840 -0.0803 -0.0542 -0.0009 143 THR A CG2 
560  N N   . GLU A 75  ? 0.3426 0.3668 0.3202 -0.0841 -0.0573 0.0050  144 GLU A N   
561  C CA  . GLU A 75  ? 0.2465 0.2600 0.2271 -0.0821 -0.0558 0.0030  144 GLU A CA  
562  C C   . GLU A 75  ? 0.2497 0.2512 0.2294 -0.0753 -0.0515 -0.0022 144 GLU A C   
563  O O   . GLU A 75  ? 0.5490 0.5463 0.5227 -0.0742 -0.0505 -0.0070 144 GLU A O   
564  C CB  . GLU A 75  ? 0.2599 0.2649 0.2345 -0.0900 -0.0599 -0.0011 144 GLU A CB  
565  N N   . LEU A 76  ? 0.2673 0.2648 0.2531 -0.0707 -0.0489 -0.0012 145 LEU A N   
566  C CA  . LEU A 76  ? 0.2336 0.2218 0.2200 -0.0642 -0.0449 -0.0053 145 LEU A CA  
567  C C   . LEU A 76  ? 0.3803 0.3595 0.3685 -0.0632 -0.0446 -0.0071 145 LEU A C   
568  O O   . LEU A 76  ? 0.4773 0.4615 0.4708 -0.0641 -0.0451 -0.0023 145 LEU A O   
569  C CB  . LEU A 76  ? 0.1857 0.1808 0.1790 -0.0581 -0.0410 -0.0009 145 LEU A CB  
570  C CG  . LEU A 76  ? 0.3369 0.3241 0.3313 -0.0521 -0.0369 -0.0049 145 LEU A CG  
571  C CD1 . LEU A 76  ? 0.3306 0.3164 0.3195 -0.0518 -0.0359 -0.0086 145 LEU A CD1 
572  C CD2 . LEU A 76  ? 0.2508 0.2426 0.2534 -0.0469 -0.0336 -0.0002 145 LEU A CD2 
573  N N   . THR A 77  ? 0.4072 0.3741 0.3911 -0.0611 -0.0436 -0.0136 146 THR A N   
574  C CA  . THR A 77  ? 0.3722 0.3303 0.3575 -0.0591 -0.0431 -0.0152 146 THR A CA  
575  C C   . THR A 77  ? 0.3409 0.2939 0.3273 -0.0522 -0.0394 -0.0192 146 THR A C   
576  O O   . THR A 77  ? 0.3578 0.3077 0.3398 -0.0508 -0.0385 -0.0240 146 THR A O   
577  C CB  . THR A 77  ? 0.4489 0.3957 0.4270 -0.0641 -0.0468 -0.0190 146 THR A CB  
578  O OG1 . THR A 77  ? 0.6178 0.5701 0.5966 -0.0711 -0.0502 -0.0142 146 THR A OG1 
579  C CG2 . THR A 77  ? 0.5326 0.4686 0.5111 -0.0607 -0.0459 -0.0212 146 THR A CG2 
580  N N   . LEU A 78  ? 0.3164 0.2698 0.3086 -0.0482 -0.0371 -0.0174 147 LEU A N   
581  C CA  . LEU A 78  ? 0.4188 0.3692 0.4131 -0.0422 -0.0337 -0.0207 147 LEU A CA  
582  C C   . LEU A 78  ? 0.4649 0.4063 0.4581 -0.0404 -0.0342 -0.0234 147 LEU A C   
583  O O   . LEU A 78  ? 0.4753 0.4171 0.4710 -0.0415 -0.0351 -0.0201 147 LEU A O   
584  C CB  . LEU A 78  ? 0.3771 0.3356 0.3787 -0.0388 -0.0306 -0.0167 147 LEU A CB  
585  C CG  . LEU A 78  ? 0.3977 0.3645 0.4007 -0.0396 -0.0299 -0.0131 147 LEU A CG  
586  C CD1 . LEU A 78  ? 0.3844 0.3558 0.3939 -0.0353 -0.0265 -0.0101 147 LEU A CD1 
587  C CD2 . LEU A 78  ? 0.3693 0.3342 0.3669 -0.0403 -0.0298 -0.0170 147 LEU A CD2 
588  N N   . ARG A 79  ? 0.5072 0.4416 0.4970 -0.0373 -0.0334 -0.0292 148 ARG A N   
589  C CA  . ARG A 79  ? 0.5436 0.4693 0.5320 -0.0346 -0.0340 -0.0320 148 ARG A CA  
590  C C   . ARG A 79  ? 0.5547 0.4839 0.5485 -0.0292 -0.0308 -0.0325 148 ARG A C   
591  O O   . ARG A 79  ? 0.5972 0.5306 0.5927 -0.0266 -0.0281 -0.0346 148 ARG A O   
592  C CB  . ARG A 79  ? 0.7405 0.6568 0.7220 -0.0336 -0.0351 -0.0382 148 ARG A CB  
593  C CG  . ARG A 79  ? 0.8020 0.7073 0.7810 -0.0310 -0.0365 -0.0404 148 ARG A CG  
594  C CD  . ARG A 79  ? 0.8355 0.7314 0.8076 -0.0290 -0.0373 -0.0470 148 ARG A CD  
595  N NE  . ARG A 79  ? 0.8841 0.7715 0.8494 -0.0347 -0.0409 -0.0477 148 ARG A NE  
596  C CZ  . ARG A 79  ? 0.8398 0.7151 0.7977 -0.0339 -0.0425 -0.0533 148 ARG A CZ  
597  N NH1 . ARG A 79  ? 0.8701 0.7398 0.8227 -0.0396 -0.0449 -0.0533 148 ARG A NH1 
598  N NH2 . ARG A 79  ? 0.6870 0.5585 0.6437 -0.0268 -0.0406 -0.0585 148 ARG A NH2 
599  N N   . TYR A 80  ? 0.6615 0.5894 0.6576 -0.0279 -0.0311 -0.0305 149 TYR A N   
600  C CA  . TYR A 80  ? 0.6642 0.5948 0.6645 -0.0232 -0.0287 -0.0316 149 TYR A CA  
601  C C   . TYR A 80  ? 0.8421 0.7651 0.8400 -0.0206 -0.0303 -0.0333 149 TYR A C   
602  O O   . TYR A 80  ? 0.8742 0.7889 0.8674 -0.0227 -0.0331 -0.0331 149 TYR A O   
603  C CB  . TYR A 80  ? 0.5839 0.5222 0.5897 -0.0233 -0.0271 -0.0273 149 TYR A CB  
604  C CG  . TYR A 80  ? 0.6196 0.5652 0.6288 -0.0240 -0.0250 -0.0254 149 TYR A CG  
605  C CD1 . TYR A 80  ? 0.5775 0.5255 0.5888 -0.0215 -0.0222 -0.0280 149 TYR A CD1 
606  C CD2 . TYR A 80  ? 0.6369 0.5871 0.6473 -0.0272 -0.0258 -0.0206 149 TYR A CD2 
607  C CE1 . TYR A 80  ? 0.4597 0.4128 0.4737 -0.0220 -0.0203 -0.0257 149 TYR A CE1 
608  C CE2 . TYR A 80  ? 0.5375 0.4941 0.5511 -0.0270 -0.0240 -0.0183 149 TYR A CE2 
609  C CZ  . TYR A 80  ? 0.4567 0.4138 0.4718 -0.0244 -0.0212 -0.0207 149 TYR A CZ  
610  O OH  . TYR A 80  ? 0.3801 0.3420 0.3980 -0.0242 -0.0195 -0.0178 149 TYR A OH  
611  N N   . SER A 81  ? 0.8678 0.7936 0.8688 -0.0162 -0.0285 -0.0349 150 SER A N   
612  C CA  . SER A 81  ? 0.8378 0.7582 0.8372 -0.0133 -0.0301 -0.0354 150 SER A CA  
613  C C   . SER A 81  ? 0.7922 0.7104 0.7908 -0.0163 -0.0322 -0.0302 150 SER A C   
614  O O   . SER A 81  ? 0.7952 0.7046 0.7899 -0.0163 -0.0348 -0.0295 150 SER A O   
615  C CB  . SER A 81  ? 0.9528 0.8797 0.9564 -0.0088 -0.0279 -0.0374 150 SER A CB  
616  O OG  . SER A 81  ? 0.9246 0.8574 0.9316 -0.0098 -0.0271 -0.0339 150 SER A OG  
617  N N   . THR A 82  ? 0.7746 0.7006 0.7769 -0.0186 -0.0310 -0.0264 151 THR A N   
618  C CA  . THR A 82  ? 0.8772 0.8038 0.8793 -0.0216 -0.0325 -0.0212 151 THR A CA  
619  C C   . THR A 82  ? 0.9787 0.9010 0.9776 -0.0275 -0.0352 -0.0183 151 THR A C   
620  O O   . THR A 82  ? 1.0843 1.0035 1.0814 -0.0307 -0.0374 -0.0142 151 THR A O   
621  C CB  . THR A 82  ? 0.8452 0.7829 0.8525 -0.0213 -0.0300 -0.0186 151 THR A CB  
622  O OG1 . THR A 82  ? 0.9234 0.8631 0.9305 -0.0237 -0.0312 -0.0135 151 THR A OG1 
623  C CG2 . THR A 82  ? 0.7429 0.6861 0.7528 -0.0234 -0.0286 -0.0178 151 THR A CG2 
624  N N   . GLY A 83  ? 0.9258 0.8483 0.9239 -0.0296 -0.0352 -0.0200 152 GLY A N   
625  C CA  . GLY A 83  ? 0.8981 0.8185 0.8934 -0.0360 -0.0379 -0.0173 152 GLY A CA  
626  C C   . GLY A 83  ? 0.8491 0.7751 0.8451 -0.0382 -0.0372 -0.0178 152 GLY A C   
627  O O   . GLY A 83  ? 0.9577 0.8822 0.9524 -0.0357 -0.0361 -0.0223 152 GLY A O   
628  N N   . THR A 84  ? 0.7099 0.6438 0.7082 -0.0427 -0.0380 -0.0130 153 THR A N   
629  C CA  . THR A 84  ? 0.5942 0.5321 0.5916 -0.0461 -0.0388 -0.0128 153 THR A CA  
630  C C   . THR A 84  ? 0.5052 0.4565 0.5083 -0.0479 -0.0380 -0.0069 153 THR A C   
631  O O   . THR A 84  ? 0.4660 0.4216 0.4713 -0.0504 -0.0389 -0.0024 153 THR A O   
632  C CB  . THR A 84  ? 0.5688 0.4978 0.5594 -0.0521 -0.0428 -0.0141 153 THR A CB  
633  O OG1 . THR A 84  ? 0.6570 0.5753 0.6422 -0.0493 -0.0429 -0.0206 153 THR A OG1 
634  C CG2 . THR A 84  ? 0.5709 0.5077 0.5613 -0.0577 -0.0445 -0.0116 153 THR A CG2 
635  N N   . VAL A 85  ? 0.4756 0.4339 0.4811 -0.0462 -0.0363 -0.0067 154 VAL A N   
636  C CA  . VAL A 85  ? 0.3770 0.3475 0.3867 -0.0483 -0.0364 -0.0012 154 VAL A CA  
637  C C   . VAL A 85  ? 0.4268 0.3982 0.4325 -0.0531 -0.0391 -0.0016 154 VAL A C   
638  O O   . VAL A 85  ? 0.5039 0.4677 0.5043 -0.0531 -0.0396 -0.0065 154 VAL A O   
639  C CB  . VAL A 85  ? 0.3721 0.3502 0.3879 -0.0425 -0.0325 0.0003  154 VAL A CB  
640  C CG1 . VAL A 85  ? 0.4589 0.4365 0.4781 -0.0381 -0.0300 -0.0001 154 VAL A CG1 
641  C CG2 . VAL A 85  ? 0.2339 0.2083 0.2478 -0.0399 -0.0310 -0.0035 154 VAL A CG2 
642  N N   . SER A 86  ? 0.3777 0.3596 0.3858 -0.0573 -0.0409 0.0037  155 SER A N   
643  C CA  . SER A 86  ? 0.2957 0.2806 0.2999 -0.0627 -0.0440 0.0040  155 SER A CA  
644  C C   . SER A 86  ? 0.3282 0.3290 0.3382 -0.0626 -0.0438 0.0104  155 SER A C   
645  O O   . SER A 86  ? 0.4116 0.4211 0.4284 -0.0598 -0.0420 0.0150  155 SER A O   
646  C CB  . SER A 86  ? 0.4527 0.4320 0.4517 -0.0707 -0.0484 0.0035  155 SER A CB  
647  O OG  . SER A 86  ? 0.6763 0.6395 0.6690 -0.0702 -0.0488 -0.0027 155 SER A OG  
648  N N   . GLY A 87  ? 0.2909 0.2960 0.2980 -0.0653 -0.0456 0.0106  156 GLY A N   
649  C CA  . GLY A 87  ? 0.3385 0.3593 0.3508 -0.0651 -0.0458 0.0171  156 GLY A CA  
650  C C   . GLY A 87  ? 0.3234 0.3469 0.3311 -0.0670 -0.0474 0.0164  156 GLY A C   
651  O O   . GLY A 87  ? 0.3600 0.3754 0.3598 -0.0714 -0.0496 0.0111  156 GLY A O   
652  N N   . PHE A 88  ? 0.2210 0.2557 0.2334 -0.0634 -0.0461 0.0217  157 PHE A N   
653  C CA  . PHE A 88  ? 0.3035 0.3435 0.3120 -0.0651 -0.0477 0.0225  157 PHE A CA  
654  C C   . PHE A 88  ? 0.2336 0.2739 0.2450 -0.0577 -0.0438 0.0244  157 PHE A C   
655  O O   . PHE A 88  ? 0.2592 0.2988 0.2770 -0.0515 -0.0403 0.0265  157 PHE A O   
656  C CB  . PHE A 88  ? 0.1843 0.2408 0.1950 -0.0699 -0.0515 0.0289  157 PHE A CB  
657  C CG  . PHE A 88  ? 0.2531 0.3224 0.2738 -0.0652 -0.0500 0.0365  157 PHE A CG  
658  C CD1 . PHE A 88  ? 0.2638 0.3360 0.2893 -0.0662 -0.0500 0.0381  157 PHE A CD1 
659  C CD2 . PHE A 88  ? 0.3010 0.3796 0.3261 -0.0595 -0.0484 0.0423  157 PHE A CD2 
660  C CE1 . PHE A 88  ? 0.2423 0.3272 0.2768 -0.0613 -0.0482 0.0447  157 PHE A CE1 
661  C CE2 . PHE A 88  ? 0.3161 0.4061 0.3504 -0.0542 -0.0468 0.0489  157 PHE A CE2 
662  C CZ  . PHE A 88  ? 0.3062 0.3999 0.3452 -0.0549 -0.0466 0.0498  157 PHE A CZ  
663  N N   . LEU A 89  ? 0.2908 0.3320 0.2971 -0.0588 -0.0443 0.0237  158 LEU A N   
664  C CA  . LEU A 89  ? 0.2515 0.2928 0.2596 -0.0530 -0.0410 0.0261  158 LEU A CA  
665  C C   . LEU A 89  ? 0.3063 0.3614 0.3205 -0.0502 -0.0413 0.0352  158 LEU A C   
666  O O   . LEU A 89  ? 0.4207 0.4878 0.4350 -0.0543 -0.0451 0.0392  158 LEU A O   
667  C CB  . LEU A 89  ? 0.3114 0.3493 0.3113 -0.0554 -0.0413 0.0222  158 LEU A CB  
668  C CG  . LEU A 89  ? 0.3978 0.4222 0.3918 -0.0561 -0.0400 0.0131  158 LEU A CG  
669  C CD1 . LEU A 89  ? 0.3553 0.3799 0.3407 -0.0590 -0.0408 0.0097  158 LEU A CD1 
670  C CD2 . LEU A 89  ? 0.3763 0.3927 0.3749 -0.0499 -0.0354 0.0116  158 LEU A CD2 
671  N N   . SER A 90  ? 0.2472 0.3002 0.2665 -0.0432 -0.0375 0.0384  159 SER A N   
672  C CA  . SER A 90  ? 0.2247 0.2884 0.2499 -0.0387 -0.0372 0.0471  159 SER A CA  
673  C C   . SER A 90  ? 0.3374 0.3941 0.3625 -0.0338 -0.0336 0.0485  159 SER A C   
674  O O   . SER A 90  ? 0.3154 0.3599 0.3380 -0.0331 -0.0308 0.0427  159 SER A O   
675  C CB  . SER A 90  ? 0.1704 0.2386 0.2042 -0.0341 -0.0359 0.0505  159 SER A CB  
676  O OG  . SER A 90  ? 0.3273 0.4066 0.3622 -0.0391 -0.0396 0.0520  159 SER A OG  
677  N N   . GLN A 91  ? 0.2963 0.3611 0.3242 -0.0303 -0.0337 0.0565  160 GLN A N   
678  C CA  . GLN A 91  ? 0.2258 0.2837 0.2538 -0.0259 -0.0304 0.0592  160 GLN A CA  
679  C C   . GLN A 91  ? 0.2489 0.3100 0.2849 -0.0181 -0.0287 0.0668  160 GLN A C   
680  O O   . GLN A 91  ? 0.2708 0.3453 0.3106 -0.0167 -0.0311 0.0732  160 GLN A O   
681  C CB  . GLN A 91  ? 0.1933 0.2560 0.2146 -0.0296 -0.0322 0.0618  160 GLN A CB  
682  C CG  . GLN A 91  ? 0.3288 0.3833 0.3489 -0.0267 -0.0288 0.0639  160 GLN A CG  
683  C CD  . GLN A 91  ? 0.4948 0.5587 0.5114 -0.0278 -0.0306 0.0716  160 GLN A CD  
684  O OE1 . GLN A 91  ? 0.6662 0.7374 0.6872 -0.0235 -0.0314 0.0805  160 GLN A OE1 
685  N NE2 . GLN A 91  ? 0.3863 0.4507 0.3946 -0.0332 -0.0313 0.0683  160 GLN A NE2 
686  N N   . ASP A 92  ? 0.2550 0.3037 0.2935 -0.0130 -0.0245 0.0660  161 ASP A N   
687  C CA  . ASP A 92  ? 0.1875 0.2358 0.2328 -0.0048 -0.0223 0.0724  161 ASP A CA  
688  C C   . ASP A 92  ? 0.3324 0.3645 0.3771 -0.0018 -0.0181 0.0707  161 ASP A C   
689  O O   . ASP A 92  ? 0.5054 0.5287 0.5455 -0.0061 -0.0169 0.0644  161 ASP A O   
690  C CB  . ASP A 92  ? 0.3687 0.4209 0.4205 -0.0008 -0.0217 0.0715  161 ASP A CB  
691  C CG  . ASP A 92  ? 0.4130 0.4731 0.4718 0.0073  -0.0212 0.0800  161 ASP A CG  
692  O OD1 . ASP A 92  ? 0.4199 0.4748 0.4793 0.0119  -0.0197 0.0853  161 ASP A OD1 
693  O OD2 . ASP A 92  ? 0.4925 0.5642 0.5564 0.0092  -0.0223 0.0816  161 ASP A OD2 
694  N N   . ILE A 93  ? 0.3532 0.3817 0.4028 0.0055  -0.0160 0.0766  162 ILE A N   
695  C CA  . ILE A 93  ? 0.4363 0.4483 0.4857 0.0083  -0.0120 0.0753  162 ILE A CA  
696  C C   . ILE A 93  ? 0.4858 0.4885 0.5376 0.0098  -0.0093 0.0670  162 ILE A C   
697  O O   . ILE A 93  ? 0.5309 0.5385 0.5874 0.0140  -0.0092 0.0664  162 ILE A O   
698  C CB  . ILE A 93  ? 0.3646 0.3741 0.4180 0.0159  -0.0108 0.0845  162 ILE A CB  
699  C CG1 . ILE A 93  ? 0.4855 0.5059 0.5363 0.0143  -0.0138 0.0935  162 ILE A CG1 
700  C CG2 . ILE A 93  ? 0.4402 0.4310 0.4928 0.0176  -0.0069 0.0831  162 ILE A CG2 
701  N N   . ILE A 94  ? 0.4341 0.4249 0.4826 0.0063  -0.0072 0.0606  163 ILE A N   
702  C CA  . ILE A 94  ? 0.3604 0.3422 0.4104 0.0072  -0.0048 0.0525  163 ILE A CA  
703  C C   . ILE A 94  ? 0.4055 0.3718 0.4558 0.0094  -0.0012 0.0518  163 ILE A C   
704  O O   . ILE A 94  ? 0.3961 0.3571 0.4429 0.0056  -0.0007 0.0531  163 ILE A O   
705  C CB  . ILE A 94  ? 0.3759 0.3585 0.4217 0.0005  -0.0059 0.0445  163 ILE A CB  
706  C CG1 . ILE A 94  ? 0.4379 0.4336 0.4833 -0.0019 -0.0094 0.0445  163 ILE A CG1 
707  C CG2 . ILE A 94  ? 0.2602 0.2331 0.3072 0.0015  -0.0033 0.0368  163 ILE A CG2 
708  C CD1 . ILE A 94  ? 0.3706 0.3653 0.4121 -0.0074 -0.0105 0.0367  163 ILE A CD1 
709  N N   . THR A 95  ? 0.5057 0.4649 0.5598 0.0152  0.0012  0.0497  164 THR A N   
710  C CA  . THR A 95  ? 0.5219 0.4649 0.5763 0.0172  0.0046  0.0480  164 THR A CA  
711  C C   . THR A 95  ? 0.5047 0.4412 0.5581 0.0145  0.0061  0.0379  164 THR A C   
712  O O   . THR A 95  ? 0.5576 0.4995 0.6126 0.0162  0.0058  0.0336  164 THR A O   
713  C CB  . THR A 95  ? 0.4875 0.4262 0.5464 0.0264  0.0063  0.0525  164 THR A CB  
714  O OG1 . THR A 95  ? 0.4760 0.4181 0.5379 0.0306  0.0072  0.0474  164 THR A OG1 
715  C CG2 . THR A 95  ? 0.5829 0.5331 0.6437 0.0299  0.0040  0.0626  164 THR A CG2 
716  N N   . VAL A 96  ? 0.4510 0.3771 0.5018 0.0099  0.0076  0.0346  165 VAL A N   
717  C CA  . VAL A 96  ? 0.5152 0.4350 0.5651 0.0073  0.0091  0.0254  165 VAL A CA  
718  C C   . VAL A 96  ? 0.5838 0.4879 0.6332 0.0064  0.0118  0.0244  165 VAL A C   
719  O O   . VAL A 96  ? 0.6552 0.5559 0.7024 0.0017  0.0120  0.0275  165 VAL A O   
720  C CB  . VAL A 96  ? 0.4971 0.4240 0.5439 0.0005  0.0074  0.0205  165 VAL A CB  
721  C CG1 . VAL A 96  ? 0.4755 0.4051 0.5192 -0.0045 0.0065  0.0248  165 VAL A CG1 
722  C CG2 . VAL A 96  ? 0.4830 0.4032 0.5293 -0.0021 0.0089  0.0119  165 VAL A CG2 
723  N N   . GLY A 97  ? 0.6184 0.5130 0.6694 0.0105  0.0140  0.0201  166 GLY A N   
724  C CA  . GLY A 97  ? 0.6494 0.5273 0.6998 0.0101  0.0164  0.0199  166 GLY A CA  
725  C C   . GLY A 97  ? 0.6869 0.5600 0.7382 0.0142  0.0167  0.0297  166 GLY A C   
726  O O   . GLY A 97  ? 0.7611 0.6405 0.8150 0.0211  0.0160  0.0347  166 GLY A O   
727  N N   . GLY A 98  ? 0.7174 0.5802 0.7666 0.0098  0.0175  0.0331  167 GLY A N   
728  C CA  . GLY A 98  ? 0.7632 0.6210 0.8127 0.0131  0.0176  0.0433  167 GLY A CA  
729  C C   . GLY A 98  ? 0.7985 0.6696 0.8465 0.0096  0.0152  0.0507  167 GLY A C   
730  O O   . GLY A 98  ? 0.7753 0.6434 0.8228 0.0112  0.0150  0.0601  167 GLY A O   
731  N N   . ILE A 99  ? 0.7738 0.6592 0.8205 0.0049  0.0133  0.0469  168 ILE A N   
732  C CA  . ILE A 99  ? 0.6336 0.5314 0.6775 0.0004  0.0112  0.0520  168 ILE A CA  
733  C C   . ILE A 99  ? 0.7096 0.6226 0.7550 0.0045  0.0085  0.0545  168 ILE A C   
734  O O   . ILE A 99  ? 0.7322 0.6504 0.7794 0.0066  0.0079  0.0487  168 ILE A O   
735  C CB  . ILE A 99  ? 0.5799 0.4822 0.6208 -0.0080 0.0111  0.0454  168 ILE A CB  
736  C CG1 . ILE A 99  ? 0.5499 0.4394 0.5895 -0.0132 0.0135  0.0448  168 ILE A CG1 
737  C CG2 . ILE A 99  ? 0.6560 0.5731 0.6938 -0.0116 0.0087  0.0487  168 ILE A CG2 
738  C CD1 . ILE A 99  ? 0.4899 0.3839 0.5276 -0.0208 0.0139  0.0377  168 ILE A CD1 
739  N N   . THR A 100 ? 0.6860 0.6066 0.7304 0.0053  0.0067  0.0635  169 THR A N   
740  C CA  . THR A 100 ? 0.6361 0.5729 0.6815 0.0076  0.0036  0.0666  169 THR A CA  
741  C C   . THR A 100 ? 0.5500 0.4981 0.5904 0.0007  0.0013  0.0681  169 THR A C   
742  O O   . THR A 100 ? 0.5153 0.4604 0.5524 -0.0030 0.0019  0.0723  169 THR A O   
743  C CB  . THR A 100 ? 0.5476 0.4858 0.5963 0.0155  0.0030  0.0761  169 THR A CB  
744  O OG1 . THR A 100 ? 0.6635 0.5973 0.7098 0.0144  0.0032  0.0847  169 THR A OG1 
745  C CG2 . THR A 100 ? 0.4371 0.3634 0.4903 0.0230  0.0057  0.0739  169 THR A CG2 
746  N N   . VAL A 101 ? 0.4485 0.4091 0.4880 -0.0012 -0.0013 0.0644  170 VAL A N   
747  C CA  . VAL A 101 ? 0.3816 0.3530 0.4158 -0.0074 -0.0036 0.0644  170 VAL A CA  
748  C C   . VAL A 101 ? 0.4576 0.4432 0.4921 -0.0066 -0.0072 0.0659  170 VAL A C   
749  O O   . VAL A 101 ? 0.4713 0.4590 0.5097 -0.0035 -0.0077 0.0630  170 VAL A O   
750  C CB  . VAL A 101 ? 0.3197 0.2890 0.3506 -0.0133 -0.0027 0.0549  170 VAL A CB  
751  C CG1 . VAL A 101 ? 0.4848 0.4454 0.5136 -0.0168 0.0001  0.0551  170 VAL A CG1 
752  C CG2 . VAL A 101 ? 0.4198 0.3846 0.4540 -0.0113 -0.0019 0.0471  170 VAL A CG2 
753  N N   . THR A 102 ? 0.3769 0.3731 0.4072 -0.0100 -0.0097 0.0704  171 THR A N   
754  C CA  . THR A 102 ? 0.4371 0.4471 0.4662 -0.0118 -0.0136 0.0700  171 THR A CA  
755  C C   . THR A 102 ? 0.3949 0.4046 0.4199 -0.0174 -0.0141 0.0600  171 THR A C   
756  O O   . THR A 102 ? 0.3502 0.3576 0.3700 -0.0217 -0.0131 0.0568  171 THR A O   
757  C CB  . THR A 102 ? 0.4703 0.4918 0.4956 -0.0137 -0.0164 0.0780  171 THR A CB  
758  O OG1 . THR A 102 ? 0.5522 0.5755 0.5823 -0.0073 -0.0165 0.0877  171 THR A OG1 
759  C CG2 . THR A 102 ? 0.3713 0.4064 0.3937 -0.0177 -0.0205 0.0757  171 THR A CG2 
760  N N   . GLN A 103 ? 0.2887 0.3008 0.3160 -0.0170 -0.0154 0.0553  172 GLN A N   
761  C CA  . GLN A 103 ? 0.2550 0.2643 0.2792 -0.0209 -0.0156 0.0459  172 GLN A CA  
762  C C   . GLN A 103 ? 0.3249 0.3437 0.3475 -0.0238 -0.0195 0.0444  172 GLN A C   
763  O O   . GLN A 103 ? 0.3899 0.4158 0.4167 -0.0215 -0.0212 0.0488  172 GLN A O   
764  C CB  . GLN A 103 ? 0.1816 0.1806 0.2100 -0.0180 -0.0128 0.0405  172 GLN A CB  
765  C CG  . GLN A 103 ? 0.2460 0.2427 0.2717 -0.0213 -0.0133 0.0316  172 GLN A CG  
766  C CD  . GLN A 103 ? 0.3476 0.3401 0.3685 -0.0248 -0.0119 0.0271  172 GLN A CD  
767  O OE1 . GLN A 103 ? 0.4185 0.4118 0.4353 -0.0280 -0.0130 0.0211  172 GLN A OE1 
768  N NE2 . GLN A 103 ? 0.3999 0.3882 0.4213 -0.0241 -0.0093 0.0302  172 GLN A NE2 
769  N N   . MET A 104 ? 0.3831 0.4020 0.3997 -0.0289 -0.0209 0.0382  173 MET A N   
770  C CA  . MET A 104 ? 0.3592 0.3831 0.3735 -0.0325 -0.0244 0.0348  173 MET A CA  
771  C C   . MET A 104 ? 0.3755 0.3913 0.3920 -0.0316 -0.0232 0.0281  173 MET A C   
772  O O   . MET A 104 ? 0.4006 0.4081 0.4153 -0.0316 -0.0210 0.0223  173 MET A O   
773  C CB  . MET A 104 ? 0.2765 0.3036 0.2823 -0.0382 -0.0266 0.0313  173 MET A CB  
774  C CG  . MET A 104 ? 0.6005 0.6317 0.6030 -0.0428 -0.0307 0.0280  173 MET A CG  
775  S SD  . MET A 104 ? 0.7691 0.8163 0.7724 -0.0450 -0.0350 0.0365  173 MET A SD  
776  C CE  . MET A 104 ? 0.6377 0.6906 0.6344 -0.0468 -0.0352 0.0397  173 MET A CE  
777  N N   . PHE A 105 ? 0.2357 0.2550 0.2563 -0.0307 -0.0247 0.0293  174 PHE A N   
778  C CA  . PHE A 105 ? 0.2355 0.2484 0.2585 -0.0295 -0.0236 0.0243  174 PHE A CA  
779  C C   . PHE A 105 ? 0.2946 0.3129 0.3167 -0.0334 -0.0271 0.0238  174 PHE A C   
780  O O   . PHE A 105 ? 0.3803 0.4083 0.4017 -0.0363 -0.0302 0.0280  174 PHE A O   
781  C CB  . PHE A 105 ? 0.2824 0.2931 0.3125 -0.0233 -0.0204 0.0270  174 PHE A CB  
782  C CG  . PHE A 105 ? 0.2194 0.2403 0.2547 -0.0205 -0.0215 0.0342  174 PHE A CG  
783  C CD1 . PHE A 105 ? 0.2938 0.3216 0.3297 -0.0194 -0.0222 0.0412  174 PHE A CD1 
784  C CD2 . PHE A 105 ? 0.2023 0.2271 0.2422 -0.0188 -0.0215 0.0345  174 PHE A CD2 
785  C CE1 . PHE A 105 ? 0.2569 0.2954 0.2982 -0.0161 -0.0232 0.0482  174 PHE A CE1 
786  C CE2 . PHE A 105 ? 0.2381 0.2741 0.2833 -0.0158 -0.0222 0.0412  174 PHE A CE2 
787  C CZ  . PHE A 105 ? 0.2604 0.3034 0.3066 -0.0142 -0.0231 0.0480  174 PHE A CZ  
788  N N   . GLY A 106 ? 0.2328 0.2449 0.2549 -0.0338 -0.0269 0.0188  175 GLY A N   
789  C CA  . GLY A 106 ? 0.2175 0.2333 0.2390 -0.0379 -0.0301 0.0185  175 GLY A CA  
790  C C   . GLY A 106 ? 0.2721 0.2953 0.3007 -0.0351 -0.0296 0.0234  175 GLY A C   
791  O O   . GLY A 106 ? 0.3658 0.3856 0.3987 -0.0299 -0.0263 0.0229  175 GLY A O   
792  N N   . GLU A 107 ? 0.1634 0.1977 0.1932 -0.0386 -0.0328 0.0279  176 GLU A N   
793  C CA  . GLU A 107 ? 0.2559 0.2994 0.2920 -0.0372 -0.0327 0.0321  176 GLU A CA  
794  C C   . GLU A 107 ? 0.2963 0.3365 0.3297 -0.0428 -0.0349 0.0289  176 GLU A C   
795  O O   . GLU A 107 ? 0.4313 0.4733 0.4604 -0.0498 -0.0388 0.0285  176 GLU A O   
796  C CB  . GLU A 107 ? 0.2860 0.3452 0.3255 -0.0381 -0.0351 0.0396  176 GLU A CB  
797  C CG  . GLU A 107 ? 0.1803 0.2448 0.2252 -0.0307 -0.0325 0.0449  176 GLU A CG  
798  C CD  . GLU A 107 ? 0.3838 0.4665 0.4341 -0.0305 -0.0347 0.0529  176 GLU A CD  
799  O OE1 . GLU A 107 ? 0.4121 0.5018 0.4612 -0.0314 -0.0367 0.0571  176 GLU A OE1 
800  O OE2 . GLU A 107 ? 0.3483 0.4395 0.4039 -0.0296 -0.0344 0.0551  176 GLU A OE2 
801  N N   . VAL A 108 ? 0.2016 0.2367 0.2373 -0.0398 -0.0325 0.0266  177 VAL A N   
802  C CA  . VAL A 108 ? 0.2915 0.3198 0.3236 -0.0442 -0.0341 0.0230  177 VAL A CA  
803  C C   . VAL A 108 ? 0.3072 0.3466 0.3430 -0.0477 -0.0358 0.0278  177 VAL A C   
804  O O   . VAL A 108 ? 0.2806 0.3296 0.3229 -0.0433 -0.0335 0.0318  177 VAL A O   
805  C CB  . VAL A 108 ? 0.3556 0.3731 0.3876 -0.0395 -0.0308 0.0181  177 VAL A CB  
806  C CG1 . VAL A 108 ? 0.2985 0.3128 0.3292 -0.0424 -0.0318 0.0170  177 VAL A CG1 
807  C CG2 . VAL A 108 ? 0.2055 0.2115 0.2322 -0.0389 -0.0302 0.0125  177 VAL A CG2 
808  N N   . THR A 109 ? 0.2924 0.3304 0.3237 -0.0558 -0.0398 0.0274  178 THR A N   
809  C CA  . THR A 109 ? 0.3344 0.3832 0.3687 -0.0609 -0.0420 0.0322  178 THR A CA  
810  C C   . THR A 109 ? 0.4277 0.4675 0.4589 -0.0648 -0.0428 0.0300  178 THR A C   
811  O O   . THR A 109 ? 0.5229 0.5708 0.5561 -0.0697 -0.0445 0.0341  178 THR A O   
812  C CB  . THR A 109 ? 0.3554 0.4126 0.3878 -0.0687 -0.0465 0.0350  178 THR A CB  
813  O OG1 . THR A 109 ? 0.3617 0.4053 0.3852 -0.0737 -0.0493 0.0293  178 THR A OG1 
814  C CG2 . THR A 109 ? 0.4072 0.4770 0.4439 -0.0647 -0.0459 0.0392  178 THR A CG2 
815  N N   . GLU A 110 ? 0.4825 0.5063 0.5087 -0.0627 -0.0418 0.0240  179 GLU A N   
816  C CA  . GLU A 110 ? 0.4465 0.4608 0.4696 -0.0650 -0.0425 0.0222  179 GLU A CA  
817  C C   . GLU A 110 ? 0.4840 0.4905 0.5077 -0.0572 -0.0386 0.0183  179 GLU A C   
818  O O   . GLU A 110 ? 0.4818 0.4773 0.5015 -0.0546 -0.0381 0.0129  179 GLU A O   
819  C CB  . GLU A 110 ? 0.5365 0.5378 0.5515 -0.0719 -0.0465 0.0186  179 GLU A CB  
820  C CG  . GLU A 110 ? 0.6731 0.6816 0.6868 -0.0807 -0.0507 0.0218  179 GLU A CG  
821  C CD  . GLU A 110 ? 0.8303 0.8240 0.8351 -0.0877 -0.0547 0.0175  179 GLU A CD  
822  O OE1 . GLU A 110 ? 0.7581 0.7553 0.7610 -0.0966 -0.0586 0.0200  179 GLU A OE1 
823  O OE2 . GLU A 110 ? 0.9286 0.9071 0.9283 -0.0841 -0.0538 0.0114  179 GLU A OE2 
824  N N   . MET A 111 ? 0.5523 0.5656 0.5808 -0.0535 -0.0359 0.0209  180 MET A N   
825  C CA  . MET A 111 ? 0.4809 0.4883 0.5099 -0.0469 -0.0326 0.0174  180 MET A CA  
826  C C   . MET A 111 ? 0.4574 0.4622 0.4847 -0.0492 -0.0333 0.0185  180 MET A C   
827  O O   . MET A 111 ? 0.5159 0.5319 0.5469 -0.0503 -0.0327 0.0233  180 MET A O   
828  C CB  . MET A 111 ? 0.5026 0.5200 0.5380 -0.0401 -0.0285 0.0189  180 MET A CB  
829  C CG  . MET A 111 ? 0.4392 0.4542 0.4754 -0.0357 -0.0268 0.0165  180 MET A CG  
830  S SD  . MET A 111 ? 0.5031 0.5223 0.5450 -0.0268 -0.0217 0.0160  180 MET A SD  
831  C CE  . MET A 111 ? 0.3835 0.4205 0.4317 -0.0264 -0.0212 0.0231  180 MET A CE  
832  N N   . PRO A 112 ? 0.3472 0.3384 0.3691 -0.0498 -0.0346 0.0146  181 PRO A N   
833  C CA  . PRO A 112 ? 0.3354 0.3234 0.3553 -0.0517 -0.0354 0.0164  181 PRO A CA  
834  C C   . PRO A 112 ? 0.3419 0.3363 0.3653 -0.0456 -0.0316 0.0164  181 PRO A C   
835  O O   . PRO A 112 ? 0.3998 0.3945 0.4253 -0.0393 -0.0287 0.0128  181 PRO A O   
836  C CB  . PRO A 112 ? 0.2073 0.1785 0.2207 -0.0521 -0.0375 0.0116  181 PRO A CB  
837  C CG  . PRO A 112 ? 0.2282 0.1959 0.2415 -0.0473 -0.0358 0.0062  181 PRO A CG  
838  C CD  . PRO A 112 ? 0.2790 0.2576 0.2963 -0.0482 -0.0352 0.0086  181 PRO A CD  
839  N N   . ALA A 113 ? 0.3566 0.3560 0.3802 -0.0479 -0.0319 0.0207  182 ALA A N   
840  C CA  . ALA A 113 ? 0.3632 0.3701 0.3894 -0.0426 -0.0284 0.0208  182 ALA A CA  
841  C C   . ALA A 113 ? 0.4229 0.4197 0.4462 -0.0375 -0.0274 0.0153  182 ALA A C   
842  O O   . ALA A 113 ? 0.4596 0.4598 0.4851 -0.0316 -0.0241 0.0121  182 ALA A O   
843  C CB  . ALA A 113 ? 0.2457 0.2607 0.2721 -0.0468 -0.0290 0.0270  182 ALA A CB  
844  N N   . LEU A 114 ? 0.2987 0.2829 0.3168 -0.0398 -0.0303 0.0140  183 LEU A N   
845  C CA  . LEU A 114 ? 0.3380 0.3129 0.3536 -0.0350 -0.0299 0.0085  183 LEU A CA  
846  C C   . LEU A 114 ? 0.4441 0.4120 0.4590 -0.0340 -0.0302 0.0038  183 LEU A C   
847  O O   . LEU A 114 ? 0.4959 0.4557 0.5074 -0.0380 -0.0332 0.0038  183 LEU A O   
848  C CB  . LEU A 114 ? 0.3341 0.2994 0.3445 -0.0367 -0.0327 0.0097  183 LEU A CB  
849  C CG  . LEU A 114 ? 0.4533 0.4101 0.4613 -0.0314 -0.0326 0.0045  183 LEU A CG  
850  C CD1 . LEU A 114 ? 0.3446 0.3098 0.3550 -0.0262 -0.0296 0.0027  183 LEU A CD1 
851  C CD2 . LEU A 114 ? 0.5169 0.4624 0.5196 -0.0332 -0.0360 0.0065  183 LEU A CD2 
852  N N   . PRO A 115 ? 0.4139 0.3842 0.4317 -0.0292 -0.0273 -0.0003 184 PRO A N   
853  C CA  . PRO A 115 ? 0.3561 0.3328 0.3768 -0.0242 -0.0240 -0.0019 184 PRO A CA  
854  C C   . PRO A 115 ? 0.2814 0.2682 0.3071 -0.0223 -0.0210 -0.0006 184 PRO A C   
855  O O   . PRO A 115 ? 0.2634 0.2549 0.2910 -0.0182 -0.0181 -0.0024 184 PRO A O   
856  C CB  . PRO A 115 ? 0.3986 0.3684 0.4183 -0.0206 -0.0232 -0.0081 184 PRO A CB  
857  C CG  . PRO A 115 ? 0.3044 0.2698 0.3235 -0.0227 -0.0243 -0.0090 184 PRO A CG  
858  C CD  . PRO A 115 ? 0.2988 0.2634 0.3159 -0.0283 -0.0274 -0.0044 184 PRO A CD  
859  N N   . PHE A 116 ? 0.2395 0.2297 0.2671 -0.0248 -0.0216 0.0022  185 PHE A N   
860  C CA  . PHE A 116 ? 0.2184 0.2161 0.2508 -0.0215 -0.0187 0.0028  185 PHE A CA  
861  C C   . PHE A 116 ? 0.2666 0.2759 0.3024 -0.0195 -0.0164 0.0060  185 PHE A C   
862  O O   . PHE A 116 ? 0.2753 0.2898 0.3150 -0.0151 -0.0134 0.0056  185 PHE A O   
863  C CB  . PHE A 116 ? 0.2441 0.2432 0.2775 -0.0245 -0.0203 0.0053  185 PHE A CB  
864  C CG  . PHE A 116 ? 0.2475 0.2366 0.2776 -0.0254 -0.0217 0.0015  185 PHE A CG  
865  C CD1 . PHE A 116 ? 0.2477 0.2334 0.2788 -0.0214 -0.0193 -0.0023 185 PHE A CD1 
866  C CD2 . PHE A 116 ? 0.3008 0.2835 0.3264 -0.0303 -0.0252 0.0014  185 PHE A CD2 
867  C CE1 . PHE A 116 ? 0.2884 0.2665 0.3165 -0.0223 -0.0202 -0.0057 185 PHE A CE1 
868  C CE2 . PHE A 116 ? 0.4077 0.3820 0.4300 -0.0305 -0.0261 -0.0027 185 PHE A CE2 
869  C CZ  . PHE A 116 ? 0.3524 0.3254 0.3761 -0.0265 -0.0235 -0.0060 185 PHE A CZ  
870  N N   . MET A 117 ? 0.2744 0.2878 0.3088 -0.0222 -0.0175 0.0091  186 MET A N   
871  C CA  . MET A 117 ? 0.3025 0.3278 0.3396 -0.0196 -0.0147 0.0114  186 MET A CA  
872  C C   . MET A 117 ? 0.3655 0.3893 0.4018 -0.0141 -0.0118 0.0062  186 MET A C   
873  O O   . MET A 117 ? 0.3796 0.4130 0.4176 -0.0110 -0.0090 0.0069  186 MET A O   
874  C CB  . MET A 117 ? 0.2744 0.3055 0.3101 -0.0249 -0.0167 0.0169  186 MET A CB  
875  C CG  . MET A 117 ? 0.2786 0.3197 0.3175 -0.0294 -0.0180 0.0231  186 MET A CG  
876  S SD  . MET A 117 ? 0.3488 0.4052 0.3949 -0.0232 -0.0138 0.0244  186 MET A SD  
877  C CE  . MET A 117 ? 0.2895 0.3586 0.3362 -0.0208 -0.0106 0.0262  186 MET A CE  
878  N N   . LEU A 118 ? 0.3088 0.3217 0.3423 -0.0129 -0.0123 0.0010  187 LEU A N   
879  C CA  . LEU A 118 ? 0.3093 0.3203 0.3420 -0.0083 -0.0099 -0.0046 187 LEU A CA  
880  C C   . LEU A 118 ? 0.4241 0.4298 0.4589 -0.0051 -0.0079 -0.0091 187 LEU A C   
881  O O   . LEU A 118 ? 0.4792 0.4812 0.5130 -0.0024 -0.0063 -0.0144 187 LEU A O   
882  C CB  . LEU A 118 ? 0.2564 0.2608 0.2847 -0.0095 -0.0121 -0.0069 187 LEU A CB  
883  C CG  . LEU A 118 ? 0.2458 0.2507 0.2711 -0.0137 -0.0151 -0.0020 187 LEU A CG  
884  C CD1 . LEU A 118 ? 0.1545 0.1499 0.1759 -0.0139 -0.0176 -0.0046 187 LEU A CD1 
885  C CD2 . LEU A 118 ? 0.3152 0.3312 0.3403 -0.0132 -0.0135 0.0011  187 LEU A CD2 
886  N N   . ALA A 119 ? 0.3746 0.3797 0.4120 -0.0058 -0.0081 -0.0068 188 ALA A N   
887  C CA  . ALA A 119 ? 0.3439 0.3434 0.3829 -0.0034 -0.0065 -0.0099 188 ALA A CA  
888  C C   . ALA A 119 ? 0.3966 0.4013 0.4393 0.0015  -0.0029 -0.0097 188 ALA A C   
889  O O   . ALA A 119 ? 0.3553 0.3687 0.4010 0.0022  -0.0025 -0.0049 188 ALA A O   
890  C CB  . ALA A 119 ? 0.3444 0.3407 0.3836 -0.0065 -0.0087 -0.0073 188 ALA A CB  
891  N N   . GLU A 120 ? 0.3725 0.3720 0.4150 0.0050  -0.0003 -0.0150 189 GLU A N   
892  C CA  . GLU A 120 ? 0.2787 0.2795 0.3242 0.0102  0.0031  -0.0156 189 GLU A CA  
893  C C   . GLU A 120 ? 0.3039 0.3004 0.3520 0.0109  0.0032  -0.0132 189 GLU A C   
894  O O   . GLU A 120 ? 0.3988 0.3955 0.4497 0.0156  0.0059  -0.0125 189 GLU A O   
895  C CB  . GLU A 120 ? 0.2507 0.2460 0.2944 0.0131  0.0057  -0.0225 189 GLU A CB  
896  C CG  . GLU A 120 ? 0.3036 0.3035 0.3441 0.0125  0.0055  -0.0252 189 GLU A CG  
897  C CD  . GLU A 120 ? 0.5044 0.5163 0.5460 0.0147  0.0067  -0.0216 189 GLU A CD  
898  O OE1 . GLU A 120 ? 0.5317 0.5469 0.5761 0.0195  0.0097  -0.0213 189 GLU A OE1 
899  O OE2 . GLU A 120 ? 0.5547 0.5728 0.5944 0.0117  0.0048  -0.0189 189 GLU A OE2 
900  N N   . PHE A 121 ? 0.3736 0.3660 0.4205 0.0065  0.0005  -0.0119 190 PHE A N   
901  C CA  . PHE A 121 ? 0.3835 0.3727 0.4320 0.0063  0.0002  -0.0091 190 PHE A CA  
902  C C   . PHE A 121 ? 0.3591 0.3564 0.4089 0.0036  -0.0025 -0.0028 190 PHE A C   
903  O O   . PHE A 121 ? 0.2391 0.2424 0.2879 0.0008  -0.0043 -0.0010 190 PHE A O   
904  C CB  . PHE A 121 ? 0.2467 0.2266 0.2925 0.0032  -0.0008 -0.0125 190 PHE A CB  
905  C CG  . PHE A 121 ? 0.2243 0.2039 0.2668 -0.0013 -0.0038 -0.0138 190 PHE A CG  
906  C CD1 . PHE A 121 ? 0.1417 0.1196 0.1820 -0.0015 -0.0038 -0.0182 190 PHE A CD1 
907  C CD2 . PHE A 121 ? 0.1409 0.1219 0.1821 -0.0050 -0.0066 -0.0105 190 PHE A CD2 
908  C CE1 . PHE A 121 ? 0.2422 0.2191 0.2795 -0.0047 -0.0065 -0.0190 190 PHE A CE1 
909  C CE2 . PHE A 121 ? 0.1735 0.1525 0.2112 -0.0084 -0.0093 -0.0119 190 PHE A CE2 
910  C CZ  . PHE A 121 ? 0.2084 0.1851 0.2443 -0.0080 -0.0092 -0.0159 190 PHE A CZ  
911  N N   . ASP A 122 ? 0.3214 0.3187 0.3730 0.0040  -0.0027 0.0008  191 ASP A N   
912  C CA  . ASP A 122 ? 0.3486 0.3543 0.4013 0.0012  -0.0054 0.0068  191 ASP A CA  
913  C C   . ASP A 122 ? 0.3187 0.3200 0.3676 -0.0045 -0.0086 0.0065  191 ASP A C   
914  O O   . ASP A 122 ? 0.1904 0.1956 0.2375 -0.0092 -0.0116 0.0082  191 ASP A O   
915  C CB  . ASP A 122 ? 0.3404 0.3511 0.3976 0.0058  -0.0039 0.0116  191 ASP A CB  
916  C CG  . ASP A 122 ? 0.3592 0.3755 0.4204 0.0123  -0.0006 0.0119  191 ASP A CG  
917  O OD1 . ASP A 122 ? 0.3804 0.4064 0.4427 0.0118  -0.0009 0.0134  191 ASP A OD1 
918  O OD2 . ASP A 122 ? 0.3370 0.3476 0.3998 0.0180  0.0023  0.0108  191 ASP A OD2 
919  N N   . GLY A 123 ? 0.2717 0.2648 0.3190 -0.0044 -0.0078 0.0042  192 GLY A N   
920  C CA  . GLY A 123 ? 0.2262 0.2160 0.2697 -0.0091 -0.0104 0.0036  192 GLY A CA  
921  C C   . GLY A 123 ? 0.3346 0.3150 0.3758 -0.0092 -0.0090 -0.0015 192 GLY A C   
922  O O   . GLY A 123 ? 0.3367 0.3127 0.3787 -0.0066 -0.0066 -0.0052 192 GLY A O   
923  N N   . VAL A 124 ? 0.1454 0.1234 0.1834 -0.0124 -0.0105 -0.0019 193 VAL A N   
924  C CA  . VAL A 124 ? 0.2346 0.2058 0.2702 -0.0133 -0.0095 -0.0067 193 VAL A CA  
925  C C   . VAL A 124 ? 0.3303 0.3009 0.3653 -0.0143 -0.0090 -0.0042 193 VAL A C   
926  O O   . VAL A 124 ? 0.2459 0.2213 0.2798 -0.0160 -0.0108 -0.0001 193 VAL A O   
927  C CB  . VAL A 124 ? 0.2801 0.2494 0.3116 -0.0163 -0.0117 -0.0106 193 VAL A CB  
928  C CG1 . VAL A 124 ? 0.3915 0.3560 0.4213 -0.0167 -0.0105 -0.0153 193 VAL A CG1 
929  C CG2 . VAL A 124 ? 0.1935 0.1633 0.2254 -0.0155 -0.0124 -0.0121 193 VAL A CG2 
930  N N   . VAL A 125 ? 0.1912 0.1566 0.2267 -0.0135 -0.0065 -0.0064 194 VAL A N   
931  C CA  . VAL A 125 ? 0.2549 0.2191 0.2892 -0.0151 -0.0058 -0.0043 194 VAL A CA  
932  C C   . VAL A 125 ? 0.2973 0.2594 0.3285 -0.0178 -0.0057 -0.0096 194 VAL A C   
933  O O   . VAL A 125 ? 0.2360 0.1943 0.2683 -0.0173 -0.0039 -0.0137 194 VAL A O   
934  C CB  . VAL A 125 ? 0.2732 0.2328 0.3107 -0.0124 -0.0029 -0.0019 194 VAL A CB  
935  C CG1 . VAL A 125 ? 0.2353 0.1927 0.2709 -0.0150 -0.0019 -0.0003 194 VAL A CG1 
936  C CG2 . VAL A 125 ? 0.1973 0.1602 0.2378 -0.0088 -0.0030 0.0040  194 VAL A CG2 
937  N N   . GLY A 126 ? 0.3924 0.3575 0.4196 -0.0205 -0.0076 -0.0098 195 GLY A N   
938  C CA  . GLY A 126 ? 0.3511 0.3154 0.3754 -0.0222 -0.0074 -0.0149 195 GLY A CA  
939  C C   . GLY A 126 ? 0.2409 0.2046 0.2654 -0.0235 -0.0048 -0.0145 195 GLY A C   
940  O O   . GLY A 126 ? 0.3563 0.3217 0.3801 -0.0246 -0.0045 -0.0097 195 GLY A O   
941  N N   . MET A 127 ? 0.2881 0.2502 0.3136 -0.0237 -0.0032 -0.0192 196 MET A N   
942  C CA  . MET A 127 ? 0.2565 0.2186 0.2827 -0.0258 -0.0007 -0.0191 196 MET A CA  
943  C C   . MET A 127 ? 0.2513 0.2182 0.2746 -0.0276 -0.0004 -0.0230 196 MET A C   
944  O O   . MET A 127 ? 0.1883 0.1569 0.2125 -0.0297 0.0018  -0.0238 196 MET A O   
945  C CB  . MET A 127 ? 0.2947 0.2524 0.3248 -0.0254 0.0013  -0.0214 196 MET A CB  
946  C CG  . MET A 127 ? 0.3876 0.3401 0.4205 -0.0229 0.0017  -0.0184 196 MET A CG  
947  S SD  . MET A 127 ? 0.4076 0.3572 0.4410 -0.0231 0.0029  -0.0106 196 MET A SD  
948  C CE  . MET A 127 ? 0.4143 0.3589 0.4489 -0.0266 0.0059  -0.0116 196 MET A CE  
949  N N   . GLY A 128 ? 0.2120 0.1811 0.2318 -0.0268 -0.0026 -0.0256 197 GLY A N   
950  C CA  . GLY A 128 ? 0.2323 0.2057 0.2487 -0.0275 -0.0023 -0.0296 197 GLY A CA  
951  C C   . GLY A 128 ? 0.2907 0.2685 0.3033 -0.0300 -0.0018 -0.0265 197 GLY A C   
952  O O   . GLY A 128 ? 0.2736 0.2512 0.2866 -0.0314 -0.0014 -0.0207 197 GLY A O   
953  N N   . PHE A 129 ? 0.2258 0.2080 0.2342 -0.0300 -0.0018 -0.0305 198 PHE A N   
954  C CA  . PHE A 129 ? 0.3426 0.3305 0.3464 -0.0324 -0.0011 -0.0287 198 PHE A CA  
955  C C   . PHE A 129 ? 0.4481 0.4355 0.4463 -0.0327 -0.0041 -0.0282 198 PHE A C   
956  O O   . PHE A 129 ? 0.4489 0.4316 0.4462 -0.0311 -0.0066 -0.0307 198 PHE A O   
957  C CB  . PHE A 129 ? 0.4256 0.4199 0.4276 -0.0321 0.0010  -0.0339 198 PHE A CB  
958  C CG  . PHE A 129 ? 0.3649 0.3623 0.3721 -0.0332 0.0041  -0.0342 198 PHE A CG  
959  C CD1 . PHE A 129 ? 0.3494 0.3443 0.3614 -0.0311 0.0041  -0.0376 198 PHE A CD1 
960  C CD2 . PHE A 129 ? 0.4518 0.4555 0.4589 -0.0367 0.0068  -0.0309 198 PHE A CD2 
961  C CE1 . PHE A 129 ? 0.4820 0.4807 0.4987 -0.0329 0.0066  -0.0382 198 PHE A CE1 
962  C CE2 . PHE A 129 ? 0.4405 0.4474 0.4525 -0.0388 0.0095  -0.0311 198 PHE A CE2 
963  C CZ  . PHE A 129 ? 0.3651 0.3695 0.3819 -0.0370 0.0093  -0.0350 198 PHE A CZ  
964  N N   . ILE A 130 ? 0.4297 0.4223 0.4237 -0.0352 -0.0039 -0.0249 199 ILE A N   
965  C CA  . ILE A 130 ? 0.4654 0.4588 0.4535 -0.0364 -0.0070 -0.0245 199 ILE A CA  
966  C C   . ILE A 130 ? 0.4689 0.4607 0.4517 -0.0351 -0.0083 -0.0324 199 ILE A C   
967  O O   . ILE A 130 ? 0.5943 0.5835 0.5726 -0.0361 -0.0115 -0.0335 199 ILE A O   
968  C CB  . ILE A 130 ? 0.4428 0.4436 0.4268 -0.0395 -0.0065 -0.0194 199 ILE A CB  
969  C CG1 . ILE A 130 ? 0.4214 0.4234 0.4013 -0.0413 -0.0103 -0.0167 199 ILE A CG1 
970  C CG2 . ILE A 130 ? 0.3779 0.3851 0.3566 -0.0402 -0.0044 -0.0239 199 ILE A CG2 
971  C CD1 . ILE A 130 ? 0.3265 0.3361 0.3037 -0.0440 -0.0103 -0.0097 199 ILE A CD1 
972  N N   . GLU A 131 ? 0.4436 0.4367 0.4268 -0.0329 -0.0059 -0.0378 200 GLU A N   
973  C CA  . GLU A 131 ? 0.4311 0.4216 0.4092 -0.0304 -0.0069 -0.0455 200 GLU A CA  
974  C C   . GLU A 131 ? 0.4825 0.4633 0.4614 -0.0287 -0.0100 -0.0474 200 GLU A C   
975  O O   . GLU A 131 ? 0.5799 0.5558 0.5533 -0.0278 -0.0121 -0.0522 200 GLU A O   
976  C CB  . GLU A 131 ? 0.5558 0.5509 0.5359 -0.0274 -0.0036 -0.0503 200 GLU A CB  
977  C CG  . GLU A 131 ? 0.4885 0.4940 0.4650 -0.0289 -0.0007 -0.0509 200 GLU A CG  
978  C CD  . GLU A 131 ? 0.5918 0.6036 0.5735 -0.0319 0.0022  -0.0446 200 GLU A CD  
979  O OE1 . GLU A 131 ? 0.5971 0.6044 0.5832 -0.0335 0.0012  -0.0389 200 GLU A OE1 
980  O OE2 . GLU A 131 ? 0.6419 0.6631 0.6231 -0.0326 0.0054  -0.0455 200 GLU A OE2 
981  N N   . GLN A 132 ? 0.3958 0.3734 0.3813 -0.0283 -0.0103 -0.0436 201 GLN A N   
982  C CA  . GLN A 132 ? 0.4522 0.4218 0.4389 -0.0270 -0.0130 -0.0444 201 GLN A CA  
983  C C   . GLN A 132 ? 0.4644 0.4326 0.4513 -0.0300 -0.0157 -0.0389 201 GLN A C   
984  O O   . GLN A 132 ? 0.5482 0.5109 0.5363 -0.0297 -0.0179 -0.0386 201 GLN A O   
985  C CB  . GLN A 132 ? 0.4735 0.4418 0.4672 -0.0242 -0.0116 -0.0445 201 GLN A CB  
986  C CG  . GLN A 132 ? 0.4808 0.4521 0.4755 -0.0211 -0.0092 -0.0496 201 GLN A CG  
987  C CD  . GLN A 132 ? 0.8060 0.7718 0.7977 -0.0174 -0.0108 -0.0552 201 GLN A CD  
988  O OE1 . GLN A 132 ? 0.9953 0.9592 0.9807 -0.0169 -0.0117 -0.0588 201 GLN A OE1 
989  N NE2 . GLN A 132 ? 0.9065 0.8694 0.9023 -0.0146 -0.0113 -0.0560 201 GLN A NE2 
990  N N   . ALA A 133 ? 0.3696 0.3435 0.3556 -0.0329 -0.0156 -0.0342 202 ALA A N   
991  C CA  . ALA A 133 ? 0.3666 0.3414 0.3540 -0.0352 -0.0179 -0.0282 202 ALA A CA  
992  C C   . ALA A 133 ? 0.4779 0.4508 0.4590 -0.0382 -0.0217 -0.0300 202 ALA A C   
993  O O   . ALA A 133 ? 0.6021 0.5772 0.5765 -0.0400 -0.0223 -0.0327 202 ALA A O   
994  C CB  . ALA A 133 ? 0.2583 0.2401 0.2472 -0.0366 -0.0165 -0.0219 202 ALA A CB  
995  N N   . ILE A 134 ? 0.4578 0.4270 0.4408 -0.0390 -0.0243 -0.0284 203 ILE A N   
996  C CA  . ILE A 134 ? 0.4291 0.3963 0.4066 -0.0431 -0.0283 -0.0293 203 ILE A CA  
997  C C   . ILE A 134 ? 0.5093 0.4856 0.4851 -0.0468 -0.0297 -0.0242 203 ILE A C   
998  O O   . ILE A 134 ? 0.5305 0.5132 0.5117 -0.0460 -0.0286 -0.0177 203 ILE A O   
999  C CB  . ILE A 134 ? 0.3953 0.3580 0.3761 -0.0437 -0.0304 -0.0275 203 ILE A CB  
1000 C CG1 . ILE A 134 ? 0.3715 0.3264 0.3543 -0.0395 -0.0289 -0.0315 203 ILE A CG1 
1001 C CG2 . ILE A 134 ? 0.3784 0.3381 0.3533 -0.0489 -0.0347 -0.0286 203 ILE A CG2 
1002 C CD1 . ILE A 134 ? 0.3797 0.3260 0.3558 -0.0388 -0.0299 -0.0388 203 ILE A CD1 
1003 N N   . GLY A 135 ? 0.5293 0.5060 0.4972 -0.0506 -0.0322 -0.0273 204 GLY A N   
1004 C CA  . GLY A 135 ? 0.4377 0.4242 0.4028 -0.0541 -0.0336 -0.0231 204 GLY A CA  
1005 C C   . GLY A 135 ? 0.4921 0.4850 0.4564 -0.0523 -0.0303 -0.0218 204 GLY A C   
1006 O O   . GLY A 135 ? 0.5037 0.5056 0.4658 -0.0548 -0.0313 -0.0173 204 GLY A O   
1007 N N   . ARG A 136 ? 0.4932 0.4824 0.4591 -0.0483 -0.0266 -0.0253 205 ARG A N   
1008 C CA  . ARG A 136 ? 0.5844 0.5798 0.5506 -0.0470 -0.0231 -0.0237 205 ARG A CA  
1009 C C   . ARG A 136 ? 0.5306 0.5323 0.5024 -0.0470 -0.0223 -0.0144 205 ARG A C   
1010 O O   . ARG A 136 ? 0.3976 0.4057 0.3682 -0.0475 -0.0205 -0.0109 205 ARG A O   
1011 C CB  . ARG A 136 ? 0.5804 0.5805 0.5371 -0.0493 -0.0234 -0.0276 205 ARG A CB  
1012 C CG  . ARG A 136 ? 0.8878 0.8812 0.8390 -0.0476 -0.0228 -0.0376 205 ARG A CG  
1013 C CD  . ARG A 136 ? 1.0578 1.0498 1.0134 -0.0430 -0.0186 -0.0404 205 ARG A CD  
1014 N NE  . ARG A 136 ? 1.1491 1.1379 1.0987 -0.0406 -0.0176 -0.0495 205 ARG A NE  
1015 C CZ  . ARG A 136 ? 1.1471 1.1409 1.0964 -0.0380 -0.0138 -0.0526 205 ARG A CZ  
1016 N NH1 . ARG A 136 ? 1.1148 1.1061 1.0587 -0.0350 -0.0130 -0.0610 205 ARG A NH1 
1017 N NH2 . ARG A 136 ? 1.1043 1.1058 1.0589 -0.0382 -0.0106 -0.0472 205 ARG A NH2 
1018 N N   . VAL A 137 ? 0.4416 0.4415 0.4198 -0.0461 -0.0235 -0.0101 206 VAL A N   
1019 C CA  . VAL A 137 ? 0.3944 0.3988 0.3785 -0.0448 -0.0227 -0.0016 206 VAL A CA  
1020 C C   . VAL A 137 ? 0.4962 0.4985 0.4841 -0.0421 -0.0183 -0.0006 206 VAL A C   
1021 O O   . VAL A 137 ? 0.6704 0.6668 0.6600 -0.0402 -0.0162 -0.0058 206 VAL A O   
1022 C CB  . VAL A 137 ? 0.4178 0.4203 0.4082 -0.0434 -0.0242 0.0013  206 VAL A CB  
1023 C CG1 . VAL A 137 ? 0.2398 0.2461 0.2368 -0.0407 -0.0229 0.0096  206 VAL A CG1 
1024 C CG2 . VAL A 137 ? 0.3536 0.3590 0.3405 -0.0473 -0.0286 0.0007  206 VAL A CG2 
1025 N N   . THR A 138 ? 0.4368 0.4439 0.4260 -0.0421 -0.0172 0.0065  207 THR A N   
1026 C CA  . THR A 138 ? 0.3661 0.3706 0.3586 -0.0405 -0.0133 0.0083  207 THR A CA  
1027 C C   . THR A 138 ? 0.3321 0.3292 0.3322 -0.0371 -0.0117 0.0086  207 THR A C   
1028 O O   . THR A 138 ? 0.3145 0.3116 0.3189 -0.0351 -0.0128 0.0137  207 THR A O   
1029 C CB  . THR A 138 ? 0.3231 0.3334 0.3149 -0.0414 -0.0127 0.0168  207 THR A CB  
1030 O OG1 . THR A 138 ? 0.3413 0.3594 0.3252 -0.0448 -0.0138 0.0160  207 THR A OG1 
1031 C CG2 . THR A 138 ? 0.2767 0.2825 0.2722 -0.0405 -0.0088 0.0193  207 THR A CG2 
1032 N N   . PRO A 139 ? 0.3234 0.3151 0.3256 -0.0361 -0.0093 0.0032  208 PRO A N   
1033 C CA  . PRO A 139 ? 0.3380 0.3229 0.3466 -0.0331 -0.0079 0.0029  208 PRO A CA  
1034 C C   . PRO A 139 ? 0.4506 0.4332 0.4634 -0.0318 -0.0059 0.0096  208 PRO A C   
1035 O O   . PRO A 139 ? 0.4279 0.4132 0.4388 -0.0335 -0.0050 0.0145  208 PRO A O   
1036 C CB  . PRO A 139 ? 0.4336 0.4155 0.4425 -0.0331 -0.0059 -0.0042 208 PRO A CB  
1037 C CG  . PRO A 139 ? 0.4500 0.4364 0.4525 -0.0351 -0.0068 -0.0086 208 PRO A CG  
1038 C CD  . PRO A 139 ? 0.3496 0.3422 0.3479 -0.0374 -0.0078 -0.0032 208 PRO A CD  
1039 N N   . ILE A 140 ? 0.4434 0.4202 0.4616 -0.0287 -0.0052 0.0099  209 ILE A N   
1040 C CA  . ILE A 140 ? 0.3437 0.3168 0.3658 -0.0264 -0.0037 0.0163  209 ILE A CA  
1041 C C   . ILE A 140 ? 0.4169 0.3848 0.4394 -0.0281 -0.0005 0.0168  209 ILE A C   
1042 O O   . ILE A 140 ? 0.5272 0.4930 0.5504 -0.0278 0.0005  0.0235  209 ILE A O   
1043 C CB  . ILE A 140 ? 0.2917 0.2604 0.3188 -0.0221 -0.0036 0.0158  209 ILE A CB  
1044 C CG1 . ILE A 140 ? 0.1814 0.1470 0.2120 -0.0186 -0.0025 0.0230  209 ILE A CG1 
1045 C CG2 . ILE A 140 ? 0.2126 0.1748 0.2416 -0.0218 -0.0017 0.0090  209 ILE A CG2 
1046 C CD1 . ILE A 140 ? 0.2592 0.2228 0.2944 -0.0137 -0.0024 0.0229  209 ILE A CD1 
1047 N N   . PHE A 141 ? 0.4220 0.3881 0.4442 -0.0301 0.0010  0.0103  210 PHE A N   
1048 C CA  . PHE A 141 ? 0.3823 0.3449 0.4050 -0.0329 0.0039  0.0110  210 PHE A CA  
1049 C C   . PHE A 141 ? 0.4527 0.4222 0.4710 -0.0365 0.0042  0.0146  210 PHE A C   
1050 O O   . PHE A 141 ? 0.5413 0.5084 0.5597 -0.0390 0.0063  0.0189  210 PHE A O   
1051 C CB  . PHE A 141 ? 0.2071 0.1682 0.2314 -0.0341 0.0052  0.0031  210 PHE A CB  
1052 C CG  . PHE A 141 ? 0.2997 0.2553 0.3262 -0.0370 0.0081  0.0037  210 PHE A CG  
1053 C CD1 . PHE A 141 ? 0.3189 0.2645 0.3488 -0.0354 0.0092  0.0058  210 PHE A CD1 
1054 C CD2 . PHE A 141 ? 0.3865 0.3473 0.4116 -0.0414 0.0097  0.0019  210 PHE A CD2 
1055 C CE1 . PHE A 141 ? 0.2578 0.1969 0.2893 -0.0389 0.0116  0.0061  210 PHE A CE1 
1056 C CE2 . PHE A 141 ? 0.3986 0.3549 0.4259 -0.0451 0.0122  0.0027  210 PHE A CE2 
1057 C CZ  . PHE A 141 ? 0.3974 0.3420 0.4277 -0.0442 0.0130  0.0047  210 PHE A CZ  
1058 N N   . ASP A 142 ? 0.4563 0.4341 0.4701 -0.0372 0.0021  0.0130  211 ASP A N   
1059 C CA  . ASP A 142 ? 0.6087 0.5941 0.6173 -0.0403 0.0023  0.0167  211 ASP A CA  
1060 C C   . ASP A 142 ? 0.5870 0.5720 0.5957 -0.0399 0.0018  0.0266  211 ASP A C   
1061 O O   . ASP A 142 ? 0.4815 0.4676 0.4885 -0.0426 0.0036  0.0318  211 ASP A O   
1062 C CB  . ASP A 142 ? 0.7085 0.7015 0.7118 -0.0407 -0.0002 0.0124  211 ASP A CB  
1063 C CG  . ASP A 142 ? 0.7150 0.7127 0.7151 -0.0427 0.0013  0.0055  211 ASP A CG  
1064 O OD1 . ASP A 142 ? 0.6967 0.6913 0.7002 -0.0427 0.0035  0.0017  211 ASP A OD1 
1065 O OD2 . ASP A 142 ? 0.7857 0.7905 0.7796 -0.0440 0.0003  0.0038  211 ASP A OD2 
1066 N N   . ASN A 143 ? 0.5301 0.5142 0.5406 -0.0364 -0.0005 0.0298  212 ASN A N   
1067 C CA  . ASN A 143 ? 0.4660 0.4502 0.4773 -0.0347 -0.0011 0.0396  212 ASN A CA  
1068 C C   . ASN A 143 ? 0.5642 0.5376 0.5797 -0.0336 0.0017  0.0437  212 ASN A C   
1069 O O   . ASN A 143 ? 0.6050 0.5776 0.6198 -0.0337 0.0022  0.0522  212 ASN A O   
1070 C CB  . ASN A 143 ? 0.4424 0.4291 0.4560 -0.0308 -0.0041 0.0416  212 ASN A CB  
1071 C CG  . ASN A 143 ? 0.4204 0.4174 0.4293 -0.0329 -0.0074 0.0390  212 ASN A CG  
1072 O OD1 . ASN A 143 ? 0.5247 0.5289 0.5278 -0.0363 -0.0080 0.0399  212 ASN A OD1 
1073 N ND2 . ASN A 143 ? 0.3005 0.2982 0.3115 -0.0311 -0.0095 0.0356  212 ASN A ND2 
1074 N N   . ILE A 144 ? 0.5973 0.5620 0.6168 -0.0324 0.0034  0.0380  213 ILE A N   
1075 C CA  . ILE A 144 ? 0.5407 0.4936 0.5636 -0.0320 0.0060  0.0407  213 ILE A CA  
1076 C C   . ILE A 144 ? 0.5404 0.4931 0.5608 -0.0378 0.0083  0.0423  213 ILE A C   
1077 O O   . ILE A 144 ? 0.7042 0.6502 0.7249 -0.0387 0.0098  0.0493  213 ILE A O   
1078 C CB  . ILE A 144 ? 0.5203 0.4651 0.5474 -0.0299 0.0070  0.0333  213 ILE A CB  
1079 C CG1 . ILE A 144 ? 0.4799 0.4241 0.5099 -0.0237 0.0053  0.0338  213 ILE A CG1 
1080 C CG2 . ILE A 144 ? 0.4113 0.3436 0.4407 -0.0312 0.0099  0.0341  213 ILE A CG2 
1081 C CD1 . ILE A 144 ? 0.4796 0.4167 0.5131 -0.0213 0.0064  0.0269  213 ILE A CD1 
1082 N N   . ILE A 145 ? 0.3626 0.3229 0.3804 -0.0417 0.0088  0.0361  214 ILE A N   
1083 C CA  . ILE A 145 ? 0.5460 0.5097 0.5613 -0.0475 0.0110  0.0379  214 ILE A CA  
1084 C C   . ILE A 145 ? 0.5578 0.5274 0.5688 -0.0487 0.0104  0.0473  214 ILE A C   
1085 O O   . ILE A 145 ? 0.5552 0.5226 0.5651 -0.0525 0.0123  0.0534  214 ILE A O   
1086 C CB  . ILE A 145 ? 0.5426 0.5157 0.5560 -0.0501 0.0115  0.0294  214 ILE A CB  
1087 C CG1 . ILE A 145 ? 0.4644 0.4318 0.4822 -0.0500 0.0126  0.0215  214 ILE A CG1 
1088 C CG2 . ILE A 145 ? 0.4085 0.3896 0.4182 -0.0556 0.0136  0.0321  214 ILE A CG2 
1089 C CD1 . ILE A 145 ? 0.3192 0.2958 0.3358 -0.0510 0.0127  0.0131  214 ILE A CD1 
1090 N N   . SER A 146 ? 0.5393 0.5164 0.5476 -0.0460 0.0075  0.0488  215 SER A N   
1091 C CA  . SER A 146 ? 0.4799 0.4644 0.4836 -0.0470 0.0064  0.0576  215 SER A CA  
1092 C C   . SER A 146 ? 0.5110 0.4867 0.5170 -0.0451 0.0068  0.0681  215 SER A C   
1093 O O   . SER A 146 ? 0.6446 0.6250 0.6469 -0.0469 0.0067  0.0767  215 SER A O   
1094 C CB  . SER A 146 ? 0.4505 0.4444 0.4515 -0.0446 0.0027  0.0567  215 SER A CB  
1095 O OG  . SER A 146 ? 0.5349 0.5383 0.5310 -0.0474 0.0023  0.0494  215 SER A OG  
1096 N N   . GLN A 147 ? 0.4298 0.3928 0.4414 -0.0412 0.0074  0.0676  216 GLN A N   
1097 C CA  . GLN A 147 ? 0.3914 0.3444 0.4053 -0.0380 0.0078  0.0772  216 GLN A CA  
1098 C C   . GLN A 147 ? 0.5401 0.4825 0.5541 -0.0425 0.0109  0.0808  216 GLN A C   
1099 O O   . GLN A 147 ? 0.6492 0.5813 0.6644 -0.0403 0.0114  0.0893  216 GLN A O   
1100 C CB  . GLN A 147 ? 0.2903 0.2341 0.3098 -0.0312 0.0072  0.0750  216 GLN A CB  
1101 C CG  . GLN A 147 ? 0.4019 0.3562 0.4219 -0.0269 0.0040  0.0735  216 GLN A CG  
1102 C CD  . GLN A 147 ? 0.5520 0.4991 0.5776 -0.0197 0.0037  0.0738  216 GLN A CD  
1103 O OE1 . GLN A 147 ? 0.7319 0.6658 0.7608 -0.0180 0.0060  0.0708  216 GLN A OE1 
1104 N NE2 . GLN A 147 ? 0.6059 0.5623 0.6324 -0.0154 0.0009  0.0773  216 GLN A NE2 
1105 N N   . GLY A 148 ? 0.5411 0.4858 0.5540 -0.0487 0.0130  0.0748  217 GLY A N   
1106 C CA  . GLY A 148 ? 0.6485 0.5844 0.6616 -0.0543 0.0159  0.0782  217 GLY A CA  
1107 C C   . GLY A 148 ? 0.6942 0.6106 0.7116 -0.0520 0.0171  0.0792  217 GLY A C   
1108 O O   . GLY A 148 ? 0.7671 0.6730 0.7841 -0.0551 0.0187  0.0863  217 GLY A O   
1109 N N   . VAL A 149 ? 0.5991 0.5100 0.6204 -0.0467 0.0164  0.0721  218 VAL A N   
1110 C CA  . VAL A 149 ? 0.4817 0.3742 0.5067 -0.0436 0.0175  0.0718  218 VAL A CA  
1111 C C   . VAL A 149 ? 0.4763 0.3624 0.5036 -0.0476 0.0193  0.0618  218 VAL A C   
1112 O O   . VAL A 149 ? 0.4883 0.3582 0.5172 -0.0488 0.0209  0.0620  218 VAL A O   
1113 C CB  . VAL A 149 ? 0.4619 0.3526 0.4896 -0.0340 0.0157  0.0720  218 VAL A CB  
1114 C CG1 . VAL A 149 ? 0.5434 0.4396 0.5694 -0.0301 0.0139  0.0831  218 VAL A CG1 
1115 C CG2 . VAL A 149 ? 0.4370 0.3393 0.4657 -0.0322 0.0141  0.0627  218 VAL A CG2 
1116 N N   . LEU A 150 ? 0.4834 0.3816 0.5108 -0.0496 0.0188  0.0531  219 LEU A N   
1117 C CA  . LEU A 150 ? 0.5332 0.4273 0.5630 -0.0530 0.0201  0.0437  219 LEU A CA  
1118 C C   . LEU A 150 ? 0.6344 0.5246 0.6635 -0.0618 0.0224  0.0454  219 LEU A C   
1119 O O   . LEU A 150 ? 0.6764 0.5754 0.7028 -0.0666 0.0230  0.0507  219 LEU A O   
1120 C CB  . LEU A 150 ? 0.4586 0.3673 0.4883 -0.0528 0.0189  0.0351  219 LEU A CB  
1121 C CG  . LEU A 150 ? 0.4497 0.3642 0.4796 -0.0455 0.0164  0.0333  219 LEU A CG  
1122 C CD1 . LEU A 150 ? 0.3195 0.2486 0.3479 -0.0466 0.0153  0.0268  219 LEU A CD1 
1123 C CD2 . LEU A 150 ? 0.4045 0.3086 0.4378 -0.0403 0.0163  0.0290  219 LEU A CD2 
1124 N N   . LYS A 151 ? 0.5880 0.4657 0.6195 -0.0645 0.0236  0.0407  220 LYS A N   
1125 C CA  . LYS A 151 ? 0.6160 0.4914 0.6475 -0.0741 0.0257  0.0411  220 LYS A CA  
1126 C C   . LYS A 151 ? 0.6568 0.5515 0.6882 -0.0791 0.0260  0.0362  220 LYS A C   
1127 O O   . LYS A 151 ? 0.6587 0.5604 0.6887 -0.0861 0.0274  0.0406  220 LYS A O   
1128 C CB  . LYS A 151 ? 0.6193 0.4785 0.6532 -0.0762 0.0265  0.0354  220 LYS A CB  
1129 C CG  . LYS A 151 ? 0.7496 0.6094 0.7843 -0.0871 0.0282  0.0329  220 LYS A CG  
1130 C CD  . LYS A 151 ? 0.8092 0.6552 0.8459 -0.0888 0.0284  0.0250  220 LYS A CD  
1131 C CE  . LYS A 151 ? 0.9159 0.7466 0.9521 -0.0978 0.0301  0.0289  220 LYS A CE  
1132 N NZ  . LYS A 151 ? 1.0358 0.8537 1.0694 -0.0955 0.0306  0.0404  220 LYS A NZ  
1133 N N   . GLU A 152 ? 0.6726 0.5766 0.7054 -0.0753 0.0247  0.0275  221 GLU A N   
1134 C CA  . GLU A 152 ? 0.6037 0.5261 0.6364 -0.0779 0.0248  0.0226  221 GLU A CA  
1135 C C   . GLU A 152 ? 0.5914 0.5225 0.6232 -0.0704 0.0226  0.0185  221 GLU A C   
1136 O O   . GLU A 152 ? 0.5866 0.5103 0.6195 -0.0644 0.0211  0.0162  221 GLU A O   
1137 C CB  . GLU A 152 ? 0.5272 0.4518 0.5632 -0.0832 0.0257  0.0146  221 GLU A CB  
1138 C CG  . GLU A 152 ? 0.6519 0.5674 0.6890 -0.0919 0.0276  0.0177  221 GLU A CG  
1139 C CD  . GLU A 152 ? 0.7662 0.6911 0.8015 -0.0990 0.0295  0.0248  221 GLU A CD  
1140 O OE1 . GLU A 152 ? 0.7305 0.6709 0.7636 -0.0971 0.0295  0.0260  221 GLU A OE1 
1141 O OE2 . GLU A 152 ? 0.7472 0.6637 0.7829 -0.1067 0.0311  0.0291  221 GLU A OE2 
1142 N N   . ASP A 153 ? 0.5773 0.5240 0.6068 -0.0709 0.0224  0.0176  222 ASP A N   
1143 C CA  . ASP A 153 ? 0.5312 0.4856 0.5591 -0.0647 0.0202  0.0138  222 ASP A CA  
1144 C C   . ASP A 153 ? 0.4652 0.4223 0.4960 -0.0627 0.0194  0.0040  222 ASP A C   
1145 O O   . ASP A 153 ? 0.4637 0.4326 0.4939 -0.0624 0.0192  -0.0011 222 ASP A O   
1146 C CB  . ASP A 153 ? 0.6061 0.5749 0.6298 -0.0659 0.0203  0.0157  222 ASP A CB  
1147 C CG  . ASP A 153 ? 0.6627 0.6301 0.6827 -0.0662 0.0202  0.0256  222 ASP A CG  
1148 O OD1 . ASP A 153 ? 0.7029 0.6578 0.7242 -0.0648 0.0199  0.0312  222 ASP A OD1 
1149 O OD2 . ASP A 153 ? 0.6151 0.5942 0.6308 -0.0676 0.0204  0.0278  222 ASP A OD2 
1150 N N   . VAL A 154 ? 0.3897 0.3354 0.4234 -0.0610 0.0190  0.0015  223 VAL A N   
1151 C CA  . VAL A 154 ? 0.3336 0.2806 0.3699 -0.0590 0.0182  -0.0069 223 VAL A CA  
1152 C C   . VAL A 154 ? 0.4752 0.4113 0.5124 -0.0534 0.0168  -0.0076 223 VAL A C   
1153 O O   . VAL A 154 ? 0.5867 0.5132 0.6235 -0.0517 0.0171  -0.0019 223 VAL A O   
1154 C CB  . VAL A 154 ? 0.3424 0.2889 0.3818 -0.0650 0.0197  -0.0110 223 VAL A CB  
1155 C CG1 . VAL A 154 ? 0.2551 0.2151 0.2944 -0.0704 0.0212  -0.0109 223 VAL A CG1 
1156 C CG2 . VAL A 154 ? 0.3450 0.2764 0.3852 -0.0683 0.0210  -0.0072 223 VAL A CG2 
1157 N N   . PHE A 155 ? 0.4887 0.4273 0.5271 -0.0501 0.0155  -0.0143 224 PHE A N   
1158 C CA  . PHE A 155 ? 0.4004 0.3301 0.4401 -0.0456 0.0147  -0.0163 224 PHE A CA  
1159 C C   . PHE A 155 ? 0.4431 0.3757 0.4847 -0.0460 0.0142  -0.0244 224 PHE A C   
1160 O O   . PHE A 155 ? 0.4810 0.4240 0.5229 -0.0478 0.0138  -0.0280 224 PHE A O   
1161 C CB  . PHE A 155 ? 0.3727 0.3041 0.4110 -0.0395 0.0128  -0.0139 224 PHE A CB  
1162 C CG  . PHE A 155 ? 0.2748 0.2172 0.3117 -0.0381 0.0110  -0.0172 224 PHE A CG  
1163 C CD1 . PHE A 155 ? 0.1812 0.1315 0.2153 -0.0397 0.0107  -0.0148 224 PHE A CD1 
1164 C CD2 . PHE A 155 ? 0.2156 0.1599 0.2532 -0.0351 0.0096  -0.0228 224 PHE A CD2 
1165 C CE1 . PHE A 155 ? 0.3128 0.2714 0.3450 -0.0381 0.0091  -0.0184 224 PHE A CE1 
1166 C CE2 . PHE A 155 ? 0.3014 0.2538 0.3373 -0.0336 0.0078  -0.0256 224 PHE A CE2 
1167 C CZ  . PHE A 155 ? 0.3115 0.2705 0.3448 -0.0350 0.0076  -0.0237 224 PHE A CZ  
1168 N N   . SER A 156 ? 0.3538 0.2776 0.3965 -0.0441 0.0143  -0.0272 225 SER A N   
1169 C CA  . SER A 156 ? 0.4040 0.3303 0.4482 -0.0453 0.0139  -0.0346 225 SER A CA  
1170 C C   . SER A 156 ? 0.4606 0.3825 0.5047 -0.0397 0.0130  -0.0375 225 SER A C   
1171 O O   . SER A 156 ? 0.4035 0.3179 0.4470 -0.0357 0.0133  -0.0341 225 SER A O   
1172 C CB  . SER A 156 ? 0.3951 0.3159 0.4407 -0.0520 0.0155  -0.0366 225 SER A CB  
1173 O OG  . SER A 156 ? 0.3909 0.2966 0.4359 -0.0516 0.0168  -0.0343 225 SER A OG  
1174 N N   . PHE A 157 ? 0.4411 0.3686 0.4858 -0.0394 0.0118  -0.0437 226 PHE A N   
1175 C CA  . PHE A 157 ? 0.3126 0.2393 0.3567 -0.0343 0.0108  -0.0466 226 PHE A CA  
1176 C C   . PHE A 157 ? 0.4125 0.3365 0.4570 -0.0365 0.0111  -0.0531 226 PHE A C   
1177 O O   . PHE A 157 ? 0.4624 0.3911 0.5080 -0.0415 0.0110  -0.0565 226 PHE A O   
1178 C CB  . PHE A 157 ? 0.3610 0.2983 0.4046 -0.0313 0.0086  -0.0475 226 PHE A CB  
1179 C CG  . PHE A 157 ? 0.3335 0.2716 0.3758 -0.0276 0.0077  -0.0423 226 PHE A CG  
1180 C CD1 . PHE A 157 ? 0.3512 0.2921 0.3927 -0.0293 0.0078  -0.0382 226 PHE A CD1 
1181 C CD2 . PHE A 157 ? 0.4292 0.3664 0.4708 -0.0229 0.0068  -0.0414 226 PHE A CD2 
1182 C CE1 . PHE A 157 ? 0.4160 0.3582 0.4561 -0.0265 0.0067  -0.0337 226 PHE A CE1 
1183 C CE2 . PHE A 157 ? 0.4119 0.3508 0.4526 -0.0203 0.0058  -0.0365 226 PHE A CE2 
1184 C CZ  . PHE A 157 ? 0.3850 0.3262 0.4248 -0.0223 0.0056  -0.0328 226 PHE A CZ  
1185 N N   . TYR A 158 ? 0.4592 0.3768 0.5028 -0.0326 0.0114  -0.0548 227 TYR A N   
1186 C CA  . TYR A 158 ? 0.2821 0.1982 0.3250 -0.0337 0.0114  -0.0617 227 TYR A CA  
1187 C C   . TYR A 158 ? 0.2934 0.2122 0.3350 -0.0274 0.0106  -0.0630 227 TYR A C   
1188 O O   . TYR A 158 ? 0.5129 0.4264 0.5541 -0.0227 0.0116  -0.0598 227 TYR A O   
1189 C CB  . TYR A 158 ? 0.2979 0.2001 0.3401 -0.0363 0.0135  -0.0633 227 TYR A CB  
1190 C CG  . TYR A 158 ? 0.4222 0.3232 0.4610 -0.0350 0.0130  -0.0687 227 TYR A CG  
1191 C CD1 . TYR A 158 ? 0.4665 0.3752 0.5044 -0.0393 0.0115  -0.0734 227 TYR A CD1 
1192 C CD2 . TYR A 158 ? 0.4600 0.3528 0.4967 -0.0294 0.0142  -0.0693 227 TYR A CD2 
1193 C CE1 . TYR A 158 ? 0.5152 0.4230 0.5497 -0.0385 0.0110  -0.0785 227 TYR A CE1 
1194 C CE2 . TYR A 158 ? 0.4848 0.3766 0.5178 -0.0284 0.0140  -0.0747 227 TYR A CE2 
1195 C CZ  . TYR A 158 ? 0.5344 0.4335 0.5661 -0.0332 0.0123  -0.0793 227 TYR A CZ  
1196 O OH  . TYR A 158 ? 0.5426 0.4411 0.5705 -0.0325 0.0120  -0.0848 227 TYR A OH  
1197 N N   . TYR A 159 ? 0.3441 0.2722 0.3852 -0.0273 0.0089  -0.0671 228 TYR A N   
1198 C CA  . TYR A 159 ? 0.2349 0.1668 0.2744 -0.0223 0.0081  -0.0684 228 TYR A CA  
1199 C C   . TYR A 159 ? 0.2554 0.1870 0.2932 -0.0237 0.0082  -0.0755 228 TYR A C   
1200 O O   . TYR A 159 ? 0.3838 0.3224 0.4216 -0.0274 0.0067  -0.0788 228 TYR A O   
1201 C CB  . TYR A 159 ? 0.3409 0.2839 0.3805 -0.0205 0.0056  -0.0666 228 TYR A CB  
1202 C CG  . TYR A 159 ? 0.3936 0.3371 0.4336 -0.0184 0.0051  -0.0602 228 TYR A CG  
1203 C CD1 . TYR A 159 ? 0.2353 0.1715 0.2759 -0.0173 0.0067  -0.0558 228 TYR A CD1 
1204 C CD2 . TYR A 159 ? 0.3757 0.3268 0.4154 -0.0173 0.0029  -0.0585 228 TYR A CD2 
1205 C CE1 . TYR A 159 ? 0.2907 0.2287 0.3316 -0.0158 0.0060  -0.0502 228 TYR A CE1 
1206 C CE2 . TYR A 159 ? 0.2819 0.2331 0.3214 -0.0160 0.0023  -0.0534 228 TYR A CE2 
1207 C CZ  . TYR A 159 ? 0.2897 0.2351 0.3298 -0.0155 0.0037  -0.0493 228 TYR A CZ  
1208 O OH  . TYR A 159 ? 0.3221 0.2689 0.3618 -0.0146 0.0028  -0.0444 228 TYR A OH  
1209 N N   . ASN A 160 ? 0.2711 0.1958 0.3069 -0.0205 0.0098  -0.0773 229 ASN A N   
1210 C CA  . ASN A 160 ? 0.2829 0.2080 0.3150 -0.0211 0.0098  -0.0828 229 ASN A CA  
1211 C C   . ASN A 160 ? 0.2874 0.2231 0.3185 -0.0183 0.0083  -0.0856 229 ASN A C   
1212 O O   . ASN A 160 ? 0.3751 0.3167 0.4072 -0.0149 0.0073  -0.0813 229 ASN A O   
1213 C CB  . ASN A 160 ? 0.3688 0.2820 0.3985 -0.0181 0.0123  -0.0838 229 ASN A CB  
1214 C CG  . ASN A 160 ? 0.5079 0.4186 0.5329 -0.0203 0.0122  -0.0897 229 ASN A CG  
1215 O OD1 . ASN A 160 ? 0.5852 0.5036 0.6095 -0.0247 0.0103  -0.0927 229 ASN A OD1 
1216 N ND2 . ASN A 160 ? 0.4635 0.3636 0.4856 -0.0171 0.0143  -0.0914 229 ASN A ND2 
1217 N N   . ARG A 161 ? 0.4487 0.3881 0.4765 -0.0199 0.0076  -0.0907 230 ARG A N   
1218 C CA  . ARG A 161 ? 0.5281 0.4772 0.5541 -0.0173 0.0063  -0.0938 230 ARG A CA  
1219 C C   . ARG A 161 ? 0.5479 0.4929 0.5715 -0.0120 0.0087  -0.0952 230 ARG A C   
1220 O O   . ARG A 161 ? 0.6593 0.5944 0.6810 -0.0112 0.0109  -0.0967 230 ARG A O   
1221 C CB  . ARG A 161 ? 0.5023 0.4585 0.5257 -0.0212 0.0045  -0.0987 230 ARG A CB  
1222 C CG  . ARG A 161 ? 0.5882 0.5517 0.6148 -0.0258 0.0022  -0.0977 230 ARG A CG  
1223 C CD  . ARG A 161 ? 0.7649 0.7334 0.7896 -0.0307 0.0009  -0.1025 230 ARG A CD  
1224 N NE  . ARG A 161 ? 0.9434 0.9172 0.9720 -0.0355 -0.0004 -0.1014 230 ARG A NE  
1225 C CZ  . ARG A 161 ? 0.9595 0.9261 0.9895 -0.0398 0.0008  -0.1002 230 ARG A CZ  
1226 N NH1 . ARG A 161 ? 0.9253 0.8991 0.9591 -0.0441 -0.0003 -0.0995 230 ARG A NH1 
1227 N NH2 . ARG A 161 ? 0.9088 0.8614 0.9365 -0.0397 0.0031  -0.0996 230 ARG A NH2 
1228 N N   . ASP A 162 ? 0.5652 0.5191 0.5879 -0.0077 0.0079  -0.0917 231 ASP A N   
1229 C CA  . ASP A 162 ? 0.6017 0.5546 0.6226 -0.0022 0.0102  -0.0912 231 ASP A CA  
1230 C C   . ASP A 162 ? 0.7818 0.7331 0.7981 -0.0019 0.0117  -0.0996 231 ASP A C   
1231 O O   . ASP A 162 ? 0.8271 0.7857 0.8406 -0.0047 0.0099  -0.1041 231 ASP A O   
1232 C CB  . ASP A 162 ? 0.6171 0.5811 0.6378 0.0010  0.0088  -0.0857 231 ASP A CB  
1233 C CG  . ASP A 162 ? 0.6765 0.6417 0.6962 0.0066  0.0115  -0.0842 231 ASP A CG  
1234 O OD1 . ASP A 162 ? 0.6205 0.5767 0.6411 0.0091  0.0143  -0.0854 231 ASP A OD1 
1235 O OD2 . ASP A 162 ? 0.6340 0.6095 0.6521 0.0087  0.0108  -0.0817 231 ASP A OD2 
1236 N N   . SER A 163 ? 0.8952 0.8372 0.9107 0.0017  0.0151  -0.1017 232 SER A N   
1237 C CA  . SER A 163 ? 0.9393 0.8781 0.9494 0.0029  0.0169  -0.1092 232 SER A CA  
1238 C C   . SER A 163 ? 1.1498 1.0931 1.1587 0.0103  0.0196  -0.1091 232 SER A C   
1239 O O   . SER A 163 ? 0.9818 0.9216 0.9939 0.0150  0.0215  -0.1037 232 SER A O   
1240 C CB  . SER A 163 ? 0.7666 0.6899 0.7750 0.0011  0.0181  -0.1099 232 SER A CB  
1241 O OG  . SER A 163 ? 0.6394 0.5601 0.6413 0.0001  0.0184  -0.1163 232 SER A OG  
1242 N N   . GLU A 164 ? 1.5555 1.5084 1.5596 0.0113  0.0196  -0.1137 233 GLU A N   
1243 C CA  . GLU A 164 ? 1.6003 1.5601 1.6022 0.0180  0.0223  -0.1133 233 GLU A CA  
1244 C C   . GLU A 164 ? 1.6913 1.6417 1.6886 0.0210  0.0258  -0.1220 233 GLU A C   
1245 O O   . GLU A 164 ? 1.6888 1.6348 1.6808 0.0165  0.0244  -0.1264 233 GLU A O   
1246 C CB  . GLU A 164 ? 1.5605 1.5373 1.5591 0.0174  0.0203  -0.1121 233 GLU A CB  
1247 N N   . ASN A 165 ? 1.8291 1.7767 1.8275 0.0285  0.0296  -0.1211 234 ASN A N   
1248 C CA  . ASN A 165 ? 1.9144 1.8517 1.9078 0.0328  0.0328  -0.1253 234 ASN A CA  
1249 C C   . ASN A 165 ? 1.9239 1.8418 1.9161 0.0295  0.0321  -0.1254 234 ASN A C   
1250 O O   . ASN A 165 ? 2.0600 1.9672 2.0459 0.0309  0.0336  -0.1302 234 ASN A O   
1251 C CB  . ASN A 165 ? 1.9539 1.8983 1.9391 0.0325  0.0331  -0.1323 234 ASN A CB  
1252 N N   . SER A 166 ? 1.5507 1.4637 1.5481 0.0251  0.0299  -0.1202 235 SER A N   
1253 C CA  . SER A 166 ? 1.2628 1.1587 1.2598 0.0222  0.0294  -0.1189 235 SER A CA  
1254 C C   . SER A 166 ? 1.3083 1.2001 1.3127 0.0247  0.0300  -0.1113 235 SER A C   
1255 O O   . SER A 166 ? 1.3556 1.2583 1.3658 0.0256  0.0295  -0.1071 235 SER A O   
1256 C CB  . SER A 166 ? 0.9638 0.8585 0.9592 0.0125  0.0256  -0.1202 235 SER A CB  
1257 N N   . GLN A 167 ? 1.2659 1.1417 1.2697 0.0260  0.0309  -0.1096 236 GLN A N   
1258 C CA  . GLN A 167 ? 1.1711 1.0419 1.1814 0.0280  0.0313  -0.1021 236 GLN A CA  
1259 C C   . GLN A 167 ? 1.1132 0.9793 1.1253 0.0195  0.0284  -0.0986 236 GLN A C   
1260 O O   . GLN A 167 ? 1.0049 0.8613 1.0198 0.0199  0.0286  -0.0934 236 GLN A O   
1261 C CB  . GLN A 167 ? 1.1090 0.9658 1.1178 0.0355  0.0341  -0.1014 236 GLN A CB  
1262 N N   . SER A 168 ? 1.0680 0.9416 1.0787 0.0121  0.0256  -0.1011 237 SER A N   
1263 C CA  . SER A 168 ? 0.9807 0.8525 0.9934 0.0041  0.0230  -0.0980 237 SER A CA  
1264 C C   . SER A 168 ? 0.9040 0.7783 0.9235 0.0050  0.0230  -0.0905 237 SER A C   
1265 O O   . SER A 168 ? 0.9524 0.8356 0.9757 0.0094  0.0237  -0.0882 237 SER A O   
1266 C CB  . SER A 168 ? 0.9360 0.8197 0.9474 -0.0022 0.0202  -0.1015 237 SER A CB  
1267 N N   . LEU A 169 ? 0.7317 0.5981 0.7526 0.0005  0.0221  -0.0866 238 LEU A N   
1268 C CA  . LEU A 169 ? 0.6564 0.5246 0.6830 0.0005  0.0220  -0.0795 238 LEU A CA  
1269 C C   . LEU A 169 ? 0.6613 0.5445 0.6910 -0.0019 0.0200  -0.0787 238 LEU A C   
1270 O O   . LEU A 169 ? 0.7255 0.6150 0.7538 -0.0076 0.0179  -0.0813 238 LEU A O   
1271 C CB  . LEU A 169 ? 0.6049 0.4636 0.6316 -0.0054 0.0213  -0.0763 238 LEU A CB  
1272 C CG  . LEU A 169 ? 0.5063 0.3676 0.5382 -0.0068 0.0210  -0.0693 238 LEU A CG  
1273 C CD1 . LEU A 169 ? 0.4654 0.3231 0.5008 0.0009  0.0231  -0.0642 238 LEU A CD1 
1274 C CD2 . LEU A 169 ? 0.4382 0.2917 0.4696 -0.0136 0.0204  -0.0668 238 LEU A CD2 
1275 N N   . GLY A 170 ? 0.5594 0.4492 0.5927 0.0028  0.0203  -0.0742 239 GLY A N   
1276 C CA  . GLY A 170 ? 0.5224 0.4270 0.5565 0.0013  0.0176  -0.0718 239 GLY A CA  
1277 C C   . GLY A 170 ? 0.5477 0.4543 0.5837 -0.0045 0.0155  -0.0687 239 GLY A C   
1278 O O   . GLY A 170 ? 0.4730 0.3877 0.5085 -0.0083 0.0134  -0.0709 239 GLY A O   
1279 N N   . GLY A 171 ? 0.4250 0.3250 0.4630 -0.0049 0.0162  -0.0633 240 GLY A N   
1280 C CA  . GLY A 171 ? 0.2801 0.1819 0.3194 -0.0103 0.0148  -0.0603 240 GLY A CA  
1281 C C   . GLY A 171 ? 0.3548 0.2467 0.3954 -0.0105 0.0162  -0.0550 240 GLY A C   
1282 O O   . GLY A 171 ? 0.3530 0.2371 0.3939 -0.0056 0.0180  -0.0531 240 GLY A O   
1283 N N   . GLN A 172 ? 0.2764 0.1694 0.3179 -0.0157 0.0154  -0.0523 241 GLN A N   
1284 C CA  . GLN A 172 ? 0.3620 0.2471 0.4045 -0.0162 0.0165  -0.0460 241 GLN A CA  
1285 C C   . GLN A 172 ? 0.4408 0.3330 0.4839 -0.0210 0.0152  -0.0423 241 GLN A C   
1286 O O   . GLN A 172 ? 0.5188 0.4156 0.5619 -0.0264 0.0145  -0.0460 241 GLN A O   
1287 C CB  . GLN A 172 ? 0.4044 0.2744 0.4461 -0.0189 0.0186  -0.0484 241 GLN A CB  
1288 C CG  . GLN A 172 ? 0.4125 0.2750 0.4548 -0.0214 0.0194  -0.0416 241 GLN A CG  
1289 C CD  . GLN A 172 ? 0.5053 0.3510 0.5465 -0.0245 0.0213  -0.0435 241 GLN A CD  
1290 O OE1 . GLN A 172 ? 0.6249 0.4592 0.6653 -0.0192 0.0227  -0.0416 241 GLN A OE1 
1291 N NE2 . GLN A 172 ? 0.4261 0.2726 0.4658 -0.0324 0.0206  -0.0463 241 GLN A NE2 
1292 N N   . ILE A 173 ? 0.4576 0.3517 0.5013 -0.0189 0.0149  -0.0351 242 ILE A N   
1293 C CA  . ILE A 173 ? 0.4857 0.3851 0.5294 -0.0230 0.0141  -0.0310 242 ILE A CA  
1294 C C   . ILE A 173 ? 0.4503 0.3395 0.4940 -0.0249 0.0158  -0.0257 242 ILE A C   
1295 O O   . ILE A 173 ? 0.5183 0.3986 0.5623 -0.0205 0.0169  -0.0227 242 ILE A O   
1296 C CB  . ILE A 173 ? 0.4573 0.3669 0.5006 -0.0201 0.0122  -0.0270 242 ILE A CB  
1297 C CG1 . ILE A 173 ? 0.5276 0.4418 0.5700 -0.0238 0.0117  -0.0226 242 ILE A CG1 
1298 C CG2 . ILE A 173 ? 0.5618 0.4692 0.6059 -0.0139 0.0123  -0.0226 242 ILE A CG2 
1299 C CD1 . ILE A 173 ? 0.6161 0.5398 0.6575 -0.0217 0.0095  -0.0196 242 ILE A CD1 
1300 N N   . VAL A 174 ? 0.5644 0.4551 0.6077 -0.0311 0.0161  -0.0243 243 VAL A N   
1301 C CA  . VAL A 174 ? 0.5459 0.4279 0.5889 -0.0340 0.0175  -0.0183 243 VAL A CA  
1302 C C   . VAL A 174 ? 0.5125 0.4043 0.5547 -0.0357 0.0167  -0.0123 243 VAL A C   
1303 O O   . VAL A 174 ? 0.5573 0.4601 0.5991 -0.0390 0.0159  -0.0149 243 VAL A O   
1304 C CB  . VAL A 174 ? 0.5590 0.4338 0.6021 -0.0413 0.0189  -0.0217 243 VAL A CB  
1305 C CG1 . VAL A 174 ? 0.4680 0.3315 0.5105 -0.0440 0.0205  -0.0146 243 VAL A CG1 
1306 C CG2 . VAL A 174 ? 0.6635 0.5305 0.7067 -0.0403 0.0194  -0.0294 243 VAL A CG2 
1307 N N   . LEU A 175 ? 0.4199 0.3080 0.4614 -0.0330 0.0168  -0.0045 244 LEU A N   
1308 C CA  . LEU A 175 ? 0.3253 0.2218 0.3652 -0.0349 0.0161  0.0018  244 LEU A CA  
1309 C C   . LEU A 175 ? 0.4517 0.3415 0.4908 -0.0406 0.0179  0.0066  244 LEU A C   
1310 O O   . LEU A 175 ? 0.5262 0.4033 0.5655 -0.0392 0.0190  0.0114  244 LEU A O   
1311 C CB  . LEU A 175 ? 0.2999 0.1988 0.3396 -0.0288 0.0148  0.0080  244 LEU A CB  
1312 C CG  . LEU A 175 ? 0.2924 0.1979 0.3329 -0.0235 0.0131  0.0047  244 LEU A CG  
1313 C CD1 . LEU A 175 ? 0.3003 0.2075 0.3413 -0.0180 0.0120  0.0117  244 LEU A CD1 
1314 C CD2 . LEU A 175 ? 0.2178 0.1357 0.2568 -0.0261 0.0114  0.0006  244 LEU A CD2 
1315 N N   . GLY A 176 ? 0.3899 0.2882 0.4281 -0.0470 0.0183  0.0057  245 GLY A N   
1316 C CA  . GLY A 176 ? 0.4519 0.3464 0.4893 -0.0535 0.0200  0.0107  245 GLY A CA  
1317 C C   . GLY A 176 ? 0.5237 0.4158 0.5625 -0.0606 0.0214  0.0053  245 GLY A C   
1318 O O   . GLY A 176 ? 0.6210 0.5145 0.6592 -0.0676 0.0228  0.0087  245 GLY A O   
1319 N N   . GLY A 177 ? 0.4935 0.3833 0.5342 -0.0595 0.0210  -0.0029 246 GLY A N   
1320 C CA  . GLY A 177 ? 0.4818 0.3711 0.5240 -0.0665 0.0219  -0.0085 246 GLY A CA  
1321 C C   . GLY A 177 ? 0.5496 0.4390 0.5932 -0.0641 0.0209  -0.0176 246 GLY A C   
1322 O O   . GLY A 177 ? 0.5610 0.4568 0.6046 -0.0578 0.0194  -0.0203 246 GLY A O   
1323 N N   . SER A 178 ? 0.4899 0.3723 0.5345 -0.0695 0.0217  -0.0223 247 SER A N   
1324 C CA  . SER A 178 ? 0.3893 0.2728 0.4349 -0.0685 0.0207  -0.0313 247 SER A CA  
1325 C C   . SER A 178 ? 0.4294 0.2946 0.4741 -0.0702 0.0216  -0.0340 247 SER A C   
1326 O O   . SER A 178 ? 0.5925 0.4459 0.6364 -0.0749 0.0229  -0.0298 247 SER A O   
1327 C CB  . SER A 178 ? 0.4776 0.3760 0.5251 -0.0744 0.0201  -0.0364 247 SER A CB  
1328 O OG  . SER A 178 ? 0.5070 0.4214 0.5550 -0.0711 0.0191  -0.0357 247 SER A OG  
1329 N N   . ASP A 179 ? 0.3812 0.2451 0.4251 -0.0658 0.0206  -0.0407 248 ASP A N   
1330 C CA  . ASP A 179 ? 0.4557 0.3062 0.4962 -0.0644 0.0200  -0.0431 248 ASP A CA  
1331 C C   . ASP A 179 ? 0.5050 0.3608 0.5446 -0.0705 0.0183  -0.0495 248 ASP A C   
1332 O O   . ASP A 179 ? 0.5284 0.3950 0.5683 -0.0685 0.0170  -0.0553 248 ASP A O   
1333 C CB  . ASP A 179 ? 0.6009 0.4473 0.6399 -0.0548 0.0198  -0.0455 248 ASP A CB  
1334 C CG  . ASP A 179 ? 0.6355 0.4671 0.6705 -0.0525 0.0196  -0.0480 248 ASP A CG  
1335 O OD1 . ASP A 179 ? 0.6868 0.5078 0.7202 -0.0578 0.0196  -0.0463 248 ASP A OD1 
1336 O OD2 . ASP A 179 ? 0.6120 0.4424 0.6454 -0.0456 0.0195  -0.0517 248 ASP A OD2 
1337 N N   . PRO A 180 ? 0.5264 0.3756 0.5653 -0.0779 0.0182  -0.0483 249 PRO A N   
1338 C CA  . PRO A 180 ? 0.5003 0.3556 0.5390 -0.0841 0.0165  -0.0543 249 PRO A CA  
1339 C C   . PRO A 180 ? 0.5072 0.3571 0.5424 -0.0801 0.0150  -0.0611 249 PRO A C   
1340 O O   . PRO A 180 ? 0.5838 0.4419 0.6189 -0.0840 0.0134  -0.0667 249 PRO A O   
1341 C CB  . PRO A 180 ? 0.5088 0.3553 0.5476 -0.0927 0.0167  -0.0502 249 PRO A CB  
1342 C CG  . PRO A 180 ? 0.5574 0.3879 0.5945 -0.0889 0.0181  -0.0432 249 PRO A CG  
1343 C CD  . PRO A 180 ? 0.5403 0.3775 0.5789 -0.0816 0.0195  -0.0408 249 PRO A CD  
1344 N N   . GLN A 181 ? 0.4468 0.2842 0.4789 -0.0724 0.0156  -0.0607 250 GLN A N   
1345 C CA  . GLN A 181 ? 0.5450 0.3788 0.5733 -0.0683 0.0146  -0.0675 250 GLN A CA  
1346 C C   . GLN A 181 ? 0.6394 0.4897 0.6687 -0.0647 0.0139  -0.0719 250 GLN A C   
1347 O O   . GLN A 181 ? 0.7188 0.5696 0.7451 -0.0626 0.0129  -0.0778 250 GLN A O   
1348 C CB  . GLN A 181 ? 0.4973 0.3152 0.5225 -0.0602 0.0158  -0.0660 250 GLN A CB  
1349 N N   . HIS A 182 ? 0.5173 0.3808 0.5506 -0.0642 0.0142  -0.0692 251 HIS A N   
1350 C CA  . HIS A 182 ? 0.5160 0.3941 0.5503 -0.0602 0.0132  -0.0726 251 HIS A CA  
1351 C C   . HIS A 182 ? 0.4893 0.3842 0.5273 -0.0654 0.0121  -0.0736 251 HIS A C   
1352 O O   . HIS A 182 ? 0.5802 0.4874 0.6198 -0.0620 0.0113  -0.0753 251 HIS A O   
1353 C CB  . HIS A 182 ? 0.4301 0.3081 0.4655 -0.0523 0.0143  -0.0691 251 HIS A CB  
1354 C CG  . HIS A 182 ? 0.5204 0.3871 0.5526 -0.0455 0.0152  -0.0700 251 HIS A CG  
1355 N ND1 . HIS A 182 ? 0.5824 0.4370 0.6146 -0.0415 0.0169  -0.0649 251 HIS A ND1 
1356 C CD2 . HIS A 182 ? 0.5572 0.4232 0.5860 -0.0420 0.0148  -0.0753 251 HIS A CD2 
1357 C CE1 . HIS A 182 ? 0.5253 0.3728 0.5547 -0.0352 0.0176  -0.0674 251 HIS A CE1 
1358 N NE2 . HIS A 182 ? 0.6239 0.4779 0.6509 -0.0356 0.0164  -0.0738 251 HIS A NE2 
1359 N N   . TYR A 183 ? 0.4810 0.3771 0.5207 -0.0735 0.0121  -0.0727 252 TYR A N   
1360 C CA  . TYR A 183 ? 0.4574 0.3709 0.5007 -0.0785 0.0111  -0.0747 252 TYR A CA  
1361 C C   . TYR A 183 ? 0.5184 0.4309 0.5618 -0.0875 0.0105  -0.0761 252 TYR A C   
1362 O O   . TYR A 183 ? 0.5520 0.4511 0.5941 -0.0912 0.0114  -0.0729 252 TYR A O   
1363 C CB  . TYR A 183 ? 0.3493 0.2716 0.3967 -0.0789 0.0123  -0.0705 252 TYR A CB  
1364 C CG  . TYR A 183 ? 0.3862 0.3009 0.4344 -0.0840 0.0143  -0.0645 252 TYR A CG  
1365 C CD1 . TYR A 183 ? 0.4991 0.4202 0.5497 -0.0929 0.0146  -0.0635 252 TYR A CD1 
1366 C CD2 . TYR A 183 ? 0.4774 0.3799 0.5244 -0.0800 0.0158  -0.0593 252 TYR A CD2 
1367 C CE1 . TYR A 183 ? 0.5211 0.4359 0.5723 -0.0979 0.0165  -0.0573 252 TYR A CE1 
1368 C CE2 . TYR A 183 ? 0.5492 0.4451 0.5968 -0.0847 0.0176  -0.0530 252 TYR A CE2 
1369 C CZ  . TYR A 183 ? 0.5513 0.4531 0.6007 -0.0937 0.0180  -0.0519 252 TYR A CZ  
1370 O OH  . TYR A 183 ? 0.6376 0.5333 0.6872 -0.0985 0.0198  -0.0450 252 TYR A OH  
1371 N N   . GLU A 184 ? 0.5270 0.4539 0.5722 -0.0909 0.0089  -0.0805 253 GLU A N   
1372 C CA  . GLU A 184 ? 0.5917 0.5209 0.6377 -0.1000 0.0080  -0.0821 253 GLU A CA  
1373 C C   . GLU A 184 ? 0.5504 0.4974 0.6021 -0.1054 0.0084  -0.0803 253 GLU A C   
1374 O O   . GLU A 184 ? 0.5354 0.4964 0.5900 -0.1015 0.0085  -0.0807 253 GLU A O   
1375 C CB  . GLU A 184 ? 0.5847 0.5177 0.6284 -0.1006 0.0057  -0.0887 253 GLU A CB  
1376 C CG  . GLU A 184 ? 0.7146 0.6642 0.7598 -0.0957 0.0045  -0.0920 253 GLU A CG  
1377 C CD  . GLU A 184 ? 0.9195 0.8743 0.9625 -0.0975 0.0022  -0.0980 253 GLU A CD  
1378 O OE1 . GLU A 184 ? 0.9092 0.8550 0.9472 -0.0929 0.0018  -0.1010 253 GLU A OE1 
1379 O OE2 . GLU A 184 ? 0.9590 0.9278 1.0051 -0.1035 0.0009  -0.0998 253 GLU A OE2 
1380 N N   . GLY A 185 ? 0.5670 0.5134 0.6202 -0.1142 0.0087  -0.0783 254 GLY A N   
1381 C CA  . GLY A 185 ? 0.5201 0.4835 0.5786 -0.1197 0.0096  -0.0760 254 GLY A CA  
1382 C C   . GLY A 185 ? 0.5631 0.5250 0.6229 -0.1180 0.0122  -0.0699 254 GLY A C   
1383 O O   . GLY A 185 ? 0.6035 0.5492 0.6603 -0.1141 0.0133  -0.0666 254 GLY A O   
1384 N N   . ASN A 186 ? 0.6294 0.6097 0.6939 -0.1210 0.0133  -0.0686 255 ASN A N   
1385 C CA  . ASN A 186 ? 0.6370 0.6193 0.7029 -0.1209 0.0159  -0.0631 255 ASN A CA  
1386 C C   . ASN A 186 ? 0.5460 0.5402 0.6138 -0.1134 0.0160  -0.0652 255 ASN A C   
1387 O O   . ASN A 186 ? 0.5022 0.5078 0.5716 -0.1097 0.0140  -0.0705 255 ASN A O   
1388 C CB  . ASN A 186 ? 0.6620 0.6572 0.7316 -0.1298 0.0174  -0.0595 255 ASN A CB  
1389 C CG  . ASN A 186 ? 0.6863 0.6667 0.7540 -0.1374 0.0177  -0.0554 255 ASN A CG  
1390 O OD1 . ASN A 186 ? 0.7135 0.7006 0.7832 -0.1448 0.0169  -0.0562 255 ASN A OD1 
1391 N ND2 . ASN A 186 ? 0.6614 0.6217 0.7254 -0.1355 0.0187  -0.0508 255 ASN A ND2 
1392 N N   . PHE A 187 ? 0.4594 0.4504 0.5267 -0.1111 0.0181  -0.0608 256 PHE A N   
1393 C CA  . PHE A 187 ? 0.4767 0.4775 0.5436 -0.1011 0.0173  -0.0605 256 PHE A CA  
1394 C C   . PHE A 187 ? 0.4896 0.5138 0.5606 -0.1020 0.0176  -0.0615 256 PHE A C   
1395 O O   . PHE A 187 ? 0.5743 0.6071 0.6478 -0.1095 0.0195  -0.0589 256 PHE A O   
1396 C CB  . PHE A 187 ? 0.4634 0.4548 0.5268 -0.0967 0.0187  -0.0538 256 PHE A CB  
1397 C CG  . PHE A 187 ? 0.3882 0.3604 0.4478 -0.0913 0.0180  -0.0530 256 PHE A CG  
1398 C CD1 . PHE A 187 ? 0.4330 0.4043 0.4916 -0.0836 0.0160  -0.0572 256 PHE A CD1 
1399 C CD2 . PHE A 187 ? 0.3081 0.2639 0.3653 -0.0937 0.0195  -0.0477 256 PHE A CD2 
1400 C CE1 . PHE A 187 ? 0.3738 0.3294 0.4293 -0.0786 0.0156  -0.0563 256 PHE A CE1 
1401 C CE2 . PHE A 187 ? 0.3546 0.2942 0.4089 -0.0880 0.0191  -0.0469 256 PHE A CE2 
1402 C CZ  . PHE A 187 ? 0.3528 0.2931 0.4065 -0.0805 0.0173  -0.0514 256 PHE A CZ  
1403 N N   . HIS A 188 ? 0.4374 0.4722 0.5092 -0.0942 0.0157  -0.0652 257 HIS A N   
1404 C CA  . HIS A 188 ? 0.3777 0.4336 0.4528 -0.0916 0.0161  -0.0658 257 HIS A CA  
1405 C C   . HIS A 188 ? 0.4263 0.4804 0.4978 -0.0829 0.0165  -0.0629 257 HIS A C   
1406 O O   . HIS A 188 ? 0.4412 0.4871 0.5098 -0.0753 0.0147  -0.0640 257 HIS A O   
1407 C CB  . HIS A 188 ? 0.1794 0.2485 0.2577 -0.0883 0.0135  -0.0717 257 HIS A CB  
1408 C CG  . HIS A 188 ? 0.5941 0.6824 0.6750 -0.0823 0.0136  -0.0725 257 HIS A CG  
1409 N ND1 . HIS A 188 ? 0.5240 0.6175 0.6048 -0.0730 0.0113  -0.0756 257 HIS A ND1 
1410 C CD2 . HIS A 188 ? 0.4720 0.5750 0.5553 -0.0836 0.0160  -0.0705 257 HIS A CD2 
1411 C CE1 . HIS A 188 ? 0.4899 0.5995 0.5730 -0.0686 0.0121  -0.0758 257 HIS A CE1 
1412 N NE2 . HIS A 188 ? 0.5056 0.6219 0.5903 -0.0748 0.0151  -0.0729 257 HIS A NE2 
1413 N N   . TYR A 189 ? 0.4057 0.4677 0.4772 -0.0844 0.0189  -0.0592 258 TYR A N   
1414 C CA  . TYR A 189 ? 0.3948 0.4534 0.4620 -0.0779 0.0196  -0.0561 258 TYR A CA  
1415 C C   . TYR A 189 ? 0.5043 0.5787 0.5723 -0.0707 0.0193  -0.0591 258 TYR A C   
1416 O O   . TYR A 189 ? 0.5933 0.6854 0.6656 -0.0727 0.0203  -0.0612 258 TYR A O   
1417 C CB  . TYR A 189 ? 0.3255 0.3816 0.3907 -0.0837 0.0224  -0.0498 258 TYR A CB  
1418 C CG  . TYR A 189 ? 0.4362 0.4725 0.4992 -0.0881 0.0225  -0.0459 258 TYR A CG  
1419 C CD1 . TYR A 189 ? 0.4449 0.4658 0.5037 -0.0823 0.0212  -0.0441 258 TYR A CD1 
1420 C CD2 . TYR A 189 ? 0.3149 0.3479 0.3800 -0.0980 0.0238  -0.0440 258 TYR A CD2 
1421 C CE1 . TYR A 189 ? 0.4874 0.4907 0.5444 -0.0851 0.0214  -0.0406 258 TYR A CE1 
1422 C CE2 . TYR A 189 ? 0.5002 0.5136 0.5630 -0.1012 0.0239  -0.0405 258 TYR A CE2 
1423 C CZ  . TYR A 189 ? 0.6020 0.6007 0.6608 -0.0942 0.0228  -0.0389 258 TYR A CZ  
1424 O OH  . TYR A 189 ? 0.6419 0.6215 0.6987 -0.0962 0.0230  -0.0355 258 TYR A OH  
1425 N N   . ILE A 190 ? 0.4351 0.5031 0.4990 -0.0624 0.0180  -0.0594 259 ILE A N   
1426 C CA  . ILE A 190 ? 0.3290 0.4078 0.3925 -0.0544 0.0175  -0.0625 259 ILE A CA  
1427 C C   . ILE A 190 ? 0.3848 0.4577 0.4424 -0.0506 0.0183  -0.0598 259 ILE A C   
1428 O O   . ILE A 190 ? 0.3657 0.4236 0.4194 -0.0492 0.0170  -0.0574 259 ILE A O   
1429 C CB  . ILE A 190 ? 0.4006 0.4767 0.4645 -0.0476 0.0143  -0.0666 259 ILE A CB  
1430 C CG1 . ILE A 190 ? 0.4247 0.5072 0.4939 -0.0517 0.0132  -0.0694 259 ILE A CG1 
1431 C CG2 . ILE A 190 ? 0.3219 0.4071 0.3851 -0.0390 0.0138  -0.0695 259 ILE A CG2 
1432 C CD1 . ILE A 190 ? 0.4133 0.4855 0.4814 -0.0486 0.0102  -0.0713 259 ILE A CD1 
1433 N N   . ASN A 191 ? 0.3721 0.4581 0.4291 -0.0490 0.0203  -0.0604 260 ASN A N   
1434 C CA  . ASN A 191 ? 0.3288 0.4110 0.3797 -0.0464 0.0212  -0.0582 260 ASN A CA  
1435 C C   . ASN A 191 ? 0.3049 0.3791 0.3516 -0.0377 0.0186  -0.0611 260 ASN A C   
1436 O O   . ASN A 191 ? 0.4042 0.4818 0.4529 -0.0321 0.0169  -0.0654 260 ASN A O   
1437 C CB  . ASN A 191 ? 0.3482 0.4476 0.3992 -0.0471 0.0244  -0.0586 260 ASN A CB  
1438 C CG  . ASN A 191 ? 0.4097 0.5173 0.4642 -0.0567 0.0272  -0.0547 260 ASN A CG  
1439 O OD1 . ASN A 191 ? 0.4292 0.5262 0.4821 -0.0628 0.0276  -0.0494 260 ASN A OD1 
1440 N ND2 . ASN A 191 ? 0.4314 0.5579 0.4907 -0.0581 0.0292  -0.0570 260 ASN A ND2 
1441 N N   . LEU A 192 ? 0.2339 0.2977 0.2748 -0.0369 0.0180  -0.0583 261 LEU A N   
1442 C CA  . LEU A 192 ? 0.3482 0.4049 0.3843 -0.0298 0.0157  -0.0608 261 LEU A CA  
1443 C C   . LEU A 192 ? 0.3596 0.4276 0.3940 -0.0245 0.0169  -0.0654 261 LEU A C   
1444 O O   . LEU A 192 ? 0.3751 0.4554 0.4097 -0.0267 0.0199  -0.0651 261 LEU A O   
1445 C CB  . LEU A 192 ? 0.3122 0.3577 0.3426 -0.0310 0.0149  -0.0567 261 LEU A CB  
1446 C CG  . LEU A 192 ? 0.2235 0.2578 0.2551 -0.0355 0.0141  -0.0516 261 LEU A CG  
1447 C CD1 . LEU A 192 ? 0.1644 0.1903 0.1904 -0.0350 0.0129  -0.0481 261 LEU A CD1 
1448 C CD2 . LEU A 192 ? 0.1759 0.2035 0.2109 -0.0334 0.0119  -0.0536 261 LEU A CD2 
1449 N N   . ILE A 193 ? 0.3016 0.3651 0.3342 -0.0172 0.0146  -0.0694 262 ILE A N   
1450 C CA  . ILE A 193 ? 0.1671 0.2375 0.1964 -0.0109 0.0155  -0.0741 262 ILE A CA  
1451 C C   . ILE A 193 ? 0.2763 0.3441 0.2983 -0.0122 0.0165  -0.0730 262 ILE A C   
1452 O O   . ILE A 193 ? 0.3455 0.4248 0.3656 -0.0114 0.0193  -0.0749 262 ILE A O   
1453 C CB  . ILE A 193 ? 0.4263 0.4887 0.4543 -0.0029 0.0124  -0.0779 262 ILE A CB  
1454 C CG1 . ILE A 193 ? 0.3624 0.4302 0.3975 -0.0014 0.0114  -0.0790 262 ILE A CG1 
1455 C CG2 . ILE A 193 ? 0.3294 0.3955 0.3529 0.0041  0.0132  -0.0830 262 ILE A CG2 
1456 C CD1 . ILE A 193 ? 0.4812 0.5379 0.5151 0.0042  0.0077  -0.0803 262 ILE A CD1 
1457 N N   . LYS A 194 ? 0.4212 0.4754 0.4391 -0.0143 0.0143  -0.0697 263 LYS A N   
1458 C CA  . LYS A 194 ? 0.3222 0.3741 0.3329 -0.0161 0.0148  -0.0682 263 LYS A CA  
1459 C C   . LYS A 194 ? 0.4314 0.4732 0.4416 -0.0215 0.0132  -0.0618 263 LYS A C   
1460 O O   . LYS A 194 ? 0.5722 0.6049 0.5854 -0.0215 0.0110  -0.0603 263 LYS A O   
1461 C CB  . LYS A 194 ? 0.2163 0.2618 0.2203 -0.0099 0.0129  -0.0733 263 LYS A CB  
1462 C CG  . LYS A 194 ? 0.1888 0.2188 0.1916 -0.0080 0.0088  -0.0730 263 LYS A CG  
1463 C CD  . LYS A 194 ? 0.1888 0.2113 0.1847 -0.0026 0.0068  -0.0782 263 LYS A CD  
1464 C CE  . LYS A 194 ? 0.4761 0.4903 0.4740 0.0027  0.0042  -0.0807 263 LYS A CE  
1465 N NZ  . LYS A 194 ? 0.6695 0.6782 0.6724 -0.0007 0.0024  -0.0757 263 LYS A NZ  
1466 N N   . THR A 195 ? 0.3725 0.4171 0.3790 -0.0258 0.0146  -0.0578 264 THR A N   
1467 C CA  . THR A 195 ? 0.4749 0.5100 0.4799 -0.0296 0.0129  -0.0517 264 THR A CA  
1468 C C   . THR A 195 ? 0.4896 0.5138 0.4902 -0.0262 0.0093  -0.0535 264 THR A C   
1469 O O   . THR A 195 ? 0.4948 0.5188 0.4910 -0.0221 0.0084  -0.0589 264 THR A O   
1470 C CB  . THR A 195 ? 0.6708 0.7122 0.6719 -0.0342 0.0149  -0.0470 264 THR A CB  
1471 O OG1 . THR A 195 ? 0.7675 0.8149 0.7735 -0.0391 0.0177  -0.0428 264 THR A OG1 
1472 C CG2 . THR A 195 ? 0.7015 0.7343 0.6987 -0.0362 0.0125  -0.0415 264 THR A CG2 
1473 N N   . GLY A 196 ? 0.3681 0.3830 0.3703 -0.0278 0.0071  -0.0490 265 GLY A N   
1474 C CA  . GLY A 196 ? 0.3454 0.3509 0.3441 -0.0258 0.0036  -0.0497 265 GLY A CA  
1475 C C   . GLY A 196 ? 0.3982 0.3963 0.4010 -0.0230 0.0016  -0.0512 265 GLY A C   
1476 O O   . GLY A 196 ? 0.4693 0.4594 0.4697 -0.0220 -0.0013 -0.0509 265 GLY A O   
1477 N N   . VAL A 197 ? 0.2975 0.2986 0.3060 -0.0221 0.0030  -0.0527 266 VAL A N   
1478 C CA  . VAL A 197 ? 0.3757 0.3709 0.3878 -0.0196 0.0012  -0.0538 266 VAL A CA  
1479 C C   . VAL A 197 ? 0.2607 0.2607 0.2794 -0.0210 0.0032  -0.0537 266 VAL A C   
1480 O O   . VAL A 197 ? 0.3071 0.3163 0.3276 -0.0214 0.0054  -0.0559 266 VAL A O   
1481 C CB  . VAL A 197 ? 0.3569 0.3495 0.3663 -0.0144 -0.0007 -0.0591 266 VAL A CB  
1482 C CG1 . VAL A 197 ? 0.4659 0.4678 0.4749 -0.0117 0.0015  -0.0638 266 VAL A CG1 
1483 C CG2 . VAL A 197 ? 0.3364 0.3243 0.3495 -0.0120 -0.0025 -0.0596 266 VAL A CG2 
1484 N N   . TRP A 198 ? 0.2715 0.2657 0.2935 -0.0221 0.0023  -0.0514 267 TRP A N   
1485 C CA  . TRP A 198 ? 0.2757 0.2729 0.3033 -0.0241 0.0039  -0.0517 267 TRP A CA  
1486 C C   . TRP A 198 ? 0.2786 0.2802 0.3086 -0.0204 0.0030  -0.0566 267 TRP A C   
1487 O O   . TRP A 198 ? 0.3977 0.3958 0.4298 -0.0189 0.0015  -0.0573 267 TRP A O   
1488 C CB  . TRP A 198 ? 0.2279 0.2171 0.2574 -0.0259 0.0033  -0.0482 267 TRP A CB  
1489 C CG  . TRP A 198 ? 0.3806 0.3664 0.4088 -0.0291 0.0044  -0.0427 267 TRP A CG  
1490 C CD1 . TRP A 198 ? 0.4600 0.4400 0.4856 -0.0284 0.0029  -0.0389 267 TRP A CD1 
1491 C CD2 . TRP A 198 ? 0.3293 0.3178 0.3588 -0.0336 0.0070  -0.0399 267 TRP A CD2 
1492 N NE1 . TRP A 198 ? 0.4468 0.4259 0.4721 -0.0315 0.0044  -0.0338 267 TRP A NE1 
1493 C CE2 . TRP A 198 ? 0.3628 0.3463 0.3902 -0.0348 0.0069  -0.0342 267 TRP A CE2 
1494 C CE3 . TRP A 198 ? 0.2926 0.2879 0.3250 -0.0370 0.0093  -0.0413 267 TRP A CE3 
1495 C CZ2 . TRP A 198 ? 0.3486 0.3323 0.3763 -0.0390 0.0090  -0.0295 267 TRP A CZ2 
1496 C CZ3 . TRP A 198 ? 0.3388 0.3342 0.3715 -0.0419 0.0115  -0.0368 267 TRP A CZ3 
1497 C CH2 . TRP A 198 ? 0.3167 0.3057 0.3468 -0.0427 0.0113  -0.0308 267 TRP A CH2 
1498 N N   . GLN A 199 ? 0.2840 0.2942 0.3136 -0.0185 0.0040  -0.0599 268 GLN A N   
1499 C CA  . GLN A 199 ? 0.3421 0.3571 0.3734 -0.0135 0.0030  -0.0644 268 GLN A CA  
1500 C C   . GLN A 199 ? 0.4209 0.4500 0.4558 -0.0143 0.0056  -0.0667 268 GLN A C   
1501 O O   . GLN A 199 ? 0.4611 0.4961 0.4945 -0.0163 0.0079  -0.0662 268 GLN A O   
1502 C CB  . GLN A 199 ? 0.2262 0.2362 0.2522 -0.0082 0.0011  -0.0665 268 GLN A CB  
1503 C CG  . GLN A 199 ? 0.1617 0.1731 0.1887 -0.0020 -0.0005 -0.0702 268 GLN A CG  
1504 C CD  . GLN A 199 ? 0.2333 0.2366 0.2541 0.0027  -0.0024 -0.0720 268 GLN A CD  
1505 O OE1 . GLN A 199 ? 0.2805 0.2849 0.2972 0.0030  -0.0013 -0.0736 268 GLN A OE1 
1506 N NE2 . GLN A 199 ? 0.1726 0.1674 0.1923 0.0058  -0.0054 -0.0718 268 GLN A NE2 
1507 N N   . ILE A 200 ? 0.3794 0.4151 0.4192 -0.0130 0.0051  -0.0691 269 ILE A N   
1508 C CA  . ILE A 200 ? 0.3881 0.4391 0.4327 -0.0145 0.0073  -0.0711 269 ILE A CA  
1509 C C   . ILE A 200 ? 0.4086 0.4675 0.4552 -0.0074 0.0061  -0.0752 269 ILE A C   
1510 O O   . ILE A 200 ? 0.3597 0.4112 0.4046 -0.0024 0.0033  -0.0761 269 ILE A O   
1511 C CB  . ILE A 200 ? 0.3482 0.4018 0.3977 -0.0214 0.0081  -0.0696 269 ILE A CB  
1512 C CG1 . ILE A 200 ? 0.3236 0.3713 0.3746 -0.0200 0.0054  -0.0705 269 ILE A CG1 
1513 C CG2 . ILE A 200 ? 0.3303 0.3765 0.3781 -0.0279 0.0097  -0.0652 269 ILE A CG2 
1514 C CD1 . ILE A 200 ? 0.3652 0.4147 0.4203 -0.0266 0.0059  -0.0702 269 ILE A CD1 
1515 N N   . GLN A 201 ? 0.4958 0.5708 0.5464 -0.0072 0.0082  -0.0773 270 GLN A N   
1516 C CA  . GLN A 201 ? 0.4604 0.5462 0.5144 -0.0005 0.0073  -0.0809 270 GLN A CA  
1517 C C   . GLN A 201 ? 0.3864 0.4752 0.4453 -0.0019 0.0052  -0.0810 270 GLN A C   
1518 O O   . GLN A 201 ? 0.4190 0.5099 0.4810 -0.0096 0.0059  -0.0795 270 GLN A O   
1519 C CB  . GLN A 201 ? 0.5582 0.6627 0.6157 -0.0004 0.0106  -0.0828 270 GLN A CB  
1520 C CG  . GLN A 201 ? 0.6606 0.7786 0.7221 0.0076  0.0100  -0.0864 270 GLN A CG  
1521 C CD  . GLN A 201 ? 0.6669 0.7854 0.7242 0.0162  0.0111  -0.0895 270 GLN A CD  
1522 O OE1 . GLN A 201 ? 0.6165 0.7241 0.6700 0.0237  0.0087  -0.0910 270 GLN A OE1 
1523 N NE2 . GLN A 201 ? 0.5935 0.7243 0.6510 0.0149  0.0148  -0.0905 270 GLN A NE2 
1524 N N   . MET A 202 ? 0.3195 0.4081 0.3786 0.0054  0.0025  -0.0827 271 MET A N   
1525 C CA  . MET A 202 ? 0.3539 0.4480 0.4174 0.0051  0.0003  -0.0831 271 MET A CA  
1526 C C   . MET A 202 ? 0.3338 0.4439 0.4016 0.0123  -0.0002 -0.0857 271 MET A C   
1527 O O   . MET A 202 ? 0.4106 0.5195 0.4759 0.0205  -0.0003 -0.0871 271 MET A O   
1528 C CB  . MET A 202 ? 0.3337 0.4122 0.3933 0.0072  -0.0030 -0.0814 271 MET A CB  
1529 C CG  . MET A 202 ? 0.3228 0.4073 0.3858 0.0077  -0.0056 -0.0819 271 MET A CG  
1530 S SD  . MET A 202 ? 0.4625 0.5320 0.5222 0.0033  -0.0075 -0.0797 271 MET A SD  
1531 C CE  . MET A 202 ? 0.4199 0.4758 0.4738 0.0116  -0.0103 -0.0778 271 MET A CE  
1532 N N   . LYS A 203 ? 0.2158 0.3412 0.2900 0.0094  -0.0007 -0.0865 272 LYS A N   
1533 C CA  . LYS A 203 ? 0.2202 0.3652 0.2999 0.0153  -0.0007 -0.0887 272 LYS A CA  
1534 C C   . LYS A 203 ? 0.3478 0.4966 0.4295 0.0211  -0.0045 -0.0888 272 LYS A C   
1535 O O   . LYS A 203 ? 0.6008 0.7653 0.6870 0.0278  -0.0050 -0.0902 272 LYS A O   
1536 C CB  . LYS A 203 ? 0.3315 0.4960 0.4180 0.0076  0.0018  -0.0894 272 LYS A CB  
1537 C CG  . LYS A 203 ? 0.4238 0.6090 0.5151 0.0133  0.0039  -0.0914 272 LYS A CG  
1538 N N   . GLY A 204 ? 0.3098 0.4457 0.3884 0.0190  -0.0072 -0.0872 273 GLY A N   
1539 C CA  . GLY A 204 ? 0.2818 0.4213 0.3614 0.0243  -0.0110 -0.0868 273 GLY A CA  
1540 C C   . GLY A 204 ? 0.3149 0.4429 0.3914 0.0192  -0.0131 -0.0853 273 GLY A C   
1541 O O   . GLY A 204 ? 0.3954 0.5179 0.4711 0.0103  -0.0116 -0.0853 273 GLY A O   
1542 N N   . VAL A 205 ? 0.1965 0.3205 0.2708 0.0250  -0.0165 -0.0838 274 VAL A N   
1543 C CA  . VAL A 205 ? 0.2590 0.3739 0.3300 0.0210  -0.0186 -0.0824 274 VAL A CA  
1544 C C   . VAL A 205 ? 0.2822 0.4106 0.3560 0.0240  -0.0219 -0.0823 274 VAL A C   
1545 O O   . VAL A 205 ? 0.4250 0.5565 0.4988 0.0331  -0.0241 -0.0808 274 VAL A O   
1546 C CB  . VAL A 205 ? 0.3318 0.4260 0.3958 0.0242  -0.0194 -0.0795 274 VAL A CB  
1547 C CG1 . VAL A 205 ? 0.3315 0.4192 0.3925 0.0205  -0.0213 -0.0781 274 VAL A CG1 
1548 C CG2 . VAL A 205 ? 0.3338 0.4161 0.3950 0.0209  -0.0165 -0.0794 274 VAL A CG2 
1549 N N   . SER A 206 ? 0.2773 0.4134 0.3530 0.0165  -0.0225 -0.0840 275 SER A N   
1550 C CA  . SER A 206 ? 0.2114 0.3641 0.2903 0.0177  -0.0257 -0.0846 275 SER A CA  
1551 C C   . SER A 206 ? 0.2821 0.4271 0.3561 0.0161  -0.0282 -0.0834 275 SER A C   
1552 O O   . SER A 206 ? 0.3698 0.5034 0.4404 0.0093  -0.0268 -0.0844 275 SER A O   
1553 C CB  . SER A 206 ? 0.1429 0.3134 0.2281 0.0095  -0.0247 -0.0881 275 SER A CB  
1554 O OG  . SER A 206 ? 0.5162 0.6945 0.6059 0.0099  -0.0219 -0.0889 275 SER A OG  
1555 N N   . VAL A 207 ? 0.3306 0.4822 0.4040 0.0228  -0.0317 -0.0812 276 VAL A N   
1556 C CA  . VAL A 207 ? 0.3309 0.4817 0.4003 0.0210  -0.0344 -0.0804 276 VAL A CA  
1557 C C   . VAL A 207 ? 0.3292 0.5020 0.4034 0.0172  -0.0364 -0.0834 276 VAL A C   
1558 O O   . VAL A 207 ? 0.3541 0.5425 0.4316 0.0233  -0.0392 -0.0820 276 VAL A O   
1559 C CB  . VAL A 207 ? 0.3696 0.5135 0.4347 0.0300  -0.0372 -0.0754 276 VAL A CB  
1560 C CG1 . VAL A 207 ? 0.2185 0.3641 0.2793 0.0278  -0.0399 -0.0744 276 VAL A CG1 
1561 C CG2 . VAL A 207 ? 0.1542 0.2766 0.2147 0.0324  -0.0353 -0.0729 276 VAL A CG2 
1562 N N   . GLY A 208 ? 0.3676 0.5418 0.4424 0.0069  -0.0349 -0.0876 277 GLY A N   
1563 C CA  . GLY A 208 ? 0.3191 0.5135 0.3983 0.0012  -0.0366 -0.0912 277 GLY A CA  
1564 C C   . GLY A 208 ? 0.5119 0.7243 0.5992 0.0022  -0.0360 -0.0920 277 GLY A C   
1565 O O   . GLY A 208 ? 0.4543 0.6643 0.5445 -0.0022 -0.0326 -0.0935 277 GLY A O   
1566 N N   . SER A 209 ? 0.7200 0.9515 0.8112 0.0085  -0.0393 -0.0905 278 SER A N   
1567 C CA  . SER A 209 ? 0.8720 1.1252 0.9718 0.0097  -0.0390 -0.0914 278 SER A CA  
1568 C C   . SER A 209 ? 0.8878 1.1364 0.9894 0.0194  -0.0368 -0.0887 278 SER A C   
1569 O O   . SER A 209 ? 0.9021 1.1554 1.0082 0.0168  -0.0336 -0.0904 278 SER A O   
1570 C CB  . SER A 209 ? 0.9362 1.2133 1.0397 0.0131  -0.0436 -0.0907 278 SER A CB  
1571 O OG  . SER A 209 ? 0.9757 1.2501 1.0768 0.0256  -0.0462 -0.0858 278 SER A OG  
1572 N N   . SER A 210 ? 0.8904 1.1294 0.9882 0.0303  -0.0385 -0.0847 279 SER A N   
1573 C CA  . SER A 210 ? 0.8296 1.0651 0.9287 0.0407  -0.0370 -0.0827 279 SER A CA  
1574 C C   . SER A 210 ? 0.8345 1.0466 0.9287 0.0388  -0.0332 -0.0830 279 SER A C   
1575 O O   . SER A 210 ? 0.7789 0.9724 0.8667 0.0346  -0.0330 -0.0823 279 SER A O   
1576 C CB  . SER A 210 ? 0.7256 0.9585 0.8221 0.0530  -0.0405 -0.0781 279 SER A CB  
1577 N N   . THR A 211 ? 0.8513 1.0658 0.9487 0.0422  -0.0301 -0.0840 280 THR A N   
1578 C CA  . THR A 211 ? 0.8085 1.0026 0.9012 0.0421  -0.0268 -0.0840 280 THR A CA  
1579 C C   . THR A 211 ? 0.7652 0.9438 0.8525 0.0531  -0.0285 -0.0809 280 THR A C   
1580 O O   . THR A 211 ? 0.6601 0.8414 0.7488 0.0626  -0.0280 -0.0808 280 THR A O   
1581 C CB  . THR A 211 ? 0.6999 0.9041 0.7974 0.0412  -0.0230 -0.0865 280 THR A CB  
1582 O OG1 . THR A 211 ? 0.6641 0.8842 0.7671 0.0306  -0.0219 -0.0888 280 THR A OG1 
1583 C CG2 . THR A 211 ? 0.6944 0.8782 0.7864 0.0396  -0.0197 -0.0866 280 THR A CG2 
1584 N N   . LEU A 212 ? 0.7694 0.9312 0.8503 0.0516  -0.0304 -0.0784 281 LEU A N   
1585 C CA  . LEU A 212 ? 0.6591 0.8067 0.7347 0.0609  -0.0327 -0.0746 281 LEU A CA  
1586 C C   . LEU A 212 ? 0.4548 0.5844 0.5262 0.0644  -0.0303 -0.0748 281 LEU A C   
1587 O O   . LEU A 212 ? 0.4807 0.6031 0.5499 0.0742  -0.0316 -0.0731 281 LEU A O   
1588 C CB  . LEU A 212 ? 0.6019 0.7385 0.6718 0.0573  -0.0352 -0.0716 281 LEU A CB  
1589 N N   . LEU A 213 ? 0.5027 0.6247 0.5728 0.0567  -0.0271 -0.0770 282 LEU A N   
1590 C CA  . LEU A 213 ? 0.5123 0.6156 0.5770 0.0582  -0.0252 -0.0770 282 LEU A CA  
1591 C C   . LEU A 213 ? 0.5069 0.6164 0.5744 0.0551  -0.0212 -0.0805 282 LEU A C   
1592 O O   . LEU A 213 ? 0.4686 0.5939 0.5416 0.0493  -0.0196 -0.0825 282 LEU A O   
1593 C CB  . LEU A 213 ? 0.5308 0.6159 0.5895 0.0514  -0.0255 -0.0748 282 LEU A CB  
1594 C CG  . LEU A 213 ? 0.6204 0.6907 0.6733 0.0557  -0.0286 -0.0706 282 LEU A CG  
1595 C CD1 . LEU A 213 ? 0.6712 0.7316 0.7212 0.0651  -0.0293 -0.0701 282 LEU A CD1 
1596 C CD2 . LEU A 213 ? 0.5818 0.6623 0.6363 0.0572  -0.0319 -0.0683 282 LEU A CD2 
1597 N N   . CYS A 214 ? 0.5276 0.6242 0.5907 0.0588  -0.0196 -0.0813 283 CYS A N   
1598 C CA  . CYS A 214 ? 0.3464 0.4439 0.4096 0.0544  -0.0157 -0.0839 283 CYS A CA  
1599 C C   . CYS A 214 ? 0.4093 0.5303 0.4802 0.0542  -0.0134 -0.0866 283 CYS A C   
1600 O O   . CYS A 214 ? 0.5184 0.6466 0.5918 0.0461  -0.0105 -0.0878 283 CYS A O   
1601 C CB  . CYS A 214 ? 0.3565 0.4442 0.4172 0.0436  -0.0146 -0.0827 283 CYS A CB  
1602 S SG  . CYS A 214 ? 0.5975 0.6852 0.6577 0.0369  -0.0101 -0.0846 283 CYS A SG  
1603 N N   . GLU A 215 ? 0.4835 0.6170 0.5582 0.0635  -0.0146 -0.0873 284 GLU A N   
1604 C CA  . GLU A 215 ? 0.5370 0.6960 0.6199 0.0638  -0.0128 -0.0895 284 GLU A CA  
1605 C C   . GLU A 215 ? 0.6022 0.7663 0.6855 0.0642  -0.0084 -0.0924 284 GLU A C   
1606 O O   . GLU A 215 ? 0.6326 0.8153 0.7219 0.0587  -0.0058 -0.0937 284 GLU A O   
1607 C CB  . GLU A 215 ? 0.6026 0.7743 0.6896 0.0748  -0.0154 -0.0890 284 GLU A CB  
1608 C CG  . GLU A 215 ? 0.7399 0.9032 0.8245 0.0771  -0.0201 -0.0854 284 GLU A CG  
1609 C CD  . GLU A 215 ? 0.8988 1.0372 0.9751 0.0838  -0.0218 -0.0834 284 GLU A CD  
1610 O OE1 . GLU A 215 ? 1.1093 1.2456 1.1848 0.0917  -0.0253 -0.0807 284 GLU A OE1 
1611 O OE2 . GLU A 215 ? 1.0049 1.1261 1.0755 0.0808  -0.0199 -0.0843 284 GLU A OE2 
1612 N N   . ASP A 216 ? 0.6156 0.7641 0.6925 0.0704  -0.0075 -0.0936 285 ASP A N   
1613 C CA  . ASP A 216 ? 0.6594 0.8116 0.7352 0.0712  -0.0034 -0.0967 285 ASP A CA  
1614 C C   . ASP A 216 ? 0.6729 0.8102 0.7428 0.0618  -0.0016 -0.0961 285 ASP A C   
1615 O O   . ASP A 216 ? 0.6381 0.7734 0.7046 0.0626  0.0014  -0.0984 285 ASP A O   
1616 C CB  . ASP A 216 ? 0.6313 0.7772 0.7034 0.0844  -0.0033 -0.0993 285 ASP A CB  
1617 C CG  . ASP A 216 ? 0.7164 0.8859 0.7960 0.0935  -0.0021 -0.1015 285 ASP A CG  
1618 O OD1 . ASP A 216 ? 0.7540 0.9429 0.8384 0.0903  0.0016  -0.1035 285 ASP A OD1 
1619 O OD2 . ASP A 216 ? 0.8096 0.9790 0.8903 0.1038  -0.0049 -0.1009 285 ASP A OD2 
1620 N N   . GLY A 217 ? 0.6799 0.8075 0.7486 0.0532  -0.0033 -0.0931 286 GLY A N   
1621 C CA  . GLY A 217 ? 0.6093 0.7249 0.6735 0.0443  -0.0017 -0.0920 286 GLY A CA  
1622 C C   . GLY A 217 ? 0.4665 0.5581 0.5223 0.0457  -0.0037 -0.0907 286 GLY A C   
1623 O O   . GLY A 217 ? 0.4550 0.5379 0.5068 0.0542  -0.0049 -0.0920 286 GLY A O   
1624 N N   . CYS A 218 ? 0.3947 0.4755 0.4482 0.0374  -0.0042 -0.0879 287 CYS A N   
1625 C CA  . CYS A 218 ? 0.4330 0.4931 0.4792 0.0370  -0.0058 -0.0862 287 CYS A CA  
1626 C C   . CYS A 218 ? 0.4960 0.5512 0.5404 0.0277  -0.0039 -0.0845 287 CYS A C   
1627 O O   . CYS A 218 ? 0.4323 0.4989 0.4802 0.0226  -0.0011 -0.0848 287 CYS A O   
1628 C CB  . CYS A 218 ? 0.4990 0.5502 0.5444 0.0386  -0.0096 -0.0836 287 CYS A CB  
1629 S SG  . CYS A 218 ? 0.6467 0.7079 0.6981 0.0318  -0.0104 -0.0817 287 CYS A SG  
1630 N N   . LEU A 219 ? 0.4697 0.5084 0.5087 0.0255  -0.0054 -0.0821 288 LEU A N   
1631 C CA  . LEU A 219 ? 0.3748 0.4079 0.4118 0.0178  -0.0040 -0.0798 288 LEU A CA  
1632 C C   . LEU A 219 ? 0.3834 0.4114 0.4220 0.0127  -0.0054 -0.0766 288 LEU A C   
1633 O O   . LEU A 219 ? 0.4248 0.4487 0.4634 0.0155  -0.0080 -0.0758 288 LEU A O   
1634 C CB  . LEU A 219 ? 0.3277 0.3477 0.3575 0.0187  -0.0045 -0.0797 288 LEU A CB  
1635 C CG  . LEU A 219 ? 0.3998 0.4239 0.4268 0.0237  -0.0028 -0.0837 288 LEU A CG  
1636 C CD1 . LEU A 219 ? 0.4180 0.4317 0.4379 0.0215  -0.0027 -0.0836 288 LEU A CD1 
1637 C CD2 . LEU A 219 ? 0.2262 0.2684 0.2584 0.0222  0.0007  -0.0853 288 LEU A CD2 
1638 N N   . ALA A 220 ? 0.3047 0.3328 0.3443 0.0056  -0.0035 -0.0747 289 ALA A N   
1639 C CA  . ALA A 220 ? 0.2502 0.2729 0.2910 0.0010  -0.0043 -0.0721 289 ALA A CA  
1640 C C   . ALA A 220 ? 0.3554 0.3693 0.3932 -0.0038 -0.0032 -0.0691 289 ALA A C   
1641 O O   . ALA A 220 ? 0.3478 0.3656 0.3867 -0.0083 -0.0007 -0.0683 289 ALA A O   
1642 C CB  . ALA A 220 ? 0.1442 0.1777 0.1907 -0.0030 -0.0033 -0.0732 289 ALA A CB  
1643 N N   . LEU A 221 ? 0.3031 0.3056 0.3372 -0.0029 -0.0052 -0.0668 290 LEU A N   
1644 C CA  . LEU A 221 ? 0.2316 0.2266 0.2636 -0.0071 -0.0046 -0.0633 290 LEU A CA  
1645 C C   . LEU A 221 ? 0.2448 0.2387 0.2800 -0.0106 -0.0041 -0.0618 290 LEU A C   
1646 O O   . LEU A 221 ? 0.3033 0.2963 0.3395 -0.0090 -0.0056 -0.0624 290 LEU A O   
1647 C CB  . LEU A 221 ? 0.2097 0.1946 0.2370 -0.0050 -0.0070 -0.0615 290 LEU A CB  
1648 C CG  . LEU A 221 ? 0.2971 0.2755 0.3219 -0.0084 -0.0069 -0.0577 290 LEU A CG  
1649 C CD1 . LEU A 221 ? 0.3542 0.3358 0.3771 -0.0105 -0.0050 -0.0576 290 LEU A CD1 
1650 C CD2 . LEU A 221 ? 0.2767 0.2468 0.2973 -0.0066 -0.0097 -0.0564 290 LEU A CD2 
1651 N N   . VAL A 222 ? 0.3567 0.3507 0.3932 -0.0154 -0.0019 -0.0600 291 VAL A N   
1652 C CA  . VAL A 222 ? 0.3624 0.3529 0.4012 -0.0186 -0.0012 -0.0588 291 VAL A CA  
1653 C C   . VAL A 222 ? 0.3613 0.3426 0.3976 -0.0186 -0.0017 -0.0548 291 VAL A C   
1654 O O   . VAL A 222 ? 0.3322 0.3109 0.3673 -0.0207 -0.0006 -0.0517 291 VAL A O   
1655 C CB  . VAL A 222 ? 0.3632 0.3578 0.4050 -0.0237 0.0014  -0.0589 291 VAL A CB  
1656 C CG1 . VAL A 222 ? 0.2410 0.2318 0.2850 -0.0264 0.0018  -0.0594 291 VAL A CG1 
1657 C CG2 . VAL A 222 ? 0.3456 0.3521 0.3899 -0.0237 0.0021  -0.0622 291 VAL A CG2 
1658 N N   . ASP A 223 ? 0.4521 0.4295 0.4877 -0.0162 -0.0035 -0.0546 292 ASP A N   
1659 C CA  . ASP A 223 ? 0.3066 0.2776 0.3396 -0.0150 -0.0048 -0.0511 292 ASP A CA  
1660 C C   . ASP A 223 ? 0.3091 0.2765 0.3437 -0.0156 -0.0041 -0.0497 292 ASP A C   
1661 O O   . ASP A 223 ? 0.3349 0.3028 0.3699 -0.0139 -0.0050 -0.0512 292 ASP A O   
1662 C CB  . ASP A 223 ? 0.3869 0.3572 0.4174 -0.0115 -0.0075 -0.0518 292 ASP A CB  
1663 C CG  . ASP A 223 ? 0.5029 0.4677 0.5304 -0.0113 -0.0090 -0.0481 292 ASP A CG  
1664 O OD1 . ASP A 223 ? 0.4812 0.4440 0.5093 -0.0132 -0.0081 -0.0449 292 ASP A OD1 
1665 O OD2 . ASP A 223 ? 0.4159 0.3785 0.4406 -0.0094 -0.0113 -0.0483 292 ASP A OD2 
1666 N N   . THR A 224 ? 0.2203 0.1841 0.2555 -0.0175 -0.0024 -0.0467 293 THR A N   
1667 C CA  . THR A 224 ? 0.3105 0.2703 0.3472 -0.0173 -0.0014 -0.0459 293 THR A CA  
1668 C C   . THR A 224 ? 0.3528 0.3112 0.3883 -0.0146 -0.0028 -0.0435 293 THR A C   
1669 O O   . THR A 224 ? 0.3541 0.3105 0.3906 -0.0134 -0.0019 -0.0434 293 THR A O   
1670 C CB  . THR A 224 ? 0.2871 0.2427 0.3248 -0.0194 0.0008  -0.0429 293 THR A CB  
1671 O OG1 . THR A 224 ? 0.2699 0.2253 0.3059 -0.0193 0.0001  -0.0384 293 THR A OG1 
1672 C CG2 . THR A 224 ? 0.2961 0.2531 0.3352 -0.0231 0.0024  -0.0451 293 THR A CG2 
1673 N N   . GLY A 225 ? 0.2208 0.1801 0.2540 -0.0137 -0.0049 -0.0417 294 GLY A N   
1674 C CA  . GLY A 225 ? 0.2423 0.2012 0.2744 -0.0120 -0.0064 -0.0392 294 GLY A CA  
1675 C C   . GLY A 225 ? 0.3312 0.2920 0.3621 -0.0104 -0.0083 -0.0413 294 GLY A C   
1676 O O   . GLY A 225 ? 0.4058 0.3666 0.4356 -0.0095 -0.0097 -0.0389 294 GLY A O   
1677 N N   . ALA A 226 ? 0.2170 0.1799 0.2481 -0.0101 -0.0084 -0.0452 295 ALA A N   
1678 C CA  . ALA A 226 ? 0.2751 0.2402 0.3052 -0.0080 -0.0103 -0.0469 295 ALA A CA  
1679 C C   . ALA A 226 ? 0.2655 0.2333 0.2971 -0.0076 -0.0093 -0.0490 295 ALA A C   
1680 O O   . ALA A 226 ? 0.3853 0.3543 0.4189 -0.0090 -0.0075 -0.0519 295 ALA A O   
1681 C CB  . ALA A 226 ? 0.1402 0.1079 0.1700 -0.0072 -0.0111 -0.0500 295 ALA A CB  
1682 N N   . SER A 227 ? 0.2134 0.1822 0.2436 -0.0061 -0.0104 -0.0475 296 SER A N   
1683 C CA  . SER A 227 ? 0.1828 0.1547 0.2135 -0.0055 -0.0095 -0.0498 296 SER A CA  
1684 C C   . SER A 227 ? 0.2373 0.2142 0.2681 -0.0050 -0.0105 -0.0538 296 SER A C   
1685 O O   . SER A 227 ? 0.2844 0.2637 0.3165 -0.0062 -0.0092 -0.0577 296 SER A O   
1686 C CB  . SER A 227 ? 0.2070 0.1801 0.2359 -0.0041 -0.0102 -0.0466 296 SER A CB  
1687 O OG  . SER A 227 ? 0.4441 0.4144 0.4731 -0.0046 -0.0100 -0.0422 296 SER A OG  
1688 N N   . TYR A 228 ? 0.2426 0.2210 0.2720 -0.0032 -0.0130 -0.0529 297 TYR A N   
1689 C CA  . TYR A 228 ? 0.3056 0.2900 0.3356 -0.0019 -0.0143 -0.0559 297 TYR A CA  
1690 C C   . TYR A 228 ? 0.2894 0.2747 0.3211 -0.0020 -0.0142 -0.0577 297 TYR A C   
1691 O O   . TYR A 228 ? 0.3825 0.3631 0.4138 -0.0026 -0.0137 -0.0562 297 TYR A O   
1692 C CB  . TYR A 228 ? 0.1979 0.1836 0.2252 0.0011  -0.0172 -0.0534 297 TYR A CB  
1693 C CG  . TYR A 228 ? 0.3109 0.2981 0.3359 0.0014  -0.0175 -0.0512 297 TYR A CG  
1694 C CD1 . TYR A 228 ? 0.4017 0.3892 0.4272 -0.0003 -0.0152 -0.0521 297 TYR A CD1 
1695 C CD2 . TYR A 228 ? 0.3004 0.2888 0.3227 0.0037  -0.0201 -0.0481 297 TYR A CD2 
1696 C CE1 . TYR A 228 ? 0.4292 0.4194 0.4524 0.0004  -0.0152 -0.0504 297 TYR A CE1 
1697 C CE2 . TYR A 228 ? 0.3007 0.2917 0.3207 0.0037  -0.0203 -0.0456 297 TYR A CE2 
1698 C CZ  . TYR A 228 ? 0.3862 0.3788 0.4067 0.0021  -0.0177 -0.0470 297 TYR A CZ  
1699 O OH  . TYR A 228 ? 0.3426 0.3393 0.3607 0.0024  -0.0175 -0.0449 297 TYR A OH  
1700 N N   . ILE A 229 ? 0.2782 0.2710 0.3118 -0.0015 -0.0147 -0.0611 298 ILE A N   
1701 C CA  . ILE A 229 ? 0.1758 0.1719 0.2108 0.0002  -0.0153 -0.0623 298 ILE A CA  
1702 C C   . ILE A 229 ? 0.2465 0.2391 0.2786 0.0047  -0.0178 -0.0596 298 ILE A C   
1703 O O   . ILE A 229 ? 0.3257 0.3181 0.3557 0.0067  -0.0198 -0.0577 298 ILE A O   
1704 C CB  . ILE A 229 ? 0.2481 0.2552 0.2863 0.0000  -0.0155 -0.0662 298 ILE A CB  
1705 C CG1 . ILE A 229 ? 0.3084 0.3176 0.3493 -0.0054 -0.0130 -0.0691 298 ILE A CG1 
1706 C CG2 . ILE A 229 ? 0.1418 0.1542 0.1814 0.0036  -0.0165 -0.0671 298 ILE A CG2 
1707 C CD1 . ILE A 229 ? 0.2644 0.2841 0.3078 -0.0070 -0.0136 -0.0730 298 ILE A CD1 
1708 N N   . SER A 230 ? 0.2865 0.2757 0.3179 0.0062  -0.0178 -0.0595 299 SER A N   
1709 C CA  . SER A 230 ? 0.2812 0.2654 0.3094 0.0106  -0.0203 -0.0577 299 SER A CA  
1710 C C   . SER A 230 ? 0.2729 0.2611 0.3024 0.0143  -0.0203 -0.0605 299 SER A C   
1711 O O   . SER A 230 ? 0.3268 0.3198 0.3587 0.0126  -0.0181 -0.0631 299 SER A O   
1712 C CB  . SER A 230 ? 0.3305 0.3037 0.3549 0.0091  -0.0208 -0.0544 299 SER A CB  
1713 O OG  . SER A 230 ? 0.4723 0.4428 0.4962 0.0080  -0.0194 -0.0558 299 SER A OG  
1714 N N   . GLY A 231 ? 0.1967 0.1830 0.2243 0.0197  -0.0228 -0.0597 300 GLY A N   
1715 C CA  . GLY A 231 ? 0.2419 0.2299 0.2698 0.0248  -0.0230 -0.0621 300 GLY A CA  
1716 C C   . GLY A 231 ? 0.3533 0.3291 0.3761 0.0290  -0.0255 -0.0599 300 GLY A C   
1717 O O   . GLY A 231 ? 0.2821 0.2495 0.3017 0.0274  -0.0272 -0.0561 300 GLY A O   
1718 N N   . SER A 232 ? 0.3913 0.3663 0.4134 0.0345  -0.0256 -0.0624 301 SER A N   
1719 C CA  . SER A 232 ? 0.2599 0.2221 0.2769 0.0394  -0.0281 -0.0611 301 SER A CA  
1720 C C   . SER A 232 ? 0.3488 0.3099 0.3653 0.0424  -0.0311 -0.0570 301 SER A C   
1721 O O   . SER A 232 ? 0.3945 0.3677 0.4149 0.0429  -0.0312 -0.0566 301 SER A O   
1722 C CB  . SER A 232 ? 0.4253 0.3890 0.4424 0.0462  -0.0274 -0.0652 301 SER A CB  
1723 O OG  . SER A 232 ? 0.5249 0.4986 0.5457 0.0528  -0.0284 -0.0654 301 SER A OG  
1724 N N   . THR A 233 ? 0.3746 0.3210 0.3856 0.0439  -0.0336 -0.0538 302 THR A N   
1725 C CA  . THR A 233 ? 0.4100 0.3543 0.4197 0.0468  -0.0366 -0.0490 302 THR A CA  
1726 C C   . THR A 233 ? 0.4351 0.3892 0.4481 0.0549  -0.0375 -0.0502 302 THR A C   
1727 O O   . THR A 233 ? 0.4210 0.3840 0.4360 0.0560  -0.0389 -0.0475 302 THR A O   
1728 C CB  . THR A 233 ? 0.3918 0.3173 0.3949 0.0474  -0.0392 -0.0455 302 THR A CB  
1729 O OG1 . THR A 233 ? 0.3855 0.3037 0.3860 0.0396  -0.0385 -0.0445 302 THR A OG1 
1730 C CG2 . THR A 233 ? 0.4383 0.3618 0.4398 0.0493  -0.0422 -0.0394 302 THR A CG2 
1731 N N   . SER A 234 ? 0.5073 0.4608 0.5208 0.0609  -0.0367 -0.0542 303 SER A N   
1732 C CA  . SER A 234 ? 0.4959 0.4605 0.5133 0.0695  -0.0374 -0.0554 303 SER A CA  
1733 C C   . SER A 234 ? 0.5033 0.4889 0.5274 0.0669  -0.0361 -0.0568 303 SER A C   
1734 O O   . SER A 234 ? 0.3460 0.3410 0.3724 0.0698  -0.0381 -0.0542 303 SER A O   
1735 C CB  . SER A 234 ? 0.5505 0.5131 0.5677 0.0758  -0.0358 -0.0605 303 SER A CB  
1736 O OG  . SER A 234 ? 0.7020 0.6801 0.7247 0.0835  -0.0356 -0.0623 303 SER A OG  
1737 N N   . SER A 235 ? 0.5698 0.5628 0.5969 0.0609  -0.0329 -0.0606 304 SER A N   
1738 C CA  . SER A 235 ? 0.3830 0.3944 0.4162 0.0573  -0.0316 -0.0623 304 SER A CA  
1739 C C   . SER A 235 ? 0.4521 0.4657 0.4848 0.0531  -0.0333 -0.0588 304 SER A C   
1740 O O   . SER A 235 ? 0.5286 0.5557 0.5646 0.0546  -0.0346 -0.0585 304 SER A O   
1741 C CB  . SER A 235 ? 0.3409 0.3557 0.3761 0.0506  -0.0279 -0.0660 304 SER A CB  
1742 O OG  . SER A 235 ? 0.3988 0.4142 0.4344 0.0544  -0.0260 -0.0695 304 SER A OG  
1743 N N   . ILE A 236 ? 0.3711 0.3727 0.3996 0.0477  -0.0333 -0.0562 305 ILE A N   
1744 C CA  . ILE A 236 ? 0.2136 0.2180 0.2414 0.0432  -0.0342 -0.0534 305 ILE A CA  
1745 C C   . ILE A 236 ? 0.3103 0.3162 0.3363 0.0484  -0.0377 -0.0491 305 ILE A C   
1746 O O   . ILE A 236 ? 0.3141 0.3309 0.3415 0.0470  -0.0386 -0.0484 305 ILE A O   
1747 C CB  . ILE A 236 ? 0.2443 0.2365 0.2683 0.0371  -0.0332 -0.0513 305 ILE A CB  
1748 C CG1 . ILE A 236 ? 0.2720 0.2653 0.2982 0.0317  -0.0298 -0.0551 305 ILE A CG1 
1749 C CG2 . ILE A 236 ? 0.2614 0.2559 0.2839 0.0337  -0.0341 -0.0481 305 ILE A CG2 
1750 C CD1 . ILE A 236 ? 0.1753 0.1823 0.2063 0.0283  -0.0281 -0.0584 305 ILE A CD1 
1751 N N   . GLU A 237 ? 0.3426 0.3372 0.3651 0.0543  -0.0398 -0.0462 306 GLU A N   
1752 C CA  . GLU A 237 ? 0.3069 0.3024 0.3276 0.0599  -0.0433 -0.0414 306 GLU A CA  
1753 C C   . GLU A 237 ? 0.3942 0.4086 0.4203 0.0645  -0.0440 -0.0432 306 GLU A C   
1754 O O   . GLU A 237 ? 0.3887 0.4123 0.4148 0.0650  -0.0462 -0.0403 306 GLU A O   
1755 C CB  . GLU A 237 ? 0.2280 0.2069 0.2444 0.0662  -0.0452 -0.0385 306 GLU A CB  
1756 N N   . LYS A 238 ? 0.4395 0.4615 0.4702 0.0674  -0.0423 -0.0482 307 LYS A N   
1757 C CA  . LYS A 238 ? 0.4300 0.4723 0.4667 0.0711  -0.0429 -0.0502 307 LYS A CA  
1758 C C   . LYS A 238 ? 0.4068 0.4634 0.4467 0.0630  -0.0418 -0.0527 307 LYS A C   
1759 O O   . LYS A 238 ? 0.4393 0.5116 0.4819 0.0641  -0.0437 -0.0524 307 LYS A O   
1760 C CB  . LYS A 238 ? 0.3868 0.4343 0.4277 0.0759  -0.0409 -0.0548 307 LYS A CB  
1761 C CG  . LYS A 238 ? 0.5174 0.5567 0.5565 0.0868  -0.0426 -0.0529 307 LYS A CG  
1762 C CD  . LYS A 238 ? 0.6897 0.7303 0.7313 0.0906  -0.0397 -0.0582 307 LYS A CD  
1763 N N   . LEU A 239 ? 0.3992 0.4505 0.4385 0.0549  -0.0388 -0.0554 308 LEU A N   
1764 C CA  . LEU A 239 ? 0.3100 0.3722 0.3517 0.0472  -0.0376 -0.0582 308 LEU A CA  
1765 C C   . LEU A 239 ? 0.3380 0.4015 0.3762 0.0453  -0.0398 -0.0549 308 LEU A C   
1766 O O   . LEU A 239 ? 0.3568 0.4345 0.3971 0.0427  -0.0406 -0.0567 308 LEU A O   
1767 C CB  . LEU A 239 ? 0.2966 0.3506 0.3380 0.0399  -0.0340 -0.0609 308 LEU A CB  
1768 C CG  . LEU A 239 ? 0.3099 0.3686 0.3519 0.0317  -0.0326 -0.0633 308 LEU A CG  
1769 C CD1 . LEU A 239 ? 0.3892 0.4648 0.4369 0.0293  -0.0320 -0.0676 308 LEU A CD1 
1770 C CD2 . LEU A 239 ? 0.2612 0.3079 0.3016 0.0261  -0.0296 -0.0641 308 LEU A CD2 
1771 N N   . MET A 240 ? 0.3155 0.3647 0.3482 0.0463  -0.0409 -0.0501 309 MET A N   
1772 C CA  . MET A 240 ? 0.2988 0.3488 0.3274 0.0441  -0.0426 -0.0465 309 MET A CA  
1773 C C   . MET A 240 ? 0.4052 0.4655 0.4336 0.0501  -0.0463 -0.0430 309 MET A C   
1774 O O   . MET A 240 ? 0.3696 0.4398 0.3966 0.0479  -0.0476 -0.0423 309 MET A O   
1775 C CB  . MET A 240 ? 0.1796 0.2122 0.2028 0.0429  -0.0425 -0.0419 309 MET A CB  
1776 C CG  . MET A 240 ? 0.2490 0.2738 0.2718 0.0361  -0.0391 -0.0444 309 MET A CG  
1777 S SD  . MET A 240 ? 0.3821 0.4173 0.4063 0.0290  -0.0368 -0.0487 309 MET A SD  
1778 C CE  . MET A 240 ? 0.2462 0.2711 0.2715 0.0236  -0.0329 -0.0516 309 MET A CE  
1779 N N   . GLU A 241 ? 0.4142 0.4725 0.4436 0.0581  -0.0481 -0.0409 310 GLU A N   
1780 C CA  . GLU A 241 ? 0.3323 0.4019 0.3624 0.0648  -0.0518 -0.0374 310 GLU A CA  
1781 C C   . GLU A 241 ? 0.4104 0.5023 0.4459 0.0629  -0.0520 -0.0420 310 GLU A C   
1782 O O   . GLU A 241 ? 0.4456 0.5499 0.4802 0.0631  -0.0546 -0.0400 310 GLU A O   
1783 C CB  . GLU A 241 ? 0.4956 0.5585 0.5264 0.0745  -0.0532 -0.0350 310 GLU A CB  
1784 C CG  . GLU A 241 ? 0.6698 0.7393 0.6998 0.0827  -0.0574 -0.0292 310 GLU A CG  
1785 C CD  . GLU A 241 ? 0.8353 0.8938 0.8650 0.0929  -0.0587 -0.0266 310 GLU A CD  
1786 O OE1 . GLU A 241 ? 0.8653 0.9095 0.8942 0.0930  -0.0564 -0.0294 310 GLU A OE1 
1787 O OE2 . GLU A 241 ? 0.8858 0.9502 0.9158 0.1012  -0.0621 -0.0220 310 GLU A OE2 
1788 N N   . ALA A 242 ? 0.4009 0.4987 0.4418 0.0603  -0.0493 -0.0480 311 ALA A N   
1789 C CA  . ALA A 242 ? 0.2849 0.4037 0.3313 0.0570  -0.0493 -0.0526 311 ALA A CA  
1790 C C   . ALA A 242 ? 0.3572 0.4799 0.4009 0.0483  -0.0490 -0.0547 311 ALA A C   
1791 O O   . ALA A 242 ? 0.4686 0.6083 0.5138 0.0466  -0.0510 -0.0563 311 ALA A O   
1792 C CB  . ALA A 242 ? 0.2129 0.3354 0.2650 0.0549  -0.0461 -0.0582 311 ALA A CB  
1793 N N   . LEU A 243 ? 0.3478 0.4555 0.3874 0.0430  -0.0466 -0.0550 312 LEU A N   
1794 C CA  . LEU A 243 ? 0.3605 0.4702 0.3969 0.0359  -0.0459 -0.0570 312 LEU A CA  
1795 C C   . LEU A 243 ? 0.3898 0.5004 0.4204 0.0381  -0.0488 -0.0518 312 LEU A C   
1796 O O   . LEU A 243 ? 0.3970 0.5129 0.4246 0.0331  -0.0486 -0.0537 312 LEU A O   
1797 C CB  . LEU A 243 ? 0.2775 0.3719 0.3120 0.0302  -0.0421 -0.0589 312 LEU A CB  
1798 C CG  . LEU A 243 ? 0.2961 0.3896 0.3354 0.0260  -0.0389 -0.0643 312 LEU A CG  
1799 C CD1 . LEU A 243 ? 0.1770 0.2567 0.2137 0.0205  -0.0356 -0.0654 312 LEU A CD1 
1800 C CD2 . LEU A 243 ? 0.2860 0.3965 0.3295 0.0218  -0.0392 -0.0696 312 LEU A CD2 
1801 N N   . GLY A 244 ? 0.2708 0.3763 0.2994 0.0453  -0.0513 -0.0452 313 GLY A N   
1802 C CA  . GLY A 244 ? 0.4083 0.5138 0.4310 0.0471  -0.0539 -0.0391 313 GLY A CA  
1803 C C   . GLY A 244 ? 0.4392 0.5313 0.4564 0.0426  -0.0519 -0.0370 313 GLY A C   
1804 O O   . GLY A 244 ? 0.5393 0.6358 0.5517 0.0409  -0.0530 -0.0343 313 GLY A O   
1805 N N   . ALA A 245 ? 0.3705 0.4476 0.3882 0.0407  -0.0491 -0.0380 314 ALA A N   
1806 C CA  . ALA A 245 ? 0.4056 0.4712 0.4193 0.0361  -0.0469 -0.0364 314 ALA A CA  
1807 C C   . ALA A 245 ? 0.4117 0.4637 0.4212 0.0395  -0.0485 -0.0285 314 ALA A C   
1808 O O   . ALA A 245 ? 0.5709 0.6157 0.5816 0.0446  -0.0499 -0.0263 314 ALA A O   
1809 C CB  . ALA A 245 ? 0.3719 0.4297 0.3885 0.0316  -0.0430 -0.0417 314 ALA A CB  
1810 N N   . LYS A 246 ? 0.4712 0.5198 0.4759 0.0365  -0.0482 -0.0244 315 LYS A N   
1811 C CA  . LYS A 246 ? 0.5119 0.5474 0.5123 0.0379  -0.0496 -0.0165 315 LYS A CA  
1812 C C   . LYS A 246 ? 0.5675 0.5894 0.5679 0.0335  -0.0468 -0.0172 315 LYS A C   
1813 O O   . LYS A 246 ? 0.6213 0.6456 0.6235 0.0289  -0.0436 -0.0223 315 LYS A O   
1814 C CB  . LYS A 246 ? 0.5620 0.6034 0.5569 0.0369  -0.0512 -0.0105 315 LYS A CB  
1815 C CG  . LYS A 246 ? 0.6934 0.7449 0.6870 0.0424  -0.0551 -0.0066 315 LYS A CG  
1816 C CD  . LYS A 246 ? 0.8285 0.8673 0.8201 0.0480  -0.0582 0.0011  315 LYS A CD  
1817 C CE  . LYS A 246 ? 0.8506 0.8990 0.8433 0.0554  -0.0620 0.0035  315 LYS A CE  
1818 N NZ  . LYS A 246 ? 0.7852 0.8407 0.7845 0.0587  -0.0615 -0.0038 315 LYS A NZ  
1819 N N   . LYS A 247 ? 0.4937 0.5012 0.4919 0.0349  -0.0481 -0.0121 316 LYS A N   
1820 C CA  . LYS A 247 ? 0.4606 0.4555 0.4584 0.0306  -0.0460 -0.0120 316 LYS A CA  
1821 C C   . LYS A 247 ? 0.4575 0.4480 0.4505 0.0269  -0.0465 -0.0049 316 LYS A C   
1822 O O   . LYS A 247 ? 0.3558 0.3442 0.3450 0.0290  -0.0493 0.0019  316 LYS A O   
1823 C CB  . LYS A 247 ? 0.3633 0.3444 0.3617 0.0338  -0.0470 -0.0123 316 LYS A CB  
1824 C CG  . LYS A 247 ? 0.4424 0.4097 0.4391 0.0293  -0.0459 -0.0110 316 LYS A CG  
1825 C CD  . LYS A 247 ? 0.6786 0.6423 0.6789 0.0290  -0.0437 -0.0175 316 LYS A CD  
1826 C CE  . LYS A 247 ? 0.8436 0.7960 0.8424 0.0238  -0.0426 -0.0166 316 LYS A CE  
1827 N NZ  . LYS A 247 ? 0.8098 0.7688 0.8097 0.0181  -0.0400 -0.0168 316 LYS A NZ  
1828 N N   . ARG A 248 ? 0.4092 0.3993 0.4028 0.0215  -0.0436 -0.0061 317 ARG A N   
1829 C CA  . ARG A 248 ? 0.4289 0.4150 0.4189 0.0172  -0.0435 0.0003  317 ARG A CA  
1830 C C   . ARG A 248 ? 0.4273 0.3997 0.4179 0.0141  -0.0430 0.0007  317 ARG A C   
1831 O O   . ARG A 248 ? 0.5235 0.4889 0.5163 0.0160  -0.0430 -0.0035 317 ARG A O   
1832 C CB  . ARG A 248 ? 0.4725 0.4715 0.4625 0.0139  -0.0407 -0.0011 317 ARG A CB  
1833 C CG  . ARG A 248 ? 0.5254 0.5383 0.5148 0.0167  -0.0412 -0.0036 317 ARG A CG  
1834 C CD  . ARG A 248 ? 0.5211 0.5458 0.5086 0.0138  -0.0389 -0.0040 317 ARG A CD  
1835 N NE  . ARG A 248 ? 0.5662 0.5913 0.5570 0.0111  -0.0350 -0.0099 317 ARG A NE  
1836 C CZ  . ARG A 248 ? 0.4962 0.5311 0.4863 0.0096  -0.0321 -0.0133 317 ARG A CZ  
1837 N NH1 . ARG A 248 ? 0.4696 0.5029 0.4628 0.0078  -0.0287 -0.0183 317 ARG A NH1 
1838 N NH2 . ARG A 248 ? 0.2720 0.3181 0.2580 0.0101  -0.0327 -0.0116 317 ARG A NH2 
1839 N N   . LEU A 249 ? 0.5070 0.4766 0.4954 0.0091  -0.0426 0.0059  318 LEU A N   
1840 C CA  . LEU A 249 ? 0.4307 0.3886 0.4194 0.0053  -0.0424 0.0067  318 LEU A CA  
1841 C C   . LEU A 249 ? 0.4736 0.4328 0.4669 0.0049  -0.0396 -0.0008 318 LEU A C   
1842 O O   . LEU A 249 ? 0.4002 0.3495 0.3940 0.0054  -0.0402 -0.0034 318 LEU A O   
1843 C CB  . LEU A 249 ? 0.4099 0.3694 0.3967 -0.0006 -0.0419 0.0131  318 LEU A CB  
1844 C CG  . LEU A 249 ? 0.3529 0.3030 0.3399 -0.0059 -0.0419 0.0146  318 LEU A CG  
1845 C CD1 . LEU A 249 ? 0.3344 0.2675 0.3177 -0.0059 -0.0456 0.0177  318 LEU A CD1 
1846 C CD2 . LEU A 249 ? 0.3542 0.3121 0.3409 -0.0116 -0.0407 0.0203  318 LEU A CD2 
1847 N N   . PHE A 250 ? 0.5791 0.5499 0.5751 0.0043  -0.0366 -0.0045 319 PHE A N   
1848 C CA  . PHE A 250 ? 0.5585 0.5304 0.5587 0.0035  -0.0338 -0.0107 319 PHE A CA  
1849 C C   . PHE A 250 ? 0.4812 0.4572 0.4840 0.0074  -0.0333 -0.0173 319 PHE A C   
1850 O O   . PHE A 250 ? 0.5909 0.5613 0.5955 0.0085  -0.0332 -0.0209 319 PHE A O   
1851 C CB  . PHE A 250 ? 0.5854 0.5664 0.5872 0.0008  -0.0306 -0.0111 319 PHE A CB  
1852 C CG  . PHE A 250 ? 0.5797 0.5587 0.5803 -0.0036 -0.0306 -0.0051 319 PHE A CG  
1853 C CD1 . PHE A 250 ? 0.6366 0.6048 0.6364 -0.0062 -0.0325 -0.0024 319 PHE A CD1 
1854 C CD2 . PHE A 250 ? 0.5582 0.5473 0.5586 -0.0052 -0.0287 -0.0026 319 PHE A CD2 
1855 C CE1 . PHE A 250 ? 0.6178 0.5855 0.6169 -0.0111 -0.0327 0.0031  319 PHE A CE1 
1856 C CE2 . PHE A 250 ? 0.6526 0.6422 0.6527 -0.0094 -0.0285 0.0032  319 PHE A CE2 
1857 C CZ  . PHE A 250 ? 0.6395 0.6186 0.6392 -0.0127 -0.0307 0.0062  319 PHE A CZ  
1858 N N   . ASP A 251 ? 0.4579 0.4443 0.4607 0.0092  -0.0329 -0.0191 320 ASP A N   
1859 C CA  . ASP A 251 ? 0.3650 0.3580 0.3709 0.0110  -0.0317 -0.0259 320 ASP A CA  
1860 C C   . ASP A 251 ? 0.3503 0.3475 0.3556 0.0153  -0.0344 -0.0261 320 ASP A C   
1861 O O   . ASP A 251 ? 0.4200 0.4150 0.4222 0.0174  -0.0372 -0.0207 320 ASP A O   
1862 C CB  . ASP A 251 ? 0.3922 0.3946 0.3989 0.0091  -0.0289 -0.0292 320 ASP A CB  
1863 C CG  . ASP A 251 ? 0.5470 0.5560 0.5498 0.0087  -0.0293 -0.0249 320 ASP A CG  
1864 O OD1 . ASP A 251 ? 0.6348 0.6397 0.6348 0.0083  -0.0312 -0.0181 320 ASP A OD1 
1865 O OD2 . ASP A 251 ? 0.5415 0.5598 0.5439 0.0084  -0.0277 -0.0283 320 ASP A OD2 
1866 N N   . TYR A 252 ? 0.2753 0.2791 0.2840 0.0165  -0.0336 -0.0322 321 TYR A N   
1867 C CA  . TYR A 252 ? 0.3290 0.3419 0.3379 0.0201  -0.0358 -0.0333 321 TYR A CA  
1868 C C   . TYR A 252 ? 0.3767 0.4018 0.3851 0.0181  -0.0347 -0.0363 321 TYR A C   
1869 O O   . TYR A 252 ? 0.4407 0.4674 0.4510 0.0149  -0.0318 -0.0413 321 TYR A O   
1870 C CB  . TYR A 252 ? 0.3055 0.3197 0.3187 0.0224  -0.0357 -0.0380 321 TYR A CB  
1871 C CG  . TYR A 252 ? 0.3246 0.3290 0.3376 0.0263  -0.0375 -0.0355 321 TYR A CG  
1872 C CD1 . TYR A 252 ? 0.2979 0.3030 0.3094 0.0318  -0.0407 -0.0320 321 TYR A CD1 
1873 C CD2 . TYR A 252 ? 0.3438 0.3383 0.3577 0.0248  -0.0359 -0.0369 321 TYR A CD2 
1874 C CE1 . TYR A 252 ? 0.3690 0.3637 0.3798 0.0360  -0.0422 -0.0303 321 TYR A CE1 
1875 C CE2 . TYR A 252 ? 0.3745 0.3594 0.3874 0.0284  -0.0373 -0.0355 321 TYR A CE2 
1876 C CZ  . TYR A 252 ? 0.3848 0.3693 0.3962 0.0342  -0.0404 -0.0325 321 TYR A CZ  
1877 O OH  . TYR A 252 ? 0.3964 0.3699 0.4062 0.0384  -0.0417 -0.0317 321 TYR A OH  
1878 N N   . VAL A 253 ? 0.3427 0.3758 0.3481 0.0202  -0.0371 -0.0333 322 VAL A N   
1879 C CA  . VAL A 253 ? 0.2949 0.3397 0.2983 0.0183  -0.0364 -0.0359 322 VAL A CA  
1880 C C   . VAL A 253 ? 0.3766 0.4338 0.3805 0.0207  -0.0391 -0.0380 322 VAL A C   
1881 O O   . VAL A 253 ? 0.3357 0.3932 0.3406 0.0251  -0.0420 -0.0350 322 VAL A O   
1882 C CB  . VAL A 253 ? 0.3427 0.3885 0.3408 0.0174  -0.0366 -0.0300 322 VAL A CB  
1883 C CG1 . VAL A 253 ? 0.2437 0.2814 0.2418 0.0142  -0.0335 -0.0290 322 VAL A CG1 
1884 C CG2 . VAL A 253 ? 0.2740 0.3167 0.2692 0.0208  -0.0403 -0.0217 322 VAL A CG2 
1885 N N   . VAL A 254 ? 0.3162 0.3841 0.3195 0.0181  -0.0381 -0.0435 323 VAL A N   
1886 C CA  . VAL A 254 ? 0.2947 0.3772 0.2968 0.0193  -0.0408 -0.0450 323 VAL A CA  
1887 C C   . VAL A 254 ? 0.3791 0.4691 0.3759 0.0167  -0.0398 -0.0461 323 VAL A C   
1888 O O   . VAL A 254 ? 0.3743 0.4589 0.3697 0.0138  -0.0365 -0.0479 323 VAL A O   
1889 C CB  . VAL A 254 ? 0.3078 0.3979 0.3149 0.0179  -0.0408 -0.0524 323 VAL A CB  
1890 C CG1 . VAL A 254 ? 0.3131 0.3984 0.3254 0.0212  -0.0416 -0.0512 323 VAL A CG1 
1891 C CG2 . VAL A 254 ? 0.2516 0.3385 0.2597 0.0123  -0.0370 -0.0598 323 VAL A CG2 
1892 N N   . LYS A 255 ? 0.4050 0.5084 0.3986 0.0180  -0.0427 -0.0452 324 LYS A N   
1893 C CA  . LYS A 255 ? 0.3763 0.4888 0.3645 0.0153  -0.0417 -0.0478 324 LYS A CA  
1894 C C   . LYS A 255 ? 0.4712 0.5849 0.4609 0.0108  -0.0388 -0.0583 324 LYS A C   
1895 O O   . LYS A 255 ? 0.5633 0.6797 0.5575 0.0095  -0.0395 -0.0634 324 LYS A O   
1896 C CB  . LYS A 255 ? 0.3636 0.4914 0.3478 0.0175  -0.0457 -0.0449 324 LYS A CB  
1897 C CG  . LYS A 255 ? 0.5312 0.6562 0.5136 0.0222  -0.0487 -0.0339 324 LYS A CG  
1898 C CD  . LYS A 255 ? 0.7708 0.9086 0.7531 0.0262  -0.0535 -0.0308 324 LYS A CD  
1899 C CE  . LYS A 255 ? 0.8546 1.0105 0.8344 0.0234  -0.0546 -0.0373 324 LYS A CE  
1900 N NZ  . LYS A 255 ? 0.7847 0.9533 0.7674 0.0269  -0.0590 -0.0366 324 LYS A NZ  
1901 N N   . CYS A 256 ? 0.3791 0.4903 0.3653 0.0084  -0.0354 -0.0612 325 CYS A N   
1902 C CA  . CYS A 256 ? 0.3650 0.4728 0.3524 0.0044  -0.0322 -0.0707 325 CYS A CA  
1903 C C   . CYS A 256 ? 0.4794 0.5991 0.4660 0.0015  -0.0340 -0.0783 325 CYS A C   
1904 O O   . CYS A 256 ? 0.5035 0.6197 0.4934 -0.0021 -0.0326 -0.0855 325 CYS A O   
1905 C CB  . CYS A 256 ? 0.3755 0.4801 0.3586 0.0036  -0.0284 -0.0721 325 CYS A CB  
1906 S SG  . CYS A 256 ? 0.4558 0.5472 0.4409 0.0057  -0.0260 -0.0640 325 CYS A SG  
1907 N N   . ASN A 257 ? 0.4039 0.5380 0.3861 0.0026  -0.0372 -0.0766 326 ASN A N   
1908 C CA  . ASN A 257 ? 0.4423 0.5893 0.4236 -0.0006 -0.0394 -0.0837 326 ASN A CA  
1909 C C   . ASN A 257 ? 0.4006 0.5503 0.3892 -0.0008 -0.0420 -0.0841 326 ASN A C   
1910 O O   . ASN A 257 ? 0.3857 0.5420 0.3760 -0.0052 -0.0427 -0.0916 326 ASN A O   
1911 C CB  . ASN A 257 ? 0.4859 0.6490 0.4606 0.0008  -0.0427 -0.0808 326 ASN A CB  
1912 C CG  . ASN A 257 ? 0.4688 0.6377 0.4453 0.0059  -0.0469 -0.0710 326 ASN A CG  
1913 O OD1 . ASN A 257 ? 0.6020 0.7614 0.5793 0.0097  -0.0465 -0.0627 326 ASN A OD1 
1914 N ND2 . ASN A 257 ? 0.3667 0.5509 0.3437 0.0062  -0.0511 -0.0717 326 ASN A ND2 
1915 N N   . GLU A 258 ? 0.4388 0.5836 0.4316 0.0038  -0.0432 -0.0764 327 GLU A N   
1916 C CA  . GLU A 258 ? 0.3730 0.5218 0.3727 0.0050  -0.0455 -0.0761 327 GLU A CA  
1917 C C   . GLU A 258 ? 0.4214 0.5580 0.4272 0.0025  -0.0424 -0.0797 327 GLU A C   
1918 O O   . GLU A 258 ? 0.4053 0.5457 0.4170 0.0030  -0.0436 -0.0802 327 GLU A O   
1919 C CB  . GLU A 258 ? 0.4153 0.5647 0.4160 0.0120  -0.0485 -0.0663 327 GLU A CB  
1920 C CG  . GLU A 258 ? 0.6369 0.8018 0.6331 0.0148  -0.0526 -0.0621 327 GLU A CG  
1921 C CD  . GLU A 258 ? 0.7483 0.9140 0.7466 0.0220  -0.0560 -0.0531 327 GLU A CD  
1922 O OE1 . GLU A 258 ? 0.7465 0.8982 0.7440 0.0252  -0.0551 -0.0467 327 GLU A OE1 
1923 O OE2 . GLU A 258 ? 0.7825 0.9628 0.7832 0.0245  -0.0598 -0.0525 327 GLU A OE2 
1924 N N   . GLY A 259 ? 0.4235 0.5465 0.4278 0.0002  -0.0384 -0.0819 328 GLY A N   
1925 C CA  . GLY A 259 ? 0.3240 0.4347 0.3334 -0.0019 -0.0354 -0.0842 328 GLY A CA  
1926 C C   . GLY A 259 ? 0.4377 0.5532 0.4513 -0.0071 -0.0353 -0.0914 328 GLY A C   
1927 O O   . GLY A 259 ? 0.4480 0.5629 0.4676 -0.0068 -0.0354 -0.0906 328 GLY A O   
1928 N N   . PRO A 260 ? 0.3496 0.4701 0.3602 -0.0123 -0.0349 -0.0987 329 PRO A N   
1929 C CA  . PRO A 260 ? 0.3566 0.4805 0.3711 -0.0187 -0.0348 -0.1057 329 PRO A CA  
1930 C C   . PRO A 260 ? 0.4041 0.5446 0.4235 -0.0185 -0.0386 -0.1049 329 PRO A C   
1931 O O   . PRO A 260 ? 0.3075 0.4511 0.3320 -0.0234 -0.0383 -0.1089 329 PRO A O   
1932 C CB  . PRO A 260 ? 0.3419 0.4673 0.3505 -0.0238 -0.0341 -0.1136 329 PRO A CB  
1933 C CG  . PRO A 260 ? 0.3586 0.4754 0.3613 -0.0200 -0.0319 -0.1111 329 PRO A CG  
1934 C CD  . PRO A 260 ? 0.2595 0.3796 0.2627 -0.0132 -0.0338 -0.1015 329 PRO A CD  
1935 N N   . THR A 261 ? 0.5020 0.6540 0.5201 -0.0130 -0.0421 -0.0996 330 THR A N   
1936 C CA  . THR A 261 ? 0.4093 0.5781 0.4325 -0.0111 -0.0458 -0.0979 330 THR A CA  
1937 C C   . THR A 261 ? 0.4137 0.5778 0.4432 -0.0059 -0.0453 -0.0925 330 THR A C   
1938 O O   . THR A 261 ? 0.3770 0.5545 0.4117 -0.0035 -0.0479 -0.0911 330 THR A O   
1939 C CB  . THR A 261 ? 0.4037 0.5865 0.4225 -0.0067 -0.0499 -0.0939 330 THR A CB  
1940 O OG1 . THR A 261 ? 0.5068 0.6913 0.5183 -0.0110 -0.0496 -0.0987 330 THR A OG1 
1941 C CG2 . THR A 261 ? 0.5707 0.7746 0.5942 -0.0062 -0.0541 -0.0940 330 THR A CG2 
1942 N N   . LEU A 262 ? 0.4820 0.6282 0.5111 -0.0040 -0.0421 -0.0897 331 LEU A N   
1943 C CA  . LEU A 262 ? 0.4386 0.5793 0.4725 0.0010  -0.0416 -0.0850 331 LEU A CA  
1944 C C   . LEU A 262 ? 0.3834 0.5277 0.4241 -0.0032 -0.0402 -0.0892 331 LEU A C   
1945 O O   . LEU A 262 ? 0.4024 0.5426 0.4432 -0.0106 -0.0378 -0.0948 331 LEU A O   
1946 C CB  . LEU A 262 ? 0.4321 0.5535 0.4632 0.0032  -0.0388 -0.0812 331 LEU A CB  
1947 C CG  . LEU A 262 ? 0.4256 0.5433 0.4510 0.0081  -0.0403 -0.0751 331 LEU A CG  
1948 C CD1 . LEU A 262 ? 0.4807 0.5806 0.5047 0.0095  -0.0377 -0.0714 331 LEU A CD1 
1949 C CD2 . LEU A 262 ? 0.1695 0.2971 0.1959 0.0149  -0.0443 -0.0696 331 LEU A CD2 
1950 N N   . PRO A 263 ? 0.3478 0.4991 0.3939 0.0014  -0.0413 -0.0865 332 PRO A N   
1951 C CA  . PRO A 263 ? 0.1631 0.3209 0.2159 -0.0028 -0.0399 -0.0902 332 PRO A CA  
1952 C C   . PRO A 263 ? 0.2964 0.4374 0.3497 -0.0060 -0.0356 -0.0911 332 PRO A C   
1953 O O   . PRO A 263 ? 0.3480 0.4731 0.3977 -0.0032 -0.0340 -0.0880 332 PRO A O   
1954 C CB  . PRO A 263 ? 0.2262 0.3948 0.2838 0.0052  -0.0419 -0.0861 332 PRO A CB  
1955 C CG  . PRO A 263 ? 0.2720 0.4291 0.3250 0.0134  -0.0429 -0.0799 332 PRO A CG  
1956 C CD  . PRO A 263 ? 0.3350 0.4871 0.3811 0.0109  -0.0436 -0.0798 332 PRO A CD  
1957 N N   . ASP A 264 ? 0.3094 0.4551 0.3674 -0.0124 -0.0339 -0.0952 333 ASP A N   
1958 C CA  . ASP A 264 ? 0.3312 0.4630 0.3902 -0.0157 -0.0300 -0.0956 333 ASP A CA  
1959 C C   . ASP A 264 ? 0.3359 0.4630 0.3968 -0.0085 -0.0291 -0.0909 333 ASP A C   
1960 O O   . ASP A 264 ? 0.3094 0.4463 0.3725 -0.0017 -0.0313 -0.0884 333 ASP A O   
1961 C CB  . ASP A 264 ? 0.3095 0.4489 0.3733 -0.0244 -0.0286 -0.1002 333 ASP A CB  
1962 C CG  . ASP A 264 ? 0.3802 0.5194 0.4413 -0.0327 -0.0290 -0.1056 333 ASP A CG  
1963 O OD1 . ASP A 264 ? 0.5617 0.6942 0.6168 -0.0313 -0.0297 -0.1061 333 ASP A OD1 
1964 O OD2 . ASP A 264 ? 0.3830 0.5284 0.4475 -0.0408 -0.0283 -0.1096 333 ASP A OD2 
1965 N N   . ILE A 265 ? 0.3894 0.5011 0.4490 -0.0099 -0.0260 -0.0900 334 ILE A N   
1966 C CA  . ILE A 265 ? 0.3681 0.4743 0.4290 -0.0048 -0.0247 -0.0867 334 ILE A CA  
1967 C C   . ILE A 265 ? 0.2935 0.3982 0.3577 -0.0108 -0.0214 -0.0886 334 ILE A C   
1968 O O   . ILE A 265 ? 0.2848 0.3794 0.3473 -0.0170 -0.0192 -0.0900 334 ILE A O   
1969 C CB  . ILE A 265 ? 0.3509 0.4400 0.4063 -0.0005 -0.0243 -0.0827 334 ILE A CB  
1970 C CG1 . ILE A 265 ? 0.3554 0.4469 0.4075 0.0054  -0.0277 -0.0799 334 ILE A CG1 
1971 C CG2 . ILE A 265 ? 0.2380 0.3200 0.2940 0.0032  -0.0227 -0.0804 334 ILE A CG2 
1972 C CD1 . ILE A 265 ? 0.3931 0.4693 0.4396 0.0077  -0.0276 -0.0761 334 ILE A CD1 
1973 N N   . SER A 266 ? 0.2912 0.4064 0.3602 -0.0087 -0.0208 -0.0885 335 SER A N   
1974 C CA  . SER A 266 ? 0.3659 0.4832 0.4384 -0.0147 -0.0178 -0.0900 335 SER A CA  
1975 C C   . SER A 266 ? 0.2622 0.3739 0.3345 -0.0097 -0.0158 -0.0874 335 SER A C   
1976 O O   . SER A 266 ? 0.2175 0.3341 0.2903 -0.0016 -0.0171 -0.0861 335 SER A O   
1977 C CB  . SER A 266 ? 0.3960 0.5343 0.4749 -0.0185 -0.0184 -0.0928 335 SER A CB  
1978 O OG  . SER A 266 ? 0.4681 0.6087 0.5469 -0.0268 -0.0192 -0.0961 335 SER A OG  
1979 N N   . PHE A 267 ? 0.2310 0.3321 0.3020 -0.0143 -0.0128 -0.0868 336 PHE A N   
1980 C CA  . PHE A 267 ? 0.2239 0.3205 0.2942 -0.0110 -0.0107 -0.0849 336 PHE A CA  
1981 C C   . PHE A 267 ? 0.3488 0.4567 0.4239 -0.0164 -0.0081 -0.0862 336 PHE A C   
1982 O O   . PHE A 267 ? 0.4022 0.5087 0.4784 -0.0251 -0.0066 -0.0870 336 PHE A O   
1983 C CB  . PHE A 267 ? 0.1426 0.2199 0.2076 -0.0120 -0.0095 -0.0825 336 PHE A CB  
1984 C CG  . PHE A 267 ? 0.1397 0.2067 0.2002 -0.0079 -0.0118 -0.0809 336 PHE A CG  
1985 C CD1 . PHE A 267 ? 0.2214 0.2840 0.2804 -0.0118 -0.0125 -0.0817 336 PHE A CD1 
1986 C CD2 . PHE A 267 ? 0.3354 0.3972 0.3930 -0.0005 -0.0132 -0.0788 336 PHE A CD2 
1987 C CE1 . PHE A 267 ? 0.2007 0.2556 0.2556 -0.0083 -0.0143 -0.0800 336 PHE A CE1 
1988 C CE2 . PHE A 267 ? 0.3429 0.3957 0.3964 0.0024  -0.0153 -0.0767 336 PHE A CE2 
1989 C CZ  . PHE A 267 ? 0.2567 0.3071 0.3091 -0.0014 -0.0158 -0.0772 336 PHE A CZ  
1990 N N   . HIS A 268 ? 0.3656 0.4843 0.4433 -0.0112 -0.0074 -0.0863 337 HIS A N   
1991 C CA  . HIS A 268 ? 0.3144 0.4478 0.3972 -0.0156 -0.0048 -0.0873 337 HIS A CA  
1992 C C   . HIS A 268 ? 0.3594 0.4837 0.4393 -0.0168 -0.0016 -0.0854 337 HIS A C   
1993 O O   . HIS A 268 ? 0.2964 0.4191 0.3741 -0.0097 -0.0010 -0.0850 337 HIS A O   
1994 C CB  . HIS A 268 ? 0.4527 0.6057 0.5404 -0.0087 -0.0057 -0.0887 337 HIS A CB  
1995 C CG  . HIS A 268 ? 0.6910 0.8558 0.7821 -0.0085 -0.0090 -0.0901 337 HIS A CG  
1996 N ND1 . HIS A 268 ? 0.6916 0.8727 0.7883 -0.0163 -0.0091 -0.0920 337 HIS A ND1 
1997 C CD2 . HIS A 268 ? 0.6532 0.8156 0.7424 -0.0022 -0.0125 -0.0897 337 HIS A CD2 
1998 C CE1 . HIS A 268 ? 0.6560 0.8451 0.7542 -0.0145 -0.0126 -0.0931 337 HIS A CE1 
1999 N NE2 . HIS A 268 ? 0.6492 0.8273 0.7427 -0.0058 -0.0147 -0.0915 337 HIS A NE2 
2000 N N   . LEU A 269 ? 0.2957 0.4134 0.3751 -0.0258 0.0003  -0.0844 338 LEU A N   
2001 C CA  . LEU A 269 ? 0.2220 0.3309 0.2982 -0.0281 0.0032  -0.0819 338 LEU A CA  
2002 C C   . LEU A 269 ? 0.3842 0.5039 0.4646 -0.0369 0.0060  -0.0815 338 LEU A C   
2003 O O   . LEU A 269 ? 0.3677 0.4895 0.4508 -0.0447 0.0057  -0.0822 338 LEU A O   
2004 C CB  . LEU A 269 ? 0.3588 0.4471 0.4299 -0.0304 0.0029  -0.0796 338 LEU A CB  
2005 C CG  . LEU A 269 ? 0.3940 0.4719 0.4612 -0.0234 0.0000  -0.0796 338 LEU A CG  
2006 C CD1 . LEU A 269 ? 0.3049 0.3668 0.3688 -0.0270 -0.0003 -0.0780 338 LEU A CD1 
2007 C CD2 . LEU A 269 ? 0.3348 0.4088 0.3985 -0.0161 0.0001  -0.0786 338 LEU A CD2 
2008 N N   . GLY A 270 ? 0.3848 0.5111 0.4652 -0.0360 0.0087  -0.0803 339 GLY A N   
2009 C CA  . GLY A 270 ? 0.3158 0.4525 0.3996 -0.0446 0.0118  -0.0790 339 GLY A CA  
2010 C C   . GLY A 270 ? 0.3600 0.5155 0.4510 -0.0494 0.0113  -0.0812 339 GLY A C   
2011 O O   . GLY A 270 ? 0.4766 0.6342 0.5700 -0.0598 0.0125  -0.0802 339 GLY A O   
2012 N N   . GLY A 271 ? 0.4447 0.6135 0.5390 -0.0423 0.0094  -0.0841 340 GLY A N   
2013 C CA  . GLY A 271 ? 0.4634 0.6524 0.5649 -0.0464 0.0085  -0.0862 340 GLY A CA  
2014 C C   . GLY A 271 ? 0.5189 0.7023 0.6210 -0.0535 0.0059  -0.0876 340 GLY A C   
2015 O O   . GLY A 271 ? 0.5688 0.7687 0.6767 -0.0593 0.0051  -0.0893 340 GLY A O   
2016 N N   . LYS A 272 ? 0.4834 0.6449 0.5797 -0.0535 0.0046  -0.0870 341 LYS A N   
2017 C CA  . LYS A 272 ? 0.4363 0.5913 0.5321 -0.0592 0.0023  -0.0891 341 LYS A CA  
2018 C C   . LYS A 272 ? 0.4242 0.5709 0.5163 -0.0506 -0.0009 -0.0902 341 LYS A C   
2019 O O   . LYS A 272 ? 0.5530 0.6911 0.6414 -0.0421 -0.0010 -0.0886 341 LYS A O   
2020 C CB  . LYS A 272 ? 0.4953 0.6317 0.5876 -0.0681 0.0040  -0.0874 341 LYS A CB  
2021 C CG  . LYS A 272 ? 0.5720 0.7156 0.6677 -0.0781 0.0069  -0.0856 341 LYS A CG  
2022 C CD  . LYS A 272 ? 0.5975 0.7231 0.6903 -0.0878 0.0079  -0.0845 341 LYS A CD  
2023 C CE  . LYS A 272 ? 0.5591 0.6922 0.6554 -0.0987 0.0106  -0.0822 341 LYS A CE  
2024 N NZ  . LYS A 272 ? 0.5642 0.6760 0.6565 -0.1061 0.0122  -0.0793 341 LYS A NZ  
2025 N N   . GLU A 273 ? 0.3869 0.5367 0.4799 -0.0534 -0.0036 -0.0930 342 GLU A N   
2026 C CA  . GLU A 273 ? 0.3528 0.4980 0.4426 -0.0463 -0.0069 -0.0940 342 GLU A CA  
2027 C C   . GLU A 273 ? 0.3529 0.4764 0.4367 -0.0492 -0.0069 -0.0940 342 GLU A C   
2028 O O   . GLU A 273 ? 0.3750 0.4950 0.4587 -0.0577 -0.0069 -0.0964 342 GLU A O   
2029 C CB  . GLU A 273 ? 0.3564 0.5204 0.4506 -0.0475 -0.0099 -0.0971 342 GLU A CB  
2030 C CG  . GLU A 273 ? 0.6586 0.8272 0.7516 -0.0374 -0.0133 -0.0970 342 GLU A CG  
2031 C CD  . GLU A 273 ? 0.8804 1.0650 0.9762 -0.0403 -0.0167 -0.1000 342 GLU A CD  
2032 O OE1 . GLU A 273 ? 0.8979 1.0805 0.9932 -0.0501 -0.0170 -0.1029 342 GLU A OE1 
2033 O OE2 . GLU A 273 ? 0.9115 1.1104 1.0098 -0.0327 -0.0192 -0.0994 342 GLU A OE2 
2034 N N   . TYR A 274 ? 0.2687 0.3777 0.3477 -0.0422 -0.0068 -0.0916 343 TYR A N   
2035 C CA  . TYR A 274 ? 0.3469 0.4368 0.4205 -0.0434 -0.0067 -0.0912 343 TYR A CA  
2036 C C   . TYR A 274 ? 0.3851 0.4749 0.4560 -0.0379 -0.0099 -0.0923 343 TYR A C   
2037 O O   . TYR A 274 ? 0.3540 0.4418 0.4228 -0.0297 -0.0111 -0.0900 343 TYR A O   
2038 C CB  . TYR A 274 ? 0.3743 0.4495 0.4444 -0.0405 -0.0046 -0.0873 343 TYR A CB  
2039 C CG  . TYR A 274 ? 0.2885 0.3610 0.3600 -0.0472 -0.0015 -0.0858 343 TYR A CG  
2040 C CD1 . TYR A 274 ? 0.2436 0.3290 0.3188 -0.0479 0.0000  -0.0850 343 TYR A CD1 
2041 C CD2 . TYR A 274 ? 0.2884 0.3461 0.3575 -0.0528 0.0001  -0.0850 343 TYR A CD2 
2042 C CE1 . TYR A 274 ? 0.3016 0.3856 0.3779 -0.0546 0.0029  -0.0830 343 TYR A CE1 
2043 C CE2 . TYR A 274 ? 0.2764 0.3312 0.3466 -0.0591 0.0028  -0.0827 343 TYR A CE2 
2044 C CZ  . TYR A 274 ? 0.2373 0.3056 0.3109 -0.0603 0.0042  -0.0816 343 TYR A CZ  
2045 O OH  . TYR A 274 ? 0.4235 0.4900 0.4979 -0.0670 0.0070  -0.0788 343 TYR A OH  
2046 N N   . THR A 275 ? 0.4581 0.5496 0.5285 -0.0427 -0.0112 -0.0958 344 THR A N   
2047 C CA  . THR A 275 ? 0.3424 0.4386 0.4107 -0.0385 -0.0144 -0.0972 344 THR A CA  
2048 C C   . THR A 275 ? 0.2374 0.3175 0.2997 -0.0377 -0.0142 -0.0972 344 THR A C   
2049 O O   . THR A 275 ? 0.2961 0.3650 0.3566 -0.0435 -0.0123 -0.0989 344 THR A O   
2050 C CB  . THR A 275 ? 0.3496 0.4614 0.4209 -0.0443 -0.0164 -0.1016 344 THR A CB  
2051 O OG1 . THR A 275 ? 0.3829 0.5122 0.4606 -0.0447 -0.0165 -0.1012 344 THR A OG1 
2052 C CG2 . THR A 275 ? 0.3442 0.4622 0.4128 -0.0398 -0.0199 -0.1026 344 THR A CG2 
2053 N N   . LEU A 276 ? 0.2004 0.2794 0.2596 -0.0305 -0.0162 -0.0952 345 LEU A N   
2054 C CA  . LEU A 276 ? 0.3104 0.3782 0.3641 -0.0292 -0.0163 -0.0952 345 LEU A CA  
2055 C C   . LEU A 276 ? 0.2749 0.3535 0.3269 -0.0270 -0.0196 -0.0969 345 LEU A C   
2056 O O   . LEU A 276 ? 0.1839 0.2707 0.2365 -0.0209 -0.0219 -0.0941 345 LEU A O   
2057 C CB  . LEU A 276 ? 0.2799 0.3359 0.3308 -0.0231 -0.0155 -0.0902 345 LEU A CB  
2058 C CG  . LEU A 276 ? 0.3686 0.4136 0.4202 -0.0246 -0.0125 -0.0879 345 LEU A CG  
2059 C CD1 . LEU A 276 ? 0.2682 0.3027 0.3164 -0.0192 -0.0124 -0.0833 345 LEU A CD1 
2060 C CD2 . LEU A 276 ? 0.4208 0.4573 0.4720 -0.0314 -0.0101 -0.0904 345 LEU A CD2 
2061 N N   . THR A 277 ? 0.2676 0.3456 0.3170 -0.0318 -0.0198 -0.1014 346 THR A N   
2062 C CA  . THR A 277 ? 0.3406 0.4286 0.3872 -0.0303 -0.0228 -0.1031 346 THR A CA  
2063 C C   . THR A 277 ? 0.4130 0.4928 0.4541 -0.0244 -0.0230 -0.0998 346 THR A C   
2064 O O   . THR A 277 ? 0.3196 0.3856 0.3591 -0.0226 -0.0206 -0.0971 346 THR A O   
2065 C CB  . THR A 277 ? 0.3643 0.4546 0.4093 -0.0381 -0.0229 -0.1100 346 THR A CB  
2066 O OG1 . THR A 277 ? 0.3969 0.4705 0.4374 -0.0398 -0.0202 -0.1118 346 THR A OG1 
2067 C CG2 . THR A 277 ? 0.1729 0.2693 0.2233 -0.0454 -0.0223 -0.1129 346 THR A CG2 
2068 N N   . SER A 278 ? 0.3604 0.4502 0.3988 -0.0215 -0.0259 -0.0996 347 SER A N   
2069 C CA  . SER A 278 ? 0.2554 0.3395 0.2886 -0.0165 -0.0262 -0.0959 347 SER A CA  
2070 C C   . SER A 278 ? 0.4018 0.4732 0.4309 -0.0191 -0.0232 -0.0985 347 SER A C   
2071 O O   . SER A 278 ? 0.4128 0.4761 0.4389 -0.0153 -0.0222 -0.0947 347 SER A O   
2072 C CB  . SER A 278 ? 0.2796 0.3777 0.3100 -0.0142 -0.0298 -0.0957 347 SER A CB  
2073 O OG  . SER A 278 ? 0.3045 0.4095 0.3331 -0.0201 -0.0303 -0.1026 347 SER A OG  
2074 N N   . ALA A 279 ? 0.4034 0.4729 0.4324 -0.0255 -0.0218 -0.1050 348 ALA A N   
2075 C CA  . ALA A 279 ? 0.4894 0.5455 0.5149 -0.0273 -0.0187 -0.1078 348 ALA A CA  
2076 C C   . ALA A 279 ? 0.4880 0.5300 0.5158 -0.0261 -0.0157 -0.1040 348 ALA A C   
2077 O O   . ALA A 279 ? 0.4604 0.4912 0.4856 -0.0254 -0.0131 -0.1043 348 ALA A O   
2078 C CB  . ALA A 279 ? 0.4714 0.5269 0.4959 -0.0345 -0.0180 -0.1155 348 ALA A CB  
2079 N N   . ASP A 280 ? 0.4941 0.5374 0.5267 -0.0256 -0.0160 -0.1005 349 ASP A N   
2080 C CA  . ASP A 280 ? 0.2789 0.3105 0.3134 -0.0247 -0.0135 -0.0966 349 ASP A CA  
2081 C C   . ASP A 280 ? 0.2040 0.2330 0.2375 -0.0183 -0.0141 -0.0901 349 ASP A C   
2082 O O   . ASP A 280 ? 0.3237 0.3421 0.3568 -0.0171 -0.0120 -0.0871 349 ASP A O   
2083 C CB  . ASP A 280 ? 0.3695 0.4040 0.4092 -0.0280 -0.0132 -0.0966 349 ASP A CB  
2084 C CG  . ASP A 280 ? 0.4869 0.5200 0.5278 -0.0357 -0.0120 -0.1022 349 ASP A CG  
2085 O OD1 . ASP A 280 ? 0.5204 0.5424 0.5584 -0.0377 -0.0099 -0.1044 349 ASP A OD1 
2086 O OD2 . ASP A 280 ? 0.4902 0.5333 0.5350 -0.0395 -0.0130 -0.1039 349 ASP A OD2 
2087 N N   . TYR A 281 ? 0.2243 0.2625 0.2573 -0.0145 -0.0170 -0.0876 350 TYR A N   
2088 C CA  . TYR A 281 ? 0.2904 0.3251 0.3226 -0.0092 -0.0179 -0.0814 350 TYR A CA  
2089 C C   . TYR A 281 ? 0.3018 0.3384 0.3296 -0.0056 -0.0194 -0.0784 350 TYR A C   
2090 O O   . TYR A 281 ? 0.3343 0.3679 0.3612 -0.0017 -0.0206 -0.0730 350 TYR A O   
2091 C CB  . TYR A 281 ? 0.1932 0.2343 0.2289 -0.0069 -0.0197 -0.0796 350 TYR A CB  
2092 C CG  . TYR A 281 ? 0.3268 0.3820 0.3632 -0.0050 -0.0229 -0.0806 350 TYR A CG  
2093 C CD1 . TYR A 281 ? 0.3449 0.4034 0.3782 -0.0003 -0.0255 -0.0769 350 TYR A CD1 
2094 C CD2 . TYR A 281 ? 0.4651 0.5310 0.5055 -0.0080 -0.0235 -0.0845 350 TYR A CD2 
2095 C CE1 . TYR A 281 ? 0.3939 0.4657 0.4279 0.0021  -0.0287 -0.0770 350 TYR A CE1 
2096 C CE2 . TYR A 281 ? 0.2687 0.3493 0.3104 -0.0060 -0.0266 -0.0850 350 TYR A CE2 
2097 C CZ  . TYR A 281 ? 0.3153 0.3986 0.3536 -0.0006 -0.0293 -0.0812 350 TYR A CZ  
2098 O OH  . TYR A 281 ? 0.2391 0.3372 0.2786 0.0021  -0.0326 -0.0809 350 TYR A OH  
2099 N N   . VAL A 282 ? 0.2894 0.3302 0.3141 -0.0070 -0.0194 -0.0817 351 VAL A N   
2100 C CA  . VAL A 282 ? 0.3728 0.4169 0.3928 -0.0039 -0.0207 -0.0787 351 VAL A CA  
2101 C C   . VAL A 282 ? 0.3432 0.3813 0.3601 -0.0050 -0.0177 -0.0805 351 VAL A C   
2102 O O   . VAL A 282 ? 0.2676 0.3044 0.2842 -0.0083 -0.0159 -0.0866 351 VAL A O   
2103 C CB  . VAL A 282 ? 0.3939 0.4518 0.4122 -0.0038 -0.0237 -0.0808 351 VAL A CB  
2104 C CG1 . VAL A 282 ? 0.3357 0.3974 0.3485 -0.0010 -0.0247 -0.0773 351 VAL A CG1 
2105 C CG2 . VAL A 282 ? 0.3986 0.4633 0.4203 -0.0015 -0.0265 -0.0786 351 VAL A CG2 
2106 N N   . PHE A 283 ? 0.2525 0.2870 0.2673 -0.0021 -0.0172 -0.0751 352 PHE A N   
2107 C CA  . PHE A 283 ? 0.2515 0.2829 0.2633 -0.0020 -0.0144 -0.0761 352 PHE A CA  
2108 C C   . PHE A 283 ? 0.3549 0.3964 0.3618 -0.0017 -0.0153 -0.0789 352 PHE A C   
2109 O O   . PHE A 283 ? 0.3483 0.3959 0.3522 0.0005  -0.0170 -0.0741 352 PHE A O   
2110 C CB  . PHE A 283 ? 0.1948 0.2215 0.2064 0.0005  -0.0137 -0.0690 352 PHE A CB  
2111 C CG  . PHE A 283 ? 0.3025 0.3193 0.3180 0.0000  -0.0125 -0.0668 352 PHE A CG  
2112 C CD1 . PHE A 283 ? 0.2571 0.2670 0.2741 -0.0010 -0.0093 -0.0694 352 PHE A CD1 
2113 C CD2 . PHE A 283 ? 0.3566 0.3710 0.3738 0.0008  -0.0147 -0.0621 352 PHE A CD2 
2114 C CE1 . PHE A 283 ? 0.3895 0.3915 0.4099 -0.0015 -0.0084 -0.0668 352 PHE A CE1 
2115 C CE2 . PHE A 283 ? 0.5210 0.5273 0.5412 0.0002  -0.0136 -0.0603 352 PHE A CE2 
2116 C CZ  . PHE A 283 ? 0.4687 0.4694 0.4904 -0.0011 -0.0106 -0.0624 352 PHE A CZ  
2117 N N   . GLN A 284 ? 0.3809 0.4239 0.3866 -0.0045 -0.0141 -0.0866 353 GLN A N   
2118 C CA  . GLN A 284 ? 0.3718 0.4257 0.3726 -0.0050 -0.0154 -0.0905 353 GLN A CA  
2119 C C   . GLN A 284 ? 0.4747 0.5279 0.4706 -0.0036 -0.0124 -0.0925 353 GLN A C   
2120 O O   . GLN A 284 ? 0.4831 0.5340 0.4768 -0.0054 -0.0102 -0.1000 353 GLN A O   
2121 C CB  . GLN A 284 ? 0.3658 0.4225 0.3675 -0.0095 -0.0163 -0.0983 353 GLN A CB  
2122 C CG  . GLN A 284 ? 0.5300 0.6012 0.5282 -0.0104 -0.0196 -0.1008 353 GLN A CG  
2123 C CD  . GLN A 284 ? 0.4756 0.5557 0.4763 -0.0082 -0.0235 -0.0946 353 GLN A CD  
2124 O OE1 . GLN A 284 ? 0.4574 0.5458 0.4547 -0.0052 -0.0257 -0.0901 353 GLN A OE1 
2125 N NE2 . GLN A 284 ? 0.2807 0.3593 0.2873 -0.0094 -0.0245 -0.0944 353 GLN A NE2 
2126 N N   . GLU A 285 ? 0.4269 0.4822 0.4213 -0.0003 -0.0122 -0.0855 354 GLU A N   
2127 C CA  . GLU A 285 ? 0.5097 0.5663 0.5000 0.0016  -0.0091 -0.0862 354 GLU A CA  
2128 C C   . GLU A 285 ? 0.4741 0.5425 0.4579 0.0013  -0.0097 -0.0910 354 GLU A C   
2129 O O   . GLU A 285 ? 0.4583 0.5268 0.4383 0.0020  -0.0065 -0.0965 354 GLU A O   
2130 C CB  . GLU A 285 ? 0.4355 0.4927 0.4264 0.0043  -0.0089 -0.0768 354 GLU A CB  
2131 N N   . SER A 286 ? 0.4044 0.4828 0.3865 0.0006  -0.0136 -0.0890 355 SER A N   
2132 C CA  . SER A 286 ? 0.2835 0.3747 0.2590 0.0000  -0.0149 -0.0928 355 SER A CA  
2133 C C   . SER A 286 ? 0.3835 0.4818 0.3602 -0.0023 -0.0193 -0.0943 355 SER A C   
2134 O O   . SER A 286 ? 0.4830 0.5764 0.4656 -0.0029 -0.0209 -0.0921 355 SER A O   
2135 C CB  . SER A 286 ? 0.2447 0.3450 0.2157 0.0028  -0.0152 -0.0854 355 SER A CB  
2136 O OG  . SER A 286 ? 0.3532 0.4675 0.3193 0.0024  -0.0186 -0.0849 355 SER A OG  
2137 N N   . TYR A 287 ? 0.2741 0.3853 0.2451 -0.0035 -0.0212 -0.0982 356 TYR A N   
2138 C CA  . TYR A 287 ? 0.2752 0.3970 0.2471 -0.0050 -0.0259 -0.0981 356 TYR A CA  
2139 C C   . TYR A 287 ? 0.3511 0.4873 0.3177 -0.0025 -0.0289 -0.0919 356 TYR A C   
2140 O O   . TYR A 287 ? 0.4693 0.6183 0.4341 -0.0036 -0.0327 -0.0933 356 TYR A O   
2141 C CB  . TYR A 287 ? 0.2710 0.3958 0.2417 -0.0100 -0.0262 -0.1092 356 TYR A CB  
2142 C CG  . TYR A 287 ? 0.3229 0.4332 0.2993 -0.0129 -0.0237 -0.1141 356 TYR A CG  
2143 C CD1 . TYR A 287 ? 0.3556 0.4643 0.3390 -0.0146 -0.0257 -0.1126 356 TYR A CD1 
2144 C CD2 . TYR A 287 ? 0.5043 0.6026 0.4790 -0.0134 -0.0192 -0.1194 356 TYR A CD2 
2145 C CE1 . TYR A 287 ? 0.3525 0.4484 0.3407 -0.0175 -0.0234 -0.1163 356 TYR A CE1 
2146 C CE2 . TYR A 287 ? 0.5422 0.6265 0.5218 -0.0159 -0.0170 -0.1229 356 TYR A CE2 
2147 C CZ  . TYR A 287 ? 0.4247 0.5080 0.4109 -0.0183 -0.0191 -0.1211 356 TYR A CZ  
2148 O OH  . TYR A 287 ? 0.4341 0.5042 0.4249 -0.0212 -0.0169 -0.1239 356 TYR A OH  
2149 N N   . SER A 288 ? 0.3278 0.4628 0.2921 0.0007  -0.0275 -0.0844 357 SER A N   
2150 C CA  . SER A 288 ? 0.4088 0.5565 0.3674 0.0028  -0.0300 -0.0775 357 SER A CA  
2151 C C   . SER A 288 ? 0.4690 0.6181 0.4312 0.0053  -0.0345 -0.0683 357 SER A C   
2152 O O   . SER A 288 ? 0.4850 0.6223 0.4528 0.0067  -0.0342 -0.0635 357 SER A O   
2153 C CB  . SER A 288 ? 0.4370 0.5829 0.3920 0.0046  -0.0266 -0.0726 357 SER A CB  
2154 O OG  . SER A 288 ? 0.5715 0.7279 0.5219 0.0064  -0.0292 -0.0636 357 SER A OG  
2155 N N   . SER A 289 ? 0.4756 0.6391 0.4341 0.0061  -0.0385 -0.0658 358 SER A N   
2156 C CA  . SER A 289 ? 0.4103 0.5757 0.3713 0.0096  -0.0429 -0.0565 358 SER A CA  
2157 C C   . SER A 289 ? 0.4412 0.6005 0.4005 0.0124  -0.0427 -0.0452 358 SER A C   
2158 O O   . SER A 289 ? 0.4517 0.6058 0.4142 0.0155  -0.0455 -0.0375 358 SER A O   
2159 C CB  . SER A 289 ? 0.4018 0.5856 0.3591 0.0100  -0.0474 -0.0564 358 SER A CB  
2160 O OG  . SER A 289 ? 0.5014 0.6965 0.4500 0.0089  -0.0468 -0.0571 358 SER A OG  
2161 N N   . LYS A 290 ? 0.4010 0.5610 0.3553 0.0114  -0.0395 -0.0441 359 LYS A N   
2162 C CA  . LYS A 290 ? 0.5423 0.6968 0.4952 0.0127  -0.0389 -0.0335 359 LYS A CA  
2163 C C   . LYS A 290 ? 0.5747 0.7138 0.5323 0.0118  -0.0350 -0.0340 359 LYS A C   
2164 O O   . LYS A 290 ? 0.6173 0.7545 0.5728 0.0113  -0.0328 -0.0285 359 LYS A O   
2165 C CB  . LYS A 290 ? 0.6761 0.8435 0.6206 0.0121  -0.0380 -0.0305 359 LYS A CB  
2166 C CG  . LYS A 290 ? 0.8154 0.9905 0.7557 0.0100  -0.0343 -0.0413 359 LYS A CG  
2167 C CD  . LYS A 290 ? 0.9076 1.1012 0.8388 0.0097  -0.0354 -0.0406 359 LYS A CD  
2168 C CE  . LYS A 290 ? 0.9329 1.1309 0.8597 0.0108  -0.0360 -0.0278 359 LYS A CE  
2169 N NZ  . LYS A 290 ? 0.8672 1.0578 0.7952 0.0100  -0.0313 -0.0248 359 LYS A NZ  
2170 N N   . LYS A 291 ? 0.5140 0.6433 0.4780 0.0113  -0.0341 -0.0400 360 LYS A N   
2171 C CA  . LYS A 291 ? 0.5356 0.6506 0.5044 0.0105  -0.0309 -0.0402 360 LYS A CA  
2172 C C   . LYS A 291 ? 0.6061 0.7111 0.5816 0.0112  -0.0325 -0.0413 360 LYS A C   
2173 O O   . LYS A 291 ? 0.7094 0.8190 0.6867 0.0113  -0.0345 -0.0462 360 LYS A O   
2174 C CB  . LYS A 291 ? 0.5324 0.6467 0.5009 0.0086  -0.0262 -0.0490 360 LYS A CB  
2175 C CG  . LYS A 291 ? 0.6520 0.7730 0.6152 0.0086  -0.0232 -0.0471 360 LYS A CG  
2176 C CD  . LYS A 291 ? 0.7255 0.8443 0.6887 0.0079  -0.0183 -0.0563 360 LYS A CD  
2177 C CE  . LYS A 291 ? 0.7260 0.8568 0.6822 0.0085  -0.0157 -0.0576 360 LYS A CE  
2178 N NZ  . LYS A 291 ? 0.6648 0.7937 0.6201 0.0086  -0.0113 -0.0682 360 LYS A NZ  
2179 N N   . LEU A 292 ? 0.4385 0.5307 0.4176 0.0114  -0.0316 -0.0369 361 LEU A N   
2180 C CA  . LEU A 292 ? 0.3823 0.4646 0.3673 0.0123  -0.0328 -0.0373 361 LEU A CA  
2181 C C   . LEU A 292 ? 0.3820 0.4555 0.3713 0.0102  -0.0291 -0.0434 361 LEU A C   
2182 O O   . LEU A 292 ? 0.5013 0.5713 0.4899 0.0090  -0.0260 -0.0430 361 LEU A O   
2183 C CB  . LEU A 292 ? 0.4106 0.4839 0.3959 0.0141  -0.0349 -0.0280 361 LEU A CB  
2184 C CG  . LEU A 292 ? 0.3407 0.4205 0.3214 0.0164  -0.0386 -0.0205 361 LEU A CG  
2185 C CD1 . LEU A 292 ? 0.2600 0.3294 0.2395 0.0166  -0.0397 -0.0109 361 LEU A CD1 
2186 C CD2 . LEU A 292 ? 0.2918 0.3764 0.2744 0.0197  -0.0422 -0.0218 361 LEU A CD2 
2187 N N   . CYS A 293 ? 0.3271 0.3978 0.3209 0.0099  -0.0295 -0.0485 362 CYS A N   
2188 C CA  . CYS A 293 ? 0.3365 0.3995 0.3342 0.0077  -0.0263 -0.0545 362 CYS A CA  
2189 C C   . CYS A 293 ? 0.4088 0.4619 0.4114 0.0084  -0.0269 -0.0523 362 CYS A C   
2190 O O   . CYS A 293 ? 0.4141 0.4686 0.4182 0.0104  -0.0298 -0.0506 362 CYS A O   
2191 C CB  . CYS A 293 ? 0.4538 0.5232 0.4520 0.0054  -0.0258 -0.0634 362 CYS A CB  
2192 S SG  . CYS A 293 ? 0.6019 0.6772 0.5948 0.0036  -0.0229 -0.0695 362 CYS A SG  
2193 N N   . THR A 294 ? 0.4385 0.4819 0.4433 0.0070  -0.0241 -0.0525 363 THR A N   
2194 C CA  . THR A 294 ? 0.2332 0.2669 0.2417 0.0074  -0.0244 -0.0503 363 THR A CA  
2195 C C   . THR A 294 ? 0.3009 0.3343 0.3136 0.0063  -0.0240 -0.0561 363 THR A C   
2196 O O   . THR A 294 ? 0.2765 0.3114 0.2902 0.0038  -0.0219 -0.0620 363 THR A O   
2197 C CB  . THR A 294 ? 0.2366 0.2619 0.2457 0.0061  -0.0217 -0.0481 363 THR A CB  
2198 O OG1 . THR A 294 ? 0.2608 0.2872 0.2665 0.0066  -0.0222 -0.0418 363 THR A OG1 
2199 C CG2 . THR A 294 ? 0.2054 0.2213 0.2178 0.0059  -0.0219 -0.0466 363 THR A CG2 
2200 N N   . LEU A 295 ? 0.1578 0.1890 0.1728 0.0082  -0.0259 -0.0544 364 LEU A N   
2201 C CA  . LEU A 295 ? 0.3203 0.3506 0.3397 0.0070  -0.0251 -0.0588 364 LEU A CA  
2202 C C   . LEU A 295 ? 0.2332 0.2525 0.2544 0.0058  -0.0230 -0.0576 364 LEU A C   
2203 O O   . LEU A 295 ? 0.2866 0.2992 0.3064 0.0072  -0.0236 -0.0526 364 LEU A O   
2204 C CB  . LEU A 295 ? 0.2592 0.2945 0.2805 0.0104  -0.0280 -0.0579 364 LEU A CB  
2205 C CG  . LEU A 295 ? 0.2966 0.3424 0.3158 0.0132  -0.0312 -0.0564 364 LEU A CG  
2206 C CD1 . LEU A 295 ? 0.2597 0.3112 0.2821 0.0167  -0.0335 -0.0566 364 LEU A CD1 
2207 C CD2 . LEU A 295 ? 0.3940 0.4496 0.4118 0.0101  -0.0307 -0.0610 364 LEU A CD2 
2208 N N   . ALA A 296 ? 0.2926 0.3102 0.3167 0.0028  -0.0206 -0.0621 365 ALA A N   
2209 C CA  . ALA A 296 ? 0.2538 0.2622 0.2796 0.0015  -0.0185 -0.0609 365 ALA A CA  
2210 C C   . ALA A 296 ? 0.3355 0.3420 0.3634 0.0029  -0.0195 -0.0602 365 ALA A C   
2211 O O   . ALA A 296 ? 0.3393 0.3435 0.3699 0.0008  -0.0177 -0.0622 365 ALA A O   
2212 C CB  . ALA A 296 ? 0.1896 0.1959 0.2172 -0.0020 -0.0155 -0.0652 365 ALA A CB  
2213 N N   . ILE A 297 ? 0.3255 0.3327 0.3519 0.0065  -0.0222 -0.0572 366 ILE A N   
2214 C CA  . ILE A 297 ? 0.2875 0.2932 0.3153 0.0091  -0.0233 -0.0568 366 ILE A CA  
2215 C C   . ILE A 297 ? 0.3060 0.3048 0.3302 0.0123  -0.0256 -0.0517 366 ILE A C   
2216 O O   . ILE A 297 ? 0.2046 0.2051 0.2262 0.0136  -0.0273 -0.0487 366 ILE A O   
2217 C CB  . ILE A 297 ? 0.2864 0.3031 0.3169 0.0111  -0.0245 -0.0600 366 ILE A CB  
2218 C CG1 . ILE A 297 ? 0.2899 0.3128 0.3242 0.0067  -0.0223 -0.0651 366 ILE A CG1 
2219 C CG2 . ILE A 297 ? 0.2087 0.2246 0.2402 0.0154  -0.0258 -0.0593 366 ILE A CG2 
2220 C CD1 . ILE A 297 ? 0.1467 0.1825 0.1827 0.0065  -0.0237 -0.0683 366 ILE A CD1 
2221 N N   . HIS A 298 ? 0.3159 0.3067 0.3396 0.0132  -0.0256 -0.0506 367 HIS A N   
2222 C CA  . HIS A 298 ? 0.3842 0.3668 0.4041 0.0159  -0.0281 -0.0461 367 HIS A CA  
2223 C C   . HIS A 298 ? 0.3448 0.3210 0.3646 0.0179  -0.0283 -0.0474 367 HIS A C   
2224 O O   . HIS A 298 ? 0.2746 0.2535 0.2971 0.0170  -0.0263 -0.0510 367 HIS A O   
2225 C CB  . HIS A 298 ? 0.5681 0.5445 0.5852 0.0127  -0.0280 -0.0418 367 HIS A CB  
2226 C CG  . HIS A 298 ? 0.9570 0.9276 0.9746 0.0092  -0.0261 -0.0421 367 HIS A CG  
2227 N ND1 . HIS A 298 ? 1.0746 1.0395 1.0900 0.0064  -0.0263 -0.0380 367 HIS A ND1 
2228 C CD2 . HIS A 298 ? 1.0661 1.0368 1.0861 0.0078  -0.0240 -0.0455 367 HIS A CD2 
2229 C CE1 . HIS A 298 ? 1.1033 1.0653 1.1198 0.0038  -0.0246 -0.0389 367 HIS A CE1 
2230 N NE2 . HIS A 298 ? 1.0603 1.0252 1.0793 0.0047  -0.0232 -0.0433 367 HIS A NE2 
2231 N N   . ALA A 299 ? 0.1695 0.1369 0.1856 0.0208  -0.0307 -0.0442 368 ALA A N   
2232 C CA  . ALA A 299 ? 0.2563 0.2164 0.2711 0.0234  -0.0311 -0.0458 368 ALA A CA  
2233 C C   . ALA A 299 ? 0.3873 0.3376 0.3995 0.0191  -0.0304 -0.0448 368 ALA A C   
2234 O O   . ALA A 299 ? 0.4765 0.4218 0.4864 0.0157  -0.0312 -0.0407 368 ALA A O   
2235 C CB  . ALA A 299 ? 0.2352 0.1890 0.2469 0.0291  -0.0342 -0.0434 368 ALA A CB  
2236 N N   . MET A 300 ? 0.3559 0.3050 0.3686 0.0189  -0.0288 -0.0483 369 MET A N   
2237 C CA  . MET A 300 ? 0.3331 0.2732 0.3427 0.0153  -0.0287 -0.0476 369 MET A CA  
2238 C C   . MET A 300 ? 0.4427 0.3794 0.4507 0.0185  -0.0283 -0.0517 369 MET A C   
2239 O O   . MET A 300 ? 0.4215 0.3664 0.4326 0.0193  -0.0260 -0.0554 369 MET A O   
2240 C CB  . MET A 300 ? 0.4027 0.3474 0.4147 0.0099  -0.0262 -0.0474 369 MET A CB  
2241 C CG  . MET A 300 ? 0.5599 0.4974 0.5690 0.0061  -0.0263 -0.0463 369 MET A CG  
2242 S SD  . MET A 300 ? 0.5730 0.5151 0.5848 0.0005  -0.0241 -0.0439 369 MET A SD  
2243 C CE  . MET A 300 ? 0.5362 0.4863 0.5519 0.0006  -0.0208 -0.0482 369 MET A CE  
2244 N N   . ASP A 301 ? 0.4469 0.3715 0.4498 0.0201  -0.0306 -0.0512 370 ASP A N   
2245 C CA  . ASP A 301 ? 0.3107 0.2306 0.3110 0.0237  -0.0303 -0.0556 370 ASP A CA  
2246 C C   . ASP A 301 ? 0.3672 0.2846 0.3652 0.0185  -0.0290 -0.0570 370 ASP A C   
2247 O O   . ASP A 301 ? 0.3954 0.3031 0.3892 0.0145  -0.0307 -0.0548 370 ASP A O   
2248 C CB  . ASP A 301 ? 0.3985 0.3047 0.3935 0.0280  -0.0333 -0.0548 370 ASP A CB  
2249 C CG  . ASP A 301 ? 0.5083 0.4181 0.5055 0.0346  -0.0346 -0.0537 370 ASP A CG  
2250 O OD1 . ASP A 301 ? 0.6069 0.5272 0.6080 0.0396  -0.0330 -0.0571 370 ASP A OD1 
2251 O OD2 . ASP A 301 ? 0.5535 0.4567 0.5486 0.0347  -0.0372 -0.0489 370 ASP A OD2 
2252 N N   . ILE A 302 ? 0.3199 0.2469 0.3210 0.0181  -0.0261 -0.0602 371 ILE A N   
2253 C CA  . ILE A 302 ? 0.3197 0.2462 0.3188 0.0134  -0.0247 -0.0611 371 ILE A CA  
2254 C C   . ILE A 302 ? 0.4185 0.3393 0.4126 0.0167  -0.0248 -0.0658 371 ILE A C   
2255 O O   . ILE A 302 ? 0.4475 0.3732 0.4429 0.0224  -0.0235 -0.0697 371 ILE A O   
2256 C CB  . ILE A 302 ? 0.3455 0.2846 0.3499 0.0107  -0.0215 -0.0613 371 ILE A CB  
2257 C CG1 . ILE A 302 ? 0.3509 0.2933 0.3591 0.0076  -0.0216 -0.0572 371 ILE A CG1 
2258 C CG2 . ILE A 302 ? 0.2972 0.2365 0.2992 0.0067  -0.0201 -0.0620 371 ILE A CG2 
2259 C CD1 . ILE A 302 ? 0.2110 0.1644 0.2248 0.0066  -0.0189 -0.0580 371 ILE A CD1 
2260 N N   . PRO A 303 ? 0.4420 0.3529 0.4302 0.0133  -0.0263 -0.0659 372 PRO A N   
2261 C CA  . PRO A 303 ? 0.4524 0.3555 0.4345 0.0167  -0.0267 -0.0711 372 PRO A CA  
2262 C C   . PRO A 303 ? 0.3860 0.2983 0.3680 0.0164  -0.0236 -0.0750 372 PRO A C   
2263 O O   . PRO A 303 ? 0.4113 0.3336 0.3971 0.0121  -0.0216 -0.0728 372 PRO A O   
2264 C CB  . PRO A 303 ? 0.4178 0.3073 0.3935 0.0114  -0.0298 -0.0692 372 PRO A CB  
2265 C CG  . PRO A 303 ? 0.3152 0.2113 0.2945 0.0043  -0.0296 -0.0639 372 PRO A CG  
2266 C CD  . PRO A 303 ? 0.3963 0.3027 0.3830 0.0064  -0.0280 -0.0613 372 PRO A CD  
2267 N N   . PRO A 304 ? 0.4368 0.3462 0.4145 0.0213  -0.0229 -0.0808 373 PRO A N   
2268 C CA  . PRO A 304 ? 0.3412 0.2594 0.3174 0.0206  -0.0199 -0.0846 373 PRO A CA  
2269 C C   . PRO A 304 ? 0.3225 0.2394 0.2954 0.0126  -0.0205 -0.0823 373 PRO A C   
2270 O O   . PRO A 304 ? 0.4485 0.3543 0.4173 0.0087  -0.0236 -0.0803 373 PRO A O   
2271 C CB  . PRO A 304 ? 0.2429 0.1534 0.2129 0.0273  -0.0200 -0.0913 373 PRO A CB  
2272 C CG  . PRO A 304 ? 0.3803 0.2848 0.3524 0.0340  -0.0217 -0.0909 373 PRO A CG  
2273 C CD  . PRO A 304 ? 0.4144 0.3136 0.3888 0.0288  -0.0244 -0.0841 373 PRO A CD  
2274 N N   . PRO A 305 ? 0.4816 0.4103 0.4560 0.0097  -0.0176 -0.0823 374 PRO A N   
2275 C CA  . PRO A 305 ? 0.4846 0.4268 0.4628 0.0133  -0.0138 -0.0850 374 PRO A CA  
2276 C C   . PRO A 305 ? 0.4711 0.4244 0.4583 0.0121  -0.0121 -0.0810 374 PRO A C   
2277 O O   . PRO A 305 ? 0.5157 0.4798 0.5069 0.0155  -0.0094 -0.0832 374 PRO A O   
2278 C CB  . PRO A 305 ? 0.3152 0.2629 0.2891 0.0093  -0.0121 -0.0862 374 PRO A CB  
2279 C CG  . PRO A 305 ? 0.3421 0.2850 0.3147 0.0020  -0.0144 -0.0808 374 PRO A CG  
2280 C CD  . PRO A 305 ? 0.4067 0.3365 0.3786 0.0023  -0.0181 -0.0792 374 PRO A CD  
2281 N N   . THR A 306 ? 0.4023 0.3534 0.3925 0.0074  -0.0134 -0.0755 375 THR A N   
2282 C CA  . THR A 306 ? 0.4139 0.3739 0.4118 0.0061  -0.0118 -0.0724 375 THR A CA  
2283 C C   . THR A 306 ? 0.3559 0.3177 0.3577 0.0115  -0.0123 -0.0739 375 THR A C   
2284 O O   . THR A 306 ? 0.3093 0.2819 0.3170 0.0122  -0.0103 -0.0741 375 THR A O   
2285 C CB  . THR A 306 ? 0.4531 0.4094 0.4526 0.0008  -0.0131 -0.0667 375 THR A CB  
2286 O OG1 . THR A 306 ? 0.4766 0.4320 0.4724 -0.0039 -0.0131 -0.0649 375 THR A OG1 
2287 C CG2 . THR A 306 ? 0.3072 0.2717 0.3138 -0.0009 -0.0112 -0.0642 375 THR A CG2 
2288 N N   . GLY A 307 ? 0.3295 0.2810 0.3282 0.0153  -0.0151 -0.0747 376 GLY A N   
2289 C CA  . GLY A 307 ? 0.3621 0.3149 0.3640 0.0210  -0.0160 -0.0754 376 GLY A CA  
2290 C C   . GLY A 307 ? 0.3529 0.3030 0.3517 0.0285  -0.0162 -0.0803 376 GLY A C   
2291 O O   . GLY A 307 ? 0.5215 0.4679 0.5150 0.0293  -0.0155 -0.0838 376 GLY A O   
2292 N N   . PRO A 308 ? 0.3230 0.2752 0.3249 0.0348  -0.0171 -0.0807 377 PRO A N   
2293 C CA  . PRO A 308 ? 0.2933 0.2506 0.3008 0.0345  -0.0182 -0.0771 377 PRO A CA  
2294 C C   . PRO A 308 ? 0.4558 0.4288 0.4700 0.0308  -0.0155 -0.0767 377 PRO A C   
2295 O O   . PRO A 308 ? 0.5153 0.4990 0.5317 0.0319  -0.0127 -0.0798 377 PRO A O   
2296 C CB  . PRO A 308 ? 0.2645 0.2217 0.2726 0.0435  -0.0195 -0.0788 377 PRO A CB  
2297 C CG  . PRO A 308 ? 0.4061 0.3517 0.4075 0.0478  -0.0201 -0.0824 377 PRO A CG  
2298 C CD  . PRO A 308 ? 0.3673 0.3161 0.3665 0.0434  -0.0174 -0.0851 377 PRO A CD  
2299 N N   . THR A 309 ? 0.1772 0.1512 0.1942 0.0262  -0.0161 -0.0730 378 THR A N   
2300 C CA  . THR A 309 ? 0.2690 0.2549 0.2915 0.0216  -0.0137 -0.0726 378 THR A CA  
2301 C C   . THR A 309 ? 0.3020 0.2883 0.3273 0.0191  -0.0150 -0.0695 378 THR A C   
2302 O O   . THR A 309 ? 0.2777 0.2543 0.3000 0.0186  -0.0172 -0.0666 378 THR A O   
2303 C CB  . THR A 309 ? 0.3085 0.2938 0.3297 0.0156  -0.0115 -0.0718 378 THR A CB  
2304 O OG1 . THR A 309 ? 0.2161 0.2113 0.2425 0.0111  -0.0093 -0.0712 378 THR A OG1 
2305 C CG2 . THR A 309 ? 0.1664 0.1393 0.1833 0.0118  -0.0132 -0.0682 378 THR A CG2 
2306 N N   . TRP A 310 ? 0.2884 0.2864 0.3192 0.0175  -0.0136 -0.0704 379 TRP A N   
2307 C CA  . TRP A 310 ? 0.2035 0.2027 0.2366 0.0139  -0.0142 -0.0683 379 TRP A CA  
2308 C C   . TRP A 310 ? 0.3162 0.3102 0.3484 0.0076  -0.0126 -0.0662 379 TRP A C   
2309 O O   . TRP A 310 ? 0.2882 0.2818 0.3196 0.0052  -0.0107 -0.0665 379 TRP A O   
2310 C CB  . TRP A 310 ? 0.2157 0.2287 0.2544 0.0131  -0.0133 -0.0705 379 TRP A CB  
2311 C CG  . TRP A 310 ? 0.3095 0.3301 0.3500 0.0194  -0.0152 -0.0719 379 TRP A CG  
2312 C CD1 . TRP A 310 ? 0.3157 0.3420 0.3571 0.0251  -0.0149 -0.0742 379 TRP A CD1 
2313 C CD2 . TRP A 310 ? 0.2583 0.2828 0.3001 0.0212  -0.0176 -0.0710 379 TRP A CD2 
2314 N NE1 . TRP A 310 ? 0.3826 0.4157 0.4260 0.0306  -0.0171 -0.0744 379 TRP A NE1 
2315 C CE2 . TRP A 310 ? 0.2409 0.2732 0.2845 0.0281  -0.0189 -0.0723 379 TRP A CE2 
2316 C CE3 . TRP A 310 ? 0.1886 0.2111 0.2300 0.0179  -0.0186 -0.0693 379 TRP A CE3 
2317 C CZ2 . TRP A 310 ? 0.3030 0.3415 0.3480 0.0315  -0.0215 -0.0713 379 TRP A CZ2 
2318 C CZ3 . TRP A 310 ? 0.2219 0.2506 0.2641 0.0210  -0.0211 -0.0688 379 TRP A CZ3 
2319 C CH2 . TRP A 310 ? 0.2903 0.3270 0.3343 0.0276  -0.0227 -0.0695 379 TRP A CH2 
2320 N N   . ALA A 311 ? 0.3219 0.3125 0.3543 0.0053  -0.0134 -0.0640 380 ALA A N   
2321 C CA  . ALA A 311 ? 0.1661 0.1527 0.1985 0.0002  -0.0118 -0.0619 380 ALA A CA  
2322 C C   . ALA A 311 ? 0.2786 0.2703 0.3145 -0.0025 -0.0109 -0.0629 380 ALA A C   
2323 O O   . ALA A 311 ? 0.4061 0.3985 0.4419 -0.0010 -0.0125 -0.0628 380 ALA A O   
2324 C CB  . ALA A 311 ? 0.1453 0.1222 0.1740 0.0000  -0.0134 -0.0583 380 ALA A CB  
2325 N N   . LEU A 312 ? 0.1404 0.1354 0.1789 -0.0066 -0.0085 -0.0639 381 LEU A N   
2326 C CA  . LEU A 312 ? 0.4049 0.4028 0.4462 -0.0100 -0.0075 -0.0654 381 LEU A CA  
2327 C C   . LEU A 312 ? 0.3738 0.3628 0.4137 -0.0123 -0.0065 -0.0627 381 LEU A C   
2328 O O   . LEU A 312 ? 0.3813 0.3668 0.4214 -0.0152 -0.0046 -0.0611 381 LEU A O   
2329 C CB  . LEU A 312 ? 0.4433 0.4489 0.4882 -0.0137 -0.0055 -0.0677 381 LEU A CB  
2330 C CG  . LEU A 312 ? 0.3354 0.3519 0.3822 -0.0109 -0.0060 -0.0701 381 LEU A CG  
2331 C CD1 . LEU A 312 ? 0.3328 0.3583 0.3836 -0.0157 -0.0038 -0.0719 381 LEU A CD1 
2332 C CD2 . LEU A 312 ? 0.2932 0.3151 0.3407 -0.0070 -0.0086 -0.0717 381 LEU A CD2 
2333 N N   . GLY A 313 ? 0.3754 0.3615 0.4139 -0.0107 -0.0078 -0.0619 382 GLY A N   
2334 C CA  . GLY A 313 ? 0.1908 0.1698 0.2281 -0.0116 -0.0069 -0.0594 382 GLY A CA  
2335 C C   . GLY A 313 ? 0.2872 0.2661 0.3259 -0.0138 -0.0055 -0.0619 382 GLY A C   
2336 O O   . GLY A 313 ? 0.2798 0.2627 0.3206 -0.0165 -0.0048 -0.0653 382 GLY A O   
2337 N N   . ALA A 314 ? 0.2327 0.2072 0.2700 -0.0127 -0.0052 -0.0603 383 ALA A N   
2338 C CA  . ALA A 314 ? 0.2585 0.2308 0.2962 -0.0142 -0.0036 -0.0629 383 ALA A CA  
2339 C C   . ALA A 314 ? 0.2553 0.2342 0.2934 -0.0152 -0.0044 -0.0679 383 ALA A C   
2340 O O   . ALA A 314 ? 0.3218 0.2995 0.3607 -0.0183 -0.0031 -0.0715 383 ALA A O   
2341 C CB  . ALA A 314 ? 0.1604 0.1294 0.1964 -0.0116 -0.0032 -0.0607 383 ALA A CB  
2342 N N   . THR A 315 ? 0.1996 0.1852 0.2369 -0.0128 -0.0069 -0.0679 384 THR A N   
2343 C CA  . THR A 315 ? 0.2531 0.2468 0.2908 -0.0136 -0.0081 -0.0721 384 THR A CA  
2344 C C   . THR A 315 ? 0.2347 0.2321 0.2756 -0.0178 -0.0072 -0.0753 384 THR A C   
2345 O O   . THR A 315 ? 0.3329 0.3334 0.3744 -0.0211 -0.0070 -0.0796 384 THR A O   
2346 C CB  . THR A 315 ? 0.3214 0.3216 0.3581 -0.0097 -0.0110 -0.0705 384 THR A CB  
2347 O OG1 . THR A 315 ? 0.2779 0.2737 0.3117 -0.0067 -0.0117 -0.0665 384 THR A OG1 
2348 C CG2 . THR A 315 ? 0.2436 0.2533 0.2802 -0.0099 -0.0127 -0.0742 384 THR A CG2 
2349 N N   . PHE A 316 ? 0.2890 0.2863 0.3317 -0.0182 -0.0067 -0.0734 385 PHE A N   
2350 C CA  . PHE A 316 ? 0.2688 0.2708 0.3147 -0.0225 -0.0056 -0.0756 385 PHE A CA  
2351 C C   . PHE A 316 ? 0.3339 0.3276 0.3803 -0.0274 -0.0029 -0.0758 385 PHE A C   
2352 O O   . PHE A 316 ? 0.3714 0.3673 0.4196 -0.0325 -0.0022 -0.0791 385 PHE A O   
2353 C CB  . PHE A 316 ? 0.1856 0.1915 0.2327 -0.0206 -0.0058 -0.0735 385 PHE A CB  
2354 C CG  . PHE A 316 ? 0.2423 0.2563 0.2931 -0.0246 -0.0046 -0.0755 385 PHE A CG  
2355 C CD1 . PHE A 316 ? 0.2626 0.2723 0.3143 -0.0292 -0.0021 -0.0742 385 PHE A CD1 
2356 C CD2 . PHE A 316 ? 0.4260 0.4530 0.4794 -0.0236 -0.0061 -0.0780 385 PHE A CD2 
2357 C CE1 . PHE A 316 ? 0.3000 0.3182 0.3550 -0.0334 -0.0010 -0.0755 385 PHE A CE1 
2358 C CE2 . PHE A 316 ? 0.3366 0.3731 0.3938 -0.0275 -0.0049 -0.0796 385 PHE A CE2 
2359 C CZ  . PHE A 316 ? 0.3021 0.3343 0.3602 -0.0327 -0.0023 -0.0783 385 PHE A CZ  
2360 N N   . ILE A 317 ? 0.3625 0.3466 0.4074 -0.0261 -0.0016 -0.0720 386 ILE A N   
2361 C CA  . ILE A 317 ? 0.3517 0.3271 0.3971 -0.0298 0.0008  -0.0710 386 ILE A CA  
2362 C C   . ILE A 317 ? 0.2697 0.2390 0.3140 -0.0316 0.0017  -0.0745 386 ILE A C   
2363 O O   . ILE A 317 ? 0.3977 0.3602 0.4426 -0.0358 0.0035  -0.0753 386 ILE A O   
2364 C CB  . ILE A 317 ? 0.3547 0.3230 0.3987 -0.0272 0.0016  -0.0656 386 ILE A CB  
2365 C CG1 . ILE A 317 ? 0.2777 0.2518 0.3216 -0.0255 0.0005  -0.0633 386 ILE A CG1 
2366 C CG2 . ILE A 317 ? 0.3119 0.2718 0.3564 -0.0306 0.0040  -0.0634 386 ILE A CG2 
2367 C CD1 . ILE A 317 ? 0.3458 0.3147 0.3881 -0.0236 0.0008  -0.0583 386 ILE A CD1 
2368 N N   . ARG A 318 ? 0.3338 0.3054 0.3762 -0.0285 0.0004  -0.0768 387 ARG A N   
2369 C CA  . ARG A 318 ? 0.3470 0.3142 0.3878 -0.0300 0.0012  -0.0813 387 ARG A CA  
2370 C C   . ARG A 318 ? 0.3453 0.3157 0.3874 -0.0363 0.0012  -0.0859 387 ARG A C   
2371 O O   . ARG A 318 ? 0.3742 0.3372 0.4142 -0.0388 0.0025  -0.0873 387 ARG A O   
2372 C CB  . ARG A 318 ? 0.3998 0.3720 0.4380 -0.0259 -0.0004 -0.0828 387 ARG A CB  
2373 C CG  . ARG A 318 ? 0.3197 0.2846 0.3554 -0.0218 0.0010  -0.0811 387 ARG A CG  
2374 C CD  . ARG A 318 ? 0.2277 0.1997 0.2608 -0.0181 -0.0006 -0.0817 387 ARG A CD  
2375 N NE  . ARG A 318 ? 0.3412 0.3150 0.3741 -0.0140 -0.0016 -0.0758 387 ARG A NE  
2376 C CZ  . ARG A 318 ? 0.4774 0.4589 0.5095 -0.0120 -0.0041 -0.0741 387 ARG A CZ  
2377 N NH1 . ARG A 318 ? 0.5510 0.5320 0.5826 -0.0091 -0.0050 -0.0687 387 ARG A NH1 
2378 N NH2 . ARG A 318 ? 0.4762 0.4658 0.5078 -0.0129 -0.0060 -0.0775 387 ARG A NH2 
2379 N N   . LYS A 319 ? 0.3006 0.2825 0.3454 -0.0383 -0.0004 -0.0869 388 LYS A N   
2380 C CA  . LYS A 319 ? 0.3511 0.3386 0.3975 -0.0447 -0.0006 -0.0906 388 LYS A CA  
2381 C C   . LYS A 319 ? 0.3923 0.3777 0.4417 -0.0499 0.0011  -0.0885 388 LYS A C   
2382 O O   . LYS A 319 ? 0.4628 0.4470 0.5123 -0.0558 0.0018  -0.0898 388 LYS A O   
2383 C CB  . LYS A 319 ? 0.2433 0.2470 0.2917 -0.0441 -0.0035 -0.0935 388 LYS A CB  
2384 C CG  . LYS A 319 ? 0.2505 0.2629 0.3007 -0.0507 -0.0041 -0.0973 388 LYS A CG  
2385 C CD  . LYS A 319 ? 0.3338 0.3602 0.3841 -0.0493 -0.0072 -0.1009 388 LYS A CD  
2386 C CE  . LYS A 319 ? 0.3831 0.4205 0.4357 -0.0558 -0.0081 -0.1038 388 LYS A CE  
2387 N NZ  . LYS A 319 ? 0.4751 0.5252 0.5267 -0.0546 -0.0112 -0.1073 388 LYS A NZ  
2388 N N   . PHE A 320 ? 0.2752 0.2603 0.3259 -0.0476 0.0018  -0.0840 389 PHE A N   
2389 C CA  . PHE A 320 ? 0.2751 0.2606 0.3282 -0.0524 0.0035  -0.0814 389 PHE A CA  
2390 C C   . PHE A 320 ? 0.3327 0.3057 0.3842 -0.0507 0.0055  -0.0761 389 PHE A C   
2391 O O   . PHE A 320 ? 0.3937 0.3672 0.4442 -0.0454 0.0051  -0.0724 389 PHE A O   
2392 C CB  . PHE A 320 ? 0.2367 0.2372 0.2927 -0.0511 0.0026  -0.0805 389 PHE A CB  
2393 C CG  . PHE A 320 ? 0.3088 0.3234 0.3670 -0.0520 0.0004  -0.0850 389 PHE A CG  
2394 C CD1 . PHE A 320 ? 0.2381 0.2590 0.2991 -0.0597 0.0006  -0.0883 389 PHE A CD1 
2395 C CD2 . PHE A 320 ? 0.3427 0.3644 0.4001 -0.0455 -0.0020 -0.0857 389 PHE A CD2 
2396 C CE1 . PHE A 320 ? 0.2433 0.2788 0.3066 -0.0607 -0.0016 -0.0924 389 PHE A CE1 
2397 C CE2 . PHE A 320 ? 0.3826 0.4180 0.4421 -0.0459 -0.0042 -0.0893 389 PHE A CE2 
2398 C CZ  . PHE A 320 ? 0.2538 0.2968 0.3164 -0.0534 -0.0040 -0.0927 389 PHE A CZ  
2399 N N   . TYR A 321 ? 0.3513 0.3127 0.4023 -0.0552 0.0073  -0.0757 390 TYR A N   
2400 C CA  . TYR A 321 ? 0.3445 0.2954 0.3946 -0.0548 0.0093  -0.0699 390 TYR A CA  
2401 C C   . TYR A 321 ? 0.4001 0.3596 0.4516 -0.0552 0.0096  -0.0656 390 TYR A C   
2402 O O   . TYR A 321 ? 0.5437 0.5132 0.5977 -0.0598 0.0097  -0.0668 390 TYR A O   
2403 C CB  . TYR A 321 ? 0.3668 0.3058 0.4165 -0.0610 0.0111  -0.0701 390 TYR A CB  
2404 C CG  . TYR A 321 ? 0.3218 0.2469 0.3703 -0.0598 0.0130  -0.0645 390 TYR A CG  
2405 C CD1 . TYR A 321 ? 0.3081 0.2344 0.3574 -0.0623 0.0141  -0.0585 390 TYR A CD1 
2406 C CD2 . TYR A 321 ? 0.2807 0.1932 0.3263 -0.0553 0.0134  -0.0641 390 TYR A CD2 
2407 C CE1 . TYR A 321 ? 0.3700 0.2845 0.4180 -0.0609 0.0156  -0.0525 390 TYR A CE1 
2408 C CE2 . TYR A 321 ? 0.2622 0.1623 0.3074 -0.0537 0.0152  -0.0588 390 TYR A CE2 
2409 C CZ  . TYR A 321 ? 0.4221 0.3233 0.4683 -0.0565 0.0161  -0.0526 390 TYR A CZ  
2410 O OH  . TYR A 321 ? 0.4407 0.3307 0.4859 -0.0543 0.0174  -0.0462 390 TYR A OH  
2411 N N   . THR A 322 ? 0.3913 0.3474 0.4411 -0.0505 0.0098  -0.0607 391 THR A N   
2412 C CA  . THR A 322 ? 0.4556 0.4202 0.5057 -0.0497 0.0098  -0.0574 391 THR A CA  
2413 C C   . THR A 322 ? 0.4227 0.3801 0.4714 -0.0511 0.0115  -0.0511 391 THR A C   
2414 O O   . THR A 322 ? 0.4158 0.3633 0.4629 -0.0480 0.0117  -0.0480 391 THR A O   
2415 C CB  . THR A 322 ? 0.4479 0.4171 0.4963 -0.0428 0.0078  -0.0575 391 THR A CB  
2416 O OG1 . THR A 322 ? 0.4891 0.4650 0.5385 -0.0412 0.0061  -0.0625 391 THR A OG1 
2417 C CG2 . THR A 322 ? 0.3938 0.3711 0.4418 -0.0419 0.0079  -0.0552 391 THR A CG2 
2418 N N   . GLU A 323 ? 0.3204 0.2842 0.3701 -0.0555 0.0128  -0.0490 392 GLU A N   
2419 C CA  . GLU A 323 ? 0.3371 0.2963 0.3853 -0.0575 0.0144  -0.0425 392 GLU A CA  
2420 C C   . GLU A 323 ? 0.4461 0.4157 0.4928 -0.0551 0.0141  -0.0407 392 GLU A C   
2421 O O   . GLU A 323 ? 0.5156 0.4975 0.5637 -0.0566 0.0144  -0.0434 392 GLU A O   
2422 C CB  . GLU A 323 ? 0.4026 0.3597 0.4523 -0.0656 0.0165  -0.0410 392 GLU A CB  
2423 C CG  . GLU A 323 ? 0.3978 0.3509 0.4457 -0.0679 0.0181  -0.0334 392 GLU A CG  
2424 C CD  . GLU A 323 ? 0.4522 0.4051 0.5015 -0.0769 0.0201  -0.0314 392 GLU A CD  
2425 O OE1 . GLU A 323 ? 0.5390 0.5046 0.5890 -0.0804 0.0212  -0.0300 392 GLU A OE1 
2426 O OE2 . GLU A 323 ? 0.5849 0.5249 0.6346 -0.0805 0.0207  -0.0312 392 GLU A OE2 
2427 N N   . PHE A 324 ? 0.3689 0.3343 0.4127 -0.0513 0.0136  -0.0363 393 PHE A N   
2428 C CA  . PHE A 324 ? 0.3375 0.3112 0.3787 -0.0490 0.0131  -0.0349 393 PHE A CA  
2429 C C   . PHE A 324 ? 0.4734 0.4479 0.5131 -0.0532 0.0151  -0.0291 393 PHE A C   
2430 O O   . PHE A 324 ? 0.4797 0.4454 0.5182 -0.0534 0.0154  -0.0235 393 PHE A O   
2431 C CB  . PHE A 324 ? 0.2843 0.2540 0.3230 -0.0430 0.0110  -0.0340 393 PHE A CB  
2432 C CG  . PHE A 324 ? 0.2755 0.2451 0.3153 -0.0391 0.0091  -0.0390 393 PHE A CG  
2433 C CD1 . PHE A 324 ? 0.3567 0.3183 0.3979 -0.0380 0.0088  -0.0398 393 PHE A CD1 
2434 C CD2 . PHE A 324 ? 0.2341 0.2113 0.2730 -0.0362 0.0077  -0.0427 393 PHE A CD2 
2435 C CE1 . PHE A 324 ? 0.2315 0.1939 0.2732 -0.0346 0.0071  -0.0440 393 PHE A CE1 
2436 C CE2 . PHE A 324 ? 0.2264 0.2032 0.2660 -0.0326 0.0058  -0.0464 393 PHE A CE2 
2437 C CZ  . PHE A 324 ? 0.1803 0.1503 0.2212 -0.0321 0.0055  -0.0469 393 PHE A CZ  
2438 N N   . ASP A 325 ? 0.4784 0.4645 0.5183 -0.0563 0.0164  -0.0300 394 ASP A N   
2439 C CA  . ASP A 325 ? 0.4435 0.4326 0.4821 -0.0613 0.0186  -0.0245 394 ASP A CA  
2440 C C   . ASP A 325 ? 0.5165 0.5129 0.5506 -0.0586 0.0183  -0.0227 394 ASP A C   
2441 O O   . ASP A 325 ? 0.4823 0.4899 0.5157 -0.0569 0.0185  -0.0269 394 ASP A O   
2442 C CB  . ASP A 325 ? 0.4949 0.4936 0.5368 -0.0675 0.0207  -0.0265 394 ASP A CB  
2443 C CG  . ASP A 325 ? 0.4464 0.4464 0.4872 -0.0741 0.0232  -0.0199 394 ASP A CG  
2444 O OD1 . ASP A 325 ? 0.3717 0.3701 0.4086 -0.0731 0.0234  -0.0144 394 ASP A OD1 
2445 O OD2 . ASP A 325 ? 0.5028 0.5063 0.5467 -0.0808 0.0249  -0.0201 394 ASP A OD2 
2446 N N   . ARG A 326 ? 0.5050 0.4953 0.5359 -0.0580 0.0179  -0.0165 395 ARG A N   
2447 C CA  . ARG A 326 ? 0.3613 0.3582 0.3872 -0.0562 0.0174  -0.0146 395 ARG A CA  
2448 C C   . ARG A 326 ? 0.4124 0.4200 0.4365 -0.0610 0.0201  -0.0119 395 ARG A C   
2449 O O   . ARG A 326 ? 0.5107 0.5290 0.5314 -0.0596 0.0203  -0.0145 395 ARG A O   
2450 C CB  . ARG A 326 ? 0.4289 0.4174 0.4523 -0.0541 0.0158  -0.0085 395 ARG A CB  
2451 C CG  . ARG A 326 ? 0.4907 0.4759 0.5133 -0.0485 0.0130  -0.0118 395 ARG A CG  
2452 C CD  . ARG A 326 ? 0.5268 0.5203 0.5445 -0.0466 0.0118  -0.0140 395 ARG A CD  
2453 N NE  . ARG A 326 ? 0.7681 0.7571 0.7836 -0.0432 0.0089  -0.0123 395 ARG A NE  
2454 C CZ  . ARG A 326 ? 0.7422 0.7352 0.7526 -0.0432 0.0077  -0.0096 395 ARG A CZ  
2455 N NH1 . ARG A 326 ? 0.7355 0.7252 0.7446 -0.0407 0.0049  -0.0081 395 ARG A NH1 
2456 N NH2 . ARG A 326 ? 0.5581 0.5594 0.5647 -0.0459 0.0092  -0.0084 395 ARG A NH2 
2457 N N   . ARG A 327 ? 0.4606 0.4652 0.4864 -0.0668 0.0221  -0.0066 396 ARG A N   
2458 C CA  . ARG A 327 ? 0.5009 0.5159 0.5247 -0.0721 0.0247  -0.0027 396 ARG A CA  
2459 C C   . ARG A 327 ? 0.4511 0.4813 0.4767 -0.0731 0.0264  -0.0090 396 ARG A C   
2460 O O   . ARG A 327 ? 0.5816 0.6244 0.6036 -0.0728 0.0276  -0.0096 396 ARG A O   
2461 C CB  . ARG A 327 ? 0.5496 0.5567 0.5754 -0.0787 0.0264  0.0043  396 ARG A CB  
2462 C CG  . ARG A 327 ? 0.6831 0.7018 0.7083 -0.0859 0.0295  0.0081  396 ARG A CG  
2463 C CD  . ARG A 327 ? 0.8225 0.8407 0.8426 -0.0881 0.0302  0.0177  396 ARG A CD  
2464 N NE  . ARG A 327 ? 0.9452 0.9459 0.9654 -0.0879 0.0290  0.0244  396 ARG A NE  
2465 C CZ  . ARG A 327 ? 1.0372 1.0343 1.0540 -0.0901 0.0295  0.0342  396 ARG A CZ  
2466 N NH1 . ARG A 327 ? 0.9909 0.9715 1.0085 -0.0887 0.0283  0.0398  396 ARG A NH1 
2467 N NH2 . ARG A 327 ? 1.1173 1.1277 1.1298 -0.0934 0.0311  0.0384  396 ARG A NH2 
2468 N N   . ASN A 328 ? 0.4102 0.4402 0.4412 -0.0738 0.0264  -0.0142 397 ASN A N   
2469 C CA  . ASN A 328 ? 0.3920 0.4375 0.4257 -0.0746 0.0280  -0.0198 397 ASN A CA  
2470 C C   . ASN A 328 ? 0.4477 0.4967 0.4817 -0.0669 0.0260  -0.0277 397 ASN A C   
2471 O O   . ASN A 328 ? 0.4667 0.5282 0.5035 -0.0661 0.0270  -0.0328 397 ASN A O   
2472 C CB  . ASN A 328 ? 0.3597 0.4056 0.3993 -0.0813 0.0292  -0.0200 397 ASN A CB  
2473 C CG  . ASN A 328 ? 0.4418 0.4796 0.4811 -0.0889 0.0307  -0.0120 397 ASN A CG  
2474 O OD1 . ASN A 328 ? 0.4695 0.5143 0.5061 -0.0928 0.0329  -0.0065 397 ASN A OD1 
2475 N ND2 . ASN A 328 ? 0.3931 0.4154 0.4347 -0.0910 0.0296  -0.0111 397 ASN A ND2 
2476 N N   . ASN A 329 ? 0.5169 0.5553 0.5480 -0.0613 0.0232  -0.0284 398 ASN A N   
2477 C CA  . ASN A 329 ? 0.4510 0.4904 0.4813 -0.0541 0.0211  -0.0349 398 ASN A CA  
2478 C C   . ASN A 329 ? 0.4312 0.4743 0.4672 -0.0531 0.0207  -0.0405 398 ASN A C   
2479 O O   . ASN A 329 ? 0.5091 0.5632 0.5462 -0.0499 0.0211  -0.0455 398 ASN A O   
2480 C CB  . ASN A 329 ? 0.3989 0.4493 0.4246 -0.0509 0.0219  -0.0376 398 ASN A CB  
2481 C CG  . ASN A 329 ? 0.5074 0.5522 0.5264 -0.0495 0.0207  -0.0343 398 ASN A CG  
2482 O OD1 . ASN A 329 ? 0.6510 0.6844 0.6688 -0.0470 0.0179  -0.0333 398 ASN A OD1 
2483 N ND2 . ASN A 329 ? 0.5049 0.5590 0.5194 -0.0512 0.0226  -0.0326 398 ASN A ND2 
2484 N N   . ARG A 330 ? 0.4148 0.4485 0.4542 -0.0556 0.0198  -0.0395 399 ARG A N   
2485 C CA  . ARG A 330 ? 0.4226 0.4601 0.4672 -0.0555 0.0192  -0.0444 399 ARG A CA  
2486 C C   . ARG A 330 ? 0.4010 0.4245 0.4466 -0.0545 0.0171  -0.0447 399 ARG A C   
2487 O O   . ARG A 330 ? 0.4125 0.4240 0.4557 -0.0546 0.0166  -0.0406 399 ARG A O   
2488 C CB  . ARG A 330 ? 0.3862 0.4331 0.4350 -0.0630 0.0217  -0.0437 399 ARG A CB  
2489 C CG  . ARG A 330 ? 0.4078 0.4442 0.4565 -0.0700 0.0228  -0.0379 399 ARG A CG  
2490 C CD  . ARG A 330 ? 0.4058 0.4517 0.4580 -0.0784 0.0254  -0.0363 399 ARG A CD  
2491 N NE  . ARG A 330 ? 0.3257 0.3584 0.3777 -0.0851 0.0261  -0.0309 399 ARG A NE  
2492 C CZ  . ARG A 330 ? 0.4177 0.4529 0.4728 -0.0940 0.0278  -0.0292 399 ARG A CZ  
2493 N NH1 . ARG A 330 ? 0.4377 0.4580 0.4920 -0.0995 0.0283  -0.0242 399 ARG A NH1 
2494 N NH2 . ARG A 330 ? 0.5244 0.5770 0.5836 -0.0973 0.0290  -0.0324 399 ARG A NH2 
2495 N N   . ILE A 331 ? 0.3587 0.3852 0.4078 -0.0533 0.0159  -0.0496 400 ILE A N   
2496 C CA  . ILE A 331 ? 0.1921 0.2078 0.2421 -0.0523 0.0140  -0.0509 400 ILE A CA  
2497 C C   . ILE A 331 ? 0.2771 0.2959 0.3316 -0.0582 0.0147  -0.0532 400 ILE A C   
2498 O O   . ILE A 331 ? 0.3747 0.4072 0.4325 -0.0593 0.0149  -0.0565 400 ILE A O   
2499 C CB  . ILE A 331 ? 0.2737 0.2895 0.3227 -0.0448 0.0114  -0.0547 400 ILE A CB  
2500 C CG1 . ILE A 331 ? 0.2056 0.2165 0.2498 -0.0403 0.0105  -0.0523 400 ILE A CG1 
2501 C CG2 . ILE A 331 ? 0.3770 0.3844 0.4271 -0.0442 0.0097  -0.0565 400 ILE A CG2 
2502 C CD1 . ILE A 331 ? 0.3120 0.3199 0.3546 -0.0339 0.0078  -0.0548 400 ILE A CD1 
2503 N N   . GLY A 332 ? 0.2975 0.3040 0.3520 -0.0618 0.0148  -0.0517 401 GLY A N   
2504 C CA  . GLY A 332 ? 0.4198 0.4265 0.4776 -0.0683 0.0152  -0.0542 401 GLY A CA  
2505 C C   . GLY A 332 ? 0.3672 0.3684 0.4253 -0.0655 0.0130  -0.0588 401 GLY A C   
2506 O O   . GLY A 332 ? 0.3321 0.3226 0.3875 -0.0606 0.0120  -0.0580 401 GLY A O   
2507 N N   . PHE A 333 ? 0.3398 0.3496 0.4012 -0.0688 0.0123  -0.0634 402 PHE A N   
2508 C CA  . PHE A 333 ? 0.3154 0.3220 0.3769 -0.0672 0.0103  -0.0681 402 PHE A CA  
2509 C C   . PHE A 333 ? 0.4223 0.4259 0.4855 -0.0758 0.0108  -0.0707 402 PHE A C   
2510 O O   . PHE A 333 ? 0.5846 0.5973 0.6509 -0.0827 0.0118  -0.0707 402 PHE A O   
2511 C CB  . PHE A 333 ? 0.3418 0.3627 0.4050 -0.0621 0.0081  -0.0719 402 PHE A CB  
2512 C CG  . PHE A 333 ? 0.3964 0.4170 0.4570 -0.0534 0.0071  -0.0702 402 PHE A CG  
2513 C CD1 . PHE A 333 ? 0.3815 0.3896 0.4385 -0.0488 0.0062  -0.0688 402 PHE A CD1 
2514 C CD2 . PHE A 333 ? 0.3096 0.3425 0.3713 -0.0500 0.0072  -0.0701 402 PHE A CD2 
2515 C CE1 . PHE A 333 ? 0.2892 0.2968 0.3438 -0.0419 0.0051  -0.0672 402 PHE A CE1 
2516 C CE2 . PHE A 333 ? 0.3348 0.3657 0.3935 -0.0425 0.0061  -0.0690 402 PHE A CE2 
2517 C CZ  . PHE A 333 ? 0.3549 0.3729 0.4101 -0.0390 0.0049  -0.0675 402 PHE A CZ  
2518 N N   . ALA A 334 ? 0.3114 0.3022 0.3724 -0.0754 0.0100  -0.0731 403 ALA A N   
2519 C CA  . ALA A 334 ? 0.2302 0.2166 0.2919 -0.0830 0.0100  -0.0772 403 ALA A CA  
2520 C C   . ALA A 334 ? 0.3073 0.2880 0.3653 -0.0775 0.0080  -0.0806 403 ALA A C   
2521 O O   . ALA A 334 ? 0.3440 0.3174 0.3997 -0.0707 0.0079  -0.0796 403 ALA A O   
2522 C CB  . ALA A 334 ? 0.2742 0.2450 0.3336 -0.0879 0.0120  -0.0727 403 ALA A CB  
2523 N N   . LEU A 335 ? 0.3343 0.3195 0.3919 -0.0807 0.0065  -0.0843 404 LEU A N   
2524 C CA  . LEU A 335 ? 0.4625 0.4451 0.5165 -0.0762 0.0047  -0.0880 404 LEU A CA  
2525 C C   . LEU A 335 ? 0.5719 0.5354 0.6209 -0.0728 0.0058  -0.0863 404 LEU A C   
2526 O O   . LEU A 335 ? 0.6175 0.5686 0.6650 -0.0766 0.0072  -0.0842 404 LEU A O   
2527 C CB  . LEU A 335 ? 0.5021 0.4920 0.5560 -0.0816 0.0031  -0.0922 404 LEU A CB  
2528 C CG  . LEU A 335 ? 0.4742 0.4695 0.5258 -0.0774 0.0008  -0.0966 404 LEU A CG  
2529 C CD1 . LEU A 335 ? 0.4718 0.4857 0.5275 -0.0740 -0.0009 -0.0978 404 LEU A CD1 
2530 C CD2 . LEU A 335 ? 0.3909 0.3862 0.4404 -0.0832 -0.0003 -0.1004 404 LEU A CD2 
2531 N N   . ALA A 336 ? 0.5670 0.5287 0.6138 -0.0654 0.0052  -0.0870 405 ALA A N   
2532 C CA  . ALA A 336 ? 0.6094 0.5554 0.6522 -0.0611 0.0064  -0.0854 405 ALA A CA  
2533 C C   . ALA A 336 ? 0.5893 0.5285 0.6279 -0.0624 0.0059  -0.0895 405 ALA A C   
2534 O O   . ALA A 336 ? 0.5667 0.5152 0.6047 -0.0637 0.0042  -0.0940 405 ALA A O   
2535 C CB  . ALA A 336 ? 0.5623 0.5099 0.6046 -0.0532 0.0061  -0.0843 405 ALA A CB  
2536 N N   . ARG A 337 ? 0.5624 0.4856 0.5980 -0.0617 0.0074  -0.0882 406 ARG A N   
2537 C CA  . ARG A 337 ? 0.5985 0.5128 0.6293 -0.0619 0.0071  -0.0924 406 ARG A CA  
2538 C C   . ARG A 337 ? 0.6795 0.5784 0.7072 -0.0560 0.0090  -0.0905 406 ARG A C   
2539 O O   . ARG A 337 ? 0.7719 0.6646 0.7953 -0.0530 0.0091  -0.0943 406 ARG A O   
2540 C CB  . ARG A 337 ? 0.5259 0.4357 0.5562 -0.0704 0.0066  -0.0940 406 ARG A CB  
2541 C CG  . ARG A 337 ? 0.4983 0.3948 0.5293 -0.0732 0.0081  -0.0891 406 ARG A CG  
2542 C CD  . ARG A 337 ? 0.5441 0.4399 0.5760 -0.0828 0.0073  -0.0898 406 ARG A CD  
2543 N NE  . ARG A 337 ? 0.6287 0.5092 0.6604 -0.0856 0.0086  -0.0851 406 ARG A NE  
2544 C CZ  . ARG A 337 ? 0.7747 0.6371 0.8021 -0.0849 0.0087  -0.0859 406 ARG A CZ  
2545 N NH1 . ARG A 337 ? 0.8472 0.6960 0.8747 -0.0874 0.0097  -0.0809 406 ARG A NH1 
2546 N NH2 . ARG A 337 ? 0.8351 0.6929 0.8579 -0.0815 0.0079  -0.0916 406 ARG A NH2 
2547 O OXT . ARG A 337 ? 0.6987 0.5919 0.7283 -0.0538 0.0104  -0.0853 406 ARG A OXT 
2548 N N   . GLY B 1   ? 0.5344 0.8077 0.5806 0.0363  0.0526  0.1808  70  GLY B N   
2549 C CA  . GLY B 1   ? 0.5741 0.8344 0.6201 0.0359  0.0481  0.1770  70  GLY B CA  
2550 C C   . GLY B 1   ? 0.7066 0.9694 0.7644 0.0296  0.0429  0.1817  70  GLY B C   
2551 O O   . GLY B 1   ? 0.7418 0.9973 0.8002 0.0210  0.0369  0.1839  70  GLY B O   
2552 N N   . ASN B 2   ? 0.8352 1.1077 0.9018 0.0338  0.0452  0.1832  71  ASN B N   
2553 C CA  . ASN B 2   ? 0.8835 1.1606 0.9617 0.0274  0.0401  0.1884  71  ASN B CA  
2554 C C   . ASN B 2   ? 0.8259 1.1031 0.9091 0.0320  0.0405  0.1868  71  ASN B C   
2555 O O   . ASN B 2   ? 0.9409 1.2263 1.0350 0.0283  0.0374  0.1920  71  ASN B O   
2556 C CB  . ASN B 2   ? 0.9746 1.2703 1.0627 0.0249  0.0413  0.1963  71  ASN B CB  
2557 C CG  . ASN B 2   ? 1.0517 1.3608 1.1409 0.0348  0.0498  0.1963  71  ASN B CG  
2558 O OD1 . ASN B 2   ? 0.9883 1.2926 1.0712 0.0436  0.0548  0.1901  71  ASN B OD1 
2559 N ND2 . ASN B 2   ? 1.1400 1.4646 1.2362 0.0333  0.0516  0.2028  71  ASN B ND2 
2560 N N   . THR B 3   ? 0.6507 0.9190 0.7261 0.0396  0.0437  0.1800  72  THR B N   
2561 C CA  . THR B 3   ? 0.5310 0.8002 0.6106 0.0453  0.0453  0.1783  72  THR B CA  
2562 C C   . THR B 3   ? 0.5416 0.7919 0.6140 0.0425  0.0401  0.1732  72  THR B C   
2563 O O   . THR B 3   ? 0.5912 0.8273 0.6519 0.0435  0.0392  0.1669  72  THR B O   
2564 C CB  . THR B 3   ? 0.2273 0.5009 0.3033 0.0573  0.0540  0.1736  72  THR B CB  
2565 N N   . THR B 4   ? 0.4009 0.6494 0.4806 0.0388  0.0351  0.1744  73  THR B N   
2566 C CA  . THR B 4   ? 0.4384 0.6681 0.5127 0.0376  0.0297  0.1668  73  THR B CA  
2567 C C   . THR B 4   ? 0.4505 0.6846 0.5333 0.0411  0.0292  0.1664  73  THR B C   
2568 O O   . THR B 4   ? 0.5994 0.8424 0.6921 0.0353  0.0258  0.1735  73  THR B O   
2569 C CB  . THR B 4   ? 0.4581 0.6767 0.5300 0.0263  0.0227  0.1690  73  THR B CB  
2570 O OG1 . THR B 4   ? 0.3104 0.5363 0.3925 0.0195  0.0186  0.1748  73  THR B OG1 
2571 C CG2 . THR B 4   ? 0.5956 0.8137 0.6646 0.0215  0.0224  0.1706  73  THR B CG2 
2572 N N   . SER B 5   ? 0.3693 0.5972 0.4481 0.0502  0.0321  0.1586  74  SER B N   
2573 C CA  . SER B 5   ? 0.4506 0.6808 0.5367 0.0543  0.0314  0.1578  74  SER B CA  
2574 C C   . SER B 5   ? 0.3705 0.5820 0.4505 0.0509  0.0253  0.1510  74  SER B C   
2575 O O   . SER B 5   ? 0.4234 0.6195 0.4925 0.0494  0.0237  0.1444  74  SER B O   
2576 C CB  . SER B 5   ? 0.4521 0.6871 0.5379 0.0667  0.0390  0.1539  74  SER B CB  
2577 O OG  . SER B 5   ? 0.5403 0.7628 0.6123 0.0710  0.0418  0.1454  74  SER B OG  
2578 N N   . SER B 6   ? 0.3950 0.6087 0.4826 0.0495  0.0218  0.1533  75  SER B N   
2579 C CA  . SER B 6   ? 0.4172 0.6148 0.4998 0.0456  0.0160  0.1478  75  SER B CA  
2580 C C   . SER B 6   ? 0.4901 0.6868 0.5752 0.0539  0.0174  0.1442  75  SER B C   
2581 O O   . SER B 6   ? 0.6037 0.8149 0.6999 0.0583  0.0195  0.1502  75  SER B O   
2582 C CB  . SER B 6   ? 0.3040 0.5027 0.3916 0.0340  0.0092  0.1541  75  SER B CB  
2583 O OG  . SER B 6   ? 0.5206 0.7197 0.6061 0.0261  0.0079  0.1580  75  SER B OG  
2584 N N   . VAL B 7   ? 0.4573 0.6370 0.5325 0.0561  0.0164  0.1350  76  VAL B N   
2585 C CA  . VAL B 7   ? 0.4939 0.6692 0.5697 0.0627  0.0167  0.1311  76  VAL B CA  
2586 C C   . VAL B 7   ? 0.5647 0.7280 0.6380 0.0550  0.0096  0.1291  76  VAL B C   
2587 O O   . VAL B 7   ? 0.6836 0.8326 0.7472 0.0499  0.0070  0.1233  76  VAL B O   
2588 C CB  . VAL B 7   ? 0.5047 0.6700 0.5701 0.0715  0.0216  0.1219  76  VAL B CB  
2589 C CG1 . VAL B 7   ? 0.4620 0.6260 0.5298 0.0798  0.0235  0.1198  76  VAL B CG1 
2590 C CG2 . VAL B 7   ? 0.5286 0.7026 0.5923 0.0762  0.0281  0.1230  76  VAL B CG2 
2591 N N   . ILE B 8   ? 0.5229 0.6926 0.6051 0.0540  0.0065  0.1344  77  ILE B N   
2592 C CA  . ILE B 8   ? 0.5047 0.6635 0.5840 0.0467  -0.0003 0.1329  77  ILE B CA  
2593 C C   . ILE B 8   ? 0.4664 0.6092 0.5360 0.0518  0.0004  0.1231  77  ILE B C   
2594 O O   . ILE B 8   ? 0.5579 0.7009 0.6265 0.0619  0.0054  0.1196  77  ILE B O   
2595 C CB  . ILE B 8   ? 0.5637 0.7351 0.6555 0.0447  -0.0040 0.1421  77  ILE B CB  
2596 C CG1 . ILE B 8   ? 0.6185 0.8064 0.7200 0.0387  -0.0043 0.1515  77  ILE B CG1 
2597 C CG2 . ILE B 8   ? 0.4359 0.5961 0.5236 0.0360  -0.0113 0.1410  77  ILE B CG2 
2598 C CD1 . ILE B 8   ? 0.5736 0.7552 0.6691 0.0264  -0.0091 0.1528  77  ILE B CD1 
2599 N N   . LEU B 9   ? 0.4882 0.6165 0.5499 0.0445  -0.0043 0.1184  78  LEU B N   
2600 C CA  . LEU B 9   ? 0.4177 0.5307 0.4700 0.0476  -0.0044 0.1094  78  LEU B CA  
2601 C C   . LEU B 9   ? 0.4317 0.5384 0.4839 0.0420  -0.0102 0.1102  78  LEU B C   
2602 O O   . LEU B 9   ? 0.3478 0.4566 0.4026 0.0326  -0.0150 0.1152  78  LEU B O   
2603 C CB  . LEU B 9   ? 0.3678 0.4679 0.4090 0.0446  -0.0038 0.1016  78  LEU B CB  
2604 C CG  . LEU B 9   ? 0.3347 0.4390 0.3741 0.0485  0.0009  0.1007  78  LEU B CG  
2605 C CD1 . LEU B 9   ? 0.3232 0.4151 0.3535 0.0440  0.0001  0.0946  78  LEU B CD1 
2606 C CD2 . LEU B 9   ? 0.2648 0.3717 0.3029 0.0594  0.0062  0.0978  78  LEU B CD2 
2607 N N   . THR B 10  ? 0.4385 0.5366 0.4866 0.0472  -0.0100 0.1052  79  THR B N   
2608 C CA  . THR B 10  ? 0.3929 0.4830 0.4390 0.0423  -0.0154 0.1049  79  THR B CA  
2609 C C   . THR B 10  ? 0.4434 0.5162 0.4767 0.0372  -0.0167 0.0959  79  THR B C   
2610 O O   . THR B 10  ? 0.4278 0.4931 0.4542 0.0425  -0.0132 0.0886  79  THR B O   
2611 C CB  . THR B 10  ? 0.4020 0.4931 0.4520 0.0513  -0.0145 0.1058  79  THR B CB  
2612 O OG1 . THR B 10  ? 0.3826 0.4908 0.4465 0.0549  -0.0141 0.1156  79  THR B OG1 
2613 C CG2 . THR B 10  ? 0.1775 0.2569 0.2224 0.0463  -0.0199 0.1039  79  THR B CG2 
2614 N N   . ASN B 11  ? 0.3717 0.4386 0.4017 0.0267  -0.0215 0.0965  80  ASN B N   
2615 C CA  . ASN B 11  ? 0.2307 0.2819 0.2494 0.0212  -0.0226 0.0884  80  ASN B CA  
2616 C C   . ASN B 11  ? 0.3081 0.3513 0.3232 0.0208  -0.0257 0.0866  80  ASN B C   
2617 O O   . ASN B 11  ? 0.4337 0.4778 0.4507 0.0145  -0.0306 0.0915  80  ASN B O   
2618 C CB  . ASN B 11  ? 0.3110 0.3586 0.3266 0.0099  -0.0252 0.0895  80  ASN B CB  
2619 C CG  . ASN B 11  ? 0.3663 0.3981 0.3708 0.0042  -0.0256 0.0814  80  ASN B CG  
2620 O OD1 . ASN B 11  ? 0.3759 0.4000 0.3753 0.0077  -0.0247 0.0755  80  ASN B OD1 
2621 N ND2 . ASN B 11  ? 0.3913 0.4180 0.3919 -0.0049 -0.0267 0.0812  80  ASN B ND2 
2622 N N   . TYR B 12  ? 0.3651 0.4001 0.3744 0.0269  -0.0233 0.0798  81  TYR B N   
2623 C CA  . TYR B 12  ? 0.3550 0.3801 0.3590 0.0261  -0.0261 0.0770  81  TYR B CA  
2624 C C   . TYR B 12  ? 0.4264 0.4385 0.4198 0.0186  -0.0268 0.0696  81  TYR B C   
2625 O O   . TYR B 12  ? 0.5988 0.6052 0.5868 0.0216  -0.0236 0.0628  81  TYR B O   
2626 C CB  . TYR B 12  ? 0.3620 0.3853 0.3656 0.0369  -0.0231 0.0743  81  TYR B CB  
2627 C CG  . TYR B 12  ? 0.4514 0.4623 0.4480 0.0362  -0.0257 0.0705  81  TYR B CG  
2628 C CD1 . TYR B 12  ? 0.4613 0.4729 0.4619 0.0359  -0.0297 0.0761  81  TYR B CD1 
2629 C CD2 . TYR B 12  ? 0.4641 0.4630 0.4503 0.0356  -0.0243 0.0619  81  TYR B CD2 
2630 C CE1 . TYR B 12  ? 0.5123 0.5117 0.5058 0.0350  -0.0323 0.0730  81  TYR B CE1 
2631 C CE2 . TYR B 12  ? 0.4468 0.4343 0.4261 0.0343  -0.0267 0.0587  81  TYR B CE2 
2632 C CZ  . TYR B 12  ? 0.5225 0.5097 0.5051 0.0340  -0.0307 0.0641  81  TYR B CZ  
2633 O OH  . TYR B 12  ? 0.5988 0.5738 0.5740 0.0324  -0.0333 0.0612  81  TYR B OH  
2634 N N   . MET B 13  ? 0.3550 0.3629 0.3456 0.0086  -0.0310 0.0713  82  MET B N   
2635 C CA  . MET B 13  ? 0.3754 0.3705 0.3557 0.0011  -0.0316 0.0647  82  MET B CA  
2636 C C   . MET B 13  ? 0.3661 0.3580 0.3431 0.0008  -0.0274 0.0588  82  MET B C   
2637 O O   . MET B 13  ? 0.4848 0.4677 0.4549 -0.0003 -0.0259 0.0519  82  MET B O   
2638 C CB  . MET B 13  ? 0.4591 0.4453 0.4337 0.0035  -0.0326 0.0605  82  MET B CB  
2639 C CG  . MET B 13  ? 0.5894 0.5788 0.5685 0.0061  -0.0364 0.0668  82  MET B CG  
2640 S SD  . MET B 13  ? 0.6986 0.6744 0.6683 0.0016  -0.0403 0.0637  82  MET B SD  
2641 C CE  . MET B 13  ? 0.7138 0.6810 0.6762 0.0070  -0.0354 0.0535  82  MET B CE  
2642 N N   . ASP B 14  ? 0.4826 0.4822 0.4649 0.0018  -0.0255 0.0619  83  ASP B N   
2643 C CA  . ASP B 14  ? 0.4065 0.4039 0.3869 0.0014  -0.0219 0.0579  83  ASP B CA  
2644 C C   . ASP B 14  ? 0.3718 0.3679 0.3506 0.0091  -0.0184 0.0522  83  ASP B C   
2645 O O   . ASP B 14  ? 0.3467 0.3403 0.3239 0.0090  -0.0157 0.0486  83  ASP B O   
2646 C CB  . ASP B 14  ? 0.4206 0.4076 0.3940 -0.0081 -0.0222 0.0541  83  ASP B CB  
2647 C CG  . ASP B 14  ? 0.5804 0.5677 0.5536 -0.0170 -0.0255 0.0594  83  ASP B CG  
2648 O OD1 . ASP B 14  ? 0.5361 0.5325 0.5158 -0.0164 -0.0259 0.0655  83  ASP B OD1 
2649 O OD2 . ASP B 14  ? 0.6934 0.6722 0.6597 -0.0251 -0.0277 0.0577  83  ASP B OD2 
2650 N N   . THR B 15  ? 0.3267 0.3237 0.3055 0.0156  -0.0185 0.0515  84  THR B N   
2651 C CA  . THR B 15  ? 0.3122 0.3065 0.2875 0.0217  -0.0157 0.0459  84  THR B CA  
2652 C C   . THR B 15  ? 0.3570 0.3591 0.3359 0.0310  -0.0134 0.0480  84  THR B C   
2653 O O   . THR B 15  ? 0.3502 0.3516 0.3261 0.0354  -0.0108 0.0441  84  THR B O   
2654 C CB  . THR B 15  ? 0.3577 0.3419 0.3258 0.0202  -0.0173 0.0408  84  THR B CB  
2655 O OG1 . THR B 15  ? 0.3921 0.3764 0.3613 0.0226  -0.0196 0.0441  84  THR B OG1 
2656 C CG2 . THR B 15  ? 0.5246 0.5012 0.4883 0.0110  -0.0187 0.0382  84  THR B CG2 
2657 N N   . GLN B 16  ? 0.2617 0.2716 0.2470 0.0338  -0.0140 0.0543  85  GLN B N   
2658 C CA  . GLN B 16  ? 0.3267 0.3443 0.3156 0.0430  -0.0108 0.0564  85  GLN B CA  
2659 C C   . GLN B 16  ? 0.3298 0.3604 0.3282 0.0431  -0.0104 0.0643  85  GLN B C   
2660 O O   . GLN B 16  ? 0.3962 0.4308 0.4001 0.0400  -0.0134 0.0700  85  GLN B O   
2661 C CB  . GLN B 16  ? 0.3799 0.3938 0.3675 0.0485  -0.0112 0.0559  85  GLN B CB  
2662 C CG  . GLN B 16  ? 0.4500 0.4503 0.4278 0.0467  -0.0125 0.0488  85  GLN B CG  
2663 C CD  . GLN B 16  ? 0.4513 0.4464 0.4257 0.0540  -0.0114 0.0470  85  GLN B CD  
2664 O OE1 . GLN B 16  ? 0.4991 0.5004 0.4773 0.0620  -0.0082 0.0495  85  GLN B OE1 
2665 N NE2 . GLN B 16  ? 0.3420 0.3252 0.3089 0.0514  -0.0138 0.0426  85  GLN B NE2 
2666 N N   . TYR B 17  ? 0.3503 0.3878 0.3507 0.0461  -0.0071 0.0652  86  TYR B N   
2667 C CA  . TYR B 17  ? 0.3651 0.4155 0.3741 0.0463  -0.0062 0.0728  86  TYR B CA  
2668 C C   . TYR B 17  ? 0.3870 0.4457 0.3985 0.0559  -0.0014 0.0740  86  TYR B C   
2669 O O   . TYR B 17  ? 0.4834 0.5403 0.4896 0.0593  0.0017  0.0699  86  TYR B O   
2670 C CB  . TYR B 17  ? 0.2881 0.3392 0.2968 0.0405  -0.0062 0.0733  86  TYR B CB  
2671 C CG  . TYR B 17  ? 0.3370 0.3800 0.3431 0.0308  -0.0098 0.0724  86  TYR B CG  
2672 C CD1 . TYR B 17  ? 0.3519 0.3827 0.3504 0.0280  -0.0106 0.0654  86  TYR B CD1 
2673 C CD2 . TYR B 17  ? 0.3754 0.4231 0.3861 0.0240  -0.0123 0.0786  86  TYR B CD2 
2674 C CE1 . TYR B 17  ? 0.3247 0.3476 0.3201 0.0192  -0.0131 0.0642  86  TYR B CE1 
2675 C CE2 . TYR B 17  ? 0.4537 0.4926 0.4603 0.0147  -0.0152 0.0773  86  TYR B CE2 
2676 C CZ  . TYR B 17  ? 0.4168 0.4431 0.4155 0.0126  -0.0152 0.0699  86  TYR B CZ  
2677 O OH  . TYR B 17  ? 0.4075 0.4246 0.4014 0.0035  -0.0172 0.0683  86  TYR B OH  
2678 N N   . TYR B 18  ? 0.3648 0.4328 0.3844 0.0601  -0.0008 0.0799  87  TYR B N   
2679 C CA  . TYR B 18  ? 0.4080 0.4829 0.4295 0.0701  0.0047  0.0806  87  TYR B CA  
2680 C C   . TYR B 18  ? 0.4315 0.5232 0.4657 0.0720  0.0060  0.0900  87  TYR B C   
2681 O O   . TYR B 18  ? 0.3094 0.4063 0.3511 0.0670  0.0019  0.0962  87  TYR B O   
2682 C CB  . TYR B 18  ? 0.3886 0.4548 0.4055 0.0768  0.0058  0.0762  87  TYR B CB  
2683 C CG  . TYR B 18  ? 0.3973 0.4620 0.4194 0.0749  0.0014  0.0797  87  TYR B CG  
2684 C CD1 . TYR B 18  ? 0.3594 0.4355 0.3928 0.0797  0.0022  0.0874  87  TYR B CD1 
2685 C CD2 . TYR B 18  ? 0.2361 0.2884 0.2518 0.0682  -0.0034 0.0759  87  TYR B CD2 
2686 C CE1 . TYR B 18  ? 0.3784 0.4535 0.4168 0.0777  -0.0024 0.0915  87  TYR B CE1 
2687 C CE2 . TYR B 18  ? 0.4029 0.4535 0.4224 0.0658  -0.0078 0.0795  87  TYR B CE2 
2688 C CZ  . TYR B 18  ? 0.5024 0.5644 0.5333 0.0706  -0.0076 0.0875  87  TYR B CZ  
2689 O OH  . TYR B 18  ? 0.6753 0.7360 0.7102 0.0680  -0.0126 0.0919  87  TYR B OH  
2690 N N   . GLY B 19  ? 0.4049 0.5053 0.4409 0.0791  0.0118  0.0913  88  GLY B N   
2691 C CA  . GLY B 19  ? 0.3421 0.4599 0.3904 0.0822  0.0143  0.1001  88  GLY B CA  
2692 C C   . GLY B 19  ? 0.3681 0.4900 0.4183 0.0940  0.0208  0.0996  88  GLY B C   
2693 O O   . GLY B 19  ? 0.5093 0.6189 0.5502 0.0994  0.0230  0.0923  88  GLY B O   
2694 N N   . GLU B 20  ? 0.3369 0.4759 0.3990 0.0978  0.0242  0.1076  89  GLU B N   
2695 C CA  . GLU B 20  ? 0.3743 0.5191 0.4407 0.1096  0.0312  0.1085  89  GLU B CA  
2696 C C   . GLU B 20  ? 0.4010 0.5537 0.4648 0.1144  0.0388  0.1080  89  GLU B C   
2697 O O   . GLU B 20  ? 0.4736 0.6383 0.5423 0.1094  0.0387  0.1134  89  GLU B O   
2698 C CB  . GLU B 20  ? 0.4473 0.6047 0.5287 0.1094  0.0302  0.1169  89  GLU B CB  
2699 C CG  . GLU B 20  ? 0.7221 0.8816 0.8067 0.1200  0.0372  0.1164  89  GLU B CG  
2700 C CD  . GLU B 20  ? 0.9654 1.1316 1.0627 0.1188  0.0344  0.1229  89  GLU B CD  
2701 O OE1 . GLU B 20  ? 1.0180 1.1779 1.1162 0.1125  0.0268  0.1236  89  GLU B OE1 
2702 O OE2 . GLU B 20  ? 0.9919 1.1698 1.0981 0.1240  0.0397  0.1276  89  GLU B OE2 
2703 N N   . ILE B 21  ? 0.4056 0.5505 0.4605 0.1234  0.0452  0.1014  90  ILE B N   
2704 C CA  . ILE B 21  ? 0.4698 0.6222 0.5218 0.1297  0.0538  0.1010  90  ILE B CA  
2705 C C   . ILE B 21  ? 0.4791 0.6319 0.5337 0.1407  0.0609  0.1003  90  ILE B C   
2706 O O   . ILE B 21  ? 0.5538 0.6953 0.6070 0.1437  0.0592  0.0972  90  ILE B O   
2707 C CB  . ILE B 21  ? 0.3823 0.5215 0.4162 0.1279  0.0551  0.0920  90  ILE B CB  
2708 C CG1 . ILE B 21  ? 0.3798 0.4992 0.4009 0.1317  0.0550  0.0826  90  ILE B CG1 
2709 C CG2 . ILE B 21  ? 0.3668 0.5042 0.3982 0.1166  0.0482  0.0925  90  ILE B CG2 
2710 C CD1 . ILE B 21  ? 0.4258 0.5329 0.4293 0.1295  0.0557  0.0742  90  ILE B CD1 
2711 N N   . GLY B 22  ? 0.3982 0.5617 0.4549 0.1450  0.0684  0.1028  91  GLY B N   
2712 C CA  . GLY B 22  ? 0.3828 0.5443 0.4392 0.1540  0.0757  0.1011  91  GLY B CA  
2713 C C   . GLY B 22  ? 0.6371 0.7925 0.6788 0.1598  0.0840  0.0942  91  GLY B C   
2714 O O   . GLY B 22  ? 0.7299 0.8934 0.7684 0.1569  0.0861  0.0954  91  GLY B O   
2715 N N   . ILE B 23  ? 0.7059 0.8463 0.7378 0.1672  0.0884  0.0869  92  ILE B N   
2716 C CA  . ILE B 23  ? 0.7176 0.8482 0.7324 0.1719  0.0959  0.0790  92  ILE B CA  
2717 C C   . ILE B 23  ? 0.7445 0.8736 0.7607 0.1804  0.1037  0.0783  92  ILE B C   
2718 O O   . ILE B 23  ? 0.7294 0.8487 0.7476 0.1849  0.1033  0.0764  92  ILE B O   
2719 C CB  . ILE B 23  ? 0.6379 0.7475 0.6350 0.1717  0.0936  0.0691  92  ILE B CB  
2720 C CG1 . ILE B 23  ? 0.6437 0.7551 0.6417 0.1636  0.0854  0.0702  92  ILE B CG1 
2721 C CG2 . ILE B 23  ? 0.5774 0.6770 0.5551 0.1744  0.1005  0.0611  92  ILE B CG2 
2722 C CD1 . ILE B 23  ? 0.6336 0.7229 0.6146 0.1592  0.0802  0.0607  92  ILE B CD1 
2723 N N   . GLY B 24  ? 0.8096 0.9480 0.8249 0.1826  0.1109  0.0798  93  GLY B N   
2724 C CA  . GLY B 24  ? 0.9508 1.0863 0.9646 0.1910  0.1196  0.0776  93  GLY B CA  
2725 C C   . GLY B 24  ? 0.9559 1.1121 0.9885 0.1929  0.1227  0.0873  93  GLY B C   
2726 O O   . GLY B 24  ? 0.9940 1.1666 1.0408 0.1871  0.1175  0.0962  93  GLY B O   
2727 N N   . THR B 25  ? 0.8869 1.0415 0.9186 0.2009  0.1314  0.0854  94  THR B N   
2728 C CA  . THR B 25  ? 0.8410 1.0134 0.8907 0.2047  0.1354  0.0939  94  THR B CA  
2729 C C   . THR B 25  ? 0.8175 0.9800 0.8703 0.2137  0.1392  0.0915  94  THR B C   
2730 O O   . THR B 25  ? 0.9563 1.1063 0.9973 0.2205  0.1473  0.0840  94  THR B O   
2731 C CB  . THR B 25  ? 0.8843 1.0672 0.9313 0.2060  0.1436  0.0948  94  THR B CB  
2732 O OG1 . THR B 25  ? 0.8819 1.0708 0.9231 0.1975  0.1399  0.0959  94  THR B OG1 
2733 C CG2 . THR B 25  ? 0.8686 1.0723 0.9358 0.2088  0.1466  0.1048  94  THR B CG2 
2734 N N   . PRO B 26  ? 0.7056 0.8729 0.7739 0.2137  0.1336  0.0977  95  PRO B N   
2735 C CA  . PRO B 26  ? 0.7210 0.9025 0.8033 0.2053  0.1241  0.1066  95  PRO B CA  
2736 C C   . PRO B 26  ? 0.6888 0.8586 0.7611 0.1979  0.1157  0.1022  95  PRO B C   
2737 O O   . PRO B 26  ? 0.6517 0.8014 0.7081 0.2004  0.1165  0.0928  95  PRO B O   
2738 C CB  . PRO B 26  ? 0.6814 0.8670 0.7801 0.2093  0.1223  0.1124  95  PRO B CB  
2739 C CG  . PRO B 26  ? 0.6560 0.8208 0.7441 0.2180  0.1270  0.1036  95  PRO B CG  
2740 C CD  . PRO B 26  ? 0.6605 0.8167 0.7316 0.2219  0.1360  0.0953  95  PRO B CD  
2741 N N   . PRO B 27  ? 0.6683 0.8497 0.7491 0.1888  0.1077  0.1089  96  PRO B N   
2742 C CA  . PRO B 27  ? 0.7889 0.9606 0.8604 0.1816  0.1003  0.1048  96  PRO B CA  
2743 C C   . PRO B 27  ? 0.7895 0.9480 0.8614 0.1814  0.0939  0.1024  96  PRO B C   
2744 O O   . PRO B 27  ? 0.7408 0.9071 0.8272 0.1786  0.0885  0.1094  96  PRO B O   
2745 C CB  . PRO B 27  ? 0.7371 0.9270 0.8192 0.1721  0.0948  0.1136  96  PRO B CB  
2746 C CG  . PRO B 27  ? 0.6026 0.8111 0.6970 0.1745  0.1002  0.1215  96  PRO B CG  
2747 C CD  . PRO B 27  ? 0.5849 0.7890 0.6833 0.1841  0.1055  0.1203  96  PRO B CD  
2748 N N   . GLN B 28  ? 0.7412 0.8793 0.7968 0.1837  0.0942  0.0926  97  GLN B N   
2749 C CA  . GLN B 28  ? 0.6951 0.8190 0.7486 0.1821  0.0873  0.0897  97  GLN B CA  
2750 C C   . GLN B 28  ? 0.6708 0.7952 0.7226 0.1724  0.0787  0.0903  97  GLN B C   
2751 O O   . GLN B 28  ? 0.5557 0.6752 0.5952 0.1702  0.0793  0.0852  97  GLN B O   
2752 C CB  . GLN B 28  ? 0.7639 0.8648 0.7998 0.1885  0.0913  0.0791  97  GLN B CB  
2753 C CG  . GLN B 28  ? 0.8571 0.9556 0.8877 0.1972  0.1019  0.0758  97  GLN B CG  
2754 C CD  . GLN B 28  ? 0.9000 0.9739 0.9110 0.2020  0.1055  0.0648  97  GLN B CD  
2755 O OE1 . GLN B 28  ? 0.9196 0.9784 0.9258 0.2013  0.1004  0.0612  97  GLN B OE1 
2756 N NE2 . GLN B 28  ? 0.8508 0.9199 0.8498 0.2063  0.1140  0.0594  97  GLN B NE2 
2757 N N   . THR B 29  ? 0.6799 0.8100 0.7437 0.1665  0.0707  0.0964  98  THR B N   
2758 C CA  . THR B 29  ? 0.5913 0.7242 0.6560 0.1564  0.0625  0.0984  98  THR B CA  
2759 C C   . THR B 29  ? 0.6095 0.7230 0.6620 0.1545  0.0572  0.0911  98  THR B C   
2760 O O   . THR B 29  ? 0.5579 0.6582 0.6069 0.1586  0.0567  0.0876  98  THR B O   
2761 C CB  . THR B 29  ? 0.5762 0.7231 0.6577 0.1496  0.0561  0.1083  98  THR B CB  
2762 O OG1 . THR B 29  ? 0.6398 0.7814 0.7271 0.1529  0.0542  0.1094  98  THR B OG1 
2763 C CG2 . THR B 29  ? 0.4746 0.6420 0.5674 0.1495  0.0604  0.1162  98  THR B CG2 
2764 N N   . PHE B 30  ? 0.6817 0.7938 0.7282 0.1479  0.0531  0.0893  99  PHE B N   
2765 C CA  . PHE B 30  ? 0.6288 0.7233 0.6631 0.1449  0.0478  0.0825  99  PHE B CA  
2766 C C   . PHE B 30  ? 0.5336 0.6311 0.5701 0.1322  0.0394  0.0850  99  PHE B C   
2767 O O   . PHE B 30  ? 0.4946 0.6056 0.5372 0.1276  0.0392  0.0900  99  PHE B O   
2768 C CB  . PHE B 30  ? 0.5925 0.6738 0.6081 0.1465  0.0523  0.0725  99  PHE B CB  
2769 C CG  . PHE B 30  ? 0.7058 0.7787 0.7149 0.1581  0.0604  0.0680  99  PHE B CG  
2770 C CD1 . PHE B 30  ? 0.7597 0.8141 0.7603 0.1610  0.0591  0.0623  99  PHE B CD1 
2771 C CD2 . PHE B 30  ? 0.7887 0.8707 0.7986 0.1646  0.0693  0.0690  99  PHE B CD2 
2772 C CE1 . PHE B 30  ? 0.7866 0.8306 0.7794 0.1704  0.0665  0.0574  99  PHE B CE1 
2773 C CE2 . PHE B 30  ? 0.7873 0.8588 0.7889 0.1726  0.0765  0.0637  99  PHE B CE2 
2774 C CZ  . PHE B 30  ? 0.7427 0.7949 0.7358 0.1755  0.0750  0.0579  99  PHE B CZ  
2775 N N   . LYS B 31  ? 0.4291 0.5130 0.4599 0.1264  0.0327  0.0814  100 LYS B N   
2776 C CA  . LYS B 31  ? 0.3987 0.4809 0.4278 0.1145  0.0255  0.0814  100 LYS B CA  
2777 C C   . LYS B 31  ? 0.4556 0.5265 0.4696 0.1111  0.0260  0.0727  100 LYS B C   
2778 O O   . LYS B 31  ? 0.4789 0.5350 0.4813 0.1136  0.0267  0.0652  100 LYS B O   
2779 C CB  . LYS B 31  ? 0.4409 0.5147 0.4711 0.1095  0.0184  0.0820  100 LYS B CB  
2780 C CG  . LYS B 31  ? 0.4362 0.5214 0.4817 0.1108  0.0160  0.0916  100 LYS B CG  
2781 C CD  . LYS B 31  ? 0.5000 0.5731 0.5431 0.1074  0.0097  0.0906  100 LYS B CD  
2782 C CE  . LYS B 31  ? 0.5141 0.5979 0.5718 0.1074  0.0063  0.1003  100 LYS B CE  
2783 N NZ  . LYS B 31  ? 0.4519 0.5235 0.5074 0.1107  0.0040  0.0988  100 LYS B NZ  
2784 N N   . VAL B 32  ? 0.3459 0.4238 0.3603 0.1053  0.0253  0.0741  101 VAL B N   
2785 C CA  . VAL B 32  ? 0.4449 0.5145 0.4468 0.1024  0.0256  0.0673  101 VAL B CA  
2786 C C   . VAL B 32  ? 0.4334 0.5030 0.4362 0.0921  0.0201  0.0682  101 VAL B C   
2787 O O   . VAL B 32  ? 0.3971 0.4767 0.4097 0.0876  0.0178  0.0749  101 VAL B O   
2788 C CB  . VAL B 32  ? 0.4219 0.4989 0.4207 0.1075  0.0323  0.0672  101 VAL B CB  
2789 C CG1 . VAL B 32  ? 0.3841 0.4564 0.3776 0.1176  0.0386  0.0638  101 VAL B CG1 
2790 C CG2 . VAL B 32  ? 0.3474 0.4425 0.3587 0.1065  0.0337  0.0762  101 VAL B CG2 
2791 N N   . VAL B 33  ? 0.3924 0.4504 0.3847 0.0884  0.0180  0.0614  102 VAL B N   
2792 C CA  . VAL B 33  ? 0.3322 0.3888 0.3240 0.0800  0.0140  0.0610  102 VAL B CA  
2793 C C   . VAL B 33  ? 0.4124 0.4747 0.4014 0.0805  0.0168  0.0614  102 VAL B C   
2794 O O   . VAL B 33  ? 0.3570 0.4162 0.3376 0.0850  0.0201  0.0573  102 VAL B O   
2795 C CB  . VAL B 33  ? 0.3861 0.4285 0.3693 0.0760  0.0104  0.0540  102 VAL B CB  
2796 C CG1 . VAL B 33  ? 0.3886 0.4295 0.3706 0.0690  0.0079  0.0530  102 VAL B CG1 
2797 C CG2 . VAL B 33  ? 0.5064 0.5434 0.4923 0.0738  0.0069  0.0546  102 VAL B CG2 
2798 N N   . PHE B 34  ? 0.3731 0.4429 0.3684 0.0754  0.0154  0.0665  103 PHE B N   
2799 C CA  . PHE B 34  ? 0.4286 0.5037 0.4219 0.0750  0.0173  0.0679  103 PHE B CA  
2800 C C   . PHE B 34  ? 0.4227 0.4890 0.4103 0.0699  0.0141  0.0636  103 PHE B C   
2801 O O   . PHE B 34  ? 0.4034 0.4674 0.3948 0.0637  0.0107  0.0649  103 PHE B O   
2802 C CB  . PHE B 34  ? 0.3342 0.4218 0.3373 0.0723  0.0176  0.0762  103 PHE B CB  
2803 C CG  . PHE B 34  ? 0.3650 0.4639 0.3755 0.0776  0.0212  0.0813  103 PHE B CG  
2804 C CD1 . PHE B 34  ? 0.3567 0.4632 0.3655 0.0840  0.0270  0.0823  103 PHE B CD1 
2805 C CD2 . PHE B 34  ? 0.4109 0.5130 0.4299 0.0762  0.0189  0.0853  103 PHE B CD2 
2806 C CE1 . PHE B 34  ? 0.3786 0.4962 0.3952 0.0895  0.0310  0.0872  103 PHE B CE1 
2807 C CE2 . PHE B 34  ? 0.4424 0.5563 0.4700 0.0816  0.0221  0.0908  103 PHE B CE2 
2808 C CZ  . PHE B 34  ? 0.3549 0.4767 0.3818 0.0886  0.0285  0.0916  103 PHE B CZ  
2809 N N   . ASP B 35  ? 0.3269 0.3884 0.3052 0.0724  0.0153  0.0586  104 ASP B N   
2810 C CA  . ASP B 35  ? 0.2334 0.2861 0.2062 0.0687  0.0122  0.0537  104 ASP B CA  
2811 C C   . ASP B 35  ? 0.3447 0.4010 0.3143 0.0683  0.0127  0.0549  104 ASP B C   
2812 O O   . ASP B 35  ? 0.3389 0.3963 0.3011 0.0720  0.0152  0.0533  104 ASP B O   
2813 C CB  . ASP B 35  ? 0.3098 0.3526 0.2738 0.0711  0.0120  0.0468  104 ASP B CB  
2814 C CG  . ASP B 35  ? 0.4618 0.4977 0.4193 0.0679  0.0093  0.0420  104 ASP B CG  
2815 O OD1 . ASP B 35  ? 0.4923 0.5283 0.4542 0.0632  0.0068  0.0432  104 ASP B OD1 
2816 O OD2 . ASP B 35  ? 0.4506 0.4804 0.3987 0.0700  0.0098  0.0370  104 ASP B OD2 
2817 N N   . THR B 36  ? 0.2890 0.3466 0.2637 0.0636  0.0104  0.0579  105 THR B N   
2818 C CA  . THR B 36  ? 0.3270 0.3873 0.2995 0.0629  0.0101  0.0596  105 THR B CA  
2819 C C   . THR B 36  ? 0.3910 0.4449 0.3561 0.0626  0.0081  0.0542  105 THR B C   
2820 O O   . THR B 36  ? 0.3417 0.3980 0.3043 0.0622  0.0074  0.0557  105 THR B O   
2821 C CB  . THR B 36  ? 0.3406 0.4021 0.3205 0.0582  0.0082  0.0641  105 THR B CB  
2822 O OG1 . THR B 36  ? 0.3188 0.3725 0.3016 0.0546  0.0058  0.0612  105 THR B OG1 
2823 C CG2 . THR B 36  ? 0.2406 0.3103 0.2266 0.0578  0.0099  0.0707  105 THR B CG2 
2824 N N   . GLY B 37  ? 0.3719 0.4179 0.3337 0.0623  0.0069  0.0486  106 GLY B N   
2825 C CA  . GLY B 37  ? 0.2917 0.3319 0.2468 0.0613  0.0047  0.0435  106 GLY B CA  
2826 C C   . GLY B 37  ? 0.3970 0.4348 0.3407 0.0646  0.0062  0.0398  106 GLY B C   
2827 O O   . GLY B 37  ? 0.4122 0.4454 0.3492 0.0630  0.0040  0.0359  106 GLY B O   
2828 N N   . SER B 38  ? 0.3972 0.4380 0.3385 0.0690  0.0101  0.0409  107 SER B N   
2829 C CA  . SER B 38  ? 0.4626 0.5003 0.3919 0.0725  0.0127  0.0373  107 SER B CA  
2830 C C   . SER B 38  ? 0.5091 0.5557 0.4381 0.0761  0.0172  0.0417  107 SER B C   
2831 O O   . SER B 38  ? 0.4793 0.5342 0.4179 0.0756  0.0179  0.0476  107 SER B O   
2832 C CB  . SER B 38  ? 0.4966 0.5255 0.4214 0.0752  0.0139  0.0323  107 SER B CB  
2833 O OG  . SER B 38  ? 0.6017 0.6343 0.5351 0.0781  0.0163  0.0355  107 SER B OG  
2834 N N   . SER B 39  ? 0.5535 0.5978 0.4705 0.0792  0.0204  0.0387  108 SER B N   
2835 C CA  . SER B 39  ? 0.6321 0.6849 0.5469 0.0821  0.0250  0.0426  108 SER B CA  
2836 C C   . SER B 39  ? 0.6203 0.6715 0.5284 0.0886  0.0316  0.0401  108 SER B C   
2837 O O   . SER B 39  ? 0.6683 0.7276 0.5754 0.0913  0.0363  0.0434  108 SER B O   
2838 C CB  . SER B 39  ? 0.5336 0.5875 0.4392 0.0789  0.0230  0.0429  108 SER B CB  
2839 O OG  . SER B 39  ? 0.4941 0.5521 0.4083 0.0741  0.0181  0.0472  108 SER B OG  
2840 N N   . ASN B 40  ? 0.4897 0.5309 0.3936 0.0913  0.0323  0.0346  109 ASN B N   
2841 C CA  . ASN B 40  ? 0.4295 0.4675 0.3269 0.0983  0.0391  0.0319  109 ASN B CA  
2842 C C   . ASN B 40  ? 0.4983 0.5399 0.4087 0.1026  0.0411  0.0347  109 ASN B C   
2843 O O   . ASN B 40  ? 0.5987 0.6390 0.5181 0.0997  0.0364  0.0358  109 ASN B O   
2844 C CB  . ASN B 40  ? 0.3649 0.3873 0.2463 0.0987  0.0390  0.0236  109 ASN B CB  
2845 C CG  . ASN B 40  ? 0.4212 0.4402 0.2884 0.0940  0.0368  0.0209  109 ASN B CG  
2846 O OD1 . ASN B 40  ? 0.4118 0.4316 0.2810 0.0877  0.0304  0.0218  109 ASN B OD1 
2847 N ND2 . ASN B 40  ? 0.5085 0.5238 0.3613 0.0971  0.0422  0.0179  109 ASN B ND2 
2848 N N   . VAL B 41  ? 0.5007 0.5473 0.4121 0.1096  0.0482  0.0363  110 VAL B N   
2849 C CA  . VAL B 41  ? 0.5119 0.5615 0.4346 0.1149  0.0506  0.0389  110 VAL B CA  
2850 C C   . VAL B 41  ? 0.5588 0.5936 0.4716 0.1203  0.0533  0.0320  110 VAL B C   
2851 O O   . VAL B 41  ? 0.6101 0.6384 0.5090 0.1240  0.0586  0.0273  110 VAL B O   
2852 C CB  . VAL B 41  ? 0.3509 0.4159 0.2826 0.1200  0.0571  0.0454  110 VAL B CB  
2853 C CG1 . VAL B 41  ? 0.3468 0.4162 0.2918 0.1254  0.0590  0.0490  110 VAL B CG1 
2854 C CG2 . VAL B 41  ? 0.2943 0.3726 0.2346 0.1141  0.0544  0.0523  110 VAL B CG2 
2855 N N   . TRP B 42  ? 0.4010 0.4296 0.3196 0.1202  0.0497  0.0314  111 TRP B N   
2856 C CA  . TRP B 42  ? 0.3854 0.3995 0.2959 0.1256  0.0521  0.0257  111 TRP B CA  
2857 C C   . TRP B 42  ? 0.4959 0.5122 0.4202 0.1291  0.0512  0.0298  111 TRP B C   
2858 O O   . TRP B 42  ? 0.4790 0.5020 0.4152 0.1239  0.0456  0.0345  111 TRP B O   
2859 C CB  . TRP B 42  ? 0.3587 0.3561 0.2549 0.1201  0.0470  0.0182  111 TRP B CB  
2860 C CG  . TRP B 42  ? 0.5266 0.5218 0.4292 0.1127  0.0388  0.0189  111 TRP B CG  
2861 C CD1 . TRP B 42  ? 0.6232 0.6221 0.5272 0.1046  0.0332  0.0196  111 TRP B CD1 
2862 C CD2 . TRP B 42  ? 0.5529 0.5411 0.4606 0.1128  0.0356  0.0187  111 TRP B CD2 
2863 N NE1 . TRP B 42  ? 0.6540 0.6487 0.5635 0.0998  0.0274  0.0196  111 TRP B NE1 
2864 C CE2 . TRP B 42  ? 0.5901 0.5784 0.5016 0.1042  0.0285  0.0191  111 TRP B CE2 
2865 C CE3 . TRP B 42  ? 0.6294 0.6114 0.5393 0.1194  0.0382  0.0186  111 TRP B CE3 
2866 C CZ2 . TRP B 42  ? 0.6913 0.6736 0.6072 0.1014  0.0240  0.0191  111 TRP B CZ2 
2867 C CZ3 . TRP B 42  ? 0.7117 0.6878 0.6265 0.1166  0.0330  0.0192  111 TRP B CZ3 
2868 C CH2 . TRP B 42  ? 0.7316 0.7079 0.6489 0.1073  0.0260  0.0193  111 TRP B CH2 
2869 N N   . VAL B 43  ? 0.5627 0.5730 0.4850 0.1379  0.0569  0.0281  112 VAL B N   
2870 C CA  . VAL B 43  ? 0.5630 0.5727 0.4967 0.1421  0.0560  0.0315  112 VAL B CA  
2871 C C   . VAL B 43  ? 0.6235 0.6132 0.5443 0.1472  0.0581  0.0244  112 VAL B C   
2872 O O   . VAL B 43  ? 0.6533 0.6320 0.5574 0.1489  0.0622  0.0175  112 VAL B O   
2873 C CB  . VAL B 43  ? 0.5205 0.5475 0.4701 0.1496  0.0617  0.0395  112 VAL B CB  
2874 C CG1 . VAL B 43  ? 0.3954 0.4411 0.3571 0.1434  0.0589  0.0468  112 VAL B CG1 
2875 C CG2 . VAL B 43  ? 0.4541 0.4799 0.3958 0.1589  0.0720  0.0366  112 VAL B CG2 
2876 N N   . PRO B 44  ? 0.5328 0.5166 0.4600 0.1489  0.0551  0.0259  113 PRO B N   
2877 C CA  . PRO B 44  ? 0.5788 0.5425 0.4939 0.1542  0.0573  0.0196  113 PRO B CA  
2878 C C   . PRO B 44  ? 0.6601 0.6232 0.5739 0.1665  0.0676  0.0191  113 PRO B C   
2879 O O   . PRO B 44  ? 0.6871 0.6664 0.6166 0.1727  0.0719  0.0263  113 PRO B O   
2880 C CB  . PRO B 44  ? 0.5415 0.5023 0.4668 0.1528  0.0511  0.0234  113 PRO B CB  
2881 C CG  . PRO B 44  ? 0.5205 0.4955 0.4573 0.1434  0.0440  0.0289  113 PRO B CG  
2882 C CD  . PRO B 44  ? 0.4389 0.4315 0.3820 0.1445  0.0484  0.0328  113 PRO B CD  
2883 N N   . SER B 45  ? 0.7460 0.6903 0.6408 0.1697  0.0720  0.0107  114 SER B N   
2884 C CA  . SER B 45  ? 0.9108 0.8519 0.8013 0.1804  0.0825  0.0088  114 SER B CA  
2885 C C   . SER B 45  ? 1.0033 0.9335 0.8980 0.1856  0.0831  0.0093  114 SER B C   
2886 O O   . SER B 45  ? 0.9599 0.8775 0.8525 0.1834  0.0771  0.0079  114 SER B O   
2887 C CB  . SER B 45  ? 0.9658 0.8922 0.8324 0.1782  0.0863  -0.0006 114 SER B CB  
2888 O OG  . SER B 45  ? 1.0434 0.9668 0.9068 0.1843  0.0947  -0.0021 114 SER B OG  
2889 N N   . SER B 46  ? 1.0442 0.9795 0.9451 0.1927  0.0907  0.0115  115 SER B N   
2890 C CA  . SER B 46  ? 0.9290 0.8524 0.8319 0.1986  0.0927  0.0110  115 SER B CA  
2891 C C   . SER B 46  ? 0.9008 0.7967 0.7803 0.1974  0.0932  0.0008  115 SER B C   
2892 O O   . SER B 46  ? 0.9666 0.8479 0.8446 0.1989  0.0908  -0.0005 115 SER B O   
2893 C CB  . SER B 46  ? 0.8090 0.7438 0.7226 0.2067  0.1014  0.0149  115 SER B CB  
2894 O OG  . SER B 46  ? 0.7887 0.7202 0.6880 0.2076  0.1088  0.0092  115 SER B OG  
2895 N N   . LYS B 47  ? 0.9181 0.8067 0.7790 0.1939  0.0960  -0.0063 116 LYS B N   
2896 C CA  . LYS B 47  ? 0.9734 0.8364 0.8107 0.1905  0.0955  -0.0160 116 LYS B CA  
2897 C C   . LYS B 47  ? 0.9659 0.8178 0.7952 0.1823  0.0859  -0.0188 116 LYS B C   
2898 O O   . LYS B 47  ? 0.9733 0.8048 0.7825 0.1772  0.0841  -0.0266 116 LYS B O   
2899 C CB  . LYS B 47  ? 0.9728 0.8330 0.7930 0.1878  0.1006  -0.0219 116 LYS B CB  
2900 C CG  . LYS B 47  ? 0.9942 0.8553 0.8146 0.1955  0.1108  -0.0225 116 LYS B CG  
2901 C CD  . LYS B 47  ? 1.0341 0.9211 0.8710 0.1990  0.1153  -0.0153 116 LYS B CD  
2902 C CE  . LYS B 47  ? 1.1424 1.0296 0.9761 0.2054  0.1259  -0.0171 116 LYS B CE  
2903 N NZ  . LYS B 47  ? 1.1590 1.0700 1.0039 0.2064  0.1300  -0.0113 116 LYS B NZ  
2904 N N   . CYS B 48  ? 0.9992 0.8634 0.8430 0.1800  0.0795  -0.0128 117 CYS B N   
2905 C CA  . CYS B 48  ? 1.0043 0.8567 0.8408 0.1726  0.0707  -0.0156 117 CYS B CA  
2906 C C   . CYS B 48  ? 0.9707 0.8040 0.8034 0.1740  0.0686  -0.0174 117 CYS B C   
2907 O O   . CYS B 48  ? 0.9911 0.8272 0.8364 0.1811  0.0715  -0.0127 117 CYS B O   
2908 C CB  . CYS B 48  ? 0.9727 0.8438 0.8275 0.1681  0.0637  -0.0080 117 CYS B CB  
2909 S SG  . CYS B 48  ? 0.9088 0.7681 0.7582 0.1552  0.0516  -0.0102 117 CYS B SG  
2910 N N   . SER B 49  ? 1.0029 0.8170 0.8185 0.1665  0.0631  -0.0239 118 SER B N   
2911 C CA  . SER B 49  ? 1.0212 0.8154 0.8309 0.1664  0.0607  -0.0260 118 SER B CA  
2912 C C   . SER B 49  ? 1.0379 0.8382 0.8656 0.1681  0.0553  -0.0183 118 SER B C   
2913 O O   . SER B 49  ? 0.9324 0.7462 0.7710 0.1649  0.0502  -0.0136 118 SER B O   
2914 C CB  . SER B 49  ? 1.0017 0.7765 0.7898 0.1561  0.0551  -0.0339 118 SER B CB  
2915 O OG  . SER B 49  ? 0.9803 0.7365 0.7633 0.1550  0.0519  -0.0352 118 SER B OG  
2916 N N   . ARG B 50  ? 1.1604 0.9505 0.9911 0.1728  0.0563  -0.0169 119 ARG B N   
2917 C CA  . ARG B 50  ? 1.1037 0.8971 0.9495 0.1732  0.0503  -0.0097 119 ARG B CA  
2918 C C   . ARG B 50  ? 0.9952 0.7741 0.8305 0.1634  0.0411  -0.0124 119 ARG B C   
2919 O O   . ARG B 50  ? 0.9565 0.7397 0.8032 0.1612  0.0347  -0.0063 119 ARG B O   
2920 C CB  . ARG B 50  ? 1.1517 0.9384 1.0038 0.1812  0.0541  -0.0073 119 ARG B CB  
2921 N N   . LEU B 51  ? 0.9736 0.7363 0.7875 0.1566  0.0400  -0.0211 120 LEU B N   
2922 C CA  . LEU B 51  ? 0.9644 0.7137 0.7674 0.1460  0.0315  -0.0242 120 LEU B CA  
2923 C C   . LEU B 51  ? 1.0075 0.7751 0.8171 0.1354  0.0256  -0.0224 120 LEU B C   
2924 O O   . LEU B 51  ? 1.0264 0.7889 0.8302 0.1242  0.0182  -0.0242 120 LEU B O   
2925 C CB  . LEU B 51  ? 1.0056 0.7335 0.7853 0.1403  0.0320  -0.0333 120 LEU B CB  
2926 C CG  . LEU B 51  ? 1.0396 0.7535 0.8151 0.1472  0.0374  -0.0346 120 LEU B CG  
2927 C CD1 . LEU B 51  ? 1.0049 0.7176 0.7711 0.1515  0.0460  -0.0395 120 LEU B CD1 
2928 C CD2 . LEU B 51  ? 1.0753 0.7664 0.8365 0.1400  0.0321  -0.0383 120 LEU B CD2 
2929 N N   . TYR B 52  ? 0.9314 0.7211 0.7536 0.1380  0.0287  -0.0186 121 TYR B N   
2930 C CA  . TYR B 52  ? 0.7869 0.5971 0.6205 0.1290  0.0234  -0.0147 121 TYR B CA  
2931 C C   . TYR B 52  ? 0.7751 0.6005 0.6301 0.1323  0.0215  -0.0052 121 TYR B C   
2932 O O   . TYR B 52  ? 0.8681 0.7055 0.7350 0.1416  0.0269  -0.0004 121 TYR B O   
2933 C CB  . TYR B 52  ? 0.6969 0.5209 0.5299 0.1288  0.0274  -0.0162 121 TYR B CB  
2934 C CG  . TYR B 52  ? 0.8443 0.6574 0.6576 0.1218  0.0267  -0.0244 121 TYR B CG  
2935 C CD1 . TYR B 52  ? 0.8756 0.6865 0.6839 0.1097  0.0191  -0.0265 121 TYR B CD1 
2936 C CD2 . TYR B 52  ? 0.8808 0.6864 0.6803 0.1269  0.0335  -0.0297 121 TYR B CD2 
2937 C CE1 . TYR B 52  ? 0.8448 0.6473 0.6362 0.1027  0.0178  -0.0330 121 TYR B CE1 
2938 C CE2 . TYR B 52  ? 0.8124 0.6084 0.5933 0.1194  0.0321  -0.0366 121 TYR B CE2 
2939 C CZ  . TYR B 52  ? 0.7417 0.5367 0.5192 0.1073  0.0239  -0.0380 121 TYR B CZ  
2940 O OH  . TYR B 52  ? 0.8465 0.6335 0.6067 0.0995  0.0218  -0.0440 121 TYR B OH  
2941 N N   . THR B 53  ? 0.6846 0.5096 0.5441 0.1243  0.0138  -0.0023 122 THR B N   
2942 C CA  . THR B 53  ? 0.7477 0.5835 0.6250 0.1267  0.0111  0.0067  122 THR B CA  
2943 C C   . THR B 53  ? 0.8294 0.6901 0.7233 0.1274  0.0125  0.0129  122 THR B C   
2944 O O   . THR B 53  ? 0.8121 0.6839 0.7213 0.1334  0.0134  0.0206  122 THR B O   
2945 C CB  . THR B 53  ? 0.6891 0.5194 0.5657 0.1163  0.0025  0.0081  122 THR B CB  
2946 O OG1 . THR B 53  ? 0.8662 0.6745 0.7247 0.1123  0.0007  0.0009  122 THR B OG1 
2947 C CG2 . THR B 53  ? 0.7148 0.5472 0.6043 0.1203  -0.0002 0.0164  122 THR B CG2 
2948 N N   . ALA B 54  ? 0.8439 0.7137 0.7353 0.1210  0.0123  0.0100  123 ALA B N   
2949 C CA  . ALA B 54  ? 0.8500 0.7421 0.7559 0.1212  0.0136  0.0157  123 ALA B CA  
2950 C C   . ALA B 54  ? 0.8301 0.7304 0.7436 0.1333  0.0213  0.0191  123 ALA B C   
2951 O O   . ALA B 54  ? 0.8924 0.8103 0.8222 0.1357  0.0218  0.0268  123 ALA B O   
2952 C CB  . ALA B 54  ? 0.8696 0.7675 0.7696 0.1137  0.0130  0.0115  123 ALA B CB  
2953 N N   . CYS B 55  ? 0.7968 0.6844 0.6985 0.1409  0.0276  0.0135  124 CYS B N   
2954 C CA  . CYS B 55  ? 0.7724 0.6670 0.6801 0.1529  0.0362  0.0159  124 CYS B CA  
2955 C C   . CYS B 55  ? 0.8711 0.7673 0.7923 0.1619  0.0373  0.0230  124 CYS B C   
2956 O O   . CYS B 55  ? 0.9175 0.8241 0.8485 0.1720  0.0442  0.0271  124 CYS B O   
2957 C CB  . CYS B 55  ? 0.7435 0.6221 0.6323 0.1577  0.0429  0.0071  124 CYS B CB  
2958 S SG  . CYS B 55  ? 0.7786 0.6624 0.6556 0.1496  0.0434  0.0013  124 CYS B SG  
2959 N N   . VAL B 56  ? 0.8729 0.7597 0.7951 0.1585  0.0307  0.0249  125 VAL B N   
2960 C CA  . VAL B 56  ? 0.8319 0.7220 0.7687 0.1659  0.0304  0.0330  125 VAL B CA  
2961 C C   . VAL B 56  ? 0.8449 0.7585 0.8016 0.1620  0.0259  0.0431  125 VAL B C   
2962 O O   . VAL B 56  ? 0.7235 0.6516 0.6970 0.1661  0.0277  0.0503  125 VAL B O   
2963 C CB  . VAL B 56  ? 0.7955 0.6649 0.7241 0.1634  0.0248  0.0313  125 VAL B CB  
2964 C CG1 . VAL B 56  ? 0.7201 0.5974 0.6665 0.1655  0.0218  0.0405  125 VAL B CG1 
2965 C CG2 . VAL B 56  ? 0.7201 0.5669 0.6303 0.1672  0.0299  0.0220  125 VAL B CG2 
2966 N N   . TYR B 57  ? 0.9525 0.8721 0.9081 0.1495  0.0195  0.0427  126 TYR B N   
2967 C CA  . TYR B 57  ? 0.8912 0.8290 0.8625 0.1432  0.0139  0.0514  126 TYR B CA  
2968 C C   . TYR B 57  ? 0.7531 0.7114 0.7332 0.1426  0.0172  0.0543  126 TYR B C   
2969 O O   . TYR B 57  ? 0.7397 0.7130 0.7317 0.1366  0.0127  0.0613  126 TYR B O   
2970 C CB  . TYR B 57  ? 0.9238 0.8551 0.8885 0.1297  0.0054  0.0493  126 TYR B CB  
2971 C CG  . TYR B 57  ? 0.9748 0.8950 0.9395 0.1277  -0.0007 0.0523  126 TYR B CG  
2972 C CD1 . TYR B 57  ? 1.0042 0.9030 0.9562 0.1311  -0.0002 0.0469  126 TYR B CD1 
2973 C CD2 . TYR B 57  ? 1.0383 0.9685 1.0144 0.1215  -0.0074 0.0606  126 TYR B CD2 
2974 C CE1 . TYR B 57  ? 1.0327 0.9208 0.9843 0.1289  -0.0061 0.0501  126 TYR B CE1 
2975 C CE2 . TYR B 57  ? 1.0928 1.0129 1.0683 0.1190  -0.0134 0.0638  126 TYR B CE2 
2976 C CZ  . TYR B 57  ? 1.0597 0.9589 1.0232 0.1228  -0.0128 0.0587  126 TYR B CZ  
2977 O OH  . TYR B 57  ? 0.9823 0.8713 0.9450 0.1200  -0.0190 0.0625  126 TYR B OH  
2978 N N   . HIS B 58  ? 0.6731 0.6319 0.6467 0.1480  0.0246  0.0493  127 HIS B N   
2979 C CA  . HIS B 58  ? 0.7036 0.6805 0.6838 0.1469  0.0277  0.0518  127 HIS B CA  
2980 C C   . HIS B 58  ? 0.7438 0.7292 0.7304 0.1594  0.0371  0.0542  127 HIS B C   
2981 O O   . HIS B 58  ? 0.9238 0.8974 0.9045 0.1674  0.0421  0.0505  127 HIS B O   
2982 C CB  . HIS B 58  ? 0.7092 0.6809 0.6751 0.1398  0.0277  0.0437  127 HIS B CB  
2983 C CG  . HIS B 58  ? 0.6272 0.5972 0.5908 0.1272  0.0196  0.0428  127 HIS B CG  
2984 N ND1 . HIS B 58  ? 0.6235 0.5765 0.5751 0.1216  0.0152  0.0369  127 HIS B ND1 
2985 C CD2 . HIS B 58  ? 0.6041 0.5870 0.5756 0.1191  0.0157  0.0469  127 HIS B CD2 
2986 C CE1 . HIS B 58  ? 0.5353 0.4915 0.4880 0.1110  0.0092  0.0374  127 HIS B CE1 
2987 N NE2 . HIS B 58  ? 0.5589 0.5323 0.5232 0.1094  0.0095  0.0432  127 HIS B NE2 
2988 N N   . LYS B 59  ? 0.5292 0.5349 0.5272 0.1593  0.0393  0.0599  128 LYS B N   
2989 C CA  . LYS B 59  ? 0.4987 0.5143 0.5018 0.1667  0.0481  0.0610  128 LYS B CA  
2990 C C   . LYS B 59  ? 0.6293 0.6325 0.6144 0.1715  0.0552  0.0517  128 LYS B C   
2991 O O   . LYS B 59  ? 0.7542 0.7495 0.7261 0.1657  0.0529  0.0457  128 LYS B O   
2992 C CB  . LYS B 59  ? 0.5351 0.5744 0.5523 0.1630  0.0483  0.0687  128 LYS B CB  
2993 C CG  . LYS B 59  ? 0.5559 0.6085 0.5826 0.1697  0.0563  0.0726  128 LYS B CG  
2994 C CD  . LYS B 59  ? 0.5708 0.6309 0.6136 0.1714  0.0542  0.0801  128 LYS B CD  
2995 C CE  . LYS B 59  ? 0.6504 0.7302 0.7091 0.1632  0.0483  0.0896  128 LYS B CE  
2996 N NZ  . LYS B 59  ? 0.6341 0.7331 0.7020 0.1649  0.0541  0.0948  128 LYS B NZ  
2997 N N   . LEU B 60  ? 0.6196 0.6206 0.6033 0.1795  0.0633  0.0499  129 LEU B N   
2998 C CA  . LEU B 60  ? 0.7333 0.7219 0.6988 0.1836  0.0705  0.0410  129 LEU B CA  
2999 C C   . LEU B 60  ? 0.8044 0.8084 0.7753 0.1879  0.0788  0.0437  129 LEU B C   
3000 O O   . LEU B 60  ? 0.8474 0.8675 0.8356 0.1903  0.0803  0.0516  129 LEU B O   
3001 C CB  . LEU B 60  ? 0.7009 0.6673 0.6550 0.1887  0.0729  0.0347  129 LEU B CB  
3002 C CG  . LEU B 60  ? 0.7498 0.7018 0.7016 0.1851  0.0648  0.0339  129 LEU B CG  
3003 C CD1 . LEU B 60  ? 0.7532 0.6831 0.6931 0.1901  0.0677  0.0277  129 LEU B CD1 
3004 C CD2 . LEU B 60  ? 0.7908 0.7359 0.7314 0.1773  0.0585  0.0298  129 LEU B CD2 
3005 N N   . PHE B 61  ? 0.7304 0.7295 0.6859 0.1882  0.0838  0.0373  130 PHE B N   
3006 C CA  . PHE B 61  ? 0.7373 0.7493 0.6950 0.1915  0.0918  0.0391  130 PHE B CA  
3007 C C   . PHE B 61  ? 0.9227 0.9204 0.8688 0.1986  0.1000  0.0328  130 PHE B C   
3008 O O   . PHE B 61  ? 1.0157 0.9942 0.9413 0.1979  0.1013  0.0237  130 PHE B O   
3009 C CB  . PHE B 61  ? 0.6620 0.6794 0.6106 0.1863  0.0919  0.0368  130 PHE B CB  
3010 C CG  . PHE B 61  ? 0.6126 0.6398 0.5593 0.1891  0.1002  0.0374  130 PHE B CG  
3011 C CD1 . PHE B 61  ? 0.6143 0.6636 0.5791 0.1901  0.1024  0.0466  130 PHE B CD1 
3012 C CD2 . PHE B 61  ? 0.5660 0.5800 0.4923 0.1900  0.1056  0.0289  130 PHE B CD2 
3013 C CE1 . PHE B 61  ? 0.5342 0.5925 0.4972 0.1924  0.1100  0.0473  130 PHE B CE1 
3014 C CE2 . PHE B 61  ? 0.5823 0.6050 0.5063 0.1920  0.1131  0.0295  130 PHE B CE2 
3015 C CZ  . PHE B 61  ? 0.5966 0.6416 0.5393 0.1935  0.1155  0.0387  130 PHE B CZ  
3016 N N   . ASP B 62  ? 0.9528 0.9597 0.9118 0.2051  0.1053  0.0378  131 ASP B N   
3017 C CA  . ASP B 62  ? 0.9606 0.9558 0.9109 0.2126  0.1140  0.0327  131 ASP B CA  
3018 C C   . ASP B 62  ? 0.9029 0.9067 0.8476 0.2136  0.1218  0.0315  131 ASP B C   
3019 O O   . ASP B 62  ? 0.7651 0.7899 0.7252 0.2150  0.1246  0.0390  131 ASP B O   
3020 C CB  . ASP B 62  ? 0.9591 0.9598 0.9268 0.2195  0.1159  0.0387  131 ASP B CB  
3021 C CG  . ASP B 62  ? 1.0039 0.9857 0.9610 0.2271  0.1228  0.0321  131 ASP B CG  
3022 O OD1 . ASP B 62  ? 1.0782 1.0529 1.0208 0.2291  0.1302  0.0258  131 ASP B OD1 
3023 O OD2 . ASP B 62  ? 0.9451 0.9185 0.9079 0.2306  0.1206  0.0332  131 ASP B OD2 
3024 N N   . ALA B 63  ? 0.9281 0.9156 0.8504 0.2122  0.1250  0.0221  132 ALA B N   
3025 C CA  . ALA B 63  ? 0.8922 0.8863 0.8067 0.2118  0.1318  0.0203  132 ALA B CA  
3026 C C   . ALA B 63  ? 0.9387 0.9386 0.8604 0.2202  0.1415  0.0222  132 ALA B C   
3027 O O   . ALA B 63  ? 0.8392 0.8572 0.7690 0.2208  0.1459  0.0271  132 ALA B O   
3028 C CB  . ALA B 63  ? 0.8212 0.7950 0.7091 0.2074  0.1322  0.0097  132 ALA B CB  
3029 N N   . SER B 64  ? 0.9898 0.9747 0.9088 0.2267  0.1450  0.0186  133 SER B N   
3030 C CA  . SER B 64  ? 1.0675 1.0565 0.9932 0.2354  0.1547  0.0198  133 SER B CA  
3031 C C   . SER B 64  ? 1.1193 1.1318 1.0724 0.2395  0.1545  0.0313  133 SER B C   
3032 O O   . SER B 64  ? 1.2136 1.2300 1.1746 0.2475  0.1623  0.0331  133 SER B O   
3033 C CB  . SER B 64  ? 1.0660 1.0309 0.9805 0.2412  0.1583  0.0125  133 SER B CB  
3034 O OG  . SER B 64  ? 1.0187 0.9813 0.9460 0.2436  0.1527  0.0167  133 SER B OG  
3035 N N   . ASP B 65  ? 1.0202 1.0480 0.9878 0.2341  0.1461  0.0392  134 ASP B N   
3036 C CA  . ASP B 65  ? 0.8822 0.9321 0.8753 0.2364  0.1448  0.0504  134 ASP B CA  
3037 C C   . ASP B 65  ? 0.8056 0.8792 0.8085 0.2311  0.1439  0.0577  134 ASP B C   
3038 O O   . ASP B 65  ? 0.8790 0.9713 0.9019 0.2294  0.1397  0.0675  134 ASP B O   
3039 C CB  . ASP B 65  ? 0.9510 0.9991 0.9545 0.2339  0.1352  0.0545  134 ASP B CB  
3040 C CG  . ASP B 65  ? 1.0637 1.0929 1.0639 0.2405  0.1365  0.0503  134 ASP B CG  
3041 O OD1 . ASP B 65  ? 1.0634 1.0772 1.0495 0.2461  0.1444  0.0427  134 ASP B OD1 
3042 O OD2 . ASP B 65  ? 1.0983 1.1275 1.1094 0.2398  0.1296  0.0547  134 ASP B OD2 
3043 N N   . SER B 66  ? 0.6980 0.7709 0.6869 0.2277  0.1472  0.0532  135 SER B N   
3044 C CA  . SER B 66  ? 0.7028 0.7972 0.6998 0.2225  0.1465  0.0600  135 SER B CA  
3045 C C   . SER B 66  ? 0.7328 0.8275 0.7177 0.2242  0.1556  0.0556  135 SER B C   
3046 O O   . SER B 66  ? 0.6949 0.7721 0.6586 0.2230  0.1579  0.0461  135 SER B O   
3047 C CB  . SER B 66  ? 0.6542 0.7499 0.6476 0.2129  0.1371  0.0606  135 SER B CB  
3048 O OG  . SER B 66  ? 0.6304 0.7186 0.6047 0.2090  0.1389  0.0538  135 SER B OG  
3049 N N   . SER B 67  ? 0.8169 0.9315 0.8152 0.2262  0.1606  0.0627  136 SER B N   
3050 C CA  . SER B 67  ? 0.7920 0.9084 0.7803 0.2279  0.1699  0.0591  136 SER B CA  
3051 C C   . SER B 67  ? 0.8400 0.9548 0.8129 0.2194  0.1672  0.0556  136 SER B C   
3052 O O   . SER B 67  ? 0.8056 0.9124 0.7617 0.2194  0.1736  0.0487  136 SER B O   
3053 C CB  . SER B 67  ? 0.6345 0.7748 0.6421 0.2309  0.1748  0.0685  136 SER B CB  
3054 N N   . SER B 68  ? 0.8482 0.9702 0.8262 0.2119  0.1579  0.0602  137 SER B N   
3055 C CA  . SER B 68  ? 0.7789 0.9023 0.7451 0.2037  0.1550  0.0585  137 SER B CA  
3056 C C   . SER B 68  ? 0.8319 0.9325 0.7752 0.2009  0.1526  0.0480  137 SER B C   
3057 O O   . SER B 68  ? 0.8907 0.9905 0.8214 0.1944  0.1511  0.0455  137 SER B O   
3058 C CB  . SER B 68  ? 0.6918 0.8315 0.6724 0.1967  0.1461  0.0675  137 SER B CB  
3059 O OG  . SER B 68  ? 0.6567 0.8145 0.6595 0.1989  0.1461  0.0774  137 SER B OG  
3060 N N   . TYR B 69  ? 0.8522 0.9345 0.7896 0.2049  0.1519  0.0421  138 TYR B N   
3061 C CA  . TYR B 69  ? 0.8925 0.9532 0.8087 0.2012  0.1483  0.0327  138 TYR B CA  
3062 C C   . TYR B 69  ? 0.9549 1.0051 0.8495 0.1998  0.1547  0.0246  138 TYR B C   
3063 O O   . TYR B 69  ? 1.0014 1.0537 0.8953 0.2048  0.1637  0.0236  138 TYR B O   
3064 C CB  . TYR B 69  ? 0.9109 0.9538 0.8256 0.2058  0.1466  0.0284  138 TYR B CB  
3065 C CG  . TYR B 69  ? 0.9738 0.9916 0.8644 0.2030  0.1450  0.0175  138 TYR B CG  
3066 C CD1 . TYR B 69  ? 0.9506 0.9633 0.8317 0.1950  0.1371  0.0151  138 TYR B CD1 
3067 C CD2 . TYR B 69  ? 1.0915 1.0907 0.9688 0.2078  0.1513  0.0096  138 TYR B CD2 
3068 C CE1 . TYR B 69  ? 1.0345 1.0248 0.8935 0.1914  0.1350  0.0055  138 TYR B CE1 
3069 C CE2 . TYR B 69  ? 1.1107 1.0866 0.9654 0.2040  0.1493  -0.0001 138 TYR B CE2 
3070 C CZ  . TYR B 69  ? 1.0990 1.0709 0.9448 0.1956  0.1409  -0.0019 138 TYR B CZ  
3071 O OH  . TYR B 69  ? 1.1285 1.0780 0.9520 0.1909  0.1383  -0.0111 138 TYR B OH  
3072 N N   . LYS B 70  ? 0.9725 1.0118 0.8494 0.1925  0.1499  0.0191  139 LYS B N   
3073 C CA  . LYS B 70  ? 0.9079 0.9353 0.7618 0.1891  0.1541  0.0110  139 LYS B CA  
3074 C C   . LYS B 70  ? 0.9134 0.9194 0.7481 0.1838  0.1479  0.0029  139 LYS B C   
3075 O O   . LYS B 70  ? 0.9797 0.9867 0.8176 0.1792  0.1393  0.0049  139 LYS B O   
3076 C CB  . LYS B 70  ? 0.7470 0.7901 0.5996 0.1829  0.1544  0.0152  139 LYS B CB  
3077 C CG  . LYS B 70  ? 0.7657 0.8041 0.6020 0.1822  0.1627  0.0097  139 LYS B CG  
3078 C CD  . LYS B 70  ? 0.7681 0.7911 0.5794 0.1735  0.1589  0.0021  139 LYS B CD  
3079 N N   . HIS B 71  ? 0.9366 0.9233 0.7514 0.1840  0.1523  -0.0063 140 HIS B N   
3080 C CA  . HIS B 71  ? 1.0646 1.0292 0.8613 0.1792  0.1468  -0.0143 140 HIS B CA  
3081 C C   . HIS B 71  ? 1.1349 1.0981 0.9156 0.1685  0.1412  -0.0167 140 HIS B C   
3082 O O   . HIS B 71  ? 1.2863 1.2546 1.0583 0.1651  0.1451  -0.0173 140 HIS B O   
3083 C CB  . HIS B 71  ? 1.1140 1.0581 0.8959 0.1832  0.1536  -0.0229 140 HIS B CB  
3084 C CG  . HIS B 71  ? 1.1679 1.0883 0.9308 0.1779  0.1480  -0.0311 140 HIS B CG  
3085 N ND1 . HIS B 71  ? 1.1961 1.1048 0.9359 0.1691  0.1463  -0.0379 140 HIS B ND1 
3086 C CD2 . HIS B 71  ? 1.1977 1.1041 0.9613 0.1795  0.1435  -0.0333 140 HIS B CD2 
3087 C CE1 . HIS B 71  ? 1.2052 1.0941 0.9327 0.1653  0.1408  -0.0439 140 HIS B CE1 
3088 N NE2 . HIS B 71  ? 1.2081 1.0950 0.9495 0.1716  0.1391  -0.0413 140 HIS B NE2 
3089 N N   . ASN B 72  ? 1.0001 0.9572 0.7775 0.1628  0.1318  -0.0175 141 ASN B N   
3090 C CA  . ASN B 72  ? 1.0248 0.9747 0.7835 0.1523  0.1258  -0.0216 141 ASN B CA  
3091 C C   . ASN B 72  ? 1.0529 0.9801 0.7963 0.1484  0.1205  -0.0294 141 ASN B C   
3092 O O   . ASN B 72  ? 1.2132 1.1267 0.9360 0.1424  0.1205  -0.0362 141 ASN B O   
3093 C CB  . ASN B 72  ? 1.0402 1.0071 0.8087 0.1468  0.1184  -0.0143 141 ASN B CB  
3094 C CG  . ASN B 72  ? 1.1434 1.1060 0.8942 0.1359  0.1122  -0.0170 141 ASN B CG  
3095 O OD1 . ASN B 72  ? 1.1573 1.1063 0.8973 0.1304  0.1055  -0.0217 141 ASN B OD1 
3096 N ND2 . ASN B 72  ? 1.2360 1.2108 0.9845 0.1321  0.1140  -0.0134 141 ASN B ND2 
3097 N N   . GLY B 73  ? 0.8671 0.7902 0.6201 0.1511  0.1159  -0.0284 142 GLY B N   
3098 C CA  . GLY B 73  ? 0.8413 0.7423 0.5815 0.1484  0.1118  -0.0355 142 GLY B CA  
3099 C C   . GLY B 73  ? 0.9416 0.8349 0.6672 0.1370  0.1025  -0.0388 142 GLY B C   
3100 O O   . GLY B 73  ? 1.0459 0.9204 0.7591 0.1334  0.0990  -0.0450 142 GLY B O   
3101 N N   . THR B 74  ? 0.8561 0.7636 0.5833 0.1309  0.0980  -0.0345 143 THR B N   
3102 C CA  . THR B 74  ? 0.8083 0.7107 0.5239 0.1199  0.0885  -0.0366 143 THR B CA  
3103 C C   . THR B 74  ? 0.9328 0.8313 0.6560 0.1191  0.0810  -0.0359 143 THR B C   
3104 O O   . THR B 74  ? 0.8755 0.7856 0.6167 0.1247  0.0810  -0.0304 143 THR B O   
3105 C CB  . THR B 74  ? 0.7378 0.6579 0.4560 0.1144  0.0853  -0.0307 143 THR B CB  
3106 O OG1 . THR B 74  ? 0.7601 0.6860 0.4737 0.1160  0.0930  -0.0303 143 THR B OG1 
3107 C CG2 . THR B 74  ? 0.6358 0.5507 0.3410 0.1027  0.0757  -0.0327 143 THR B CG2 
3108 N N   . GLU B 75  ? 1.0516 0.9346 0.7613 0.1114  0.0746  -0.0414 144 GLU B N   
3109 C CA  . GLU B 75  ? 1.0533 0.9316 0.7686 0.1095  0.0674  -0.0414 144 GLU B CA  
3110 C C   . GLU B 75  ? 0.9864 0.8817 0.7126 0.1057  0.0607  -0.0350 144 GLU B C   
3111 O O   . GLU B 75  ? 0.9844 0.8888 0.7065 0.0996  0.0578  -0.0327 144 GLU B O   
3112 C CB  . GLU B 75  ? 1.1440 1.0030 0.8424 0.1007  0.0617  -0.0482 144 GLU B CB  
3113 C CG  . GLU B 75  ? 1.3230 1.1649 1.0210 0.1046  0.0623  -0.0521 144 GLU B CG  
3114 C CD  . GLU B 75  ? 1.4214 1.2674 1.1336 0.1062  0.0571  -0.0487 144 GLU B CD  
3115 O OE1 . GLU B 75  ? 1.4078 1.2418 1.1221 0.1103  0.0578  -0.0506 144 GLU B OE1 
3116 O OE2 . GLU B 75  ? 1.4005 1.2612 1.1213 0.1032  0.0522  -0.0440 144 GLU B OE2 
3117 N N   . LEU B 76  ? 0.9740 0.8751 0.7195 0.1072  0.0569  -0.0311 145 LEU B N   
3118 C CA  . LEU B 76  ? 0.9145 0.8338 0.6794 0.1024  0.0500  -0.0238 145 LEU B CA  
3119 C C   . LEU B 76  ? 0.8374 0.7516 0.6096 0.0978  0.0422  -0.0243 145 LEU B C   
3120 O O   . LEU B 76  ? 0.7707 0.6745 0.5444 0.1020  0.0436  -0.0267 145 LEU B O   
3121 C CB  . LEU B 76  ? 0.8233 0.7598 0.6083 0.1096  0.0548  -0.0167 145 LEU B CB  
3122 C CG  . LEU B 76  ? 0.7487 0.7033 0.5542 0.1057  0.0490  -0.0088 145 LEU B CG  
3123 C CD1 . LEU B 76  ? 0.7459 0.7109 0.5480 0.1002  0.0470  -0.0058 145 LEU B CD1 
3124 C CD2 . LEU B 76  ? 0.7304 0.6973 0.5546 0.1130  0.0535  -0.0028 145 LEU B CD2 
3125 N N   . THR B 77  ? 0.7494 0.6711 0.5266 0.0892  0.0343  -0.0217 146 THR B N   
3126 C CA  . THR B 77  ? 0.6678 0.5871 0.4532 0.0841  0.0271  -0.0217 146 THR B CA  
3127 C C   . THR B 77  ? 0.6361 0.5732 0.4402 0.0805  0.0224  -0.0147 146 THR B C   
3128 O O   . THR B 77  ? 0.6043 0.5496 0.4072 0.0756  0.0194  -0.0125 146 THR B O   
3129 C CB  . THR B 77  ? 0.6356 0.5413 0.4042 0.0760  0.0218  -0.0274 146 THR B CB  
3130 O OG1 . THR B 77  ? 0.7205 0.6068 0.4718 0.0794  0.0260  -0.0342 146 THR B OG1 
3131 C CG2 . THR B 77  ? 0.4665 0.3732 0.2454 0.0700  0.0144  -0.0263 146 THR B CG2 
3132 N N   . LEU B 78  ? 0.6216 0.5638 0.4422 0.0827  0.0217  -0.0113 147 LEU B N   
3133 C CA  . LEU B 78  ? 0.5266 0.4831 0.3643 0.0793  0.0176  -0.0053 147 LEU B CA  
3134 C C   . LEU B 78  ? 0.4816 0.4333 0.3237 0.0735  0.0115  -0.0068 147 LEU B C   
3135 O O   . LEU B 78  ? 0.4269 0.3678 0.2665 0.0747  0.0115  -0.0099 147 LEU B O   
3136 C CB  . LEU B 78  ? 0.5145 0.4817 0.3678 0.0852  0.0215  0.0003  147 LEU B CB  
3137 C CG  . LEU B 78  ? 0.5500 0.5212 0.4000 0.0923  0.0289  0.0016  147 LEU B CG  
3138 C CD1 . LEU B 78  ? 0.4924 0.4706 0.3571 0.0986  0.0325  0.0061  147 LEU B CD1 
3139 C CD2 . LEU B 78  ? 0.5472 0.5300 0.3969 0.0899  0.0290  0.0052  147 LEU B CD2 
3140 N N   . ARG B 79  ? 0.4525 0.4125 0.3014 0.0674  0.0066  -0.0042 148 ARG B N   
3141 C CA  . ARG B 79  ? 0.4920 0.4490 0.3450 0.0614  0.0012  -0.0054 148 ARG B CA  
3142 C C   . ARG B 79  ? 0.5497 0.5183 0.4207 0.0604  -0.0002 -0.0001 148 ARG B C   
3143 O O   . ARG B 79  ? 0.5332 0.5128 0.4110 0.0599  -0.0004 0.0042  148 ARG B O   
3144 C CB  . ARG B 79  ? 0.4778 0.4332 0.3219 0.0545  -0.0035 -0.0077 148 ARG B CB  
3145 C CG  . ARG B 79  ? 0.5781 0.5380 0.4319 0.0481  -0.0087 -0.0064 148 ARG B CG  
3146 C CD  . ARG B 79  ? 0.6160 0.5760 0.4618 0.0414  -0.0135 -0.0079 148 ARG B CD  
3147 N NE  . ARG B 79  ? 0.8087 0.7545 0.6359 0.0397  -0.0138 -0.0137 148 ARG B NE  
3148 C CZ  . ARG B 79  ? 0.8459 0.7803 0.6673 0.0364  -0.0158 -0.0179 148 ARG B CZ  
3149 N NH1 . ARG B 79  ? 0.7942 0.7144 0.5974 0.0348  -0.0158 -0.0232 148 ARG B NH1 
3150 N NH2 . ARG B 79  ? 0.8953 0.8317 0.7282 0.0344  -0.0176 -0.0170 148 ARG B NH2 
3151 N N   . TYR B 80  ? 0.5377 0.5028 0.4155 0.0600  -0.0010 -0.0003 149 TYR B N   
3152 C CA  . TYR B 80  ? 0.3799 0.3528 0.2723 0.0576  -0.0027 0.0036  149 TYR B CA  
3153 C C   . TYR B 80  ? 0.4652 0.4340 0.3578 0.0509  -0.0070 0.0009  149 TYR B C   
3154 O O   . TYR B 80  ? 0.5444 0.5053 0.4265 0.0479  -0.0091 -0.0033 149 TYR B O   
3155 C CB  . TYR B 80  ? 0.3730 0.3461 0.2731 0.0614  -0.0004 0.0060  149 TYR B CB  
3156 C CG  . TYR B 80  ? 0.4433 0.4222 0.3452 0.0680  0.0043  0.0093  149 TYR B CG  
3157 C CD1 . TYR B 80  ? 0.3675 0.3585 0.2774 0.0686  0.0054  0.0144  149 TYR B CD1 
3158 C CD2 . TYR B 80  ? 0.4428 0.4153 0.3388 0.0738  0.0077  0.0076  149 TYR B CD2 
3159 C CE1 . TYR B 80  ? 0.4029 0.4003 0.3149 0.0742  0.0098  0.0178  149 TYR B CE1 
3160 C CE2 . TYR B 80  ? 0.5570 0.5362 0.4557 0.0802  0.0127  0.0109  149 TYR B CE2 
3161 C CZ  . TYR B 80  ? 0.5481 0.5402 0.4547 0.0800  0.0136  0.0160  149 TYR B CZ  
3162 O OH  . TYR B 80  ? 0.6770 0.6768 0.5865 0.0859  0.0187  0.0195  149 TYR B OH  
3163 N N   . SER B 81  ? 0.4625 0.4366 0.3669 0.0483  -0.0081 0.0036  150 SER B N   
3164 C CA  . SER B 81  ? 0.4152 0.3867 0.3212 0.0421  -0.0113 0.0014  150 SER B CA  
3165 C C   . SER B 81  ? 0.4108 0.3703 0.3094 0.0405  -0.0124 -0.0027 150 SER B C   
3166 O O   . SER B 81  ? 0.5046 0.4598 0.3997 0.0351  -0.0152 -0.0056 150 SER B O   
3167 C CB  . SER B 81  ? 0.4256 0.4035 0.3446 0.0401  -0.0111 0.0046  150 SER B CB  
3168 O OG  . SER B 81  ? 0.4525 0.4270 0.3745 0.0413  -0.0100 0.0056  150 SER B OG  
3169 N N   . THR B 82  ? 0.3978 0.3520 0.2944 0.0451  -0.0103 -0.0024 151 THR B N   
3170 C CA  . THR B 82  ? 0.4856 0.4276 0.3753 0.0442  -0.0114 -0.0056 151 THR B CA  
3171 C C   . THR B 82  ? 0.5627 0.4939 0.4377 0.0458  -0.0112 -0.0100 151 THR B C   
3172 O O   . THR B 82  ? 0.6442 0.5636 0.5116 0.0437  -0.0128 -0.0132 151 THR B O   
3173 C CB  . THR B 82  ? 0.5079 0.4492 0.4032 0.0486  -0.0095 -0.0026 151 THR B CB  
3174 O OG1 . THR B 82  ? 0.5861 0.5333 0.4833 0.0556  -0.0058 0.0002  151 THR B OG1 
3175 C CG2 . THR B 82  ? 0.3974 0.3448 0.3041 0.0448  -0.0107 0.0008  151 THR B CG2 
3176 N N   . GLY B 83  ? 0.6138 0.5477 0.4835 0.0491  -0.0091 -0.0102 152 GLY B N   
3177 C CA  . GLY B 83  ? 0.5261 0.4484 0.3801 0.0503  -0.0085 -0.0148 152 GLY B CA  
3178 C C   . GLY B 83  ? 0.5554 0.4807 0.4056 0.0571  -0.0038 -0.0139 152 GLY B C   
3179 O O   . GLY B 83  ? 0.5215 0.4594 0.3789 0.0581  -0.0028 -0.0102 152 GLY B O   
3180 N N   . THR B 84  ? 0.6157 0.5289 0.4545 0.0618  -0.0008 -0.0173 153 THR B N   
3181 C CA  . THR B 84  ? 0.4272 0.3394 0.2570 0.0672  0.0040  -0.0185 153 THR B CA  
3182 C C   . THR B 84  ? 0.5167 0.4241 0.3475 0.0763  0.0096  -0.0180 153 THR B C   
3183 O O   . THR B 84  ? 0.6926 0.5890 0.5218 0.0778  0.0093  -0.0197 153 THR B O   
3184 C CB  . THR B 84  ? 0.5249 0.4244 0.3353 0.0629  0.0024  -0.0245 153 THR B CB  
3185 O OG1 . THR B 84  ? 0.6866 0.5953 0.4972 0.0561  -0.0016 -0.0233 153 THR B OG1 
3186 C CG2 . THR B 84  ? 0.5998 0.4905 0.3964 0.0694  0.0085  -0.0277 153 THR B CG2 
3187 N N   . VAL B 85  ? 0.5355 0.4519 0.3699 0.0825  0.0148  -0.0151 154 VAL B N   
3188 C CA  . VAL B 85  ? 0.5450 0.4572 0.3781 0.0920  0.0214  -0.0152 154 VAL B CA  
3189 C C   . VAL B 85  ? 0.6511 0.5579 0.4683 0.0948  0.0263  -0.0191 154 VAL B C   
3190 O O   . VAL B 85  ? 0.5970 0.5090 0.4086 0.0900  0.0248  -0.0195 154 VAL B O   
3191 C CB  . VAL B 85  ? 0.4290 0.3568 0.2803 0.0974  0.0243  -0.0080 154 VAL B CB  
3192 C CG1 . VAL B 85  ? 0.5196 0.4487 0.3836 0.0955  0.0202  -0.0047 154 VAL B CG1 
3193 C CG2 . VAL B 85  ? 0.4030 0.3469 0.2612 0.0944  0.0237  -0.0039 154 VAL B CG2 
3194 N N   . SER B 86  ? 0.7014 0.5974 0.5111 0.1026  0.0324  -0.0220 155 SER B N   
3195 C CA  . SER B 86  ? 0.6968 0.5845 0.4889 0.1056  0.0381  -0.0268 155 SER B CA  
3196 C C   . SER B 86  ? 0.8063 0.6949 0.6018 0.1172  0.0473  -0.0255 155 SER B C   
3197 O O   . SER B 86  ? 0.8164 0.7047 0.6233 0.1230  0.0486  -0.0228 155 SER B O   
3198 C CB  . SER B 86  ? 0.8242 0.6899 0.5952 0.1014  0.0362  -0.0347 155 SER B CB  
3199 O OG  . SER B 86  ? 1.0461 0.9129 0.8139 0.0904  0.0280  -0.0355 155 SER B OG  
3200 N N   . GLY B 87  ? 0.7704 0.6605 0.5561 0.1204  0.0536  -0.0272 156 GLY B N   
3201 C CA  . GLY B 87  ? 0.7072 0.5994 0.4955 0.1316  0.0635  -0.0261 156 GLY B CA  
3202 C C   . GLY B 87  ? 0.6719 0.5659 0.4467 0.1328  0.0699  -0.0285 156 GLY B C   
3203 O O   . GLY B 87  ? 0.7461 0.6294 0.5015 0.1264  0.0679  -0.0341 156 GLY B O   
3204 N N   . PHE B 88  ? 0.6617 0.5695 0.4463 0.1404  0.0774  -0.0239 157 PHE B N   
3205 C CA  . PHE B 88  ? 0.7944 0.7052 0.5674 0.1412  0.0839  -0.0255 157 PHE B CA  
3206 C C   . PHE B 88  ? 0.7647 0.6992 0.5549 0.1450  0.0876  -0.0172 157 PHE B C   
3207 O O   . PHE B 88  ? 0.7106 0.6571 0.5219 0.1488  0.0869  -0.0108 157 PHE B O   
3208 C CB  . PHE B 88  ? 0.8369 0.7329 0.6003 0.1459  0.0911  -0.0307 157 PHE B CB  
3209 C CG  . PHE B 88  ? 0.8521 0.7473 0.6298 0.1559  0.0955  -0.0283 157 PHE B CG  
3210 C CD1 . PHE B 88  ? 0.7582 0.6700 0.5524 0.1638  0.1022  -0.0220 157 PHE B CD1 
3211 C CD2 . PHE B 88  ? 0.8618 0.7403 0.6371 0.1568  0.0923  -0.0315 157 PHE B CD2 
3212 C CE1 . PHE B 88  ? 0.7607 0.6733 0.5695 0.1724  0.1055  -0.0187 157 PHE B CE1 
3213 C CE2 . PHE B 88  ? 0.8064 0.6847 0.5957 0.1656  0.0957  -0.0284 157 PHE B CE2 
3214 C CZ  . PHE B 88  ? 0.7847 0.6804 0.5910 0.1734  0.1021  -0.0218 157 PHE B CZ  
3215 N N   . LEU B 89  ? 0.7823 0.7238 0.5649 0.1418  0.0901  -0.0167 158 LEU B N   
3216 C CA  . LEU B 89  ? 0.8179 0.7814 0.6149 0.1445  0.0938  -0.0089 158 LEU B CA  
3217 C C   . LEU B 89  ? 0.7698 0.7377 0.5770 0.1538  0.1028  -0.0068 158 LEU B C   
3218 O O   . LEU B 89  ? 0.8002 0.7535 0.5990 0.1576  0.1074  -0.0124 158 LEU B O   
3219 C CB  . LEU B 89  ? 0.8621 0.8309 0.6476 0.1375  0.0933  -0.0087 158 LEU B CB  
3220 C CG  . LEU B 89  ? 0.8944 0.8626 0.6739 0.1269  0.0831  -0.0087 158 LEU B CG  
3221 C CD1 . LEU B 89  ? 1.0045 0.9825 0.7765 0.1217  0.0833  -0.0059 158 LEU B CD1 
3222 C CD2 . LEU B 89  ? 0.9201 0.8987 0.7217 0.1239  0.0750  -0.0025 158 LEU B CD2 
3223 N N   . SER B 90  ? 0.6834 0.6723 0.5096 0.1570  0.1050  0.0017  159 SER B N   
3224 C CA  . SER B 90  ? 0.6580 0.6558 0.4968 0.1650  0.1129  0.0055  159 SER B CA  
3225 C C   . SER B 90  ? 0.7169 0.7388 0.5709 0.1639  0.1138  0.0146  159 SER B C   
3226 O O   . SER B 90  ? 0.8611 0.8929 0.7215 0.1589  0.1077  0.0191  159 SER B O   
3227 C CB  . SER B 90  ? 0.6057 0.6005 0.4586 0.1719  0.1129  0.0072  159 SER B CB  
3228 O OG  . SER B 90  ? 0.6060 0.5778 0.4449 0.1736  0.1133  -0.0009 159 SER B OG  
3229 N N   . GLN B 91  ? 0.6683 0.6994 0.5278 0.1684  0.1214  0.0174  160 GLN B N   
3230 C CA  . GLN B 91  ? 0.6698 0.7236 0.5435 0.1671  0.1227  0.0263  160 GLN B CA  
3231 C C   . GLN B 91  ? 0.7802 0.8469 0.6757 0.1742  0.1263  0.0331  160 GLN B C   
3232 O O   . GLN B 91  ? 0.8891 0.9485 0.7844 0.1810  0.1322  0.0303  160 GLN B O   
3233 C CB  . GLN B 91  ? 0.5515 0.6075 0.4126 0.1644  0.1281  0.0245  160 GLN B CB  
3234 C CG  . GLN B 91  ? 0.6831 0.7603 0.5544 0.1600  0.1271  0.0332  160 GLN B CG  
3235 C CD  . GLN B 91  ? 0.8081 0.8866 0.6659 0.1568  0.1321  0.0313  160 GLN B CD  
3236 O OE1 . GLN B 91  ? 0.8331 0.9285 0.6993 0.1546  0.1336  0.0382  160 GLN B OE1 
3237 N NE2 . GLN B 91  ? 0.8140 0.8744 0.6504 0.1557  0.1344  0.0221  160 GLN B NE2 
3238 N N   . ASP B 92  ? 0.7102 0.7958 0.6242 0.1720  0.1226  0.0424  161 ASP B N   
3239 C CA  . ASP B 92  ? 0.6622 0.7629 0.5978 0.1767  0.1248  0.0505  161 ASP B CA  
3240 C C   . ASP B 92  ? 0.6234 0.7448 0.5746 0.1710  0.1201  0.0603  161 ASP B C   
3241 O O   . ASP B 92  ? 0.7566 0.8791 0.7026 0.1642  0.1150  0.0606  161 ASP B O   
3242 C CB  . ASP B 92  ? 0.7514 0.8436 0.6949 0.1816  0.1224  0.0497  161 ASP B CB  
3243 C CG  . ASP B 92  ? 0.8262 0.9294 0.7871 0.1880  0.1269  0.0559  161 ASP B CG  
3244 O OD1 . ASP B 92  ? 0.8405 0.9639 0.8165 0.1862  0.1269  0.0647  161 ASP B OD1 
3245 O OD2 . ASP B 92  ? 0.8345 0.9261 0.7939 0.1945  0.1301  0.0521  161 ASP B OD2 
3246 N N   . ILE B 93  ? 0.6245 0.7621 0.5946 0.1734  0.1217  0.0686  162 ILE B N   
3247 C CA  . ILE B 93  ? 0.5205 0.6776 0.5065 0.1675  0.1171  0.0786  162 ILE B CA  
3248 C C   . ILE B 93  ? 0.6848 0.8413 0.6814 0.1648  0.1087  0.0815  162 ILE B C   
3249 O O   . ILE B 93  ? 0.7946 0.9435 0.7955 0.1692  0.1077  0.0798  162 ILE B O   
3250 C CB  . ILE B 93  ? 0.3476 0.5221 0.3487 0.1703  0.1219  0.0866  162 ILE B CB  
3251 N N   . ILE B 94  ? 0.6251 0.7893 0.6258 0.1571  0.1025  0.0858  163 ILE B N   
3252 C CA  . ILE B 94  ? 0.5610 0.7244 0.5709 0.1533  0.0943  0.0881  163 ILE B CA  
3253 C C   . ILE B 94  ? 0.4239 0.6063 0.4506 0.1466  0.0900  0.0988  163 ILE B C   
3254 O O   . ILE B 94  ? 0.4285 0.6198 0.4537 0.1416  0.0905  0.1021  163 ILE B O   
3255 C CB  . ILE B 94  ? 0.6674 0.8140 0.6624 0.1468  0.0877  0.0807  163 ILE B CB  
3256 C CG1 . ILE B 94  ? 0.6653 0.7923 0.6438 0.1527  0.0910  0.0704  163 ILE B CG1 
3257 C CG2 . ILE B 94  ? 0.5910 0.7350 0.5946 0.1392  0.0772  0.0832  163 ILE B CG2 
3258 C CD1 . ILE B 94  ? 0.6278 0.7373 0.5926 0.1455  0.0833  0.0632  163 ILE B CD1 
3259 N N   . THR B 95  ? 0.4193 0.6069 0.4609 0.1457  0.0856  0.1043  164 THR B N   
3260 C CA  . THR B 95  ? 0.6332 0.8369 0.6902 0.1383  0.0806  0.1144  164 THR B CA  
3261 C C   . THR B 95  ? 0.5629 0.7603 0.6209 0.1302  0.0710  0.1142  164 THR B C   
3262 O O   . THR B 95  ? 0.5945 0.7805 0.6520 0.1309  0.0666  0.1108  164 THR B O   
3263 C CB  . THR B 95  ? 0.7765 0.9894 0.8481 0.1403  0.0809  0.1210  164 THR B CB  
3264 O OG1 . THR B 95  ? 0.9897 1.1896 1.0598 0.1458  0.0803  0.1160  164 THR B OG1 
3265 C CG2 . THR B 95  ? 0.6004 0.8238 0.6742 0.1454  0.0891  0.1239  164 THR B CG2 
3266 N N   . VAL B 96  ? 0.4292 0.6299 0.4859 0.1208  0.0667  0.1172  165 VAL B N   
3267 C CA  . VAL B 96  ? 0.3862 0.5784 0.4422 0.1107  0.0570  0.1170  165 VAL B CA  
3268 C C   . VAL B 96  ? 0.4782 0.6861 0.5466 0.1030  0.0539  0.1273  165 VAL B C   
3269 O O   . VAL B 96  ? 0.4687 0.6847 0.5359 0.1002  0.0562  0.1307  165 VAL B O   
3270 C CB  . VAL B 96  ? 0.4633 0.6404 0.5033 0.1063  0.0544  0.1095  165 VAL B CB  
3271 C CG1 . VAL B 96  ? 0.4002 0.5655 0.4392 0.0982  0.0456  0.1074  165 VAL B CG1 
3272 C CG2 . VAL B 96  ? 0.5664 0.7315 0.5927 0.1139  0.0595  0.1004  165 VAL B CG2 
3273 N N   . GLY B 97  ? 0.5116 0.7233 0.5912 0.0989  0.0482  0.1324  166 GLY B N   
3274 C CA  . GLY B 97  ? 0.5294 0.7568 0.6211 0.0915  0.0453  0.1428  166 GLY B CA  
3275 C C   . GLY B 97  ? 0.6976 0.9455 0.7994 0.0977  0.0531  0.1497  166 GLY B C   
3276 O O   . GLY B 97  ? 0.6731 0.9213 0.7768 0.1051  0.0577  0.1485  166 GLY B O   
3277 N N   . GLY B 98  ? 0.7967 1.0553 0.9001 0.0923  0.0541  0.1554  167 GLY B N   
3278 C CA  . GLY B 98  ? 0.8166 1.0893 0.9243 0.0958  0.0609  0.1604  167 GLY B CA  
3279 C C   . GLY B 98  ? 0.7181 0.9882 0.8137 0.1011  0.0682  0.1551  167 GLY B C   
3280 O O   . GLY B 98  ? 0.7137 0.9941 0.8101 0.1006  0.0721  0.1594  167 GLY B O   
3281 N N   . ILE B 99  ? 0.5934 0.8489 0.6770 0.1055  0.0696  0.1457  168 ILE B N   
3282 C CA  . ILE B 99  ? 0.4794 0.7284 0.5477 0.1081  0.0749  0.1398  168 ILE B CA  
3283 C C   . ILE B 99  ? 0.4744 0.7139 0.5344 0.1190  0.0812  0.1313  168 ILE B C   
3284 O O   . ILE B 99  ? 0.5205 0.7490 0.5799 0.1222  0.0786  0.1264  168 ILE B O   
3285 C CB  . ILE B 99  ? 0.4583 0.6912 0.5140 0.0999  0.0678  0.1351  168 ILE B CB  
3286 C CG1 . ILE B 99  ? 0.3761 0.6172 0.4379 0.0894  0.0628  0.1434  168 ILE B CG1 
3287 C CG2 . ILE B 99  ? 0.4703 0.6941 0.5091 0.1031  0.0722  0.1279  168 ILE B CG2 
3288 C CD1 . ILE B 99  ? 0.4130 0.6395 0.4637 0.0820  0.0568  0.1398  168 ILE B CD1 
3289 N N   . THR B 100 ? 0.4629 0.7036 0.5148 0.1236  0.0884  0.1290  169 THR B N   
3290 C CA  . THR B 100 ? 0.5469 0.7758 0.5876 0.1328  0.0947  0.1202  169 THR B CA  
3291 C C   . THR B 100 ? 0.5983 0.8179 0.6202 0.1319  0.0974  0.1136  169 THR B C   
3292 O O   . THR B 100 ? 0.6868 0.9136 0.7060 0.1266  0.0976  0.1173  169 THR B O   
3293 C CB  . THR B 100 ? 0.6569 0.8941 0.7034 0.1390  0.1016  0.1227  169 THR B CB  
3294 O OG1 . THR B 100 ? 0.9172 1.1690 0.9675 0.1345  0.1032  0.1295  169 THR B OG1 
3295 C CG2 . THR B 100 ? 0.5686 0.8117 0.6310 0.1411  0.0994  0.1278  169 THR B CG2 
3296 N N   . VAL B 101 ? 0.4794 0.6824 0.4876 0.1365  0.0988  0.1041  170 VAL B N   
3297 C CA  . VAL B 101 ? 0.4959 0.6884 0.4843 0.1353  0.1009  0.0973  170 VAL B CA  
3298 C C   . VAL B 101 ? 0.6012 0.7789 0.5768 0.1432  0.1065  0.0879  170 VAL B C   
3299 O O   . VAL B 101 ? 0.5992 0.7686 0.5776 0.1482  0.1060  0.0844  170 VAL B O   
3300 C CB  . VAL B 101 ? 0.5418 0.7223 0.5225 0.1272  0.0916  0.0944  170 VAL B CB  
3301 C CG1 . VAL B 101 ? 0.6023 0.7930 0.5911 0.1180  0.0859  0.1025  170 VAL B CG1 
3302 C CG2 . VAL B 101 ? 0.6137 0.7822 0.5982 0.1276  0.0854  0.0904  170 VAL B CG2 
3303 N N   . THR B 102 ? 0.6900 0.8636 0.6511 0.1437  0.1116  0.0838  171 THR B N   
3304 C CA  . THR B 102 ? 0.7028 0.8585 0.6462 0.1484  0.1157  0.0734  171 THR B CA  
3305 C C   . THR B 102 ? 0.7453 0.8869 0.6754 0.1442  0.1096  0.0677  171 THR B C   
3306 O O   . THR B 102 ? 0.7400 0.8819 0.6612 0.1373  0.1062  0.0684  171 THR B O   
3307 C CB  . THR B 102 ? 0.7723 0.9280 0.7034 0.1485  0.1224  0.0709  171 THR B CB  
3308 O OG1 . THR B 102 ? 0.9188 1.0925 0.8642 0.1493  0.1262  0.0788  171 THR B OG1 
3309 C CG2 . THR B 102 ? 0.7139 0.8531 0.6312 0.1550  0.1286  0.0613  171 THR B CG2 
3310 N N   . GLN B 103 ? 0.7279 0.8572 0.6567 0.1478  0.1077  0.0626  172 GLN B N   
3311 C CA  . GLN B 103 ? 0.7038 0.8193 0.6244 0.1416  0.0988  0.0580  172 GLN B CA  
3312 C C   . GLN B 103 ? 0.6100 0.7052 0.5131 0.1453  0.1007  0.0476  172 GLN B C   
3313 O O   . GLN B 103 ? 0.7026 0.7929 0.6065 0.1539  0.1069  0.0447  172 GLN B O   
3314 C CB  . GLN B 103 ? 0.7298 0.8479 0.6675 0.1382  0.0905  0.0622  172 GLN B CB  
3315 C CG  . GLN B 103 ? 0.7095 0.8131 0.6406 0.1315  0.0809  0.0573  172 GLN B CG  
3316 C CD  . GLN B 103 ? 0.6553 0.7576 0.5764 0.1236  0.0767  0.0570  172 GLN B CD  
3317 O OE1 . GLN B 103 ? 0.6675 0.7824 0.5934 0.1204  0.0770  0.0634  172 GLN B OE1 
3318 N NE2 . GLN B 103 ? 0.6678 0.7552 0.5754 0.1203  0.0723  0.0500  172 GLN B NE2 
3319 N N   . MET B 104 ? 0.5278 0.6109 0.4152 0.1387  0.0954  0.0423  173 MET B N   
3320 C CA  . MET B 104 ? 0.5547 0.6174 0.4250 0.1397  0.0949  0.0327  173 MET B CA  
3321 C C   . MET B 104 ? 0.5097 0.5643 0.3870 0.1361  0.0857  0.0314  173 MET B C   
3322 O O   . MET B 104 ? 0.3912 0.4490 0.2737 0.1282  0.0773  0.0343  173 MET B O   
3323 C CB  . MET B 104 ? 0.6453 0.7002 0.4948 0.1337  0.0936  0.0282  173 MET B CB  
3324 C CG  . MET B 104 ? 0.8470 0.8809 0.6759 0.1348  0.0948  0.0181  173 MET B CG  
3325 S SD  . MET B 104 ? 1.0629 1.0904 0.8831 0.1425  0.1065  0.0133  173 MET B SD  
3326 C CE  . MET B 104 ? 1.0949 1.1057 0.8870 0.1345  0.1046  0.0049  173 MET B CE  
3327 N N   . PHE B 105 ? 0.6039 0.6474 0.4809 0.1418  0.0875  0.0271  174 PHE B N   
3328 C CA  . PHE B 105 ? 0.6169 0.6536 0.5014 0.1389  0.0796  0.0265  174 PHE B CA  
3329 C C   . PHE B 105 ? 0.6969 0.7125 0.5663 0.1413  0.0801  0.0175  174 PHE B C   
3330 O O   . PHE B 105 ? 0.8065 0.8131 0.6621 0.1470  0.0876  0.0123  174 PHE B O   
3331 C CB  . PHE B 105 ? 0.5983 0.6466 0.5044 0.1430  0.0797  0.0335  174 PHE B CB  
3332 C CG  . PHE B 105 ? 0.6053 0.6512 0.5137 0.1539  0.0879  0.0325  174 PHE B CG  
3333 C CD1 . PHE B 105 ? 0.7471 0.8035 0.6574 0.1610  0.0977  0.0352  174 PHE B CD1 
3334 C CD2 . PHE B 105 ? 0.6985 0.7316 0.6075 0.1573  0.0861  0.0293  174 PHE B CD2 
3335 C CE1 . PHE B 105 ? 0.7597 0.8135 0.6736 0.1706  0.1049  0.0345  174 PHE B CE1 
3336 C CE2 . PHE B 105 ? 0.8298 0.8600 0.7416 0.1680  0.0938  0.0288  174 PHE B CE2 
3337 C CZ  . PHE B 105 ? 0.7653 0.8057 0.6801 0.1742  0.1027  0.0315  174 PHE B CZ  
3338 N N   . GLY B 106 ? 0.6353 0.6423 0.5068 0.1366  0.0721  0.0157  175 GLY B N   
3339 C CA  . GLY B 106 ? 0.6644 0.6509 0.5219 0.1372  0.0711  0.0077  175 GLY B CA  
3340 C C   . GLY B 106 ? 0.6866 0.6683 0.5532 0.1445  0.0731  0.0083  175 GLY B C   
3341 O O   . GLY B 106 ? 0.6518 0.6419 0.5354 0.1435  0.0687  0.0140  175 GLY B O   
3342 N N   . GLU B 107 ? 0.7227 0.6901 0.5771 0.1517  0.0797  0.0025  176 GLU B N   
3343 C CA  . GLU B 107 ? 0.7308 0.6891 0.5905 0.1587  0.0812  0.0019  176 GLU B CA  
3344 C C   . GLU B 107 ? 0.7326 0.6717 0.5808 0.1525  0.0739  -0.0042 176 GLU B C   
3345 O O   . GLU B 107 ? 0.6477 0.5697 0.4756 0.1513  0.0754  -0.0121 176 GLU B O   
3346 C CB  . GLU B 107 ? 0.7595 0.7109 0.6117 0.1701  0.0926  -0.0013 176 GLU B CB  
3347 C CG  . GLU B 107 ? 0.8183 0.7894 0.6891 0.1763  0.0985  0.0067  176 GLU B CG  
3348 C CD  . GLU B 107 ? 0.9115 0.8747 0.7794 0.1834  0.1064  0.0044  176 GLU B CD  
3349 O OE1 . GLU B 107 ? 0.9167 0.8803 0.7751 0.1840  0.1127  0.0018  176 GLU B OE1 
3350 O OE2 . GLU B 107 ? 0.9456 0.9019 0.8205 0.1883  0.1064  0.0052  176 GLU B OE2 
3351 N N   . VAL B 108 ? 0.7268 0.6688 0.5875 0.1480  0.0661  -0.0006 177 VAL B N   
3352 C CA  . VAL B 108 ? 0.6284 0.5553 0.4797 0.1403  0.0584  -0.0054 177 VAL B CA  
3353 C C   . VAL B 108 ? 0.6861 0.5938 0.5302 0.1459  0.0603  -0.0097 177 VAL B C   
3354 O O   . VAL B 108 ? 0.5980 0.5082 0.4539 0.1539  0.0633  -0.0057 177 VAL B O   
3355 C CB  . VAL B 108 ? 0.5419 0.4795 0.4082 0.1325  0.0498  -0.0001 177 VAL B CB  
3356 C CG1 . VAL B 108 ? 0.4116 0.3345 0.2726 0.1269  0.0430  -0.0038 177 VAL B CG1 
3357 C CG2 . VAL B 108 ? 0.5242 0.4734 0.3907 0.1250  0.0468  0.0014  177 VAL B CG2 
3358 N N   . THR B 109 ? 0.7296 0.6179 0.5540 0.1414  0.0582  -0.0176 178 THR B N   
3359 C CA  . THR B 109 ? 0.6907 0.5572 0.5041 0.1461  0.0603  -0.0228 178 THR B CA  
3360 C C   . THR B 109 ? 0.7760 0.6299 0.5846 0.1375  0.0514  -0.0254 178 THR B C   
3361 O O   . THR B 109 ? 0.7842 0.6191 0.5841 0.1403  0.0519  -0.0292 178 THR B O   
3362 C CB  . THR B 109 ? 0.7919 0.6427 0.5825 0.1489  0.0671  -0.0308 178 THR B CB  
3363 O OG1 . THR B 109 ? 0.9789 0.8289 0.7563 0.1384  0.0626  -0.0346 178 THR B OG1 
3364 C CG2 . THR B 109 ? 0.7923 0.6541 0.5883 0.1582  0.0769  -0.0282 178 THR B CG2 
3365 N N   . GLU B 110 ? 0.7911 0.6545 0.6047 0.1272  0.0437  -0.0235 179 GLU B N   
3366 C CA  . GLU B 110 ? 0.7928 0.6470 0.6035 0.1185  0.0354  -0.0253 179 GLU B CA  
3367 C C   . GLU B 110 ? 0.8050 0.6771 0.6342 0.1129  0.0296  -0.0187 179 GLU B C   
3368 O O   . GLU B 110 ? 0.8532 0.7389 0.6864 0.1083  0.0281  -0.0168 179 GLU B O   
3369 C CB  . GLU B 110 ? 0.9095 0.7524 0.7008 0.1098  0.0322  -0.0322 179 GLU B CB  
3370 C CG  . GLU B 110 ? 1.1132 0.9353 0.8829 0.1137  0.0375  -0.0396 179 GLU B CG  
3371 C CD  . GLU B 110 ? 1.2024 1.0145 0.9528 0.1037  0.0334  -0.0457 179 GLU B CD  
3372 O OE1 . GLU B 110 ? 1.1530 0.9470 0.8831 0.1050  0.0371  -0.0523 179 GLU B OE1 
3373 O OE2 . GLU B 110 ? 1.2395 1.0619 0.9950 0.0944  0.0264  -0.0438 179 GLU B OE2 
3374 N N   . MET B 111 ? 0.7883 0.6598 0.6281 0.1134  0.0264  -0.0150 180 MET B N   
3375 C CA  . MET B 111 ? 0.6409 0.5267 0.4967 0.1077  0.0210  -0.0091 180 MET B CA  
3376 C C   . MET B 111 ? 0.6363 0.5110 0.4895 0.1009  0.0144  -0.0106 180 MET B C   
3377 O O   . MET B 111 ? 0.7687 0.6377 0.6265 0.1041  0.0136  -0.0081 180 MET B O   
3378 C CB  . MET B 111 ? 0.5673 0.4670 0.4409 0.1147  0.0237  -0.0014 180 MET B CB  
3379 C CG  . MET B 111 ? 0.6454 0.5632 0.5273 0.1172  0.0276  0.0024  180 MET B CG  
3380 S SD  . MET B 111 ? 0.7023 0.6361 0.6044 0.1256  0.0312  0.0117  180 MET B SD  
3381 C CE  . MET B 111 ? 0.7304 0.6734 0.6464 0.1163  0.0228  0.0175  180 MET B CE  
3382 N N   . PRO B 112 ? 0.4921 0.3644 0.3384 0.0912  0.0096  -0.0141 181 PRO B N   
3383 C CA  . PRO B 112 ? 0.5363 0.3987 0.3797 0.0839  0.0036  -0.0155 181 PRO B CA  
3384 C C   . PRO B 112 ? 0.6033 0.4737 0.4619 0.0830  0.0007  -0.0093 181 PRO B C   
3385 O O   . PRO B 112 ? 0.6285 0.5150 0.5007 0.0842  0.0015  -0.0040 181 PRO B O   
3386 C CB  . PRO B 112 ? 0.3563 0.2225 0.1952 0.0741  -0.0003 -0.0184 181 PRO B CB  
3387 C CG  . PRO B 112 ? 0.4388 0.3078 0.2702 0.0769  0.0036  -0.0209 181 PRO B CG  
3388 C CD  . PRO B 112 ? 0.4829 0.3613 0.3235 0.0866  0.0094  -0.0166 181 PRO B CD  
3389 N N   . ALA B 113 ? 0.5288 0.3871 0.3842 0.0802  -0.0030 -0.0098 182 ALA B N   
3390 C CA  . ALA B 113 ? 0.4353 0.2995 0.3031 0.0781  -0.0064 -0.0039 182 ALA B CA  
3391 C C   . ALA B 113 ? 0.4840 0.3611 0.3594 0.0693  -0.0098 -0.0022 182 ALA B C   
3392 O O   . ALA B 113 ? 0.4815 0.3707 0.3697 0.0692  -0.0104 0.0035  182 ALA B O   
3393 C CB  . ALA B 113 ? 0.3264 0.1737 0.1871 0.0756  -0.0101 -0.0051 182 ALA B CB  
3394 N N   . LEU B 114 ? 0.4114 0.2859 0.2792 0.0618  -0.0119 -0.0069 183 LEU B N   
3395 C CA  . LEU B 114 ? 0.3853 0.2724 0.2602 0.0550  -0.0137 -0.0057 183 LEU B CA  
3396 C C   . LEU B 114 ? 0.5071 0.4040 0.3829 0.0580  -0.0104 -0.0064 183 LEU B C   
3397 O O   . LEU B 114 ? 0.5837 0.4752 0.4489 0.0569  -0.0100 -0.0110 183 LEU B O   
3398 C CB  . LEU B 114 ? 0.3177 0.1985 0.1858 0.0454  -0.0178 -0.0096 183 LEU B CB  
3399 C CG  . LEU B 114 ? 0.3886 0.2814 0.2636 0.0386  -0.0190 -0.0092 183 LEU B CG  
3400 C CD1 . LEU B 114 ? 0.4335 0.3355 0.3208 0.0374  -0.0193 -0.0041 183 LEU B CD1 
3401 C CD2 . LEU B 114 ? 0.3355 0.2222 0.2036 0.0298  -0.0223 -0.0131 183 LEU B CD2 
3402 N N   . PRO B 115 ? 0.4942 0.4054 0.3817 0.0609  -0.0083 -0.0016 184 PRO B N   
3403 C CA  . PRO B 115 ? 0.4927 0.4121 0.3926 0.0596  -0.0096 0.0040  184 PRO B CA  
3404 C C   . PRO B 115 ? 0.5214 0.4446 0.4288 0.0673  -0.0073 0.0092  184 PRO B C   
3405 O O   . PRO B 115 ? 0.6506 0.5800 0.5676 0.0653  -0.0092 0.0143  184 PRO B O   
3406 C CB  . PRO B 115 ? 0.4662 0.3990 0.3734 0.0570  -0.0089 0.0058  184 PRO B CB  
3407 C CG  . PRO B 115 ? 0.3937 0.3290 0.2961 0.0625  -0.0052 0.0041  184 PRO B CG  
3408 C CD  . PRO B 115 ? 0.2977 0.2184 0.1860 0.0638  -0.0051 -0.0015 184 PRO B CD  
3409 N N   . PHE B 116 ? 0.3807 0.3008 0.2840 0.0756  -0.0031 0.0083  185 PHE B N   
3410 C CA  . PHE B 116 ? 0.3476 0.2768 0.2609 0.0835  0.0004  0.0140  185 PHE B CA  
3411 C C   . PHE B 116 ? 0.5040 0.4295 0.4229 0.0863  -0.0013 0.0183  185 PHE B C   
3412 O O   . PHE B 116 ? 0.5902 0.5255 0.5199 0.0920  0.0008  0.0243  185 PHE B O   
3413 C CB  . PHE B 116 ? 0.3075 0.2354 0.2145 0.0917  0.0064  0.0115  185 PHE B CB  
3414 C CG  . PHE B 116 ? 0.4205 0.3567 0.3256 0.0895  0.0079  0.0099  185 PHE B CG  
3415 C CD1 . PHE B 116 ? 0.3778 0.3300 0.2944 0.0890  0.0087  0.0152  185 PHE B CD1 
3416 C CD2 . PHE B 116 ? 0.4119 0.3397 0.3035 0.0868  0.0078  0.0035  185 PHE B CD2 
3417 C CE1 . PHE B 116 ? 0.4354 0.3947 0.3504 0.0867  0.0097  0.0144  185 PHE B CE1 
3418 C CE2 . PHE B 116 ? 0.3204 0.2563 0.2107 0.0843  0.0085  0.0029  185 PHE B CE2 
3419 C CZ  . PHE B 116 ? 0.3754 0.3269 0.2776 0.0846  0.0096  0.0084  185 PHE B CZ  
3420 N N   . MET B 117 ? 0.4377 0.3502 0.3502 0.0820  -0.0054 0.0160  186 MET B N   
3421 C CA  . MET B 117 ? 0.4821 0.3931 0.4014 0.0823  -0.0085 0.0214  186 MET B CA  
3422 C C   . MET B 117 ? 0.4572 0.3792 0.3864 0.0746  -0.0126 0.0265  186 MET B C   
3423 O O   . MET B 117 ? 0.3944 0.3177 0.3303 0.0740  -0.0157 0.0321  186 MET B O   
3424 C CB  . MET B 117 ? 0.5805 0.4731 0.4887 0.0796  -0.0118 0.0176  186 MET B CB  
3425 C CG  . MET B 117 ? 0.6726 0.5522 0.5726 0.0887  -0.0079 0.0145  186 MET B CG  
3426 S SD  . MET B 117 ? 0.7812 0.6634 0.6931 0.0993  -0.0062 0.0225  186 MET B SD  
3427 C CE  . MET B 117 ? 0.6455 0.5118 0.5525 0.0940  -0.0131 0.0235  186 MET B CE  
3428 N N   . LEU B 118 ? 0.4045 0.3339 0.3343 0.0686  -0.0128 0.0248  187 LEU B N   
3429 C CA  . LEU B 118 ? 0.2965 0.2353 0.2344 0.0613  -0.0157 0.0289  187 LEU B CA  
3430 C C   . LEU B 118 ? 0.3630 0.3176 0.3118 0.0644  -0.0131 0.0341  187 LEU B C   
3431 O O   . LEU B 118 ? 0.4821 0.4444 0.4371 0.0583  -0.0152 0.0376  187 LEU B O   
3432 C CB  . LEU B 118 ? 0.3189 0.2549 0.2509 0.0524  -0.0174 0.0238  187 LEU B CB  
3433 C CG  . LEU B 118 ? 0.4068 0.3286 0.3269 0.0486  -0.0193 0.0176  187 LEU B CG  
3434 C CD1 . LEU B 118 ? 0.4385 0.3616 0.3556 0.0412  -0.0197 0.0133  187 LEU B CD1 
3435 C CD2 . LEU B 118 ? 0.3931 0.3063 0.3114 0.0449  -0.0235 0.0195  187 LEU B CD2 
3436 N N   . ALA B 119 ? 0.2953 0.2544 0.2458 0.0733  -0.0083 0.0348  188 ALA B N   
3437 C CA  . ALA B 119 ? 0.3769 0.3511 0.3366 0.0760  -0.0053 0.0392  188 ALA B CA  
3438 C C   . ALA B 119 ? 0.4425 0.4261 0.4141 0.0809  -0.0050 0.0474  188 ALA B C   
3439 O O   . ALA B 119 ? 0.4478 0.4275 0.4198 0.0885  -0.0032 0.0483  188 ALA B O   
3440 C CB  . ALA B 119 ? 0.3468 0.3217 0.3010 0.0822  0.0001  0.0353  188 ALA B CB  
3441 N N   . GLU B 120 ? 0.4402 0.4362 0.4216 0.0764  -0.0068 0.0534  189 GLU B N   
3442 C CA  . GLU B 120 ? 0.4910 0.4996 0.4853 0.0806  -0.0064 0.0622  189 GLU B CA  
3443 C C   . GLU B 120 ? 0.4719 0.4916 0.4711 0.0888  0.0000  0.0640  189 GLU B C   
3444 O O   . GLU B 120 ? 0.5664 0.5948 0.5751 0.0959  0.0023  0.0699  189 GLU B O   
3445 C CB  . GLU B 120 ? 0.5861 0.6031 0.5876 0.0713  -0.0112 0.0680  189 GLU B CB  
3446 C CG  . GLU B 120 ? 0.7112 0.7182 0.7081 0.0629  -0.0172 0.0672  189 GLU B CG  
3447 C CD  . GLU B 120 ? 0.8753 0.8802 0.8764 0.0664  -0.0199 0.0719  189 GLU B CD  
3448 O OE1 . GLU B 120 ? 0.8895 0.9065 0.9023 0.0715  -0.0192 0.0797  189 GLU B OE1 
3449 O OE2 . GLU B 120 ? 0.8983 0.8899 0.8914 0.0640  -0.0228 0.0683  189 GLU B OE2 
3450 N N   . PHE B 121 ? 0.4750 0.4951 0.4682 0.0880  0.0029  0.0594  190 PHE B N   
3451 C CA  . PHE B 121 ? 0.3450 0.3739 0.3402 0.0952  0.0092  0.0602  190 PHE B CA  
3452 C C   . PHE B 121 ? 0.4100 0.4295 0.3970 0.1044  0.0141  0.0550  190 PHE B C   
3453 O O   . PHE B 121 ? 0.4974 0.5021 0.4753 0.1042  0.0123  0.0497  190 PHE B O   
3454 C CB  . PHE B 121 ? 0.4396 0.4711 0.4303 0.0904  0.0099  0.0574  190 PHE B CB  
3455 C CG  . PHE B 121 ? 0.4597 0.4773 0.4370 0.0872  0.0087  0.0488  190 PHE B CG  
3456 C CD1 . PHE B 121 ? 0.3661 0.3768 0.3406 0.0787  0.0036  0.0464  190 PHE B CD1 
3457 C CD2 . PHE B 121 ? 0.4869 0.4987 0.4542 0.0925  0.0129  0.0432  190 PHE B CD2 
3458 C CE1 . PHE B 121 ? 0.3448 0.3446 0.3084 0.0757  0.0026  0.0392  190 PHE B CE1 
3459 C CE2 . PHE B 121 ? 0.3961 0.3963 0.3517 0.0889  0.0112  0.0360  190 PHE B CE2 
3460 C CZ  . PHE B 121 ? 0.3595 0.3544 0.3141 0.0807  0.0060  0.0342  190 PHE B CZ  
3461 N N   . ASP B 122 ? 0.4358 0.4633 0.4251 0.1123  0.0206  0.0564  191 ASP B N   
3462 C CA  . ASP B 122 ? 0.5149 0.5328 0.4947 0.1212  0.0265  0.0510  191 ASP B CA  
3463 C C   . ASP B 122 ? 0.5164 0.5294 0.4830 0.1199  0.0292  0.0441  191 ASP B C   
3464 O O   . ASP B 122 ? 0.4420 0.4397 0.3947 0.1207  0.0298  0.0367  191 ASP B O   
3465 C CB  . ASP B 122 ? 0.5911 0.6199 0.5808 0.1316  0.0330  0.0565  191 ASP B CB  
3466 C CG  . ASP B 122 ? 0.6687 0.7038 0.6728 0.1334  0.0300  0.0643  191 ASP B CG  
3467 O OD1 . ASP B 122 ? 0.7255 0.7481 0.7265 0.1341  0.0269  0.0626  191 ASP B OD1 
3468 O OD2 . ASP B 122 ? 0.6457 0.6986 0.6643 0.1337  0.0305  0.0727  191 ASP B OD2 
3469 N N   . GLY B 123 ? 0.5760 0.6014 0.5462 0.1175  0.0306  0.0469  192 GLY B N   
3470 C CA  . GLY B 123 ? 0.5033 0.5261 0.4620 0.1163  0.0330  0.0417  192 GLY B CA  
3471 C C   . GLY B 123 ? 0.5190 0.5502 0.4811 0.1082  0.0295  0.0441  192 GLY B C   
3472 O O   . GLY B 123 ? 0.4554 0.4917 0.4268 0.1026  0.0249  0.0485  192 GLY B O   
3473 N N   . VAL B 124 ? 0.4407 0.4726 0.3946 0.1075  0.0317  0.0414  193 VAL B N   
3474 C CA  . VAL B 124 ? 0.3459 0.3839 0.3015 0.1004  0.0285  0.0432  193 VAL B CA  
3475 C C   . VAL B 124 ? 0.3781 0.4274 0.3343 0.1031  0.0334  0.0465  193 VAL B C   
3476 O O   . VAL B 124 ? 0.4574 0.5047 0.4050 0.1088  0.0388  0.0436  193 VAL B O   
3477 C CB  . VAL B 124 ? 0.4637 0.4902 0.4079 0.0951  0.0247  0.0366  193 VAL B CB  
3478 C CG1 . VAL B 124 ? 0.3586 0.3914 0.3056 0.0888  0.0219  0.0389  193 VAL B CG1 
3479 C CG2 . VAL B 124 ? 0.5922 0.6078 0.5356 0.0919  0.0202  0.0334  193 VAL B CG2 
3480 N N   . VAL B 125 ? 0.3866 0.4470 0.3519 0.0988  0.0317  0.0526  194 VAL B N   
3481 C CA  . VAL B 125 ? 0.4043 0.4755 0.3700 0.0994  0.0352  0.0563  194 VAL B CA  
3482 C C   . VAL B 125 ? 0.5326 0.6019 0.4951 0.0922  0.0307  0.0556  194 VAL B C   
3483 O O   . VAL B 125 ? 0.5504 0.6232 0.5211 0.0867  0.0268  0.0596  194 VAL B O   
3484 C CB  . VAL B 125 ? 0.3407 0.4272 0.3202 0.1003  0.0371  0.0649  194 VAL B CB  
3485 C CG1 . VAL B 125 ? 0.2074 0.3043 0.1870 0.0990  0.0396  0.0690  194 VAL B CG1 
3486 C CG2 . VAL B 125 ? 0.2896 0.3796 0.2731 0.1087  0.0424  0.0660  194 VAL B CG2 
3487 N N   . GLY B 126 ? 0.4957 0.5588 0.4459 0.0922  0.0311  0.0508  195 GLY B N   
3488 C CA  . GLY B 126 ? 0.3165 0.3777 0.2641 0.0862  0.0268  0.0503  195 GLY B CA  
3489 C C   . GLY B 126 ? 0.3009 0.3735 0.2535 0.0843  0.0276  0.0569  195 GLY B C   
3490 O O   . GLY B 126 ? 0.4833 0.5621 0.4319 0.0876  0.0322  0.0586  195 GLY B O   
3491 N N   . MET B 127 ? 0.2706 0.3453 0.2313 0.0788  0.0235  0.0606  196 MET B N   
3492 C CA  . MET B 127 ? 0.2572 0.3412 0.2232 0.0762  0.0236  0.0673  196 MET B CA  
3493 C C   . MET B 127 ? 0.3420 0.4236 0.3026 0.0730  0.0208  0.0669  196 MET B C   
3494 O O   . MET B 127 ? 0.3407 0.4269 0.3063 0.0696  0.0193  0.0723  196 MET B O   
3495 C CB  . MET B 127 ? 0.2908 0.3777 0.2685 0.0720  0.0210  0.0721  196 MET B CB  
3496 C CG  . MET B 127 ? 0.4038 0.4954 0.3885 0.0745  0.0230  0.0742  196 MET B CG  
3497 S SD  . MET B 127 ? 0.4775 0.5845 0.4662 0.0790  0.0291  0.0808  196 MET B SD  
3498 C CE  . MET B 127 ? 0.4617 0.5765 0.4594 0.0718  0.0263  0.0893  196 MET B CE  
3499 N N   . GLY B 128 ? 0.4185 0.4929 0.3689 0.0738  0.0199  0.0611  197 GLY B N   
3500 C CA  . GLY B 128 ? 0.4757 0.5486 0.4217 0.0707  0.0166  0.0612  197 GLY B CA  
3501 C C   . GLY B 128 ? 0.4391 0.5179 0.3773 0.0718  0.0190  0.0637  197 GLY B C   
3502 O O   . GLY B 128 ? 0.4250 0.5096 0.3614 0.0751  0.0240  0.0656  197 GLY B O   
3503 N N   . PHE B 129 ? 0.4945 0.5721 0.4281 0.0689  0.0155  0.0641  198 PHE B N   
3504 C CA  . PHE B 129 ? 0.4724 0.5551 0.3977 0.0687  0.0166  0.0672  198 PHE B CA  
3505 C C   . PHE B 129 ? 0.4990 0.5769 0.4089 0.0707  0.0189  0.0613  198 PHE B C   
3506 O O   . PHE B 129 ? 0.5075 0.5770 0.4128 0.0712  0.0179  0.0548  198 PHE B O   
3507 C CB  . PHE B 129 ? 0.3977 0.4813 0.3249 0.0645  0.0112  0.0710  198 PHE B CB  
3508 C CG  . PHE B 129 ? 0.4311 0.5179 0.3716 0.0624  0.0093  0.0770  198 PHE B CG  
3509 C CD1 . PHE B 129 ? 0.4398 0.5217 0.3898 0.0614  0.0074  0.0753  198 PHE B CD1 
3510 C CD2 . PHE B 129 ? 0.3456 0.4393 0.2880 0.0610  0.0095  0.0844  198 PHE B CD2 
3511 C CE1 . PHE B 129 ? 0.4085 0.4914 0.3690 0.0591  0.0060  0.0804  198 PHE B CE1 
3512 C CE2 . PHE B 129 ? 0.3449 0.4397 0.2983 0.0587  0.0078  0.0898  198 PHE B CE2 
3513 C CZ  . PHE B 129 ? 0.4028 0.4917 0.3650 0.0578  0.0062  0.0876  198 PHE B CZ  
3514 N N   . ILE B 130 ? 0.4118 0.4946 0.3126 0.0713  0.0221  0.0635  199 ILE B N   
3515 C CA  . ILE B 130 ? 0.4940 0.5713 0.3779 0.0727  0.0248  0.0577  199 ILE B CA  
3516 C C   . ILE B 130 ? 0.4384 0.5086 0.3140 0.0684  0.0187  0.0543  199 ILE B C   
3517 O O   . ILE B 130 ? 0.5669 0.6286 0.4294 0.0688  0.0195  0.0477  199 ILE B O   
3518 C CB  . ILE B 130 ? 0.5833 0.6674 0.4583 0.0735  0.0297  0.0611  199 ILE B CB  
3519 C CG1 . ILE B 130 ? 0.4846 0.5613 0.3414 0.0760  0.0346  0.0541  199 ILE B CG1 
3520 C CG2 . ILE B 130 ? 0.5306 0.6198 0.4040 0.0682  0.0248  0.0671  199 ILE B CG2 
3521 C CD1 . ILE B 130 ? 0.5278 0.6104 0.3742 0.0769  0.0404  0.0564  199 ILE B CD1 
3522 N N   . GLU B 131 ? 0.3671 0.4406 0.2503 0.0643  0.0126  0.0589  200 GLU B N   
3523 C CA  . GLU B 131 ? 0.4136 0.4826 0.2917 0.0601  0.0063  0.0567  200 GLU B CA  
3524 C C   . GLU B 131 ? 0.5047 0.5639 0.3804 0.0606  0.0055  0.0490  200 GLU B C   
3525 O O   . GLU B 131 ? 0.5432 0.5967 0.4077 0.0576  0.0025  0.0450  200 GLU B O   
3526 C CB  . GLU B 131 ? 0.3729 0.4469 0.2644 0.0572  0.0006  0.0629  200 GLU B CB  
3527 C CG  . GLU B 131 ? 0.3268 0.4084 0.2170 0.0549  -0.0013 0.0704  200 GLU B CG  
3528 C CD  . GLU B 131 ? 0.5733 0.6615 0.4714 0.0568  0.0025  0.0763  200 GLU B CD  
3529 O OE1 . GLU B 131 ? 0.4638 0.5518 0.3633 0.0603  0.0081  0.0741  200 GLU B OE1 
3530 O OE2 . GLU B 131 ? 0.6304 0.7240 0.5335 0.0547  -0.0003 0.0837  200 GLU B OE2 
3531 N N   . GLN B 132 ? 0.5569 0.6140 0.4422 0.0637  0.0079  0.0472  201 GLN B N   
3532 C CA  . GLN B 132 ? 0.4972 0.5452 0.3819 0.0637  0.0068  0.0408  201 GLN B CA  
3533 C C   . GLN B 132 ? 0.5691 0.6101 0.4450 0.0682  0.0124  0.0352  201 GLN B C   
3534 O O   . GLN B 132 ? 0.5790 0.6114 0.4535 0.0685  0.0117  0.0299  201 GLN B O   
3535 C CB  . GLN B 132 ? 0.4277 0.4769 0.3288 0.0634  0.0049  0.0426  201 GLN B CB  
3536 C CG  . GLN B 132 ? 0.5087 0.5618 0.4185 0.0595  -0.0005 0.0465  201 GLN B CG  
3537 C CD  . GLN B 132 ? 0.7211 0.7684 0.6339 0.0569  -0.0041 0.0423  201 GLN B CD  
3538 O OE1 . GLN B 132 ? 0.9111 0.9540 0.8145 0.0546  -0.0066 0.0384  201 GLN B OE1 
3539 N NE2 . GLN B 132 ? 0.7736 0.8205 0.6987 0.0568  -0.0043 0.0431  201 GLN B NE2 
3540 N N   . ALA B 133 ? 0.5759 0.6202 0.4459 0.0718  0.0181  0.0364  202 ALA B N   
3541 C CA  . ALA B 133 ? 0.5274 0.5653 0.3902 0.0772  0.0243  0.0314  202 ALA B CA  
3542 C C   . ALA B 133 ? 0.5381 0.5639 0.3820 0.0759  0.0242  0.0242  202 ALA B C   
3543 O O   . ALA B 133 ? 0.6637 0.6892 0.4958 0.0721  0.0222  0.0241  202 ALA B O   
3544 C CB  . ALA B 133 ? 0.4814 0.5275 0.3443 0.0817  0.0312  0.0351  202 ALA B CB  
3545 N N   . ILE B 134 ? 0.5267 0.5418 0.3670 0.0788  0.0260  0.0183  203 ILE B N   
3546 C CA  . ILE B 134 ? 0.6398 0.6409 0.4611 0.0777  0.0264  0.0109  203 ILE B CA  
3547 C C   . ILE B 134 ? 0.7443 0.7430 0.5520 0.0824  0.0344  0.0087  203 ILE B C   
3548 O O   . ILE B 134 ? 0.7164 0.7197 0.5308 0.0892  0.0411  0.0105  203 ILE B O   
3549 C CB  . ILE B 134 ? 0.7090 0.6986 0.5314 0.0791  0.0256  0.0057  203 ILE B CB  
3550 C CG1 . ILE B 134 ? 0.5415 0.5343 0.3773 0.0742  0.0184  0.0079  203 ILE B CG1 
3551 C CG2 . ILE B 134 ? 0.8458 0.8193 0.6475 0.0773  0.0256  -0.0021 203 ILE B CG2 
3552 C CD1 . ILE B 134 ? 0.5134 0.5083 0.3450 0.0667  0.0118  0.0086  203 ILE B CD1 
3553 N N   . GLY B 135 ? 0.7283 0.7201 0.5166 0.0786  0.0338  0.0051  204 GLY B N   
3554 C CA  . GLY B 135 ? 0.6672 0.6564 0.4403 0.0820  0.0416  0.0029  204 GLY B CA  
3555 C C   . GLY B 135 ? 0.6824 0.6866 0.4604 0.0824  0.0442  0.0099  204 GLY B C   
3556 O O   . GLY B 135 ? 0.7271 0.7315 0.4956 0.0865  0.0522  0.0088  204 GLY B O   
3557 N N   . ARG B 136 ? 0.7222 0.7386 0.5146 0.0784  0.0380  0.0170  205 ARG B N   
3558 C CA  . ARG B 136 ? 0.7931 0.8241 0.5921 0.0781  0.0395  0.0247  205 ARG B CA  
3559 C C   . ARG B 136 ? 0.7123 0.7500 0.5189 0.0858  0.0485  0.0267  205 ARG B C   
3560 O O   . ARG B 136 ? 0.6973 0.7436 0.5012 0.0867  0.0532  0.0306  205 ARG B O   
3561 C CB  . ARG B 136 ? 0.9972 1.0278 0.7779 0.0730  0.0387  0.0249  205 ARG B CB  
3562 C CG  . ARG B 136 ? 1.1516 1.1968 0.9384 0.0713  0.0387  0.0336  205 ARG B CG  
3563 C CD  . ARG B 136 ? 1.2846 1.3293 1.0517 0.0706  0.0444  0.0327  205 ARG B CD  
3564 N NE  . ARG B 136 ? 1.3259 1.3718 1.0820 0.0623  0.0376  0.0355  205 ARG B NE  
3565 C CZ  . ARG B 136 ? 1.2920 1.3363 1.0326 0.0582  0.0399  0.0348  205 ARG B CZ  
3566 N NH1 . ARG B 136 ? 1.2880 1.3335 1.0211 0.0497  0.0324  0.0380  205 ARG B NH1 
3567 N NH2 . ARG B 136 ? 1.2168 1.2584 0.9502 0.0621  0.0497  0.0309  205 ARG B NH2 
3568 N N   . VAL B 137 ? 0.6803 0.7151 0.4971 0.0912  0.0509  0.0247  206 VAL B N   
3569 C CA  . VAL B 137 ? 0.6101 0.6527 0.4368 0.0986  0.0589  0.0275  206 VAL B CA  
3570 C C   . VAL B 137 ? 0.5740 0.6324 0.4200 0.0969  0.0562  0.0367  206 VAL B C   
3571 O O   . VAL B 137 ? 0.6402 0.6997 0.4975 0.0930  0.0491  0.0390  206 VAL B O   
3572 C CB  . VAL B 137 ? 0.5434 0.5776 0.3748 0.1046  0.0614  0.0231  206 VAL B CB  
3573 C CG1 . VAL B 137 ? 0.5015 0.5459 0.3454 0.1122  0.0690  0.0271  206 VAL B CG1 
3574 C CG2 . VAL B 137 ? 0.5678 0.5844 0.3788 0.1060  0.0640  0.0138  206 VAL B CG2 
3575 N N   . THR B 138 ? 0.5771 0.6471 0.4264 0.0996  0.0623  0.0417  207 THR B N   
3576 C CA  . THR B 138 ? 0.6689 0.7531 0.5342 0.0970  0.0597  0.0507  207 THR B CA  
3577 C C   . THR B 138 ? 0.7231 0.8102 0.6071 0.0988  0.0577  0.0530  207 THR B C   
3578 O O   . THR B 138 ? 0.8213 0.9072 0.7091 0.1050  0.0626  0.0509  207 THR B O   
3579 C CB  . THR B 138 ? 0.6625 0.7588 0.5271 0.0995  0.0673  0.0556  207 THR B CB  
3580 O OG1 . THR B 138 ? 0.7028 0.7966 0.5493 0.0962  0.0682  0.0541  207 THR B OG1 
3581 C CG2 . THR B 138 ? 0.6724 0.7829 0.5539 0.0965  0.0648  0.0651  207 THR B CG2 
3582 N N   . PRO B 139 ? 0.6791 0.7695 0.5746 0.0937  0.0506  0.0574  208 PRO B N   
3583 C CA  . PRO B 139 ? 0.6009 0.6933 0.5126 0.0943  0.0484  0.0596  208 PRO B CA  
3584 C C   . PRO B 139 ? 0.5761 0.6816 0.4994 0.0978  0.0537  0.0659  208 PRO B C   
3585 O O   . PRO B 139 ? 0.6409 0.7561 0.5628 0.0979  0.0577  0.0704  208 PRO B O   
3586 C CB  . PRO B 139 ? 0.6503 0.7430 0.5690 0.0875  0.0406  0.0630  208 PRO B CB  
3587 C CG  . PRO B 139 ? 0.7459 0.8342 0.6517 0.0840  0.0377  0.0610  208 PRO B CG  
3588 C CD  . PRO B 139 ? 0.7373 0.8286 0.6309 0.0870  0.0442  0.0604  208 PRO B CD  
3589 N N   . ILE B 140 ? 0.5062 0.6125 0.4413 0.1001  0.0534  0.0667  209 ILE B N   
3590 C CA  . ILE B 140 ? 0.4265 0.5460 0.3738 0.1035  0.0582  0.0729  209 ILE B CA  
3591 C C   . ILE B 140 ? 0.5131 0.6443 0.4701 0.0978  0.0555  0.0815  209 ILE B C   
3592 O O   . ILE B 140 ? 0.4860 0.6303 0.4483 0.0993  0.0604  0.0874  209 ILE B O   
3593 C CB  . ILE B 140 ? 0.3502 0.4676 0.3077 0.1066  0.0573  0.0723  209 ILE B CB  
3594 C CG1 . ILE B 140 ? 0.3945 0.5269 0.3648 0.1110  0.0627  0.0790  209 ILE B CG1 
3595 C CG2 . ILE B 140 ? 0.2412 0.3543 0.2063 0.1000  0.0490  0.0733  209 ILE B CG2 
3596 C CD1 . ILE B 140 ? 0.4233 0.5546 0.4038 0.1146  0.0621  0.0792  209 ILE B CD1 
3597 N N   . PHE B 141 ? 0.5734 0.6999 0.5325 0.0912  0.0482  0.0824  210 PHE B N   
3598 C CA  . PHE B 141 ? 0.5106 0.6462 0.4782 0.0857  0.0458  0.0904  210 PHE B CA  
3599 C C   . PHE B 141 ? 0.5452 0.6863 0.5048 0.0844  0.0482  0.0933  210 PHE B C   
3600 O O   . PHE B 141 ? 0.5989 0.7507 0.5647 0.0816  0.0490  0.1009  210 PHE B O   
3601 C CB  . PHE B 141 ? 0.3007 0.4286 0.2725 0.0794  0.0381  0.0904  210 PHE B CB  
3602 C CG  . PHE B 141 ? 0.2460 0.3813 0.2280 0.0739  0.0357  0.0984  210 PHE B CG  
3603 C CD1 . PHE B 141 ? 0.2384 0.3830 0.2315 0.0738  0.0372  0.1037  210 PHE B CD1 
3604 C CD2 . PHE B 141 ? 0.3225 0.4554 0.3029 0.0688  0.0318  0.1012  210 PHE B CD2 
3605 C CE1 . PHE B 141 ? 0.3310 0.4816 0.3323 0.0677  0.0347  0.1112  210 PHE B CE1 
3606 C CE2 . PHE B 141 ? 0.2996 0.4375 0.2883 0.0634  0.0296  0.1086  210 PHE B CE2 
3607 C CZ  . PHE B 141 ? 0.2613 0.4077 0.2598 0.0625  0.0310  0.1134  210 PHE B CZ  
3608 N N   . ASP B 142 ? 0.6068 0.7405 0.5521 0.0857  0.0489  0.0878  211 ASP B N   
3609 C CA  . ASP B 142 ? 0.6077 0.7466 0.5437 0.0843  0.0514  0.0906  211 ASP B CA  
3610 C C   . ASP B 142 ? 0.5958 0.7461 0.5320 0.0890  0.0602  0.0933  211 ASP B C   
3611 O O   . ASP B 142 ? 0.6482 0.8091 0.5858 0.0866  0.0623  0.1000  211 ASP B O   
3612 C CB  . ASP B 142 ? 0.6082 0.7363 0.5278 0.0841  0.0500  0.0839  211 ASP B CB  
3613 C CG  . ASP B 142 ? 0.7343 0.8550 0.6545 0.0786  0.0414  0.0836  211 ASP B CG  
3614 O OD1 . ASP B 142 ? 0.7443 0.8673 0.6765 0.0752  0.0372  0.0884  211 ASP B OD1 
3615 O OD2 . ASP B 142 ? 0.7526 0.8651 0.6611 0.0776  0.0390  0.0787  211 ASP B OD2 
3616 N N   . ASN B 143 ? 0.4770 0.6253 0.4122 0.0958  0.0657  0.0884  212 ASN B N   
3617 C CA  . ASN B 143 ? 0.5382 0.6982 0.4760 0.1014  0.0748  0.0911  212 ASN B CA  
3618 C C   . ASN B 143 ? 0.6404 0.8155 0.5959 0.0994  0.0747  0.1006  212 ASN B C   
3619 O O   . ASN B 143 ? 0.6777 0.8662 0.6355 0.1001  0.0804  0.1062  212 ASN B O   
3620 C CB  . ASN B 143 ? 0.4741 0.6279 0.4100 0.1097  0.0801  0.0845  212 ASN B CB  
3621 C CG  . ASN B 143 ? 0.5818 0.7217 0.4977 0.1120  0.0825  0.0754  212 ASN B CG  
3622 O OD1 . ASN B 143 ? 0.6246 0.7648 0.5274 0.1100  0.0848  0.0750  212 ASN B OD1 
3623 N ND2 . ASN B 143 ? 0.6288 0.7560 0.5414 0.1156  0.0816  0.0683  212 ASN B ND2 
3624 N N   . ILE B 144 ? 0.5083 0.6816 0.4758 0.0962  0.0682  0.1024  213 ILE B N   
3625 C CA  . ILE B 144 ? 0.3833 0.5697 0.3665 0.0927  0.0669  0.1115  213 ILE B CA  
3626 C C   . ILE B 144 ? 0.4402 0.6319 0.4223 0.0856  0.0644  0.1180  213 ILE B C   
3627 O O   . ILE B 144 ? 0.5929 0.7988 0.5835 0.0835  0.0667  0.1261  213 ILE B O   
3628 C CB  . ILE B 144 ? 0.4879 0.6686 0.4814 0.0900  0.0602  0.1112  213 ILE B CB  
3629 C CG1 . ILE B 144 ? 0.4281 0.6043 0.4234 0.0972  0.0627  0.1058  213 ILE B CG1 
3630 C CG2 . ILE B 144 ? 0.5753 0.7682 0.5834 0.0849  0.0580  0.1206  213 ILE B CG2 
3631 C CD1 . ILE B 144 ? 0.2477 0.4170 0.2509 0.0943  0.0560  0.1050  213 ILE B CD1 
3632 N N   . ILE B 145 ? 0.5134 0.6945 0.4855 0.0816  0.0595  0.1152  214 ILE B N   
3633 C CA  . ILE B 145 ? 0.5192 0.7039 0.4894 0.0752  0.0568  0.1215  214 ILE B CA  
3634 C C   . ILE B 145 ? 0.5167 0.7116 0.4793 0.0769  0.0639  0.1244  214 ILE B C   
3635 O O   . ILE B 145 ? 0.4807 0.6846 0.4493 0.0724  0.0635  0.1309  214 ILE B O   
3636 C CB  . ILE B 145 ? 0.4501 0.6211 0.4121 0.0716  0.0498  0.1178  214 ILE B CB  
3637 C CG1 . ILE B 145 ? 0.4307 0.5937 0.4021 0.0682  0.0430  0.1173  214 ILE B CG1 
3638 C CG2 . ILE B 145 ? 0.2743 0.4484 0.2308 0.0666  0.0482  0.1237  214 ILE B CG2 
3639 C CD1 . ILE B 145 ? 0.2183 0.3683 0.1837 0.0658  0.0368  0.1131  214 ILE B CD1 
3640 N N   . SER B 146 ? 0.5273 0.7185 0.4777 0.0826  0.0694  0.1177  215 SER B N   
3641 C CA  . SER B 146 ? 0.5144 0.7107 0.4573 0.0834  0.0749  0.1172  215 SER B CA  
3642 C C   . SER B 146 ? 0.6017 0.8133 0.5569 0.0849  0.0803  0.1226  215 SER B C   
3643 O O   . SER B 146 ? 0.6672 0.8852 0.6192 0.0829  0.0832  0.1250  215 SER B O   
3644 C CB  . SER B 146 ? 0.4840 0.6713 0.4118 0.0894  0.0800  0.1079  215 SER B CB  
3645 O OG  . SER B 146 ? 0.5936 0.7681 0.5080 0.0864  0.0747  0.1034  215 SER B OG  
3646 N N   . GLN B 147 ? 0.4997 0.7174 0.4688 0.0880  0.0813  0.1250  216 GLN B N   
3647 C CA  . GLN B 147 ? 0.4939 0.7269 0.4762 0.0895  0.0856  0.1307  216 GLN B CA  
3648 C C   . GLN B 147 ? 0.5206 0.7631 0.5129 0.0811  0.0808  0.1399  216 GLN B C   
3649 O O   . GLN B 147 ? 0.6046 0.8606 0.6069 0.0810  0.0838  0.1454  216 GLN B O   
3650 C CB  . GLN B 147 ? 0.5362 0.7726 0.5307 0.0953  0.0873  0.1306  216 GLN B CB  
3651 C CG  . GLN B 147 ? 0.6077 0.8341 0.5935 0.1041  0.0923  0.1215  216 GLN B CG  
3652 C CD  . GLN B 147 ? 0.6321 0.8628 0.6313 0.1102  0.0942  0.1220  216 GLN B CD  
3653 O OE1 . GLN B 147 ? 0.6839 0.9244 0.6986 0.1071  0.0907  0.1293  216 GLN B OE1 
3654 N NE2 . GLN B 147 ? 0.6702 0.8925 0.6631 0.1185  0.0993  0.1145  216 GLN B NE2 
3655 N N   . GLY B 148 ? 0.5464 0.7813 0.5364 0.0741  0.0733  0.1416  217 GLY B N   
3656 C CA  . GLY B 148 ? 0.4718 0.7126 0.4704 0.0657  0.0683  0.1495  217 GLY B CA  
3657 C C   . GLY B 148 ? 0.5609 0.8121 0.5761 0.0640  0.0671  0.1557  217 GLY B C   
3658 O O   . GLY B 148 ? 0.4780 0.7381 0.5009 0.0581  0.0653  0.1625  217 GLY B O   
3659 N N   . VAL B 149 ? 0.6370 0.8870 0.6578 0.0684  0.0676  0.1537  218 VAL B N   
3660 C CA  . VAL B 149 ? 0.5482 0.8085 0.5849 0.0663  0.0659  0.1599  218 VAL B CA  
3661 C C   . VAL B 149 ? 0.5286 0.7808 0.5693 0.0582  0.0574  0.1625  218 VAL B C   
3662 O O   . VAL B 149 ? 0.5822 0.8419 0.6342 0.0522  0.0539  0.1690  218 VAL B O   
3663 C CB  . VAL B 149 ? 0.5995 0.8638 0.6418 0.0751  0.0708  0.1572  218 VAL B CB  
3664 C CG1 . VAL B 149 ? 0.6426 0.9089 0.6776 0.0837  0.0791  0.1522  218 VAL B CG1 
3665 C CG2 . VAL B 149 ? 0.7277 0.9790 0.7660 0.0769  0.0681  0.1520  218 VAL B CG2 
3666 N N   . LEU B 150 ? 0.4990 0.7352 0.5303 0.0574  0.0537  0.1572  219 LEU B N   
3667 C CA  . LEU B 150 ? 0.4912 0.7171 0.5257 0.0512  0.0462  0.1578  219 LEU B CA  
3668 C C   . LEU B 150 ? 0.4691 0.6924 0.5060 0.0416  0.0407  0.1620  219 LEU B C   
3669 O O   . LEU B 150 ? 0.5087 0.7311 0.5397 0.0400  0.0410  0.1623  219 LEU B O   
3670 C CB  . LEU B 150 ? 0.4504 0.6587 0.4751 0.0538  0.0434  0.1491  219 LEU B CB  
3671 C CG  . LEU B 150 ? 0.4887 0.6942 0.5127 0.0620  0.0464  0.1416  219 LEU B CG  
3672 C CD1 . LEU B 150 ? 0.5353 0.7237 0.5486 0.0639  0.0435  0.1325  219 LEU B CD1 
3673 C CD2 . LEU B 150 ? 0.4616 0.6701 0.4974 0.0610  0.0441  0.1435  219 LEU B CD2 
3674 N N   . LYS B 151 ? 0.4670 0.6886 0.5121 0.0349  0.0355  0.1652  220 LYS B N   
3675 C CA  . LYS B 151 ? 0.4867 0.7028 0.5330 0.0256  0.0302  0.1682  220 LYS B CA  
3676 C C   . LYS B 151 ? 0.4894 0.6882 0.5257 0.0246  0.0271  0.1634  220 LYS B C   
3677 O O   . LYS B 151 ? 0.4637 0.6598 0.4969 0.0206  0.0256  0.1654  220 LYS B O   
3678 C CB  . LYS B 151 ? 0.4995 0.7139 0.5541 0.0185  0.0252  0.1710  220 LYS B CB  
3679 C CG  . LYS B 151 ? 0.6701 0.8776 0.7251 0.0086  0.0200  0.1740  220 LYS B CG  
3680 C CD  . LYS B 151 ? 0.7331 0.9377 0.7944 0.0011  0.0150  0.1759  220 LYS B CD  
3681 C CE  . LYS B 151 ? 0.8547 1.0393 0.9098 -0.0059 0.0098  0.1732  220 LYS B CE  
3682 N NZ  . LYS B 151 ? 0.9023 1.0713 0.9498 -0.0013 0.0096  0.1661  220 LYS B NZ  
3683 N N   . GLU B 152 ? 0.5125 0.6999 0.5440 0.0284  0.0260  0.1573  221 GLU B N   
3684 C CA  . GLU B 152 ? 0.5223 0.6955 0.5449 0.0294  0.0237  0.1525  221 GLU B CA  
3685 C C   . GLU B 152 ? 0.5314 0.7016 0.5478 0.0374  0.0261  0.1463  221 GLU B C   
3686 O O   . GLU B 152 ? 0.5901 0.7627 0.6097 0.0405  0.0273  0.1450  221 GLU B O   
3687 C CB  . GLU B 152 ? 0.4582 0.6162 0.4818 0.0233  0.0179  0.1513  221 GLU B CB  
3688 C CG  . GLU B 152 ? 0.5285 0.6857 0.5558 0.0150  0.0151  0.1567  221 GLU B CG  
3689 C CD  . GLU B 152 ? 0.6809 0.8386 0.7038 0.0141  0.0153  0.1592  221 GLU B CD  
3690 O OE1 . GLU B 152 ? 0.7202 0.8734 0.7364 0.0186  0.0158  0.1559  221 GLU B OE1 
3691 O OE2 . GLU B 152 ? 0.6808 0.8434 0.7068 0.0084  0.0145  0.1646  221 GLU B OE2 
3692 N N   . ASP B 153 ? 0.4601 0.6252 0.4673 0.0406  0.0265  0.1428  222 ASP B N   
3693 C CA  . ASP B 153 ? 0.5141 0.6752 0.5141 0.0476  0.0284  0.1361  222 ASP B CA  
3694 C C   . ASP B 153 ? 0.5879 0.7346 0.5889 0.0466  0.0235  0.1304  222 ASP B C   
3695 O O   . ASP B 153 ? 0.6002 0.7372 0.5962 0.0464  0.0205  0.1272  222 ASP B O   
3696 C CB  . ASP B 153 ? 0.6285 0.7897 0.6176 0.0504  0.0302  0.1346  222 ASP B CB  
3697 C CG  . ASP B 153 ? 0.6680 0.8413 0.6568 0.0494  0.0343  0.1392  222 ASP B CG  
3698 O OD1 . ASP B 153 ? 0.6980 0.8698 0.6846 0.0453  0.0320  0.1418  222 ASP B OD1 
3699 O OD2 . ASP B 153 ? 0.7477 0.9321 0.7390 0.0530  0.0399  0.1405  222 ASP B OD2 
3700 N N   . VAL B 154 ? 0.4932 0.6395 0.5012 0.0457  0.0228  0.1293  223 VAL B N   
3701 C CA  . VAL B 154 ? 0.3462 0.4801 0.3565 0.0427  0.0184  0.1256  223 VAL B CA  
3702 C C   . VAL B 154 ? 0.3613 0.4968 0.3761 0.0447  0.0191  0.1226  223 VAL B C   
3703 O O   . VAL B 154 ? 0.5191 0.6665 0.5394 0.0456  0.0219  0.1267  223 VAL B O   
3704 C CB  . VAL B 154 ? 0.3984 0.5288 0.4129 0.0350  0.0149  0.1317  223 VAL B CB  
3705 C CG1 . VAL B 154 ? 0.4215 0.5427 0.4399 0.0310  0.0118  0.1291  223 VAL B CG1 
3706 C CG2 . VAL B 154 ? 0.3444 0.4675 0.3543 0.0335  0.0129  0.1329  223 VAL B CG2 
3707 N N   . PHE B 155 ? 0.3819 0.5062 0.3951 0.0453  0.0168  0.1158  224 PHE B N   
3708 C CA  . PHE B 155 ? 0.2949 0.4189 0.3126 0.0456  0.0162  0.1137  224 PHE B CA  
3709 C C   . PHE B 155 ? 0.3581 0.4689 0.3759 0.0405  0.0118  0.1104  224 PHE B C   
3710 O O   . PHE B 155 ? 0.4254 0.5267 0.4394 0.0390  0.0100  0.1080  224 PHE B O   
3711 C CB  . PHE B 155 ? 0.3059 0.4306 0.3202 0.0531  0.0192  0.1078  224 PHE B CB  
3712 C CG  . PHE B 155 ? 0.2659 0.3801 0.2714 0.0558  0.0185  0.1003  224 PHE B CG  
3713 C CD1 . PHE B 155 ? 0.3564 0.4725 0.3549 0.0590  0.0207  0.0995  224 PHE B CD1 
3714 C CD2 . PHE B 155 ? 0.2315 0.3345 0.2356 0.0549  0.0155  0.0944  224 PHE B CD2 
3715 C CE1 . PHE B 155 ? 0.3526 0.4598 0.3432 0.0608  0.0194  0.0932  224 PHE B CE1 
3716 C CE2 . PHE B 155 ? 0.2987 0.3933 0.2955 0.0570  0.0147  0.0880  224 PHE B CE2 
3717 C CZ  . PHE B 155 ? 0.2917 0.3885 0.2819 0.0598  0.0164  0.0876  224 PHE B CZ  
3718 N N   . SER B 156 ? 0.3069 0.4173 0.3291 0.0379  0.0102  0.1107  225 SER B N   
3719 C CA  . SER B 156 ? 0.3745 0.4726 0.3961 0.0321  0.0065  0.1079  225 SER B CA  
3720 C C   . SER B 156 ? 0.4719 0.5682 0.4950 0.0325  0.0053  0.1047  225 SER B C   
3721 O O   . SER B 156 ? 0.5472 0.6534 0.5745 0.0359  0.0069  0.1071  225 SER B O   
3722 C CB  . SER B 156 ? 0.3929 0.4904 0.4176 0.0239  0.0042  0.1143  225 SER B CB  
3723 O OG  . SER B 156 ? 0.5555 0.6640 0.5867 0.0211  0.0038  0.1203  225 SER B OG  
3724 N N   . PHE B 157 ? 0.3804 0.4639 0.4003 0.0292  0.0028  0.0996  226 PHE B N   
3725 C CA  . PHE B 157 ? 0.2927 0.3723 0.3124 0.0289  0.0013  0.0960  226 PHE B CA  
3726 C C   . PHE B 157 ? 0.3361 0.4083 0.3561 0.0200  -0.0022 0.0971  226 PHE B C   
3727 O O   . PHE B 157 ? 0.4482 0.5100 0.4646 0.0157  -0.0029 0.0951  226 PHE B O   
3728 C CB  . PHE B 157 ? 0.2038 0.2743 0.2175 0.0332  0.0018  0.0876  226 PHE B CB  
3729 C CG  . PHE B 157 ? 0.2965 0.3729 0.3086 0.0414  0.0047  0.0856  226 PHE B CG  
3730 C CD1 . PHE B 157 ? 0.2187 0.3005 0.2290 0.0454  0.0074  0.0868  226 PHE B CD1 
3731 C CD2 . PHE B 157 ? 0.2879 0.3632 0.2991 0.0450  0.0049  0.0824  226 PHE B CD2 
3732 C CE1 . PHE B 157 ? 0.1934 0.2790 0.2002 0.0524  0.0104  0.0844  226 PHE B CE1 
3733 C CE2 . PHE B 157 ? 0.2161 0.2946 0.2243 0.0525  0.0080  0.0800  226 PHE B CE2 
3734 C CZ  . PHE B 157 ? 0.1934 0.2769 0.1990 0.0561  0.0109  0.0807  226 PHE B CZ  
3735 N N   . TYR B 158 ? 0.2838 0.3609 0.3077 0.0172  -0.0042 0.1004  227 TYR B N   
3736 C CA  . TYR B 158 ? 0.2088 0.2777 0.2309 0.0086  -0.0079 0.1004  227 TYR B CA  
3737 C C   . TYR B 158 ? 0.3105 0.3758 0.3310 0.0107  -0.0091 0.0960  227 TYR B C   
3738 O O   . TYR B 158 ? 0.3869 0.4617 0.4121 0.0158  -0.0087 0.0982  227 TYR B O   
3739 C CB  . TYR B 158 ? 0.3513 0.4291 0.3790 0.0019  -0.0104 0.1091  227 TYR B CB  
3740 C CG  . TYR B 158 ? 0.3821 0.4535 0.4077 -0.0069 -0.0148 0.1096  227 TYR B CG  
3741 C CD1 . TYR B 158 ? 0.4440 0.4999 0.4618 -0.0146 -0.0162 0.1058  227 TYR B CD1 
3742 C CD2 . TYR B 158 ? 0.3579 0.4385 0.3891 -0.0074 -0.0174 0.1140  227 TYR B CD2 
3743 C CE1 . TYR B 158 ? 0.5455 0.5947 0.5596 -0.0233 -0.0200 0.1060  227 TYR B CE1 
3744 C CE2 . TYR B 158 ? 0.4145 0.4893 0.4430 -0.0161 -0.0220 0.1149  227 TYR B CE2 
3745 C CZ  . TYR B 158 ? 0.5580 0.6168 0.5771 -0.0244 -0.0233 0.1107  227 TYR B CZ  
3746 O OH  . TYR B 158 ? 0.5385 0.5906 0.5532 -0.0339 -0.0277 0.1112  227 TYR B OH  
3747 N N   . TYR B 159 ? 0.3497 0.4012 0.3636 0.0071  -0.0102 0.0897  228 TYR B N   
3748 C CA  . TYR B 159 ? 0.3209 0.3671 0.3320 0.0069  -0.0120 0.0857  228 TYR B CA  
3749 C C   . TYR B 159 ? 0.4365 0.4748 0.4442 -0.0035 -0.0156 0.0865  228 TYR B C   
3750 O O   . TYR B 159 ? 0.3838 0.4124 0.3867 -0.0093 -0.0154 0.0845  228 TYR B O   
3751 C CB  . TYR B 159 ? 0.1651 0.2019 0.1704 0.0112  -0.0101 0.0772  228 TYR B CB  
3752 C CG  . TYR B 159 ? 0.2241 0.2666 0.2303 0.0209  -0.0074 0.0752  228 TYR B CG  
3753 C CD1 . TYR B 159 ? 0.2726 0.3276 0.2845 0.0263  -0.0061 0.0803  228 TYR B CD1 
3754 C CD2 . TYR B 159 ? 0.2342 0.2695 0.2351 0.0244  -0.0059 0.0682  228 TYR B CD2 
3755 C CE1 . TYR B 159 ? 0.2305 0.2889 0.2413 0.0349  -0.0031 0.0778  228 TYR B CE1 
3756 C CE2 . TYR B 159 ? 0.2083 0.2473 0.2082 0.0322  -0.0037 0.0661  228 TYR B CE2 
3757 C CZ  . TYR B 159 ? 0.2973 0.3470 0.3013 0.0375  -0.0021 0.0705  228 TYR B CZ  
3758 O OH  . TYR B 159 ? 0.3916 0.4434 0.3928 0.0450  0.0006  0.0678  228 TYR B OH  
3759 N N   . ASN B 160 ? 0.4052 0.4469 0.4148 -0.0059 -0.0189 0.0895  229 ASN B N   
3760 C CA  . ASN B 160 ? 0.3581 0.3934 0.3638 -0.0166 -0.0231 0.0911  229 ASN B CA  
3761 C C   . ASN B 160 ? 0.4046 0.4276 0.4026 -0.0184 -0.0238 0.0841  229 ASN B C   
3762 O O   . ASN B 160 ? 0.5720 0.5946 0.5698 -0.0111 -0.0223 0.0799  229 ASN B O   
3763 C CB  . ASN B 160 ? 0.4145 0.4626 0.4278 -0.0190 -0.0270 0.1000  229 ASN B CB  
3764 C CG  . ASN B 160 ? 0.4740 0.5181 0.4837 -0.0318 -0.0316 0.1041  229 ASN B CG  
3765 O OD1 . ASN B 160 ? 0.5811 0.6122 0.5822 -0.0388 -0.0312 0.1002  229 ASN B OD1 
3766 N ND2 . ASN B 160 ? 0.3931 0.4480 0.4092 -0.0350 -0.0361 0.1122  229 ASN B ND2 
3767 N N   . ARG B 161 ? 0.4723 0.4846 0.4629 -0.0286 -0.0260 0.0827  230 ARG B N   
3768 C CA  . ARG B 161 ? 0.4345 0.4366 0.4177 -0.0321 -0.0275 0.0776  230 ARG B CA  
3769 C C   . ARG B 161 ? 0.4592 0.4685 0.4459 -0.0338 -0.0325 0.0833  230 ARG B C   
3770 O O   . ARG B 161 ? 0.5189 0.5388 0.5121 -0.0364 -0.0356 0.0916  230 ARG B O   
3771 C CB  . ARG B 161 ? 0.4267 0.4142 0.3996 -0.0426 -0.0274 0.0738  230 ARG B CB  
3772 C CG  . ARG B 161 ? 0.6698 0.6454 0.6342 -0.0448 -0.0268 0.0663  230 ARG B CG  
3773 C CD  . ARG B 161 ? 0.7182 0.6786 0.6729 -0.0516 -0.0236 0.0602  230 ARG B CD  
3774 N NE  . ARG B 161 ? 0.7121 0.6640 0.6615 -0.0497 -0.0207 0.0522  230 ARG B NE  
3775 C CZ  . ARG B 161 ? 0.7684 0.7175 0.7190 -0.0435 -0.0157 0.0466  230 ARG B CZ  
3776 N NH1 . ARG B 161 ? 0.8924 0.8453 0.8485 -0.0386 -0.0132 0.0481  230 ARG B NH1 
3777 N NH2 . ARG B 161 ? 0.5323 0.4751 0.4787 -0.0425 -0.0134 0.0400  230 ARG B NH2 
3778 N N   . ASP B 162 ? 0.4928 0.4968 0.4758 -0.0325 -0.0335 0.0795  231 ASP B N   
3779 C CA  . ASP B 162 ? 0.6511 0.6619 0.6383 -0.0323 -0.0381 0.0851  231 ASP B CA  
3780 C C   . ASP B 162 ? 0.6471 0.6560 0.6306 -0.0447 -0.0437 0.0903  231 ASP B C   
3781 O O   . ASP B 162 ? 0.5229 0.5190 0.4956 -0.0540 -0.0441 0.0860  231 ASP B O   
3782 C CB  . ASP B 162 ? 0.7229 0.7270 0.7061 -0.0279 -0.0378 0.0797  231 ASP B CB  
3783 C CG  . ASP B 162 ? 0.7278 0.7390 0.7167 -0.0254 -0.0421 0.0858  231 ASP B CG  
3784 O OD1 . ASP B 162 ? 0.7896 0.7939 0.7741 -0.0238 -0.0430 0.0824  231 ASP B OD1 
3785 O OD2 . ASP B 162 ? 0.7428 0.7665 0.7409 -0.0250 -0.0445 0.0944  231 ASP B OD2 
3786 N N   . SER B 163 ? 0.8051 0.8272 0.7977 -0.0449 -0.0479 0.0998  232 SER B N   
3787 C CA  . SER B 163 ? 1.0105 1.0345 1.0018 -0.0565 -0.0545 0.1069  232 SER B CA  
3788 C C   . SER B 163 ? 1.2068 1.2356 1.2022 -0.0547 -0.0593 0.1116  232 SER B C   
3789 O O   . SER B 163 ? 1.2110 1.2478 1.2154 -0.0431 -0.0575 0.1127  232 SER B O   
3790 C CB  . SER B 163 ? 0.9706 1.0081 0.9708 -0.0587 -0.0558 0.1156  232 SER B CB  
3791 N N   . GLU B 164 ? 1.3202 1.3436 1.3087 -0.0659 -0.0654 0.1144  233 GLU B N   
3792 C CA  . GLU B 164 ? 1.3955 1.4114 1.3745 -0.0807 -0.0685 0.1133  233 GLU B CA  
3793 C C   . GLU B 164 ? 1.4767 1.5060 1.4649 -0.0854 -0.0714 0.1204  233 GLU B C   
3794 O O   . GLU B 164 ? 1.5127 1.5371 1.4937 -0.0972 -0.0745 0.1193  233 GLU B O   
3795 C CB  . GLU B 164 ? 1.3583 1.3568 1.3229 -0.0853 -0.0635 0.1043  233 GLU B CB  
3796 N N   . ASN B 165 ? 1.5079 1.5541 1.5114 -0.0762 -0.0703 0.1271  234 ASN B N   
3797 C CA  . ASN B 165 ? 1.4928 1.5544 1.5072 -0.0807 -0.0735 0.1351  234 ASN B CA  
3798 C C   . ASN B 165 ? 1.5776 1.6578 1.6094 -0.0729 -0.0750 0.1433  234 ASN B C   
3799 O O   . ASN B 165 ? 1.6602 1.7532 1.7013 -0.0788 -0.0794 0.1510  234 ASN B O   
3800 C CB  . ASN B 165 ? 1.4105 1.4751 1.4268 -0.0786 -0.0690 0.1352  234 ASN B CB  
3801 N N   . SER B 166 ? 1.5434 1.6250 1.5798 -0.0594 -0.0710 0.1416  235 SER B N   
3802 C CA  . SER B 166 ? 1.5357 1.6329 1.5881 -0.0486 -0.0697 0.1474  235 SER B CA  
3803 C C   . SER B 166 ? 1.5492 1.6644 1.6154 -0.0446 -0.0668 0.1538  235 SER B C   
3804 O O   . SER B 166 ? 1.5349 1.6640 1.6150 -0.0356 -0.0647 0.1588  235 SER B O   
3805 C CB  . SER B 166 ? 1.5298 1.6315 1.5875 -0.0533 -0.0756 0.1527  235 SER B CB  
3806 N N   . GLN B 167 ? 1.5331 1.6480 1.5955 -0.0512 -0.0663 0.1539  236 GLN B N   
3807 C CA  . GLN B 167 ? 1.4644 1.5952 1.5383 -0.0476 -0.0630 0.1594  236 GLN B CA  
3808 C C   . GLN B 167 ? 1.3118 1.4360 1.3788 -0.0441 -0.0578 0.1543  236 GLN B C   
3809 O O   . GLN B 167 ? 1.2878 1.4246 1.3638 -0.0384 -0.0538 0.1579  236 GLN B O   
3810 C CB  . GLN B 167 ? 1.4933 1.6341 1.5724 -0.0607 -0.0684 0.1673  236 GLN B CB  
3811 N N   . SER B 168 ? 1.1681 1.2731 1.2195 -0.0475 -0.0574 0.1463  237 SER B N   
3812 C CA  . SER B 168 ? 0.9634 1.0609 1.0079 -0.0450 -0.0524 0.1416  237 SER B CA  
3813 C C   . SER B 168 ? 0.7681 0.8740 0.8201 -0.0300 -0.0463 0.1410  237 SER B C   
3814 O O   . SER B 168 ? 0.6323 0.7415 0.6890 -0.0206 -0.0450 0.1401  237 SER B O   
3815 C CB  . SER B 168 ? 0.8540 0.9294 0.8819 -0.0494 -0.0519 0.1322  237 SER B CB  
3816 O OG  . SER B 168 ? 0.6305 0.6956 0.6488 -0.0630 -0.0547 0.1311  237 SER B OG  
3817 N N   . LEU B 169 ? 0.6212 0.7295 0.6736 -0.0280 -0.0419 0.1402  238 LEU B N   
3818 C CA  . LEU B 169 ? 0.4859 0.5997 0.5428 -0.0148 -0.0352 0.1371  238 LEU B CA  
3819 C C   . LEU B 169 ? 0.4694 0.5666 0.5156 -0.0100 -0.0320 0.1256  238 LEU B C   
3820 O O   . LEU B 169 ? 0.3604 0.4432 0.3963 -0.0162 -0.0321 0.1196  238 LEU B O   
3821 C CB  . LEU B 169 ? 0.4015 0.5220 0.4609 -0.0156 -0.0322 0.1400  238 LEU B CB  
3822 C CG  . LEU B 169 ? 0.5356 0.6565 0.5944 -0.0051 -0.0253 0.1350  238 LEU B CG  
3823 C CD1 . LEU B 169 ? 0.5368 0.6739 0.6066 0.0062  -0.0216 0.1390  238 LEU B CD1 
3824 C CD2 . LEU B 169 ? 0.5113 0.6323 0.5682 -0.0098 -0.0239 0.1366  238 LEU B CD2 
3825 N N   . GLY B 170 ? 0.5314 0.6304 0.5802 0.0010  -0.0289 0.1225  239 GLY B N   
3826 C CA  . GLY B 170 ? 0.5407 0.6249 0.5796 0.0052  -0.0262 0.1121  239 GLY B CA  
3827 C C   . GLY B 170 ? 0.6102 0.6903 0.6447 0.0080  -0.0215 0.1069  239 GLY B C   
3828 O O   . GLY B 170 ? 0.4946 0.5610 0.5199 0.0061  -0.0207 0.0993  239 GLY B O   
3829 N N   . GLY B 171 ? 0.5256 0.6179 0.5667 0.0122  -0.0184 0.1114  240 GLY B N   
3830 C CA  . GLY B 171 ? 0.4208 0.5105 0.4582 0.0147  -0.0144 0.1079  240 GLY B CA  
3831 C C   . GLY B 171 ? 0.5052 0.6109 0.5508 0.0205  -0.0109 0.1139  240 GLY B C   
3832 O O   . GLY B 171 ? 0.4898 0.6085 0.5444 0.0239  -0.0108 0.1201  240 GLY B O   
3833 N N   . GLN B 172 ? 0.4220 0.5268 0.4646 0.0218  -0.0078 0.1123  241 GLN B N   
3834 C CA  . GLN B 172 ? 0.4129 0.5325 0.4621 0.0261  -0.0043 0.1182  241 GLN B CA  
3835 C C   . GLN B 172 ? 0.3703 0.4860 0.4136 0.0304  -0.0004 0.1137  241 GLN B C   
3836 O O   . GLN B 172 ? 0.4156 0.5200 0.4525 0.0260  -0.0015 0.1100  241 GLN B O   
3837 C CB  . GLN B 172 ? 0.3996 0.5279 0.4548 0.0175  -0.0070 0.1270  241 GLN B CB  
3838 C CG  . GLN B 172 ? 0.3060 0.4508 0.3685 0.0210  -0.0033 0.1338  241 GLN B CG  
3839 C CD  . GLN B 172 ? 0.3848 0.5368 0.4520 0.0112  -0.0065 0.1425  241 GLN B CD  
3840 O OE1 . GLN B 172 ? 0.4922 0.6583 0.5692 0.0092  -0.0081 0.1505  241 GLN B OE1 
3841 N NE2 . GLN B 172 ? 0.3482 0.4904 0.4087 0.0048  -0.0075 0.1412  241 GLN B NE2 
3842 N N   . ILE B 173 ? 0.2709 0.3959 0.3163 0.0390  0.0044  0.1143  242 ILE B N   
3843 C CA  . ILE B 173 ? 0.3184 0.4432 0.3589 0.0425  0.0080  0.1122  242 ILE B CA  
3844 C C   . ILE B 173 ? 0.3233 0.4638 0.3707 0.0422  0.0104  0.1206  242 ILE B C   
3845 O O   . ILE B 173 ? 0.2981 0.4517 0.3538 0.0450  0.0120  0.1260  242 ILE B O   
3846 C CB  . ILE B 173 ? 0.4189 0.5402 0.4535 0.0517  0.0118  0.1054  242 ILE B CB  
3847 C CG1 . ILE B 173 ? 0.5263 0.6496 0.5558 0.0548  0.0154  0.1045  242 ILE B CG1 
3848 C CG2 . ILE B 173 ? 0.4688 0.5994 0.5092 0.0587  0.0147  0.1074  242 ILE B CG2 
3849 C CD1 . ILE B 173 ? 0.5614 0.6810 0.5835 0.0628  0.0190  0.0980  242 ILE B CD1 
3850 N N   . VAL B 174 ? 0.2841 0.4233 0.3285 0.0385  0.0105  0.1223  243 VAL B N   
3851 C CA  . VAL B 174 ? 0.2680 0.4212 0.3173 0.0377  0.0130  0.1301  243 VAL B CA  
3852 C C   . VAL B 174 ? 0.3621 0.5159 0.4050 0.0439  0.0175  0.1272  243 VAL B C   
3853 O O   . VAL B 174 ? 0.4891 0.6310 0.5240 0.0437  0.0164  0.1218  243 VAL B O   
3854 C CB  . VAL B 174 ? 0.2384 0.3894 0.2888 0.0274  0.0091  0.1355  243 VAL B CB  
3855 C CG1 . VAL B 174 ? 0.1693 0.3345 0.2240 0.0263  0.0117  0.1436  243 VAL B CG1 
3856 C CG2 . VAL B 174 ? 0.2584 0.4088 0.3137 0.0203  0.0044  0.1386  243 VAL B CG2 
3857 N N   . LEU B 175 ? 0.4051 0.5730 0.4516 0.0492  0.0225  0.1310  244 LEU B N   
3858 C CA  . LEU B 175 ? 0.3414 0.5116 0.3812 0.0541  0.0271  0.1294  244 LEU B CA  
3859 C C   . LEU B 175 ? 0.3770 0.5572 0.4197 0.0492  0.0277  0.1376  244 LEU B C   
3860 O O   . LEU B 175 ? 0.4402 0.6350 0.4919 0.0480  0.0294  0.1450  244 LEU B O   
3861 C CB  . LEU B 175 ? 0.3321 0.5099 0.3719 0.0637  0.0333  0.1272  244 LEU B CB  
3862 C CG  . LEU B 175 ? 0.3406 0.5084 0.3766 0.0695  0.0334  0.1192  244 LEU B CG  
3863 C CD1 . LEU B 175 ? 0.3657 0.5390 0.3989 0.0791  0.0406  0.1167  244 LEU B CD1 
3864 C CD2 . LEU B 175 ? 0.2373 0.3879 0.2630 0.0674  0.0297  0.1115  244 LEU B CD2 
3865 N N   . GLY B 176 ? 0.4400 0.6126 0.4756 0.0460  0.0262  0.1370  245 GLY B N   
3866 C CA  . GLY B 176 ? 0.3581 0.5382 0.3950 0.0410  0.0265  0.1446  245 GLY B CA  
3867 C C   . GLY B 176 ? 0.3852 0.5585 0.4243 0.0314  0.0209  0.1488  245 GLY B C   
3868 O O   . GLY B 176 ? 0.3908 0.5691 0.4320 0.0263  0.0206  0.1541  245 GLY B O   
3869 N N   . GLY B 177 ? 0.3320 0.4926 0.3707 0.0284  0.0166  0.1445  246 GLY B N   
3870 C CA  . GLY B 177 ? 0.3031 0.4554 0.3429 0.0191  0.0119  0.1475  246 GLY B CA  
3871 C C   . GLY B 177 ? 0.3690 0.5085 0.4078 0.0169  0.0083  0.1421  246 GLY B C   
3872 O O   . GLY B 177 ? 0.3303 0.4640 0.3660 0.0225  0.0091  0.1347  246 GLY B O   
3873 N N   . SER B 178 ? 0.4140 0.5484 0.4546 0.0079  0.0045  0.1453  247 SER B N   
3874 C CA  . SER B 178 ? 0.3879 0.5095 0.4265 0.0041  0.0011  0.1407  247 SER B CA  
3875 C C   . SER B 178 ? 0.4076 0.5338 0.4514 -0.0046 -0.0022 0.1463  247 SER B C   
3876 O O   . SER B 178 ? 0.4733 0.6088 0.5220 -0.0091 -0.0026 0.1518  247 SER B O   
3877 C CB  . SER B 178 ? 0.4665 0.5694 0.4979 0.0012  -0.0006 0.1362  247 SER B CB  
3878 O OG  . SER B 178 ? 0.3909 0.4873 0.4182 0.0086  0.0011  0.1285  247 SER B OG  
3879 N N   . ASP B 179 ? 0.4693 0.5887 0.5122 -0.0073 -0.0050 0.1435  248 ASP B N   
3880 C CA  . ASP B 179 ? 0.4114 0.5351 0.4589 -0.0158 -0.0088 0.1479  248 ASP B CA  
3881 C C   . ASP B 179 ? 0.3494 0.4550 0.3896 -0.0258 -0.0126 0.1451  248 ASP B C   
3882 O O   . ASP B 179 ? 0.3198 0.4126 0.3542 -0.0267 -0.0138 0.1402  248 ASP B O   
3883 C CB  . ASP B 179 ? 0.4470 0.5772 0.4987 -0.0120 -0.0095 0.1474  248 ASP B CB  
3884 C CG  . ASP B 179 ? 0.4980 0.6343 0.5553 -0.0209 -0.0142 0.1526  248 ASP B CG  
3885 O OD1 . ASP B 179 ? 0.3884 0.5228 0.4455 -0.0303 -0.0171 0.1552  248 ASP B OD1 
3886 O OD2 . ASP B 179 ? 0.4197 0.5621 0.4815 -0.0184 -0.0153 0.1536  248 ASP B OD2 
3887 N N   . PRO B 180 ? 0.3886 0.4920 0.4283 -0.0336 -0.0145 0.1480  249 PRO B N   
3888 C CA  . PRO B 180 ? 0.3901 0.4741 0.4211 -0.0428 -0.0175 0.1448  249 PRO B CA  
3889 C C   . PRO B 180 ? 0.4558 0.5357 0.4851 -0.0501 -0.0216 0.1436  249 PRO B C   
3890 O O   . PRO B 180 ? 0.5304 0.5922 0.5506 -0.0571 -0.0233 0.1396  249 PRO B O   
3891 C CB  . PRO B 180 ? 0.4450 0.5306 0.4767 -0.0490 -0.0187 0.1491  249 PRO B CB  
3892 C CG  . PRO B 180 ? 0.4365 0.5455 0.4792 -0.0454 -0.0176 0.1556  249 PRO B CG  
3893 C CD  . PRO B 180 ? 0.3819 0.4991 0.4277 -0.0339 -0.0135 0.1540  249 PRO B CD  
3894 N N   . GLN B 181 ? 0.3572 0.4525 0.3945 -0.0486 -0.0230 0.1471  250 GLN B N   
3895 C CA  . GLN B 181 ? 0.4355 0.5270 0.4710 -0.0553 -0.0274 0.1461  250 GLN B CA  
3896 C C   . GLN B 181 ? 0.4825 0.5592 0.5100 -0.0527 -0.0264 0.1391  250 GLN B C   
3897 O O   . GLN B 181 ? 0.4790 0.5467 0.5012 -0.0597 -0.0299 0.1366  250 GLN B O   
3898 C CB  . GLN B 181 ? 0.4358 0.5488 0.4834 -0.0536 -0.0292 0.1527  250 GLN B CB  
3899 C CG  . GLN B 181 ? 0.5463 0.6760 0.6031 -0.0581 -0.0312 0.1607  250 GLN B CG  
3900 C CD  . GLN B 181 ? 0.6217 0.7423 0.6726 -0.0711 -0.0367 0.1609  250 GLN B CD  
3901 O OE1 . GLN B 181 ? 0.7737 0.8904 0.8220 -0.0782 -0.0416 0.1603  250 GLN B OE1 
3902 N NE2 . GLN B 181 ? 0.6438 0.7601 0.6915 -0.0744 -0.0362 0.1615  250 GLN B NE2 
3903 N N   . HIS B 182 ? 0.4158 0.4898 0.4419 -0.0431 -0.0221 0.1359  251 HIS B N   
3904 C CA  . HIS B 182 ? 0.3379 0.3997 0.3581 -0.0392 -0.0210 0.1272  251 HIS B CA  
3905 C C   . HIS B 182 ? 0.3140 0.3591 0.3267 -0.0372 -0.0179 0.1202  251 HIS B C   
3906 O O   . HIS B 182 ? 0.3819 0.4197 0.3916 -0.0315 -0.0159 0.1125  251 HIS B O   
3907 C CB  . HIS B 182 ? 0.2951 0.3687 0.3217 -0.0281 -0.0189 0.1255  251 HIS B CB  
3908 C CG  . HIS B 182 ? 0.4049 0.4919 0.4387 -0.0295 -0.0219 0.1312  251 HIS B CG  
3909 N ND1 . HIS B 182 ? 0.4406 0.5471 0.4849 -0.0239 -0.0206 0.1379  251 HIS B ND1 
3910 C CD2 . HIS B 182 ? 0.3921 0.4761 0.4244 -0.0359 -0.0263 0.1317  251 HIS B CD2 
3911 C CE1 . HIS B 182 ? 0.4353 0.5507 0.4855 -0.0262 -0.0240 0.1426  251 HIS B CE1 
3912 N NE2 . HIS B 182 ? 0.4405 0.5425 0.4833 -0.0337 -0.0279 0.1391  251 HIS B NE2 
3913 N N   . TYR B 183 ? 0.3197 0.3588 0.3297 -0.0421 -0.0177 0.1231  252 TYR B N   
3914 C CA  . TYR B 183 ? 0.3595 0.3812 0.3626 -0.0412 -0.0152 0.1171  252 TYR B CA  
3915 C C   . TYR B 183 ? 0.3604 0.3716 0.3583 -0.0513 -0.0167 0.1210  252 TYR B C   
3916 O O   . TYR B 183 ? 0.4567 0.4773 0.4581 -0.0563 -0.0191 0.1270  252 TYR B O   
3917 C CB  . TYR B 183 ? 0.3772 0.4037 0.3840 -0.0305 -0.0115 0.1156  252 TYR B CB  
3918 C CG  . TYR B 183 ? 0.2524 0.2889 0.2634 -0.0299 -0.0110 0.1233  252 TYR B CG  
3919 C CD1 . TYR B 183 ? 0.3535 0.3797 0.3609 -0.0343 -0.0109 0.1257  252 TYR B CD1 
3920 C CD2 . TYR B 183 ? 0.3765 0.4322 0.3948 -0.0245 -0.0103 0.1280  252 TYR B CD2 
3921 C CE1 . TYR B 183 ? 0.4167 0.4518 0.4275 -0.0342 -0.0107 0.1330  252 TYR B CE1 
3922 C CE2 . TYR B 183 ? 0.3957 0.4610 0.4173 -0.0241 -0.0095 0.1350  252 TYR B CE2 
3923 C CZ  . TYR B 183 ? 0.4302 0.4852 0.4481 -0.0291 -0.0099 0.1366  252 TYR B CZ  
3924 O OH  . TYR B 183 ? 0.4341 0.4981 0.4554 -0.0289 -0.0093 0.1412  252 TYR B OH  
3925 N N   . GLU B 184 ? 0.4916 0.4832 0.4817 -0.0532 -0.0148 0.1153  253 GLU B N   
3926 C CA  . GLU B 184 ? 0.5166 0.4941 0.5000 -0.0622 -0.0155 0.1176  253 GLU B CA  
3927 C C   . GLU B 184 ? 0.4587 0.4256 0.4410 -0.0563 -0.0117 0.1151  253 GLU B C   
3928 O O   . GLU B 184 ? 0.5537 0.5208 0.5387 -0.0467 -0.0088 0.1099  253 GLU B O   
3929 C CB  . GLU B 184 ? 0.5244 0.4855 0.4978 -0.0712 -0.0167 0.1120  253 GLU B CB  
3930 C CG  . GLU B 184 ? 0.5812 0.5286 0.5495 -0.0673 -0.0132 0.1033  253 GLU B CG  
3931 C CD  . GLU B 184 ? 0.8283 0.7595 0.7853 -0.0777 -0.0143 0.0991  253 GLU B CD  
3932 O OE1 . GLU B 184 ? 0.8856 0.8253 0.8427 -0.0827 -0.0182 0.0999  253 GLU B OE1 
3933 O OE2 . GLU B 184 ? 0.9243 0.8357 0.8731 -0.0792 -0.0107 0.0932  253 GLU B OE2 
3934 N N   . GLY B 185 ? 0.4382 0.3958 0.4167 -0.0621 -0.0121 0.1187  254 GLY B N   
3935 C CA  . GLY B 185 ? 0.4433 0.3912 0.4216 -0.0570 -0.0091 0.1186  254 GLY B CA  
3936 C C   . GLY B 185 ? 0.5114 0.4769 0.4987 -0.0479 -0.0086 0.1230  254 GLY B C   
3937 O O   . GLY B 185 ? 0.4663 0.4508 0.4595 -0.0469 -0.0102 0.1277  254 GLY B O   
3938 N N   . ASN B 186 ? 0.5261 0.4848 0.5144 -0.0411 -0.0060 0.1215  255 ASN B N   
3939 C CA  . ASN B 186 ? 0.4632 0.4361 0.4582 -0.0330 -0.0054 0.1255  255 ASN B CA  
3940 C C   . ASN B 186 ? 0.3269 0.3048 0.3256 -0.0227 -0.0033 0.1191  255 ASN B C   
3941 O O   . ASN B 186 ? 0.5017 0.4684 0.4981 -0.0210 -0.0016 0.1119  255 ASN B O   
3942 C CB  . ASN B 186 ? 0.5809 0.5444 0.5749 -0.0328 -0.0049 0.1298  255 ASN B CB  
3943 C CG  . ASN B 186 ? 0.7105 0.6664 0.6995 -0.0430 -0.0068 0.1338  255 ASN B CG  
3944 O OD1 . ASN B 186 ? 0.7692 0.7050 0.7516 -0.0477 -0.0060 0.1315  255 ASN B OD1 
3945 N ND2 . ASN B 186 ? 0.7198 0.6921 0.7119 -0.0459 -0.0089 0.1379  255 ASN B ND2 
3946 N N   . PHE B 187 ? 0.2561 0.2510 0.2599 -0.0165 -0.0034 0.1219  256 PHE B N   
3947 C CA  . PHE B 187 ? 0.3818 0.3813 0.3882 -0.0072 -0.0018 0.1166  256 PHE B CA  
3948 C C   . PHE B 187 ? 0.3541 0.3425 0.3607 -0.0029 -0.0004 0.1150  256 PHE B C   
3949 O O   . PHE B 187 ? 0.3323 0.3163 0.3389 -0.0042 -0.0007 0.1205  256 PHE B O   
3950 C CB  . PHE B 187 ? 0.4144 0.4329 0.4245 -0.0021 -0.0019 0.1202  256 PHE B CB  
3951 C CG  . PHE B 187 ? 0.4153 0.4458 0.4269 -0.0030 -0.0023 0.1199  256 PHE B CG  
3952 C CD1 . PHE B 187 ? 0.4037 0.4354 0.4153 0.0012  -0.0017 0.1131  256 PHE B CD1 
3953 C CD2 . PHE B 187 ? 0.3629 0.4036 0.3765 -0.0079 -0.0035 0.1268  256 PHE B CD2 
3954 C CE1 . PHE B 187 ? 0.4605 0.5025 0.4739 0.0009  -0.0022 0.1132  256 PHE B CE1 
3955 C CE2 . PHE B 187 ? 0.3992 0.4516 0.4157 -0.0080 -0.0038 0.1272  256 PHE B CE2 
3956 C CZ  . PHE B 187 ? 0.3784 0.4311 0.3948 -0.0033 -0.0032 0.1204  256 PHE B CZ  
3957 N N   . HIS B 188 ? 0.3602 0.3445 0.3676 0.0023  0.0012  0.1080  257 HIS B N   
3958 C CA  . HIS B 188 ? 0.2895 0.2677 0.2995 0.0082  0.0025  0.1068  257 HIS B CA  
3959 C C   . HIS B 188 ? 0.3686 0.3612 0.3819 0.0155  0.0019  0.1065  257 HIS B C   
3960 O O   . HIS B 188 ? 0.4791 0.4772 0.4922 0.0178  0.0022  0.1013  257 HIS B O   
3961 C CB  . HIS B 188 ? 0.3313 0.2951 0.3403 0.0085  0.0050  0.0995  257 HIS B CB  
3962 C CG  . HIS B 188 ? 0.5981 0.5596 0.6120 0.0159  0.0064  0.0979  257 HIS B CG  
3963 N ND1 . HIS B 188 ? 0.6286 0.5903 0.6445 0.0201  0.0080  0.0912  257 HIS B ND1 
3964 C CD2 . HIS B 188 ? 0.5905 0.5503 0.6082 0.0197  0.0061  0.1028  257 HIS B CD2 
3965 C CE1 . HIS B 188 ? 0.6233 0.5844 0.6448 0.0261  0.0087  0.0921  257 HIS B CE1 
3966 N NE2 . HIS B 188 ? 0.5898 0.5495 0.6125 0.0262  0.0075  0.0992  257 HIS B NE2 
3967 N N   . TYR B 189 ? 0.3554 0.3533 0.3708 0.0186  0.0009  0.1123  258 TYR B N   
3968 C CA  . TYR B 189 ? 0.3508 0.3627 0.3672 0.0241  0.0000  0.1129  258 TYR B CA  
3969 C C   . TYR B 189 ? 0.3675 0.3773 0.3872 0.0301  0.0000  0.1105  258 TYR B C   
3970 O O   . TYR B 189 ? 0.4607 0.4606 0.4833 0.0310  0.0003  0.1120  258 TYR B O   
3971 C CB  . TYR B 189 ? 0.2508 0.2719 0.2664 0.0233  -0.0012 0.1212  258 TYR B CB  
3972 C CG  . TYR B 189 ? 0.2798 0.3087 0.2936 0.0186  -0.0010 0.1239  258 TYR B CG  
3973 C CD1 . TYR B 189 ? 0.2547 0.2952 0.2677 0.0206  -0.0003 0.1211  258 TYR B CD1 
3974 C CD2 . TYR B 189 ? 0.2570 0.2816 0.2702 0.0121  -0.0016 0.1295  258 TYR B CD2 
3975 C CE1 . TYR B 189 ? 0.2740 0.3230 0.2870 0.0169  0.0001  0.1242  258 TYR B CE1 
3976 C CE2 . TYR B 189 ? 0.2789 0.3124 0.2917 0.0075  -0.0017 0.1328  258 TYR B CE2 
3977 C CZ  . TYR B 189 ? 0.3311 0.3773 0.3444 0.0102  -0.0008 0.1303  258 TYR B CZ  
3978 O OH  . TYR B 189 ? 0.2839 0.3403 0.2985 0.0063  -0.0007 0.1342  258 TYR B OH  
3979 N N   . ILE B 190 ? 0.2618 0.2810 0.2810 0.0341  -0.0005 0.1070  259 ILE B N   
3980 C CA  . ILE B 190 ? 0.3032 0.3231 0.3254 0.0391  -0.0012 0.1046  259 ILE B CA  
3981 C C   . ILE B 190 ? 0.4134 0.4464 0.4329 0.0420  -0.0030 0.1066  259 ILE B C   
3982 O O   . ILE B 190 ? 0.4692 0.5097 0.4843 0.0415  -0.0026 0.1049  259 ILE B O   
3983 C CB  . ILE B 190 ? 0.3250 0.3404 0.3480 0.0398  0.0003  0.0963  259 ILE B CB  
3984 C CG1 . ILE B 190 ? 0.3989 0.4008 0.4222 0.0360  0.0026  0.0937  259 ILE B CG1 
3985 C CG2 . ILE B 190 ? 0.1932 0.2101 0.2206 0.0445  -0.0004 0.0946  259 ILE B CG2 
3986 C CD1 . ILE B 190 ? 0.4478 0.4475 0.4681 0.0336  0.0039  0.0866  259 ILE B CD1 
3987 N N   . ASN B 191 ? 0.4464 0.4819 0.4685 0.0451  -0.0050 0.1101  260 ASN B N   
3988 C CA  . ASN B 191 ? 0.4863 0.5331 0.5043 0.0472  -0.0071 0.1119  260 ASN B CA  
3989 C C   . ASN B 191 ? 0.4457 0.4964 0.4607 0.0489  -0.0069 0.1045  260 ASN B C   
3990 O O   . ASN B 191 ? 0.4198 0.4653 0.4383 0.0498  -0.0064 0.0993  260 ASN B O   
3991 C CB  . ASN B 191 ? 0.5572 0.6054 0.5790 0.0497  -0.0100 0.1175  260 ASN B CB  
3992 C CG  . ASN B 191 ? 0.6228 0.6688 0.6457 0.0478  -0.0107 0.1255  260 ASN B CG  
3993 O OD1 . ASN B 191 ? 0.6881 0.7243 0.7165 0.0477  -0.0102 0.1278  260 ASN B OD1 
3994 N ND2 . ASN B 191 ? 0.6077 0.6616 0.6246 0.0457  -0.0114 0.1282  260 ASN B ND2 
3995 N N   . LEU B 192 ? 0.3366 0.3958 0.3444 0.0494  -0.0072 0.1042  261 LEU B N   
3996 C CA  . LEU B 192 ? 0.3274 0.3902 0.3310 0.0512  -0.0081 0.0987  261 LEU B CA  
3997 C C   . LEU B 192 ? 0.3822 0.4473 0.3882 0.0527  -0.0116 0.1013  261 LEU B C   
3998 O O   . LEU B 192 ? 0.3301 0.3973 0.3383 0.0529  -0.0135 0.1083  261 LEU B O   
3999 C CB  . LEU B 192 ? 0.3018 0.3719 0.2961 0.0514  -0.0070 0.0979  261 LEU B CB  
4000 C CG  . LEU B 192 ? 0.3445 0.4154 0.3365 0.0506  -0.0036 0.0964  261 LEU B CG  
4001 C CD1 . LEU B 192 ? 0.3791 0.4572 0.3620 0.0522  -0.0021 0.0952  261 LEU B CD1 
4002 C CD2 . LEU B 192 ? 0.2898 0.3542 0.2846 0.0501  -0.0025 0.0901  261 LEU B CD2 
4003 N N   . ILE B 193 ? 0.3276 0.3929 0.3338 0.0537  -0.0128 0.0960  262 ILE B N   
4004 C CA  . ILE B 193 ? 0.3316 0.4010 0.3404 0.0548  -0.0166 0.0987  262 ILE B CA  
4005 C C   . ILE B 193 ? 0.4234 0.5006 0.4230 0.0541  -0.0191 0.1023  262 ILE B C   
4006 O O   . ILE B 193 ? 0.3353 0.4161 0.3366 0.0541  -0.0220 0.1096  262 ILE B O   
4007 C CB  . ILE B 193 ? 0.4459 0.5144 0.4565 0.0550  -0.0173 0.0923  262 ILE B CB  
4008 C CG1 . ILE B 193 ? 0.4725 0.5337 0.4932 0.0558  -0.0149 0.0899  262 ILE B CG1 
4009 C CG2 . ILE B 193 ? 0.4426 0.5180 0.4542 0.0553  -0.0220 0.0953  262 ILE B CG2 
4010 C CD1 . ILE B 193 ? 0.3999 0.4583 0.4196 0.0549  -0.0136 0.0820  262 ILE B CD1 
4011 N N   . LYS B 194 ? 0.4970 0.5760 0.4861 0.0534  -0.0179 0.0973  263 LYS B N   
4012 C CA  . LYS B 194 ? 0.5404 0.6253 0.5182 0.0525  -0.0190 0.0995  263 LYS B CA  
4013 C C   . LYS B 194 ? 0.6704 0.7549 0.6401 0.0528  -0.0144 0.0957  263 LYS B C   
4014 O O   . LYS B 194 ? 0.7467 0.8267 0.7177 0.0535  -0.0118 0.0898  263 LYS B O   
4015 C CB  . LYS B 194 ? 0.4971 0.5849 0.4684 0.0514  -0.0228 0.0970  263 LYS B CB  
4016 C CG  . LYS B 194 ? 0.4344 0.5182 0.4002 0.0513  -0.0212 0.0880  263 LYS B CG  
4017 C CD  . LYS B 194 ? 0.6499 0.7362 0.6073 0.0491  -0.0253 0.0861  263 LYS B CD  
4018 C CE  . LYS B 194 ? 0.6965 0.7775 0.6476 0.0486  -0.0239 0.0773  263 LYS B CE  
4019 N NZ  . LYS B 194 ? 0.6901 0.7670 0.6527 0.0495  -0.0229 0.0741  263 LYS B NZ  
4020 N N   . THR B 195 ? 0.7528 0.8423 0.7147 0.0523  -0.0133 0.0995  264 THR B N   
4021 C CA  . THR B 195 ? 0.7066 0.7972 0.6608 0.0532  -0.0085 0.0963  264 THR B CA  
4022 C C   . THR B 195 ? 0.6308 0.7187 0.5756 0.0540  -0.0080 0.0883  264 THR B C   
4023 O O   . THR B 195 ? 0.6814 0.7690 0.6210 0.0527  -0.0116 0.0869  264 THR B O   
4024 C CB  . THR B 195 ? 0.7218 0.8190 0.6690 0.0524  -0.0072 0.1022  264 THR B CB  
4025 O OG1 . THR B 195 ? 0.8303 0.9289 0.7859 0.0516  -0.0062 0.1086  264 THR B OG1 
4026 C CG2 . THR B 195 ? 0.6154 0.7148 0.5518 0.0539  -0.0022 0.0981  264 THR B CG2 
4027 N N   . GLY B 196 ? 0.5168 0.6024 0.4598 0.0559  -0.0036 0.0834  265 GLY B N   
4028 C CA  . GLY B 196 ? 0.4239 0.5050 0.3580 0.0570  -0.0025 0.0756  265 GLY B CA  
4029 C C   . GLY B 196 ? 0.4019 0.4766 0.3424 0.0576  -0.0024 0.0702  265 GLY B C   
4030 O O   . GLY B 196 ? 0.5380 0.6084 0.4721 0.0590  -0.0004 0.0641  265 GLY B O   
4031 N N   . VAL B 197 ? 0.3168 0.3901 0.2692 0.0565  -0.0043 0.0722  266 VAL B N   
4032 C CA  . VAL B 197 ? 0.3682 0.4354 0.3265 0.0563  -0.0040 0.0676  266 VAL B CA  
4033 C C   . VAL B 197 ? 0.3889 0.4559 0.3578 0.0557  -0.0028 0.0715  266 VAL B C   
4034 O O   . VAL B 197 ? 0.3526 0.4219 0.3268 0.0547  -0.0041 0.0773  266 VAL B O   
4035 C CB  . VAL B 197 ? 0.4613 0.5253 0.4218 0.0547  -0.0077 0.0646  266 VAL B CB  
4036 C CG1 . VAL B 197 ? 0.4905 0.5478 0.4528 0.0543  -0.0068 0.0584  266 VAL B CG1 
4037 C CG2 . VAL B 197 ? 0.4171 0.4828 0.3674 0.0538  -0.0103 0.0632  266 VAL B CG2 
4038 N N   . TRP B 198 ? 0.3680 0.4318 0.3395 0.0558  -0.0006 0.0688  267 TRP B N   
4039 C CA  . TRP B 198 ? 0.2395 0.3013 0.2200 0.0539  0.0000  0.0717  267 TRP B CA  
4040 C C   . TRP B 198 ? 0.2934 0.3487 0.2794 0.0522  -0.0020 0.0690  267 TRP B C   
4041 O O   . TRP B 198 ? 0.3022 0.3519 0.2905 0.0508  -0.0014 0.0653  267 TRP B O   
4042 C CB  . TRP B 198 ? 0.2498 0.3114 0.2308 0.0541  0.0025  0.0705  267 TRP B CB  
4043 C CG  . TRP B 198 ? 0.3773 0.4467 0.3555 0.0560  0.0052  0.0741  267 TRP B CG  
4044 C CD1 . TRP B 198 ? 0.3969 0.4687 0.3693 0.0593  0.0078  0.0714  267 TRP B CD1 
4045 C CD2 . TRP B 198 ? 0.3463 0.4219 0.3275 0.0550  0.0061  0.0812  267 TRP B CD2 
4046 N NE1 . TRP B 198 ? 0.3207 0.4007 0.2928 0.0606  0.0107  0.0763  267 TRP B NE1 
4047 C CE2 . TRP B 198 ? 0.3655 0.4485 0.3430 0.0577  0.0096  0.0825  267 TRP B CE2 
4048 C CE3 . TRP B 198 ? 0.2981 0.3735 0.2848 0.0521  0.0046  0.0867  267 TRP B CE3 
4049 C CZ2 . TRP B 198 ? 0.2549 0.3461 0.2340 0.0571  0.0114  0.0893  267 TRP B CZ2 
4050 C CZ3 . TRP B 198 ? 0.4299 0.5123 0.4175 0.0512  0.0060  0.0935  267 TRP B CZ3 
4051 C CH2 . TRP B 198 ? 0.1852 0.2760 0.1693 0.0534  0.0093  0.0948  267 TRP B CH2 
4052 N N   . GLN B 199 ? 0.3796 0.4360 0.3677 0.0522  -0.0042 0.0714  268 GLN B N   
4053 C CA  . GLN B 199 ? 0.3348 0.3869 0.3287 0.0515  -0.0057 0.0693  268 GLN B CA  
4054 C C   . GLN B 199 ? 0.3069 0.3584 0.3087 0.0513  -0.0062 0.0751  268 GLN B C   
4055 O O   . GLN B 199 ? 0.4429 0.4991 0.4441 0.0520  -0.0072 0.0809  268 GLN B O   
4056 C CB  . GLN B 199 ? 0.3745 0.4293 0.3646 0.0521  -0.0083 0.0668  268 GLN B CB  
4057 C CG  . GLN B 199 ? 0.3695 0.4207 0.3645 0.0511  -0.0092 0.0627  268 GLN B CG  
4058 C CD  . GLN B 199 ? 0.3746 0.4289 0.3642 0.0508  -0.0121 0.0601  268 GLN B CD  
4059 O OE1 . GLN B 199 ? 0.4911 0.5508 0.4760 0.0512  -0.0144 0.0632  268 GLN B OE1 
4060 N NE2 . GLN B 199 ? 0.3300 0.3807 0.3194 0.0493  -0.0123 0.0545  268 GLN B NE2 
4061 N N   . ILE B 200 ? 0.2325 0.2774 0.2411 0.0504  -0.0052 0.0735  269 ILE B N   
4062 C CA  . ILE B 200 ? 0.2414 0.2830 0.2573 0.0506  -0.0050 0.0783  269 ILE B CA  
4063 C C   . ILE B 200 ? 0.2947 0.3332 0.3176 0.0517  -0.0050 0.0762  269 ILE B C   
4064 O O   . ILE B 200 ? 0.2620 0.2996 0.2844 0.0512  -0.0047 0.0704  269 ILE B O   
4065 C CB  . ILE B 200 ? 0.3453 0.3801 0.3623 0.0479  -0.0025 0.0794  269 ILE B CB  
4066 C CG1 . ILE B 200 ? 0.3061 0.3340 0.3224 0.0456  -0.0005 0.0728  269 ILE B CG1 
4067 C CG2 . ILE B 200 ? 0.1770 0.2170 0.1890 0.0470  -0.0024 0.0831  269 ILE B CG2 
4068 C CD1 . ILE B 200 ? 0.1983 0.2185 0.2151 0.0420  0.0014  0.0738  269 ILE B CD1 
4069 N N   . GLN B 201 ? 0.3603 0.3976 0.3905 0.0533  -0.0053 0.0812  270 GLN B N   
4070 C CA  . GLN B 201 ? 0.4264 0.4613 0.4652 0.0553  -0.0046 0.0801  270 GLN B CA  
4071 C C   . GLN B 201 ? 0.4960 0.5199 0.5370 0.0536  -0.0003 0.0756  270 GLN B C   
4072 O O   . GLN B 201 ? 0.3834 0.4001 0.4224 0.0516  0.0015  0.0768  270 GLN B O   
4073 C CB  . GLN B 201 ? 0.3344 0.3713 0.3808 0.0583  -0.0062 0.0877  270 GLN B CB  
4074 C CG  . GLN B 201 ? 0.4514 0.4879 0.5087 0.0613  -0.0054 0.0876  270 GLN B CG  
4075 C CD  . GLN B 201 ? 0.6334 0.6804 0.6920 0.0620  -0.0088 0.0865  270 GLN B CD  
4076 O OE1 . GLN B 201 ? 0.7487 0.8037 0.8013 0.0612  -0.0128 0.0889  270 GLN B OE1 
4077 N NE2 . GLN B 201 ? 0.6353 0.6822 0.7011 0.0631  -0.0070 0.0829  270 GLN B NE2 
4078 N N   . MET B 202 ? 0.5422 0.5649 0.5866 0.0539  0.0012  0.0704  271 MET B N   
4079 C CA  . MET B 202 ? 0.5081 0.5203 0.5540 0.0523  0.0056  0.0656  271 MET B CA  
4080 C C   . MET B 202 ? 0.5366 0.5483 0.5931 0.0558  0.0077  0.0659  271 MET B C   
4081 O O   . MET B 202 ? 0.5348 0.5555 0.5958 0.0577  0.0057  0.0660  271 MET B O   
4082 C CB  . MET B 202 ? 0.4862 0.4973 0.5254 0.0488  0.0062  0.0585  271 MET B CB  
4083 C CG  . MET B 202 ? 0.4423 0.4426 0.4813 0.0461  0.0107  0.0531  271 MET B CG  
4084 S SD  . MET B 202 ? 0.3870 0.3836 0.4155 0.0406  0.0106  0.0471  271 MET B SD  
4085 C CE  . MET B 202 ? 0.2963 0.3011 0.3245 0.0413  0.0086  0.0430  271 MET B CE  
4086 N N   . LYS B 203 ? 0.5025 0.5036 0.5630 0.0565  0.0119  0.0663  272 LYS B N   
4087 C CA  . LYS B 203 ? 0.3722 0.3720 0.4440 0.0611  0.0148  0.0675  272 LYS B CA  
4088 C C   . LYS B 203 ? 0.4553 0.4458 0.5278 0.0598  0.0208  0.0605  272 LYS B C   
4089 O O   . LYS B 203 ? 0.5740 0.5569 0.6534 0.0628  0.0255  0.0609  272 LYS B O   
4090 C CB  . LYS B 203 ? 0.2752 0.2692 0.3518 0.0641  0.0153  0.0743  272 LYS B CB  
4091 N N   . GLY B 204 ? 0.4310 0.4215 0.4961 0.0553  0.0211  0.0542  273 GLY B N   
4092 C CA  . GLY B 204 ? 0.3486 0.3309 0.4133 0.0534  0.0267  0.0475  273 GLY B CA  
4093 C C   . GLY B 204 ? 0.3760 0.3511 0.4286 0.0467  0.0273  0.0417  273 GLY B C   
4094 O O   . GLY B 204 ? 0.3501 0.3202 0.3951 0.0435  0.0257  0.0430  273 GLY B O   
4095 N N   . VAL B 205 ? 0.4056 0.3808 0.4568 0.0444  0.0296  0.0358  274 VAL B N   
4096 C CA  . VAL B 205 ? 0.3011 0.2686 0.3414 0.0379  0.0306  0.0301  274 VAL B CA  
4097 C C   . VAL B 205 ? 0.4902 0.4474 0.5311 0.0365  0.0377  0.0250  274 VAL B C   
4098 O O   . VAL B 205 ? 0.4778 0.4394 0.5273 0.0399  0.0409  0.0237  274 VAL B O   
4099 C CB  . VAL B 205 ? 0.3409 0.3172 0.3771 0.0356  0.0266  0.0276  274 VAL B CB  
4100 C CG1 . VAL B 205 ? 0.2746 0.2428 0.2998 0.0288  0.0271  0.0227  274 VAL B CG1 
4101 C CG2 . VAL B 205 ? 0.4147 0.4009 0.4502 0.0377  0.0205  0.0324  274 VAL B CG2 
4102 N N   . SER B 206 ? 0.5176 0.4611 0.5492 0.0313  0.0403  0.0222  275 SER B N   
4103 C CA  . SER B 206 ? 0.5393 0.4701 0.5691 0.0295  0.0478  0.0171  275 SER B CA  
4104 C C   . SER B 206 ? 0.5745 0.4983 0.5922 0.0213  0.0485  0.0112  275 SER B C   
4105 O O   . SER B 206 ? 0.5392 0.4629 0.5485 0.0164  0.0437  0.0121  275 SER B O   
4106 C CB  . SER B 206 ? 0.5281 0.4456 0.5567 0.0301  0.0510  0.0192  275 SER B CB  
4107 O OG  . SER B 206 ? 0.6586 0.5787 0.6996 0.0380  0.0536  0.0228  275 SER B OG  
4108 N N   . VAL B 207 ? 0.4712 0.3899 0.4884 0.0200  0.0547  0.0057  276 VAL B N   
4109 C CA  . VAL B 207 ? 0.2899 0.1989 0.2946 0.0117  0.0568  -0.0002 276 VAL B CA  
4110 C C   . VAL B 207 ? 0.4085 0.3003 0.4085 0.0099  0.0645  -0.0035 276 VAL B C   
4111 O O   . VAL B 207 ? 0.4453 0.3348 0.4523 0.0145  0.0716  -0.0056 276 VAL B O   
4112 C CB  . VAL B 207 ? 0.3421 0.2583 0.3483 0.0106  0.0582  -0.0044 276 VAL B CB  
4113 C CG1 . VAL B 207 ? 0.3385 0.2434 0.3312 0.0017  0.0610  -0.0103 276 VAL B CG1 
4114 C CG2 . VAL B 207 ? 0.3223 0.2532 0.3310 0.0116  0.0506  -0.0016 276 VAL B CG2 
4115 N N   . GLY B 208 ? 0.4542 0.3337 0.4421 0.0030  0.0633  -0.0037 277 GLY B N   
4116 C CA  . GLY B 208 ? 0.3543 0.2157 0.3363 0.0011  0.0701  -0.0064 277 GLY B CA  
4117 C C   . GLY B 208 ? 0.5153 0.3765 0.5086 0.0098  0.0722  -0.0020 277 GLY B C   
4118 O O   . GLY B 208 ? 0.4641 0.3339 0.4633 0.0133  0.0662  0.0045  277 GLY B O   
4119 N N   . SER B 209 ? 0.5994 0.4506 0.5959 0.0136  0.0811  -0.0053 278 SER B N   
4120 C CA  . SER B 209 ? 0.4897 0.3402 0.4981 0.0227  0.0836  -0.0009 278 SER B CA  
4121 C C   . SER B 209 ? 0.5273 0.3967 0.5534 0.0320  0.0827  0.0024  278 SER B C   
4122 O O   . SER B 209 ? 0.7646 0.6378 0.8022 0.0397  0.0822  0.0081  278 SER B O   
4123 C CB  . SER B 209 ? 0.4730 0.3036 0.4777 0.0236  0.0940  -0.0057 278 SER B CB  
4124 O OG  . SER B 209 ? 0.7126 0.5468 0.7332 0.0345  0.0988  -0.0030 278 SER B OG  
4125 N N   . SER B 210 ? 0.5059 0.3873 0.5343 0.0309  0.0820  -0.0004 279 SER B N   
4126 C CA  . SER B 210 ? 0.5407 0.4392 0.5853 0.0386  0.0821  0.0020  279 SER B CA  
4127 C C   . SER B 210 ? 0.5126 0.4282 0.5620 0.0400  0.0720  0.0081  279 SER B C   
4128 O O   . SER B 210 ? 0.5571 0.4769 0.5979 0.0341  0.0664  0.0070  279 SER B O   
4129 C CB  . SER B 210 ? 0.5507 0.4529 0.5945 0.0359  0.0869  -0.0043 279 SER B CB  
4130 O OG  . SER B 210 ? 0.7848 0.7051 0.8440 0.0420  0.0861  -0.0016 279 SER B OG  
4131 N N   . THR B 211 ? 0.4636 0.3883 0.5262 0.0479  0.0700  0.0145  280 THR B N   
4132 C CA  . THR B 211 ? 0.4345 0.3753 0.5015 0.0495  0.0610  0.0203  280 THR B CA  
4133 C C   . THR B 211 ? 0.3908 0.3474 0.4658 0.0510  0.0599  0.0195  280 THR B C   
4134 O O   . THR B 211 ? 0.5172 0.4804 0.6056 0.0569  0.0636  0.0209  280 THR B O   
4135 C CB  . THR B 211 ? 0.4948 0.4382 0.5711 0.0562  0.0587  0.0280  280 THR B CB  
4136 O OG1 . THR B 211 ? 0.5183 0.4445 0.5879 0.0549  0.0617  0.0282  280 THR B OG1 
4137 C CG2 . THR B 211 ? 0.5435 0.4999 0.6192 0.0559  0.0493  0.0335  280 THR B CG2 
4138 N N   . LEU B 212 ? 0.3799 0.3428 0.4473 0.0456  0.0546  0.0174  281 LEU B N   
4139 C CA  . LEU B 212 ? 0.3345 0.3098 0.4067 0.0451  0.0539  0.0155  281 LEU B CA  
4140 C C   . LEU B 212 ? 0.3505 0.3412 0.4260 0.0463  0.0455  0.0201  281 LEU B C   
4141 O O   . LEU B 212 ? 0.4293 0.4320 0.5120 0.0470  0.0445  0.0203  281 LEU B O   
4142 C CB  . LEU B 212 ? 0.3510 0.3198 0.4110 0.0373  0.0557  0.0084  281 LEU B CB  
4143 C CG  . LEU B 212 ? 0.4509 0.4226 0.5000 0.0316  0.0485  0.0076  281 LEU B CG  
4144 C CD1 . LEU B 212 ? 0.5086 0.4753 0.5488 0.0247  0.0510  0.0011  281 LEU B CD1 
4145 C CD2 . LEU B 212 ? 0.5898 0.5538 0.6301 0.0298  0.0448  0.0098  281 LEU B CD2 
4146 N N   . LEU B 213 ? 0.3255 0.3164 0.3958 0.0462  0.0396  0.0239  282 LEU B N   
4147 C CA  . LEU B 213 ? 0.2791 0.2831 0.3503 0.0469  0.0321  0.0277  282 LEU B CA  
4148 C C   . LEU B 213 ? 0.3899 0.3959 0.4640 0.0510  0.0285  0.0346  282 LEU B C   
4149 O O   . LEU B 213 ? 0.4305 0.4267 0.5035 0.0521  0.0310  0.0360  282 LEU B O   
4150 C CB  . LEU B 213 ? 0.2889 0.2919 0.3470 0.0409  0.0278  0.0242  282 LEU B CB  
4151 C CG  . LEU B 213 ? 0.3930 0.3962 0.4476 0.0363  0.0295  0.0183  282 LEU B CG  
4152 C CD1 . LEU B 213 ? 0.2996 0.2955 0.3401 0.0303  0.0272  0.0146  282 LEU B CD1 
4153 C CD2 . LEU B 213 ? 0.2890 0.3062 0.3501 0.0372  0.0260  0.0198  282 LEU B CD2 
4154 N N   . CYS B 214 ? 0.4628 0.4813 0.5396 0.0526  0.0224  0.0388  283 CYS B N   
4155 C CA  . CYS B 214 ? 0.5450 0.5667 0.6219 0.0553  0.0179  0.0454  283 CYS B CA  
4156 C C   . CYS B 214 ? 0.6103 0.6291 0.6978 0.0607  0.0209  0.0504  283 CYS B C   
4157 O O   . CYS B 214 ? 0.6644 0.6793 0.7498 0.0620  0.0194  0.0548  283 CYS B O   
4158 C CB  . CYS B 214 ? 0.4687 0.4834 0.5327 0.0516  0.0160  0.0442  283 CYS B CB  
4159 S SG  . CYS B 214 ? 0.7363 0.7558 0.7977 0.0537  0.0106  0.0516  283 CYS B SG  
4160 N N   . GLU B 215 ? 0.6106 0.6309 0.7096 0.0642  0.0254  0.0501  284 GLU B N   
4161 C CA  . GLU B 215 ? 0.6202 0.6356 0.7294 0.0700  0.0293  0.0545  284 GLU B CA  
4162 C C   . GLU B 215 ? 0.6726 0.6978 0.7890 0.0742  0.0235  0.0636  284 GLU B C   
4163 O O   . GLU B 215 ? 0.7211 0.7397 0.8398 0.0774  0.0241  0.0683  284 GLU B O   
4164 C CB  . GLU B 215 ? 0.4735 0.4900 0.5946 0.0734  0.0359  0.0522  284 GLU B CB  
4165 N N   . ASP B 216 ? 0.6087 0.6489 0.7277 0.0737  0.0175  0.0663  285 ASP B N   
4166 C CA  . ASP B 216 ? 0.5867 0.6370 0.7108 0.0766  0.0112  0.0750  285 ASP B CA  
4167 C C   . ASP B 216 ? 0.4877 0.5381 0.5981 0.0727  0.0056  0.0761  285 ASP B C   
4168 O O   . ASP B 216 ? 0.4484 0.5092 0.5591 0.0730  -0.0006 0.0817  285 ASP B O   
4169 C CB  . ASP B 216 ? 0.5990 0.6660 0.7333 0.0777  0.0075  0.0780  285 ASP B CB  
4170 N N   . GLY B 217 ? 0.4375 0.4768 0.5358 0.0690  0.0078  0.0710  286 GLY B N   
4171 C CA  . GLY B 217 ? 0.3151 0.3546 0.4012 0.0658  0.0036  0.0719  286 GLY B CA  
4172 C C   . GLY B 217 ? 0.4273 0.4729 0.5042 0.0618  0.0001  0.0676  286 GLY B C   
4173 O O   . GLY B 217 ? 0.4295 0.4834 0.5103 0.0614  -0.0016 0.0665  286 GLY B O   
4174 N N   . CYS B 218 ? 0.4279 0.4695 0.4927 0.0586  -0.0008 0.0654  287 CYS B N   
4175 C CA  . CYS B 218 ? 0.4148 0.4600 0.4695 0.0552  -0.0036 0.0612  287 CYS B CA  
4176 C C   . CYS B 218 ? 0.4936 0.5355 0.5377 0.0537  -0.0045 0.0617  287 CYS B C   
4177 O O   . CYS B 218 ? 0.5302 0.5674 0.5750 0.0546  -0.0030 0.0651  287 CYS B O   
4178 C CB  . CYS B 218 ? 0.4275 0.4682 0.4801 0.0522  -0.0007 0.0537  287 CYS B CB  
4179 S SG  . CYS B 218 ? 0.7324 0.7588 0.7805 0.0499  0.0047  0.0491  287 CYS B SG  
4180 N N   . LEU B 219 ? 0.1666 0.2110 0.2010 0.0515  -0.0068 0.0585  288 LEU B N   
4181 C CA  . LEU B 219 ? 0.1670 0.2104 0.1920 0.0507  -0.0074 0.0592  288 LEU B CA  
4182 C C   . LEU B 219 ? 0.4105 0.4458 0.4307 0.0484  -0.0044 0.0544  288 LEU B C   
4183 O O   . LEU B 219 ? 0.2515 0.2824 0.2720 0.0464  -0.0028 0.0493  288 LEU B O   
4184 C CB  . LEU B 219 ? 0.2956 0.3452 0.3121 0.0501  -0.0110 0.0584  288 LEU B CB  
4185 C CG  . LEU B 219 ? 0.3418 0.4001 0.3617 0.0512  -0.0150 0.0632  288 LEU B CG  
4186 C CD1 . LEU B 219 ? 0.1748 0.2372 0.1834 0.0497  -0.0183 0.0621  288 LEU B CD1 
4187 C CD2 . LEU B 219 ? 0.1737 0.2340 0.1990 0.0536  -0.0153 0.0707  288 LEU B CD2 
4188 N N   . ALA B 220 ? 0.3254 0.3594 0.3411 0.0481  -0.0039 0.0566  289 ALA B N   
4189 C CA  . ALA B 220 ? 0.2323 0.2604 0.2435 0.0457  -0.0019 0.0534  289 ALA B CA  
4190 C C   . ALA B 220 ? 0.2853 0.3175 0.2896 0.0464  -0.0028 0.0553  289 ALA B C   
4191 O O   . ALA B 220 ? 0.3587 0.3939 0.3638 0.0473  -0.0028 0.0607  289 ALA B O   
4192 C CB  . ALA B 220 ? 0.2386 0.2593 0.2541 0.0441  0.0008  0.0547  289 ALA B CB  
4193 N N   . LEU B 221 ? 0.2092 0.2415 0.2069 0.0460  -0.0033 0.0511  290 LEU B N   
4194 C CA  . LEU B 221 ? 0.2141 0.2493 0.2054 0.0472  -0.0030 0.0519  290 LEU B CA  
4195 C C   . LEU B 221 ? 0.2652 0.2967 0.2572 0.0453  -0.0013 0.0519  290 LEU B C   
4196 O O   . LEU B 221 ? 0.3221 0.3480 0.3137 0.0430  -0.0010 0.0478  290 LEU B O   
4197 C CB  . LEU B 221 ? 0.2714 0.3069 0.2550 0.0480  -0.0042 0.0472  290 LEU B CB  
4198 C CG  . LEU B 221 ? 0.4826 0.5198 0.4588 0.0500  -0.0032 0.0467  290 LEU B CG  
4199 C CD1 . LEU B 221 ? 0.5110 0.5551 0.4848 0.0523  -0.0030 0.0513  290 LEU B CD1 
4200 C CD2 . LEU B 221 ? 0.5486 0.5821 0.5170 0.0501  -0.0042 0.0409  290 LEU B CD2 
4201 N N   . VAL B 222 ? 0.2732 0.3083 0.2663 0.0456  -0.0004 0.0569  291 VAL B N   
4202 C CA  . VAL B 222 ? 0.2781 0.3116 0.2723 0.0433  0.0006  0.0581  291 VAL B CA  
4203 C C   . VAL B 222 ? 0.3376 0.3747 0.3270 0.0456  0.0011  0.0568  291 VAL B C   
4204 O O   . VAL B 222 ? 0.2437 0.2878 0.2317 0.0482  0.0021  0.0601  291 VAL B O   
4205 C CB  . VAL B 222 ? 0.3958 0.4317 0.3938 0.0420  0.0012  0.0646  291 VAL B CB  
4206 C CG1 . VAL B 222 ? 0.1633 0.1984 0.1624 0.0386  0.0017  0.0663  291 VAL B CG1 
4207 C CG2 . VAL B 222 ? 0.3620 0.3926 0.3643 0.0405  0.0011  0.0657  291 VAL B CG2 
4208 N N   . ASP B 223 ? 0.3554 0.3876 0.3423 0.0447  0.0007  0.0520  292 ASP B N   
4209 C CA  . ASP B 223 ? 0.3851 0.4182 0.3667 0.0476  0.0010  0.0493  292 ASP B CA  
4210 C C   . ASP B 223 ? 0.2637 0.2965 0.2472 0.0465  0.0013  0.0505  292 ASP B C   
4211 O O   . ASP B 223 ? 0.2099 0.2365 0.1933 0.0433  0.0002  0.0476  292 ASP B O   
4212 C CB  . ASP B 223 ? 0.4049 0.4322 0.3818 0.0474  -0.0003 0.0431  292 ASP B CB  
4213 C CG  . ASP B 223 ? 0.5423 0.5687 0.5119 0.0507  0.0001  0.0399  292 ASP B CG  
4214 O OD1 . ASP B 223 ? 0.5375 0.5668 0.5068 0.0533  0.0017  0.0419  292 ASP B OD1 
4215 O OD2 . ASP B 223 ? 0.5581 0.5805 0.5222 0.0506  -0.0011 0.0354  292 ASP B OD2 
4216 N N   . THR B 224 ? 0.2627 0.3030 0.2480 0.0489  0.0028  0.0551  293 THR B N   
4217 C CA  . THR B 224 ? 0.2379 0.2802 0.2266 0.0480  0.0028  0.0576  293 THR B CA  
4218 C C   . THR B 224 ? 0.2582 0.2967 0.2431 0.0506  0.0027  0.0537  293 THR B C   
4219 O O   . THR B 224 ? 0.3079 0.3471 0.2959 0.0495  0.0019  0.0557  293 THR B O   
4220 C CB  . THR B 224 ? 0.3261 0.3792 0.3189 0.0503  0.0048  0.0641  293 THR B CB  
4221 O OG1 . THR B 224 ? 0.4087 0.4660 0.3969 0.0562  0.0074  0.0631  293 THR B OG1 
4222 C CG2 . THR B 224 ? 0.2678 0.3234 0.2647 0.0463  0.0044  0.0690  293 THR B CG2 
4223 N N   . GLY B 225 ? 0.2039 0.2383 0.1820 0.0536  0.0031  0.0486  294 GLY B N   
4224 C CA  . GLY B 225 ? 0.3563 0.3844 0.3297 0.0554  0.0026  0.0443  294 GLY B CA  
4225 C C   . GLY B 225 ? 0.4811 0.4999 0.4520 0.0507  -0.0001 0.0395  294 GLY B C   
4226 O O   . GLY B 225 ? 0.3211 0.3335 0.2873 0.0515  -0.0009 0.0358  294 GLY B O   
4227 N N   . ALA B 226 ? 0.4350 0.4523 0.4088 0.0460  -0.0012 0.0396  295 ALA B N   
4228 C CA  . ALA B 226 ? 0.4084 0.4177 0.3802 0.0414  -0.0029 0.0352  295 ALA B CA  
4229 C C   . ALA B 226 ? 0.3103 0.3163 0.2848 0.0364  -0.0041 0.0367  295 ALA B C   
4230 O O   . ALA B 226 ? 0.3465 0.3555 0.3258 0.0339  -0.0039 0.0408  295 ALA B O   
4231 C CB  . ALA B 226 ? 0.2822 0.2915 0.2556 0.0395  -0.0027 0.0341  295 ALA B CB  
4232 N N   . SER B 227 ? 0.1962 0.1958 0.1670 0.0345  -0.0057 0.0336  296 SER B N   
4233 C CA  . SER B 227 ? 0.3146 0.3105 0.2867 0.0287  -0.0073 0.0350  296 SER B CA  
4234 C C   . SER B 227 ? 0.3901 0.3814 0.3625 0.0228  -0.0069 0.0331  296 SER B C   
4235 O O   . SER B 227 ? 0.3852 0.3760 0.3599 0.0183  -0.0072 0.0360  296 SER B O   
4236 C CB  . SER B 227 ? 0.2592 0.2486 0.2264 0.0279  -0.0093 0.0324  296 SER B CB  
4237 O OG  . SER B 227 ? 0.2304 0.2226 0.1971 0.0342  -0.0091 0.0337  296 SER B OG  
4238 N N   . TYR B 228 ? 0.2658 0.2536 0.2359 0.0226  -0.0061 0.0284  297 TYR B N   
4239 C CA  . TYR B 228 ? 0.2754 0.2588 0.2462 0.0180  -0.0048 0.0260  297 TYR B CA  
4240 C C   . TYR B 228 ? 0.1942 0.1820 0.1695 0.0210  -0.0029 0.0270  297 TYR B C   
4241 O O   . TYR B 228 ? 0.3963 0.3901 0.3726 0.0260  -0.0029 0.0287  297 TYR B O   
4242 C CB  . TYR B 228 ? 0.3508 0.3282 0.3172 0.0153  -0.0051 0.0205  297 TYR B CB  
4243 C CG  . TYR B 228 ? 0.3442 0.3154 0.3057 0.0108  -0.0070 0.0193  297 TYR B CG  
4244 C CD1 . TYR B 228 ? 0.2733 0.2452 0.2349 0.0100  -0.0089 0.0233  297 TYR B CD1 
4245 C CD2 . TYR B 228 ? 0.3924 0.3577 0.3495 0.0070  -0.0072 0.0146  297 TYR B CD2 
4246 C CE1 . TYR B 228 ? 0.3126 0.2790 0.2700 0.0057  -0.0113 0.0229  297 TYR B CE1 
4247 C CE2 . TYR B 228 ? 0.4158 0.3749 0.3677 0.0024  -0.0093 0.0138  297 TYR B CE2 
4248 C CZ  . TYR B 228 ? 0.3885 0.3481 0.3405 0.0018  -0.0115 0.0181  297 TYR B CZ  
4249 O OH  . TYR B 228 ? 0.4195 0.3732 0.3665 -0.0029 -0.0141 0.0180  297 TYR B OH  
4250 N N   . ILE B 229 ? 0.1855 0.1695 0.1630 0.0177  -0.0010 0.0259  298 ILE B N   
4251 C CA  . ILE B 229 ? 0.1635 0.1501 0.1454 0.0204  0.0007  0.0257  298 ILE B CA  
4252 C C   . ILE B 229 ? 0.3361 0.3228 0.3164 0.0211  0.0004  0.0214  298 ILE B C   
4253 O O   . ILE B 229 ? 0.3168 0.2984 0.2935 0.0173  0.0003  0.0175  298 ILE B O   
4254 C CB  . ILE B 229 ? 0.2562 0.2373 0.2409 0.0170  0.0035  0.0258  298 ILE B CB  
4255 C CG1 . ILE B 229 ? 0.2248 0.2068 0.2116 0.0168  0.0036  0.0310  298 ILE B CG1 
4256 C CG2 . ILE B 229 ? 0.2653 0.2477 0.2550 0.0195  0.0056  0.0242  298 ILE B CG2 
4257 C CD1 . ILE B 229 ? 0.2095 0.1828 0.1958 0.0117  0.0059  0.0305  298 ILE B CD1 
4258 N N   . SER B 230 ? 0.3433 0.3362 0.3259 0.0253  -0.0002 0.0222  299 SER B N   
4259 C CA  . SER B 230 ? 0.3312 0.3253 0.3123 0.0255  -0.0011 0.0187  299 SER B CA  
4260 C C   . SER B 230 ? 0.3832 0.3827 0.3711 0.0277  -0.0003 0.0202  299 SER B C   
4261 O O   . SER B 230 ? 0.5167 0.5201 0.5087 0.0307  0.0001  0.0244  299 SER B O   
4262 C CB  . SER B 230 ? 0.3822 0.3782 0.3569 0.0278  -0.0037 0.0180  299 SER B CB  
4263 O OG  . SER B 230 ? 0.4890 0.4916 0.4647 0.0321  -0.0044 0.0212  299 SER B OG  
4264 N N   . GLY B 231 ? 0.3822 0.3823 0.3717 0.0261  -0.0001 0.0172  300 GLY B N   
4265 C CA  . GLY B 231 ? 0.2865 0.2931 0.2833 0.0282  0.0001  0.0188  300 GLY B CA  
4266 C C   . GLY B 231 ? 0.3528 0.3629 0.3474 0.0267  -0.0024 0.0162  300 GLY B C   
4267 O O   . GLY B 231 ? 0.2542 0.2602 0.2408 0.0241  -0.0039 0.0128  300 GLY B O   
4268 N N   . SER B 232 ? 0.3532 0.3709 0.3548 0.0283  -0.0030 0.0182  301 SER B N   
4269 C CA  . SER B 232 ? 0.2819 0.3040 0.2826 0.0259  -0.0055 0.0163  301 SER B CA  
4270 C C   . SER B 232 ? 0.3405 0.3581 0.3408 0.0214  -0.0033 0.0117  301 SER B C   
4271 O O   . SER B 232 ? 0.2587 0.2717 0.2624 0.0206  0.0008  0.0105  301 SER B O   
4272 C CB  . SER B 232 ? 0.1621 0.1944 0.1727 0.0281  -0.0065 0.0203  301 SER B CB  
4273 O OG  . SER B 232 ? 0.3143 0.3477 0.3355 0.0285  -0.0024 0.0204  301 SER B OG  
4274 N N   . THR B 233 ? 0.2804 0.2989 0.2754 0.0178  -0.0061 0.0091  302 THR B N   
4275 C CA  . THR B 233 ? 0.2404 0.2556 0.2348 0.0129  -0.0043 0.0050  302 THR B CA  
4276 C C   . THR B 233 ? 0.3014 0.3224 0.3082 0.0132  -0.0002 0.0059  302 THR B C   
4277 O O   . THR B 233 ? 0.2978 0.3141 0.3053 0.0104  0.0038  0.0029  302 THR B O   
4278 C CB  . THR B 233 ? 0.1710 0.1869 0.1581 0.0088  -0.0085 0.0029  302 THR B CB  
4279 O OG1 . THR B 233 ? 0.3856 0.3938 0.3605 0.0090  -0.0113 0.0015  302 THR B OG1 
4280 C CG2 . THR B 233 ? 0.1728 0.1864 0.1595 0.0031  -0.0068 -0.0008 302 THR B CG2 
4281 N N   . SER B 234 ? 0.3864 0.4172 0.4031 0.0169  -0.0008 0.0101  303 SER B N   
4282 C CA  . SER B 234 ? 0.4164 0.4529 0.4465 0.0187  0.0037  0.0115  303 SER B CA  
4283 C C   . SER B 234 ? 0.3898 0.4182 0.4222 0.0211  0.0092  0.0111  303 SER B C   
4284 O O   . SER B 234 ? 0.2637 0.2886 0.2992 0.0194  0.0145  0.0082  303 SER B O   
4285 C CB  . SER B 234 ? 0.3826 0.4314 0.4230 0.0225  0.0011  0.0172  303 SER B CB  
4286 O OG  . SER B 234 ? 0.5178 0.5707 0.5721 0.0264  0.0060  0.0196  303 SER B OG  
4287 N N   . SER B 235 ? 0.3482 0.3733 0.3783 0.0244  0.0082  0.0138  304 SER B N   
4288 C CA  . SER B 235 ? 0.3241 0.3412 0.3558 0.0261  0.0129  0.0139  304 SER B CA  
4289 C C   . SER B 235 ? 0.3242 0.3302 0.3467 0.0210  0.0153  0.0089  304 SER B C   
4290 O O   . SER B 235 ? 0.3356 0.3354 0.3600 0.0200  0.0207  0.0069  304 SER B O   
4291 C CB  . SER B 235 ? 0.3597 0.3762 0.3899 0.0297  0.0106  0.0182  304 SER B CB  
4292 O OG  . SER B 235 ? 0.5951 0.6202 0.6353 0.0345  0.0096  0.0235  304 SER B OG  
4293 N N   . ILE B 236 ? 0.3100 0.3129 0.3220 0.0178  0.0115  0.0069  305 ILE B N   
4294 C CA  . ILE B 236 ? 0.3411 0.3339 0.3442 0.0128  0.0129  0.0031  305 ILE B CA  
4295 C C   . ILE B 236 ? 0.3858 0.3771 0.3895 0.0083  0.0164  -0.0011 305 ILE B C   
4296 O O   . ILE B 236 ? 0.3052 0.2881 0.3049 0.0046  0.0201  -0.0039 305 ILE B O   
4297 C CB  . ILE B 236 ? 0.2507 0.2410 0.2437 0.0112  0.0080  0.0027  305 ILE B CB  
4298 C CG1 . ILE B 236 ? 0.2356 0.2272 0.2280 0.0155  0.0058  0.0068  305 ILE B CG1 
4299 C CG2 . ILE B 236 ? 0.2704 0.2510 0.2549 0.0058  0.0087  -0.0004 305 ILE B CG2 
4300 C CD1 . ILE B 236 ? 0.1975 0.1856 0.1938 0.0168  0.0090  0.0090  305 ILE B CD1 
4301 N N   . GLU B 237 ? 0.3955 0.3952 0.4038 0.0081  0.0153  -0.0013 306 GLU B N   
4302 C CA  . GLU B 237 ? 0.4577 0.4581 0.4682 0.0041  0.0191  -0.0047 306 GLU B CA  
4303 C C   . GLU B 237 ? 0.4202 0.4182 0.4381 0.0059  0.0265  -0.0054 306 GLU B C   
4304 O O   . GLU B 237 ? 0.4984 0.4894 0.5124 0.0015  0.0311  -0.0093 306 GLU B O   
4305 C CB  . GLU B 237 ? 0.5631 0.5755 0.5800 0.0042  0.0166  -0.0035 306 GLU B CB  
4306 C CG  . GLU B 237 ? 0.7015 0.7129 0.7091 -0.0016 0.0123  -0.0060 306 GLU B CG  
4307 C CD  . GLU B 237 ? 0.8540 0.8774 0.8675 -0.0020 0.0090  -0.0041 306 GLU B CD  
4308 O OE1 . GLU B 237 ? 0.8873 0.9107 0.8932 -0.0040 0.0032  -0.0040 306 GLU B OE1 
4309 O OE2 . GLU B 237 ? 0.8848 0.9177 0.9108 -0.0005 0.0124  -0.0026 306 GLU B OE2 
4310 N N   . LYS B 238 ? 0.2185 0.2214 0.2466 0.0121  0.0278  -0.0015 307 LYS B N   
4311 C CA  . LYS B 238 ? 0.3508 0.3505 0.3864 0.0147  0.0352  -0.0020 307 LYS B CA  
4312 C C   . LYS B 238 ? 0.4726 0.4580 0.4993 0.0126  0.0379  -0.0040 307 LYS B C   
4313 O O   . LYS B 238 ? 0.4866 0.4641 0.5121 0.0106  0.0445  -0.0074 307 LYS B O   
4314 C CB  . LYS B 238 ? 0.2491 0.2574 0.2981 0.0222  0.0352  0.0035  307 LYS B CB  
4315 C CG  . LYS B 238 ? 0.4424 0.4483 0.5012 0.0261  0.0432  0.0033  307 LYS B CG  
4316 C CD  . LYS B 238 ? 0.6778 0.6980 0.7531 0.0321  0.0434  0.0080  307 LYS B CD  
4317 C CE  . LYS B 238 ? 0.7521 0.7688 0.8381 0.0379  0.0512  0.0091  307 LYS B CE  
4318 N NZ  . LYS B 238 ? 0.7427 0.7568 0.8317 0.0433  0.0490  0.0143  307 LYS B NZ  
4319 N N   . LEU B 239 ? 0.3914 0.3733 0.4114 0.0127  0.0330  -0.0017 308 LEU B N   
4320 C CA  . LEU B 239 ? 0.3375 0.3071 0.3495 0.0101  0.0347  -0.0027 308 LEU B CA  
4321 C C   . LEU B 239 ? 0.4422 0.4032 0.4428 0.0023  0.0356  -0.0075 308 LEU B C   
4322 O O   . LEU B 239 ? 0.1989 0.1494 0.1947 -0.0012 0.0404  -0.0102 308 LEU B O   
4323 C CB  . LEU B 239 ? 0.3461 0.3163 0.3549 0.0120  0.0291  0.0016  308 LEU B CB  
4324 C CG  . LEU B 239 ? 0.4027 0.3622 0.4021 0.0078  0.0288  0.0013  308 LEU B CG  
4325 C CD1 . LEU B 239 ? 0.3656 0.3171 0.3673 0.0088  0.0337  0.0020  308 LEU B CD1 
4326 C CD2 . LEU B 239 ? 0.3398 0.3027 0.3357 0.0090  0.0226  0.0051  308 LEU B CD2 
4327 N N   . MET B 240 ? 0.1875 0.1520 0.1831 -0.0009 0.0312  -0.0086 309 MET B N   
4328 C CA  . MET B 240 ? 0.4056 0.3620 0.3902 -0.0084 0.0313  -0.0124 309 MET B CA  
4329 C C   . MET B 240 ? 0.4556 0.4093 0.4410 -0.0118 0.0382  -0.0168 309 MET B C   
4330 O O   . MET B 240 ? 0.4973 0.4407 0.4737 -0.0178 0.0412  -0.0200 309 MET B O   
4331 C CB  . MET B 240 ? 0.3496 0.3095 0.3288 -0.0105 0.0250  -0.0123 309 MET B CB  
4332 C CG  . MET B 240 ? 0.3828 0.3427 0.3585 -0.0082 0.0192  -0.0088 309 MET B CG  
4333 S SD  . MET B 240 ? 0.3876 0.3368 0.3556 -0.0119 0.0192  -0.0078 309 MET B SD  
4334 C CE  . MET B 240 ? 0.3201 0.2743 0.2882 -0.0070 0.0130  -0.0027 309 MET B CE  
4335 N N   . GLU B 241 ? 0.4554 0.4187 0.4513 -0.0082 0.0408  -0.0168 310 GLU B N   
4336 C CA  . GLU B 241 ? 0.4551 0.4174 0.4541 -0.0102 0.0485  -0.0205 310 GLU B CA  
4337 C C   . GLU B 241 ? 0.3648 0.3165 0.3630 -0.0093 0.0555  -0.0221 310 GLU B C   
4338 O O   . GLU B 241 ? 0.5297 0.4728 0.5212 -0.0144 0.0614  -0.0266 310 GLU B O   
4339 C CB  . GLU B 241 ? 0.5467 0.5232 0.5600 -0.0052 0.0498  -0.0187 310 GLU B CB  
4340 C CG  . GLU B 241 ? 0.5671 0.5452 0.5877 -0.0049 0.0589  -0.0216 310 GLU B CG  
4341 C CD  . GLU B 241 ? 0.6992 0.6936 0.7334 -0.0017 0.0587  -0.0193 310 GLU B CD  
4342 O OE1 . GLU B 241 ? 0.7397 0.7433 0.7777 0.0007  0.0514  -0.0152 310 GLU B OE1 
4343 O OE2 . GLU B 241 ? 0.7441 0.7425 0.7850 -0.0020 0.0659  -0.0215 310 GLU B OE2 
4344 N N   . ALA B 242 ? 0.3128 0.2641 0.3166 -0.0034 0.0549  -0.0185 311 ALA B N   
4345 C CA  . ALA B 242 ? 0.3863 0.3256 0.3879 -0.0029 0.0610  -0.0198 311 ALA B CA  
4346 C C   . ALA B 242 ? 0.4810 0.4065 0.4667 -0.0109 0.0598  -0.0221 311 ALA B C   
4347 O O   . ALA B 242 ? 0.5058 0.4192 0.4851 -0.0144 0.0662  -0.0258 311 ALA B O   
4348 C CB  . ALA B 242 ? 0.2640 0.2057 0.2743 0.0047  0.0595  -0.0146 311 ALA B CB  
4349 N N   . LEU B 243 ? 0.4461 0.3731 0.4250 -0.0140 0.0519  -0.0200 312 LEU B N   
4350 C CA  . LEU B 243 ? 0.3643 0.2800 0.3293 -0.0217 0.0497  -0.0210 312 LEU B CA  
4351 C C   . LEU B 243 ? 0.4465 0.3569 0.4013 -0.0300 0.0514  -0.0257 312 LEU B C   
4352 O O   . LEU B 243 ? 0.4567 0.3563 0.3993 -0.0374 0.0508  -0.0270 312 LEU B O   
4353 C CB  . LEU B 243 ? 0.2238 0.1441 0.1868 -0.0213 0.0409  -0.0165 312 LEU B CB  
4354 C CG  . LEU B 243 ? 0.2681 0.1935 0.2387 -0.0144 0.0381  -0.0113 312 LEU B CG  
4355 C CD1 . LEU B 243 ? 0.3121 0.2405 0.2787 -0.0152 0.0306  -0.0074 312 LEU B CD1 
4356 C CD2 . LEU B 243 ? 0.2750 0.1907 0.2449 -0.0145 0.0427  -0.0111 312 LEU B CD2 
4357 N N   . GLY B 244 ? 0.4075 0.3252 0.3664 -0.0298 0.0531  -0.0279 313 GLY B N   
4358 C CA  . GLY B 244 ? 0.3276 0.2411 0.2762 -0.0381 0.0535  -0.0315 313 GLY B CA  
4359 C C   . GLY B 244 ? 0.4830 0.3978 0.4246 -0.0419 0.0446  -0.0293 313 GLY B C   
4360 O O   . GLY B 244 ? 0.5561 0.4652 0.4871 -0.0499 0.0438  -0.0315 313 GLY B O   
4361 N N   . ALA B 245 ? 0.3599 0.2819 0.3070 -0.0364 0.0383  -0.0248 314 ALA B N   
4362 C CA  . ALA B 245 ? 0.3202 0.2433 0.2616 -0.0385 0.0304  -0.0225 314 ALA B CA  
4363 C C   . ALA B 245 ? 0.4034 0.3337 0.3468 -0.0385 0.0284  -0.0236 314 ALA B C   
4364 O O   . ALA B 245 ? 0.3624 0.3012 0.3153 -0.0341 0.0309  -0.0240 314 ALA B O   
4365 C CB  . ALA B 245 ? 0.3962 0.3234 0.3418 -0.0326 0.0252  -0.0176 314 ALA B CB  
4366 N N   . LYS B 246 ? 0.4099 0.3367 0.3445 -0.0436 0.0235  -0.0236 315 LYS B N   
4367 C CA  . LYS B 246 ? 0.4118 0.3429 0.3456 -0.0452 0.0210  -0.0247 315 LYS B CA  
4368 C C   . LYS B 246 ? 0.3940 0.3274 0.3269 -0.0416 0.0136  -0.0214 315 LYS B C   
4369 O O   . LYS B 246 ? 0.4219 0.3518 0.3518 -0.0404 0.0100  -0.0186 315 LYS B O   
4370 C CB  . LYS B 246 ? 0.3695 0.2932 0.2926 -0.0547 0.0219  -0.0276 315 LYS B CB  
4371 C CG  . LYS B 246 ? 0.4097 0.3320 0.3336 -0.0582 0.0304  -0.0316 315 LYS B CG  
4372 C CD  . LYS B 246 ? 0.6974 0.6293 0.6288 -0.0571 0.0332  -0.0333 315 LYS B CD  
4373 C CE  . LYS B 246 ? 0.7897 0.7194 0.7191 -0.0626 0.0414  -0.0376 315 LYS B CE  
4374 N NZ  . LYS B 246 ? 0.8164 0.7423 0.7491 -0.0598 0.0486  -0.0391 315 LYS B NZ  
4375 N N   . LYS B 247 ? 0.3648 0.3042 0.3003 -0.0401 0.0114  -0.0218 316 LYS B N   
4376 C CA  . LYS B 247 ? 0.4104 0.3517 0.3450 -0.0359 0.0053  -0.0193 316 LYS B CA  
4377 C C   . LYS B 247 ? 0.5391 0.4732 0.4633 -0.0410 0.0007  -0.0198 316 LYS B C   
4378 O O   . LYS B 247 ? 0.5876 0.5206 0.5082 -0.0466 0.0011  -0.0222 316 LYS B O   
4379 C CB  . LYS B 247 ? 0.3164 0.2675 0.2587 -0.0313 0.0050  -0.0191 316 LYS B CB  
4380 C CG  . LYS B 247 ? 0.4196 0.3723 0.3610 -0.0258 -0.0001 -0.0166 316 LYS B CG  
4381 C CD  . LYS B 247 ? 0.5290 0.4907 0.4760 -0.0228 -0.0012 -0.0164 316 LYS B CD  
4382 C CE  . LYS B 247 ? 0.6227 0.5838 0.5656 -0.0185 -0.0061 -0.0147 316 LYS B CE  
4383 N NZ  . LYS B 247 ? 0.8005 0.7624 0.7462 -0.0124 -0.0059 -0.0117 316 LYS B NZ  
4384 N N   . ARG B 248 ? 0.5791 0.5085 0.4990 -0.0391 -0.0036 -0.0171 317 ARG B N   
4385 C CA  . ARG B 248 ? 0.5192 0.4418 0.4304 -0.0416 -0.0087 -0.0166 317 ARG B CA  
4386 C C   . ARG B 248 ? 0.5776 0.5034 0.4897 -0.0367 -0.0116 -0.0166 317 ARG B C   
4387 O O   . ARG B 248 ? 0.8947 0.8284 0.8134 -0.0336 -0.0097 -0.0174 317 ARG B O   
4388 C CB  . ARG B 248 ? 0.5497 0.4670 0.4574 -0.0408 -0.0119 -0.0131 317 ARG B CB  
4389 C CG  . ARG B 248 ? 0.4357 0.3470 0.3382 -0.0482 -0.0110 -0.0129 317 ARG B CG  
4390 C CD  . ARG B 248 ? 0.5651 0.4745 0.4673 -0.0463 -0.0143 -0.0083 317 ARG B CD  
4391 N NE  . ARG B 248 ? 0.7692 0.6712 0.6635 -0.0542 -0.0165 -0.0069 317 ARG B NE  
4392 C CZ  . ARG B 248 ? 0.8721 0.7720 0.7651 -0.0541 -0.0206 -0.0022 317 ARG B CZ  
4393 N NH1 . ARG B 248 ? 0.9377 0.8310 0.8231 -0.0622 -0.0231 -0.0006 317 ARG B NH1 
4394 N NH2 . ARG B 248 ? 0.8701 0.7751 0.7696 -0.0461 -0.0223 0.0014  317 ARG B NH2 
4395 N N   . LEU B 249 ? 0.5884 0.5075 0.4935 -0.0362 -0.0162 -0.0157 318 LEU B N   
4396 C CA  . LEU B 249 ? 0.6882 0.6084 0.5922 -0.0314 -0.0187 -0.0160 318 LEU B CA  
4397 C C   . LEU B 249 ? 0.7621 0.6903 0.6737 -0.0235 -0.0172 -0.0143 318 LEU B C   
4398 O O   . LEU B 249 ? 0.8948 0.8293 0.8098 -0.0214 -0.0167 -0.0152 318 LEU B O   
4399 C CB  . LEU B 249 ? 0.7069 0.6171 0.6023 -0.0305 -0.0231 -0.0149 318 LEU B CB  
4400 C CG  . LEU B 249 ? 0.6309 0.5405 0.5239 -0.0247 -0.0250 -0.0154 318 LEU B CG  
4401 C CD1 . LEU B 249 ? 0.4205 0.3328 0.3120 -0.0282 -0.0252 -0.0185 318 LEU B CD1 
4402 C CD2 . LEU B 249 ? 0.6804 0.5789 0.5651 -0.0228 -0.0285 -0.0145 318 LEU B CD2 
4403 N N   . PHE B 250 ? 0.8292 0.7579 0.7436 -0.0195 -0.0169 -0.0112 319 PHE B N   
4404 C CA  . PHE B 250 ? 0.9485 0.8844 0.8693 -0.0122 -0.0157 -0.0092 319 PHE B CA  
4405 C C   . PHE B 250 ? 0.9012 0.8423 0.8297 -0.0113 -0.0125 -0.0071 319 PHE B C   
4406 O O   . PHE B 250 ? 0.9244 0.8728 0.8593 -0.0068 -0.0108 -0.0061 319 PHE B O   
4407 C CB  . PHE B 250 ? 0.9830 0.9159 0.9005 -0.0065 -0.0182 -0.0070 319 PHE B CB  
4408 C CG  . PHE B 250 ? 0.9758 0.9016 0.8895 -0.0081 -0.0203 -0.0048 319 PHE B CG  
4409 C CD1 . PHE B 250 ? 0.9890 0.9067 0.8955 -0.0072 -0.0233 -0.0050 319 PHE B CD1 
4410 C CD2 . PHE B 250 ? 0.8576 0.7847 0.7749 -0.0104 -0.0194 -0.0022 319 PHE B CD2 
4411 C CE1 . PHE B 250 ? 0.7794 0.6913 0.6835 -0.0082 -0.0256 -0.0021 319 PHE B CE1 
4412 C CE2 . PHE B 250 ? 0.8239 0.7456 0.7382 -0.0123 -0.0221 0.0007  319 PHE B CE2 
4413 C CZ  . PHE B 250 ? 0.7534 0.6681 0.6618 -0.0109 -0.0253 0.0010  319 PHE B CZ  
4414 N N   . ASP B 251 ? 0.7409 0.6780 0.6682 -0.0159 -0.0117 -0.0065 320 ASP B N   
4415 C CA  . ASP B 251 ? 0.4386 0.3787 0.3715 -0.0158 -0.0087 -0.0048 320 ASP B CA  
4416 C C   . ASP B 251 ? 0.4728 0.4115 0.4064 -0.0215 -0.0048 -0.0078 320 ASP B C   
4417 O O   . ASP B 251 ? 0.5869 0.5232 0.5168 -0.0261 -0.0045 -0.0109 320 ASP B O   
4418 C CB  . ASP B 251 ? 0.3676 0.3043 0.2986 -0.0168 -0.0106 -0.0012 320 ASP B CB  
4419 C CG  . ASP B 251 ? 0.6331 0.5618 0.5563 -0.0236 -0.0131 -0.0017 320 ASP B CG  
4420 O OD1 . ASP B 251 ? 0.7539 0.6790 0.6724 -0.0268 -0.0137 -0.0048 320 ASP B OD1 
4421 O OD2 . ASP B 251 ? 0.6040 0.5301 0.5256 -0.0262 -0.0148 0.0015  320 ASP B OD2 
4422 N N   . TYR B 252 ? 0.3593 0.2995 0.2976 -0.0211 -0.0014 -0.0069 321 TYR B N   
4423 C CA  . TYR B 252 ? 0.3591 0.2964 0.2975 -0.0260 0.0033  -0.0097 321 TYR B CA  
4424 C C   . TYR B 252 ? 0.3126 0.2424 0.2451 -0.0317 0.0032  -0.0087 321 TYR B C   
4425 O O   . TYR B 252 ? 0.2709 0.2009 0.2039 -0.0299 0.0009  -0.0049 321 TYR B O   
4426 C CB  . TYR B 252 ? 0.3897 0.3326 0.3372 -0.0214 0.0076  -0.0095 321 TYR B CB  
4427 C CG  . TYR B 252 ? 0.4478 0.3987 0.4018 -0.0175 0.0084  -0.0105 321 TYR B CG  
4428 C CD1 . TYR B 252 ? 0.3453 0.3031 0.3034 -0.0112 0.0055  -0.0079 321 TYR B CD1 
4429 C CD2 . TYR B 252 ? 0.5773 0.5295 0.5331 -0.0205 0.0119  -0.0139 321 TYR B CD2 
4430 C CE1 . TYR B 252 ? 0.3082 0.2735 0.2716 -0.0085 0.0055  -0.0084 321 TYR B CE1 
4431 C CE2 . TYR B 252 ? 0.4944 0.4553 0.4570 -0.0175 0.0121  -0.0141 321 TYR B CE2 
4432 C CZ  . TYR B 252 ? 0.3301 0.2973 0.2962 -0.0118 0.0085  -0.0112 321 TYR B CZ  
4433 O OH  . TYR B 252 ? 0.4686 0.4446 0.4408 -0.0098 0.0080  -0.0110 321 TYR B OH  
4434 N N   . VAL B 253 ? 0.3474 0.2708 0.2738 -0.0391 0.0057  -0.0119 322 VAL B N   
4435 C CA  . VAL B 253 ? 0.3274 0.2427 0.2460 -0.0462 0.0053  -0.0113 322 VAL B CA  
4436 C C   . VAL B 253 ? 0.3997 0.3098 0.3160 -0.0511 0.0119  -0.0153 322 VAL B C   
4437 O O   . VAL B 253 ? 0.4006 0.3133 0.3206 -0.0500 0.0167  -0.0188 322 VAL B O   
4438 C CB  . VAL B 253 ? 0.4302 0.3403 0.3397 -0.0522 0.0005  -0.0107 322 VAL B CB  
4439 C CG1 . VAL B 253 ? 0.4908 0.4045 0.4023 -0.0469 -0.0055 -0.0068 322 VAL B CG1 
4440 C CG2 . VAL B 253 ? 0.3630 0.2713 0.2687 -0.0565 0.0028  -0.0152 322 VAL B CG2 
4441 N N   . VAL B 254 ? 0.4183 0.3211 0.3283 -0.0567 0.0123  -0.0145 323 VAL B N   
4442 C CA  . VAL B 254 ? 0.3916 0.2858 0.2948 -0.0636 0.0183  -0.0186 323 VAL B CA  
4443 C C   . VAL B 254 ? 0.5246 0.4103 0.4150 -0.0735 0.0146  -0.0177 323 VAL B C   
4444 O O   . VAL B 254 ? 0.5868 0.4737 0.4757 -0.0741 0.0077  -0.0129 323 VAL B O   
4445 C CB  . VAL B 254 ? 0.3431 0.2344 0.2496 -0.0614 0.0230  -0.0188 323 VAL B CB  
4446 C CG1 . VAL B 254 ? 0.5157 0.4162 0.4355 -0.0511 0.0253  -0.0182 323 VAL B CG1 
4447 C CG2 . VAL B 254 ? 0.3095 0.1980 0.2125 -0.0637 0.0180  -0.0139 323 VAL B CG2 
4448 N N   . LYS B 255 ? 0.5551 0.4324 0.4363 -0.0814 0.0194  -0.0221 324 LYS B N   
4449 C CA  . LYS B 255 ? 0.5588 0.4277 0.4270 -0.0916 0.0162  -0.0210 324 LYS B CA  
4450 C C   . LYS B 255 ? 0.4719 0.3382 0.3388 -0.0926 0.0136  -0.0170 324 LYS B C   
4451 O O   . LYS B 255 ? 0.3463 0.2095 0.2160 -0.0907 0.0183  -0.0185 324 LYS B O   
4452 C CB  . LYS B 255 ? 0.6910 0.5568 0.5520 -0.0958 0.0230  -0.0254 324 LYS B CB  
4453 C CG  . LYS B 255 ? 0.7456 0.6148 0.6075 -0.0960 0.0255  -0.0286 324 LYS B CG  
4454 C CD  . LYS B 255 ? 0.8540 0.7197 0.7137 -0.0982 0.0356  -0.0346 324 LYS B CD  
4455 C CE  . LYS B 255 ? 0.9268 0.7956 0.7832 -0.1017 0.0373  -0.0365 324 LYS B CE  
4456 N NZ  . LYS B 255 ? 0.8979 0.7633 0.7524 -0.1042 0.0480  -0.0427 324 LYS B NZ  
4457 N N   . CYS B 256 ? 0.4532 0.3217 0.3167 -0.0952 0.0059  -0.0113 325 CYS B N   
4458 C CA  . CYS B 256 ? 0.3623 0.2305 0.2263 -0.0963 0.0020  -0.0064 325 CYS B CA  
4459 C C   . CYS B 256 ? 0.5126 0.3751 0.3703 -0.0998 0.0069  -0.0088 325 CYS B C   
4460 O O   . CYS B 256 ? 0.5908 0.4514 0.4513 -0.0989 0.0074  -0.0072 325 CYS B O   
4461 C CB  . CYS B 256 ? 0.3409 0.2127 0.2021 -0.0993 -0.0067 0.0000  325 CYS B CB  
4462 S SG  . CYS B 256 ? 0.6155 0.4934 0.4854 -0.0934 -0.0127 0.0040  325 CYS B SG  
4463 N N   . ASN B 257 ? 0.5610 0.4198 0.4095 -0.1040 0.0109  -0.0126 326 ASN B N   
4464 C CA  . ASN B 257 ? 0.5668 0.4183 0.4072 -0.1078 0.0160  -0.0153 326 ASN B CA  
4465 C C   . ASN B 257 ? 0.5699 0.4163 0.4156 -0.1037 0.0244  -0.0202 326 ASN B C   
4466 O O   . ASN B 257 ? 0.6506 0.4901 0.4916 -0.1055 0.0278  -0.0214 326 ASN B O   
4467 C CB  . ASN B 257 ? 0.5248 0.3728 0.3533 -0.1134 0.0191  -0.0181 326 ASN B CB  
4468 C CG  . ASN B 257 ? 0.5035 0.3515 0.3346 -0.1112 0.0263  -0.0236 326 ASN B CG  
4469 O OD1 . ASN B 257 ? 0.5273 0.3811 0.3666 -0.1072 0.0244  -0.0233 326 ASN B OD1 
4470 N ND2 . ASN B 257 ? 0.4500 0.2912 0.2741 -0.1140 0.0348  -0.0287 326 ASN B ND2 
4471 N N   . GLU B 258 ? 0.4967 0.3457 0.3516 -0.0982 0.0278  -0.0228 327 GLU B N   
4472 C CA  . GLU B 258 ? 0.5749 0.4190 0.4359 -0.0937 0.0361  -0.0272 327 GLU B CA  
4473 C C   . GLU B 258 ? 0.6255 0.4720 0.4964 -0.0878 0.0337  -0.0233 327 GLU B C   
4474 O O   . GLU B 258 ? 0.5511 0.3958 0.4280 -0.0820 0.0397  -0.0252 327 GLU B O   
4475 C CB  . GLU B 258 ? 0.5741 0.4209 0.4408 -0.0904 0.0412  -0.0319 327 GLU B CB  
4476 C CG  . GLU B 258 ? 0.8253 0.6708 0.6838 -0.0951 0.0457  -0.0359 327 GLU B CG  
4477 C CD  . GLU B 258 ? 1.0348 0.8849 0.8997 -0.0926 0.0495  -0.0398 327 GLU B CD  
4478 O OE1 . GLU B 258 ? 1.0856 0.9462 0.9624 -0.0851 0.0457  -0.0370 327 GLU B OE1 
4479 O OE2 . GLU B 258 ? 1.1196 0.9681 0.9799 -0.0958 0.0558  -0.0440 327 GLU B OE2 
4480 N N   . GLY B 259 ? 0.6218 0.4765 0.4965 -0.0864 0.0251  -0.0170 328 GLY B N   
4481 C CA  . GLY B 259 ? 0.4587 0.3215 0.3444 -0.0786 0.0220  -0.0118 328 GLY B CA  
4482 C C   . GLY B 259 ? 0.5336 0.3885 0.4178 -0.0795 0.0255  -0.0116 328 GLY B C   
4483 O O   . GLY B 259 ? 0.6407 0.4995 0.5350 -0.0711 0.0285  -0.0111 328 GLY B O   
4484 N N   . PRO B 260 ? 0.3871 0.2302 0.2583 -0.0900 0.0250  -0.0118 329 PRO B N   
4485 C CA  . PRO B 260 ? 0.3132 0.1481 0.1820 -0.0914 0.0276  -0.0113 329 PRO B CA  
4486 C C   . PRO B 260 ? 0.5232 0.3481 0.3921 -0.0880 0.0378  -0.0176 329 PRO B C   
4487 O O   . PRO B 260 ? 0.4921 0.3112 0.3624 -0.0863 0.0402  -0.0167 329 PRO B O   
4488 C CB  . PRO B 260 ? 0.3643 0.1980 0.2216 -0.0993 0.0232  -0.0101 329 PRO B CB  
4489 C CG  . PRO B 260 ? 0.4485 0.2913 0.3055 -0.1013 0.0159  -0.0067 329 PRO B CG  
4490 C CD  . PRO B 260 ? 0.4379 0.2828 0.2996 -0.0971 0.0195  -0.0105 329 PRO B CD  
4491 N N   . THR B 261 ? 0.6195 0.4427 0.4875 -0.0869 0.0439  -0.0237 330 THR B N   
4492 C CA  . THR B 261 ? 0.5742 0.3903 0.4450 -0.0820 0.0541  -0.0292 330 THR B CA  
4493 C C   . THR B 261 ? 0.5394 0.3690 0.4285 -0.0687 0.0557  -0.0277 330 THR B C   
4494 O O   . THR B 261 ? 0.5957 0.4217 0.4901 -0.0631 0.0638  -0.0312 330 THR B O   
4495 C CB  . THR B 261 ? 0.5478 0.3595 0.4104 -0.0859 0.0604  -0.0358 330 THR B CB  
4496 O OG1 . THR B 261 ? 0.4862 0.3071 0.3521 -0.0858 0.0576  -0.0360 330 THR B OG1 
4497 C CG2 . THR B 261 ? 0.4651 0.2722 0.3126 -0.0944 0.0584  -0.0357 330 THR B CG2 
4498 N N   . LEU B 262 ? 0.4470 0.2916 0.3456 -0.0637 0.0483  -0.0225 331 LEU B N   
4499 C CA  . LEU B 262 ? 0.4181 0.2756 0.3327 -0.0522 0.0490  -0.0208 331 LEU B CA  
4500 C C   . LEU B 262 ? 0.3882 0.2433 0.3095 -0.0464 0.0512  -0.0181 331 LEU B C   
4501 O O   . LEU B 262 ? 0.5746 0.4220 0.4897 -0.0508 0.0490  -0.0156 331 LEU B O   
4502 C CB  . LEU B 262 ? 0.4673 0.3393 0.3881 -0.0490 0.0406  -0.0159 331 LEU B CB  
4503 C CG  . LEU B 262 ? 0.4022 0.2785 0.3193 -0.0524 0.0379  -0.0178 331 LEU B CG  
4504 C CD1 . LEU B 262 ? 0.3495 0.2375 0.2716 -0.0489 0.0297  -0.0126 331 LEU B CD1 
4505 C CD2 . LEU B 262 ? 0.4258 0.3058 0.3487 -0.0484 0.0438  -0.0223 331 LEU B CD2 
4506 N N   . PRO B 263 ? 0.3693 0.2308 0.3032 -0.0369 0.0551  -0.0182 332 PRO B N   
4507 C CA  . PRO B 263 ? 0.2728 0.1314 0.2133 -0.0311 0.0573  -0.0154 332 PRO B CA  
4508 C C   . PRO B 263 ? 0.5103 0.3799 0.4578 -0.0269 0.0497  -0.0082 332 PRO B C   
4509 O O   . PRO B 263 ? 0.3911 0.2724 0.3409 -0.0262 0.0435  -0.0057 332 PRO B O   
4510 C CB  . PRO B 263 ? 0.3992 0.2626 0.3517 -0.0225 0.0640  -0.0177 332 PRO B CB  
4511 C CG  . PRO B 263 ? 0.4754 0.3512 0.4313 -0.0219 0.0617  -0.0190 332 PRO B CG  
4512 C CD  . PRO B 263 ? 0.3972 0.2671 0.3389 -0.0322 0.0587  -0.0213 332 PRO B CD  
4513 N N   . ASP B 264 ? 0.3973 0.2622 0.3475 -0.0243 0.0506  -0.0051 333 ASP B N   
4514 C CA  . ASP B 264 ? 0.3366 0.2114 0.2934 -0.0202 0.0444  0.0019  333 ASP B CA  
4515 C C   . ASP B 264 ? 0.2696 0.1596 0.2401 -0.0105 0.0434  0.0041  333 ASP B C   
4516 O O   . ASP B 264 ? 0.3196 0.2106 0.2968 -0.0054 0.0484  0.0014  333 ASP B O   
4517 C CB  . ASP B 264 ? 0.4655 0.3302 0.4212 -0.0204 0.0460  0.0048  333 ASP B CB  
4518 C CG  . ASP B 264 ? 0.6169 0.4674 0.5583 -0.0312 0.0454  0.0038  333 ASP B CG  
4519 O OD1 . ASP B 264 ? 0.6917 0.5425 0.6250 -0.0384 0.0424  0.0022  333 ASP B OD1 
4520 O OD2 . ASP B 264 ? 0.6988 0.5375 0.6368 -0.0330 0.0476  0.0050  333 ASP B OD2 
4521 N N   . ILE B 265 ? 0.2482 0.1502 0.2225 -0.0080 0.0368  0.0091  334 ILE B N   
4522 C CA  . ILE B 265 ? 0.3862 0.3019 0.3716 0.0005  0.0349  0.0121  334 ILE B CA  
4523 C C   . ILE B 265 ? 0.3750 0.2935 0.3648 0.0039  0.0324  0.0185  334 ILE B C   
4524 O O   . ILE B 265 ? 0.3362 0.2535 0.3209 -0.0002 0.0288  0.0218  334 ILE B O   
4525 C CB  . ILE B 265 ? 0.4263 0.3533 0.4114 0.0006  0.0298  0.0121  334 ILE B CB  
4526 C CG1 . ILE B 265 ? 0.4329 0.3560 0.4124 -0.0040 0.0320  0.0061  334 ILE B CG1 
4527 C CG2 . ILE B 265 ? 0.3836 0.3236 0.3786 0.0085  0.0280  0.0146  334 ILE B CG2 
4528 C CD1 . ILE B 265 ? 0.5281 0.4599 0.5061 -0.0044 0.0271  0.0058  334 ILE B CD1 
4529 N N   . SER B 266 ? 0.3751 0.2977 0.3745 0.0111  0.0341  0.0208  335 SER B N   
4530 C CA  . SER B 266 ? 0.3720 0.2957 0.3753 0.0142  0.0324  0.0270  335 SER B CA  
4531 C C   . SER B 266 ? 0.3209 0.2591 0.3337 0.0216  0.0294  0.0311  335 SER B C   
4532 O O   . SER B 266 ? 0.3149 0.2585 0.3346 0.0261  0.0310  0.0294  335 SER B O   
4533 C CB  . SER B 266 ? 0.3626 0.2731 0.3671 0.0151  0.0378  0.0269  335 SER B CB  
4534 O OG  . SER B 266 ? 0.5340 0.4302 0.5275 0.0071  0.0394  0.0244  335 SER B OG  
4535 N N   . PHE B 267 ? 0.4286 0.3733 0.4415 0.0225  0.0249  0.0366  336 PHE B N   
4536 C CA  . PHE B 267 ? 0.2306 0.1881 0.2504 0.0286  0.0218  0.0411  336 PHE B CA  
4537 C C   . PHE B 267 ? 0.4026 0.3574 0.4265 0.0312  0.0220  0.0471  336 PHE B C   
4538 O O   . PHE B 267 ? 0.4110 0.3602 0.4303 0.0275  0.0213  0.0498  336 PHE B O   
4539 C CB  . PHE B 267 ? 0.1873 0.1548 0.2032 0.0278  0.0169  0.0427  336 PHE B CB  
4540 C CG  . PHE B 267 ? 0.2668 0.2351 0.2777 0.0247  0.0163  0.0373  336 PHE B CG  
4541 C CD1 . PHE B 267 ? 0.2813 0.2417 0.2849 0.0184  0.0168  0.0347  336 PHE B CD1 
4542 C CD2 . PHE B 267 ? 0.2979 0.2744 0.3110 0.0276  0.0149  0.0352  336 PHE B CD2 
4543 C CE1 . PHE B 267 ? 0.2754 0.2361 0.2744 0.0155  0.0159  0.0303  336 PHE B CE1 
4544 C CE2 . PHE B 267 ? 0.2654 0.2415 0.2734 0.0246  0.0142  0.0305  336 PHE B CE2 
4545 C CZ  . PHE B 267 ? 0.3528 0.3210 0.3539 0.0188  0.0148  0.0281  336 PHE B CZ  
4546 N N   . HIS B 268 ? 0.5572 0.5161 0.5901 0.0373  0.0228  0.0495  337 HIS B N   
4547 C CA  . HIS B 268 ? 0.5160 0.4720 0.5535 0.0404  0.0229  0.0556  337 HIS B CA  
4548 C C   . HIS B 268 ? 0.5019 0.4706 0.5405 0.0425  0.0176  0.0618  337 HIS B C   
4549 O O   . HIS B 268 ? 0.6670 0.6466 0.7107 0.0467  0.0153  0.0632  337 HIS B O   
4550 C CB  . HIS B 268 ? 0.5162 0.4700 0.5636 0.0461  0.0266  0.0557  337 HIS B CB  
4551 C CG  . HIS B 268 ? 0.8109 0.7561 0.8620 0.0486  0.0281  0.0609  337 HIS B CG  
4552 N ND1 . HIS B 268 ? 0.8812 0.8100 0.9314 0.0479  0.0339  0.0583  337 HIS B ND1 
4553 C CD2 . HIS B 268 ? 0.8880 0.8377 0.9430 0.0516  0.0248  0.0686  337 HIS B CD2 
4554 C CE1 . HIS B 268 ? 0.8941 0.8172 0.9478 0.0506  0.0339  0.0643  337 HIS B CE1 
4555 N NE2 . HIS B 268 ? 0.8658 0.8018 0.9228 0.0528  0.0283  0.0708  337 HIS B NE2 
4556 N N   . LEU B 269 ? 0.4019 0.3692 0.4352 0.0392  0.0157  0.0655  338 LEU B N   
4557 C CA  . LEU B 269 ? 0.3864 0.3652 0.4192 0.0405  0.0114  0.0711  338 LEU B CA  
4558 C C   . LEU B 269 ? 0.4382 0.4123 0.4713 0.0397  0.0110  0.0779  338 LEU B C   
4559 O O   . LEU B 269 ? 0.4894 0.4536 0.5179 0.0348  0.0123  0.0779  338 LEU B O   
4560 C CB  . LEU B 269 ? 0.3530 0.3377 0.3787 0.0369  0.0094  0.0693  338 LEU B CB  
4561 C CG  . LEU B 269 ? 0.3231 0.3086 0.3463 0.0359  0.0100  0.0622  338 LEU B CG  
4562 C CD1 . LEU B 269 ? 0.1840 0.1694 0.2004 0.0311  0.0090  0.0608  338 LEU B CD1 
4563 C CD2 . LEU B 269 ? 0.2943 0.2909 0.3197 0.0401  0.0078  0.0615  338 LEU B CD2 
4564 N N   . GLY B 270 ? 0.3595 0.3406 0.3973 0.0439  0.0087  0.0839  339 GLY B N   
4565 C CA  . GLY B 270 ? 0.3252 0.3027 0.3631 0.0431  0.0078  0.0911  339 GLY B CA  
4566 C C   . GLY B 270 ? 0.4018 0.3629 0.4415 0.0424  0.0112  0.0912  339 GLY B C   
4567 O O   . GLY B 270 ? 0.3644 0.3180 0.4004 0.0386  0.0111  0.0951  339 GLY B O   
4568 N N   . GLY B 271 ? 0.3698 0.3247 0.4147 0.0458  0.0146  0.0871  340 GLY B N   
4569 C CA  . GLY B 271 ? 0.3892 0.3271 0.4354 0.0459  0.0189  0.0864  340 GLY B CA  
4570 C C   . GLY B 271 ? 0.5347 0.4592 0.5728 0.0398  0.0226  0.0797  340 GLY B C   
4571 O O   . GLY B 271 ? 0.7342 0.6440 0.7728 0.0404  0.0275  0.0767  340 GLY B O   
4572 N N   . LYS B 272 ? 0.5229 0.4518 0.5535 0.0339  0.0206  0.0774  341 LYS B N   
4573 C CA  . LYS B 272 ? 0.4409 0.3581 0.4629 0.0270  0.0232  0.0717  341 LYS B CA  
4574 C C   . LYS B 272 ? 0.4376 0.3595 0.4590 0.0271  0.0244  0.0644  341 LYS B C   
4575 O O   . LYS B 272 ? 0.4632 0.3990 0.4890 0.0311  0.0222  0.0642  341 LYS B O   
4576 C CB  . LYS B 272 ? 0.4210 0.3397 0.4355 0.0197  0.0198  0.0749  341 LYS B CB  
4577 C CG  . LYS B 272 ? 0.4937 0.4043 0.5065 0.0171  0.0190  0.0814  341 LYS B CG  
4578 C CD  . LYS B 272 ? 0.6379 0.5430 0.6415 0.0075  0.0175  0.0821  341 LYS B CD  
4579 C CE  . LYS B 272 ? 0.6864 0.5889 0.6887 0.0044  0.0153  0.0901  341 LYS B CE  
4580 N NZ  . LYS B 272 ? 0.5857 0.5053 0.5944 0.0096  0.0120  0.0963  341 LYS B NZ  
4581 N N   . GLU B 273 ? 0.4025 0.3117 0.4173 0.0221  0.0280  0.0585  342 GLU B N   
4582 C CA  . GLU B 273 ? 0.4520 0.3636 0.4645 0.0206  0.0293  0.0515  342 GLU B CA  
4583 C C   . GLU B 273 ? 0.4135 0.3276 0.4174 0.0132  0.0258  0.0510  342 GLU B C   
4584 O O   . GLU B 273 ? 0.4534 0.3578 0.4501 0.0064  0.0256  0.0520  342 GLU B O   
4585 C CB  . GLU B 273 ? 0.4977 0.3939 0.5080 0.0197  0.0358  0.0452  342 GLU B CB  
4586 C CG  . GLU B 273 ? 0.7569 0.6516 0.7776 0.0280  0.0400  0.0457  342 GLU B CG  
4587 C CD  . GLU B 273 ? 0.8724 0.7806 0.9013 0.0334  0.0401  0.0433  342 GLU B CD  
4588 O OE1 . GLU B 273 ? 0.8634 0.7828 0.8900 0.0314  0.0361  0.0421  342 GLU B OE1 
4589 O OE2 . GLU B 273 ? 0.8424 0.7499 0.8803 0.0396  0.0441  0.0428  342 GLU B OE2 
4590 N N   . TYR B 274 ? 0.4106 0.3376 0.4154 0.0143  0.0229  0.0497  343 TYR B N   
4591 C CA  . TYR B 274 ? 0.4693 0.4001 0.4676 0.0084  0.0196  0.0495  343 TYR B CA  
4592 C C   . TYR B 274 ? 0.5198 0.4458 0.5134 0.0052  0.0215  0.0423  343 TYR B C   
4593 O O   . TYR B 274 ? 0.6224 0.5554 0.6194 0.0091  0.0217  0.0392  343 TYR B O   
4594 C CB  . TYR B 274 ? 0.4151 0.3626 0.4170 0.0122  0.0152  0.0533  343 TYR B CB  
4595 C CG  . TYR B 274 ? 0.4770 0.4290 0.4811 0.0131  0.0131  0.0608  343 TYR B CG  
4596 C CD1 . TYR B 274 ? 0.3395 0.2916 0.3492 0.0182  0.0140  0.0642  343 TYR B CD1 
4597 C CD2 . TYR B 274 ? 0.4618 0.4185 0.4627 0.0086  0.0102  0.0649  343 TYR B CD2 
4598 C CE1 . TYR B 274 ? 0.3576 0.3135 0.3687 0.0184  0.0120  0.0713  343 TYR B CE1 
4599 C CE2 . TYR B 274 ? 0.3685 0.3300 0.3714 0.0090  0.0086  0.0720  343 TYR B CE2 
4600 C CZ  . TYR B 274 ? 0.4227 0.3833 0.4301 0.0136  0.0095  0.0750  343 TYR B CZ  
4601 O OH  . TYR B 274 ? 0.4583 0.4235 0.4670 0.0135  0.0077  0.0823  343 TYR B OH  
4602 N N   . THR B 275 ? 0.4041 0.3178 0.3894 -0.0025 0.0229  0.0399  344 THR B N   
4603 C CA  . THR B 275 ? 0.3780 0.2837 0.3573 -0.0065 0.0257  0.0330  344 THR B CA  
4604 C C   . THR B 275 ? 0.4295 0.3395 0.4027 -0.0126 0.0215  0.0327  344 THR B C   
4605 O O   . THR B 275 ? 0.3904 0.3008 0.3598 -0.0178 0.0180  0.0370  344 THR B O   
4606 C CB  . THR B 275 ? 0.3537 0.2407 0.3261 -0.0116 0.0306  0.0299  344 THR B CB  
4607 O OG1 . THR B 275 ? 0.4740 0.3565 0.4528 -0.0055 0.0344  0.0313  344 THR B OG1 
4608 C CG2 . THR B 275 ? 0.3049 0.1839 0.2715 -0.0149 0.0347  0.0223  344 THR B CG2 
4609 N N   . LEU B 276 ? 0.3656 0.2792 0.3382 -0.0119 0.0217  0.0282  345 LEU B N   
4610 C CA  . LEU B 276 ? 0.3024 0.2178 0.2687 -0.0176 0.0183  0.0272  345 LEU B CA  
4611 C C   . LEU B 276 ? 0.4152 0.3179 0.3731 -0.0239 0.0219  0.0208  345 LEU B C   
4612 O O   . LEU B 276 ? 0.4729 0.3728 0.4329 -0.0207 0.0265  0.0160  345 LEU B O   
4613 C CB  . LEU B 276 ? 0.3328 0.2615 0.3038 -0.0123 0.0154  0.0272  345 LEU B CB  
4614 C CG  . LEU B 276 ? 0.3600 0.3017 0.3373 -0.0067 0.0117  0.0330  345 LEU B CG  
4615 C CD1 . LEU B 276 ? 0.2564 0.2073 0.2346 -0.0036 0.0090  0.0318  345 LEU B CD1 
4616 C CD2 . LEU B 276 ? 0.5131 0.4555 0.4884 -0.0112 0.0087  0.0387  345 LEU B CD2 
4617 N N   . THR B 277 ? 0.4256 0.3212 0.3740 -0.0331 0.0198  0.0211  346 THR B N   
4618 C CA  . THR B 277 ? 0.3474 0.2310 0.2857 -0.0403 0.0228  0.0152  346 THR B CA  
4619 C C   . THR B 277 ? 0.3756 0.2659 0.3122 -0.0417 0.0195  0.0136  346 THR B C   
4620 O O   . THR B 277 ? 0.3688 0.2711 0.3102 -0.0386 0.0144  0.0177  346 THR B O   
4621 C CB  . THR B 277 ? 0.4100 0.2813 0.3372 -0.0508 0.0218  0.0162  346 THR B CB  
4622 O OG1 . THR B 277 ? 0.4410 0.3209 0.3678 -0.0548 0.0146  0.0222  346 THR B OG1 
4623 C CG2 . THR B 277 ? 0.4157 0.2782 0.3435 -0.0500 0.0250  0.0178  346 THR B CG2 
4624 N N   . SER B 278 ? 0.4388 0.3204 0.3678 -0.0465 0.0229  0.0076  347 SER B N   
4625 C CA  . SER B 278 ? 0.4735 0.3597 0.3998 -0.0485 0.0201  0.0059  347 SER B CA  
4626 C C   . SER B 278 ? 0.5390 0.4309 0.4630 -0.0527 0.0125  0.0114  347 SER B C   
4627 O O   . SER B 278 ? 0.5887 0.4902 0.5165 -0.0492 0.0087  0.0130  347 SER B O   
4628 C CB  . SER B 278 ? 0.4537 0.3277 0.3695 -0.0556 0.0246  -0.0006 347 SER B CB  
4629 O OG  . SER B 278 ? 0.6176 0.4778 0.5235 -0.0636 0.0267  -0.0015 347 SER B OG  
4630 N N   . ALA B 279 ? 0.4547 0.3408 0.3728 -0.0599 0.0103  0.0147  348 ALA B N   
4631 C CA  . ALA B 279 ? 0.4201 0.3139 0.3384 -0.0631 0.0030  0.0214  348 ALA B CA  
4632 C C   . ALA B 279 ? 0.3782 0.2872 0.3088 -0.0535 0.0003  0.0265  348 ALA B C   
4633 O O   . ALA B 279 ? 0.4328 0.3510 0.3662 -0.0524 -0.0047 0.0303  348 ALA B O   
4634 C CB  . ALA B 279 ? 0.2859 0.1722 0.1972 -0.0724 0.0011  0.0248  348 ALA B CB  
4635 N N   . ASP B 280 ? 0.2523 0.1639 0.1901 -0.0464 0.0036  0.0266  349 ASP B N   
4636 C CA  . ASP B 280 ? 0.3270 0.2525 0.2749 -0.0379 0.0013  0.0314  349 ASP B CA  
4637 C C   . ASP B 280 ? 0.3511 0.2841 0.3030 -0.0310 0.0009  0.0290  349 ASP B C   
4638 O O   . ASP B 280 ? 0.3338 0.2775 0.2910 -0.0260 -0.0022 0.0328  349 ASP B O   
4639 C CB  . ASP B 280 ? 0.2154 0.1412 0.1691 -0.0326 0.0046  0.0326  349 ASP B CB  
4640 C CG  . ASP B 280 ? 0.4516 0.3709 0.4019 -0.0388 0.0042  0.0362  349 ASP B CG  
4641 O OD1 . ASP B 280 ? 0.4999 0.4217 0.4476 -0.0448 -0.0002 0.0408  349 ASP B OD1 
4642 O OD2 . ASP B 280 ? 0.4871 0.3987 0.4376 -0.0377 0.0083  0.0348  349 ASP B OD2 
4643 N N   . TYR B 281 ? 0.3205 0.2480 0.2699 -0.0308 0.0043  0.0227  350 TYR B N   
4644 C CA  . TYR B 281 ? 0.3233 0.2575 0.2766 -0.0244 0.0042  0.0203  350 TYR B CA  
4645 C C   . TYR B 281 ? 0.2863 0.2167 0.2333 -0.0287 0.0031  0.0165  350 TYR B C   
4646 O O   . TYR B 281 ? 0.3794 0.3140 0.3284 -0.0244 0.0029  0.0142  350 TYR B O   
4647 C CB  . TYR B 281 ? 0.3423 0.2774 0.3013 -0.0184 0.0087  0.0174  350 TYR B CB  
4648 C CG  . TYR B 281 ? 0.3734 0.2985 0.3292 -0.0216 0.0141  0.0119  350 TYR B CG  
4649 C CD1 . TYR B 281 ? 0.3110 0.2335 0.2631 -0.0239 0.0156  0.0068  350 TYR B CD1 
4650 C CD2 . TYR B 281 ? 0.3401 0.2584 0.2967 -0.0219 0.0183  0.0118  350 TYR B CD2 
4651 C CE1 . TYR B 281 ? 0.2750 0.1894 0.2248 -0.0264 0.0214  0.0018  350 TYR B CE1 
4652 C CE2 . TYR B 281 ? 0.3205 0.2295 0.2747 -0.0239 0.0242  0.0065  350 TYR B CE2 
4653 C CZ  . TYR B 281 ? 0.3654 0.2730 0.3164 -0.0261 0.0260  0.0015  350 TYR B CZ  
4654 O OH  . TYR B 281 ? 0.3857 0.2848 0.3345 -0.0279 0.0327  -0.0038 350 TYR B OH  
4655 N N   . VAL B 282 ? 0.3683 0.2906 0.3068 -0.0375 0.0020  0.0161  351 VAL B N   
4656 C CA  . VAL B 282 ? 0.3084 0.2272 0.2402 -0.0423 0.0001  0.0136  351 VAL B CA  
4657 C C   . VAL B 282 ? 0.4028 0.3247 0.3328 -0.0457 -0.0062 0.0192  351 VAL B C   
4658 O O   . VAL B 282 ? 0.4823 0.4040 0.4117 -0.0495 -0.0082 0.0236  351 VAL B O   
4659 C CB  . VAL B 282 ? 0.3607 0.2673 0.2833 -0.0505 0.0041  0.0083  351 VAL B CB  
4660 C CG1 . VAL B 282 ? 0.3275 0.2309 0.2427 -0.0559 0.0019  0.0061  351 VAL B CG1 
4661 C CG2 . VAL B 282 ? 0.2868 0.1915 0.2132 -0.0462 0.0109  0.0033  351 VAL B CG2 
4662 N N   . PHE B 283 ? 0.4145 0.3396 0.3441 -0.0441 -0.0095 0.0195  352 PHE B N   
4663 C CA  . PHE B 283 ? 0.3770 0.3045 0.3051 -0.0471 -0.0155 0.0248  352 PHE B CA  
4664 C C   . PHE B 283 ? 0.4419 0.3595 0.3591 -0.0582 -0.0168 0.0233  352 PHE B C   
4665 O O   . PHE B 283 ? 0.4417 0.3551 0.3537 -0.0605 -0.0173 0.0201  352 PHE B O   
4666 C CB  . PHE B 283 ? 0.3592 0.2925 0.2908 -0.0404 -0.0181 0.0256  352 PHE B CB  
4667 C CG  . PHE B 283 ? 0.3659 0.3091 0.3068 -0.0302 -0.0177 0.0282  352 PHE B CG  
4668 C CD1 . PHE B 283 ? 0.2869 0.2378 0.2335 -0.0281 -0.0202 0.0349  352 PHE B CD1 
4669 C CD2 . PHE B 283 ? 0.4565 0.4018 0.3999 -0.0233 -0.0149 0.0242  352 PHE B CD2 
4670 C CE1 . PHE B 283 ? 0.4073 0.3673 0.3614 -0.0190 -0.0192 0.0371  352 PHE B CE1 
4671 C CE2 . PHE B 283 ? 0.3416 0.2953 0.2918 -0.0147 -0.0145 0.0265  352 PHE B CE2 
4672 C CZ  . PHE B 283 ? 0.4202 0.3810 0.3755 -0.0124 -0.0164 0.0327  352 PHE B CZ  
4673 N N   . GLN B 284 ? 0.4190 0.3322 0.3317 -0.0659 -0.0176 0.0256  353 GLN B N   
4674 C CA  . GLN B 284 ? 0.3067 0.2094 0.2071 -0.0776 -0.0187 0.0240  353 GLN B CA  
4675 C C   . GLN B 284 ? 0.4517 0.3579 0.3507 -0.0818 -0.0264 0.0305  353 GLN B C   
4676 O O   . GLN B 284 ? 0.5364 0.4427 0.4328 -0.0888 -0.0305 0.0359  353 GLN B O   
4677 C CB  . GLN B 284 ? 0.4222 0.3167 0.3164 -0.0849 -0.0160 0.0230  353 GLN B CB  
4678 C CG  . GLN B 284 ? 0.3425 0.2317 0.2376 -0.0811 -0.0079 0.0165  353 GLN B CG  
4679 C CD  . GLN B 284 ? 0.3308 0.2096 0.2166 -0.0857 -0.0028 0.0089  353 GLN B CD  
4680 O OE1 . GLN B 284 ? 0.4457 0.3189 0.3313 -0.0839 0.0042  0.0036  353 GLN B OE1 
4681 N NE2 . GLN B 284 ? 0.3488 0.2254 0.2276 -0.0914 -0.0061 0.0086  353 GLN B NE2 
4682 N N   . GLU B 285 ? 0.6303 0.5395 0.5312 -0.0775 -0.0285 0.0304  354 GLU B N   
4683 C CA  . GLU B 285 ? 0.6259 0.5362 0.5245 -0.0815 -0.0355 0.0359  354 GLU B CA  
4684 C C   . GLU B 285 ? 0.5475 0.4474 0.4325 -0.0951 -0.0374 0.0351  354 GLU B C   
4685 O O   . GLU B 285 ? 0.6118 0.5128 0.4943 -0.1009 -0.0441 0.0414  354 GLU B O   
4686 C CB  . GLU B 285 ? 0.6967 0.6087 0.5978 -0.0747 -0.0363 0.0343  354 GLU B CB  
4687 C CG  . GLU B 285 ? 0.9953 0.8981 0.8877 -0.0782 -0.0323 0.0264  354 GLU B CG  
4688 C CD  . GLU B 285 ? 1.1468 1.0507 1.0415 -0.0715 -0.0327 0.0244  354 GLU B CD  
4689 O OE1 . GLU B 285 ? 1.1732 1.0842 1.0760 -0.0631 -0.0353 0.0283  354 GLU B OE1 
4690 O OE2 . GLU B 285 ? 1.1381 1.0355 1.0261 -0.0749 -0.0301 0.0187  354 GLU B OE2 
4691 N N   . SER B 286 ? 0.4805 0.3705 0.3567 -0.1001 -0.0315 0.0277  355 SER B N   
4692 C CA  . SER B 286 ? 0.5322 0.4172 0.3965 -0.1074 -0.0313 0.0242  355 SER B CA  
4693 C C   . SER B 286 ? 0.6140 0.4927 0.4736 -0.1076 -0.0227 0.0165  355 SER B C   
4694 O O   . SER B 286 ? 0.5469 0.4243 0.4124 -0.1029 -0.0177 0.0137  355 SER B O   
4695 C CB  . SER B 286 ? 0.4787 0.3621 0.3378 -0.1084 -0.0332 0.0229  355 SER B CB  
4696 O OG  . SER B 286 ? 0.5077 0.3858 0.3559 -0.1122 -0.0284 0.0170  355 SER B OG  
4697 N N   . TYR B 287 ? 0.5896 0.4637 0.4379 -0.1133 -0.0211 0.0138  356 TYR B N   
4698 C CA  . TYR B 287 ? 0.4084 0.2753 0.2511 -0.1138 -0.0123 0.0065  356 TYR B CA  
4699 C C   . TYR B 287 ? 0.4512 0.3143 0.2845 -0.1165 -0.0087 0.0022  356 TYR B C   
4700 O O   . TYR B 287 ? 0.5575 0.4143 0.3839 -0.1186 -0.0016 -0.0032 356 TYR B O   
4701 C CB  . TYR B 287 ? 0.3096 0.1725 0.1462 -0.1182 -0.0118 0.0070  356 TYR B CB  
4702 C CG  . TYR B 287 ? 0.4250 0.2912 0.2713 -0.1154 -0.0137 0.0109  356 TYR B CG  
4703 C CD1 . TYR B 287 ? 0.5446 0.4076 0.3970 -0.1106 -0.0073 0.0076  356 TYR B CD1 
4704 C CD2 . TYR B 287 ? 0.3647 0.2381 0.2147 -0.1174 -0.0219 0.0187  356 TYR B CD2 
4705 C CE1 . TYR B 287 ? 0.4708 0.3369 0.3315 -0.1080 -0.0090 0.0121  356 TYR B CE1 
4706 C CE2 . TYR B 287 ? 0.3317 0.2094 0.1909 -0.1149 -0.0234 0.0231  356 TYR B CE2 
4707 C CZ  . TYR B 287 ? 0.4308 0.3047 0.2949 -0.1102 -0.0169 0.0199  356 TYR B CZ  
4708 O OH  . TYR B 287 ? 0.5880 0.4664 0.4606 -0.1078 -0.0182 0.0251  356 TYR B OH  
4709 N N   . SER B 288 ? 0.4857 0.3522 0.3186 -0.1167 -0.0132 0.0046  357 SER B N   
4710 C CA  . SER B 288 ? 0.4477 0.3113 0.2715 -0.1199 -0.0103 0.0016  357 SER B CA  
4711 C C   . SER B 288 ? 0.5568 0.4194 0.3848 -0.1159 -0.0024 -0.0047 357 SER B C   
4712 O O   . SER B 288 ? 0.4769 0.3429 0.3153 -0.1100 -0.0024 -0.0053 357 SER B O   
4713 C CB  . SER B 288 ? 0.4880 0.3550 0.3105 -0.1213 -0.0180 0.0068  357 SER B CB  
4714 O OG  . SER B 288 ? 0.6081 0.4729 0.4243 -0.1230 -0.0147 0.0040  357 SER B OG  
4715 N N   . SER B 289 ? 0.5499 0.4078 0.3692 -0.1195 0.0042  -0.0092 358 SER B N   
4716 C CA  . SER B 289 ? 0.4104 0.2681 0.2327 -0.1171 0.0114  -0.0148 358 SER B CA  
4717 C C   . SER B 289 ? 0.4862 0.3483 0.3104 -0.1162 0.0080  -0.0133 358 SER B C   
4718 O O   . SER B 289 ? 0.4853 0.3484 0.3120 -0.1149 0.0132  -0.0174 358 SER B O   
4719 C CB  . SER B 289 ? 0.5749 0.4260 0.3865 -0.1223 0.0196  -0.0195 358 SER B CB  
4720 O OG  . SER B 289 ? 0.7449 0.5944 0.5446 -0.1287 0.0172  -0.0172 358 SER B OG  
4721 N N   . LYS B 290 ? 0.5895 0.4540 0.4126 -0.1170 -0.0006 -0.0074 359 LYS B N   
4722 C CA  . LYS B 290 ? 0.6650 0.5322 0.4893 -0.1162 -0.0044 -0.0054 359 LYS B CA  
4723 C C   . LYS B 290 ? 0.5737 0.4447 0.4082 -0.1104 -0.0103 -0.0024 359 LYS B C   
4724 O O   . LYS B 290 ? 0.5644 0.4362 0.3988 -0.1100 -0.0155 0.0008  359 LYS B O   
4725 C CB  . LYS B 290 ? 0.7883 0.6533 0.6013 -0.1225 -0.0091 -0.0010 359 LYS B CB  
4726 C CG  . LYS B 290 ? 0.7985 0.6592 0.6000 -0.1285 -0.0028 -0.0044 359 LYS B CG  
4727 C CD  . LYS B 290 ? 0.8642 0.7208 0.6525 -0.1357 -0.0062 -0.0007 359 LYS B CD  
4728 C CE  . LYS B 290 ? 0.9379 0.7908 0.7137 -0.1423 -0.0029 -0.0016 359 LYS B CE  
4729 N NZ  . LYS B 290 ? 0.9550 0.8063 0.7210 -0.1476 -0.0110 0.0050  359 LYS B NZ  
4730 N N   . LYS B 291 ? 0.6100 0.4824 0.4526 -0.1063 -0.0095 -0.0031 360 LYS B N   
4731 C CA  . LYS B 291 ? 0.4862 0.3613 0.3375 -0.1012 -0.0146 -0.0002 360 LYS B CA  
4732 C C   . LYS B 291 ? 0.4541 0.3300 0.3137 -0.0961 -0.0097 -0.0044 360 LYS B C   
4733 O O   . LYS B 291 ? 0.5466 0.4209 0.4063 -0.0964 -0.0034 -0.0081 360 LYS B O   
4734 C CB  . LYS B 291 ? 0.4024 0.2784 0.2545 -0.1025 -0.0218 0.0065  360 LYS B CB  
4735 C CG  . LYS B 291 ? 0.4895 0.3651 0.3355 -0.1065 -0.0287 0.0118  360 LYS B CG  
4736 C CD  . LYS B 291 ? 0.5841 0.4611 0.4282 -0.1105 -0.0343 0.0177  360 LYS B CD  
4737 C CE  . LYS B 291 ? 0.7307 0.6088 0.5745 -0.1121 -0.0434 0.0248  360 LYS B CE  
4738 N NZ  . LYS B 291 ? 0.7825 0.6616 0.6362 -0.1063 -0.0470 0.0278  360 LYS B NZ  
4739 N N   . LEU B 292 ? 0.4461 0.3236 0.3119 -0.0914 -0.0129 -0.0036 361 LEU B N   
4740 C CA  . LEU B 292 ? 0.5169 0.4016 0.3937 -0.0816 -0.0085 -0.0059 361 LEU B CA  
4741 C C   . LEU B 292 ? 0.4539 0.3451 0.3392 -0.0745 -0.0114 -0.0008 361 LEU B C   
4742 O O   . LEU B 292 ? 0.5448 0.4386 0.4318 -0.0723 -0.0174 0.0044  361 LEU B O   
4743 C CB  . LEU B 292 ? 0.4628 0.3515 0.3432 -0.0765 -0.0088 -0.0080 361 LEU B CB  
4744 C CG  . LEU B 292 ? 0.5763 0.4604 0.4497 -0.0832 -0.0054 -0.0129 361 LEU B CG  
4745 C CD1 . LEU B 292 ? 0.5318 0.4209 0.4100 -0.0780 -0.0056 -0.0148 361 LEU B CD1 
4746 C CD2 . LEU B 292 ? 0.5423 0.4240 0.4144 -0.0867 0.0025  -0.0176 361 LEU B CD2 
4747 N N   . CYS B 293 ? 0.4124 0.3061 0.3033 -0.0708 -0.0069 -0.0019 362 CYS B N   
4748 C CA  . CYS B 293 ? 0.3896 0.2895 0.2883 -0.0649 -0.0089 0.0029  362 CYS B CA  
4749 C C   . CYS B 293 ? 0.4013 0.3094 0.3105 -0.0544 -0.0064 0.0019  362 CYS B C   
4750 O O   . CYS B 293 ? 0.3810 0.2891 0.2926 -0.0527 -0.0010 -0.0026 362 CYS B O   
4751 C CB  . CYS B 293 ? 0.4705 0.3655 0.3660 -0.0702 -0.0066 0.0034  362 CYS B CB  
4752 S SG  . CYS B 293 ? 0.6999 0.5892 0.5855 -0.0814 -0.0129 0.0086  362 CYS B SG  
4753 N N   . THR B 294 ? 0.4334 0.3486 0.3488 -0.0475 -0.0102 0.0062  363 THR B N   
4754 C CA  . THR B 294 ? 0.3697 0.2925 0.2935 -0.0381 -0.0087 0.0057  363 THR B CA  
4755 C C   . THR B 294 ? 0.3965 0.3228 0.3265 -0.0346 -0.0052 0.0067  363 THR B C   
4756 O O   . THR B 294 ? 0.4278 0.3537 0.3579 -0.0369 -0.0063 0.0104  363 THR B O   
4757 C CB  . THR B 294 ? 0.3141 0.2421 0.2408 -0.0321 -0.0133 0.0099  363 THR B CB  
4758 O OG1 . THR B 294 ? 0.3946 0.3181 0.3154 -0.0346 -0.0163 0.0088  363 THR B OG1 
4759 C CG2 . THR B 294 ? 0.3317 0.2670 0.2654 -0.0230 -0.0118 0.0094  363 THR B CG2 
4760 N N   . LEU B 295 ? 0.3119 0.2419 0.2473 -0.0295 -0.0015 0.0039  364 LEU B N   
4761 C CA  . LEU B 295 ? 0.3678 0.3019 0.3103 -0.0247 0.0012  0.0055  364 LEU B CA  
4762 C C   . LEU B 295 ? 0.3651 0.3082 0.3136 -0.0167 -0.0014 0.0091  364 LEU B C   
4763 O O   . LEU B 295 ? 0.4739 0.4203 0.4227 -0.0130 -0.0030 0.0080  364 LEU B O   
4764 C CB  . LEU B 295 ? 0.2824 0.2164 0.2285 -0.0231 0.0065  0.0012  364 LEU B CB  
4765 C CG  . LEU B 295 ? 0.3057 0.2316 0.2488 -0.0284 0.0117  -0.0019 364 LEU B CG  
4766 C CD1 . LEU B 295 ? 0.4485 0.3658 0.3812 -0.0374 0.0111  -0.0041 364 LEU B CD1 
4767 C CD2 . LEU B 295 ? 0.3786 0.3068 0.3272 -0.0252 0.0168  -0.0056 364 LEU B CD2 
4768 N N   . ALA B 296 ? 0.3056 0.2522 0.2582 -0.0144 -0.0017 0.0135  365 ALA B N   
4769 C CA  . ALA B 296 ? 0.3476 0.3029 0.3052 -0.0071 -0.0036 0.0172  365 ALA B CA  
4770 C C   . ALA B 296 ? 0.4276 0.3879 0.3907 -0.0012 -0.0011 0.0160  365 ALA B C   
4771 O O   . ALA B 296 ? 0.4206 0.3865 0.3886 0.0031  -0.0008 0.0196  365 ALA B O   
4772 C CB  . ALA B 296 ? 0.1802 0.1384 0.1402 -0.0076 -0.0051 0.0229  365 ALA B CB  
4773 N N   . ILE B 297 ? 0.3504 0.3094 0.3129 -0.0013 0.0004  0.0116  366 ILE B N   
4774 C CA  . ILE B 297 ? 0.3466 0.3111 0.3144 0.0037  0.0021  0.0107  366 ILE B CA  
4775 C C   . ILE B 297 ? 0.3763 0.3414 0.3412 0.0037  0.0007  0.0072  366 ILE B C   
4776 O O   . ILE B 297 ? 0.4630 0.4224 0.4227 -0.0013 0.0005  0.0042  366 ILE B O   
4777 C CB  . ILE B 297 ? 0.3076 0.2700 0.2798 0.0027  0.0064  0.0094  366 ILE B CB  
4778 C CG1 . ILE B 297 ? 0.2981 0.2565 0.2707 0.0008  0.0077  0.0123  366 ILE B CG1 
4779 C CG2 . ILE B 297 ? 0.2483 0.2181 0.2276 0.0084  0.0073  0.0101  366 ILE B CG2 
4780 C CD1 . ILE B 297 ? 0.2701 0.2212 0.2430 -0.0026 0.0125  0.0096  366 ILE B CD1 
4781 N N   . HIS B 298 ? 0.3244 0.2958 0.2916 0.0086  -0.0004 0.0076  367 HIS B N   
4782 C CA  . HIS B 298 ? 0.4082 0.3800 0.3725 0.0079  -0.0017 0.0043  367 HIS B CA  
4783 C C   . HIS B 298 ? 0.3449 0.3245 0.3137 0.0125  -0.0021 0.0053  367 HIS B C   
4784 O O   . HIS B 298 ? 0.3300 0.3142 0.3034 0.0165  -0.0015 0.0088  367 HIS B O   
4785 C CB  . HIS B 298 ? 0.4800 0.4476 0.4365 0.0072  -0.0050 0.0035  367 HIS B CB  
4786 C CG  . HIS B 298 ? 0.7109 0.6822 0.6662 0.0130  -0.0070 0.0057  367 HIS B CG  
4787 N ND1 . HIS B 298 ? 0.8249 0.7938 0.7737 0.0141  -0.0093 0.0038  367 HIS B ND1 
4788 C CD2 . HIS B 298 ? 0.7940 0.7706 0.7529 0.0177  -0.0065 0.0095  367 HIS B CD2 
4789 C CE1 . HIS B 298 ? 0.8103 0.7827 0.7585 0.0196  -0.0098 0.0060  367 HIS B CE1 
4790 N NE2 . HIS B 298 ? 0.7335 0.7113 0.6881 0.0217  -0.0081 0.0096  367 HIS B NE2 
4791 N N   . ALA B 299 ? 0.2989 0.2799 0.2660 0.0113  -0.0034 0.0027  368 ALA B N   
4792 C CA  . ALA B 299 ? 0.2909 0.2797 0.2618 0.0143  -0.0044 0.0038  368 ALA B CA  
4793 C C   . ALA B 299 ? 0.3232 0.3127 0.2876 0.0175  -0.0076 0.0047  368 ALA B C   
4794 O O   . ALA B 299 ? 0.3932 0.3769 0.3495 0.0162  -0.0094 0.0026  368 ALA B O   
4795 C CB  . ALA B 299 ? 0.2817 0.2727 0.2540 0.0108  -0.0045 0.0011  368 ALA B CB  
4796 N N   . MET B 300 ? 0.3085 0.3048 0.2762 0.0216  -0.0081 0.0078  369 MET B N   
4797 C CA  . MET B 300 ? 0.4315 0.4289 0.3923 0.0242  -0.0106 0.0082  369 MET B CA  
4798 C C   . MET B 300 ? 0.4134 0.4194 0.3783 0.0260  -0.0119 0.0108  369 MET B C   
4799 O O   . MET B 300 ? 0.4480 0.4591 0.4199 0.0287  -0.0106 0.0147  369 MET B O   
4800 C CB  . MET B 300 ? 0.3043 0.3001 0.2623 0.0281  -0.0098 0.0105  369 MET B CB  
4801 C CG  . MET B 300 ? 0.2499 0.2462 0.2000 0.0312  -0.0113 0.0104  369 MET B CG  
4802 S SD  . MET B 300 ? 0.4393 0.4338 0.3866 0.0358  -0.0096 0.0126  369 MET B SD  
4803 C CE  . MET B 300 ? 0.4930 0.4778 0.4364 0.0329  -0.0100 0.0094  369 MET B CE  
4804 N N   . ASP B 301 ? 0.4112 0.4184 0.3713 0.0238  -0.0147 0.0090  370 ASP B N   
4805 C CA  . ASP B 301 ? 0.3460 0.3618 0.3088 0.0246  -0.0170 0.0119  370 ASP B CA  
4806 C C   . ASP B 301 ? 0.3866 0.4020 0.3407 0.0277  -0.0183 0.0131  370 ASP B C   
4807 O O   . ASP B 301 ? 0.4649 0.4757 0.4078 0.0264  -0.0203 0.0102  370 ASP B O   
4808 C CB  . ASP B 301 ? 0.2695 0.2875 0.2311 0.0199  -0.0198 0.0098  370 ASP B CB  
4809 C CG  . ASP B 301 ? 0.3893 0.4110 0.3621 0.0177  -0.0178 0.0098  370 ASP B CG  
4810 O OD1 . ASP B 301 ? 0.5407 0.5587 0.5110 0.0133  -0.0179 0.0062  370 ASP B OD1 
4811 O OD2 . ASP B 301 ? 0.4530 0.4805 0.4368 0.0206  -0.0156 0.0133  370 ASP B OD2 
4812 N N   . ILE B 302 ? 0.4724 0.4920 0.4312 0.0316  -0.0167 0.0172  371 ILE B N   
4813 C CA  . ILE B 302 ? 0.4646 0.4848 0.4158 0.0348  -0.0170 0.0189  371 ILE B CA  
4814 C C   . ILE B 302 ? 0.3429 0.3694 0.2915 0.0336  -0.0205 0.0209  371 ILE B C   
4815 O O   . ILE B 302 ? 0.3803 0.4146 0.3386 0.0331  -0.0217 0.0246  371 ILE B O   
4816 C CB  . ILE B 302 ? 0.3966 0.4196 0.3540 0.0385  -0.0142 0.0232  371 ILE B CB  
4817 C CG1 . ILE B 302 ? 0.3126 0.3295 0.2717 0.0386  -0.0115 0.0215  371 ILE B CG1 
4818 C CG2 . ILE B 302 ? 0.2046 0.2299 0.1548 0.0416  -0.0141 0.0253  371 ILE B CG2 
4819 C CD1 . ILE B 302 ? 0.3839 0.4033 0.3487 0.0413  -0.0091 0.0259  371 ILE B CD1 
4820 N N   . PRO B 303 ? 0.3862 0.4093 0.3217 0.0329  -0.0222 0.0187  372 PRO B N   
4821 C CA  . PRO B 303 ? 0.4851 0.5136 0.4163 0.0304  -0.0262 0.0205  372 PRO B CA  
4822 C C   . PRO B 303 ? 0.5387 0.5754 0.4740 0.0333  -0.0263 0.0265  372 PRO B C   
4823 O O   . PRO B 303 ? 0.5733 0.6096 0.5104 0.0373  -0.0229 0.0284  372 PRO B O   
4824 C CB  . PRO B 303 ? 0.4927 0.5124 0.4063 0.0291  -0.0270 0.0157  372 PRO B CB  
4825 C CG  . PRO B 303 ? 0.4841 0.4968 0.3949 0.0337  -0.0223 0.0137  372 PRO B CG  
4826 C CD  . PRO B 303 ? 0.3945 0.4079 0.3181 0.0343  -0.0204 0.0144  372 PRO B CD  
4827 N N   . PRO B 304 ? 0.6013 0.6460 0.5387 0.0310  -0.0304 0.0303  373 PRO B N   
4828 C CA  . PRO B 304 ? 0.5567 0.6082 0.4945 0.0330  -0.0313 0.0362  373 PRO B CA  
4829 C C   . PRO B 304 ? 0.5805 0.6272 0.5015 0.0334  -0.0306 0.0342  373 PRO B C   
4830 O O   . PRO B 304 ? 0.5646 0.6027 0.4732 0.0317  -0.0303 0.0283  373 PRO B O   
4831 C CB  . PRO B 304 ? 0.5612 0.6221 0.5048 0.0295  -0.0367 0.0405  373 PRO B CB  
4832 C CG  . PRO B 304 ? 0.5807 0.6385 0.5211 0.0248  -0.0389 0.0357  373 PRO B CG  
4833 C CD  . PRO B 304 ? 0.5894 0.6387 0.5315 0.0264  -0.0344 0.0304  373 PRO B CD  
4834 N N   . PRO B 305 ? 0.5730 0.6243 0.4925 0.0356  -0.0300 0.0389  374 PRO B N   
4835 C CA  . PRO B 305 ? 0.5265 0.5867 0.4585 0.0376  -0.0305 0.0464  374 PRO B CA  
4836 C C   . PRO B 305 ? 0.5690 0.6283 0.5139 0.0414  -0.0264 0.0475  374 PRO B C   
4837 O O   . PRO B 305 ? 0.6213 0.6860 0.5789 0.0424  -0.0271 0.0527  374 PRO B O   
4838 C CB  . PRO B 305 ? 0.3586 0.4206 0.2799 0.0385  -0.0300 0.0493  374 PRO B CB  
4839 C CG  . PRO B 305 ? 0.4097 0.4627 0.3177 0.0398  -0.0259 0.0429  374 PRO B CG  
4840 C CD  . PRO B 305 ? 0.4922 0.5387 0.3955 0.0366  -0.0278 0.0367  374 PRO B CD  
4841 N N   . THR B 306 ? 0.4980 0.5502 0.4395 0.0432  -0.0222 0.0430  375 THR B N   
4842 C CA  . THR B 306 ? 0.5150 0.5660 0.4670 0.0458  -0.0187 0.0443  375 THR B CA  
4843 C C   . THR B 306 ? 0.4694 0.5201 0.4332 0.0444  -0.0192 0.0436  375 THR B C   
4844 O O   . THR B 306 ? 0.4639 0.5165 0.4387 0.0458  -0.0179 0.0472  375 THR B O   
4845 C CB  . THR B 306 ? 0.5864 0.6308 0.5325 0.0476  -0.0148 0.0402  375 THR B CB  
4846 O OG1 . THR B 306 ? 0.6762 0.7202 0.6099 0.0490  -0.0137 0.0395  375 THR B OG1 
4847 C CG2 . THR B 306 ? 0.4362 0.4813 0.3914 0.0497  -0.0117 0.0433  375 THR B CG2 
4848 N N   . GLY B 307 ? 0.4859 0.5335 0.4469 0.0416  -0.0208 0.0388  376 GLY B N   
4849 C CA  . GLY B 307 ? 0.3743 0.4219 0.3456 0.0401  -0.0207 0.0377  376 GLY B CA  
4850 C C   . GLY B 307 ? 0.3967 0.4525 0.3749 0.0385  -0.0244 0.0412  376 GLY B C   
4851 O O   . GLY B 307 ? 0.5205 0.5817 0.4944 0.0379  -0.0278 0.0445  376 GLY B O   
4852 N N   . PRO B 308 ? 0.4818 0.5391 0.4710 0.0377  -0.0237 0.0408  377 PRO B N   
4853 C CA  . PRO B 308 ? 0.4383 0.4891 0.4321 0.0377  -0.0196 0.0370  377 PRO B CA  
4854 C C   . PRO B 308 ? 0.5151 0.5636 0.5149 0.0410  -0.0160 0.0399  377 PRO B C   
4855 O O   . PRO B 308 ? 0.5280 0.5816 0.5346 0.0434  -0.0165 0.0455  377 PRO B O   
4856 C CB  . PRO B 308 ? 0.3901 0.4457 0.3945 0.0360  -0.0199 0.0370  377 PRO B CB  
4857 C CG  . PRO B 308 ? 0.3879 0.4527 0.3923 0.0345  -0.0250 0.0405  377 PRO B CG  
4858 C CD  . PRO B 308 ? 0.4423 0.5089 0.4410 0.0367  -0.0268 0.0446  377 PRO B CD  
4859 N N   . THR B 309 ? 0.4118 0.4526 0.4088 0.0407  -0.0128 0.0366  378 THR B N   
4860 C CA  . THR B 309 ? 0.2769 0.3150 0.2781 0.0427  -0.0099 0.0394  378 THR B CA  
4861 C C   . THR B 309 ? 0.2405 0.2704 0.2408 0.0407  -0.0068 0.0352  378 THR B C   
4862 O O   . THR B 309 ? 0.4364 0.4625 0.4304 0.0384  -0.0073 0.0305  378 THR B O   
4863 C CB  . THR B 309 ? 0.2621 0.3018 0.2567 0.0447  -0.0105 0.0424  378 THR B CB  
4864 O OG1 . THR B 309 ? 0.3452 0.3831 0.3445 0.0460  -0.0081 0.0460  378 THR B OG1 
4865 C CG2 . THR B 309 ? 0.1688 0.2044 0.1527 0.0440  -0.0103 0.0381  378 THR B CG2 
4866 N N   . TRP B 310 ? 0.2439 0.2703 0.2498 0.0411  -0.0040 0.0370  379 TRP B N   
4867 C CA  . TRP B 310 ? 0.2979 0.3166 0.3007 0.0388  -0.0017 0.0343  379 TRP B CA  
4868 C C   . TRP B 310 ? 0.3173 0.3365 0.3138 0.0397  -0.0025 0.0360  379 TRP B C   
4869 O O   . TRP B 310 ? 0.2772 0.3018 0.2727 0.0423  -0.0037 0.0398  379 TRP B O   
4870 C CB  . TRP B 310 ? 0.2306 0.2443 0.2398 0.0381  0.0015  0.0357  379 TRP B CB  
4871 C CG  . TRP B 310 ? 0.3510 0.3632 0.3668 0.0375  0.0037  0.0335  379 TRP B CG  
4872 C CD1 . TRP B 310 ? 0.4037 0.4219 0.4275 0.0403  0.0034  0.0359  379 TRP B CD1 
4873 C CD2 . TRP B 310 ? 0.3662 0.3710 0.3817 0.0341  0.0068  0.0289  379 TRP B CD2 
4874 N NE1 . TRP B 310 ? 0.4215 0.4370 0.4508 0.0393  0.0066  0.0330  379 TRP B NE1 
4875 C CE2 . TRP B 310 ? 0.3993 0.4061 0.4230 0.0353  0.0090  0.0284  379 TRP B CE2 
4876 C CE3 . TRP B 310 ? 0.2906 0.2876 0.2996 0.0298  0.0080  0.0255  379 TRP B CE3 
4877 C CZ2 . TRP B 310 ? 0.4155 0.4165 0.4405 0.0326  0.0130  0.0240  379 TRP B CZ2 
4878 C CZ3 . TRP B 310 ? 0.3008 0.2914 0.3101 0.0265  0.0113  0.0213  379 TRP B CZ3 
4879 C CH2 . TRP B 310 ? 0.4024 0.3949 0.4194 0.0280  0.0142  0.0203  379 TRP B CH2 
4880 N N   . ALA B 311 ? 0.1860 0.1998 0.1784 0.0375  -0.0017 0.0335  380 ALA B N   
4881 C CA  . ALA B 311 ? 0.1884 0.2031 0.1768 0.0385  -0.0018 0.0356  380 ALA B CA  
4882 C C   . ALA B 311 ? 0.3625 0.3721 0.3525 0.0353  -0.0004 0.0363  380 ALA B C   
4883 O O   . ALA B 311 ? 0.3869 0.3905 0.3752 0.0319  0.0000  0.0327  380 ALA B O   
4884 C CB  . ALA B 311 ? 0.1620 0.1762 0.1428 0.0393  -0.0031 0.0323  380 ALA B CB  
4885 N N   . LEU B 312 ? 0.3681 0.3799 0.3607 0.0358  0.0003  0.0412  381 LEU B N   
4886 C CA  . LEU B 312 ? 0.2368 0.2441 0.2303 0.0320  0.0011  0.0428  381 LEU B CA  
4887 C C   . LEU B 312 ? 0.2140 0.2243 0.2044 0.0322  0.0001  0.0441  381 LEU B C   
4888 O O   . LEU B 312 ? 0.3359 0.3529 0.3272 0.0347  0.0002  0.0485  381 LEU B O   
4889 C CB  . LEU B 312 ? 0.2945 0.3023 0.2924 0.0317  0.0021  0.0478  381 LEU B CB  
4890 C CG  . LEU B 312 ? 0.3064 0.3115 0.3087 0.0327  0.0033  0.0475  381 LEU B CG  
4891 C CD1 . LEU B 312 ? 0.3621 0.3632 0.3675 0.0309  0.0046  0.0518  381 LEU B CD1 
4892 C CD2 . LEU B 312 ? 0.3420 0.3407 0.3444 0.0307  0.0046  0.0418  381 LEU B CD2 
4893 N N   . GLY B 313 ? 0.2630 0.2687 0.2501 0.0297  -0.0006 0.0407  382 GLY B N   
4894 C CA  . GLY B 313 ? 0.1605 0.1687 0.1458 0.0301  -0.0016 0.0422  382 GLY B CA  
4895 C C   . GLY B 313 ? 0.2753 0.2817 0.2623 0.0251  -0.0022 0.0455  382 GLY B C   
4896 O O   . GLY B 313 ? 0.2317 0.2360 0.2209 0.0218  -0.0016 0.0477  382 GLY B O   
4897 N N   . ALA B 314 ? 0.2269 0.2337 0.2125 0.0243  -0.0038 0.0460  383 ALA B N   
4898 C CA  . ALA B 314 ? 0.2849 0.2920 0.2722 0.0193  -0.0052 0.0502  383 ALA B CA  
4899 C C   . ALA B 314 ? 0.3436 0.3413 0.3287 0.0118  -0.0054 0.0482  383 ALA B C   
4900 O O   . ALA B 314 ? 0.4075 0.4046 0.3935 0.0068  -0.0062 0.0521  383 ALA B O   
4901 C CB  . ALA B 314 ? 0.2337 0.2425 0.2203 0.0200  -0.0072 0.0510  383 ALA B CB  
4902 N N   . THR B 315 ? 0.2883 0.2784 0.2698 0.0106  -0.0044 0.0423  384 THR B N   
4903 C CA  . THR B 315 ? 0.2431 0.2236 0.2219 0.0039  -0.0034 0.0399  384 THR B CA  
4904 C C   . THR B 315 ? 0.3880 0.3677 0.3697 0.0032  -0.0015 0.0427  384 THR B C   
4905 O O   . THR B 315 ? 0.4522 0.4250 0.4315 -0.0031 -0.0013 0.0436  384 THR B O   
4906 C CB  . THR B 315 ? 0.3690 0.3434 0.3450 0.0040  -0.0016 0.0334  384 THR B CB  
4907 O OG1 . THR B 315 ? 0.3419 0.3175 0.3152 0.0056  -0.0035 0.0311  384 THR B OG1 
4908 C CG2 . THR B 315 ? 0.1789 0.1426 0.1506 -0.0034 0.0000  0.0303  384 THR B CG2 
4909 N N   . PHE B 316 ? 0.2978 0.2836 0.2837 0.0092  -0.0004 0.0444  385 PHE B N   
4910 C CA  . PHE B 316 ? 0.2432 0.2284 0.2322 0.0093  0.0011  0.0477  385 PHE B CA  
4911 C C   . PHE B 316 ? 0.3621 0.3536 0.3531 0.0079  -0.0005 0.0545  385 PHE B C   
4912 O O   . PHE B 316 ? 0.3810 0.3677 0.3714 0.0028  -0.0004 0.0572  385 PHE B O   
4913 C CB  . PHE B 316 ? 0.2404 0.2302 0.2330 0.0159  0.0024  0.0472  385 PHE B CB  
4914 C CG  . PHE B 316 ? 0.2418 0.2292 0.2377 0.0163  0.0041  0.0500  385 PHE B CG  
4915 C CD1 . PHE B 316 ? 0.2270 0.2052 0.2233 0.0150  0.0067  0.0468  385 PHE B CD1 
4916 C CD2 . PHE B 316 ? 0.2092 0.2033 0.2078 0.0183  0.0033  0.0561  385 PHE B CD2 
4917 C CE1 . PHE B 316 ? 0.2786 0.2534 0.2782 0.0160  0.0083  0.0497  385 PHE B CE1 
4918 C CE2 . PHE B 316 ? 0.2598 0.2508 0.2611 0.0185  0.0046  0.0591  385 PHE B CE2 
4919 C CZ  . PHE B 316 ? 0.2331 0.2140 0.2351 0.0176  0.0070  0.0560  385 PHE B CZ  
4920 N N   . ILE B 317 ? 0.3736 0.3756 0.3667 0.0123  -0.0018 0.0573  386 ILE B N   
4921 C CA  . ILE B 317 ? 0.3278 0.3384 0.3242 0.0119  -0.0028 0.0642  386 ILE B CA  
4922 C C   . ILE B 317 ? 0.4055 0.4131 0.4007 0.0040  -0.0049 0.0669  386 ILE B C   
4923 O O   . ILE B 317 ? 0.4430 0.4533 0.4402 0.0004  -0.0057 0.0726  386 ILE B O   
4924 C CB  . ILE B 317 ? 0.2568 0.2785 0.2552 0.0183  -0.0029 0.0657  386 ILE B CB  
4925 C CG1 . ILE B 317 ? 0.2462 0.2693 0.2434 0.0249  -0.0013 0.0621  386 ILE B CG1 
4926 C CG2 . ILE B 317 ? 0.2011 0.2332 0.2040 0.0186  -0.0030 0.0731  386 ILE B CG2 
4927 C CD1 . ILE B 317 ? 0.2671 0.2955 0.2666 0.0278  -0.0001 0.0658  386 ILE B CD1 
4928 N N   . ARG B 318 ? 0.4448 0.4470 0.4364 0.0008  -0.0063 0.0634  387 ARG B N   
4929 C CA  . ARG B 318 ? 0.4139 0.4129 0.4032 -0.0076 -0.0090 0.0660  387 ARG B CA  
4930 C C   . ARG B 318 ? 0.4580 0.4489 0.4447 -0.0146 -0.0085 0.0675  387 ARG B C   
4931 O O   . ARG B 318 ? 0.4282 0.4215 0.4154 -0.0206 -0.0109 0.0731  387 ARG B O   
4932 C CB  . ARG B 318 ? 0.2299 0.2211 0.2138 -0.0108 -0.0101 0.0608  387 ARG B CB  
4933 C CG  . ARG B 318 ? 0.2982 0.2961 0.2837 -0.0105 -0.0134 0.0636  387 ARG B CG  
4934 C CD  . ARG B 318 ? 0.3586 0.3474 0.3377 -0.0141 -0.0145 0.0584  387 ARG B CD  
4935 N NE  . ARG B 318 ? 0.4300 0.4220 0.4100 -0.0070 -0.0144 0.0557  387 ARG B NE  
4936 C CZ  . ARG B 318 ? 0.3521 0.3373 0.3279 -0.0055 -0.0128 0.0490  387 ARG B CZ  
4937 N NH1 . ARG B 318 ? 0.4235 0.4112 0.3994 0.0004  -0.0131 0.0471  387 ARG B NH1 
4938 N NH2 . ARG B 318 ? 0.4233 0.3990 0.3946 -0.0099 -0.0108 0.0444  387 ARG B NH2 
4939 N N   . LYS B 319 ? 0.4108 0.3920 0.3950 -0.0139 -0.0054 0.0628  388 LYS B N   
4940 C CA  . LYS B 319 ? 0.3146 0.2860 0.2956 -0.0200 -0.0044 0.0639  388 LYS B CA  
4941 C C   . LYS B 319 ? 0.3803 0.3574 0.3663 -0.0168 -0.0037 0.0693  388 LYS B C   
4942 O O   . LYS B 319 ? 0.3873 0.3609 0.3717 -0.0229 -0.0046 0.0736  388 LYS B O   
4943 C CB  . LYS B 319 ? 0.2027 0.1602 0.1791 -0.0206 -0.0008 0.0568  388 LYS B CB  
4944 C CG  . LYS B 319 ? 0.4734 0.4173 0.4442 -0.0281 0.0006  0.0570  388 LYS B CG  
4945 C CD  . LYS B 319 ? 0.5314 0.4616 0.4982 -0.0279 0.0053  0.0499  388 LYS B CD  
4946 C CE  . LYS B 319 ? 0.5850 0.4997 0.5416 -0.0381 0.0061  0.0476  388 LYS B CE  
4947 N NZ  . LYS B 319 ? 0.5831 0.4833 0.5363 -0.0372 0.0120  0.0413  388 LYS B NZ  
4948 N N   . PHE B 320 ? 0.3222 0.3077 0.3132 -0.0082 -0.0024 0.0694  389 PHE B N   
4949 C CA  . PHE B 320 ? 0.2984 0.2883 0.2934 -0.0050 -0.0015 0.0741  389 PHE B CA  
4950 C C   . PHE B 320 ? 0.3999 0.4058 0.3997 -0.0005 -0.0027 0.0793  389 PHE B C   
4951 O O   . PHE B 320 ? 0.3024 0.3151 0.3040 0.0065  -0.0019 0.0772  389 PHE B O   
4952 C CB  . PHE B 320 ? 0.3707 0.3559 0.3667 0.0007  0.0013  0.0703  389 PHE B CB  
4953 C CG  . PHE B 320 ? 0.4038 0.3738 0.3961 -0.0028 0.0035  0.0655  389 PHE B CG  
4954 C CD1 . PHE B 320 ? 0.3990 0.3585 0.3885 -0.0083 0.0043  0.0676  389 PHE B CD1 
4955 C CD2 . PHE B 320 ? 0.3819 0.3473 0.3729 -0.0008 0.0053  0.0587  389 PHE B CD2 
4956 C CE1 . PHE B 320 ? 0.3195 0.2637 0.3048 -0.0111 0.0073  0.0627  389 PHE B CE1 
4957 C CE2 . PHE B 320 ? 0.3860 0.3376 0.3736 -0.0038 0.0083  0.0541  389 PHE B CE2 
4958 C CZ  . PHE B 320 ? 0.3129 0.2536 0.2975 -0.0086 0.0096  0.0560  389 PHE B CZ  
4959 N N   . TYR B 321 ? 0.1853 0.1972 0.1870 -0.0049 -0.0045 0.0860  390 TYR B N   
4960 C CA  . TYR B 321 ? 0.2415 0.2689 0.2484 -0.0008 -0.0046 0.0918  390 TYR B CA  
4961 C C   . TYR B 321 ? 0.3465 0.3769 0.3547 0.0061  -0.0024 0.0917  390 TYR B C   
4962 O O   . TYR B 321 ? 0.3696 0.3922 0.3767 0.0051  -0.0016 0.0919  390 TYR B O   
4963 C CB  . TYR B 321 ? 0.2531 0.2850 0.2620 -0.0077 -0.0065 0.0996  390 TYR B CB  
4964 C CG  . TYR B 321 ? 0.3151 0.3646 0.3303 -0.0047 -0.0065 0.1064  390 TYR B CG  
4965 C CD1 . TYR B 321 ? 0.3970 0.4539 0.4144 0.0003  -0.0044 0.1094  390 TYR B CD1 
4966 C CD2 . TYR B 321 ? 0.3782 0.4372 0.3972 -0.0070 -0.0084 0.1102  390 TYR B CD2 
4967 C CE1 . TYR B 321 ? 0.3926 0.4657 0.4153 0.0030  -0.0035 0.1154  390 TYR B CE1 
4968 C CE2 . TYR B 321 ? 0.2992 0.3752 0.3251 -0.0037 -0.0076 0.1166  390 TYR B CE2 
4969 C CZ  . TYR B 321 ? 0.3562 0.4389 0.3835 0.0013  -0.0048 0.1189  390 TYR B CZ  
4970 O OH  . TYR B 321 ? 0.4140 0.5136 0.4476 0.0048  -0.0031 0.1249  390 TYR B OH  
4971 N N   . THR B 322 ? 0.2912 0.3322 0.3013 0.0131  -0.0014 0.0915  391 THR B N   
4972 C CA  . THR B 322 ? 0.3475 0.3908 0.3572 0.0194  0.0003  0.0904  391 THR B CA  
4973 C C   . THR B 322 ? 0.3720 0.4291 0.3842 0.0227  0.0014  0.0962  391 THR B C   
4974 O O   . THR B 322 ? 0.3122 0.3786 0.3262 0.0248  0.0020  0.0974  391 THR B O   
4975 C CB  . THR B 322 ? 0.2997 0.3408 0.3069 0.0245  0.0009  0.0833  391 THR B CB  
4976 O OG1 . THR B 322 ? 0.3071 0.3359 0.3122 0.0214  0.0004  0.0781  391 THR B OG1 
4977 C CG2 . THR B 322 ? 0.3093 0.3537 0.3156 0.0302  0.0019  0.0829  391 THR B CG2 
4978 N N   . GLU B 323 ? 0.4677 0.5259 0.4800 0.0233  0.0019  0.0999  392 GLU B N   
4979 C CA  . GLU B 323 ? 0.3822 0.4528 0.3956 0.0262  0.0034  0.1053  392 GLU B CA  
4980 C C   . GLU B 323 ? 0.4120 0.4838 0.4220 0.0321  0.0044  0.1028  392 GLU B C   
4981 O O   . GLU B 323 ? 0.2940 0.3579 0.3029 0.0322  0.0034  0.1014  392 GLU B O   
4982 C CB  . GLU B 323 ? 0.2883 0.3600 0.3037 0.0208  0.0026  0.1129  392 GLU B CB  
4983 C CG  . GLU B 323 ? 0.2094 0.2941 0.2255 0.0231  0.0044  0.1190  392 GLU B CG  
4984 C CD  . GLU B 323 ? 0.3269 0.4117 0.3446 0.0171  0.0033  0.1266  392 GLU B CD  
4985 O OE1 . GLU B 323 ? 0.2732 0.3505 0.2889 0.0166  0.0025  0.1278  392 GLU B OE1 
4986 O OE2 . GLU B 323 ? 0.4539 0.5461 0.4750 0.0127  0.0031  0.1319  392 GLU B OE2 
4987 N N   . PHE B 324 ? 0.2721 0.3536 0.2804 0.0371  0.0065  0.1025  393 PHE B N   
4988 C CA  . PHE B 324 ? 0.3653 0.4487 0.3687 0.0420  0.0073  0.1005  393 PHE B CA  
4989 C C   . PHE B 324 ? 0.5024 0.5957 0.5051 0.0424  0.0090  0.1072  393 PHE B C   
4990 O O   . PHE B 324 ? 0.4945 0.5976 0.4989 0.0429  0.0114  0.1106  393 PHE B O   
4991 C CB  . PHE B 324 ? 0.3926 0.4774 0.3921 0.0470  0.0089  0.0944  393 PHE B CB  
4992 C CG  . PHE B 324 ? 0.4375 0.5129 0.4369 0.0463  0.0072  0.0879  393 PHE B CG  
4993 C CD1 . PHE B 324 ? 0.3615 0.4357 0.3645 0.0440  0.0069  0.0875  393 PHE B CD1 
4994 C CD2 . PHE B 324 ? 0.3118 0.3801 0.3078 0.0476  0.0058  0.0826  393 PHE B CD2 
4995 C CE1 . PHE B 324 ? 0.4017 0.4671 0.4038 0.0428  0.0054  0.0817  393 PHE B CE1 
4996 C CE2 . PHE B 324 ? 0.3018 0.3619 0.2976 0.0466  0.0046  0.0768  393 PHE B CE2 
4997 C CZ  . PHE B 324 ? 0.3941 0.4523 0.3925 0.0442  0.0045  0.0763  393 PHE B CZ  
4998 N N   . ASP B 325 ? 0.4834 0.5748 0.4838 0.0422  0.0077  0.1095  394 ASP B N   
4999 C CA  . ASP B 325 ? 0.4189 0.5178 0.4186 0.0410  0.0085  0.1169  394 ASP B CA  
5000 C C   . ASP B 325 ? 0.4222 0.5246 0.4149 0.0448  0.0090  0.1160  394 ASP B C   
5001 O O   . ASP B 325 ? 0.4172 0.5135 0.4082 0.0452  0.0064  0.1147  394 ASP B O   
5002 C CB  . ASP B 325 ? 0.3694 0.4616 0.3727 0.0360  0.0059  0.1219  394 ASP B CB  
5003 C CG  . ASP B 325 ? 0.4722 0.5709 0.4749 0.0337  0.0062  0.1294  394 ASP B CG  
5004 O OD1 . ASP B 325 ? 0.5853 0.6930 0.5839 0.0362  0.0082  0.1302  394 ASP B OD1 
5005 O OD2 . ASP B 325 ? 0.5090 0.6021 0.5150 0.0287  0.0046  0.1331  394 ASP B OD2 
5006 N N   . ARG B 326 ? 0.3024 0.4149 0.2911 0.0472  0.0126  0.1173  395 ARG B N   
5007 C CA  . ARG B 326 ? 0.3005 0.4160 0.2803 0.0502  0.0135  0.1160  395 ARG B CA  
5008 C C   . ARG B 326 ? 0.4057 0.5250 0.3831 0.0477  0.0124  0.1232  395 ARG B C   
5009 O O   . ARG B 326 ? 0.5202 0.6385 0.4910 0.0485  0.0110  0.1222  395 ARG B O   
5010 C CB  . ARG B 326 ? 0.3762 0.4993 0.3512 0.0543  0.0186  0.1133  395 ARG B CB  
5011 C CG  . ARG B 326 ? 0.4755 0.5929 0.4486 0.0580  0.0192  0.1049  395 ARG B CG  
5012 C CD  . ARG B 326 ? 0.4691 0.5791 0.4346 0.0589  0.0163  0.0998  395 ARG B CD  
5013 N NE  . ARG B 326 ? 0.5266 0.6407 0.4812 0.0604  0.0182  0.1002  395 ARG B NE  
5014 C CZ  . ARG B 326 ? 0.5452 0.6612 0.4915 0.0642  0.0226  0.0960  395 ARG B CZ  
5015 N NH1 . ARG B 326 ? 0.4374 0.5560 0.3723 0.0646  0.0242  0.0962  395 ARG B NH1 
5016 N NH2 . ARG B 326 ? 0.6476 0.7624 0.5963 0.0675  0.0255  0.0916  395 ARG B NH2 
5017 N N   . ARG B 327 ? 0.4610 0.5833 0.4446 0.0434  0.0127  0.1286  396 ARG B N   
5018 C CA  . ARG B 327 ? 0.3817 0.5062 0.3643 0.0399  0.0116  0.1336  396 ARG B CA  
5019 C C   . ARG B 327 ? 0.3945 0.5087 0.3789 0.0379  0.0066  0.1342  396 ARG B C   
5020 O O   . ARG B 327 ? 0.3798 0.4942 0.3603 0.0372  0.0048  0.1363  396 ARG B O   
5021 C CB  . ARG B 327 ? 0.2752 0.4058 0.2639 0.0355  0.0132  0.1392  396 ARG B CB  
5022 C CG  . ARG B 327 ? 0.3740 0.5053 0.3624 0.0311  0.0115  0.1448  396 ARG B CG  
5023 C CD  . ARG B 327 ? 0.3352 0.4608 0.3308 0.0255  0.0090  0.1487  396 ARG B CD  
5024 N NE  . ARG B 327 ? 0.4588 0.5881 0.4542 0.0211  0.0085  0.1547  396 ARG B NE  
5025 C CZ  . ARG B 327 ? 0.4839 0.6046 0.4795 0.0178  0.0049  0.1579  396 ARG B CZ  
5026 N NH1 . ARG B 327 ? 0.3830 0.5074 0.3778 0.0137  0.0046  0.1635  396 ARG B NH1 
5027 N NH2 . ARG B 327 ? 0.4247 0.5330 0.4214 0.0190  0.0017  0.1556  396 ARG B NH2 
5028 N N   . ASN B 328 ? 0.3676 0.4727 0.3580 0.0370  0.0045  0.1328  397 ASN B N   
5029 C CA  . ASN B 328 ? 0.3508 0.4458 0.3442 0.0361  0.0006  0.1334  397 ASN B CA  
5030 C C   . ASN B 328 ? 0.3488 0.4385 0.3414 0.0401  -0.0010 0.1280  397 ASN B C   
5031 O O   . ASN B 328 ? 0.4013 0.4835 0.3974 0.0402  -0.0039 0.1284  397 ASN B O   
5032 C CB  . ASN B 328 ? 0.4933 0.5803 0.4931 0.0321  -0.0002 0.1360  397 ASN B CB  
5033 C CG  . ASN B 328 ? 0.4804 0.5726 0.4813 0.0273  0.0009  0.1416  397 ASN B CG  
5034 O OD1 . ASN B 328 ? 0.3487 0.4415 0.3484 0.0252  -0.0004 0.1459  397 ASN B OD1 
5035 N ND2 . ASN B 328 ? 0.4251 0.5214 0.4285 0.0251  0.0029  0.1418  397 ASN B ND2 
5036 N N   . ASN B 329 ? 0.3617 0.4552 0.3501 0.0434  0.0008  0.1231  398 ASN B N   
5037 C CA  . ASN B 329 ? 0.3747 0.4638 0.3619 0.0466  -0.0007 0.1172  398 ASN B CA  
5038 C C   . ASN B 329 ? 0.3553 0.4340 0.3501 0.0456  -0.0023 0.1149  398 ASN B C   
5039 O O   . ASN B 329 ? 0.4192 0.4932 0.4168 0.0466  -0.0049 0.1145  398 ASN B O   
5040 C CB  . ASN B 329 ? 0.4221 0.5134 0.4039 0.0478  -0.0033 0.1178  398 ASN B CB  
5041 C CG  . ASN B 329 ? 0.6082 0.7075 0.5796 0.0491  -0.0011 0.1168  398 ASN B CG  
5042 O OD1 . ASN B 329 ? 0.5706 0.6701 0.5371 0.0515  0.0008  0.1105  398 ASN B OD1 
5043 N ND2 . ASN B 329 ? 0.7575 0.8618 0.7258 0.0469  -0.0007 0.1214  398 ASN B ND2 
5044 N N   . ARG B 330 ? 0.2498 0.3254 0.2481 0.0435  -0.0006 0.1137  399 ARG B N   
5045 C CA  . ARG B 330 ? 0.3523 0.4174 0.3565 0.0417  -0.0013 0.1115  399 ARG B CA  
5046 C C   . ARG B 330 ? 0.3898 0.4533 0.3945 0.0404  0.0005  0.1066  399 ARG B C   
5047 O O   . ARG B 330 ? 0.3489 0.4200 0.3514 0.0407  0.0023  0.1068  399 ARG B O   
5048 C CB  . ARG B 330 ? 0.2885 0.3486 0.2962 0.0382  -0.0020 0.1183  399 ARG B CB  
5049 C CG  . ARG B 330 ? 0.2786 0.3443 0.2856 0.0344  -0.0006 0.1232  399 ARG B CG  
5050 C CD  . ARG B 330 ? 0.3081 0.3677 0.3176 0.0302  -0.0017 0.1300  399 ARG B CD  
5051 N NE  . ARG B 330 ? 0.2707 0.3343 0.2805 0.0251  -0.0006 0.1332  399 ARG B NE  
5052 C CZ  . ARG B 330 ? 0.3509 0.4084 0.3622 0.0197  -0.0014 0.1375  399 ARG B CZ  
5053 N NH1 . ARG B 330 ? 0.3113 0.3741 0.3233 0.0147  -0.0008 0.1402  399 ARG B NH1 
5054 N NH2 . ARG B 330 ? 0.2541 0.3002 0.2664 0.0193  -0.0030 0.1391  399 ARG B NH2 
5055 N N   . ILE B 331 ? 0.3694 0.4230 0.3772 0.0390  0.0002  0.1025  400 ILE B N   
5056 C CA  . ILE B 331 ? 0.3159 0.3662 0.3241 0.0367  0.0012  0.0984  400 ILE B CA  
5057 C C   . ILE B 331 ? 0.3332 0.3740 0.3443 0.0316  0.0010  0.1005  400 ILE B C   
5058 O O   . ILE B 331 ? 0.3596 0.3921 0.3727 0.0314  0.0006  0.1012  400 ILE B O   
5059 C CB  . ILE B 331 ? 0.3214 0.3676 0.3286 0.0389  0.0011  0.0905  400 ILE B CB  
5060 C CG1 . ILE B 331 ? 0.3100 0.3641 0.3126 0.0432  0.0013  0.0881  400 ILE B CG1 
5061 C CG2 . ILE B 331 ? 0.4029 0.4443 0.4103 0.0357  0.0017  0.0868  400 ILE B CG2 
5062 C CD1 . ILE B 331 ? 0.2603 0.3106 0.2611 0.0447  0.0010  0.0806  400 ILE B CD1 
5063 N N   . GLY B 332 ? 0.2791 0.3210 0.2902 0.0274  0.0013  0.1019  401 GLY B N   
5064 C CA  . GLY B 332 ? 0.2723 0.3044 0.2842 0.0212  0.0010  0.1038  401 GLY B CA  
5065 C C   . GLY B 332 ? 0.2584 0.2847 0.2691 0.0179  0.0010  0.0986  401 GLY B C   
5066 O O   . GLY B 332 ? 0.2239 0.2575 0.2343 0.0190  0.0010  0.0966  401 GLY B O   
5067 N N   . PHE B 333 ? 0.2400 0.2527 0.2497 0.0137  0.0012  0.0965  402 PHE B N   
5068 C CA  . PHE B 333 ? 0.1932 0.1984 0.2004 0.0096  0.0013  0.0914  402 PHE B CA  
5069 C C   . PHE B 333 ? 0.3169 0.3134 0.3216 0.0012  0.0005  0.0945  402 PHE B C   
5070 O O   . PHE B 333 ? 0.3858 0.3726 0.3896 -0.0007 0.0012  0.0965  402 PHE B O   
5071 C CB  . PHE B 333 ? 0.1934 0.1887 0.1999 0.0121  0.0029  0.0843  402 PHE B CB  
5072 C CG  . PHE B 333 ? 0.3638 0.3665 0.3715 0.0186  0.0030  0.0804  402 PHE B CG  
5073 C CD1 . PHE B 333 ? 0.1794 0.1898 0.1858 0.0195  0.0022  0.0783  402 PHE B CD1 
5074 C CD2 . PHE B 333 ? 0.2826 0.2843 0.2928 0.0237  0.0038  0.0790  402 PHE B CD2 
5075 C CE1 . PHE B 333 ? 0.3228 0.3382 0.3290 0.0250  0.0023  0.0745  402 PHE B CE1 
5076 C CE2 . PHE B 333 ? 0.2464 0.2547 0.2569 0.0286  0.0034  0.0756  402 PHE B CE2 
5077 C CZ  . PHE B 333 ? 0.1742 0.1885 0.1820 0.0290  0.0027  0.0730  402 PHE B CZ  
5078 N N   . ALA B 334 ? 0.3853 0.3848 0.3885 -0.0039 -0.0010 0.0951  403 ALA B N   
5079 C CA  . ALA B 334 ? 0.3839 0.3744 0.3833 -0.0133 -0.0023 0.0972  403 ALA B CA  
5080 C C   . ALA B 334 ? 0.3108 0.2949 0.3062 -0.0174 -0.0028 0.0917  403 ALA B C   
5081 O O   . ALA B 334 ? 0.2800 0.2715 0.2770 -0.0136 -0.0032 0.0887  403 ALA B O   
5082 C CB  . ALA B 334 ? 0.3459 0.3480 0.3477 -0.0177 -0.0046 0.1055  403 ALA B CB  
5083 N N   . LEU B 335 ? 0.3773 0.3467 0.3665 -0.0253 -0.0029 0.0903  404 LEU B N   
5084 C CA  . LEU B 335 ? 0.3536 0.3162 0.3374 -0.0310 -0.0037 0.0857  404 LEU B CA  
5085 C C   . LEU B 335 ? 0.3364 0.3115 0.3220 -0.0353 -0.0077 0.0907  404 LEU B C   
5086 O O   . LEU B 335 ? 0.4841 0.4621 0.4697 -0.0419 -0.0102 0.0973  404 LEU B O   
5087 C CB  . LEU B 335 ? 0.3765 0.3194 0.3516 -0.0392 -0.0026 0.0832  404 LEU B CB  
5088 C CG  . LEU B 335 ? 0.4522 0.3851 0.4194 -0.0459 -0.0029 0.0777  404 LEU B CG  
5089 C CD1 . LEU B 335 ? 0.4415 0.3685 0.4082 -0.0398 0.0010  0.0694  404 LEU B CD1 
5090 C CD2 . LEU B 335 ? 0.3580 0.2739 0.3154 -0.0567 -0.0029 0.0779  404 LEU B CD2 
5091 N N   . ALA B 336 ? 0.3721 0.3547 0.3597 -0.0318 -0.0085 0.0880  405 ALA B N   
5092 C CA  . ALA B 336 ? 0.4289 0.4258 0.4207 -0.0333 -0.0119 0.0932  405 ALA B CA  
5093 C C   . ALA B 336 ? 0.5397 0.5310 0.5262 -0.0446 -0.0155 0.0950  405 ALA B C   
5094 O O   . ALA B 336 ? 0.6469 0.6227 0.6249 -0.0503 -0.0151 0.0897  405 ALA B O   
5095 C CB  . ALA B 336 ? 0.3785 0.3831 0.3734 -0.0255 -0.0114 0.0895  405 ALA B CB  
5096 N N   . ARG B 337 ? 0.5058 0.5103 0.4973 -0.0481 -0.0190 0.1027  406 ARG B N   
5097 C CA  . ARG B 337 ? 0.4630 0.4656 0.4507 -0.0590 -0.0236 0.1059  406 ARG B CA  
5098 C C   . ARG B 337 ? 0.5059 0.5282 0.5031 -0.0574 -0.0269 0.1130  406 ARG B C   
5099 O O   . ARG B 337 ? 0.5478 0.5727 0.5442 -0.0659 -0.0316 0.1174  406 ARG B O   
5100 C CB  . ARG B 337 ? 0.3078 0.3021 0.2901 -0.0697 -0.0252 0.1100  406 ARG B CB  
5101 C CG  . ARG B 337 ? 0.3113 0.3202 0.3020 -0.0683 -0.0259 0.1176  406 ARG B CG  
5102 C CD  . ARG B 337 ? 0.5185 0.5164 0.5032 -0.0761 -0.0264 0.1172  406 ARG B CD  
5103 N NE  . ARG B 337 ? 0.6022 0.6127 0.5944 -0.0742 -0.0264 0.1235  406 ARG B NE  
5104 C CZ  . ARG B 337 ? 0.6064 0.6313 0.6048 -0.0785 -0.0303 0.1292  406 ARG B CZ  
5105 N NH1 . ARG B 337 ? 0.5664 0.6022 0.5713 -0.0768 -0.0297 0.1346  406 ARG B NH1 
5106 N NH2 . ARG B 337 ? 0.5988 0.6278 0.5973 -0.0848 -0.0348 0.1299  406 ARG B NH2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   70  70  GLY GLY A . n 
A 1 2   ASN 2   71  71  ASN ASN A . n 
A 1 3   THR 3   72  72  THR THR A . n 
A 1 4   THR 4   73  73  THR THR A . n 
A 1 5   SER 5   74  74  SER SER A . n 
A 1 6   SER 6   75  75  SER SER A . n 
A 1 7   VAL 7   76  76  VAL VAL A . n 
A 1 8   ILE 8   77  77  ILE ILE A . n 
A 1 9   LEU 9   78  78  LEU LEU A . n 
A 1 10  THR 10  79  79  THR THR A . n 
A 1 11  ASN 11  80  80  ASN ASN A . n 
A 1 12  TYR 12  81  81  TYR TYR A . n 
A 1 13  MET 13  82  82  MET MET A . n 
A 1 14  ASP 14  83  83  ASP ASP A . n 
A 1 15  THR 15  84  84  THR THR A . n 
A 1 16  GLN 16  85  85  GLN GLN A . n 
A 1 17  TYR 17  86  86  TYR TYR A . n 
A 1 18  TYR 18  87  87  TYR TYR A . n 
A 1 19  GLY 19  88  88  GLY GLY A . n 
A 1 20  GLU 20  89  89  GLU GLU A . n 
A 1 21  ILE 21  90  90  ILE ILE A . n 
A 1 22  GLY 22  91  91  GLY GLY A . n 
A 1 23  ILE 23  92  92  ILE ILE A . n 
A 1 24  GLY 24  93  93  GLY GLY A . n 
A 1 25  THR 25  94  94  THR THR A . n 
A 1 26  PRO 26  95  95  PRO PRO A . n 
A 1 27  PRO 27  96  96  PRO PRO A . n 
A 1 28  GLN 28  97  97  GLN GLN A . n 
A 1 29  THR 29  98  98  THR THR A . n 
A 1 30  PHE 30  99  99  PHE PHE A . n 
A 1 31  LYS 31  100 100 LYS LYS A . n 
A 1 32  VAL 32  101 101 VAL VAL A . n 
A 1 33  VAL 33  102 102 VAL VAL A . n 
A 1 34  PHE 34  103 103 PHE PHE A . n 
A 1 35  ASP 35  104 104 ASP ASP A . n 
A 1 36  THR 36  105 105 THR THR A . n 
A 1 37  GLY 37  106 106 GLY GLY A . n 
A 1 38  SER 38  107 107 SER SER A . n 
A 1 39  SER 39  108 108 SER SER A . n 
A 1 40  ASN 40  109 109 ASN ASN A . n 
A 1 41  VAL 41  110 110 VAL VAL A . n 
A 1 42  TRP 42  111 111 TRP TRP A . n 
A 1 43  VAL 43  112 112 VAL VAL A . n 
A 1 44  PRO 44  113 113 PRO PRO A . n 
A 1 45  SER 45  114 114 SER SER A . n 
A 1 46  SER 46  115 115 SER SER A . n 
A 1 47  LYS 47  116 116 LYS LYS A . n 
A 1 48  CYS 48  117 117 CYS CYS A . n 
A 1 49  SER 49  118 118 SER SER A . n 
A 1 50  ARG 50  119 119 ARG ARG A . n 
A 1 51  LEU 51  120 120 LEU LEU A . n 
A 1 52  TYR 52  121 121 TYR TYR A . n 
A 1 53  THR 53  122 122 THR THR A . n 
A 1 54  ALA 54  123 123 ALA ALA A . n 
A 1 55  CYS 55  124 124 CYS CYS A . n 
A 1 56  VAL 56  125 125 VAL VAL A . n 
A 1 57  TYR 57  126 126 TYR TYR A . n 
A 1 58  HIS 58  127 127 HIS HIS A . n 
A 1 59  LYS 59  128 128 LYS LYS A . n 
A 1 60  LEU 60  129 129 LEU LEU A . n 
A 1 61  PHE 61  130 130 PHE PHE A . n 
A 1 62  ASP 62  131 131 ASP ASP A . n 
A 1 63  ALA 63  132 132 ALA ALA A . n 
A 1 64  SER 64  133 133 SER SER A . n 
A 1 65  ASP 65  134 134 ASP ASP A . n 
A 1 66  SER 66  135 135 SER SER A . n 
A 1 67  SER 67  136 136 SER SER A . n 
A 1 68  SER 68  137 137 SER SER A . n 
A 1 69  TYR 69  138 138 TYR TYR A . n 
A 1 70  LYS 70  139 139 LYS LYS A . n 
A 1 71  HIS 71  140 140 HIS HIS A . n 
A 1 72  ASN 72  141 141 ASN ASN A . n 
A 1 73  GLY 73  142 142 GLY GLY A . n 
A 1 74  THR 74  143 143 THR THR A . n 
A 1 75  GLU 75  144 144 GLU GLU A . n 
A 1 76  LEU 76  145 145 LEU LEU A . n 
A 1 77  THR 77  146 146 THR THR A . n 
A 1 78  LEU 78  147 147 LEU LEU A . n 
A 1 79  ARG 79  148 148 ARG ARG A . n 
A 1 80  TYR 80  149 149 TYR TYR A . n 
A 1 81  SER 81  150 150 SER SER A . n 
A 1 82  THR 82  151 151 THR THR A . n 
A 1 83  GLY 83  152 152 GLY GLY A . n 
A 1 84  THR 84  153 153 THR THR A . n 
A 1 85  VAL 85  154 154 VAL VAL A . n 
A 1 86  SER 86  155 155 SER SER A . n 
A 1 87  GLY 87  156 156 GLY GLY A . n 
A 1 88  PHE 88  157 157 PHE PHE A . n 
A 1 89  LEU 89  158 158 LEU LEU A . n 
A 1 90  SER 90  159 159 SER SER A . n 
A 1 91  GLN 91  160 160 GLN GLN A . n 
A 1 92  ASP 92  161 161 ASP ASP A . n 
A 1 93  ILE 93  162 162 ILE ILE A . n 
A 1 94  ILE 94  163 163 ILE ILE A . n 
A 1 95  THR 95  164 164 THR THR A . n 
A 1 96  VAL 96  165 165 VAL VAL A . n 
A 1 97  GLY 97  166 166 GLY GLY A . n 
A 1 98  GLY 98  167 167 GLY GLY A . n 
A 1 99  ILE 99  168 168 ILE ILE A . n 
A 1 100 THR 100 169 169 THR THR A . n 
A 1 101 VAL 101 170 170 VAL VAL A . n 
A 1 102 THR 102 171 171 THR THR A . n 
A 1 103 GLN 103 172 172 GLN GLN A . n 
A 1 104 MET 104 173 173 MET MET A . n 
A 1 105 PHE 105 174 174 PHE PHE A . n 
A 1 106 GLY 106 175 175 GLY GLY A . n 
A 1 107 GLU 107 176 176 GLU GLU A . n 
A 1 108 VAL 108 177 177 VAL VAL A . n 
A 1 109 THR 109 178 178 THR THR A . n 
A 1 110 GLU 110 179 179 GLU GLU A . n 
A 1 111 MET 111 180 180 MET MET A . n 
A 1 112 PRO 112 181 181 PRO PRO A . n 
A 1 113 ALA 113 182 182 ALA ALA A . n 
A 1 114 LEU 114 183 183 LEU LEU A . n 
A 1 115 PRO 115 184 184 PRO PRO A . n 
A 1 116 PHE 116 185 185 PHE PHE A . n 
A 1 117 MET 117 186 186 MET MET A . n 
A 1 118 LEU 118 187 187 LEU LEU A . n 
A 1 119 ALA 119 188 188 ALA ALA A . n 
A 1 120 GLU 120 189 189 GLU GLU A . n 
A 1 121 PHE 121 190 190 PHE PHE A . n 
A 1 122 ASP 122 191 191 ASP ASP A . n 
A 1 123 GLY 123 192 192 GLY GLY A . n 
A 1 124 VAL 124 193 193 VAL VAL A . n 
A 1 125 VAL 125 194 194 VAL VAL A . n 
A 1 126 GLY 126 195 195 GLY GLY A . n 
A 1 127 MET 127 196 196 MET MET A . n 
A 1 128 GLY 128 197 197 GLY GLY A . n 
A 1 129 PHE 129 198 198 PHE PHE A . n 
A 1 130 ILE 130 199 199 ILE ILE A . n 
A 1 131 GLU 131 200 200 GLU GLU A . n 
A 1 132 GLN 132 201 201 GLN GLN A . n 
A 1 133 ALA 133 202 202 ALA ALA A . n 
A 1 134 ILE 134 203 203 ILE ILE A . n 
A 1 135 GLY 135 204 204 GLY GLY A . n 
A 1 136 ARG 136 205 205 ARG ARG A . n 
A 1 137 VAL 137 206 206 VAL VAL A . n 
A 1 138 THR 138 207 207 THR THR A . n 
A 1 139 PRO 139 208 208 PRO PRO A . n 
A 1 140 ILE 140 209 209 ILE ILE A . n 
A 1 141 PHE 141 210 210 PHE PHE A . n 
A 1 142 ASP 142 211 211 ASP ASP A . n 
A 1 143 ASN 143 212 212 ASN ASN A . n 
A 1 144 ILE 144 213 213 ILE ILE A . n 
A 1 145 ILE 145 214 214 ILE ILE A . n 
A 1 146 SER 146 215 215 SER SER A . n 
A 1 147 GLN 147 216 216 GLN GLN A . n 
A 1 148 GLY 148 217 217 GLY GLY A . n 
A 1 149 VAL 149 218 218 VAL VAL A . n 
A 1 150 LEU 150 219 219 LEU LEU A . n 
A 1 151 LYS 151 220 220 LYS LYS A . n 
A 1 152 GLU 152 221 221 GLU GLU A . n 
A 1 153 ASP 153 222 222 ASP ASP A . n 
A 1 154 VAL 154 223 223 VAL VAL A . n 
A 1 155 PHE 155 224 224 PHE PHE A . n 
A 1 156 SER 156 225 225 SER SER A . n 
A 1 157 PHE 157 226 226 PHE PHE A . n 
A 1 158 TYR 158 227 227 TYR TYR A . n 
A 1 159 TYR 159 228 228 TYR TYR A . n 
A 1 160 ASN 160 229 229 ASN ASN A . n 
A 1 161 ARG 161 230 230 ARG ARG A . n 
A 1 162 ASP 162 231 231 ASP ASP A . n 
A 1 163 SER 163 232 232 SER SER A . n 
A 1 164 GLU 164 233 233 GLU GLU A . n 
A 1 165 ASN 165 234 234 ASN ALA A . n 
A 1 166 SER 166 235 235 SER SER A . n 
A 1 167 GLN 167 236 236 GLN GLN A . n 
A 1 168 SER 168 237 237 SER SER A . n 
A 1 169 LEU 169 238 238 LEU LEU A . n 
A 1 170 GLY 170 239 239 GLY GLY A . n 
A 1 171 GLY 171 240 240 GLY GLY A . n 
A 1 172 GLN 172 241 241 GLN GLN A . n 
A 1 173 ILE 173 242 242 ILE ILE A . n 
A 1 174 VAL 174 243 243 VAL VAL A . n 
A 1 175 LEU 175 244 244 LEU LEU A . n 
A 1 176 GLY 176 245 245 GLY GLY A . n 
A 1 177 GLY 177 246 246 GLY GLY A . n 
A 1 178 SER 178 247 247 SER SER A . n 
A 1 179 ASP 179 248 248 ASP ASP A . n 
A 1 180 PRO 180 249 249 PRO PRO A . n 
A 1 181 GLN 181 250 250 GLN GLN A . n 
A 1 182 HIS 182 251 251 HIS HIS A . n 
A 1 183 TYR 183 252 252 TYR TYR A . n 
A 1 184 GLU 184 253 253 GLU GLU A . n 
A 1 185 GLY 185 254 254 GLY GLY A . n 
A 1 186 ASN 186 255 255 ASN ASN A . n 
A 1 187 PHE 187 256 256 PHE PHE A . n 
A 1 188 HIS 188 257 257 HIS HIS A . n 
A 1 189 TYR 189 258 258 TYR TYR A . n 
A 1 190 ILE 190 259 259 ILE ILE A . n 
A 1 191 ASN 191 260 260 ASN ASN A . n 
A 1 192 LEU 192 261 261 LEU LEU A . n 
A 1 193 ILE 193 262 262 ILE ILE A . n 
A 1 194 LYS 194 263 263 LYS LYS A . n 
A 1 195 THR 195 264 264 THR THR A . n 
A 1 196 GLY 196 265 265 GLY GLY A . n 
A 1 197 VAL 197 266 266 VAL VAL A . n 
A 1 198 TRP 198 267 267 TRP TRP A . n 
A 1 199 GLN 199 268 268 GLN GLN A . n 
A 1 200 ILE 200 269 269 ILE ILE A . n 
A 1 201 GLN 201 270 270 GLN GLN A . n 
A 1 202 MET 202 271 271 MET MET A . n 
A 1 203 LYS 203 272 272 LYS LYS A . n 
A 1 204 GLY 204 273 273 GLY GLY A . n 
A 1 205 VAL 205 274 274 VAL VAL A . n 
A 1 206 SER 206 275 275 SER SER A . n 
A 1 207 VAL 207 276 276 VAL VAL A . n 
A 1 208 GLY 208 277 277 GLY GLY A . n 
A 1 209 SER 209 278 278 SER SER A . n 
A 1 210 SER 210 279 279 SER SER A . n 
A 1 211 THR 211 280 280 THR THR A . n 
A 1 212 LEU 212 281 281 LEU LEU A . n 
A 1 213 LEU 213 282 282 LEU LEU A . n 
A 1 214 CYS 214 283 283 CYS CYS A . n 
A 1 215 GLU 215 284 284 GLU GLU A . n 
A 1 216 ASP 216 285 285 ASP ASP A . n 
A 1 217 GLY 217 286 286 GLY GLY A . n 
A 1 218 CYS 218 287 287 CYS CYS A . n 
A 1 219 LEU 219 288 288 LEU LEU A . n 
A 1 220 ALA 220 289 289 ALA ALA A . n 
A 1 221 LEU 221 290 290 LEU LEU A . n 
A 1 222 VAL 222 291 291 VAL VAL A . n 
A 1 223 ASP 223 292 292 ASP ASP A . n 
A 1 224 THR 224 293 293 THR THR A . n 
A 1 225 GLY 225 294 294 GLY GLY A . n 
A 1 226 ALA 226 295 295 ALA ALA A . n 
A 1 227 SER 227 296 296 SER SER A . n 
A 1 228 TYR 228 297 297 TYR TYR A . n 
A 1 229 ILE 229 298 298 ILE ILE A . n 
A 1 230 SER 230 299 299 SER SER A . n 
A 1 231 GLY 231 300 300 GLY GLY A . n 
A 1 232 SER 232 301 301 SER SER A . n 
A 1 233 THR 233 302 302 THR THR A . n 
A 1 234 SER 234 303 303 SER SER A . n 
A 1 235 SER 235 304 304 SER SER A . n 
A 1 236 ILE 236 305 305 ILE ILE A . n 
A 1 237 GLU 237 306 306 GLU GLU A . n 
A 1 238 LYS 238 307 307 LYS LYS A . n 
A 1 239 LEU 239 308 308 LEU LEU A . n 
A 1 240 MET 240 309 309 MET MET A . n 
A 1 241 GLU 241 310 310 GLU GLU A . n 
A 1 242 ALA 242 311 311 ALA ALA A . n 
A 1 243 LEU 243 312 312 LEU LEU A . n 
A 1 244 GLY 244 313 313 GLY GLY A . n 
A 1 245 ALA 245 314 314 ALA ALA A . n 
A 1 246 LYS 246 315 315 LYS LYS A . n 
A 1 247 LYS 247 316 316 LYS LYS A . n 
A 1 248 ARG 248 317 317 ARG ARG A . n 
A 1 249 LEU 249 318 318 LEU LEU A . n 
A 1 250 PHE 250 319 319 PHE PHE A . n 
A 1 251 ASP 251 320 320 ASP ASP A . n 
A 1 252 TYR 252 321 321 TYR TYR A . n 
A 1 253 VAL 253 322 322 VAL VAL A . n 
A 1 254 VAL 254 323 323 VAL VAL A . n 
A 1 255 LYS 255 324 324 LYS LYS A . n 
A 1 256 CYS 256 325 325 CYS CYS A . n 
A 1 257 ASN 257 326 326 ASN ASN A . n 
A 1 258 GLU 258 327 327 GLU GLU A . n 
A 1 259 GLY 259 328 328 GLY GLY A . n 
A 1 260 PRO 260 329 329 PRO PRO A . n 
A 1 261 THR 261 330 330 THR THR A . n 
A 1 262 LEU 262 331 331 LEU LEU A . n 
A 1 263 PRO 263 332 332 PRO PRO A . n 
A 1 264 ASP 264 333 333 ASP ASP A . n 
A 1 265 ILE 265 334 334 ILE ILE A . n 
A 1 266 SER 266 335 335 SER SER A . n 
A 1 267 PHE 267 336 336 PHE PHE A . n 
A 1 268 HIS 268 337 337 HIS HIS A . n 
A 1 269 LEU 269 338 338 LEU LEU A . n 
A 1 270 GLY 270 339 339 GLY GLY A . n 
A 1 271 GLY 271 340 340 GLY GLY A . n 
A 1 272 LYS 272 341 341 LYS LYS A . n 
A 1 273 GLU 273 342 342 GLU GLU A . n 
A 1 274 TYR 274 343 343 TYR TYR A . n 
A 1 275 THR 275 344 344 THR THR A . n 
A 1 276 LEU 276 345 345 LEU LEU A . n 
A 1 277 THR 277 346 346 THR THR A . n 
A 1 278 SER 278 347 347 SER SER A . n 
A 1 279 ALA 279 348 348 ALA ALA A . n 
A 1 280 ASP 280 349 349 ASP ASP A . n 
A 1 281 TYR 281 350 350 TYR TYR A . n 
A 1 282 VAL 282 351 351 VAL VAL A . n 
A 1 283 PHE 283 352 352 PHE PHE A . n 
A 1 284 GLN 284 353 353 GLN GLN A . n 
A 1 285 GLU 285 354 354 GLU GLU A . n 
A 1 286 SER 286 355 355 SER SER A . n 
A 1 287 TYR 287 356 356 TYR TYR A . n 
A 1 288 SER 288 357 357 SER SER A . n 
A 1 289 SER 289 358 358 SER SER A . n 
A 1 290 LYS 290 359 359 LYS LYS A . n 
A 1 291 LYS 291 360 360 LYS LYS A . n 
A 1 292 LEU 292 361 361 LEU LEU A . n 
A 1 293 CYS 293 362 362 CYS CYS A . n 
A 1 294 THR 294 363 363 THR THR A . n 
A 1 295 LEU 295 364 364 LEU LEU A . n 
A 1 296 ALA 296 365 365 ALA ALA A . n 
A 1 297 ILE 297 366 366 ILE ILE A . n 
A 1 298 HIS 298 367 367 HIS HIS A . n 
A 1 299 ALA 299 368 368 ALA ALA A . n 
A 1 300 MET 300 369 369 MET MET A . n 
A 1 301 ASP 301 370 370 ASP ASP A . n 
A 1 302 ILE 302 371 371 ILE ILE A . n 
A 1 303 PRO 303 372 372 PRO PRO A . n 
A 1 304 PRO 304 373 373 PRO PRO A . n 
A 1 305 PRO 305 374 374 PRO PRO A . n 
A 1 306 THR 306 375 375 THR THR A . n 
A 1 307 GLY 307 376 376 GLY GLY A . n 
A 1 308 PRO 308 377 377 PRO PRO A . n 
A 1 309 THR 309 378 378 THR THR A . n 
A 1 310 TRP 310 379 379 TRP TRP A . n 
A 1 311 ALA 311 380 380 ALA ALA A . n 
A 1 312 LEU 312 381 381 LEU LEU A . n 
A 1 313 GLY 313 382 382 GLY GLY A . n 
A 1 314 ALA 314 383 383 ALA ALA A . n 
A 1 315 THR 315 384 384 THR THR A . n 
A 1 316 PHE 316 385 385 PHE PHE A . n 
A 1 317 ILE 317 386 386 ILE ILE A . n 
A 1 318 ARG 318 387 387 ARG ARG A . n 
A 1 319 LYS 319 388 388 LYS LYS A . n 
A 1 320 PHE 320 389 389 PHE PHE A . n 
A 1 321 TYR 321 390 390 TYR TYR A . n 
A 1 322 THR 322 391 391 THR THR A . n 
A 1 323 GLU 323 392 392 GLU GLU A . n 
A 1 324 PHE 324 393 393 PHE PHE A . n 
A 1 325 ASP 325 394 394 ASP ASP A . n 
A 1 326 ARG 326 395 395 ARG ARG A . n 
A 1 327 ARG 327 396 396 ARG ARG A . n 
A 1 328 ASN 328 397 397 ASN ASN A . n 
A 1 329 ASN 329 398 398 ASN ASN A . n 
A 1 330 ARG 330 399 399 ARG ARG A . n 
A 1 331 ILE 331 400 400 ILE ILE A . n 
A 1 332 GLY 332 401 401 GLY GLY A . n 
A 1 333 PHE 333 402 402 PHE PHE A . n 
A 1 334 ALA 334 403 403 ALA ALA A . n 
A 1 335 LEU 335 404 404 LEU LEU A . n 
A 1 336 ALA 336 405 405 ALA ALA A . n 
A 1 337 ARG 337 406 406 ARG ARG A . n 
B 1 1   GLY 1   70  70  GLY GLY B . n 
B 1 2   ASN 2   71  71  ASN ASN B . n 
B 1 3   THR 3   72  72  THR THR B . n 
B 1 4   THR 4   73  73  THR THR B . n 
B 1 5   SER 5   74  74  SER SER B . n 
B 1 6   SER 6   75  75  SER SER B . n 
B 1 7   VAL 7   76  76  VAL VAL B . n 
B 1 8   ILE 8   77  77  ILE ILE B . n 
B 1 9   LEU 9   78  78  LEU LEU B . n 
B 1 10  THR 10  79  79  THR THR B . n 
B 1 11  ASN 11  80  80  ASN ASN B . n 
B 1 12  TYR 12  81  81  TYR TYR B . n 
B 1 13  MET 13  82  82  MET MET B . n 
B 1 14  ASP 14  83  83  ASP ASP B . n 
B 1 15  THR 15  84  84  THR THR B . n 
B 1 16  GLN 16  85  85  GLN GLN B . n 
B 1 17  TYR 17  86  86  TYR TYR B . n 
B 1 18  TYR 18  87  87  TYR TYR B . n 
B 1 19  GLY 19  88  88  GLY GLY B . n 
B 1 20  GLU 20  89  89  GLU GLU B . n 
B 1 21  ILE 21  90  90  ILE ILE B . n 
B 1 22  GLY 22  91  91  GLY GLY B . n 
B 1 23  ILE 23  92  92  ILE ILE B . n 
B 1 24  GLY 24  93  93  GLY GLY B . n 
B 1 25  THR 25  94  94  THR THR B . n 
B 1 26  PRO 26  95  95  PRO PRO B . n 
B 1 27  PRO 27  96  96  PRO PRO B . n 
B 1 28  GLN 28  97  97  GLN GLN B . n 
B 1 29  THR 29  98  98  THR THR B . n 
B 1 30  PHE 30  99  99  PHE PHE B . n 
B 1 31  LYS 31  100 100 LYS LYS B . n 
B 1 32  VAL 32  101 101 VAL VAL B . n 
B 1 33  VAL 33  102 102 VAL VAL B . n 
B 1 34  PHE 34  103 103 PHE PHE B . n 
B 1 35  ASP 35  104 104 ASP ASP B . n 
B 1 36  THR 36  105 105 THR THR B . n 
B 1 37  GLY 37  106 106 GLY GLY B . n 
B 1 38  SER 38  107 107 SER SER B . n 
B 1 39  SER 39  108 108 SER SER B . n 
B 1 40  ASN 40  109 109 ASN ASN B . n 
B 1 41  VAL 41  110 110 VAL VAL B . n 
B 1 42  TRP 42  111 111 TRP TRP B . n 
B 1 43  VAL 43  112 112 VAL VAL B . n 
B 1 44  PRO 44  113 113 PRO PRO B . n 
B 1 45  SER 45  114 114 SER SER B . n 
B 1 46  SER 46  115 115 SER SER B . n 
B 1 47  LYS 47  116 116 LYS LYS B . n 
B 1 48  CYS 48  117 117 CYS CYS B . n 
B 1 49  SER 49  118 118 SER SER B . n 
B 1 50  ARG 50  119 119 ARG ARG B . n 
B 1 51  LEU 51  120 120 LEU LEU B . n 
B 1 52  TYR 52  121 121 TYR TYR B . n 
B 1 53  THR 53  122 122 THR THR B . n 
B 1 54  ALA 54  123 123 ALA ALA B . n 
B 1 55  CYS 55  124 124 CYS CYS B . n 
B 1 56  VAL 56  125 125 VAL VAL B . n 
B 1 57  TYR 57  126 126 TYR TYR B . n 
B 1 58  HIS 58  127 127 HIS HIS B . n 
B 1 59  LYS 59  128 128 LYS LYS B . n 
B 1 60  LEU 60  129 129 LEU LEU B . n 
B 1 61  PHE 61  130 130 PHE PHE B . n 
B 1 62  ASP 62  131 131 ASP ASP B . n 
B 1 63  ALA 63  132 132 ALA ALA B . n 
B 1 64  SER 64  133 133 SER SER B . n 
B 1 65  ASP 65  134 134 ASP ASP B . n 
B 1 66  SER 66  135 135 SER SER B . n 
B 1 67  SER 67  136 136 SER SER B . n 
B 1 68  SER 68  137 137 SER SER B . n 
B 1 69  TYR 69  138 138 TYR TYR B . n 
B 1 70  LYS 70  139 139 LYS LYS B . n 
B 1 71  HIS 71  140 140 HIS HIS B . n 
B 1 72  ASN 72  141 141 ASN ASN B . n 
B 1 73  GLY 73  142 142 GLY GLY B . n 
B 1 74  THR 74  143 143 THR THR B . n 
B 1 75  GLU 75  144 144 GLU GLU B . n 
B 1 76  LEU 76  145 145 LEU LEU B . n 
B 1 77  THR 77  146 146 THR THR B . n 
B 1 78  LEU 78  147 147 LEU LEU B . n 
B 1 79  ARG 79  148 148 ARG ARG B . n 
B 1 80  TYR 80  149 149 TYR TYR B . n 
B 1 81  SER 81  150 150 SER SER B . n 
B 1 82  THR 82  151 151 THR THR B . n 
B 1 83  GLY 83  152 152 GLY GLY B . n 
B 1 84  THR 84  153 153 THR THR B . n 
B 1 85  VAL 85  154 154 VAL VAL B . n 
B 1 86  SER 86  155 155 SER SER B . n 
B 1 87  GLY 87  156 156 GLY GLY B . n 
B 1 88  PHE 88  157 157 PHE PHE B . n 
B 1 89  LEU 89  158 158 LEU LEU B . n 
B 1 90  SER 90  159 159 SER SER B . n 
B 1 91  GLN 91  160 160 GLN GLN B . n 
B 1 92  ASP 92  161 161 ASP ASP B . n 
B 1 93  ILE 93  162 162 ILE ILE B . n 
B 1 94  ILE 94  163 163 ILE ILE B . n 
B 1 95  THR 95  164 164 THR THR B . n 
B 1 96  VAL 96  165 165 VAL VAL B . n 
B 1 97  GLY 97  166 166 GLY GLY B . n 
B 1 98  GLY 98  167 167 GLY GLY B . n 
B 1 99  ILE 99  168 168 ILE ILE B . n 
B 1 100 THR 100 169 169 THR THR B . n 
B 1 101 VAL 101 170 170 VAL VAL B . n 
B 1 102 THR 102 171 171 THR THR B . n 
B 1 103 GLN 103 172 172 GLN GLN B . n 
B 1 104 MET 104 173 173 MET MET B . n 
B 1 105 PHE 105 174 174 PHE PHE B . n 
B 1 106 GLY 106 175 175 GLY GLY B . n 
B 1 107 GLU 107 176 176 GLU GLU B . n 
B 1 108 VAL 108 177 177 VAL VAL B . n 
B 1 109 THR 109 178 178 THR THR B . n 
B 1 110 GLU 110 179 179 GLU GLU B . n 
B 1 111 MET 111 180 180 MET MET B . n 
B 1 112 PRO 112 181 181 PRO PRO B . n 
B 1 113 ALA 113 182 182 ALA ALA B . n 
B 1 114 LEU 114 183 183 LEU LEU B . n 
B 1 115 PRO 115 184 184 PRO PRO B . n 
B 1 116 PHE 116 185 185 PHE PHE B . n 
B 1 117 MET 117 186 186 MET MET B . n 
B 1 118 LEU 118 187 187 LEU LEU B . n 
B 1 119 ALA 119 188 188 ALA ALA B . n 
B 1 120 GLU 120 189 189 GLU GLU B . n 
B 1 121 PHE 121 190 190 PHE PHE B . n 
B 1 122 ASP 122 191 191 ASP ASP B . n 
B 1 123 GLY 123 192 192 GLY GLY B . n 
B 1 124 VAL 124 193 193 VAL VAL B . n 
B 1 125 VAL 125 194 194 VAL VAL B . n 
B 1 126 GLY 126 195 195 GLY GLY B . n 
B 1 127 MET 127 196 196 MET MET B . n 
B 1 128 GLY 128 197 197 GLY GLY B . n 
B 1 129 PHE 129 198 198 PHE PHE B . n 
B 1 130 ILE 130 199 199 ILE ILE B . n 
B 1 131 GLU 131 200 200 GLU GLU B . n 
B 1 132 GLN 132 201 201 GLN GLN B . n 
B 1 133 ALA 133 202 202 ALA ALA B . n 
B 1 134 ILE 134 203 203 ILE ILE B . n 
B 1 135 GLY 135 204 204 GLY GLY B . n 
B 1 136 ARG 136 205 205 ARG ARG B . n 
B 1 137 VAL 137 206 206 VAL VAL B . n 
B 1 138 THR 138 207 207 THR THR B . n 
B 1 139 PRO 139 208 208 PRO PRO B . n 
B 1 140 ILE 140 209 209 ILE ILE B . n 
B 1 141 PHE 141 210 210 PHE PHE B . n 
B 1 142 ASP 142 211 211 ASP ASP B . n 
B 1 143 ASN 143 212 212 ASN ASN B . n 
B 1 144 ILE 144 213 213 ILE ILE B . n 
B 1 145 ILE 145 214 214 ILE ILE B . n 
B 1 146 SER 146 215 215 SER SER B . n 
B 1 147 GLN 147 216 216 GLN GLN B . n 
B 1 148 GLY 148 217 217 GLY GLY B . n 
B 1 149 VAL 149 218 218 VAL VAL B . n 
B 1 150 LEU 150 219 219 LEU LEU B . n 
B 1 151 LYS 151 220 220 LYS LYS B . n 
B 1 152 GLU 152 221 221 GLU GLU B . n 
B 1 153 ASP 153 222 222 ASP ASP B . n 
B 1 154 VAL 154 223 223 VAL VAL B . n 
B 1 155 PHE 155 224 224 PHE PHE B . n 
B 1 156 SER 156 225 225 SER SER B . n 
B 1 157 PHE 157 226 226 PHE PHE B . n 
B 1 158 TYR 158 227 227 TYR TYR B . n 
B 1 159 TYR 159 228 228 TYR TYR B . n 
B 1 160 ASN 160 229 229 ASN ASN B . n 
B 1 161 ARG 161 230 230 ARG ARG B . n 
B 1 162 ASP 162 231 231 ASP ASP B . n 
B 1 163 SER 163 232 232 SER SER B . n 
B 1 164 GLU 164 233 233 GLU GLU B . n 
B 1 165 ASN 165 234 234 ASN ASN B . n 
B 1 166 SER 166 235 235 SER SER B . n 
B 1 167 GLN 167 236 236 GLN GLN B . n 
B 1 168 SER 168 237 237 SER SER B . n 
B 1 169 LEU 169 238 238 LEU LEU B . n 
B 1 170 GLY 170 239 239 GLY GLY B . n 
B 1 171 GLY 171 240 240 GLY GLY B . n 
B 1 172 GLN 172 241 241 GLN GLN B . n 
B 1 173 ILE 173 242 242 ILE ILE B . n 
B 1 174 VAL 174 243 243 VAL VAL B . n 
B 1 175 LEU 175 244 244 LEU LEU B . n 
B 1 176 GLY 176 245 245 GLY GLY B . n 
B 1 177 GLY 177 246 246 GLY GLY B . n 
B 1 178 SER 178 247 247 SER SER B . n 
B 1 179 ASP 179 248 248 ASP ASP B . n 
B 1 180 PRO 180 249 249 PRO PRO B . n 
B 1 181 GLN 181 250 250 GLN GLN B . n 
B 1 182 HIS 182 251 251 HIS HIS B . n 
B 1 183 TYR 183 252 252 TYR TYR B . n 
B 1 184 GLU 184 253 253 GLU GLU B . n 
B 1 185 GLY 185 254 254 GLY GLY B . n 
B 1 186 ASN 186 255 255 ASN ASN B . n 
B 1 187 PHE 187 256 256 PHE PHE B . n 
B 1 188 HIS 188 257 257 HIS HIS B . n 
B 1 189 TYR 189 258 258 TYR TYR B . n 
B 1 190 ILE 190 259 259 ILE ILE B . n 
B 1 191 ASN 191 260 260 ASN ASN B . n 
B 1 192 LEU 192 261 261 LEU LEU B . n 
B 1 193 ILE 193 262 262 ILE ILE B . n 
B 1 194 LYS 194 263 263 LYS LYS B . n 
B 1 195 THR 195 264 264 THR THR B . n 
B 1 196 GLY 196 265 265 GLY GLY B . n 
B 1 197 VAL 197 266 266 VAL VAL B . n 
B 1 198 TRP 198 267 267 TRP TRP B . n 
B 1 199 GLN 199 268 268 GLN GLN B . n 
B 1 200 ILE 200 269 269 ILE ILE B . n 
B 1 201 GLN 201 270 270 GLN GLN B . n 
B 1 202 MET 202 271 271 MET MET B . n 
B 1 203 LYS 203 272 272 LYS LYS B . n 
B 1 204 GLY 204 273 273 GLY GLY B . n 
B 1 205 VAL 205 274 274 VAL VAL B . n 
B 1 206 SER 206 275 275 SER SER B . n 
B 1 207 VAL 207 276 276 VAL VAL B . n 
B 1 208 GLY 208 277 277 GLY GLY B . n 
B 1 209 SER 209 278 278 SER SER B . n 
B 1 210 SER 210 279 279 SER SER B . n 
B 1 211 THR 211 280 280 THR THR B . n 
B 1 212 LEU 212 281 281 LEU LEU B . n 
B 1 213 LEU 213 282 282 LEU LEU B . n 
B 1 214 CYS 214 283 283 CYS CYS B . n 
B 1 215 GLU 215 284 284 GLU GLU B . n 
B 1 216 ASP 216 285 285 ASP ASP B . n 
B 1 217 GLY 217 286 286 GLY GLY B . n 
B 1 218 CYS 218 287 287 CYS CYS B . n 
B 1 219 LEU 219 288 288 LEU LEU B . n 
B 1 220 ALA 220 289 289 ALA ALA B . n 
B 1 221 LEU 221 290 290 LEU LEU B . n 
B 1 222 VAL 222 291 291 VAL VAL B . n 
B 1 223 ASP 223 292 292 ASP ASP B . n 
B 1 224 THR 224 293 293 THR THR B . n 
B 1 225 GLY 225 294 294 GLY GLY B . n 
B 1 226 ALA 226 295 295 ALA ALA B . n 
B 1 227 SER 227 296 296 SER SER B . n 
B 1 228 TYR 228 297 297 TYR TYR B . n 
B 1 229 ILE 229 298 298 ILE ILE B . n 
B 1 230 SER 230 299 299 SER SER B . n 
B 1 231 GLY 231 300 300 GLY GLY B . n 
B 1 232 SER 232 301 301 SER SER B . n 
B 1 233 THR 233 302 302 THR THR B . n 
B 1 234 SER 234 303 303 SER SER B . n 
B 1 235 SER 235 304 304 SER SER B . n 
B 1 236 ILE 236 305 305 ILE ILE B . n 
B 1 237 GLU 237 306 306 GLU GLU B . n 
B 1 238 LYS 238 307 307 LYS LYS B . n 
B 1 239 LEU 239 308 308 LEU LEU B . n 
B 1 240 MET 240 309 309 MET MET B . n 
B 1 241 GLU 241 310 310 GLU GLU B . n 
B 1 242 ALA 242 311 311 ALA ALA B . n 
B 1 243 LEU 243 312 312 LEU LEU B . n 
B 1 244 GLY 244 313 313 GLY GLY B . n 
B 1 245 ALA 245 314 314 ALA ALA B . n 
B 1 246 LYS 246 315 315 LYS LYS B . n 
B 1 247 LYS 247 316 316 LYS LYS B . n 
B 1 248 ARG 248 317 317 ARG ARG B . n 
B 1 249 LEU 249 318 318 LEU LEU B . n 
B 1 250 PHE 250 319 319 PHE PHE B . n 
B 1 251 ASP 251 320 320 ASP ASP B . n 
B 1 252 TYR 252 321 321 TYR TYR B . n 
B 1 253 VAL 253 322 322 VAL VAL B . n 
B 1 254 VAL 254 323 323 VAL VAL B . n 
B 1 255 LYS 255 324 324 LYS LYS B . n 
B 1 256 CYS 256 325 325 CYS CYS B . n 
B 1 257 ASN 257 326 326 ASN ASN B . n 
B 1 258 GLU 258 327 327 GLU GLU B . n 
B 1 259 GLY 259 328 328 GLY GLY B . n 
B 1 260 PRO 260 329 329 PRO PRO B . n 
B 1 261 THR 261 330 330 THR THR B . n 
B 1 262 LEU 262 331 331 LEU LEU B . n 
B 1 263 PRO 263 332 332 PRO PRO B . n 
B 1 264 ASP 264 333 333 ASP ASP B . n 
B 1 265 ILE 265 334 334 ILE ILE B . n 
B 1 266 SER 266 335 335 SER SER B . n 
B 1 267 PHE 267 336 336 PHE PHE B . n 
B 1 268 HIS 268 337 337 HIS HIS B . n 
B 1 269 LEU 269 338 338 LEU LEU B . n 
B 1 270 GLY 270 339 339 GLY GLY B . n 
B 1 271 GLY 271 340 340 GLY GLY B . n 
B 1 272 LYS 272 341 341 LYS LYS B . n 
B 1 273 GLU 273 342 342 GLU GLU B . n 
B 1 274 TYR 274 343 343 TYR TYR B . n 
B 1 275 THR 275 344 344 THR THR B . n 
B 1 276 LEU 276 345 345 LEU LEU B . n 
B 1 277 THR 277 346 346 THR THR B . n 
B 1 278 SER 278 347 347 SER SER B . n 
B 1 279 ALA 279 348 348 ALA ALA B . n 
B 1 280 ASP 280 349 349 ASP ASP B . n 
B 1 281 TYR 281 350 350 TYR TYR B . n 
B 1 282 VAL 282 351 351 VAL VAL B . n 
B 1 283 PHE 283 352 352 PHE PHE B . n 
B 1 284 GLN 284 353 353 GLN GLN B . n 
B 1 285 GLU 285 354 354 GLU GLU B . n 
B 1 286 SER 286 355 355 SER SER B . n 
B 1 287 TYR 287 356 356 TYR TYR B . n 
B 1 288 SER 288 357 357 SER SER B . n 
B 1 289 SER 289 358 358 SER SER B . n 
B 1 290 LYS 290 359 359 LYS LYS B . n 
B 1 291 LYS 291 360 360 LYS LYS B . n 
B 1 292 LEU 292 361 361 LEU LEU B . n 
B 1 293 CYS 293 362 362 CYS CYS B . n 
B 1 294 THR 294 363 363 THR THR B . n 
B 1 295 LEU 295 364 364 LEU LEU B . n 
B 1 296 ALA 296 365 365 ALA ALA B . n 
B 1 297 ILE 297 366 366 ILE ILE B . n 
B 1 298 HIS 298 367 367 HIS HIS B . n 
B 1 299 ALA 299 368 368 ALA ALA B . n 
B 1 300 MET 300 369 369 MET MET B . n 
B 1 301 ASP 301 370 370 ASP ASP B . n 
B 1 302 ILE 302 371 371 ILE ILE B . n 
B 1 303 PRO 303 372 372 PRO PRO B . n 
B 1 304 PRO 304 373 373 PRO PRO B . n 
B 1 305 PRO 305 374 374 PRO PRO B . n 
B 1 306 THR 306 375 375 THR THR B . n 
B 1 307 GLY 307 376 376 GLY GLY B . n 
B 1 308 PRO 308 377 377 PRO PRO B . n 
B 1 309 THR 309 378 378 THR THR B . n 
B 1 310 TRP 310 379 379 TRP TRP B . n 
B 1 311 ALA 311 380 380 ALA ALA B . n 
B 1 312 LEU 312 381 381 LEU LEU B . n 
B 1 313 GLY 313 382 382 GLY GLY B . n 
B 1 314 ALA 314 383 383 ALA ALA B . n 
B 1 315 THR 315 384 384 THR THR B . n 
B 1 316 PHE 316 385 385 PHE PHE B . n 
B 1 317 ILE 317 386 386 ILE ILE B . n 
B 1 318 ARG 318 387 387 ARG ARG B . n 
B 1 319 LYS 319 388 388 LYS LYS B . n 
B 1 320 PHE 320 389 389 PHE PHE B . n 
B 1 321 TYR 321 390 390 TYR TYR B . n 
B 1 322 THR 322 391 391 THR THR B . n 
B 1 323 GLU 323 392 392 GLU GLU B . n 
B 1 324 PHE 324 393 393 PHE PHE B . n 
B 1 325 ASP 325 394 394 ASP ASP B . n 
B 1 326 ARG 326 395 395 ARG ARG B . n 
B 1 327 ARG 327 396 396 ARG ARG B . n 
B 1 328 ASN 328 397 397 ASN ASN B . n 
B 1 329 ASN 329 398 398 ASN ASN B . n 
B 1 330 ARG 330 399 399 ARG ARG B . n 
B 1 331 ILE 331 400 400 ILE ILE B . n 
B 1 332 GLY 332 401 401 GLY GLY B . n 
B 1 333 PHE 333 402 402 PHE PHE B . n 
B 1 334 ALA 334 403 403 ALA ALA B . n 
B 1 335 LEU 335 404 404 LEU LEU B . n 
B 1 336 ALA 336 405 405 ALA ALA B . n 
B 1 337 ARG 337 406 406 ARG ARG B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 NAG 1  501 1  NAG NAG A . 
D 3 90D 1  502 3  90D 811 A . 
E 3 90D 1  503 4  90D 811 A . 
F 2 NAG 1  501 2  NAG NAG B . 
G 3 90D 1  502 1  90D 811 B . 
H 3 90D 1  503 2  90D 811 B . 
I 4 HOH 1  601 44 HOH HOH A . 
I 4 HOH 2  602 82 HOH HOH A . 
I 4 HOH 3  603 81 HOH HOH A . 
I 4 HOH 4  604 56 HOH HOH A . 
I 4 HOH 5  605 16 HOH HOH A . 
I 4 HOH 6  606 41 HOH HOH A . 
I 4 HOH 7  607 72 HOH HOH A . 
I 4 HOH 8  608 12 HOH HOH A . 
I 4 HOH 9  609 37 HOH HOH A . 
I 4 HOH 10 610 38 HOH HOH A . 
I 4 HOH 11 611 61 HOH HOH A . 
I 4 HOH 12 612 73 HOH HOH A . 
I 4 HOH 13 613 10 HOH HOH A . 
I 4 HOH 14 614 23 HOH HOH A . 
I 4 HOH 15 615 13 HOH HOH A . 
I 4 HOH 16 616 14 HOH HOH A . 
I 4 HOH 17 617 30 HOH HOH A . 
I 4 HOH 18 618 26 HOH HOH A . 
I 4 HOH 19 619 45 HOH HOH A . 
I 4 HOH 20 620 80 HOH HOH A . 
I 4 HOH 21 621 77 HOH HOH A . 
I 4 HOH 22 622 70 HOH HOH A . 
I 4 HOH 23 623 11 HOH HOH A . 
I 4 HOH 24 624 51 HOH HOH A . 
I 4 HOH 25 625 47 HOH HOH A . 
I 4 HOH 26 626 27 HOH HOH A . 
I 4 HOH 27 627 21 HOH HOH A . 
I 4 HOH 28 628 8  HOH HOH A . 
I 4 HOH 29 629 19 HOH HOH A . 
I 4 HOH 30 630 65 HOH HOH A . 
I 4 HOH 31 631 2  HOH HOH A . 
I 4 HOH 32 632 57 HOH HOH A . 
I 4 HOH 33 633 40 HOH HOH A . 
I 4 HOH 34 634 52 HOH HOH A . 
I 4 HOH 35 635 85 HOH HOH A . 
I 4 HOH 36 636 64 HOH HOH A . 
I 4 HOH 37 637 63 HOH HOH A . 
I 4 HOH 38 638 32 HOH HOH A . 
I 4 HOH 39 639 86 HOH HOH A . 
I 4 HOH 40 640 3  HOH HOH A . 
I 4 HOH 41 641 22 HOH HOH A . 
I 4 HOH 42 642 66 HOH HOH A . 
I 4 HOH 43 643 60 HOH HOH A . 
I 4 HOH 44 644 62 HOH HOH A . 
I 4 HOH 45 645 74 HOH HOH A . 
J 4 HOH 1  601 18 HOH HOH B . 
J 4 HOH 2  602 83 HOH HOH B . 
J 4 HOH 3  603 68 HOH HOH B . 
J 4 HOH 4  604 67 HOH HOH B . 
J 4 HOH 5  605 6  HOH HOH B . 
J 4 HOH 6  606 29 HOH HOH B . 
J 4 HOH 7  607 54 HOH HOH B . 
J 4 HOH 8  608 78 HOH HOH B . 
J 4 HOH 9  609 15 HOH HOH B . 
J 4 HOH 10 610 31 HOH HOH B . 
J 4 HOH 11 611 53 HOH HOH B . 
J 4 HOH 12 612 71 HOH HOH B . 
J 4 HOH 13 613 84 HOH HOH B . 
J 4 HOH 14 614 5  HOH HOH B . 
J 4 HOH 15 615 75 HOH HOH B . 
J 4 HOH 16 616 69 HOH HOH B . 
J 4 HOH 17 617 79 HOH HOH B . 
J 4 HOH 18 618 59 HOH HOH B . 
J 4 HOH 19 619 50 HOH HOH B . 
J 4 HOH 20 620 36 HOH HOH B . 
J 4 HOH 21 621 49 HOH HOH B . 
J 4 HOH 22 622 48 HOH HOH B . 
J 4 HOH 23 623 35 HOH HOH B . 
J 4 HOH 24 624 43 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,I 
2 1 B,F,G,H,J 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-10-18 
2 'Structure model' 1 1 2017-10-25 
3 'Structure model' 1 2 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 3 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'  
2 3 'Structure model' 'Data collection'      
3 3 'Structure model' 'Derived calculations' 
4 3 'Structure model' 'Structure summary'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation                  
2 3 'Structure model' chem_comp                 
3 3 'Structure model' entity                    
4 3 'Structure model' pdbx_chem_comp_identifier 
5 3 'Structure model' pdbx_entity_nonpoly       
6 3 'Structure model' struct_conn               
7 3 'Structure model' struct_site               
8 3 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_volume'  
2 2 'Structure model' '_citation.page_first'      
3 2 'Structure model' '_citation.page_last'       
4 3 'Structure model' '_chem_comp.name'           
5 3 'Structure model' '_chem_comp.type'           
6 3 'Structure model' '_entity.pdbx_description'  
7 3 'Structure model' '_pdbx_entity_nonpoly.name' 
8 3 'Structure model' '_struct_conn.pdbx_role'    
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 29.6972 46.1374 9.2184  0.1299 0.0883 0.1645 -0.0140 -0.0036 -0.0419 0.8648 0.3377 1.1006 0.0561 
0.0354  -0.1273 0.0105  0.0029  0.0940  -0.0147 0.0782 -0.0088 -0.0486 0.0445  0.0008 
'X-RAY DIFFRACTION' 2 ? refined 14.5205 19.4023 28.2006 0.1535 0.1896 0.1357 0.0521  0.0027  0.0513  0.5323 0.7507 0.9045 0.3738 
-0.0313 -0.3637 -0.0607 -0.1584 -0.0254 0.0488  0.1351 0.0964  -0.0740 -0.1466 0.0055 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? 'chain A' 
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? 'chain B' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX    ? ? ? '(1.11.1_2575: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DENZO     ? ? ? .                    2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? .                    3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER    ? ? ? .                    4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 ND2 A ASN 141 ? ? C2  A NAG 501 ? ? 2.11 
2 1 OD1 A ASP 211 ? ? NH1 A ARG 395 ? ? 2.13 
3 1 NZ  B LYS 220 ? ? O   B HOH 601 ? ? 2.17 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 141 ? ? -122.79 -55.59 
2 1 LYS A 359 ? ? -97.52  31.55  
3 1 ASN B 71  ? ? -143.06 19.01  
4 1 ASN B 141 ? ? -122.86 -50.15 
5 1 GLU B 233 ? ? 70.37   -0.25  
6 1 SER B 358 ? ? -69.97  1.39   
7 1 ALA B 365 ? ? -83.35  49.07  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASN 71  ? CG  ? A ASN 2   CG  
2  1 Y 1 A ASN 71  ? OD1 ? A ASN 2   OD1 
3  1 Y 1 A ASN 71  ? ND2 ? A ASN 2   ND2 
4  1 Y 1 A THR 73  ? OG1 ? A THR 4   OG1 
5  1 Y 1 A THR 73  ? CG2 ? A THR 4   CG2 
6  1 Y 1 A TYR 126 ? CG  ? A TYR 57  CG  
7  1 Y 1 A TYR 126 ? CD1 ? A TYR 57  CD1 
8  1 Y 1 A TYR 126 ? CD2 ? A TYR 57  CD2 
9  1 Y 1 A TYR 126 ? CE1 ? A TYR 57  CE1 
10 1 Y 1 A TYR 126 ? CE2 ? A TYR 57  CE2 
11 1 Y 1 A TYR 126 ? CZ  ? A TYR 57  CZ  
12 1 Y 1 A TYR 126 ? OH  ? A TYR 57  OH  
13 1 Y 1 A GLU 144 ? CG  ? A GLU 75  CG  
14 1 Y 1 A GLU 144 ? CD  ? A GLU 75  CD  
15 1 Y 1 A GLU 144 ? OE1 ? A GLU 75  OE1 
16 1 Y 1 A GLU 144 ? OE2 ? A GLU 75  OE2 
17 1 Y 1 A ILE 162 ? CD1 ? A ILE 93  CD1 
18 1 Y 1 A GLU 233 ? CG  ? A GLU 164 CG  
19 1 Y 1 A GLU 233 ? CD  ? A GLU 164 CD  
20 1 Y 1 A GLU 233 ? OE1 ? A GLU 164 OE1 
21 1 Y 1 A GLU 233 ? OE2 ? A GLU 164 OE2 
22 1 Y 1 A ASN 234 ? CG  ? A ASN 165 CG  
23 1 Y 1 A ASN 234 ? OD1 ? A ASN 165 OD1 
24 1 Y 1 A ASN 234 ? ND2 ? A ASN 165 ND2 
25 1 Y 1 A SER 235 ? OG  ? A SER 166 OG  
26 1 Y 1 A GLN 236 ? CG  ? A GLN 167 CG  
27 1 Y 1 A GLN 236 ? CD  ? A GLN 167 CD  
28 1 Y 1 A GLN 236 ? OE1 ? A GLN 167 OE1 
29 1 Y 1 A GLN 236 ? NE2 ? A GLN 167 NE2 
30 1 Y 1 A SER 237 ? OG  ? A SER 168 OG  
31 1 Y 1 A GLN 250 ? CG  ? A GLN 181 CG  
32 1 Y 1 A GLN 250 ? CD  ? A GLN 181 CD  
33 1 Y 1 A GLN 250 ? OE1 ? A GLN 181 OE1 
34 1 Y 1 A GLN 250 ? NE2 ? A GLN 181 NE2 
35 1 Y 1 A LYS 272 ? CD  ? A LYS 203 CD  
36 1 Y 1 A LYS 272 ? CE  ? A LYS 203 CE  
37 1 Y 1 A LYS 272 ? NZ  ? A LYS 203 NZ  
38 1 Y 1 A SER 279 ? OG  ? A SER 210 OG  
39 1 Y 1 A LEU 281 ? CG  ? A LEU 212 CG  
40 1 Y 1 A LEU 281 ? CD1 ? A LEU 212 CD1 
41 1 Y 1 A LEU 281 ? CD2 ? A LEU 212 CD2 
42 1 Y 1 A GLU 306 ? CG  ? A GLU 237 CG  
43 1 Y 1 A GLU 306 ? CD  ? A GLU 237 CD  
44 1 Y 1 A GLU 306 ? OE1 ? A GLU 237 OE1 
45 1 Y 1 A GLU 306 ? OE2 ? A GLU 237 OE2 
46 1 Y 1 A LYS 307 ? CE  ? A LYS 238 CE  
47 1 Y 1 A LYS 307 ? NZ  ? A LYS 238 NZ  
48 1 Y 1 A GLU 354 ? CG  ? A GLU 285 CG  
49 1 Y 1 A GLU 354 ? CD  ? A GLU 285 CD  
50 1 Y 1 A GLU 354 ? OE1 ? A GLU 285 OE1 
51 1 Y 1 A GLU 354 ? OE2 ? A GLU 285 OE2 
52 1 Y 1 B THR 72  ? OG1 ? B THR 3   OG1 
53 1 Y 1 B THR 72  ? CG2 ? B THR 3   CG2 
54 1 Y 1 B ARG 119 ? CG  ? B ARG 50  CG  
55 1 Y 1 B ARG 119 ? CD  ? B ARG 50  CD  
56 1 Y 1 B ARG 119 ? NE  ? B ARG 50  NE  
57 1 Y 1 B ARG 119 ? CZ  ? B ARG 50  CZ  
58 1 Y 1 B ARG 119 ? NH1 ? B ARG 50  NH1 
59 1 Y 1 B ARG 119 ? NH2 ? B ARG 50  NH2 
60 1 Y 1 B SER 136 ? OG  ? B SER 67  OG  
61 1 Y 1 B LYS 139 ? CE  ? B LYS 70  CE  
62 1 Y 1 B LYS 139 ? NZ  ? B LYS 70  NZ  
63 1 Y 1 B ILE 162 ? CG1 ? B ILE 93  CG1 
64 1 Y 1 B ILE 162 ? CG2 ? B ILE 93  CG2 
65 1 Y 1 B ILE 162 ? CD1 ? B ILE 93  CD1 
66 1 Y 1 B SER 232 ? OG  ? B SER 163 OG  
67 1 Y 1 B GLU 233 ? CG  ? B GLU 164 CG  
68 1 Y 1 B GLU 233 ? CD  ? B GLU 164 CD  
69 1 Y 1 B GLU 233 ? OE1 ? B GLU 164 OE1 
70 1 Y 1 B GLU 233 ? OE2 ? B GLU 164 OE2 
71 1 Y 1 B ASN 234 ? CG  ? B ASN 165 CG  
72 1 Y 1 B ASN 234 ? OD1 ? B ASN 165 OD1 
73 1 Y 1 B ASN 234 ? ND2 ? B ASN 165 ND2 
74 1 Y 1 B SER 235 ? OG  ? B SER 166 OG  
75 1 Y 1 B GLN 236 ? CG  ? B GLN 167 CG  
76 1 Y 1 B GLN 236 ? CD  ? B GLN 167 CD  
77 1 Y 1 B GLN 236 ? OE1 ? B GLN 167 OE1 
78 1 Y 1 B GLN 236 ? NE2 ? B GLN 167 NE2 
79 1 Y 1 B LYS 272 ? CG  ? B LYS 203 CG  
80 1 Y 1 B LYS 272 ? CD  ? B LYS 203 CD  
81 1 Y 1 B LYS 272 ? CE  ? B LYS 203 CE  
82 1 Y 1 B LYS 272 ? NZ  ? B LYS 203 NZ  
83 1 Y 1 B GLU 284 ? CG  ? B GLU 215 CG  
84 1 Y 1 B GLU 284 ? CD  ? B GLU 215 CD  
85 1 Y 1 B GLU 284 ? OE1 ? B GLU 215 OE1 
86 1 Y 1 B GLU 284 ? OE2 ? B GLU 215 OE2 
87 1 Y 1 B ASP 285 ? CG  ? B ASP 216 CG  
88 1 Y 1 B ASP 285 ? OD1 ? B ASP 216 OD1 
89 1 Y 1 B ASP 285 ? OD2 ? B ASP 216 OD2 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
3 
;methyl [(4S)-4-(3'-ethyl-6-fluoro[1,1'-biphenyl]-2-yl)-4-hydroxy-4-{(3R)-1-[4-(methylamino)butanoyl]piperidin-3-yl}butyl]carbamate
;
90D 
4 water HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#