data_5VO8
# 
_entry.id   5VO8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5VO8         
WWPDB D_1000227749 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
_pdbx_database_related.db_id          5VOI 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5VO8 
_pdbx_database_status.recvd_initial_deposition_date   2017-05-02 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Murakami, K.S.'     1 ? 
'Shin, Y.'           2 ? 
'Turnbough Jr, C.L.' 3 ? 
'Molodtsov, V.'      4 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Proc. Natl. Acad. Sci. U.S.A.' 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            114 
_citation.language                  ? 
_citation.page_first                8211 
_citation.page_last                 8216 
_citation.title                     
'X-ray crystal structure of a reiterative transcription complex reveals an atypical RNA extension pathway.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1702741114 
_citation.pdbx_database_id_PubMed   28652344 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Murakami, K.S.'  1 ? 
primary 'Shin, Y.'        2 ? 
primary 'Turnbough, C.L.' 3 ? 
primary 'Molodtsov, V.'   4 ? 
# 
_cell.entry_id           5VO8 
_cell.length_a           186.537 
_cell.length_b           101.984 
_cell.length_c           296.113 
_cell.angle_alpha        90.00 
_cell.angle_beta         98.56 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5VO8 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-directed RNA polymerase subunit alpha'                                35056.164  2 2.7.7.6 ? ? ? 
2  polymer     nat 'DNA-directed RNA polymerase subunit beta'                                 125436.539 1 2.7.7.6 ? ? ? 
3  polymer     nat 
;DNA-directed RNA polymerase subunit beta'
;
170997.391 1 2.7.7.6 ? ? ? 
4  polymer     nat 'DNA-directed RNA polymerase subunit omega'                                11533.316  1 2.7.7.6 ? ? ? 
5  polymer     nat 'RNA polymerase sigma factor SigA'                                         48598.031  1 ?       ? ? ? 
6  polymer     syn 
;DNA (5'-D(P*GP*GP*TP*GP*CP*AP*TP*CP*AP*GP*AP*GP*CP*CP*CP*AP*AP*AP*A)-3')
;
6674.347   1 ?       ? ? ? 
7  polymer     syn 
;DNA (5'-D(*TP*AP*TP*AP*AP*TP*GP*GP*GP*CP*TP*GP*AP*TP*GP*CP*AP*CP*C)-3')
;
8412.417   1 ?       ? ? ? 
8  polymer     nat 
;RNA (5'-D(*(GTP))-R(P*GP*GP*GP*GP*GP*GP*G)-3')
;
2876.648   1 ?       ? ? ? 
9  non-polymer syn 'MAGNESIUM ION'                                                            24.305     2 ?       ? ? ? 
10 non-polymer syn 'PYROPHOSPHATE 2-'                                                         175.959    1 ?       ? ? ? 
11 non-polymer syn 'ZINC ION'                                                                 65.409     2 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'RNAP subunit alpha,RNA polymerase subunit alpha,Transcriptase subunit alpha' 
2 'RNAP subunit beta,RNA polymerase subunit beta,Transcriptase subunit beta'    
3 
;RNAP subunit beta',RNA polymerase subunit beta',Transcriptase subunit beta'
;
4 'RNAP omega subunit,RNA polymerase omega subunit,Transcriptase subunit omega' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
A,B ? 
2 'polypeptide(L)'        no no  
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
C   ? 
3 'polypeptide(L)'        no no  
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
D   ? 
4 'polypeptide(L)'        no no  
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
E   ? 
5 'polypeptide(L)'        no no  
;MKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEGLDLEEEEEDLPIPKISTSDP
VRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEID
QKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYAT
WWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETP
IGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQI
ENKALRKLKYHESRTRKLRDFLD
;
;MKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEGLDLEEEEEDLPIPKISTSDP
VRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEID
QKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYAT
WWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETP
IGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQI
ENKALRKLKYHESRTRKLRDFLD
;
F   ? 
6 polydeoxyribonucleotide no no  
;(DC)(DC)(DT)(DG)(DC)(DA)(DT)(DC)(DA)(DG)(DA)(DG)(DC)(DC)(DC)(DA)(DA)(DA)(DA)(DT)
(DA)(DC)
;
CCTGCATCAGAGCCCAAAATAC G   ? 
7 polydeoxyribonucleotide no no  
;(DT)(DA)(DT)(DA)(DA)(DT)(DG)(DG)(DG)(DA)(DG)(DC)(DT)(DG)(DG)(DC)(DT)(DC)(DT)(DG)
(DA)(DT)(DG)(DC)(DA)(DG)(DG)
;
TATAATGGGAGCTGGCTCTGATGCAGG H   ? 
8 polyribonucleotide      no yes '(GTP)GGGGGGG' GGGGGGGG I   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    LEU n 
1 3    ASP n 
1 4    SER n 
1 5    LYS n 
1 6    LEU n 
1 7    LYS n 
1 8    ALA n 
1 9    PRO n 
1 10   VAL n 
1 11   PHE n 
1 12   THR n 
1 13   VAL n 
1 14   ARG n 
1 15   THR n 
1 16   GLN n 
1 17   GLY n 
1 18   ARG n 
1 19   GLU n 
1 20   TYR n 
1 21   GLY n 
1 22   GLU n 
1 23   PHE n 
1 24   VAL n 
1 25   LEU n 
1 26   GLU n 
1 27   PRO n 
1 28   LEU n 
1 29   GLU n 
1 30   ARG n 
1 31   GLY n 
1 32   PHE n 
1 33   GLY n 
1 34   VAL n 
1 35   THR n 
1 36   LEU n 
1 37   GLY n 
1 38   ASN n 
1 39   PRO n 
1 40   LEU n 
1 41   ARG n 
1 42   ARG n 
1 43   ILE n 
1 44   LEU n 
1 45   LEU n 
1 46   SER n 
1 47   SER n 
1 48   ILE n 
1 49   PRO n 
1 50   GLY n 
1 51   THR n 
1 52   ALA n 
1 53   VAL n 
1 54   THR n 
1 55   SER n 
1 56   VAL n 
1 57   TYR n 
1 58   ILE n 
1 59   GLU n 
1 60   ASP n 
1 61   VAL n 
1 62   LEU n 
1 63   HIS n 
1 64   GLU n 
1 65   PHE n 
1 66   SER n 
1 67   THR n 
1 68   ILE n 
1 69   PRO n 
1 70   GLY n 
1 71   VAL n 
1 72   LYS n 
1 73   GLU n 
1 74   ASP n 
1 75   VAL n 
1 76   VAL n 
1 77   GLU n 
1 78   ILE n 
1 79   ILE n 
1 80   LEU n 
1 81   ASN n 
1 82   LEU n 
1 83   LYS n 
1 84   GLU n 
1 85   LEU n 
1 86   VAL n 
1 87   VAL n 
1 88   ARG n 
1 89   PHE n 
1 90   LEU n 
1 91   ASN n 
1 92   PRO n 
1 93   SER n 
1 94   LEU n 
1 95   GLN n 
1 96   THR n 
1 97   VAL n 
1 98   THR n 
1 99   LEU n 
1 100  LEU n 
1 101  LEU n 
1 102  LYS n 
1 103  ALA n 
1 104  GLU n 
1 105  GLY n 
1 106  PRO n 
1 107  LYS n 
1 108  GLU n 
1 109  VAL n 
1 110  LYS n 
1 111  ALA n 
1 112  ARG n 
1 113  ASP n 
1 114  PHE n 
1 115  LEU n 
1 116  PRO n 
1 117  VAL n 
1 118  ALA n 
1 119  ASP n 
1 120  VAL n 
1 121  GLU n 
1 122  ILE n 
1 123  MET n 
1 124  ASN n 
1 125  PRO n 
1 126  ASP n 
1 127  LEU n 
1 128  HIS n 
1 129  ILE n 
1 130  ALA n 
1 131  THR n 
1 132  LEU n 
1 133  GLU n 
1 134  GLU n 
1 135  GLY n 
1 136  GLY n 
1 137  ARG n 
1 138  LEU n 
1 139  ASN n 
1 140  MET n 
1 141  GLU n 
1 142  VAL n 
1 143  ARG n 
1 144  VAL n 
1 145  ASP n 
1 146  ARG n 
1 147  GLY n 
1 148  VAL n 
1 149  GLY n 
1 150  TYR n 
1 151  VAL n 
1 152  PRO n 
1 153  ALA n 
1 154  GLU n 
1 155  LYS n 
1 156  HIS n 
1 157  GLY n 
1 158  ILE n 
1 159  LYS n 
1 160  ASP n 
1 161  ARG n 
1 162  ILE n 
1 163  ASN n 
1 164  ALA n 
1 165  ILE n 
1 166  PRO n 
1 167  VAL n 
1 168  ASP n 
1 169  ALA n 
1 170  VAL n 
1 171  PHE n 
1 172  SER n 
1 173  PRO n 
1 174  VAL n 
1 175  ARG n 
1 176  ARG n 
1 177  VAL n 
1 178  ALA n 
1 179  PHE n 
1 180  GLN n 
1 181  VAL n 
1 182  GLU n 
1 183  ASP n 
1 184  THR n 
1 185  ARG n 
1 186  LEU n 
1 187  GLY n 
1 188  GLN n 
1 189  ARG n 
1 190  THR n 
1 191  ASP n 
1 192  LEU n 
1 193  ASP n 
1 194  LYS n 
1 195  LEU n 
1 196  THR n 
1 197  LEU n 
1 198  ARG n 
1 199  ILE n 
1 200  TRP n 
1 201  THR n 
1 202  ASP n 
1 203  GLY n 
1 204  SER n 
1 205  VAL n 
1 206  THR n 
1 207  PRO n 
1 208  LEU n 
1 209  GLU n 
1 210  ALA n 
1 211  LEU n 
1 212  ASN n 
1 213  GLN n 
1 214  ALA n 
1 215  VAL n 
1 216  GLU n 
1 217  ILE n 
1 218  LEU n 
1 219  ARG n 
1 220  GLU n 
1 221  HIS n 
1 222  LEU n 
1 223  THR n 
1 224  TYR n 
1 225  PHE n 
1 226  SER n 
1 227  ASN n 
1 228  PRO n 
1 229  GLN n 
1 230  ALA n 
1 231  ALA n 
1 232  ALA n 
1 233  VAL n 
1 234  ALA n 
1 235  ALA n 
1 236  PRO n 
1 237  GLU n 
1 238  GLU n 
1 239  ALA n 
1 240  LYS n 
1 241  GLU n 
1 242  PRO n 
1 243  GLU n 
1 244  ALA n 
1 245  PRO n 
1 246  PRO n 
1 247  GLU n 
1 248  GLN n 
1 249  GLU n 
1 250  GLU n 
1 251  GLU n 
1 252  LEU n 
1 253  ASP n 
1 254  LEU n 
1 255  PRO n 
1 256  LEU n 
1 257  GLU n 
1 258  GLU n 
1 259  LEU n 
1 260  GLY n 
1 261  LEU n 
1 262  SER n 
1 263  THR n 
1 264  ARG n 
1 265  VAL n 
1 266  LEU n 
1 267  HIS n 
1 268  SER n 
1 269  LEU n 
1 270  LYS n 
1 271  GLU n 
1 272  GLU n 
1 273  GLY n 
1 274  ILE n 
1 275  GLU n 
1 276  SER n 
1 277  VAL n 
1 278  ARG n 
1 279  ALA n 
1 280  LEU n 
1 281  LEU n 
1 282  ALA n 
1 283  LEU n 
1 284  ASN n 
1 285  LEU n 
1 286  LYS n 
1 287  ASP n 
1 288  LEU n 
1 289  LYS n 
1 290  ASN n 
1 291  ILE n 
1 292  PRO n 
1 293  GLY n 
1 294  ILE n 
1 295  GLY n 
1 296  GLU n 
1 297  ARG n 
1 298  SER n 
1 299  LEU n 
1 300  GLU n 
1 301  GLU n 
1 302  ILE n 
1 303  LYS n 
1 304  GLU n 
1 305  ALA n 
1 306  LEU n 
1 307  GLU n 
1 308  LYS n 
1 309  LYS n 
1 310  GLY n 
1 311  PHE n 
1 312  THR n 
1 313  LEU n 
1 314  LYS n 
1 315  GLU n 
2 1    MET n 
2 2    GLU n 
2 3    ILE n 
2 4    LYS n 
2 5    ARG n 
2 6    PHE n 
2 7    GLY n 
2 8    ARG n 
2 9    ILE n 
2 10   ARG n 
2 11   GLU n 
2 12   VAL n 
2 13   ILE n 
2 14   PRO n 
2 15   LEU n 
2 16   PRO n 
2 17   PRO n 
2 18   LEU n 
2 19   THR n 
2 20   GLU n 
2 21   ILE n 
2 22   GLN n 
2 23   VAL n 
2 24   GLU n 
2 25   SER n 
2 26   TYR n 
2 27   ARG n 
2 28   ARG n 
2 29   ALA n 
2 30   LEU n 
2 31   GLN n 
2 32   ALA n 
2 33   ASP n 
2 34   VAL n 
2 35   PRO n 
2 36   PRO n 
2 37   GLU n 
2 38   LYS n 
2 39   ARG n 
2 40   GLU n 
2 41   ASN n 
2 42   VAL n 
2 43   GLY n 
2 44   ILE n 
2 45   GLN n 
2 46   ALA n 
2 47   ALA n 
2 48   PHE n 
2 49   ARG n 
2 50   GLU n 
2 51   THR n 
2 52   PHE n 
2 53   PRO n 
2 54   ILE n 
2 55   GLU n 
2 56   GLU n 
2 57   GLU n 
2 58   ASP n 
2 59   LYS n 
2 60   GLY n 
2 61   LYS n 
2 62   GLY n 
2 63   GLY n 
2 64   LEU n 
2 65   VAL n 
2 66   LEU n 
2 67   ASP n 
2 68   PHE n 
2 69   LEU n 
2 70   GLU n 
2 71   TYR n 
2 72   ARG n 
2 73   LEU n 
2 74   GLY n 
2 75   GLU n 
2 76   PRO n 
2 77   PRO n 
2 78   PHE n 
2 79   PRO n 
2 80   GLN n 
2 81   ASP n 
2 82   GLU n 
2 83   CYS n 
2 84   ARG n 
2 85   GLU n 
2 86   LYS n 
2 87   ASP n 
2 88   LEU n 
2 89   THR n 
2 90   TYR n 
2 91   GLN n 
2 92   ALA n 
2 93   PRO n 
2 94   LEU n 
2 95   TYR n 
2 96   ALA n 
2 97   ARG n 
2 98   LEU n 
2 99   GLN n 
2 100  LEU n 
2 101  ILE n 
2 102  HIS n 
2 103  LYS n 
2 104  ASP n 
2 105  THR n 
2 106  GLY n 
2 107  LEU n 
2 108  ILE n 
2 109  LYS n 
2 110  GLU n 
2 111  ASP n 
2 112  GLU n 
2 113  VAL n 
2 114  PHE n 
2 115  LEU n 
2 116  GLY n 
2 117  HIS n 
2 118  ILE n 
2 119  PRO n 
2 120  LEU n 
2 121  MET n 
2 122  THR n 
2 123  GLU n 
2 124  ASP n 
2 125  GLY n 
2 126  SER n 
2 127  PHE n 
2 128  ILE n 
2 129  ILE n 
2 130  ASN n 
2 131  GLY n 
2 132  ALA n 
2 133  ASP n 
2 134  ARG n 
2 135  VAL n 
2 136  ILE n 
2 137  VAL n 
2 138  SER n 
2 139  GLN n 
2 140  ILE n 
2 141  HIS n 
2 142  ARG n 
2 143  SER n 
2 144  PRO n 
2 145  GLY n 
2 146  VAL n 
2 147  TYR n 
2 148  PHE n 
2 149  THR n 
2 150  PRO n 
2 151  ASP n 
2 152  PRO n 
2 153  ALA n 
2 154  ARG n 
2 155  PRO n 
2 156  GLY n 
2 157  ARG n 
2 158  TYR n 
2 159  ILE n 
2 160  ALA n 
2 161  SER n 
2 162  ILE n 
2 163  ILE n 
2 164  PRO n 
2 165  LEU n 
2 166  PRO n 
2 167  LYS n 
2 168  ARG n 
2 169  GLY n 
2 170  PRO n 
2 171  TRP n 
2 172  ILE n 
2 173  ASP n 
2 174  LEU n 
2 175  GLU n 
2 176  VAL n 
2 177  GLU n 
2 178  PRO n 
2 179  ASN n 
2 180  GLY n 
2 181  VAL n 
2 182  VAL n 
2 183  SER n 
2 184  MET n 
2 185  LYS n 
2 186  VAL n 
2 187  ASN n 
2 188  LYS n 
2 189  ARG n 
2 190  LYS n 
2 191  PHE n 
2 192  PRO n 
2 193  LEU n 
2 194  VAL n 
2 195  LEU n 
2 196  LEU n 
2 197  LEU n 
2 198  ARG n 
2 199  VAL n 
2 200  LEU n 
2 201  GLY n 
2 202  TYR n 
2 203  ASP n 
2 204  GLN n 
2 205  GLU n 
2 206  THR n 
2 207  LEU n 
2 208  ALA n 
2 209  ARG n 
2 210  GLU n 
2 211  LEU n 
2 212  GLY n 
2 213  ALA n 
2 214  TYR n 
2 215  GLY n 
2 216  GLU n 
2 217  LEU n 
2 218  VAL n 
2 219  GLN n 
2 220  GLY n 
2 221  LEU n 
2 222  MET n 
2 223  ASP n 
2 224  GLU n 
2 225  SER n 
2 226  VAL n 
2 227  PHE n 
2 228  ALA n 
2 229  MET n 
2 230  ARG n 
2 231  PRO n 
2 232  GLU n 
2 233  GLU n 
2 234  ALA n 
2 235  LEU n 
2 236  ILE n 
2 237  ARG n 
2 238  LEU n 
2 239  PHE n 
2 240  THR n 
2 241  LEU n 
2 242  LEU n 
2 243  ARG n 
2 244  PRO n 
2 245  GLY n 
2 246  ASP n 
2 247  PRO n 
2 248  PRO n 
2 249  LYS n 
2 250  ARG n 
2 251  ASP n 
2 252  LYS n 
2 253  ALA n 
2 254  VAL n 
2 255  ALA n 
2 256  TYR n 
2 257  VAL n 
2 258  TYR n 
2 259  GLY n 
2 260  LEU n 
2 261  ILE n 
2 262  ALA n 
2 263  ASP n 
2 264  PRO n 
2 265  ARG n 
2 266  ARG n 
2 267  TYR n 
2 268  ASP n 
2 269  LEU n 
2 270  GLY n 
2 271  GLU n 
2 272  ALA n 
2 273  GLY n 
2 274  ARG n 
2 275  TYR n 
2 276  LYS n 
2 277  ALA n 
2 278  GLU n 
2 279  GLU n 
2 280  LYS n 
2 281  LEU n 
2 282  GLY n 
2 283  ILE n 
2 284  ARG n 
2 285  LEU n 
2 286  SER n 
2 287  GLY n 
2 288  ARG n 
2 289  THR n 
2 290  LEU n 
2 291  ALA n 
2 292  ARG n 
2 293  PHE n 
2 294  GLU n 
2 295  ASP n 
2 296  GLY n 
2 297  GLU n 
2 298  PHE n 
2 299  LYS n 
2 300  ASP n 
2 301  GLU n 
2 302  VAL n 
2 303  PHE n 
2 304  LEU n 
2 305  PRO n 
2 306  THR n 
2 307  LEU n 
2 308  ARG n 
2 309  TYR n 
2 310  LEU n 
2 311  PHE n 
2 312  ALA n 
2 313  LEU n 
2 314  THR n 
2 315  ALA n 
2 316  GLY n 
2 317  VAL n 
2 318  PRO n 
2 319  GLY n 
2 320  HIS n 
2 321  GLU n 
2 322  VAL n 
2 323  ASP n 
2 324  ASP n 
2 325  ILE n 
2 326  ASP n 
2 327  HIS n 
2 328  LEU n 
2 329  GLY n 
2 330  ASN n 
2 331  ARG n 
2 332  ARG n 
2 333  ILE n 
2 334  ARG n 
2 335  THR n 
2 336  VAL n 
2 337  GLY n 
2 338  GLU n 
2 339  LEU n 
2 340  MET n 
2 341  THR n 
2 342  ASP n 
2 343  GLN n 
2 344  PHE n 
2 345  ARG n 
2 346  VAL n 
2 347  GLY n 
2 348  LEU n 
2 349  ALA n 
2 350  ARG n 
2 351  LEU n 
2 352  ALA n 
2 353  ARG n 
2 354  GLY n 
2 355  VAL n 
2 356  ARG n 
2 357  GLU n 
2 358  ARG n 
2 359  MET n 
2 360  LEU n 
2 361  MET n 
2 362  GLY n 
2 363  SER n 
2 364  GLU n 
2 365  ASP n 
2 366  SER n 
2 367  LEU n 
2 368  THR n 
2 369  PRO n 
2 370  ALA n 
2 371  LYS n 
2 372  LEU n 
2 373  VAL n 
2 374  ASN n 
2 375  SER n 
2 376  ARG n 
2 377  PRO n 
2 378  LEU n 
2 379  GLU n 
2 380  ALA n 
2 381  ALA n 
2 382  ILE n 
2 383  ARG n 
2 384  GLU n 
2 385  PHE n 
2 386  PHE n 
2 387  SER n 
2 388  ARG n 
2 389  SER n 
2 390  GLN n 
2 391  LEU n 
2 392  SER n 
2 393  GLN n 
2 394  PHE n 
2 395  LYS n 
2 396  ASP n 
2 397  GLU n 
2 398  THR n 
2 399  ASN n 
2 400  PRO n 
2 401  LEU n 
2 402  SER n 
2 403  SER n 
2 404  LEU n 
2 405  ARG n 
2 406  HIS n 
2 407  LYS n 
2 408  ARG n 
2 409  ARG n 
2 410  ILE n 
2 411  SER n 
2 412  ALA n 
2 413  LEU n 
2 414  GLY n 
2 415  PRO n 
2 416  GLY n 
2 417  GLY n 
2 418  LEU n 
2 419  THR n 
2 420  ARG n 
2 421  GLU n 
2 422  ARG n 
2 423  ALA n 
2 424  GLY n 
2 425  PHE n 
2 426  ASP n 
2 427  VAL n 
2 428  ARG n 
2 429  ASP n 
2 430  VAL n 
2 431  HIS n 
2 432  ARG n 
2 433  THR n 
2 434  HIS n 
2 435  TYR n 
2 436  GLY n 
2 437  ARG n 
2 438  ILE n 
2 439  CYS n 
2 440  PRO n 
2 441  VAL n 
2 442  GLU n 
2 443  THR n 
2 444  PRO n 
2 445  GLU n 
2 446  GLY n 
2 447  ALA n 
2 448  ASN n 
2 449  ILE n 
2 450  GLY n 
2 451  LEU n 
2 452  ILE n 
2 453  THR n 
2 454  SER n 
2 455  LEU n 
2 456  ALA n 
2 457  ALA n 
2 458  TYR n 
2 459  ALA n 
2 460  ARG n 
2 461  VAL n 
2 462  ASP n 
2 463  GLU n 
2 464  LEU n 
2 465  GLY n 
2 466  PHE n 
2 467  ILE n 
2 468  ARG n 
2 469  THR n 
2 470  PRO n 
2 471  TYR n 
2 472  ARG n 
2 473  ARG n 
2 474  VAL n 
2 475  VAL n 
2 476  GLY n 
2 477  GLY n 
2 478  VAL n 
2 479  VAL n 
2 480  THR n 
2 481  ASP n 
2 482  GLU n 
2 483  VAL n 
2 484  VAL n 
2 485  TYR n 
2 486  MET n 
2 487  THR n 
2 488  ALA n 
2 489  THR n 
2 490  GLU n 
2 491  GLU n 
2 492  ASP n 
2 493  ARG n 
2 494  TYR n 
2 495  THR n 
2 496  ILE n 
2 497  ALA n 
2 498  GLN n 
2 499  ALA n 
2 500  ASN n 
2 501  THR n 
2 502  PRO n 
2 503  LEU n 
2 504  GLU n 
2 505  GLY n 
2 506  ASN n 
2 507  ARG n 
2 508  ILE n 
2 509  ALA n 
2 510  ALA n 
2 511  GLU n 
2 512  ARG n 
2 513  VAL n 
2 514  VAL n 
2 515  ALA n 
2 516  ARG n 
2 517  ARG n 
2 518  LYS n 
2 519  GLY n 
2 520  GLU n 
2 521  PRO n 
2 522  VAL n 
2 523  ILE n 
2 524  VAL n 
2 525  SER n 
2 526  PRO n 
2 527  GLU n 
2 528  GLU n 
2 529  VAL n 
2 530  GLU n 
2 531  PHE n 
2 532  MET n 
2 533  ASP n 
2 534  VAL n 
2 535  SER n 
2 536  PRO n 
2 537  LYS n 
2 538  GLN n 
2 539  VAL n 
2 540  PHE n 
2 541  SER n 
2 542  VAL n 
2 543  ASN n 
2 544  THR n 
2 545  ASN n 
2 546  LEU n 
2 547  ILE n 
2 548  PRO n 
2 549  PHE n 
2 550  LEU n 
2 551  GLU n 
2 552  HIS n 
2 553  ASP n 
2 554  ASP n 
2 555  ALA n 
2 556  ASN n 
2 557  ARG n 
2 558  ALA n 
2 559  LEU n 
2 560  MET n 
2 561  GLY n 
2 562  SER n 
2 563  ASN n 
2 564  MET n 
2 565  GLN n 
2 566  THR n 
2 567  GLN n 
2 568  ALA n 
2 569  VAL n 
2 570  PRO n 
2 571  LEU n 
2 572  ILE n 
2 573  ARG n 
2 574  ALA n 
2 575  GLN n 
2 576  ALA n 
2 577  PRO n 
2 578  VAL n 
2 579  VAL n 
2 580  MET n 
2 581  THR n 
2 582  GLY n 
2 583  LEU n 
2 584  GLU n 
2 585  GLU n 
2 586  ARG n 
2 587  VAL n 
2 588  VAL n 
2 589  ARG n 
2 590  ASP n 
2 591  SER n 
2 592  LEU n 
2 593  ALA n 
2 594  ALA n 
2 595  LEU n 
2 596  TYR n 
2 597  ALA n 
2 598  GLU n 
2 599  GLU n 
2 600  ASP n 
2 601  GLY n 
2 602  GLU n 
2 603  VAL n 
2 604  ALA n 
2 605  LYS n 
2 606  VAL n 
2 607  ASP n 
2 608  GLY n 
2 609  ASN n 
2 610  ARG n 
2 611  ILE n 
2 612  VAL n 
2 613  VAL n 
2 614  ARG n 
2 615  TYR n 
2 616  GLU n 
2 617  ASP n 
2 618  GLY n 
2 619  ARG n 
2 620  LEU n 
2 621  VAL n 
2 622  GLU n 
2 623  TYR n 
2 624  PRO n 
2 625  LEU n 
2 626  ARG n 
2 627  ARG n 
2 628  PHE n 
2 629  TYR n 
2 630  ARG n 
2 631  SER n 
2 632  ASN n 
2 633  GLN n 
2 634  GLY n 
2 635  THR n 
2 636  ALA n 
2 637  LEU n 
2 638  ASP n 
2 639  GLN n 
2 640  ARG n 
2 641  PRO n 
2 642  ARG n 
2 643  VAL n 
2 644  VAL n 
2 645  VAL n 
2 646  GLY n 
2 647  GLN n 
2 648  ARG n 
2 649  VAL n 
2 650  ARG n 
2 651  LYS n 
2 652  GLY n 
2 653  ASP n 
2 654  LEU n 
2 655  LEU n 
2 656  ALA n 
2 657  ASP n 
2 658  GLY n 
2 659  PRO n 
2 660  ALA n 
2 661  SER n 
2 662  GLU n 
2 663  ASN n 
2 664  GLY n 
2 665  PHE n 
2 666  LEU n 
2 667  ALA n 
2 668  LEU n 
2 669  GLY n 
2 670  GLN n 
2 671  ASN n 
2 672  VAL n 
2 673  LEU n 
2 674  VAL n 
2 675  ALA n 
2 676  ILE n 
2 677  MET n 
2 678  PRO n 
2 679  PHE n 
2 680  ASP n 
2 681  GLY n 
2 682  TYR n 
2 683  ASN n 
2 684  PHE n 
2 685  GLU n 
2 686  ASP n 
2 687  ALA n 
2 688  ILE n 
2 689  VAL n 
2 690  ILE n 
2 691  SER n 
2 692  GLU n 
2 693  GLU n 
2 694  LEU n 
2 695  LEU n 
2 696  LYS n 
2 697  ARG n 
2 698  ASP n 
2 699  PHE n 
2 700  TYR n 
2 701  THR n 
2 702  SER n 
2 703  ILE n 
2 704  HIS n 
2 705  ILE n 
2 706  GLU n 
2 707  ARG n 
2 708  TYR n 
2 709  GLU n 
2 710  ILE n 
2 711  GLU n 
2 712  ALA n 
2 713  ARG n 
2 714  ASP n 
2 715  THR n 
2 716  LYS n 
2 717  LEU n 
2 718  GLY n 
2 719  PRO n 
2 720  GLU n 
2 721  ARG n 
2 722  ILE n 
2 723  THR n 
2 724  ARG n 
2 725  ASP n 
2 726  ILE n 
2 727  PRO n 
2 728  HIS n 
2 729  LEU n 
2 730  SER n 
2 731  GLU n 
2 732  ALA n 
2 733  ALA n 
2 734  LEU n 
2 735  ARG n 
2 736  ASP n 
2 737  LEU n 
2 738  ASP n 
2 739  GLU n 
2 740  GLU n 
2 741  GLY n 
2 742  VAL n 
2 743  VAL n 
2 744  ARG n 
2 745  ILE n 
2 746  GLY n 
2 747  ALA n 
2 748  GLU n 
2 749  VAL n 
2 750  LYS n 
2 751  PRO n 
2 752  GLY n 
2 753  ASP n 
2 754  ILE n 
2 755  LEU n 
2 756  VAL n 
2 757  GLY n 
2 758  ARG n 
2 759  THR n 
2 760  SER n 
2 761  PHE n 
2 762  LYS n 
2 763  GLY n 
2 764  GLU n 
2 765  SER n 
2 766  GLU n 
2 767  PRO n 
2 768  THR n 
2 769  PRO n 
2 770  GLU n 
2 771  GLU n 
2 772  ARG n 
2 773  LEU n 
2 774  LEU n 
2 775  ARG n 
2 776  SER n 
2 777  ILE n 
2 778  PHE n 
2 779  GLY n 
2 780  GLU n 
2 781  LYS n 
2 782  ALA n 
2 783  ARG n 
2 784  ASP n 
2 785  VAL n 
2 786  LYS n 
2 787  ASP n 
2 788  THR n 
2 789  SER n 
2 790  LEU n 
2 791  ARG n 
2 792  VAL n 
2 793  PRO n 
2 794  PRO n 
2 795  GLY n 
2 796  GLU n 
2 797  GLY n 
2 798  GLY n 
2 799  ILE n 
2 800  VAL n 
2 801  VAL n 
2 802  ARG n 
2 803  THR n 
2 804  VAL n 
2 805  ARG n 
2 806  LEU n 
2 807  ARG n 
2 808  ARG n 
2 809  GLY n 
2 810  ASP n 
2 811  PRO n 
2 812  GLY n 
2 813  VAL n 
2 814  GLU n 
2 815  LEU n 
2 816  LYS n 
2 817  PRO n 
2 818  GLY n 
2 819  VAL n 
2 820  ARG n 
2 821  GLU n 
2 822  VAL n 
2 823  VAL n 
2 824  ARG n 
2 825  VAL n 
2 826  TYR n 
2 827  VAL n 
2 828  ALA n 
2 829  GLN n 
2 830  LYS n 
2 831  ARG n 
2 832  LYS n 
2 833  LEU n 
2 834  GLN n 
2 835  VAL n 
2 836  GLY n 
2 837  ASP n 
2 838  LYS n 
2 839  LEU n 
2 840  ALA n 
2 841  ASN n 
2 842  ARG n 
2 843  HIS n 
2 844  GLY n 
2 845  ASN n 
2 846  LYS n 
2 847  GLY n 
2 848  VAL n 
2 849  VAL n 
2 850  ALA n 
2 851  LYS n 
2 852  ILE n 
2 853  LEU n 
2 854  PRO n 
2 855  VAL n 
2 856  GLU n 
2 857  ASP n 
2 858  MET n 
2 859  PRO n 
2 860  HIS n 
2 861  LEU n 
2 862  PRO n 
2 863  ASP n 
2 864  GLY n 
2 865  THR n 
2 866  PRO n 
2 867  VAL n 
2 868  ASP n 
2 869  VAL n 
2 870  ILE n 
2 871  LEU n 
2 872  ASN n 
2 873  PRO n 
2 874  LEU n 
2 875  GLY n 
2 876  VAL n 
2 877  PRO n 
2 878  SER n 
2 879  ARG n 
2 880  MET n 
2 881  ASN n 
2 882  LEU n 
2 883  GLY n 
2 884  GLN n 
2 885  ILE n 
2 886  LEU n 
2 887  GLU n 
2 888  THR n 
2 889  HIS n 
2 890  LEU n 
2 891  GLY n 
2 892  LEU n 
2 893  ALA n 
2 894  GLY n 
2 895  TYR n 
2 896  PHE n 
2 897  LEU n 
2 898  GLY n 
2 899  GLN n 
2 900  ARG n 
2 901  TYR n 
2 902  ILE n 
2 903  SER n 
2 904  PRO n 
2 905  ILE n 
2 906  PHE n 
2 907  ASP n 
2 908  GLY n 
2 909  ALA n 
2 910  LYS n 
2 911  GLU n 
2 912  PRO n 
2 913  GLU n 
2 914  ILE n 
2 915  LYS n 
2 916  GLU n 
2 917  LEU n 
2 918  LEU n 
2 919  ALA n 
2 920  GLN n 
2 921  ALA n 
2 922  PHE n 
2 923  GLU n 
2 924  VAL n 
2 925  TYR n 
2 926  PHE n 
2 927  GLY n 
2 928  LYS n 
2 929  ARG n 
2 930  LYS n 
2 931  GLY n 
2 932  GLU n 
2 933  GLY n 
2 934  PHE n 
2 935  GLY n 
2 936  VAL n 
2 937  ASP n 
2 938  LYS n 
2 939  ARG n 
2 940  GLU n 
2 941  VAL n 
2 942  GLU n 
2 943  VAL n 
2 944  LEU n 
2 945  ARG n 
2 946  ARG n 
2 947  ALA n 
2 948  GLU n 
2 949  LYS n 
2 950  LEU n 
2 951  GLY n 
2 952  LEU n 
2 953  VAL n 
2 954  THR n 
2 955  PRO n 
2 956  GLY n 
2 957  LYS n 
2 958  THR n 
2 959  PRO n 
2 960  GLU n 
2 961  GLU n 
2 962  GLN n 
2 963  LEU n 
2 964  LYS n 
2 965  GLU n 
2 966  LEU n 
2 967  PHE n 
2 968  LEU n 
2 969  GLN n 
2 970  GLY n 
2 971  LYS n 
2 972  VAL n 
2 973  VAL n 
2 974  LEU n 
2 975  TYR n 
2 976  ASP n 
2 977  GLY n 
2 978  ARG n 
2 979  THR n 
2 980  GLY n 
2 981  GLU n 
2 982  PRO n 
2 983  ILE n 
2 984  GLU n 
2 985  GLY n 
2 986  PRO n 
2 987  ILE n 
2 988  VAL n 
2 989  VAL n 
2 990  GLY n 
2 991  GLN n 
2 992  MET n 
2 993  PHE n 
2 994  ILE n 
2 995  MET n 
2 996  LYS n 
2 997  LEU n 
2 998  TYR n 
2 999  HIS n 
2 1000 MET n 
2 1001 VAL n 
2 1002 GLU n 
2 1003 ASP n 
2 1004 LYS n 
2 1005 MET n 
2 1006 HIS n 
2 1007 ALA n 
2 1008 ARG n 
2 1009 SER n 
2 1010 THR n 
2 1011 GLY n 
2 1012 PRO n 
2 1013 TYR n 
2 1014 SER n 
2 1015 LEU n 
2 1016 ILE n 
2 1017 THR n 
2 1018 GLN n 
2 1019 GLN n 
2 1020 PRO n 
2 1021 LEU n 
2 1022 GLY n 
2 1023 GLY n 
2 1024 LYS n 
2 1025 ALA n 
2 1026 GLN n 
2 1027 PHE n 
2 1028 GLY n 
2 1029 GLY n 
2 1030 GLN n 
2 1031 ARG n 
2 1032 PHE n 
2 1033 GLY n 
2 1034 GLU n 
2 1035 MET n 
2 1036 GLU n 
2 1037 VAL n 
2 1038 TRP n 
2 1039 ALA n 
2 1040 LEU n 
2 1041 GLU n 
2 1042 ALA n 
2 1043 TYR n 
2 1044 GLY n 
2 1045 ALA n 
2 1046 ALA n 
2 1047 HIS n 
2 1048 THR n 
2 1049 LEU n 
2 1050 GLN n 
2 1051 GLU n 
2 1052 MET n 
2 1053 LEU n 
2 1054 THR n 
2 1055 LEU n 
2 1056 LYS n 
2 1057 SER n 
2 1058 ASP n 
2 1059 ASP n 
2 1060 ILE n 
2 1061 GLU n 
2 1062 GLY n 
2 1063 ARG n 
2 1064 ASN n 
2 1065 ALA n 
2 1066 ALA n 
2 1067 TYR n 
2 1068 GLU n 
2 1069 ALA n 
2 1070 ILE n 
2 1071 ILE n 
2 1072 LYS n 
2 1073 GLY n 
2 1074 GLU n 
2 1075 ASP n 
2 1076 VAL n 
2 1077 PRO n 
2 1078 GLU n 
2 1079 PRO n 
2 1080 SER n 
2 1081 VAL n 
2 1082 PRO n 
2 1083 GLU n 
2 1084 SER n 
2 1085 PHE n 
2 1086 ARG n 
2 1087 VAL n 
2 1088 LEU n 
2 1089 VAL n 
2 1090 LYS n 
2 1091 GLU n 
2 1092 LEU n 
2 1093 GLN n 
2 1094 ALA n 
2 1095 LEU n 
2 1096 ALA n 
2 1097 LEU n 
2 1098 ASP n 
2 1099 VAL n 
2 1100 GLN n 
2 1101 THR n 
2 1102 LEU n 
2 1103 ASP n 
2 1104 GLU n 
2 1105 LYS n 
2 1106 ASP n 
2 1107 ASN n 
2 1108 PRO n 
2 1109 VAL n 
2 1110 ASP n 
2 1111 ILE n 
2 1112 PHE n 
2 1113 GLU n 
2 1114 GLY n 
2 1115 LEU n 
2 1116 ALA n 
2 1117 SER n 
2 1118 LYS n 
2 1119 ARG n 
3 1    MET n 
3 2    LYS n 
3 3    LYS n 
3 4    GLU n 
3 5    VAL n 
3 6    ARG n 
3 7    LYS n 
3 8    VAL n 
3 9    ARG n 
3 10   ILE n 
3 11   ALA n 
3 12   LEU n 
3 13   ALA n 
3 14   SER n 
3 15   PRO n 
3 16   GLU n 
3 17   LYS n 
3 18   ILE n 
3 19   ARG n 
3 20   SER n 
3 21   TRP n 
3 22   SER n 
3 23   TYR n 
3 24   GLY n 
3 25   GLU n 
3 26   VAL n 
3 27   GLU n 
3 28   LYS n 
3 29   PRO n 
3 30   GLU n 
3 31   THR n 
3 32   ILE n 
3 33   ASN n 
3 34   TYR n 
3 35   ARG n 
3 36   THR n 
3 37   LEU n 
3 38   LYS n 
3 39   PRO n 
3 40   GLU n 
3 41   ARG n 
3 42   ASP n 
3 43   GLY n 
3 44   LEU n 
3 45   PHE n 
3 46   ASP n 
3 47   GLU n 
3 48   ARG n 
3 49   ILE n 
3 50   PHE n 
3 51   GLY n 
3 52   PRO n 
3 53   ILE n 
3 54   LYS n 
3 55   ASP n 
3 56   TYR n 
3 57   GLU n 
3 58   CYS n 
3 59   ALA n 
3 60   CYS n 
3 61   GLY n 
3 62   LYS n 
3 63   TYR n 
3 64   LYS n 
3 65   ARG n 
3 66   GLN n 
3 67   ARG n 
3 68   PHE n 
3 69   GLU n 
3 70   GLY n 
3 71   LYS n 
3 72   VAL n 
3 73   CYS n 
3 74   GLU n 
3 75   ARG n 
3 76   CYS n 
3 77   GLY n 
3 78   VAL n 
3 79   GLU n 
3 80   VAL n 
3 81   THR n 
3 82   LYS n 
3 83   SER n 
3 84   ILE n 
3 85   VAL n 
3 86   ARG n 
3 87   ARG n 
3 88   TYR n 
3 89   ARG n 
3 90   MET n 
3 91   GLY n 
3 92   HIS n 
3 93   ILE n 
3 94   GLU n 
3 95   LEU n 
3 96   ALA n 
3 97   THR n 
3 98   PRO n 
3 99   ALA n 
3 100  ALA n 
3 101  HIS n 
3 102  ILE n 
3 103  TRP n 
3 104  PHE n 
3 105  VAL n 
3 106  LYS n 
3 107  ASP n 
3 108  VAL n 
3 109  PRO n 
3 110  SER n 
3 111  LYS n 
3 112  ILE n 
3 113  GLY n 
3 114  THR n 
3 115  LEU n 
3 116  LEU n 
3 117  ASP n 
3 118  LEU n 
3 119  SER n 
3 120  ALA n 
3 121  THR n 
3 122  GLU n 
3 123  LEU n 
3 124  GLU n 
3 125  GLN n 
3 126  VAL n 
3 127  LEU n 
3 128  TYR n 
3 129  PHE n 
3 130  SER n 
3 131  LYS n 
3 132  TYR n 
3 133  ILE n 
3 134  VAL n 
3 135  LEU n 
3 136  ASP n 
3 137  PRO n 
3 138  LYS n 
3 139  GLY n 
3 140  ALA n 
3 141  ILE n 
3 142  LEU n 
3 143  ASN n 
3 144  GLY n 
3 145  VAL n 
3 146  PRO n 
3 147  VAL n 
3 148  GLU n 
3 149  LYS n 
3 150  ARG n 
3 151  GLN n 
3 152  LEU n 
3 153  LEU n 
3 154  THR n 
3 155  ASP n 
3 156  GLU n 
3 157  GLU n 
3 158  TYR n 
3 159  ARG n 
3 160  GLU n 
3 161  LEU n 
3 162  ARG n 
3 163  TYR n 
3 164  GLY n 
3 165  LYS n 
3 166  GLN n 
3 167  GLU n 
3 168  THR n 
3 169  TYR n 
3 170  PRO n 
3 171  LEU n 
3 172  PRO n 
3 173  PRO n 
3 174  GLY n 
3 175  VAL n 
3 176  ASP n 
3 177  ALA n 
3 178  LEU n 
3 179  VAL n 
3 180  LYS n 
3 181  ASP n 
3 182  GLY n 
3 183  GLU n 
3 184  GLU n 
3 185  VAL n 
3 186  VAL n 
3 187  LYS n 
3 188  GLY n 
3 189  GLN n 
3 190  GLU n 
3 191  LEU n 
3 192  ALA n 
3 193  PRO n 
3 194  GLY n 
3 195  VAL n 
3 196  VAL n 
3 197  SER n 
3 198  ARG n 
3 199  LEU n 
3 200  ASP n 
3 201  GLY n 
3 202  VAL n 
3 203  ALA n 
3 204  LEU n 
3 205  TYR n 
3 206  ARG n 
3 207  PHE n 
3 208  PRO n 
3 209  ARG n 
3 210  ARG n 
3 211  VAL n 
3 212  ARG n 
3 213  VAL n 
3 214  GLU n 
3 215  TYR n 
3 216  VAL n 
3 217  LYS n 
3 218  LYS n 
3 219  GLU n 
3 220  ARG n 
3 221  ALA n 
3 222  GLY n 
3 223  LEU n 
3 224  ARG n 
3 225  LEU n 
3 226  PRO n 
3 227  LEU n 
3 228  ALA n 
3 229  ALA n 
3 230  TRP n 
3 231  VAL n 
3 232  GLU n 
3 233  LYS n 
3 234  GLU n 
3 235  ALA n 
3 236  TYR n 
3 237  LYS n 
3 238  PRO n 
3 239  GLY n 
3 240  GLU n 
3 241  ILE n 
3 242  LEU n 
3 243  ALA n 
3 244  GLU n 
3 245  LEU n 
3 246  PRO n 
3 247  GLU n 
3 248  PRO n 
3 249  TYR n 
3 250  LEU n 
3 251  PHE n 
3 252  ARG n 
3 253  ALA n 
3 254  GLU n 
3 255  GLU n 
3 256  GLU n 
3 257  GLY n 
3 258  VAL n 
3 259  VAL n 
3 260  GLU n 
3 261  LEU n 
3 262  LYS n 
3 263  GLU n 
3 264  LEU n 
3 265  GLU n 
3 266  GLU n 
3 267  GLY n 
3 268  ALA n 
3 269  PHE n 
3 270  LEU n 
3 271  VAL n 
3 272  LEU n 
3 273  ARG n 
3 274  ARG n 
3 275  GLU n 
3 276  ASP n 
3 277  GLU n 
3 278  PRO n 
3 279  VAL n 
3 280  ALA n 
3 281  THR n 
3 282  TYR n 
3 283  PHE n 
3 284  LEU n 
3 285  PRO n 
3 286  VAL n 
3 287  GLY n 
3 288  MET n 
3 289  THR n 
3 290  PRO n 
3 291  LEU n 
3 292  VAL n 
3 293  VAL n 
3 294  HIS n 
3 295  GLY n 
3 296  GLU n 
3 297  ILE n 
3 298  VAL n 
3 299  GLU n 
3 300  LYS n 
3 301  GLY n 
3 302  GLN n 
3 303  PRO n 
3 304  LEU n 
3 305  ALA n 
3 306  GLU n 
3 307  ALA n 
3 308  LYS n 
3 309  GLY n 
3 310  LEU n 
3 311  LEU n 
3 312  ARG n 
3 313  MET n 
3 314  PRO n 
3 315  ARG n 
3 316  GLN n 
3 317  VAL n 
3 318  ARG n 
3 319  ALA n 
3 320  ALA n 
3 321  GLN n 
3 322  VAL n 
3 323  GLU n 
3 324  ALA n 
3 325  GLU n 
3 326  GLU n 
3 327  GLU n 
3 328  GLY n 
3 329  GLU n 
3 330  THR n 
3 331  VAL n 
3 332  TYR n 
3 333  LEU n 
3 334  THR n 
3 335  LEU n 
3 336  PHE n 
3 337  LEU n 
3 338  GLU n 
3 339  TRP n 
3 340  THR n 
3 341  GLU n 
3 342  PRO n 
3 343  LYS n 
3 344  ASP n 
3 345  TYR n 
3 346  ARG n 
3 347  VAL n 
3 348  GLN n 
3 349  PRO n 
3 350  HIS n 
3 351  MET n 
3 352  ASN n 
3 353  VAL n 
3 354  VAL n 
3 355  VAL n 
3 356  PRO n 
3 357  GLU n 
3 358  GLY n 
3 359  ALA n 
3 360  ARG n 
3 361  VAL n 
3 362  GLU n 
3 363  ALA n 
3 364  GLY n 
3 365  ASP n 
3 366  LYS n 
3 367  ILE n 
3 368  VAL n 
3 369  ALA n 
3 370  ALA n 
3 371  ILE n 
3 372  ASP n 
3 373  PRO n 
3 374  GLU n 
3 375  GLU n 
3 376  GLU n 
3 377  VAL n 
3 378  ILE n 
3 379  ALA n 
3 380  GLU n 
3 381  ALA n 
3 382  GLU n 
3 383  GLY n 
3 384  VAL n 
3 385  VAL n 
3 386  HIS n 
3 387  LEU n 
3 388  HIS n 
3 389  GLU n 
3 390  PRO n 
3 391  ALA n 
3 392  SER n 
3 393  ILE n 
3 394  LEU n 
3 395  VAL n 
3 396  VAL n 
3 397  LYS n 
3 398  ALA n 
3 399  ARG n 
3 400  VAL n 
3 401  TYR n 
3 402  PRO n 
3 403  PHE n 
3 404  GLU n 
3 405  ASP n 
3 406  ASP n 
3 407  VAL n 
3 408  GLU n 
3 409  VAL n 
3 410  SER n 
3 411  THR n 
3 412  GLY n 
3 413  ASP n 
3 414  ARG n 
3 415  VAL n 
3 416  ALA n 
3 417  PRO n 
3 418  GLY n 
3 419  ASP n 
3 420  VAL n 
3 421  LEU n 
3 422  ALA n 
3 423  ASP n 
3 424  GLY n 
3 425  GLY n 
3 426  LYS n 
3 427  VAL n 
3 428  LYS n 
3 429  SER n 
3 430  ASP n 
3 431  VAL n 
3 432  TYR n 
3 433  GLY n 
3 434  ARG n 
3 435  VAL n 
3 436  GLU n 
3 437  VAL n 
3 438  ASP n 
3 439  LEU n 
3 440  VAL n 
3 441  ARG n 
3 442  ASN n 
3 443  VAL n 
3 444  VAL n 
3 445  ARG n 
3 446  VAL n 
3 447  VAL n 
3 448  GLU n 
3 449  SER n 
3 450  TYR n 
3 451  ASP n 
3 452  ILE n 
3 453  ASP n 
3 454  ALA n 
3 455  ARG n 
3 456  MET n 
3 457  GLY n 
3 458  ALA n 
3 459  GLU n 
3 460  ALA n 
3 461  ILE n 
3 462  GLN n 
3 463  GLN n 
3 464  LEU n 
3 465  LEU n 
3 466  LYS n 
3 467  GLU n 
3 468  LEU n 
3 469  ASP n 
3 470  LEU n 
3 471  GLU n 
3 472  ALA n 
3 473  LEU n 
3 474  GLU n 
3 475  LYS n 
3 476  GLU n 
3 477  LEU n 
3 478  LEU n 
3 479  GLU n 
3 480  GLU n 
3 481  MET n 
3 482  LYS n 
3 483  HIS n 
3 484  PRO n 
3 485  SER n 
3 486  ARG n 
3 487  ALA n 
3 488  ARG n 
3 489  ARG n 
3 490  ALA n 
3 491  LYS n 
3 492  ALA n 
3 493  ARG n 
3 494  LYS n 
3 495  ARG n 
3 496  LEU n 
3 497  GLU n 
3 498  VAL n 
3 499  VAL n 
3 500  ARG n 
3 501  ALA n 
3 502  PHE n 
3 503  LEU n 
3 504  ASP n 
3 505  SER n 
3 506  GLY n 
3 507  ASN n 
3 508  ARG n 
3 509  PRO n 
3 510  GLU n 
3 511  TRP n 
3 512  MET n 
3 513  ILE n 
3 514  LEU n 
3 515  GLU n 
3 516  ALA n 
3 517  VAL n 
3 518  PRO n 
3 519  VAL n 
3 520  LEU n 
3 521  PRO n 
3 522  PRO n 
3 523  ASP n 
3 524  LEU n 
3 525  ARG n 
3 526  PRO n 
3 527  MET n 
3 528  VAL n 
3 529  GLN n 
3 530  VAL n 
3 531  ASP n 
3 532  GLY n 
3 533  GLY n 
3 534  ARG n 
3 535  PHE n 
3 536  ALA n 
3 537  THR n 
3 538  SER n 
3 539  ASP n 
3 540  LEU n 
3 541  ASN n 
3 542  ASP n 
3 543  LEU n 
3 544  TYR n 
3 545  ARG n 
3 546  ARG n 
3 547  LEU n 
3 548  ILE n 
3 549  ASN n 
3 550  ARG n 
3 551  ASN n 
3 552  ASN n 
3 553  ARG n 
3 554  LEU n 
3 555  LYS n 
3 556  LYS n 
3 557  LEU n 
3 558  LEU n 
3 559  ALA n 
3 560  GLN n 
3 561  GLY n 
3 562  ALA n 
3 563  PRO n 
3 564  GLU n 
3 565  ILE n 
3 566  ILE n 
3 567  ILE n 
3 568  ARG n 
3 569  ASN n 
3 570  GLU n 
3 571  LYS n 
3 572  ARG n 
3 573  MET n 
3 574  LEU n 
3 575  GLN n 
3 576  GLU n 
3 577  ALA n 
3 578  VAL n 
3 579  ASP n 
3 580  ALA n 
3 581  LEU n 
3 582  LEU n 
3 583  ASP n 
3 584  ASN n 
3 585  GLY n 
3 586  ARG n 
3 587  ARG n 
3 588  GLY n 
3 589  ALA n 
3 590  PRO n 
3 591  VAL n 
3 592  THR n 
3 593  ASN n 
3 594  PRO n 
3 595  GLY n 
3 596  SER n 
3 597  ASP n 
3 598  ARG n 
3 599  PRO n 
3 600  LEU n 
3 601  ARG n 
3 602  SER n 
3 603  LEU n 
3 604  THR n 
3 605  ASP n 
3 606  ILE n 
3 607  LEU n 
3 608  SER n 
3 609  GLY n 
3 610  LYS n 
3 611  GLN n 
3 612  GLY n 
3 613  ARG n 
3 614  PHE n 
3 615  ARG n 
3 616  GLN n 
3 617  ASN n 
3 618  LEU n 
3 619  LEU n 
3 620  GLY n 
3 621  LYS n 
3 622  ARG n 
3 623  VAL n 
3 624  ASP n 
3 625  TYR n 
3 626  SER n 
3 627  GLY n 
3 628  ARG n 
3 629  SER n 
3 630  VAL n 
3 631  ILE n 
3 632  VAL n 
3 633  VAL n 
3 634  GLY n 
3 635  PRO n 
3 636  GLN n 
3 637  LEU n 
3 638  LYS n 
3 639  LEU n 
3 640  HIS n 
3 641  GLN n 
3 642  CYS n 
3 643  GLY n 
3 644  LEU n 
3 645  PRO n 
3 646  LYS n 
3 647  ARG n 
3 648  MET n 
3 649  ALA n 
3 650  LEU n 
3 651  GLU n 
3 652  LEU n 
3 653  PHE n 
3 654  LYS n 
3 655  PRO n 
3 656  PHE n 
3 657  LEU n 
3 658  LEU n 
3 659  LYS n 
3 660  LYS n 
3 661  MET n 
3 662  GLU n 
3 663  GLU n 
3 664  LYS n 
3 665  GLY n 
3 666  ILE n 
3 667  ALA n 
3 668  PRO n 
3 669  ASN n 
3 670  VAL n 
3 671  LYS n 
3 672  ALA n 
3 673  ALA n 
3 674  ARG n 
3 675  ARG n 
3 676  MET n 
3 677  LEU n 
3 678  GLU n 
3 679  ARG n 
3 680  GLN n 
3 681  ARG n 
3 682  ASP n 
3 683  ILE n 
3 684  LYS n 
3 685  ASP n 
3 686  GLU n 
3 687  VAL n 
3 688  TRP n 
3 689  ASP n 
3 690  ALA n 
3 691  LEU n 
3 692  GLU n 
3 693  GLU n 
3 694  VAL n 
3 695  ILE n 
3 696  HIS n 
3 697  GLY n 
3 698  LYS n 
3 699  VAL n 
3 700  VAL n 
3 701  LEU n 
3 702  LEU n 
3 703  ASN n 
3 704  ARG n 
3 705  ALA n 
3 706  PRO n 
3 707  THR n 
3 708  LEU n 
3 709  HIS n 
3 710  ARG n 
3 711  LEU n 
3 712  GLY n 
3 713  ILE n 
3 714  GLN n 
3 715  ALA n 
3 716  PHE n 
3 717  GLN n 
3 718  PRO n 
3 719  VAL n 
3 720  LEU n 
3 721  VAL n 
3 722  GLU n 
3 723  GLY n 
3 724  GLN n 
3 725  SER n 
3 726  ILE n 
3 727  GLN n 
3 728  LEU n 
3 729  HIS n 
3 730  PRO n 
3 731  LEU n 
3 732  VAL n 
3 733  CYS n 
3 734  GLU n 
3 735  ALA n 
3 736  PHE n 
3 737  ASN n 
3 738  ALA n 
3 739  ASP n 
3 740  PHE n 
3 741  ASP n 
3 742  GLY n 
3 743  ASP n 
3 744  GLN n 
3 745  MET n 
3 746  ALA n 
3 747  VAL n 
3 748  HIS n 
3 749  VAL n 
3 750  PRO n 
3 751  LEU n 
3 752  SER n 
3 753  SER n 
3 754  PHE n 
3 755  ALA n 
3 756  GLN n 
3 757  ALA n 
3 758  GLU n 
3 759  ALA n 
3 760  ARG n 
3 761  ILE n 
3 762  GLN n 
3 763  MET n 
3 764  LEU n 
3 765  SER n 
3 766  ALA n 
3 767  HIS n 
3 768  ASN n 
3 769  LEU n 
3 770  LEU n 
3 771  SER n 
3 772  PRO n 
3 773  ALA n 
3 774  SER n 
3 775  GLY n 
3 776  GLU n 
3 777  PRO n 
3 778  LEU n 
3 779  ALA n 
3 780  LYS n 
3 781  PRO n 
3 782  SER n 
3 783  ARG n 
3 784  ASP n 
3 785  ILE n 
3 786  ILE n 
3 787  LEU n 
3 788  GLY n 
3 789  LEU n 
3 790  TYR n 
3 791  TYR n 
3 792  ILE n 
3 793  THR n 
3 794  GLN n 
3 795  VAL n 
3 796  ARG n 
3 797  LYS n 
3 798  GLU n 
3 799  LYS n 
3 800  LYS n 
3 801  GLY n 
3 802  ALA n 
3 803  GLY n 
3 804  LEU n 
3 805  GLU n 
3 806  PHE n 
3 807  ALA n 
3 808  THR n 
3 809  PRO n 
3 810  GLU n 
3 811  GLU n 
3 812  ALA n 
3 813  LEU n 
3 814  ALA n 
3 815  ALA n 
3 816  HIS n 
3 817  GLU n 
3 818  ARG n 
3 819  GLY n 
3 820  GLU n 
3 821  VAL n 
3 822  ALA n 
3 823  LEU n 
3 824  ASN n 
3 825  ALA n 
3 826  PRO n 
3 827  ILE n 
3 828  LYS n 
3 829  VAL n 
3 830  ALA n 
3 831  GLY n 
3 832  ARG n 
3 833  GLU n 
3 834  THR n 
3 835  SER n 
3 836  VAL n 
3 837  GLY n 
3 838  ARG n 
3 839  LEU n 
3 840  LYS n 
3 841  TYR n 
3 842  VAL n 
3 843  PHE n 
3 844  ALA n 
3 845  ASN n 
3 846  PRO n 
3 847  ASP n 
3 848  GLU n 
3 849  ALA n 
3 850  LEU n 
3 851  LEU n 
3 852  ALA n 
3 853  VAL n 
3 854  ALA n 
3 855  HIS n 
3 856  GLY n 
3 857  ILE n 
3 858  VAL n 
3 859  ASP n 
3 860  LEU n 
3 861  GLN n 
3 862  ASP n 
3 863  VAL n 
3 864  VAL n 
3 865  THR n 
3 866  VAL n 
3 867  ARG n 
3 868  TYR n 
3 869  MET n 
3 870  GLY n 
3 871  LYS n 
3 872  ARG n 
3 873  LEU n 
3 874  GLU n 
3 875  THR n 
3 876  SER n 
3 877  PRO n 
3 878  GLY n 
3 879  ARG n 
3 880  ILE n 
3 881  LEU n 
3 882  PHE n 
3 883  ALA n 
3 884  ARG n 
3 885  ILE n 
3 886  VAL n 
3 887  ALA n 
3 888  GLU n 
3 889  ALA n 
3 890  VAL n 
3 891  GLU n 
3 892  ASP n 
3 893  GLU n 
3 894  LYS n 
3 895  VAL n 
3 896  ALA n 
3 897  TRP n 
3 898  GLU n 
3 899  LEU n 
3 900  ILE n 
3 901  GLN n 
3 902  LEU n 
3 903  ASP n 
3 904  VAL n 
3 905  PRO n 
3 906  GLN n 
3 907  GLU n 
3 908  LYS n 
3 909  ASN n 
3 910  SER n 
3 911  LEU n 
3 912  LYS n 
3 913  ASP n 
3 914  LEU n 
3 915  VAL n 
3 916  TYR n 
3 917  GLN n 
3 918  ALA n 
3 919  PHE n 
3 920  LEU n 
3 921  ARG n 
3 922  LEU n 
3 923  GLY n 
3 924  MET n 
3 925  GLU n 
3 926  LYS n 
3 927  THR n 
3 928  ALA n 
3 929  ARG n 
3 930  LEU n 
3 931  LEU n 
3 932  ASP n 
3 933  ALA n 
3 934  LEU n 
3 935  LYS n 
3 936  TYR n 
3 937  TYR n 
3 938  GLY n 
3 939  PHE n 
3 940  THR n 
3 941  PHE n 
3 942  SER n 
3 943  THR n 
3 944  THR n 
3 945  SER n 
3 946  GLY n 
3 947  ILE n 
3 948  THR n 
3 949  ILE n 
3 950  GLY n 
3 951  ILE n 
3 952  ASP n 
3 953  ASP n 
3 954  ALA n 
3 955  VAL n 
3 956  ILE n 
3 957  PRO n 
3 958  GLU n 
3 959  GLU n 
3 960  LYS n 
3 961  LYS n 
3 962  GLN n 
3 963  TYR n 
3 964  LEU n 
3 965  GLU n 
3 966  GLU n 
3 967  ALA n 
3 968  ASP n 
3 969  ARG n 
3 970  LYS n 
3 971  LEU n 
3 972  LEU n 
3 973  GLN n 
3 974  ILE n 
3 975  GLU n 
3 976  GLN n 
3 977  ALA n 
3 978  TYR n 
3 979  GLU n 
3 980  MET n 
3 981  GLY n 
3 982  PHE n 
3 983  LEU n 
3 984  THR n 
3 985  ASP n 
3 986  ARG n 
3 987  GLU n 
3 988  ARG n 
3 989  TYR n 
3 990  ASP n 
3 991  GLN n 
3 992  ILE n 
3 993  LEU n 
3 994  GLN n 
3 995  LEU n 
3 996  TRP n 
3 997  THR n 
3 998  GLU n 
3 999  THR n 
3 1000 THR n 
3 1001 GLU n 
3 1002 LYS n 
3 1003 VAL n 
3 1004 THR n 
3 1005 GLN n 
3 1006 ALA n 
3 1007 VAL n 
3 1008 PHE n 
3 1009 LYS n 
3 1010 ASN n 
3 1011 PHE n 
3 1012 GLU n 
3 1013 GLU n 
3 1014 ASN n 
3 1015 TYR n 
3 1016 PRO n 
3 1017 PHE n 
3 1018 ASN n 
3 1019 PRO n 
3 1020 LEU n 
3 1021 TYR n 
3 1022 VAL n 
3 1023 MET n 
3 1024 ALA n 
3 1025 GLN n 
3 1026 SER n 
3 1027 GLY n 
3 1028 ALA n 
3 1029 ARG n 
3 1030 GLY n 
3 1031 ASN n 
3 1032 PRO n 
3 1033 GLN n 
3 1034 GLN n 
3 1035 ILE n 
3 1036 ARG n 
3 1037 GLN n 
3 1038 LEU n 
3 1039 CYS n 
3 1040 GLY n 
3 1041 LEU n 
3 1042 ARG n 
3 1043 GLY n 
3 1044 LEU n 
3 1045 MET n 
3 1046 GLN n 
3 1047 LYS n 
3 1048 PRO n 
3 1049 SER n 
3 1050 GLY n 
3 1051 GLU n 
3 1052 THR n 
3 1053 PHE n 
3 1054 GLU n 
3 1055 VAL n 
3 1056 PRO n 
3 1057 VAL n 
3 1058 ARG n 
3 1059 SER n 
3 1060 SER n 
3 1061 PHE n 
3 1062 ARG n 
3 1063 GLU n 
3 1064 GLY n 
3 1065 LEU n 
3 1066 THR n 
3 1067 VAL n 
3 1068 LEU n 
3 1069 GLU n 
3 1070 TYR n 
3 1071 PHE n 
3 1072 ILE n 
3 1073 SER n 
3 1074 SER n 
3 1075 HIS n 
3 1076 GLY n 
3 1077 ALA n 
3 1078 ARG n 
3 1079 LYS n 
3 1080 GLY n 
3 1081 GLY n 
3 1082 ALA n 
3 1083 ASP n 
3 1084 THR n 
3 1085 ALA n 
3 1086 LEU n 
3 1087 ARG n 
3 1088 THR n 
3 1089 ALA n 
3 1090 ASP n 
3 1091 SER n 
3 1092 GLY n 
3 1093 TYR n 
3 1094 LEU n 
3 1095 THR n 
3 1096 ARG n 
3 1097 LYS n 
3 1098 LEU n 
3 1099 VAL n 
3 1100 ASP n 
3 1101 VAL n 
3 1102 THR n 
3 1103 HIS n 
3 1104 GLU n 
3 1105 ILE n 
3 1106 VAL n 
3 1107 VAL n 
3 1108 ARG n 
3 1109 GLU n 
3 1110 ALA n 
3 1111 ASP n 
3 1112 CYS n 
3 1113 GLY n 
3 1114 THR n 
3 1115 THR n 
3 1116 ASN n 
3 1117 TYR n 
3 1118 ILE n 
3 1119 SER n 
3 1120 VAL n 
3 1121 PRO n 
3 1122 LEU n 
3 1123 PHE n 
3 1124 GLN n 
3 1125 PRO n 
3 1126 ASP n 
3 1127 GLU n 
3 1128 VAL n 
3 1129 THR n 
3 1130 ARG n 
3 1131 SER n 
3 1132 LEU n 
3 1133 ARG n 
3 1134 LEU n 
3 1135 ARG n 
3 1136 LYS n 
3 1137 ARG n 
3 1138 ALA n 
3 1139 ASP n 
3 1140 ILE n 
3 1141 GLU n 
3 1142 ALA n 
3 1143 GLY n 
3 1144 LEU n 
3 1145 TYR n 
3 1146 GLY n 
3 1147 ARG n 
3 1148 VAL n 
3 1149 LEU n 
3 1150 ALA n 
3 1151 ARG n 
3 1152 GLU n 
3 1153 VAL n 
3 1154 GLU n 
3 1155 VAL n 
3 1156 LEU n 
3 1157 GLY n 
3 1158 VAL n 
3 1159 ARG n 
3 1160 LEU n 
3 1161 GLU n 
3 1162 GLU n 
3 1163 GLY n 
3 1164 ARG n 
3 1165 TYR n 
3 1166 LEU n 
3 1167 SER n 
3 1168 MET n 
3 1169 ASP n 
3 1170 ASP n 
3 1171 VAL n 
3 1172 HIS n 
3 1173 LEU n 
3 1174 LEU n 
3 1175 ILE n 
3 1176 LYS n 
3 1177 ALA n 
3 1178 ALA n 
3 1179 GLU n 
3 1180 ALA n 
3 1181 GLY n 
3 1182 GLU n 
3 1183 ILE n 
3 1184 GLN n 
3 1185 GLU n 
3 1186 VAL n 
3 1187 PRO n 
3 1188 VAL n 
3 1189 ARG n 
3 1190 SER n 
3 1191 PRO n 
3 1192 LEU n 
3 1193 THR n 
3 1194 CYS n 
3 1195 GLN n 
3 1196 THR n 
3 1197 ARG n 
3 1198 TYR n 
3 1199 GLY n 
3 1200 VAL n 
3 1201 CYS n 
3 1202 GLN n 
3 1203 LYS n 
3 1204 CYS n 
3 1205 TYR n 
3 1206 GLY n 
3 1207 TYR n 
3 1208 ASP n 
3 1209 LEU n 
3 1210 SER n 
3 1211 MET n 
3 1212 ALA n 
3 1213 ARG n 
3 1214 PRO n 
3 1215 VAL n 
3 1216 SER n 
3 1217 ILE n 
3 1218 GLY n 
3 1219 GLU n 
3 1220 ALA n 
3 1221 VAL n 
3 1222 GLY n 
3 1223 ILE n 
3 1224 VAL n 
3 1225 ALA n 
3 1226 ALA n 
3 1227 GLN n 
3 1228 SER n 
3 1229 ILE n 
3 1230 GLY n 
3 1231 GLU n 
3 1232 PRO n 
3 1233 GLY n 
3 1234 THR n 
3 1235 GLN n 
3 1236 LEU n 
3 1237 THR n 
3 1238 MET n 
3 1239 ARG n 
3 1240 THR n 
3 1241 PHE n 
3 1242 HIS n 
3 1243 THR n 
3 1244 GLY n 
3 1245 GLY n 
3 1246 VAL n 
3 1247 ALA n 
3 1248 GLY n 
3 1249 ALA n 
3 1250 ALA n 
3 1251 ASP n 
3 1252 ILE n 
3 1253 THR n 
3 1254 GLN n 
3 1255 GLY n 
3 1256 LEU n 
3 1257 PRO n 
3 1258 ARG n 
3 1259 VAL n 
3 1260 ILE n 
3 1261 GLU n 
3 1262 LEU n 
3 1263 PHE n 
3 1264 GLU n 
3 1265 ALA n 
3 1266 ARG n 
3 1267 ARG n 
3 1268 PRO n 
3 1269 LYS n 
3 1270 ALA n 
3 1271 LYS n 
3 1272 ALA n 
3 1273 VAL n 
3 1274 ILE n 
3 1275 SER n 
3 1276 GLU n 
3 1277 ILE n 
3 1278 ASP n 
3 1279 GLY n 
3 1280 VAL n 
3 1281 VAL n 
3 1282 ARG n 
3 1283 ILE n 
3 1284 GLU n 
3 1285 GLU n 
3 1286 THR n 
3 1287 GLU n 
3 1288 GLU n 
3 1289 LYS n 
3 1290 LEU n 
3 1291 SER n 
3 1292 VAL n 
3 1293 PHE n 
3 1294 VAL n 
3 1295 GLU n 
3 1296 SER n 
3 1297 GLU n 
3 1298 GLY n 
3 1299 PHE n 
3 1300 SER n 
3 1301 LYS n 
3 1302 GLU n 
3 1303 TYR n 
3 1304 LYS n 
3 1305 LEU n 
3 1306 PRO n 
3 1307 LYS n 
3 1308 GLU n 
3 1309 ALA n 
3 1310 ARG n 
3 1311 LEU n 
3 1312 LEU n 
3 1313 VAL n 
3 1314 LYS n 
3 1315 ASP n 
3 1316 GLY n 
3 1317 ASP n 
3 1318 TYR n 
3 1319 VAL n 
3 1320 GLU n 
3 1321 ALA n 
3 1322 GLY n 
3 1323 GLN n 
3 1324 PRO n 
3 1325 LEU n 
3 1326 THR n 
3 1327 ARG n 
3 1328 GLY n 
3 1329 ALA n 
3 1330 ILE n 
3 1331 ASP n 
3 1332 PRO n 
3 1333 HIS n 
3 1334 GLN n 
3 1335 LEU n 
3 1336 LEU n 
3 1337 GLU n 
3 1338 ALA n 
3 1339 LYS n 
3 1340 GLY n 
3 1341 PRO n 
3 1342 GLU n 
3 1343 ALA n 
3 1344 VAL n 
3 1345 GLU n 
3 1346 ARG n 
3 1347 TYR n 
3 1348 LEU n 
3 1349 VAL n 
3 1350 GLU n 
3 1351 GLU n 
3 1352 ILE n 
3 1353 GLN n 
3 1354 LYS n 
3 1355 VAL n 
3 1356 TYR n 
3 1357 ARG n 
3 1358 ALA n 
3 1359 GLN n 
3 1360 GLY n 
3 1361 VAL n 
3 1362 LYS n 
3 1363 LEU n 
3 1364 HIS n 
3 1365 ASP n 
3 1366 LYS n 
3 1367 HIS n 
3 1368 ILE n 
3 1369 GLU n 
3 1370 ILE n 
3 1371 VAL n 
3 1372 VAL n 
3 1373 ARG n 
3 1374 GLN n 
3 1375 MET n 
3 1376 MET n 
3 1377 LYS n 
3 1378 TYR n 
3 1379 VAL n 
3 1380 GLU n 
3 1381 VAL n 
3 1382 THR n 
3 1383 ASP n 
3 1384 PRO n 
3 1385 GLY n 
3 1386 ASP n 
3 1387 SER n 
3 1388 ARG n 
3 1389 LEU n 
3 1390 LEU n 
3 1391 GLU n 
3 1392 GLY n 
3 1393 GLN n 
3 1394 VAL n 
3 1395 LEU n 
3 1396 GLU n 
3 1397 LYS n 
3 1398 TRP n 
3 1399 ASP n 
3 1400 VAL n 
3 1401 GLU n 
3 1402 ALA n 
3 1403 LEU n 
3 1404 ASN n 
3 1405 GLU n 
3 1406 ARG n 
3 1407 LEU n 
3 1408 ILE n 
3 1409 ALA n 
3 1410 GLU n 
3 1411 GLY n 
3 1412 LYS n 
3 1413 THR n 
3 1414 PRO n 
3 1415 VAL n 
3 1416 ALA n 
3 1417 TRP n 
3 1418 LYS n 
3 1419 PRO n 
3 1420 LEU n 
3 1421 LEU n 
3 1422 MET n 
3 1423 GLY n 
3 1424 VAL n 
3 1425 THR n 
3 1426 LYS n 
3 1427 SER n 
3 1428 ALA n 
3 1429 LEU n 
3 1430 SER n 
3 1431 THR n 
3 1432 LYS n 
3 1433 SER n 
3 1434 TRP n 
3 1435 LEU n 
3 1436 SER n 
3 1437 ALA n 
3 1438 ALA n 
3 1439 SER n 
3 1440 PHE n 
3 1441 GLN n 
3 1442 ASN n 
3 1443 THR n 
3 1444 THR n 
3 1445 HIS n 
3 1446 VAL n 
3 1447 LEU n 
3 1448 THR n 
3 1449 GLU n 
3 1450 ALA n 
3 1451 ALA n 
3 1452 ILE n 
3 1453 ALA n 
3 1454 GLY n 
3 1455 LYS n 
3 1456 LYS n 
3 1457 ASP n 
3 1458 GLU n 
3 1459 LEU n 
3 1460 ILE n 
3 1461 GLY n 
3 1462 LEU n 
3 1463 LYS n 
3 1464 GLU n 
3 1465 ASN n 
3 1466 VAL n 
3 1467 ILE n 
3 1468 LEU n 
3 1469 GLY n 
3 1470 ARG n 
3 1471 LEU n 
3 1472 ILE n 
3 1473 PRO n 
3 1474 ALA n 
3 1475 GLY n 
3 1476 THR n 
3 1477 GLY n 
3 1478 SER n 
3 1479 ASP n 
3 1480 PHE n 
3 1481 VAL n 
3 1482 ARG n 
3 1483 PHE n 
3 1484 THR n 
3 1485 GLN n 
3 1486 VAL n 
3 1487 VAL n 
3 1488 ASP n 
3 1489 GLN n 
3 1490 LYS n 
3 1491 THR n 
3 1492 LEU n 
3 1493 LYS n 
3 1494 ALA n 
3 1495 ILE n 
3 1496 GLU n 
3 1497 GLU n 
3 1498 ALA n 
3 1499 ARG n 
3 1500 LYS n 
3 1501 GLU n 
3 1502 ALA n 
3 1503 VAL n 
3 1504 GLU n 
3 1505 ALA n 
3 1506 LYS n 
3 1507 GLU n 
3 1508 ARG n 
3 1509 PRO n 
3 1510 ALA n 
3 1511 ALA n 
3 1512 ARG n 
3 1513 ARG n 
3 1514 GLY n 
3 1515 VAL n 
3 1516 LYS n 
3 1517 ARG n 
3 1518 GLU n 
3 1519 GLN n 
3 1520 PRO n 
3 1521 GLY n 
3 1522 LYS n 
3 1523 GLN n 
3 1524 ALA n 
4 1    MET n 
4 2    ALA n 
4 3    GLU n 
4 4    PRO n 
4 5    GLY n 
4 6    ILE n 
4 7    ASP n 
4 8    LYS n 
4 9    LEU n 
4 10   PHE n 
4 11   GLY n 
4 12   MET n 
4 13   VAL n 
4 14   ASP n 
4 15   SER n 
4 16   LYS n 
4 17   TYR n 
4 18   ARG n 
4 19   LEU n 
4 20   THR n 
4 21   VAL n 
4 22   VAL n 
4 23   VAL n 
4 24   ALA n 
4 25   LYS n 
4 26   ARG n 
4 27   ALA n 
4 28   GLN n 
4 29   GLN n 
4 30   LEU n 
4 31   LEU n 
4 32   ARG n 
4 33   HIS n 
4 34   GLY n 
4 35   PHE n 
4 36   LYS n 
4 37   ASN n 
4 38   THR n 
4 39   VAL n 
4 40   LEU n 
4 41   GLU n 
4 42   PRO n 
4 43   GLU n 
4 44   GLU n 
4 45   ARG n 
4 46   PRO n 
4 47   LYS n 
4 48   MET n 
4 49   GLN n 
4 50   THR n 
4 51   LEU n 
4 52   GLU n 
4 53   GLY n 
4 54   LEU n 
4 55   PHE n 
4 56   ASP n 
4 57   ASP n 
4 58   PRO n 
4 59   ASN n 
4 60   ALA n 
4 61   VAL n 
4 62   THR n 
4 63   TRP n 
4 64   ALA n 
4 65   MET n 
4 66   LYS n 
4 67   GLU n 
4 68   LEU n 
4 69   LEU n 
4 70   THR n 
4 71   GLY n 
4 72   ARG n 
4 73   LEU n 
4 74   VAL n 
4 75   PHE n 
4 76   GLY n 
4 77   GLU n 
4 78   ASN n 
4 79   LEU n 
4 80   VAL n 
4 81   PRO n 
4 82   GLU n 
4 83   ASP n 
4 84   ARG n 
4 85   LEU n 
4 86   GLN n 
4 87   LYS n 
4 88   GLU n 
4 89   MET n 
4 90   GLU n 
4 91   ARG n 
4 92   LEU n 
4 93   TYR n 
4 94   PRO n 
4 95   VAL n 
4 96   GLU n 
4 97   ARG n 
4 98   GLU n 
4 99   GLU n 
5 1    MET n 
5 2    LYS n 
5 3    LYS n 
5 4    SER n 
5 5    LYS n 
5 6    ARG n 
5 7    LYS n 
5 8    ASN n 
5 9    ALA n 
5 10   GLN n 
5 11   ALA n 
5 12   GLN n 
5 13   GLU n 
5 14   ALA n 
5 15   GLN n 
5 16   GLU n 
5 17   THR n 
5 18   GLU n 
5 19   VAL n 
5 20   LEU n 
5 21   VAL n 
5 22   GLN n 
5 23   GLU n 
5 24   GLU n 
5 25   ALA n 
5 26   GLU n 
5 27   GLU n 
5 28   LEU n 
5 29   PRO n 
5 30   GLU n 
5 31   PHE n 
5 32   PRO n 
5 33   GLU n 
5 34   GLY n 
5 35   GLU n 
5 36   PRO n 
5 37   ASP n 
5 38   PRO n 
5 39   ASP n 
5 40   LEU n 
5 41   GLU n 
5 42   ASP n 
5 43   PRO n 
5 44   ASP n 
5 45   LEU n 
5 46   THR n 
5 47   LEU n 
5 48   GLU n 
5 49   ASP n 
5 50   ASP n 
5 51   LEU n 
5 52   LEU n 
5 53   ASP n 
5 54   LEU n 
5 55   PRO n 
5 56   GLU n 
5 57   GLU n 
5 58   GLY n 
5 59   GLU n 
5 60   GLY n 
5 61   LEU n 
5 62   ASP n 
5 63   LEU n 
5 64   GLU n 
5 65   GLU n 
5 66   GLU n 
5 67   GLU n 
5 68   GLU n 
5 69   ASP n 
5 70   LEU n 
5 71   PRO n 
5 72   ILE n 
5 73   PRO n 
5 74   LYS n 
5 75   ILE n 
5 76   SER n 
5 77   THR n 
5 78   SER n 
5 79   ASP n 
5 80   PRO n 
5 81   VAL n 
5 82   ARG n 
5 83   GLN n 
5 84   TYR n 
5 85   LEU n 
5 86   HIS n 
5 87   GLU n 
5 88   ILE n 
5 89   GLY n 
5 90   GLN n 
5 91   VAL n 
5 92   PRO n 
5 93   LEU n 
5 94   LEU n 
5 95   THR n 
5 96   LEU n 
5 97   GLU n 
5 98   GLU n 
5 99   GLU n 
5 100  VAL n 
5 101  GLU n 
5 102  LEU n 
5 103  ALA n 
5 104  ARG n 
5 105  LYS n 
5 106  VAL n 
5 107  GLU n 
5 108  GLU n 
5 109  GLY n 
5 110  MET n 
5 111  GLU n 
5 112  ALA n 
5 113  ILE n 
5 114  LYS n 
5 115  LYS n 
5 116  LEU n 
5 117  SER n 
5 118  GLU n 
5 119  ILE n 
5 120  THR n 
5 121  GLY n 
5 122  LEU n 
5 123  ASP n 
5 124  PRO n 
5 125  ASP n 
5 126  LEU n 
5 127  ILE n 
5 128  ARG n 
5 129  GLU n 
5 130  VAL n 
5 131  VAL n 
5 132  ARG n 
5 133  ALA n 
5 134  LYS n 
5 135  ILE n 
5 136  LEU n 
5 137  GLY n 
5 138  SER n 
5 139  ALA n 
5 140  ARG n 
5 141  VAL n 
5 142  ARG n 
5 143  HIS n 
5 144  ILE n 
5 145  PRO n 
5 146  GLY n 
5 147  LEU n 
5 148  LYS n 
5 149  GLU n 
5 150  THR n 
5 151  LEU n 
5 152  ASP n 
5 153  PRO n 
5 154  LYS n 
5 155  THR n 
5 156  VAL n 
5 157  GLU n 
5 158  GLU n 
5 159  ILE n 
5 160  ASP n 
5 161  GLN n 
5 162  LYS n 
5 163  LEU n 
5 164  LYS n 
5 165  SER n 
5 166  LEU n 
5 167  PRO n 
5 168  LYS n 
5 169  GLU n 
5 170  HIS n 
5 171  LYS n 
5 172  ARG n 
5 173  TYR n 
5 174  LEU n 
5 175  HIS n 
5 176  ILE n 
5 177  ALA n 
5 178  ARG n 
5 179  GLU n 
5 180  GLY n 
5 181  GLU n 
5 182  ALA n 
5 183  ALA n 
5 184  ARG n 
5 185  GLN n 
5 186  HIS n 
5 187  LEU n 
5 188  ILE n 
5 189  GLU n 
5 190  ALA n 
5 191  ASN n 
5 192  LEU n 
5 193  ARG n 
5 194  LEU n 
5 195  VAL n 
5 196  VAL n 
5 197  SER n 
5 198  ILE n 
5 199  ALA n 
5 200  LYS n 
5 201  LYS n 
5 202  TYR n 
5 203  THR n 
5 204  GLY n 
5 205  ARG n 
5 206  GLY n 
5 207  LEU n 
5 208  SER n 
5 209  PHE n 
5 210  LEU n 
5 211  ASP n 
5 212  LEU n 
5 213  ILE n 
5 214  GLN n 
5 215  GLU n 
5 216  GLY n 
5 217  ASN n 
5 218  GLN n 
5 219  GLY n 
5 220  LEU n 
5 221  ILE n 
5 222  ARG n 
5 223  ALA n 
5 224  VAL n 
5 225  GLU n 
5 226  LYS n 
5 227  PHE n 
5 228  GLU n 
5 229  TYR n 
5 230  LYS n 
5 231  ARG n 
5 232  ARG n 
5 233  PHE n 
5 234  LYS n 
5 235  PHE n 
5 236  SER n 
5 237  THR n 
5 238  TYR n 
5 239  ALA n 
5 240  THR n 
5 241  TRP n 
5 242  TRP n 
5 243  ILE n 
5 244  ARG n 
5 245  GLN n 
5 246  ALA n 
5 247  ILE n 
5 248  ASN n 
5 249  ARG n 
5 250  ALA n 
5 251  ILE n 
5 252  ALA n 
5 253  ASP n 
5 254  GLN n 
5 255  ALA n 
5 256  ARG n 
5 257  THR n 
5 258  ILE n 
5 259  ARG n 
5 260  ILE n 
5 261  PRO n 
5 262  VAL n 
5 263  HIS n 
5 264  MET n 
5 265  VAL n 
5 266  GLU n 
5 267  THR n 
5 268  ILE n 
5 269  ASN n 
5 270  LYS n 
5 271  LEU n 
5 272  SER n 
5 273  ARG n 
5 274  THR n 
5 275  ALA n 
5 276  ARG n 
5 277  GLN n 
5 278  LEU n 
5 279  GLN n 
5 280  GLN n 
5 281  GLU n 
5 282  LEU n 
5 283  GLY n 
5 284  ARG n 
5 285  GLU n 
5 286  PRO n 
5 287  THR n 
5 288  TYR n 
5 289  GLU n 
5 290  GLU n 
5 291  ILE n 
5 292  ALA n 
5 293  GLU n 
5 294  ALA n 
5 295  MET n 
5 296  GLY n 
5 297  PRO n 
5 298  GLY n 
5 299  TRP n 
5 300  ASP n 
5 301  ALA n 
5 302  LYS n 
5 303  ARG n 
5 304  VAL n 
5 305  GLU n 
5 306  GLU n 
5 307  THR n 
5 308  LEU n 
5 309  LYS n 
5 310  ILE n 
5 311  ALA n 
5 312  GLN n 
5 313  GLU n 
5 314  PRO n 
5 315  VAL n 
5 316  SER n 
5 317  LEU n 
5 318  GLU n 
5 319  THR n 
5 320  PRO n 
5 321  ILE n 
5 322  GLY n 
5 323  ASP n 
5 324  GLU n 
5 325  LYS n 
5 326  ASP n 
5 327  SER n 
5 328  PHE n 
5 329  TYR n 
5 330  GLY n 
5 331  ASP n 
5 332  PHE n 
5 333  ILE n 
5 334  PRO n 
5 335  ASP n 
5 336  GLU n 
5 337  HIS n 
5 338  LEU n 
5 339  PRO n 
5 340  SER n 
5 341  PRO n 
5 342  VAL n 
5 343  ASP n 
5 344  ALA n 
5 345  ALA n 
5 346  THR n 
5 347  GLN n 
5 348  SER n 
5 349  LEU n 
5 350  LEU n 
5 351  SER n 
5 352  GLU n 
5 353  GLU n 
5 354  LEU n 
5 355  GLU n 
5 356  LYS n 
5 357  ALA n 
5 358  LEU n 
5 359  SER n 
5 360  LYS n 
5 361  LEU n 
5 362  SER n 
5 363  GLU n 
5 364  ARG n 
5 365  GLU n 
5 366  ALA n 
5 367  MET n 
5 368  VAL n 
5 369  LEU n 
5 370  LYS n 
5 371  LEU n 
5 372  ARG n 
5 373  LYS n 
5 374  GLY n 
5 375  LEU n 
5 376  ILE n 
5 377  ASP n 
5 378  GLY n 
5 379  ARG n 
5 380  GLU n 
5 381  HIS n 
5 382  THR n 
5 383  LEU n 
5 384  GLU n 
5 385  GLU n 
5 386  VAL n 
5 387  GLY n 
5 388  ALA n 
5 389  PHE n 
5 390  PHE n 
5 391  GLY n 
5 392  VAL n 
5 393  THR n 
5 394  ARG n 
5 395  GLU n 
5 396  ARG n 
5 397  ILE n 
5 398  ARG n 
5 399  GLN n 
5 400  ILE n 
5 401  GLU n 
5 402  ASN n 
5 403  LYS n 
5 404  ALA n 
5 405  LEU n 
5 406  ARG n 
5 407  LYS n 
5 408  LEU n 
5 409  LYS n 
5 410  TYR n 
5 411  HIS n 
5 412  GLU n 
5 413  SER n 
5 414  ARG n 
5 415  THR n 
5 416  ARG n 
5 417  LYS n 
5 418  LEU n 
5 419  ARG n 
5 420  ASP n 
5 421  PHE n 
5 422  LEU n 
5 423  ASP n 
6 1    DC  n 
6 2    DC  n 
6 3    DT  n 
6 4    DG  n 
6 5    DC  n 
6 6    DA  n 
6 7    DT  n 
6 8    DC  n 
6 9    DA  n 
6 10   DG  n 
6 11   DA  n 
6 12   DG  n 
6 13   DC  n 
6 14   DC  n 
6 15   DC  n 
6 16   DA  n 
6 17   DA  n 
6 18   DA  n 
6 19   DA  n 
6 20   DT  n 
6 21   DA  n 
6 22   DC  n 
7 1    DT  n 
7 2    DA  n 
7 3    DT  n 
7 4    DA  n 
7 5    DA  n 
7 6    DT  n 
7 7    DG  n 
7 8    DG  n 
7 9    DG  n 
7 10   DA  n 
7 11   DG  n 
7 12   DC  n 
7 13   DT  n 
7 14   DG  n 
7 15   DG  n 
7 16   DC  n 
7 17   DT  n 
7 18   DC  n 
7 19   DT  n 
7 20   DG  n 
7 21   DA  n 
7 22   DT  n 
7 23   DG  n 
7 24   DC  n 
7 25   DA  n 
7 26   DG  n 
7 27   DG  n 
8 1    GTP n 
8 2    G   n 
8 3    G   n 
8 4    G   n 
8 5    G   n 
8 6    G   n 
8 7    G   n 
8 8    G   n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample 1 315  ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
2 1 sample 1 1119 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
3 1 sample 1 1524 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
4 1 sample 1 99   ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
5 1 sample 1 423  ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
8 1 sample 1 8    ? 'Thermus thermophilus'                                     274    ? ? ?                            ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
6 1 sample 1 22 'Bacillus subtilis' ? 1423 ? 
7 1 sample 1 27 'Bacillus subtilis' ? 1423 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP RPOA_THET8   Q5SHR6 ? 1 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
1 
2 UNP RPOB_THET8   Q8RQE9 ? 2 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
1 
3 UNP RPOC_THET8   Q8RQE8 ? 3 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
1 
4 UNP RPOZ_THET8   Q8RQE7 ? 4 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
1 
5 UNP Q5SKW1_THET8 Q5SKW1 ? 5 
;MKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEGLDLEEEEEDLPIPKISTSDP
VRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEID
QKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYAT
WWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETP
IGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQI
ENKALRKLKYHESRTRKLRDFLD
;
1 
6 PDB 5VO8         5VO8   ? 6 ? 1 
7 PDB 5VO8         5VO8   ? 7 ? 1 
8 PDB 5VO8         5VO8   ? 8 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5VO8 A 1 ? 315  ? Q5SHR6 1 ? 315  ? 1 315  
2 1 5VO8 B 1 ? 315  ? Q5SHR6 1 ? 315  ? 1 315  
3 2 5VO8 C 1 ? 1119 ? Q8RQE9 1 ? 1119 ? 1 1119 
4 3 5VO8 D 1 ? 1524 ? Q8RQE8 1 ? 1524 ? 1 1524 
5 4 5VO8 E 1 ? 99   ? Q8RQE7 1 ? 99   ? 1 99   
6 5 5VO8 F 1 ? 423  ? Q5SKW1 1 ? 423  ? 1 423  
7 6 5VO8 G 1 ? 22   ? 5VO8   3 ? 24   ? 3 24   
8 7 5VO8 H 1 ? 27   ? 5VO8   1 ? 25   ? 1 25   
9 8 5VO8 I 1 ? 8    ? 5VO8   1 ? 8    ? 1 8    
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'   322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O8 P'   363.221 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'        75.067  
GTP non-polymer         n "GUANOSINE-5'-TRIPHOSPHATE"          ? 'C10 H16 N5 O14 P3' 523.180 
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'       165.189 
POP non-polymer         . 'PYROPHOSPHATE 2-'                   ? 'H2 O7 P2 -2'       175.959 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'              65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5VO8 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.15 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         60.95 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M Tris-HCl (pH 8), 0.2M KCl, 50 mM MgCl2, 9.5 % PEG4000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-12-07 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.98 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_synchrotron_site       CHESS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5VO8 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.3 
_reflns.d_resolution_low                 30 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       78332 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             94.2 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.2 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            9.9 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  . 
_reflns_shell.d_res_low                   ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5VO8 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     78219 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.883 
_refine.ls_d_res_high                            3.300 
_refine.ls_percent_reflns_obs                    94.24 
_refine.ls_R_factor_obs                          0.1865 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1850 
_refine.ls_R_factor_R_free                       0.2461 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.56 
_refine.ls_number_reflns_R_free                  1999 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      4Q4Z 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.38 
_refine.pdbx_overall_phase_error                 28.67 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        27548 
_refine_hist.pdbx_number_atoms_nucleic_acid   973 
_refine_hist.pdbx_number_atoms_ligand         13 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               28534 
_refine_hist.d_res_high                       3.300 
_refine_hist.d_res_low                        29.883 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.013  ? ? 29156 'X-RAY DIFFRACTION' ? 
f_angle_d          1.580  ? ? 39623 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 19.865 ? ? 17759 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.088  ? ? 4464  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.011  ? ? 5026  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 3.3000 3.3824  3970 0.3015 70.00  0.3444 . . 114 . . . . 
'X-RAY DIFFRACTION' . 3.3824 3.4737  4440 0.2771 78.00  0.3069 . . 121 . . . . 
'X-RAY DIFFRACTION' . 3.4737 3.5758  4967 0.2754 86.00  0.3325 . . 127 . . . . 
'X-RAY DIFFRACTION' . 3.5758 3.6910  5296 0.2532 92.00  0.3171 . . 139 . . . . 
'X-RAY DIFFRACTION' . 3.6910 3.8227  5537 0.2416 96.00  0.2902 . . 141 . . . . 
'X-RAY DIFFRACTION' . 3.8227 3.9754  5662 0.2149 98.00  0.2958 . . 152 . . . . 
'X-RAY DIFFRACTION' . 3.9754 4.1559  5709 0.1870 99.00  0.2421 . . 150 . . . . 
'X-RAY DIFFRACTION' . 4.1559 4.3743  5764 0.1754 100.00 0.2284 . . 154 . . . . 
'X-RAY DIFFRACTION' . 4.3743 4.6475  5774 0.1594 100.00 0.1947 . . 146 . . . . 
'X-RAY DIFFRACTION' . 4.6475 5.0048  5756 0.1616 100.00 0.2308 . . 146 . . . . 
'X-RAY DIFFRACTION' . 5.0048 5.5056  5793 0.1673 100.00 0.2563 . . 155 . . . . 
'X-RAY DIFFRACTION' . 5.5056 6.2958  5809 0.1857 100.00 0.2336 . . 155 . . . . 
'X-RAY DIFFRACTION' . 6.2958 7.9076  5822 0.1812 100.00 0.2354 . . 151 . . . . 
'X-RAY DIFFRACTION' . 7.9076 29.8842 5921 0.1414 99.00  0.2082 . . 148 . . . . 
# 
_struct.entry_id                     5VO8 
_struct.title                        'X-ray crystal structure of a bacterial reiterative transcription complex of pyrG promoter' 
_struct.pdbx_descriptor              
;DNA-directed RNA polymerase subunit alpha, DNA-directed RNA polymerase subunit beta, DNA-directed RNA polymerase subunit beta', DNA-directed RNA polymerase subunit omega, RNA polymerase sigma factor SigA/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5VO8 
_struct_keywords.text            
'Thermus thermophilus, RNA polymerase, reiterative transcription, holoenzyme, transcription-DNA-RNA complex' 
_struct_keywords.pdbx_keywords   transcription/DNA/RNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 1  ? 
C N N 2  ? 
D N N 3  ? 
E N N 4  ? 
F N N 5  ? 
G N N 6  ? 
H N N 7  ? 
I N N 8  ? 
J N N 9  ? 
K N N 10 ? 
L N N 9  ? 
M N N 11 ? 
N N N 11 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 GLY A 31   ? SER A 47   ? GLY A 31   SER A 47   1 ? 17 
HELX_P HELX_P2   AA2 ASP A 74   ? LYS A 83   ? ASP A 74   LYS A 83   1 ? 10 
HELX_P HELX_P3   AA3 ARG A 112  ? PHE A 114  ? ARG A 112  PHE A 114  5 ? 3  
HELX_P HELX_P4   AA4 PRO A 152  ? GLY A 157  ? PRO A 152  GLY A 157  1 ? 6  
HELX_P HELX_P5   AA5 THR A 206  ? TYR A 224  ? THR A 206  TYR A 224  1 ? 19 
HELX_P HELX_P6   AA6 GLY B 31   ? SER B 47   ? GLY B 31   SER B 47   1 ? 17 
HELX_P HELX_P7   AA7 ASP B 74   ? GLU B 84   ? ASP B 74   GLU B 84   1 ? 11 
HELX_P HELX_P8   AA8 PRO B 152  ? GLY B 157  ? PRO B 152  GLY B 157  1 ? 6  
HELX_P HELX_P9   AA9 THR B 206  ? THR B 223  ? THR B 206  THR B 223  1 ? 18 
HELX_P HELX_P10  AB1 THR C 19   ? GLN C 31   ? THR C 19   GLN C 31   1 ? 13 
HELX_P HELX_P11  AB2 PRO C 35   ? ARG C 39   ? PRO C 35   ARG C 39   5 ? 5  
HELX_P HELX_P12  AB3 VAL C 42   ? PHE C 52   ? VAL C 42   PHE C 52   1 ? 11 
HELX_P HELX_P13  AB4 PRO C 79   ? ASP C 87   ? PRO C 79   ASP C 87   1 ? 9  
HELX_P HELX_P14  AB5 LEU C 193  ? LEU C 200  ? LEU C 193  LEU C 200  1 ? 8  
HELX_P HELX_P15  AB6 ASP C 203  ? GLY C 212  ? ASP C 203  GLY C 212  1 ? 10 
HELX_P HELX_P16  AB7 TYR C 214  ? MET C 222  ? TYR C 214  MET C 222  1 ? 9  
HELX_P HELX_P17  AB8 ASP C 223  ? ALA C 228  ? ASP C 223  ALA C 228  1 ? 6  
HELX_P HELX_P18  AB9 ARG C 230  ? ARG C 243  ? ARG C 230  ARG C 243  1 ? 14 
HELX_P HELX_P19  AC1 LYS C 249  ? ALA C 262  ? LYS C 249  ALA C 262  1 ? 14 
HELX_P HELX_P20  AC2 GLY C 270  ? GLY C 282  ? GLY C 270  GLY C 282  1 ? 13 
HELX_P HELX_P21  AC3 VAL C 302  ? ALA C 315  ? VAL C 302  ALA C 315  1 ? 14 
HELX_P HELX_P22  AC4 THR C 335  ? MET C 359  ? THR C 335  MET C 359  1 ? 25 
HELX_P HELX_P23  AC5 THR C 368  ? VAL C 373  ? THR C 368  VAL C 373  1 ? 6  
HELX_P HELX_P24  AC6 SER C 375  ? SER C 389  ? SER C 375  SER C 389  1 ? 15 
HELX_P HELX_P25  AC7 ASN C 399  ? ARG C 408  ? ASN C 399  ARG C 408  1 ? 10 
HELX_P HELX_P26  AC8 HIS C 431  ? TYR C 435  ? HIS C 431  TYR C 435  5 ? 5  
HELX_P HELX_P27  AC9 THR C 487  ? ASP C 492  ? THR C 487  ASP C 492  1 ? 6  
HELX_P HELX_P28  AD1 SER C 525  ? VAL C 529  ? SER C 525  VAL C 529  5 ? 5  
HELX_P HELX_P29  AD2 PRO C 536  ? PHE C 540  ? PRO C 536  PHE C 540  5 ? 5  
HELX_P HELX_P30  AD3 ASN C 543  ? ILE C 547  ? ASN C 543  ILE C 547  5 ? 5  
HELX_P HELX_P31  AD4 PHE C 549  ? ASP C 553  ? PHE C 549  ASP C 553  5 ? 5  
HELX_P HELX_P32  AD5 ASP C 554  ? THR C 566  ? ASP C 554  THR C 566  1 ? 13 
HELX_P HELX_P33  AD6 LEU C 583  ? LEU C 592  ? LEU C 583  LEU C 592  1 ? 10 
HELX_P HELX_P34  AD7 ASN C 683  ? ALA C 687  ? ASN C 683  ALA C 687  5 ? 5  
HELX_P HELX_P35  AD8 GLU C 692  ? ARG C 697  ? GLU C 692  ARG C 697  1 ? 6  
HELX_P HELX_P36  AD9 SER C 730  ? ARG C 735  ? SER C 730  ARG C 735  1 ? 6  
HELX_P HELX_P37  AE1 THR C 768  ? GLY C 779  ? THR C 768  GLY C 779  1 ? 12 
HELX_P HELX_P38  AE2 PRO C 854  ? MET C 858  ? PRO C 854  MET C 858  5 ? 5  
HELX_P HELX_P39  AE3 LEU C 874  ? MET C 880  ? LEU C 874  MET C 880  1 ? 7  
HELX_P HELX_P40  AE4 LEU C 882  ? GLY C 898  ? LEU C 882  GLY C 898  1 ? 17 
HELX_P HELX_P41  AE5 LYS C 910  ? GLU C 932  ? LYS C 910  GLU C 932  1 ? 23 
HELX_P HELX_P42  AE6 ASP C 937  ? LEU C 950  ? ASP C 937  LEU C 950  1 ? 14 
HELX_P HELX_P43  AE7 THR C 958  ? GLN C 969  ? THR C 958  GLN C 969  1 ? 12 
HELX_P HELX_P44  AE8 MET C 1000 ? MET C 1005 ? MET C 1000 MET C 1005 1 ? 6  
HELX_P HELX_P45  AE9 GLY C 1033 ? TYR C 1043 ? GLY C 1033 TYR C 1043 1 ? 11 
HELX_P HELX_P46  AF1 ALA C 1045 ? THR C 1054 ? ALA C 1045 THR C 1054 1 ? 10 
HELX_P HELX_P47  AF2 ASP C 1059 ? GLY C 1073 ? ASP C 1059 GLY C 1073 1 ? 15 
HELX_P HELX_P48  AF3 PRO C 1082 ? LEU C 1095 ? PRO C 1082 LEU C 1095 1 ? 14 
HELX_P HELX_P49  AF4 SER D 14   ? SER D 22   ? SER D 14   SER D 22   1 ? 9  
HELX_P HELX_P50  AF5 ASP D 46   ? GLY D 51   ? ASP D 46   GLY D 51   1 ? 6  
HELX_P HELX_P51  AF6 LYS D 82   ? TYR D 88   ? LYS D 82   TYR D 88   5 ? 7  
HELX_P HELX_P52  AF7 ILE D 102  ? ASP D 107  ? ILE D 102  ASP D 107  1 ? 6  
HELX_P HELX_P53  AF8 SER D 110  ? ASP D 117  ? SER D 110  ASP D 117  1 ? 8  
HELX_P HELX_P54  AF9 SER D 119  ? TYR D 128  ? SER D 119  TYR D 128  1 ? 10 
HELX_P HELX_P55  AG1 THR D 154  ? GLY D 164  ? THR D 154  GLY D 164  1 ? 11 
HELX_P HELX_P56  AG2 ASP D 423  ? LYS D 426  ? ASP D 423  LYS D 426  5 ? 4  
HELX_P HELX_P57  AG3 MET D 456  ? GLU D 467  ? MET D 456  GLU D 467  1 ? 12 
HELX_P HELX_P58  AG4 ASP D 469  ? MET D 481  ? ASP D 469  MET D 481  1 ? 13 
HELX_P HELX_P59  AG5 ARG D 486  ? GLY D 506  ? ARG D 486  GLY D 506  1 ? 21 
HELX_P HELX_P60  AG6 ARG D 508  ? TRP D 511  ? ARG D 508  TRP D 511  5 ? 4  
HELX_P HELX_P61  AG7 PRO D 521  ? ARG D 525  ? PRO D 521  ARG D 525  5 ? 5  
HELX_P HELX_P62  AG8 SER D 538  ? GLN D 560  ? SER D 538  GLN D 560  1 ? 23 
HELX_P HELX_P63  AG9 PRO D 563  ? ASP D 583  ? PRO D 563  ASP D 583  1 ? 21 
HELX_P HELX_P64  AH1 SER D 602  ? SER D 608  ? SER D 602  SER D 608  1 ? 7  
HELX_P HELX_P65  AH2 GLY D 612  ? LEU D 618  ? GLY D 612  LEU D 618  1 ? 7  
HELX_P HELX_P66  AH3 LYS D 646  ? PHE D 653  ? LYS D 646  PHE D 653  1 ? 8  
HELX_P HELX_P67  AH4 PHE D 653  ? LYS D 664  ? PHE D 653  LYS D 664  1 ? 12 
HELX_P HELX_P68  AH5 ASN D 669  ? ARG D 679  ? ASN D 669  ARG D 679  1 ? 11 
HELX_P HELX_P69  AH6 GLN D 680  ? ILE D 683  ? GLN D 680  ILE D 683  5 ? 4  
HELX_P HELX_P70  AH7 ASP D 685  ? ILE D 695  ? ASP D 685  ILE D 695  1 ? 11 
HELX_P HELX_P71  AH8 HIS D 709  ? LEU D 711  ? HIS D 709  LEU D 711  5 ? 3  
HELX_P HELX_P72  AH9 HIS D 729  ? GLU D 734  ? HIS D 729  GLU D 734  5 ? 6  
HELX_P HELX_P73  AI1 SER D 752  ? MET D 763  ? SER D 752  MET D 763  1 ? 12 
HELX_P HELX_P74  AI2 LEU D 764  ? ASN D 768  ? LEU D 764  ASN D 768  5 ? 5  
HELX_P HELX_P75  AI3 ARG D 783  ? GLN D 794  ? ARG D 783  GLN D 794  1 ? 12 
HELX_P HELX_P76  AI4 THR D 808  ? GLY D 819  ? THR D 808  GLY D 819  1 ? 12 
HELX_P HELX_P77  AI5 VAL D 836  ? TYR D 841  ? VAL D 836  TYR D 841  1 ? 6  
HELX_P HELX_P78  AI6 ASN D 845  ? HIS D 855  ? ASN D 845  HIS D 855  1 ? 11 
HELX_P HELX_P79  AI7 SER D 876  ? GLU D 891  ? SER D 876  GLU D 891  1 ? 16 
HELX_P HELX_P80  AI8 ASP D 892  ? ILE D 900  ? ASP D 892  ILE D 900  1 ? 9  
HELX_P HELX_P81  AI9 GLU D 907  ? GLY D 923  ? GLU D 907  GLY D 923  1 ? 17 
HELX_P HELX_P82  AJ1 GLY D 923  ? GLY D 946  ? GLY D 923  GLY D 946  1 ? 24 
HELX_P HELX_P83  AJ2 GLY D 950  ? ALA D 954  ? GLY D 950  ALA D 954  5 ? 5  
HELX_P HELX_P84  AJ3 GLU D 958  ? MET D 980  ? GLU D 958  MET D 980  1 ? 23 
HELX_P HELX_P85  AJ4 THR D 984  ? TYR D 1015 ? THR D 984  TYR D 1015 1 ? 32 
HELX_P HELX_P86  AJ5 ASN D 1018 ? SER D 1026 ? ASN D 1018 SER D 1026 1 ? 9  
HELX_P HELX_P87  AJ6 ASN D 1031 ? GLY D 1040 ? ASN D 1031 GLY D 1040 1 ? 10 
HELX_P HELX_P88  AJ7 THR D 1066 ? HIS D 1103 ? THR D 1066 HIS D 1103 1 ? 38 
HELX_P HELX_P89  AJ8 LYS D 1136 ? TYR D 1145 ? LYS D 1136 TYR D 1145 1 ? 10 
HELX_P HELX_P90  AJ9 SER D 1167 ? ALA D 1180 ? SER D 1167 ALA D 1180 1 ? 14 
HELX_P HELX_P91  AK1 SER D 1190 ? CYS D 1194 ? SER D 1190 CYS D 1194 5 ? 5  
HELX_P HELX_P92  AK2 GLN D 1202 ? GLY D 1206 ? GLN D 1202 GLY D 1206 1 ? 5  
HELX_P HELX_P93  AK3 ALA D 1220 ? GLU D 1231 ? ALA D 1220 GLU D 1231 1 ? 12 
HELX_P HELX_P94  AK4 GLY D 1255 ? GLU D 1264 ? GLY D 1255 GLU D 1264 1 ? 10 
HELX_P HELX_P95  AK5 ASP D 1331 ? GLY D 1340 ? ASP D 1331 GLY D 1340 1 ? 10 
HELX_P HELX_P96  AK6 GLY D 1340 ? GLN D 1359 ? GLY D 1340 GLN D 1359 1 ? 20 
HELX_P HELX_P97  AK7 HIS D 1364 ? MET D 1376 ? HIS D 1364 MET D 1376 1 ? 13 
HELX_P HELX_P98  AK8 LYS D 1397 ? ALA D 1409 ? LYS D 1397 ALA D 1409 1 ? 13 
HELX_P HELX_P99  AK9 GLY D 1423 ? SER D 1430 ? GLY D 1423 SER D 1430 1 ? 8  
HELX_P HELX_P100 AL1 SER D 1433 ? GLN D 1441 ? SER D 1433 GLN D 1441 1 ? 9  
HELX_P HELX_P101 AL2 ASN D 1442 ? GLY D 1454 ? ASN D 1442 GLY D 1454 1 ? 13 
HELX_P HELX_P102 AL3 GLY D 1461 ? GLY D 1469 ? GLY D 1461 GLY D 1469 1 ? 9  
HELX_P HELX_P103 AL4 ALA D 1474 ? SER D 1478 ? ALA D 1474 SER D 1478 5 ? 5  
HELX_P HELX_P104 AL5 GLN D 1489 ? GLU D 1501 ? GLN D 1489 GLU D 1501 1 ? 13 
HELX_P HELX_P105 AL6 GLY E 5    ? MET E 12   ? GLY E 5    MET E 12   1 ? 8  
HELX_P HELX_P106 AL7 SER E 15   ? GLY E 34   ? SER E 15   GLY E 34   1 ? 20 
HELX_P HELX_P107 AL8 ASN E 59   ? GLY E 71   ? ASN E 59   GLY E 71   1 ? 13 
HELX_P HELX_P108 AL9 PRO E 81   ? TYR E 93   ? PRO E 81   TYR E 93   1 ? 13 
HELX_P HELX_P109 AM1 ASP F 79   ? GLY F 89   ? ASP F 79   GLY F 89   1 ? 11 
HELX_P HELX_P110 AM2 THR F 95   ? GLY F 121  ? THR F 95   GLY F 121  1 ? 27 
HELX_P HELX_P111 AM3 ASP F 123  ? GLY F 137  ? ASP F 123  GLY F 137  1 ? 15 
HELX_P HELX_P112 AM4 ASP F 152  ? LYS F 164  ? ASP F 152  LYS F 164  1 ? 13 
HELX_P HELX_P113 AM5 PRO F 167  ? ASN F 191  ? PRO F 167  ASN F 191  1 ? 25 
HELX_P HELX_P114 AM6 ASN F 191  ? LYS F 200  ? ASN F 191  LYS F 200  1 ? 10 
HELX_P HELX_P115 AM7 LYS F 201  ? THR F 203  ? LYS F 201  THR F 203  5 ? 3  
HELX_P HELX_P116 AM8 SER F 208  ? PHE F 227  ? SER F 208  PHE F 227  1 ? 20 
HELX_P HELX_P117 AM9 GLU F 228  ? ARG F 232  ? GLU F 228  ARG F 232  5 ? 5  
HELX_P HELX_P118 AN1 LYS F 234  ? ALA F 255  ? LYS F 234  ALA F 255  1 ? 22 
HELX_P HELX_P119 AN2 PRO F 261  ? GLY F 283  ? PRO F 261  GLY F 283  1 ? 23 
HELX_P HELX_P120 AN3 THR F 287  ? MET F 295  ? THR F 287  MET F 295  1 ? 9  
HELX_P HELX_P121 AN4 ASP F 300  ? ALA F 311  ? ASP F 300  ALA F 311  1 ? 12 
HELX_P HELX_P122 AN5 PHE F 328  ? ILE F 333  ? PHE F 328  ILE F 333  5 ? 6  
HELX_P HELX_P123 AN6 SER F 340  ? SER F 359  ? SER F 340  SER F 359  1 ? 20 
HELX_P HELX_P124 AN7 SER F 362  ? GLY F 374  ? SER F 362  GLY F 374  1 ? 13 
HELX_P HELX_P125 AN8 GLU F 384  ? ALA F 388  ? GLU F 384  ALA F 388  5 ? 5  
HELX_P HELX_P126 AN9 ARG F 394  ? THR F 415  ? ARG F 394  THR F 415  1 ? 22 
HELX_P HELX_P127 AO1 ARG F 416  ? ASP F 423  ? ARG F 416  ASP F 423  5 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ?    ? B GLU 154  OE1   ? ? ? 1_555 J MG  .  MG ? ? B GLU 154  B MG  1001 1_555 ? ? ? ? ? ? ?               2.599 
? 
metalc2  metalc ?    ? B GLU 154  OE2   ? ? ? 1_555 J MG  .  MG ? ? B GLU 154  B MG  1001 1_555 ? ? ? ? ? ? ?               2.332 
? 
metalc3  metalc ?    ? B ASP 168  OD1   ? ? ? 1_555 J MG  .  MG ? ? B ASP 168  B MG  1001 1_555 ? ? ? ? ? ? ?               2.847 
? 
metalc4  metalc ?    ? B ASP 168  OD2   ? ? ? 1_555 J MG  .  MG ? ? B ASP 168  B MG  1001 1_555 ? ? ? ? ? ? ?               2.667 
? 
covale1  covale none ? C ARG 879  NH2   ? ? ? 1_555 K POP .  O3 ? ? C ARG 879  C POP 1201 1_555 ? ? ? ? ? ? ?               1.313 
? 
metalc5  metalc ?    ? D CYS 58   SG    ? ? ? 1_555 M ZN  .  ZN ? ? D CYS 58   D ZN  2002 1_555 ? ? ? ? ? ? ?               2.295 
? 
metalc6  metalc ?    ? D CYS 60   SG    ? ? ? 1_555 M ZN  .  ZN ? ? D CYS 60   D ZN  2002 1_555 ? ? ? ? ? ? ?               2.375 
? 
metalc7  metalc ?    ? D CYS 73   SG    ? ? ? 1_555 M ZN  .  ZN ? ? D CYS 73   D ZN  2002 1_555 ? ? ? ? ? ? ?               2.378 
? 
metalc8  metalc ?    ? D CYS 76   SG    ? ? ? 1_555 M ZN  .  ZN ? ? D CYS 76   D ZN  2002 1_555 ? ? ? ? ? ? ?               2.342 
? 
metalc9  metalc ?    ? D ASP 739  OD1   ? ? ? 1_555 L MG  .  MG ? ? D ASP 739  D MG  2001 1_555 ? ? ? ? ? ? ?               2.385 
? 
metalc10 metalc ?    ? D ASP 741  OD1   ? ? ? 1_555 L MG  .  MG ? ? D ASP 741  D MG  2001 1_555 ? ? ? ? ? ? ?               2.292 
? 
metalc11 metalc ?    ? D ASP 741  OD2   ? ? ? 1_555 L MG  .  MG ? ? D ASP 741  D MG  2001 1_555 ? ? ? ? ? ? ?               2.630 
? 
metalc12 metalc ?    ? D ASP 743  OD1   ? ? ? 1_555 L MG  .  MG ? ? D ASP 743  D MG  2001 1_555 ? ? ? ? ? ? ?               2.228 
? 
metalc13 metalc ?    ? D ASP 743  OD2   ? ? ? 1_555 L MG  .  MG ? ? D ASP 743  D MG  2001 1_555 ? ? ? ? ? ? ?               2.775 
? 
metalc14 metalc ?    ? D LYS 840  O     ? ? ? 1_555 J MG  .  MG ? ? D LYS 840  B MG  1001 1_555 ? ? ? ? ? ? ?               2.355 
? 
metalc15 metalc ?    ? D CYS 1112 SG    ? ? ? 1_555 N ZN  .  ZN ? ? D CYS 1112 D ZN  2003 1_555 ? ? ? ? ? ? ?               2.351 
? 
metalc16 metalc ?    ? D CYS 1194 SG    ? ? ? 1_555 N ZN  .  ZN ? ? D CYS 1194 D ZN  2003 1_555 ? ? ? ? ? ? ?               2.110 
? 
metalc17 metalc ?    ? D CYS 1201 SG    ? ? ? 1_555 N ZN  .  ZN ? ? D CYS 1201 D ZN  2003 1_555 ? ? ? ? ? ? ?               2.442 
? 
metalc18 metalc ?    ? D CYS 1204 SG    ? ? ? 1_555 N ZN  .  ZN ? ? D CYS 1204 D ZN  2003 1_555 ? ? ? ? ? ? ?               2.627 
? 
covale2  covale both ? I GTP 1    "O3'" ? ? ? 1_555 I G   2  P  ? ? I GTP 1    I G   2    1_555 ? ? ? ? ? ? ?               1.556 
? 
metalc19 metalc ?    ? I G   8    "O3'" ? ? ? 1_555 L MG  .  MG ? ? I G   8    D MG  2001 1_555 ? ? ? ? ? ? ?               2.102 
? 
hydrog1  hydrog ?    ? G DC  1    N3    ? ? ? 1_555 H DG  27 N1 ? ? G DC  3    H DG  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog2  hydrog ?    ? G DC  1    N4    ? ? ? 1_555 H DG  27 O6 ? ? G DC  3    H DG  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog3  hydrog ?    ? G DC  1    O2    ? ? ? 1_555 H DG  27 N2 ? ? G DC  3    H DG  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog4  hydrog ?    ? G DC  2    N3    ? ? ? 1_555 H DG  26 N1 ? ? G DC  4    H DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog5  hydrog ?    ? G DC  2    N4    ? ? ? 1_555 H DG  26 O6 ? ? G DC  4    H DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog6  hydrog ?    ? G DC  2    O2    ? ? ? 1_555 H DG  26 N2 ? ? G DC  4    H DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog7  hydrog ?    ? G DT  3    O4    ? ? ? 1_555 H DC  24 N4 ? ? G DT  5    H DC  22   1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ?     
? 
hydrog8  hydrog ?    ? G DG  4    N1    ? ? ? 1_555 H DC  24 O2 ? ? G DG  6    H DC  22   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     
? 
hydrog9  hydrog ?    ? G DC  5    N3    ? ? ? 1_555 H DG  23 N1 ? ? G DC  7    H DG  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog10 hydrog ?    ? G DC  5    N4    ? ? ? 1_555 H DG  23 O6 ? ? G DC  7    H DG  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog11 hydrog ?    ? G DC  5    O2    ? ? ? 1_555 H DG  23 N2 ? ? G DC  7    H DG  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog12 hydrog ?    ? G DA  6    N1    ? ? ? 1_555 H DT  22 N3 ? ? G DA  8    H DT  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog13 hydrog ?    ? G DA  6    N6    ? ? ? 1_555 H DT  22 O4 ? ? G DA  8    H DT  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog14 hydrog ?    ? G DT  7    N3    ? ? ? 1_555 H DA  21 N1 ? ? G DT  9    H DA  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog15 hydrog ?    ? G DT  7    O4    ? ? ? 1_555 H DA  21 N6 ? ? G DT  9    H DA  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog16 hydrog ?    ? G DC  8    N3    ? ? ? 1_555 H DG  20 N1 ? ? G DC  10   H DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog17 hydrog ?    ? G DC  8    N4    ? ? ? 1_555 H DG  20 O6 ? ? G DC  10   H DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog18 hydrog ?    ? G DC  8    O2    ? ? ? 1_555 H DG  20 N2 ? ? G DC  10   H DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog19 hydrog ?    ? G DA  9    N1    ? ? ? 1_555 H DT  19 N3 ? ? G DA  11   H DT  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog20 hydrog ?    ? G DA  9    N6    ? ? ? 1_555 H DT  19 O4 ? ? G DA  11   H DT  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog21 hydrog ?    ? G DG  10   N1    ? ? ? 1_555 H DC  18 N3 ? ? G DG  12   H DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog22 hydrog ?    ? G DG  10   N2    ? ? ? 1_555 H DC  18 O2 ? ? G DG  12   H DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog23 hydrog ?    ? G DG  10   O6    ? ? ? 1_555 H DC  18 N4 ? ? G DG  12   H DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog24 hydrog ?    ? G DC  13   N3    ? ? ? 1_555 I G   8  N1 ? ? G DC  15   I G   8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog25 hydrog ?    ? G DC  13   N4    ? ? ? 1_555 I G   8  O6 ? ? G DC  15   I G   8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog26 hydrog ?    ? G DC  13   O2    ? ? ? 1_555 I G   8  N2 ? ? G DC  15   I G   8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog27 hydrog ?    ? G DC  14   N3    ? ? ? 1_555 I G   7  N1 ? ? G DC  16   I G   7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog28 hydrog ?    ? G DC  14   N4    ? ? ? 1_555 I G   7  O6 ? ? G DC  16   I G   7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog29 hydrog ?    ? G DC  14   O2    ? ? ? 1_555 I G   7  N2 ? ? G DC  16   I G   7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog30 hydrog ?    ? G DC  15   N3    ? ? ? 1_555 I G   6  N1 ? ? G DC  17   I G   6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog31 hydrog ?    ? G DC  15   N4    ? ? ? 1_555 I G   6  O6 ? ? G DC  17   I G   6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog32 hydrog ?    ? G DC  15   O2    ? ? ? 1_555 I G   6  N2 ? ? G DC  17   I G   6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 26   A . ? GLU 26   A PRO 27   A ? PRO 27   A 1 -11.83 
2 GLU 26   B . ? GLU 26   B PRO 27   B ? PRO 27   B 1 -9.80  
3 PHE 52   C . ? PHE 52   C PRO 53   C ? PRO 53   C 1 2.46   
4 VAL 108  D . ? VAL 108  D PRO 109  D ? PRO 109  D 1 -7.18  
5 ALA 705  D . ? ALA 705  D PRO 706  D ? PRO 706  D 1 0.97   
6 THR 1234 D . ? THR 1234 D GLN 1235 D ? GLN 1235 D 1 16.30  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 4 ? 
AA7 ? 4 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 3 ? 
AB3 ? 3 ? 
AB4 ? 3 ? 
AB5 ? 4 ? 
AB6 ? 5 ? 
AB7 ? 2 ? 
AB8 ? 3 ? 
AB9 ? 6 ? 
AC1 ? 2 ? 
AC2 ? 3 ? 
AC3 ? 4 ? 
AC4 ? 2 ? 
AC5 ? 2 ? 
AC6 ? 8 ? 
AC7 ? 4 ? 
AC8 ? 2 ? 
AC9 ? 2 ? 
AD1 ? 8 ? 
AD2 ? 2 ? 
AD3 ? 4 ? 
AD4 ? 2 ? 
AD5 ? 3 ? 
AD6 ? 2 ? 
AD7 ? 4 ? 
AD8 ? 2 ? 
AD9 ? 5 ? 
AE1 ? 3 ? 
AE2 ? 3 ? 
AE3 ? 4 ? 
AE4 ? 3 ? 
AE5 ? 4 ? 
AE6 ? 2 ? 
AE7 ? 3 ? 
AE8 ? 3 ? 
AE9 ? 3 ? 
AF1 ? 2 ? 
AF2 ? 2 ? 
AF3 ? 2 ? 
AF4 ? 2 ? 
AF5 ? 2 ? 
AF6 ? 4 ? 
AF7 ? 3 ? 
AF8 ? 2 ? 
AF9 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? parallel      
AB2 2 3 ? parallel      
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? parallel      
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? parallel      
AB9 4 5 ? anti-parallel 
AB9 5 6 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC6 4 5 ? parallel      
AC6 5 6 ? anti-parallel 
AC6 6 7 ? parallel      
AC6 7 8 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD1 3 4 ? anti-parallel 
AD1 4 5 ? anti-parallel 
AD1 5 6 ? parallel      
AD1 6 7 ? anti-parallel 
AD1 7 8 ? parallel      
AD2 1 2 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD3 3 4 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD7 2 3 ? anti-parallel 
AD7 3 4 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AD9 3 4 ? anti-parallel 
AD9 4 5 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE1 2 3 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE3 2 3 ? anti-parallel 
AE3 3 4 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE5 2 3 ? anti-parallel 
AE5 3 4 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE7 2 3 ? parallel      
AE8 1 2 ? parallel      
AE8 2 3 ? anti-parallel 
AE9 1 2 ? parallel      
AE9 2 3 ? anti-parallel 
AF1 1 2 ? parallel      
AF2 1 2 ? anti-parallel 
AF3 1 2 ? anti-parallel 
AF4 1 2 ? anti-parallel 
AF5 1 2 ? parallel      
AF6 1 2 ? anti-parallel 
AF6 2 3 ? anti-parallel 
AF6 3 4 ? anti-parallel 
AF7 1 2 ? anti-parallel 
AF7 2 3 ? anti-parallel 
AF8 1 2 ? anti-parallel 
AF9 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 10   ? VAL A 13   ? VAL A 10   VAL A 13   
AA1 2 TYR A 20   ? LEU A 28   ? TYR A 20   LEU A 28   
AA1 3 LEU A 192  ? THR A 201  ? LEU A 192  THR A 201  
AA1 4 VAL A 174  ? THR A 184  ? VAL A 174  THR A 184  
AA2 1 LEU A 99   ? ALA A 103  ? LEU A 99   ALA A 103  
AA2 2 LEU A 138  ? GLY A 147  ? LEU A 138  GLY A 147  
AA2 3 GLY A 50   ? ILE A 58   ? GLY A 50   ILE A 58   
AA2 4 ILE A 165  ? PRO A 166  ? ILE A 165  PRO A 166  
AA3 1 VAL A 87   ? PHE A 89   ? VAL A 87   PHE A 89   
AA3 2 VAL A 120  ? ILE A 122  ? VAL A 120  ILE A 122  
AA4 1 GLU A 108  ? LYS A 110  ? GLU A 108  LYS A 110  
AA4 2 HIS A 128  ? THR A 131  ? HIS A 128  THR A 131  
AA5 1 TYR A 150  ? VAL A 151  ? TYR A 150  VAL A 151  
AA5 2 ALA A 169  ? VAL A 170  ? ALA A 169  VAL A 170  
AA6 1 VAL B 10   ? THR B 15   ? VAL B 10   THR B 15   
AA6 2 TYR B 20   ? LEU B 28   ? TYR B 20   LEU B 28   
AA6 3 ARG B 189  ? THR B 201  ? ARG B 189  THR B 201  
AA6 4 VAL B 174  ? LEU B 186  ? VAL B 174  LEU B 186  
AA7 1 THR B 96   ? GLU B 104  ? THR B 96   GLU B 104  
AA7 2 ARG B 137  ? VAL B 148  ? ARG B 137  VAL B 148  
AA7 3 PRO B 49   ? ILE B 58   ? PRO B 49   ILE B 58   
AA7 4 ILE B 165  ? PRO B 166  ? ILE B 165  PRO B 166  
AA8 1 VAL B 87   ? PHE B 89   ? VAL B 87   PHE B 89   
AA8 2 VAL B 120  ? ILE B 122  ? VAL B 120  ILE B 122  
AA9 1 LYS B 107  ? LYS B 110  ? LYS B 107  LYS B 110  
AA9 2 HIS B 128  ? LEU B 132  ? HIS B 128  LEU B 132  
AB1 1 TYR B 150  ? VAL B 151  ? TYR B 150  VAL B 151  
AB1 2 ALA B 169  ? VAL B 170  ? ALA B 169  VAL B 170  
AB2 1 GLU C 2    ? ARG C 5    ? GLU C 2    ARG C 5    
AB2 2 GLN C 899  ? ILE C 902  ? GLN C 899  ILE C 902  
AB2 3 VAL C 579  ? MET C 580  ? VAL C 579  MET C 580  
AB3 1 VAL C 65   ? LEU C 73   ? VAL C 65   LEU C 73   
AB3 2 GLN C 91   ? ILE C 101  ? GLN C 91   ILE C 101  
AB3 3 ILE C 108  ? PRO C 119  ? ILE C 108  PRO C 119  
AB4 1 PHE C 127  ? ILE C 129  ? PHE C 127  ILE C 129  
AB4 2 ALA C 132  ? ILE C 136  ? ALA C 132  ILE C 136  
AB4 3 SER C 392  ? PHE C 394  ? SER C 392  PHE C 394  
AB5 1 ARG C 331  ? ARG C 334  ? ARG C 331  ARG C 334  
AB5 2 SER C 138  ? ARG C 142  ? SER C 138  ARG C 142  
AB5 3 ARG C 409  ? SER C 411  ? ARG C 409  SER C 411  
AB5 4 ILE C 452  ? SER C 454  ? ILE C 452  SER C 454  
AB6 1 GLY C 145  ? PRO C 150  ? GLY C 145  PRO C 150  
AB6 2 TYR C 158  ? ILE C 163  ? TYR C 158  ILE C 163  
AB6 3 ILE C 172  ? ASP C 173  ? ILE C 172  ASP C 173  
AB6 4 SER C 183  ? VAL C 186  ? SER C 183  VAL C 186  
AB6 5 ARG C 189  ? PRO C 192  ? ARG C 189  PRO C 192  
AB7 1 ALA C 291  ? GLU C 294  ? ALA C 291  GLU C 294  
AB7 2 GLU C 297  ? ASP C 300  ? GLU C 297  ASP C 300  
AB8 1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
AB8 2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
AB8 3 VAL C 478  ? MET C 486  ? VAL C 478  MET C 486  
AB9 1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
AB9 2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
AB9 3 PHE C 531  ? ASP C 533  ? PHE C 531  ASP C 533  
AB9 4 THR C 495  ? ALA C 497  ? THR C 495  ALA C 497  
AB9 5 VAL C 513  ? ARG C 517  ? VAL C 513  ARG C 517  
AB9 6 GLU C 520  ? VAL C 524  ? GLU C 520  VAL C 524  
AC1 1 LEU C 503  ? GLU C 504  ? LEU C 503  GLU C 504  
AC1 2 ARG C 507  ? ILE C 508  ? ARG C 507  ILE C 508  
AC2 1 LEU C 595  ? TYR C 596  ? LEU C 595  TYR C 596  
AC2 2 LEU C 654  ? ASP C 657  ? LEU C 654  ASP C 657  
AC2 3 ARG C 640  ? PRO C 641  ? ARG C 640  PRO C 641  
AC3 1 LEU C 620  ? PRO C 624  ? LEU C 620  PRO C 624  
AC3 2 ARG C 610  ? TYR C 615  ? ARG C 610  TYR C 615  
AC3 3 GLY C 601  ? VAL C 606  ? GLY C 601  VAL C 606  
AC3 4 ARG C 648  ? VAL C 649  ? ARG C 648  VAL C 649  
AC4 1 TYR C 629  ? ARG C 630  ? TYR C 629  ARG C 630  
AC4 2 ALA C 636  ? LEU C 637  ? ALA C 636  LEU C 637  
AC5 1 SER C 661  ? GLU C 662  ? SER C 661  GLU C 662  
AC5 2 PHE C 665  ? LEU C 666  ? PHE C 665  LEU C 666  
AC6 1 LYS C 971  ? VAL C 972  ? LYS C 971  VAL C 972  
AC6 2 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
AC6 3 LYS C 838  ? ASN C 841  ? LYS C 838  ASN C 841  
AC6 4 LYS C 846  ? LEU C 853  ? LYS C 846  LEU C 853  
AC6 5 ILE C 688  ? SER C 691  ? ILE C 688  SER C 691  
AC6 6 VAL C 869  ? LEU C 871  ? VAL C 869  LEU C 871  
AC6 7 GLY C 669  ? ILE C 676  ? GLY C 669  ILE C 676  
AC6 8 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
AC7 1 SER C 702  ? ARG C 713  ? SER C 702  ARG C 713  
AC7 2 VAL C 819  ? ARG C 831  ? VAL C 819  ARG C 831  
AC7 3 GLY C 798  ? LEU C 806  ? GLY C 798  LEU C 806  
AC7 4 GLU C 748  ? VAL C 749  ? GLU C 748  VAL C 749  
AC8 1 ILE C 754  ? VAL C 756  ? ILE C 754  VAL C 756  
AC8 2 LEU C 790  ? ARG C 791  ? LEU C 790  ARG C 791  
AC9 1 THR C 759  ? PHE C 761  ? THR C 759  PHE C 761  
AC9 2 VAL C 785  ? ASP C 787  ? VAL C 785  ASP C 787  
AD1 1 HIS C 1006 ? ARG C 1008 ? HIS C 1006 ARG C 1008 
AD1 2 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AD1 3 GLN D 744  ? HIS D 748  ? GLN D 744  HIS D 748  
AD1 4 VAL D 700  ? ASN D 703  ? VAL D 700  ASN D 703  
AD1 5 ILE D 713  ? VAL D 721  ? ILE D 713  VAL D 721  
AD1 6 GLN D 641  ? PRO D 645  ? GLN D 641  PRO D 645  
AD1 7 ILE D 726  ? LEU D 728  ? ILE D 726  LEU D 728  
AD1 8 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AD2 1 GLN C 1030 ? PHE C 1032 ? GLN C 1030 PHE C 1032 
AD2 2 LYS D 621  ? VAL D 623  ? LYS D 621  VAL D 623  
AD3 1 PRO C 1108 ? VAL C 1109 ? PRO C 1108 VAL C 1109 
AD3 2 LEU C 1097 ? LEU C 1102 ? LEU C 1097 LEU C 1102 
AD3 3 LYS D 7    ? LEU D 12   ? LYS D 7    LEU D 12   
AD3 4 LYS D 1456 ? ASP D 1457 ? LYS D 1456 ASP D 1457 
AD4 1 GLY D 91   ? ALA D 100  ? GLY D 91   ALA D 100  
AD4 2 ILE D 513  ? VAL D 519  ? ILE D 513  VAL D 519  
AD5 1 LEU D 152  ? LEU D 153  ? LEU D 152  LEU D 153  
AD5 2 TYR D 132  ? ASP D 136  ? TYR D 132  ASP D 136  
AD5 3 ASP D 453  ? ARG D 455  ? ASP D 453  ARG D 455  
AD6 1 ILE D 141  ? LEU D 142  ? ILE D 141  LEU D 142  
AD6 2 VAL D 145  ? PRO D 146  ? VAL D 145  PRO D 146  
AD7 1 GLN D 166  ? PRO D 170  ? GLN D 166  PRO D 170  
AD7 2 SER D 392  ? VAL D 396  ? SER D 392  VAL D 396  
AD7 3 GLY D 201  ? TYR D 205  ? GLY D 201  TYR D 205  
AD7 4 GLU D 184  ? VAL D 185  ? GLU D 184  VAL D 185  
AD8 1 GLU D 190  ? ALA D 192  ? GLU D 190  ALA D 192  
AD8 2 VAL D 195  ? VAL D 196  ? VAL D 195  VAL D 196  
AD9 1 VAL D 317  ? GLU D 327  ? VAL D 317  GLU D 327  
AD9 2 THR D 330  ? ARG D 346  ? THR D 330  ARG D 346  
AD9 3 ARG D 210  ? PRO D 226  ? ARG D 210  PRO D 226  
AD9 4 GLY D 383  ? HIS D 388  ? GLY D 383  HIS D 388  
AD9 5 ARG D 360  ? VAL D 361  ? ARG D 360  VAL D 361  
AE1 1 ILE D 241  ? GLU D 244  ? ILE D 241  GLU D 244  
AE1 2 PRO D 303  ? ARG D 312  ? PRO D 303  ARG D 312  
AE1 3 TYR D 249  ? ARG D 252  ? TYR D 249  ARG D 252  
AE2 1 ILE D 241  ? GLU D 244  ? ILE D 241  GLU D 244  
AE2 2 PRO D 303  ? ARG D 312  ? PRO D 303  ARG D 312  
AE2 3 VAL D 286  ? PRO D 290  ? VAL D 286  PRO D 290  
AE3 1 GLU D 277  ? LEU D 284  ? GLU D 277  LEU D 284  
AE3 2 ALA D 268  ? ARG D 274  ? ALA D 268  ARG D 274  
AE3 3 GLY D 257  ? GLU D 263  ? GLY D 257  GLU D 263  
AE3 4 ILE D 297  ? VAL D 298  ? ILE D 297  VAL D 298  
AE4 1 ASN D 352  ? VAL D 353  ? ASN D 352  VAL D 353  
AE4 2 LYS D 366  ? ALA D 369  ? LYS D 366  ALA D 369  
AE4 3 VAL D 377  ? ILE D 378  ? VAL D 377  ILE D 378  
AE5 1 ALA D 398  ? PRO D 402  ? ALA D 398  PRO D 402  
AE5 2 VAL D 443  ? GLU D 448  ? VAL D 443  GLU D 448  
AE5 3 GLY D 433  ? ASP D 438  ? GLY D 433  ASP D 438  
AE5 4 ARG D 414  ? VAL D 415  ? ARG D 414  VAL D 415  
AE6 1 VAL D 420  ? ALA D 422  ? VAL D 420  ALA D 422  
AE6 2 VAL D 427  ? LYS D 428  ? VAL D 427  LYS D 428  
AE7 1 MET D 527  ? GLN D 529  ? MET D 527  GLN D 529  
AE7 2 PHE D 535  ? THR D 537  ? PHE D 535  THR D 537  
AE7 3 VAL F 315  ? SER F 316  ? VAL F 315  SER F 316  
AE8 1 GLU D 805  ? PHE D 806  ? GLU D 805  PHE D 806  
AE8 2 PRO D 826  ? VAL D 829  ? PRO D 826  VAL D 829  
AE8 3 ARG D 832  ? SER D 835  ? ARG D 832  SER D 835  
AE9 1 VAL D 842  ? PHE D 843  ? VAL D 842  PHE D 843  
AE9 2 VAL D 864  ? TYR D 868  ? VAL D 864  TYR D 868  
AE9 3 LYS D 871  ? THR D 875  ? LYS D 871  THR D 875  
AF1 1 VAL D 1106 ? GLU D 1109 ? VAL D 1106 GLU D 1109 
AF1 2 GLY D 1199 ? CYS D 1201 ? GLY D 1199 CYS D 1201 
AF2 1 ILE D 1118 ? PRO D 1121 ? ILE D 1118 PRO D 1121 
AF2 2 GLU D 1185 ? VAL D 1188 ? GLU D 1185 VAL D 1188 
AF3 1 PHE D 1123 ? ASP D 1126 ? PHE D 1123 ASP D 1126 
AF3 2 SER D 1131 ? LEU D 1134 ? SER D 1131 LEU D 1134 
AF4 1 VAL D 1153 ? VAL D 1155 ? VAL D 1153 VAL D 1155 
AF4 2 VAL D 1158 ? LEU D 1160 ? VAL D 1158 LEU D 1160 
AF5 1 LYS D 1271 ? ALA D 1272 ? LYS D 1271 ALA D 1272 
AF5 2 ALA D 1329 ? ILE D 1330 ? ALA D 1329 ILE D 1330 
AF6 1 LYS D 1301 ? TYR D 1303 ? LYS D 1301 TYR D 1303 
AF6 2 VAL D 1292 ? GLU D 1295 ? VAL D 1292 GLU D 1295 
AF6 3 GLY D 1279 ? ILE D 1283 ? GLY D 1279 ILE D 1283 
AF6 4 TYR D 1318 ? VAL D 1319 ? TYR D 1318 VAL D 1319 
AF7 1 VAL D 1394 ? GLU D 1396 ? VAL D 1394 GLU D 1396 
AF7 2 TYR D 1378 ? ASP D 1383 ? TYR D 1378 ASP D 1383 
AF7 3 ALA D 1416 ? PRO D 1419 ? ALA D 1416 PRO D 1419 
AF8 1 GLN D 1485 ? ASP D 1488 ? GLN D 1485 ASP D 1488 
AF8 2 LEU E 73   ? GLY E 76   ? LEU E 73   GLY E 76   
AF9 1 LYS E 47   ? GLN E 49   ? LYS E 47   GLN E 49   
AF9 2 LEU E 54   ? ASP E 56   ? LEU E 54   ASP E 56   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 10   ? N VAL A 10   O GLU A 26   ? O GLU A 26   
AA1 2 3 N PHE A 23   ? N PHE A 23   O LEU A 197  ? O LEU A 197  
AA1 3 4 O LYS A 194  ? O LYS A 194  N GLU A 182  ? N GLU A 182  
AA2 1 2 N LEU A 99   ? N LEU A 99   O VAL A 142  ? O VAL A 142  
AA2 2 3 O ARG A 143  ? O ARG A 143  N THR A 54   ? N THR A 54   
AA2 3 4 N VAL A 56   ? N VAL A 56   O ILE A 165  ? O ILE A 165  
AA3 1 2 N ARG A 88   ? N ARG A 88   O GLU A 121  ? O GLU A 121  
AA4 1 2 N VAL A 109  ? N VAL A 109  O ILE A 129  ? O ILE A 129  
AA5 1 2 N VAL A 151  ? N VAL A 151  O ALA A 169  ? O ALA A 169  
AA6 1 2 N ARG B 14   ? N ARG B 14   O GLU B 22   ? O GLU B 22   
AA6 2 3 N LEU B 28   ? N LEU B 28   O ASP B 193  ? O ASP B 193  
AA6 3 4 O TRP B 200  ? O TRP B 200  N ARG B 175  ? N ARG B 175  
AA7 1 2 N LEU B 99   ? N LEU B 99   O VAL B 142  ? O VAL B 142  
AA7 2 3 O ARG B 143  ? O ARG B 143  N THR B 54   ? N THR B 54   
AA7 3 4 N VAL B 56   ? N VAL B 56   O ILE B 165  ? O ILE B 165  
AA8 1 2 N ARG B 88   ? N ARG B 88   O GLU B 121  ? O GLU B 121  
AA9 1 2 N VAL B 109  ? N VAL B 109  O ALA B 130  ? O ALA B 130  
AB1 1 2 N VAL B 151  ? N VAL B 151  O ALA B 169  ? O ALA B 169  
AB2 1 2 N LYS C 4    ? N LYS C 4    O ILE C 902  ? O ILE C 902  
AB2 2 3 O TYR C 901  ? O TYR C 901  N MET C 580  ? N MET C 580  
AB3 1 2 N VAL C 65   ? N VAL C 65   O ILE C 101  ? O ILE C 101  
AB3 2 3 N ALA C 92   ? N ALA C 92   O ILE C 118  ? O ILE C 118  
AB4 1 2 N PHE C 127  ? N PHE C 127  O ARG C 134  ? O ARG C 134  
AB4 2 3 N VAL C 135  ? N VAL C 135  O GLN C 393  ? O GLN C 393  
AB5 1 2 O ARG C 334  ? O ARG C 334  N GLN C 139  ? N GLN C 139  
AB5 2 3 N SER C 138  ? N SER C 138  O SER C 411  ? O SER C 411  
AB5 3 4 N ILE C 410  ? N ILE C 410  O THR C 453  ? O THR C 453  
AB6 1 2 N TYR C 147  ? N TYR C 147  O SER C 161  ? O SER C 161  
AB6 2 3 N ILE C 162  ? N ILE C 162  O ILE C 172  ? O ILE C 172  
AB6 3 4 N ASP C 173  ? N ASP C 173  O LYS C 185  ? O LYS C 185  
AB6 4 5 N VAL C 186  ? N VAL C 186  O ARG C 189  ? O ARG C 189  
AB7 1 2 N GLU C 294  ? N GLU C 294  O GLU C 297  ? O GLU C 297  
AB8 1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
AB8 2 3 N TYR C 471  ? N TYR C 471  O VAL C 484  ? O VAL C 484  
AB9 1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
AB9 2 3 N ARG C 472  ? N ARG C 472  O MET C 532  ? O MET C 532  
AB9 3 4 O PHE C 531  ? O PHE C 531  N ALA C 497  ? N ALA C 497  
AB9 4 5 N ILE C 496  ? N ILE C 496  O ARG C 516  ? O ARG C 516  
AB9 5 6 N VAL C 513  ? N VAL C 513  O VAL C 524  ? O VAL C 524  
AC1 1 2 N GLU C 504  ? N GLU C 504  O ARG C 507  ? O ARG C 507  
AC2 1 2 N LEU C 595  ? N LEU C 595  O LEU C 655  ? O LEU C 655  
AC2 2 3 O ASP C 657  ? O ASP C 657  N ARG C 640  ? N ARG C 640  
AC3 1 2 O TYR C 623  ? O TYR C 623  N ILE C 611  ? N ILE C 611  
AC3 2 3 O ARG C 614  ? O ARG C 614  N GLU C 602  ? N GLU C 602  
AC3 3 4 N GLY C 601  ? N GLY C 601  O VAL C 649  ? O VAL C 649  
AC4 1 2 N TYR C 629  ? N TYR C 629  O LEU C 637  ? O LEU C 637  
AC5 1 2 N GLU C 662  ? N GLU C 662  O PHE C 665  ? O PHE C 665  
AC6 1 2 N VAL C 972  ? N VAL C 972  O ILE C 987  ? O ILE C 987  
AC6 2 3 O MET C 995  ? O MET C 995  N ALA C 840  ? N ALA C 840  
AC6 3 4 N LEU C 839  ? N LEU C 839  O GLY C 847  ? O GLY C 847  
AC6 4 5 O VAL C 848  ? O VAL C 848  N ILE C 688  ? N ILE C 688  
AC6 5 6 N VAL C 689  ? N VAL C 689  O ILE C 870  ? O ILE C 870  
AC6 6 7 O VAL C 869  ? O VAL C 869  N ALA C 675  ? N ALA C 675  
AC6 7 8 N VAL C 674  ? N VAL C 674  O GLY C 990  ? O GLY C 990  
AC7 1 2 N SER C 702  ? N SER C 702  O ARG C 831  ? O ARG C 831  
AC7 2 3 O VAL C 822  ? O VAL C 822  N LEU C 806  ? N LEU C 806  
AC7 3 4 O GLY C 798  ? O GLY C 798  N VAL C 749  ? N VAL C 749  
AC8 1 2 N LEU C 755  ? N LEU C 755  O LEU C 790  ? O LEU C 790  
AC9 1 2 N SER C 760  ? N SER C 760  O LYS C 786  ? O LYS C 786  
AD1 1 2 N HIS C 1006 ? N HIS C 1006 O ARG D 628  ? O ARG D 628  
AD1 2 3 N GLY D 627  ? N GLY D 627  O VAL D 747  ? O VAL D 747  
AD1 3 4 O ALA D 746  ? O ALA D 746  N ASN D 703  ? N ASN D 703  
AD1 4 5 N LEU D 702  ? N LEU D 702  O GLN D 714  ? O GLN D 714  
AD1 5 6 O VAL D 719  ? O VAL D 719  N CYS D 642  ? N CYS D 642  
AD1 6 7 N GLY D 643  ? N GLY D 643  O GLN D 727  ? O GLN D 727  
AD1 7 8 O ILE D 726  ? O ILE D 726  N VAL D 630  ? N VAL D 630  
AD2 1 2 N PHE C 1032 ? N PHE C 1032 O LYS D 621  ? O LYS D 621  
AD3 1 2 O VAL C 1109 ? O VAL C 1109 N THR C 1101 ? N THR C 1101 
AD3 2 3 N ASP C 1098 ? N ASP C 1098 O ALA D 11   ? O ALA D 11   
AD3 3 4 N VAL D 8    ? N VAL D 8    O ASP D 1457 ? O ASP D 1457 
AD4 1 2 N ALA D 99   ? N ALA D 99   O LEU D 514  ? O LEU D 514  
AD5 1 2 O LEU D 153  ? O LEU D 153  N TYR D 132  ? N TYR D 132  
AD5 2 3 N ILE D 133  ? N ILE D 133  O ARG D 455  ? O ARG D 455  
AD6 1 2 N LEU D 142  ? N LEU D 142  O VAL D 145  ? O VAL D 145  
AD7 1 2 N TYR D 169  ? N TYR D 169  O ILE D 393  ? O ILE D 393  
AD7 2 3 O VAL D 396  ? O VAL D 396  N VAL D 202  ? N VAL D 202  
AD7 3 4 O GLY D 201  ? O GLY D 201  N VAL D 185  ? N VAL D 185  
AD8 1 2 N ALA D 192  ? N ALA D 192  O VAL D 195  ? O VAL D 195  
AD9 1 2 N GLU D 325  ? N GLU D 325  O TYR D 332  ? O TYR D 332  
AD9 2 3 O LEU D 337  ? O LEU D 337  N GLU D 219  ? N GLU D 219  
AD9 3 4 N GLU D 214  ? N GLU D 214  O VAL D 384  ? O VAL D 384  
AD9 4 5 O GLY D 383  ? O GLY D 383  N VAL D 361  ? N VAL D 361  
AE1 1 2 N ALA D 243  ? N ALA D 243  O LEU D 311  ? O LEU D 311  
AE1 2 3 O LEU D 304  ? O LEU D 304  N PHE D 251  ? N PHE D 251  
AE2 1 2 N ALA D 243  ? N ALA D 243  O LEU D 311  ? O LEU D 311  
AE2 2 3 O GLU D 306  ? O GLU D 306  N THR D 289  ? N THR D 289  
AE3 1 2 O TYR D 282  ? O TYR D 282  N LEU D 270  ? N LEU D 270  
AE3 2 3 O PHE D 269  ? O PHE D 269  N LYS D 262  ? N LYS D 262  
AE3 3 4 N GLY D 257  ? N GLY D 257  O VAL D 298  ? O VAL D 298  
AE4 1 2 N ASN D 352  ? N ASN D 352  O ALA D 369  ? O ALA D 369  
AE4 2 3 N ILE D 367  ? N ILE D 367  O VAL D 377  ? O VAL D 377  
AE5 1 2 N ARG D 399  ? N ARG D 399  O VAL D 446  ? O VAL D 446  
AE5 2 3 O ARG D 445  ? O ARG D 445  N GLU D 436  ? N GLU D 436  
AE5 3 4 O GLY D 433  ? O GLY D 433  N VAL D 415  ? N VAL D 415  
AE6 1 2 N LEU D 421  ? N LEU D 421  O VAL D 427  ? O VAL D 427  
AE7 1 2 N VAL D 528  ? N VAL D 528  O ALA D 536  ? O ALA D 536  
AE7 2 3 N THR D 537  ? N THR D 537  O VAL F 315  ? O VAL F 315  
AE8 1 2 N PHE D 806  ? N PHE D 806  O LYS D 828  ? O LYS D 828  
AE8 2 3 N ILE D 827  ? N ILE D 827  O THR D 834  ? O THR D 834  
AE9 1 2 N PHE D 843  ? N PHE D 843  O THR D 865  ? O THR D 865  
AE9 2 3 N VAL D 864  ? N VAL D 864  O THR D 875  ? O THR D 875  
AF1 1 2 N ARG D 1108 ? N ARG D 1108 O VAL D 1200 ? O VAL D 1200 
AF2 1 2 N ILE D 1118 ? N ILE D 1118 O VAL D 1188 ? O VAL D 1188 
AF3 1 2 N ASP D 1126 ? N ASP D 1126 O SER D 1131 ? O SER D 1131 
AF4 1 2 N VAL D 1153 ? N VAL D 1153 O LEU D 1160 ? O LEU D 1160 
AF5 1 2 N ALA D 1272 ? N ALA D 1272 O ALA D 1329 ? O ALA D 1329 
AF6 1 2 O TYR D 1303 ? O TYR D 1303 N VAL D 1292 ? N VAL D 1292 
AF6 2 3 O GLU D 1295 ? O GLU D 1295 N VAL D 1280 ? N VAL D 1280 
AF6 3 4 N GLY D 1279 ? N GLY D 1279 O VAL D 1319 ? O VAL D 1319 
AF7 1 2 O LEU D 1395 ? O LEU D 1395 N VAL D 1379 ? N VAL D 1379 
AF7 2 3 N ASP D 1383 ? N ASP D 1383 O ALA D 1416 ? O ALA D 1416 
AF8 1 2 N GLN D 1485 ? N GLN D 1485 O GLY E 76   ? O GLY E 76   
AF9 1 2 N MET E 48   ? N MET E 48   O PHE E 55   ? O PHE E 55   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software B MG  1001 ? 3 'binding site for residue MG B 1001'               
AC2 Software C POP 1201 ? 3 'binding site for residue POP C 1201'              
AC3 Software D MG  2001 ? 4 'binding site for residue MG D 2001'               
AC4 Software D ZN  2002 ? 4 'binding site for residue ZN D 2002'               
AC5 Software D ZN  2003 ? 4 'binding site for residue ZN D 2003'               
AC6 Software I GTP 1    ? 4 'binding site for Di-nucleotide GTP I 1 and G I 2' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3 GLU B 154  ? GLU B 154  . ? 1_555 ? 
2  AC1 3 ASP B 168  ? ASP B 168  . ? 1_555 ? 
3  AC1 3 LYS D 840  ? LYS D 840  . ? 1_555 ? 
4  AC2 3 ARG C 879  ? ARG C 879  . ? 1_555 ? 
5  AC2 3 ASP D 739  ? ASP D 739  . ? 1_555 ? 
6  AC2 3 ARG D 1029 ? ARG D 1029 . ? 1_555 ? 
7  AC3 4 ASP D 739  ? ASP D 739  . ? 1_555 ? 
8  AC3 4 ASP D 741  ? ASP D 741  . ? 1_555 ? 
9  AC3 4 ASP D 743  ? ASP D 743  . ? 1_555 ? 
10 AC3 4 G   I 8    ? G   I 8    . ? 1_555 ? 
11 AC4 4 CYS D 58   ? CYS D 58   . ? 1_555 ? 
12 AC4 4 CYS D 60   ? CYS D 60   . ? 1_555 ? 
13 AC4 4 CYS D 73   ? CYS D 73   . ? 1_555 ? 
14 AC4 4 CYS D 76   ? CYS D 76   . ? 1_555 ? 
15 AC5 4 CYS D 1112 ? CYS D 1112 . ? 1_555 ? 
16 AC5 4 CYS D 1194 ? CYS D 1194 . ? 1_555 ? 
17 AC5 4 CYS D 1201 ? CYS D 1201 . ? 1_555 ? 
18 AC5 4 CYS D 1204 ? CYS D 1204 . ? 1_555 ? 
19 AC6 4 LYS C 188  ? LYS C 188  . ? 1_555 ? 
20 AC6 4 DA  G 9    ? DA  G 11   . ? 1_555 ? 
21 AC6 4 DA  G 11   ? DA  G 13   . ? 1_555 ? 
22 AC6 4 G   I 3    ? G   I 3    . ? 1_555 ? 
# 
_atom_sites.entry_id                    5VO8 
_atom_sites.fract_transf_matrix[1][1]   0.005361 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000807 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009805 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003415 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . SER A 1  4    ? 455.093 15.403  728.330 1.00 130.05 ? 4    SER A N     1 
ATOM   2     C  CA    . SER A 1  4    ? 456.042 16.361  728.903 1.00 133.80 ? 4    SER A CA    1 
ATOM   3     C  C     . SER A 1  4    ? 457.384 16.258  728.181 1.00 138.25 ? 4    SER A C     1 
ATOM   4     O  O     . SER A 1  4    ? 457.879 15.161  727.894 1.00 141.21 ? 4    SER A O     1 
ATOM   5     C  CB    . SER A 1  4    ? 456.220 16.135  730.416 1.00 132.23 ? 4    SER A CB    1 
ATOM   6     O  OG    . SER A 1  4    ? 457.057 17.130  730.988 1.00 129.27 ? 4    SER A OG    1 
ATOM   7     N  N     . LYS A 1  5    ? 457.962 17.420  727.890 1.00 143.36 ? 5    LYS A N     1 
ATOM   8     C  CA    . LYS A 1  5    ? 459.141 17.487  727.038 1.00 140.00 ? 5    LYS A CA    1 
ATOM   9     C  C     . LYS A 1  5    ? 460.324 16.802  727.712 1.00 140.26 ? 5    LYS A C     1 
ATOM   10    O  O     . LYS A 1  5    ? 460.570 16.981  728.910 1.00 139.83 ? 5    LYS A O     1 
ATOM   11    C  CB    . LYS A 1  5    ? 459.454 18.947  726.713 1.00 140.60 ? 5    LYS A CB    1 
ATOM   12    C  CG    . LYS A 1  5    ? 460.891 19.241  726.373 1.00 144.65 ? 5    LYS A CG    1 
ATOM   13    C  CD    . LYS A 1  5    ? 461.244 18.811  724.980 1.00 144.66 ? 5    LYS A CD    1 
ATOM   14    C  CE    . LYS A 1  5    ? 462.641 19.306  724.623 1.00 146.44 ? 5    LYS A CE    1 
ATOM   15    N  NZ    . LYS A 1  5    ? 462.957 19.112  723.168 1.00 147.99 ? 5    LYS A NZ    1 
ATOM   16    N  N     . LEU A 1  6    ? 461.046 15.994  726.934 1.00 135.13 ? 6    LEU A N     1 
ATOM   17    C  CA    . LEU A 1  6    ? 462.181 15.258  727.471 1.00 127.44 ? 6    LEU A CA    1 
ATOM   18    C  C     . LEU A 1  6    ? 463.330 16.193  727.808 1.00 126.60 ? 6    LEU A C     1 
ATOM   19    O  O     . LEU A 1  6    ? 463.498 17.264  727.217 1.00 128.87 ? 6    LEU A O     1 
ATOM   20    C  CB    . LEU A 1  6    ? 462.683 14.213  726.485 1.00 116.44 ? 6    LEU A CB    1 
ATOM   21    C  CG    . LEU A 1  6    ? 462.802 12.841  727.129 1.00 109.93 ? 6    LEU A CG    1 
ATOM   22    C  CD1   . LEU A 1  6    ? 461.611 12.039  726.677 1.00 109.60 ? 6    LEU A CD1   1 
ATOM   23    C  CD2   . LEU A 1  6    ? 464.104 12.154  726.788 1.00 109.58 ? 6    LEU A CD2   1 
ATOM   24    N  N     . LYS A 1  7    ? 464.146 15.752  728.749 1.00 121.67 ? 7    LYS A N     1 
ATOM   25    C  CA    . LYS A 1  7    ? 465.300 16.501  729.205 1.00 119.57 ? 7    LYS A CA    1 
ATOM   26    C  C     . LYS A 1  7    ? 466.577 15.916  728.604 1.00 117.16 ? 7    LYS A C     1 
ATOM   27    O  O     . LYS A 1  7    ? 466.611 14.773  728.137 1.00 117.21 ? 7    LYS A O     1 
ATOM   28    C  CB    . LYS A 1  7    ? 465.343 16.528  730.719 1.00 126.15 ? 7    LYS A CB    1 
ATOM   29    C  CG    . LYS A 1  7    ? 464.170 17.294  731.304 1.00 133.54 ? 7    LYS A CG    1 
ATOM   30    C  CD    . LYS A 1  7    ? 464.249 18.797  731.098 1.00 137.07 ? 7    LYS A CD    1 
ATOM   31    C  CE    . LYS A 1  7    ? 463.148 19.524  731.889 1.00 139.21 ? 7    LYS A CE    1 
ATOM   32    N  NZ    . LYS A 1  7    ? 461.759 19.089  731.528 1.00 137.86 ? 7    LYS A NZ    1 
ATOM   33    N  N     . ALA A 1  8    ? 467.618 16.738  728.609 1.00 113.23 ? 8    ALA A N     1 
ATOM   34    C  CA    . ALA A 1  8    ? 468.888 16.433  727.963 1.00 114.10 ? 8    ALA A CA    1 
ATOM   35    C  C     . ALA A 1  8    ? 469.407 15.028  728.296 1.00 116.04 ? 8    ALA A C     1 
ATOM   36    O  O     . ALA A 1  8    ? 469.413 14.639  729.470 1.00 123.15 ? 8    ALA A O     1 
ATOM   37    C  CB    . ALA A 1  8    ? 469.912 17.483  728.389 1.00 118.94 ? 8    ALA A CB    1 
ATOM   38    N  N     . PRO A 1  9    ? 469.758 14.222  727.287 1.00 110.74 ? 9    PRO A N     1 
ATOM   39    C  CA    . PRO A 1  9    ? 470.124 12.810  727.497 1.00 110.96 ? 9    PRO A CA    1 
ATOM   40    C  C     . PRO A 1  9    ? 471.552 12.605  727.999 1.00 110.12 ? 9    PRO A C     1 
ATOM   41    O  O     . PRO A 1  9    ? 472.437 13.438  727.802 1.00 109.15 ? 9    PRO A O     1 
ATOM   42    C  CB    . PRO A 1  9    ? 469.961 12.199  726.104 1.00 110.75 ? 9    PRO A CB    1 
ATOM   43    C  CG    . PRO A 1  9    ? 470.275 13.339  725.178 1.00 112.86 ? 9    PRO A CG    1 
ATOM   44    C  CD    . PRO A 1  9    ? 469.728 14.577  725.863 1.00 113.26 ? 9    PRO A CD    1 
ATOM   45    N  N     . VAL A 1  10   ? 471.764 11.439  728.628 1.00 116.95 ? 10   VAL A N     1 
ATOM   46    C  CA    . VAL A 1  10   ? 473.100 10.976  729.016 1.00 121.37 ? 10   VAL A CA    1 
ATOM   47    C  C     . VAL A 1  10   ? 473.912 10.580  727.789 1.00 124.38 ? 10   VAL A C     1 
ATOM   48    O  O     . VAL A 1  10   ? 473.436 9.846   726.913 1.00 123.31 ? 10   VAL A O     1 
ATOM   49    C  CB    . VAL A 1  10   ? 473.008 9.806   730.011 1.00 124.14 ? 10   VAL A CB    1 
ATOM   50    C  CG1   . VAL A 1  10   ? 472.275 10.230  731.257 1.00 121.95 ? 10   VAL A CG1   1 
ATOM   51    C  CG2   . VAL A 1  10   ? 472.388 8.565   729.391 1.00 127.95 ? 10   VAL A CG2   1 
ATOM   52    N  N     . PHE A 1  11   ? 475.168 11.023  727.752 1.00 129.09 ? 11   PHE A N     1 
ATOM   53    C  CA    . PHE A 1  11   ? 476.079 10.810  726.633 1.00 128.10 ? 11   PHE A CA    1 
ATOM   54    C  C     . PHE A 1  11   ? 477.204 9.895   727.107 1.00 136.13 ? 11   PHE A C     1 
ATOM   55    O  O     . PHE A 1  11   ? 478.051 10.317  727.901 1.00 143.27 ? 11   PHE A O     1 
ATOM   56    C  CB    . PHE A 1  11   ? 476.596 12.177  726.183 1.00 126.62 ? 11   PHE A CB    1 
ATOM   57    C  CG    . PHE A 1  11   ? 477.676 12.141  725.144 1.00 127.11 ? 11   PHE A CG    1 
ATOM   58    C  CD1   . PHE A 1  11   ? 477.616 11.279  724.073 1.00 127.59 ? 11   PHE A CD1   1 
ATOM   59    C  CD2   . PHE A 1  11   ? 478.728 13.034  725.211 1.00 126.99 ? 11   PHE A CD2   1 
ATOM   60    C  CE1   . PHE A 1  11   ? 478.609 11.284  723.107 1.00 125.79 ? 11   PHE A CE1   1 
ATOM   61    C  CE2   . PHE A 1  11   ? 479.719 13.040  724.251 1.00 122.15 ? 11   PHE A CE2   1 
ATOM   62    C  CZ    . PHE A 1  11   ? 479.659 12.170  723.206 1.00 123.21 ? 11   PHE A CZ    1 
ATOM   63    N  N     . THR A 1  12   ? 477.187 8.633   726.658 1.00 133.45 ? 12   THR A N     1 
ATOM   64    C  CA    . THR A 1  12   ? 478.140 7.608   727.086 1.00 133.27 ? 12   THR A CA    1 
ATOM   65    C  C     . THR A 1  12   ? 479.196 7.425   725.991 1.00 132.41 ? 12   THR A C     1 
ATOM   66    O  O     . THR A 1  12   ? 478.894 7.559   724.804 1.00 133.08 ? 12   THR A O     1 
ATOM   67    C  CB    . THR A 1  12   ? 477.454 6.280   727.436 1.00 128.43 ? 12   THR A CB    1 
ATOM   68    O  OG1   . THR A 1  12   ? 476.263 6.544   728.185 1.00 123.99 ? 12   THR A OG1   1 
ATOM   69    C  CG2   . THR A 1  12   ? 478.375 5.434   728.336 1.00 128.66 ? 12   THR A CG2   1 
ATOM   70    N  N     . VAL A 1  13   ? 480.433 7.095   726.393 1.00 130.18 ? 13   VAL A N     1 
ATOM   71    C  CA    . VAL A 1  13   ? 481.567 6.913   725.474 1.00 119.79 ? 13   VAL A CA    1 
ATOM   72    C  C     . VAL A 1  13   ? 482.324 5.621   725.799 1.00 121.24 ? 13   VAL A C     1 
ATOM   73    O  O     . VAL A 1  13   ? 482.796 5.444   726.932 1.00 122.20 ? 13   VAL A O     1 
ATOM   74    C  CB    . VAL A 1  13   ? 482.528 8.115   725.548 1.00 114.68 ? 13   VAL A CB    1 
ATOM   75    C  CG1   . VAL A 1  13   ? 483.793 7.807   724.824 1.00 112.98 ? 13   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A 1  13   ? 481.876 9.379   724.995 1.00 109.46 ? 13   VAL A CG2   1 
ATOM   77    N  N     . ARG A 1  14   ? 482.407 4.707   724.821 1.00 119.59 ? 14   ARG A N     1 
ATOM   78    C  CA    . ARG A 1  14   ? 483.145 3.432   724.950 1.00 126.77 ? 14   ARG A CA    1 
ATOM   79    C  C     . ARG A 1  14   ? 484.277 3.265   723.918 1.00 118.73 ? 14   ARG A C     1 
ATOM   80    O  O     . ARG A 1  14   ? 484.203 2.363   723.083 1.00 111.70 ? 14   ARG A O     1 
ATOM   81    C  CB    . ARG A 1  14   ? 482.198 2.232   724.824 1.00 123.08 ? 14   ARG A CB    1 
ATOM   82    C  CG    . ARG A 1  14   ? 481.052 2.205   725.752 1.00 121.58 ? 14   ARG A CG    1 
ATOM   83    C  CD    . ARG A 1  14   ? 480.313 0.886   725.623 1.00 118.12 ? 14   ARG A CD    1 
ATOM   84    N  NE    . ARG A 1  14   ? 479.270 0.866   724.602 1.00 111.13 ? 14   ARG A NE    1 
ATOM   85    C  CZ    . ARG A 1  14   ? 477.986 1.104   724.860 1.00 113.67 ? 14   ARG A CZ    1 
ATOM   86    N  NH1   . ARG A 1  14   ? 477.610 1.386   726.098 1.00 121.10 ? 14   ARG A NH1   1 
ATOM   87    N  NH2   . ARG A 1  14   ? 477.068 1.048   723.904 1.00 113.02 ? 14   ARG A NH2   1 
ATOM   88    N  N     . THR A 1  15   ? 485.368 4.017   724.034 1.00 129.88 ? 15   THR A N     1 
ATOM   89    C  CA    . THR A 1  15   ? 486.417 3.897   723.028 1.00 135.71 ? 15   THR A CA    1 
ATOM   90    C  C     . THR A 1  15   ? 487.283 2.661   723.254 1.00 138.90 ? 15   THR A C     1 
ATOM   91    O  O     . THR A 1  15   ? 487.650 2.327   724.383 1.00 139.44 ? 15   THR A O     1 
ATOM   92    C  CB    . THR A 1  15   ? 487.329 5.128   723.024 1.00 143.09 ? 15   THR A CB    1 
ATOM   93    O  OG1   . THR A 1  15   ? 488.167 5.111   724.190 1.00 145.34 ? 15   THR A OG1   1 
ATOM   94    C  CG2   . THR A 1  15   ? 486.526 6.412   722.977 1.00 145.42 ? 15   THR A CG2   1 
ATOM   95    N  N     . GLN A 1  16   ? 487.613 1.990   722.151 1.00 142.75 ? 16   GLN A N     1 
ATOM   96    C  CA    . GLN A 1  16   ? 488.622 0.936   722.076 1.00 144.89 ? 16   GLN A CA    1 
ATOM   97    C  C     . GLN A 1  16   ? 489.760 1.407   721.178 1.00 137.71 ? 16   GLN A C     1 
ATOM   98    O  O     . GLN A 1  16   ? 489.573 1.563   719.969 1.00 131.42 ? 16   GLN A O     1 
ATOM   99    C  CB    . GLN A 1  16   ? 488.016 -0.369  721.587 1.00 151.29 ? 16   GLN A CB    1 
ATOM   100   C  CG    . GLN A 1  16   ? 489.022 -1.457  721.383 1.00 158.94 ? 16   GLN A CG    1 
ATOM   101   C  CD    . GLN A 1  16   ? 488.377 -2.667  720.778 1.00 164.35 ? 16   GLN A CD    1 
ATOM   102   O  OE1   . GLN A 1  16   ? 487.307 -2.572  720.166 1.00 162.96 ? 16   GLN A OE1   1 
ATOM   103   N  NE2   . GLN A 1  16   ? 489.006 -3.824  720.958 1.00 168.98 ? 16   GLN A NE2   1 
ATOM   104   N  N     . GLY A 1  17   ? 490.916 1.670   721.776 1.00 136.68 ? 17   GLY A N     1 
ATOM   105   C  CA    . GLY A 1  17   ? 492.142 2.137   721.159 1.00 135.56 ? 17   GLY A CA    1 
ATOM   106   C  C     . GLY A 1  17   ? 491.882 3.430   720.411 1.00 134.41 ? 17   GLY A C     1 
ATOM   107   O  O     . GLY A 1  17   ? 490.951 4.172   720.736 1.00 134.07 ? 17   GLY A O     1 
ATOM   108   N  N     . ARG A 1  18   ? 492.684 3.700   719.372 1.00 135.06 ? 18   ARG A N     1 
ATOM   109   C  CA    . ARG A 1  18   ? 492.444 4.891   718.569 1.00 135.27 ? 18   ARG A CA    1 
ATOM   110   C  C     . ARG A 1  18   ? 491.643 4.590   717.323 1.00 141.56 ? 18   ARG A C     1 
ATOM   111   O  O     . ARG A 1  18   ? 491.233 5.518   716.617 1.00 147.15 ? 18   ARG A O     1 
ATOM   112   C  CB    . ARG A 1  18   ? 493.769 5.544   718.152 1.00 127.04 ? 18   ARG A CB    1 
ATOM   113   C  CG    . ARG A 1  18   ? 494.726 5.880   719.282 1.00 126.62 ? 18   ARG A CG    1 
ATOM   114   C  CD    . ARG A 1  18   ? 495.968 6.522   718.725 1.00 118.53 ? 18   ARG A CD    1 
ATOM   115   N  NE    . ARG A 1  18   ? 495.578 7.685   717.924 1.00 123.25 ? 18   ARG A NE    1 
ATOM   116   C  CZ    . ARG A 1  18   ? 495.286 8.894   718.401 1.00 115.96 ? 18   ARG A CZ    1 
ATOM   117   N  NH1   . ARG A 1  18   ? 495.332 9.135   719.700 1.00 117.80 ? 18   ARG A NH1   1 
ATOM   118   N  NH2   . ARG A 1  18   ? 494.935 9.869   717.572 1.00 113.92 ? 18   ARG A NH2   1 
ATOM   119   N  N     . GLU A 1  19   ? 491.394 3.315   717.072 1.00 147.66 ? 19   GLU A N     1 
ATOM   120   C  CA    . GLU A 1  19   ? 490.773 2.844   715.845 1.00 150.60 ? 19   GLU A CA    1 
ATOM   121   C  C     . GLU A 1  19   ? 489.246 2.936   715.881 1.00 149.03 ? 19   GLU A C     1 
ATOM   122   O  O     . GLU A 1  19   ? 488.630 3.302   714.876 1.00 150.76 ? 19   GLU A O     1 
ATOM   123   C  CB    . GLU A 1  19   ? 491.271 1.427   715.548 1.00 155.62 ? 19   GLU A CB    1 
ATOM   124   C  CG    . GLU A 1  19   ? 492.811 1.204   715.797 1.00 162.88 ? 19   GLU A CG    1 
ATOM   125   C  CD    . GLU A 1  19   ? 493.760 1.620   714.622 1.00 159.32 ? 19   GLU A CD    1 
ATOM   126   O  OE1   . GLU A 1  19   ? 493.667 2.767   714.119 1.00 161.58 ? 19   GLU A OE1   1 
ATOM   127   O  OE2   . GLU A 1  19   ? 494.624 0.789   714.228 1.00 153.99 ? 19   GLU A OE2   1 
ATOM   128   N  N     . TYR A 1  20   ? 488.622 2.567   717.007 1.00 141.95 ? 20   TYR A N     1 
ATOM   129   C  CA    . TYR A 1  20   ? 487.189 2.293   717.096 1.00 132.60 ? 20   TYR A CA    1 
ATOM   130   C  C     . TYR A 1  20   ? 486.557 2.986   718.286 1.00 124.06 ? 20   TYR A C     1 
ATOM   131   O  O     . TYR A 1  20   ? 487.222 3.256   719.291 1.00 125.90 ? 20   TYR A O     1 
ATOM   132   C  CB    . TYR A 1  20   ? 486.938 0.796   717.249 1.00 134.24 ? 20   TYR A CB    1 
ATOM   133   C  CG    . TYR A 1  20   ? 485.494 0.381   717.392 1.00 133.01 ? 20   TYR A CG    1 
ATOM   134   C  CD1   . TYR A 1  20   ? 484.547 0.792   716.476 1.00 132.63 ? 20   TYR A CD1   1 
ATOM   135   C  CD2   . TYR A 1  20   ? 485.091 -0.465  718.415 1.00 131.36 ? 20   TYR A CD2   1 
ATOM   136   C  CE1   . TYR A 1  20   ? 483.231 0.391   716.573 1.00 132.47 ? 20   TYR A CE1   1 
ATOM   137   C  CE2   . TYR A 1  20   ? 483.772 -0.873  718.526 1.00 130.96 ? 20   TYR A CE2   1 
ATOM   138   C  CZ    . TYR A 1  20   ? 482.842 -0.439  717.593 1.00 132.12 ? 20   TYR A CZ    1 
ATOM   139   O  OH    . TYR A 1  20   ? 481.513 -0.815  717.651 1.00 129.51 ? 20   TYR A OH    1 
ATOM   140   N  N     . GLY A 1  21   ? 485.277 3.310   718.143 1.00 114.95 ? 21   GLY A N     1 
ATOM   141   C  CA    . GLY A 1  21   ? 484.506 3.858   719.248 1.00 117.48 ? 21   GLY A CA    1 
ATOM   142   C  C     . GLY A 1  21   ? 483.028 3.566   719.110 1.00 118.53 ? 21   GLY A C     1 
ATOM   143   O  O     . GLY A 1  21   ? 482.531 3.337   718.005 1.00 121.09 ? 21   GLY A O     1 
ATOM   144   N  N     . GLU A 1  22   ? 482.327 3.530   720.248 1.00 111.69 ? 22   GLU A N     1 
ATOM   145   C  CA    . GLU A 1  22   ? 480.876 3.375   720.297 1.00 103.33 ? 22   GLU A CA    1 
ATOM   146   C  C     . GLU A 1  22   ? 480.345 4.549   721.094 1.00 108.57 ? 22   GLU A C     1 
ATOM   147   O  O     . GLU A 1  22   ? 480.911 4.871   722.137 1.00 116.65 ? 22   GLU A O     1 
ATOM   148   C  CB    . GLU A 1  22   ? 480.462 2.068   720.959 1.00 104.84 ? 22   GLU A CB    1 
ATOM   149   C  CG    . GLU A 1  22   ? 481.003 0.855   720.255 1.00 109.92 ? 22   GLU A CG    1 
ATOM   150   C  CD    . GLU A 1  22   ? 480.460 -0.445  720.800 1.00 118.62 ? 22   GLU A CD    1 
ATOM   151   O  OE1   . GLU A 1  22   ? 479.637 -0.392  721.725 1.00 119.31 ? 22   GLU A OE1   1 
ATOM   152   O  OE2   . GLU A 1  22   ? 480.897 -1.526  720.347 1.00 120.11 ? 22   GLU A OE2   1 
ATOM   153   N  N     . PHE A 1  23   ? 479.318 5.241   720.591 1.00 108.86 ? 23   PHE A N     1 
ATOM   154   C  CA    . PHE A 1  23   ? 478.826 6.473   721.231 1.00 108.95 ? 23   PHE A CA    1 
ATOM   155   C  C     . PHE A 1  23   ? 477.307 6.440   721.428 1.00 111.03 ? 23   PHE A C     1 
ATOM   156   O  O     . PHE A 1  23   ? 476.552 6.455   720.450 1.00 113.81 ? 23   PHE A O     1 
ATOM   157   C  CB    . PHE A 1  23   ? 479.267 7.700   720.426 1.00 106.42 ? 23   PHE A CB    1 
ATOM   158   C  CG    . PHE A 1  23   ? 480.752 7.777   720.262 1.00 107.00 ? 23   PHE A CG    1 
ATOM   159   C  CD1   . PHE A 1  23   ? 481.408 6.943   719.369 1.00 106.33 ? 23   PHE A CD1   1 
ATOM   160   C  CD2   . PHE A 1  23   ? 481.503 8.634   721.044 1.00 112.50 ? 23   PHE A CD2   1 
ATOM   161   C  CE1   . PHE A 1  23   ? 482.785 6.972   719.240 1.00 109.28 ? 23   PHE A CE1   1 
ATOM   162   C  CE2   . PHE A 1  23   ? 482.890 8.678   720.923 1.00 114.17 ? 23   PHE A CE2   1 
ATOM   163   C  CZ    . PHE A 1  23   ? 483.531 7.839   720.015 1.00 112.50 ? 23   PHE A CZ    1 
ATOM   164   N  N     . VAL A 1  24   ? 476.847 6.396   722.695 1.00 108.06 ? 24   VAL A N     1 
ATOM   165   C  CA    . VAL A 1  24   ? 475.422 6.239   723.004 1.00 110.17 ? 24   VAL A CA    1 
ATOM   166   C  C     . VAL A 1  24   ? 474.833 7.573   723.454 1.00 106.94 ? 24   VAL A C     1 
ATOM   167   O  O     . VAL A 1  24   ? 475.447 8.320   724.230 1.00 115.05 ? 24   VAL A O     1 
ATOM   168   C  CB    . VAL A 1  24   ? 475.184 5.162   724.087 1.00 105.30 ? 24   VAL A CB    1 
ATOM   169   C  CG1   . VAL A 1  24   ? 473.751 4.656   724.041 1.00 99.76  ? 24   VAL A CG1   1 
ATOM   170   C  CG2   . VAL A 1  24   ? 476.142 4.015   723.947 1.00 102.54 ? 24   VAL A CG2   1 
ATOM   171   N  N     . LEU A 1  25   ? 473.592 7.815   723.049 1.00 95.94  ? 25   LEU A N     1 
ATOM   172   C  CA    . LEU A 1  25   ? 472.812 8.970   723.456 1.00 94.91  ? 25   LEU A CA    1 
ATOM   173   C  C     . LEU A 1  25   ? 471.452 8.391   723.824 1.00 107.71 ? 25   LEU A C     1 
ATOM   174   O  O     . LEU A 1  25   ? 470.756 7.844   722.961 1.00 104.94 ? 25   LEU A O     1 
ATOM   175   C  CB    . LEU A 1  25   ? 472.730 10.039  722.366 1.00 92.86  ? 25   LEU A CB    1 
ATOM   176   C  CG    . LEU A 1  25   ? 472.891 11.455  722.952 1.00 102.84 ? 25   LEU A CG    1 
ATOM   177   C  CD1   . LEU A 1  25   ? 474.232 11.600  723.625 1.00 95.03  ? 25   LEU A CD1   1 
ATOM   178   C  CD2   . LEU A 1  25   ? 472.717 12.557  721.946 1.00 108.56 ? 25   LEU A CD2   1 
ATOM   179   N  N     . GLU A 1  26   ? 471.079 8.503   725.107 1.00 113.49 ? 26   GLU A N     1 
ATOM   180   C  CA    . GLU A 1  26   ? 469.788 8.054   725.612 1.00 104.35 ? 26   GLU A CA    1 
ATOM   181   C  C     . GLU A 1  26   ? 469.317 8.885   726.795 1.00 104.11 ? 26   GLU A C     1 
ATOM   182   O  O     . GLU A 1  26   ? 470.151 9.433   727.524 1.00 104.54 ? 26   GLU A O     1 
ATOM   183   C  CB    . GLU A 1  26   ? 470.085 6.635   726.124 1.00 100.95 ? 26   GLU A CB    1 
ATOM   184   C  CG    . GLU A 1  26   ? 469.178 5.890   727.032 1.00 99.26  ? 26   GLU A CG    1 
ATOM   185   C  CD    . GLU A 1  26   ? 469.676 4.450   727.122 1.00 100.21 ? 26   GLU A CD    1 
ATOM   186   O  OE1   . GLU A 1  26   ? 470.885 4.299   727.439 1.00 101.89 ? 26   GLU A OE1   1 
ATOM   187   O  OE2   . GLU A 1  26   ? 468.910 3.489   726.879 1.00 100.11 ? 26   GLU A OE2   1 
ATOM   188   N  N     . PRO A 1  27   ? 467.983 9.024   727.002 1.00 101.77 ? 27   PRO A N     1 
ATOM   189   C  CA    . PRO A 1  27   ? 466.888 8.667   726.090 1.00 104.22 ? 27   PRO A CA    1 
ATOM   190   C  C     . PRO A 1  27   ? 466.692 9.861   725.118 1.00 98.30  ? 27   PRO A C     1 
ATOM   191   O  O     . PRO A 1  27   ? 466.898 11.010  725.557 1.00 90.79  ? 27   PRO A O     1 
ATOM   192   C  CB    . PRO A 1  27   ? 465.711 8.466   727.023 1.00 102.46 ? 27   PRO A CB    1 
ATOM   193   C  CG    . PRO A 1  27   ? 465.948 9.455   728.086 1.00 103.47 ? 27   PRO A CG    1 
ATOM   194   C  CD    . PRO A 1  27   ? 467.454 9.549   728.272 1.00 105.12 ? 27   PRO A CD    1 
ATOM   195   N  N     . LEU A 1  28   ? 466.177 9.616   723.903 1.00 107.56 ? 28   LEU A N     1 
ATOM   196   C  CA    . LEU A 1  28   ? 465.891 10.637  722.891 1.00 101.15 ? 28   LEU A CA    1 
ATOM   197   C  C     . LEU A 1  28   ? 464.446 10.577  722.426 1.00 100.78 ? 28   LEU A C     1 
ATOM   198   O  O     . LEU A 1  28   ? 463.834 9.500   722.400 1.00 102.54 ? 28   LEU A O     1 
ATOM   199   C  CB    . LEU A 1  28   ? 466.835 10.469  721.691 1.00 102.34 ? 28   LEU A CB    1 
ATOM   200   C  CG    . LEU A 1  28   ? 468.253 10.963  722.002 1.00 106.92 ? 28   LEU A CG    1 
ATOM   201   C  CD1   . LEU A 1  28   ? 469.324 10.376  721.110 1.00 110.03 ? 28   LEU A CD1   1 
ATOM   202   C  CD2   . LEU A 1  28   ? 468.264 12.475  721.849 1.00 108.13 ? 28   LEU A CD2   1 
ATOM   203   N  N     . GLU A 1  29   ? 463.903 11.738  722.049 1.00 98.09  ? 29   GLU A N     1 
ATOM   204   C  CA    . GLU A 1  29   ? 462.544 11.732  721.526 1.00 103.26 ? 29   GLU A CA    1 
ATOM   205   C  C     . GLU A 1  29   ? 462.419 10.789  720.325 1.00 109.80 ? 29   GLU A C     1 
ATOM   206   O  O     . GLU A 1  29   ? 463.349 10.637  719.531 1.00 113.71 ? 29   GLU A O     1 
ATOM   207   C  CB    . GLU A 1  29   ? 462.124 13.150  721.112 1.00 100.43 ? 29   GLU A CB    1 
ATOM   208   C  CG    . GLU A 1  29   ? 461.813 14.078  722.248 1.00 103.60 ? 29   GLU A CG    1 
ATOM   209   C  CD    . GLU A 1  29   ? 460.519 13.647  722.985 1.00 109.52 ? 29   GLU A CD    1 
ATOM   210   O  OE1   . GLU A 1  29   ? 459.756 12.812  722.424 1.00 103.61 ? 29   GLU A OE1   1 
ATOM   211   O  OE2   . GLU A 1  29   ? 460.264 14.137  724.125 1.00 116.17 ? 29   GLU A OE2   1 
ATOM   212   N  N     . ARG A 1  30   ? 461.250 10.145  720.206 1.00 109.01 ? 30   ARG A N     1 
ATOM   213   C  CA    . ARG A 1  30   ? 461.020 9.167   719.148 1.00 105.23 ? 30   ARG A CA    1 
ATOM   214   C  C     . ARG A 1  30   ? 461.318 9.776   717.799 1.00 102.86 ? 30   ARG A C     1 
ATOM   215   O  O     . ARG A 1  30   ? 460.880 10.888  717.502 1.00 103.07 ? 30   ARG A O     1 
ATOM   216   C  CB    . ARG A 1  30   ? 459.585 8.659   719.124 1.00 111.01 ? 30   ARG A CB    1 
ATOM   217   C  CG    . ARG A 1  30   ? 459.428 7.554   718.069 1.00 120.28 ? 30   ARG A CG    1 
ATOM   218   C  CD    . ARG A 1  30   ? 457.989 7.025   717.792 1.00 129.07 ? 30   ARG A CD    1 
ATOM   219   N  NE    . ARG A 1  30   ? 457.060 8.008   717.218 1.00 132.07 ? 30   ARG A NE    1 
ATOM   220   C  CZ    . ARG A 1  30   ? 455.972 7.693   716.504 1.00 132.13 ? 30   ARG A CZ    1 
ATOM   221   N  NH1   . ARG A 1  30   ? 455.656 6.417   716.269 1.00 129.26 ? 30   ARG A NH1   1 
ATOM   222   N  NH2   . ARG A 1  30   ? 455.194 8.661   716.022 1.00 132.70 ? 30   ARG A NH2   1 
ATOM   223   N  N     . GLY A 1  31   ? 462.122 9.077   717.013 1.00 109.04 ? 31   GLY A N     1 
ATOM   224   C  CA    . GLY A 1  31   ? 462.458 9.521   715.683 1.00 107.25 ? 31   GLY A CA    1 
ATOM   225   C  C     . GLY A 1  31   ? 463.689 10.375  715.634 1.00 106.05 ? 31   GLY A C     1 
ATOM   226   O  O     . GLY A 1  31   ? 464.199 10.643  714.552 1.00 114.35 ? 31   GLY A O     1 
ATOM   227   N  N     . PHE A 1  32   ? 464.193 10.799  716.775 1.00 102.00 ? 32   PHE A N     1 
ATOM   228   C  CA    . PHE A 1  32   ? 465.391 11.606  716.800 1.00 94.89  ? 32   PHE A CA    1 
ATOM   229   C  C     . PHE A 1  32   ? 466.624 10.744  716.695 1.00 93.40  ? 32   PHE A C     1 
ATOM   230   O  O     . PHE A 1  32   ? 467.721 11.277  716.500 1.00 97.47  ? 32   PHE A O     1 
ATOM   231   C  CB    . PHE A 1  32   ? 465.406 12.434  718.063 1.00 93.62  ? 32   PHE A CB    1 
ATOM   232   C  CG    . PHE A 1  32   ? 464.767 13.748  717.884 1.00 88.70  ? 32   PHE A CG    1 
ATOM   233   C  CD1   . PHE A 1  32   ? 463.402 13.852  717.894 1.00 88.74  ? 32   PHE A CD1   1 
ATOM   234   C  CD2   . PHE A 1  32   ? 465.524 14.889  717.756 1.00 87.01  ? 32   PHE A CD2   1 
ATOM   235   C  CE1   . PHE A 1  32   ? 462.804 15.072  717.743 1.00 89.93  ? 32   PHE A CE1   1 
ATOM   236   C  CE2   . PHE A 1  32   ? 464.926 16.118  717.616 1.00 84.79  ? 32   PHE A CE2   1 
ATOM   237   C  CZ    . PHE A 1  32   ? 463.571 16.212  717.605 1.00 85.87  ? 32   PHE A CZ    1 
ATOM   238   N  N     . GLY A 1  33   ? 466.443 9.426   716.794 1.00 90.97  ? 33   GLY A N     1 
ATOM   239   C  CA    . GLY A 1  33   ? 467.562 8.516   716.633 1.00 95.25  ? 33   GLY A CA    1 
ATOM   240   C  C     . GLY A 1  33   ? 468.204 8.695   715.272 1.00 92.63  ? 33   GLY A C     1 
ATOM   241   O  O     . GLY A 1  33   ? 469.412 8.938   715.164 1.00 84.98  ? 33   GLY A O     1 
ATOM   242   N  N     . VAL A 1  34   ? 467.392 8.604   714.216 1.00 92.18  ? 34   VAL A N     1 
ATOM   243   C  CA    . VAL A 1  34   ? 467.931 8.818   712.882 1.00 85.69  ? 34   VAL A CA    1 
ATOM   244   C  C     . VAL A 1  34   ? 468.064 10.306  712.624 1.00 80.21  ? 34   VAL A C     1 
ATOM   245   O  O     . VAL A 1  34   ? 468.958 10.717  711.899 1.00 83.96  ? 34   VAL A O     1 
ATOM   246   C  CB    . VAL A 1  34   ? 467.115 8.123   711.769 1.00 89.84  ? 34   VAL A CB    1 
ATOM   247   C  CG1   . VAL A 1  34   ? 466.247 7.031   712.321 1.00 89.39  ? 34   VAL A CG1   1 
ATOM   248   C  CG2   . VAL A 1  34   ? 466.301 9.106   711.004 1.00 78.78  ? 34   VAL A CG2   1 
ATOM   249   N  N     . THR A 1  35   ? 467.269 11.156  713.264 1.00 82.91  ? 35   THR A N     1 
ATOM   250   C  CA    . THR A 1  35   ? 467.435 12.577  712.990 1.00 86.06  ? 35   THR A CA    1 
ATOM   251   C  C     . THR A 1  35   ? 468.839 13.021  713.361 1.00 85.89  ? 35   THR A C     1 
ATOM   252   O  O     . THR A 1  35   ? 469.458 13.791  712.625 1.00 82.14  ? 35   THR A O     1 
ATOM   253   C  CB    . THR A 1  35   ? 466.394 13.410  713.744 1.00 98.44  ? 35   THR A CB    1 
ATOM   254   O  OG1   . THR A 1  35   ? 465.086 13.087  713.266 1.00 102.39 ? 35   THR A OG1   1 
ATOM   255   C  CG2   . THR A 1  35   ? 466.642 14.906  713.571 1.00 100.77 ? 35   THR A CG2   1 
ATOM   256   N  N     . LEU A 1  36   ? 469.373 12.540  714.480 1.00 89.62  ? 36   LEU A N     1 
ATOM   257   C  CA    . LEU A 1  36   ? 470.779 12.829  714.746 1.00 99.23  ? 36   LEU A CA    1 
ATOM   258   C  C     . LEU A 1  36   ? 471.740 11.869  714.044 1.00 100.80 ? 36   LEU A C     1 
ATOM   259   O  O     . LEU A 1  36   ? 472.747 12.307  713.473 1.00 104.10 ? 36   LEU A O     1 
ATOM   260   C  CB    . LEU A 1  36   ? 471.076 12.826  716.238 1.00 103.22 ? 36   LEU A CB    1 
ATOM   261   C  CG    . LEU A 1  36   ? 470.845 14.115  717.016 1.00 95.58  ? 36   LEU A CG    1 
ATOM   262   C  CD1   . LEU A 1  36   ? 471.508 13.916  718.385 1.00 102.62 ? 36   LEU A CD1   1 
ATOM   263   C  CD2   . LEU A 1  36   ? 471.387 15.365  716.302 1.00 82.99  ? 36   LEU A CD2   1 
ATOM   264   N  N     . GLY A 1  37   ? 471.434 10.571  714.056 1.00 104.94 ? 37   GLY A N     1 
ATOM   265   C  CA    . GLY A 1  37   ? 472.387 9.569   713.575 1.00 104.33 ? 37   GLY A CA    1 
ATOM   266   C  C     . GLY A 1  37   ? 472.797 9.692   712.118 1.00 101.81 ? 37   GLY A C     1 
ATOM   267   O  O     . GLY A 1  37   ? 473.976 9.560   711.785 1.00 100.16 ? 37   GLY A O     1 
ATOM   268   N  N     . ASN A 1  38   ? 471.840 9.922   711.229 1.00 99.85  ? 38   ASN A N     1 
ATOM   269   C  CA    . ASN A 1  38   ? 472.168 9.921   709.803 1.00 99.74  ? 38   ASN A CA    1 
ATOM   270   C  C     . ASN A 1  38   ? 473.044 11.087  709.372 1.00 98.91  ? 38   ASN A C     1 
ATOM   271   O  O     . ASN A 1  38   ? 474.085 10.842  708.738 1.00 106.28 ? 38   ASN A O     1 
ATOM   272   C  CB    . ASN A 1  38   ? 470.884 9.880   708.981 1.00 101.87 ? 38   ASN A CB    1 
ATOM   273   C  CG    . ASN A 1  38   ? 471.118 9.394   707.622 1.00 106.42 ? 38   ASN A CG    1 
ATOM   274   O  OD1   . ASN A 1  38   ? 471.545 8.254   707.429 1.00 108.62 ? 38   ASN A OD1   1 
ATOM   275   N  ND2   . ASN A 1  38   ? 470.863 10.245  706.647 1.00 112.19 ? 38   ASN A ND2   1 
ATOM   276   N  N     . PRO A 1  39   ? 472.720 12.346  709.677 1.00 91.51  ? 39   PRO A N     1 
ATOM   277   C  CA    . PRO A 1  39   ? 473.583 13.438  709.224 1.00 91.80  ? 39   PRO A CA    1 
ATOM   278   C  C     . PRO A 1  39   ? 474.971 13.336  709.780 1.00 95.40  ? 39   PRO A C     1 
ATOM   279   O  O     . PRO A 1  39   ? 475.934 13.700  709.092 1.00 101.46 ? 39   PRO A O     1 
ATOM   280   C  CB    . PRO A 1  39   ? 472.900 14.679  709.795 1.00 88.04  ? 39   PRO A CB    1 
ATOM   281   C  CG    . PRO A 1  39   ? 471.606 14.289  710.052 1.00 87.09  ? 39   PRO A CG    1 
ATOM   282   C  CD    . PRO A 1  39   ? 471.587 12.877  710.430 1.00 90.18  ? 39   PRO A CD    1 
ATOM   283   N  N     . LEU A 1  40   ? 475.113 12.800  710.991 1.00 94.98  ? 40   LEU A N     1 
ATOM   284   C  CA    . LEU A 1  40   ? 476.457 12.651  711.506 1.00 98.58  ? 40   LEU A CA    1 
ATOM   285   C  C     . LEU A 1  40   ? 477.187 11.598  710.702 1.00 102.39 ? 40   LEU A C     1 
ATOM   286   O  O     . LEU A 1  40   ? 478.350 11.794  710.333 1.00 107.90 ? 40   LEU A O     1 
ATOM   287   C  CB    . LEU A 1  40   ? 476.441 12.332  712.997 1.00 101.24 ? 40   LEU A CB    1 
ATOM   288   C  CG    . LEU A 1  40   ? 476.012 13.502  713.881 1.00 97.80  ? 40   LEU A CG    1 
ATOM   289   C  CD1   . LEU A 1  40   ? 476.042 13.035  715.306 1.00 98.75  ? 40   LEU A CD1   1 
ATOM   290   C  CD2   . LEU A 1  40   ? 476.891 14.742  713.688 1.00 98.67  ? 40   LEU A CD2   1 
ATOM   291   N  N     . ARG A 1  41   ? 476.507 10.502  710.363 1.00 95.93  ? 41   ARG A N     1 
ATOM   292   C  CA    . ARG A 1  41   ? 477.159 9.522   709.507 1.00 97.03  ? 41   ARG A CA    1 
ATOM   293   C  C     . ARG A 1  41   ? 477.566 10.137  708.184 1.00 91.78  ? 41   ARG A C     1 
ATOM   294   O  O     . ARG A 1  41   ? 478.708 9.970   707.749 1.00 91.73  ? 41   ARG A O     1 
ATOM   295   C  CB    . ARG A 1  41   ? 476.263 8.325   709.270 1.00 95.39  ? 41   ARG A CB    1 
ATOM   296   C  CG    . ARG A 1  41   ? 476.901 7.311   708.361 1.00 94.47  ? 41   ARG A CG    1 
ATOM   297   C  CD    . ARG A 1  41   ? 475.986 6.140   708.241 1.00 98.07  ? 41   ARG A CD    1 
ATOM   298   N  NE    . ARG A 1  41   ? 476.530 5.072   707.424 1.00 99.19  ? 41   ARG A NE    1 
ATOM   299   C  CZ    . ARG A 1  41   ? 476.326 5.004   706.120 1.00 102.15 ? 41   ARG A CZ    1 
ATOM   300   N  NH1   . ARG A 1  41   ? 475.585 5.943   705.539 1.00 99.22  ? 41   ARG A NH1   1 
ATOM   301   N  NH2   . ARG A 1  41   ? 476.856 4.012   705.405 1.00 106.44 ? 41   ARG A NH2   1 
ATOM   302   N  N     . ARG A 1  42   ? 476.678 10.913  707.566 1.00 90.46  ? 42   ARG A N     1 
ATOM   303   C  CA    . ARG A 1  42   ? 477.018 11.524  706.285 1.00 93.36  ? 42   ARG A CA    1 
ATOM   304   C  C     . ARG A 1  42   ? 478.212 12.463  706.434 1.00 100.61 ? 42   ARG A C     1 
ATOM   305   O  O     . ARG A 1  42   ? 479.134 12.443  705.606 1.00 109.35 ? 42   ARG A O     1 
ATOM   306   C  CB    . ARG A 1  42   ? 475.791 12.226  705.700 1.00 85.79  ? 42   ARG A CB    1 
ATOM   307   C  CG    . ARG A 1  42   ? 474.708 11.232  705.326 1.00 80.09  ? 42   ARG A CG    1 
ATOM   308   C  CD    . ARG A 1  42   ? 473.496 11.936  704.825 1.00 79.39  ? 42   ARG A CD    1 
ATOM   309   N  NE    . ARG A 1  42   ? 473.731 12.853  703.727 1.00 86.91  ? 42   ARG A NE    1 
ATOM   310   C  CZ    . ARG A 1  42   ? 473.908 12.475  702.464 1.00 93.54  ? 42   ARG A CZ    1 
ATOM   311   N  NH1   . ARG A 1  42   ? 473.884 11.188  702.141 1.00 97.05  ? 42   ARG A NH1   1 
ATOM   312   N  NH2   . ARG A 1  42   ? 474.084 13.389  701.517 1.00 93.31  ? 42   ARG A NH2   1 
ATOM   313   N  N     . ILE A 1  43   ? 478.194 13.321  707.457 1.00 91.63  ? 43   ILE A N     1 
ATOM   314   C  CA    . ILE A 1  43   ? 479.305 14.243  707.664 1.00 95.67  ? 43   ILE A CA    1 
ATOM   315   C  C     . ILE A 1  43   ? 480.585 13.496  708.029 1.00 103.29 ? 43   ILE A C     1 
ATOM   316   O  O     . ILE A 1  43   ? 481.687 13.882  707.612 1.00 110.72 ? 43   ILE A O     1 
ATOM   317   C  CB    . ILE A 1  43   ? 478.930 15.280  708.726 1.00 95.91  ? 43   ILE A CB    1 
ATOM   318   C  CG1   . ILE A 1  43   ? 477.776 16.128  708.223 1.00 99.29  ? 43   ILE A CG1   1 
ATOM   319   C  CG2   . ILE A 1  43   ? 480.117 16.146  709.085 1.00 96.72  ? 43   ILE A CG2   1 
ATOM   320   C  CD1   . ILE A 1  43   ? 477.125 16.895  709.342 1.00 105.62 ? 43   ILE A CD1   1 
ATOM   321   N  N     . LEU A 1  44   ? 480.467 12.424  708.817 1.00 105.27 ? 44   LEU A N     1 
ATOM   322   C  CA    . LEU A 1  44   ? 481.643 11.647  709.221 1.00 105.39 ? 44   LEU A CA    1 
ATOM   323   C  C     . LEU A 1  44   ? 482.328 10.960  708.042 1.00 109.59 ? 44   LEU A C     1 
ATOM   324   O  O     . LEU A 1  44   ? 483.560 10.886  707.994 1.00 111.15 ? 44   LEU A O     1 
ATOM   325   C  CB    . LEU A 1  44   ? 481.225 10.589  710.228 1.00 106.55 ? 44   LEU A CB    1 
ATOM   326   C  CG    . LEU A 1  44   ? 480.894 11.036  711.637 1.00 107.78 ? 44   LEU A CG    1 
ATOM   327   C  CD1   . LEU A 1  44   ? 480.103 9.877   712.115 1.00 110.12 ? 44   LEU A CD1   1 
ATOM   328   C  CD2   . LEU A 1  44   ? 482.106 11.296  712.566 1.00 107.43 ? 44   LEU A CD2   1 
ATOM   329   N  N     . LEU A 1  45   ? 481.549 10.459  707.076 1.00 102.55 ? 45   LEU A N     1 
ATOM   330   C  CA    . LEU A 1  45   ? 482.116 9.717   705.960 1.00 102.20 ? 45   LEU A CA    1 
ATOM   331   C  C     . LEU A 1  45   ? 482.750 10.616  704.903 1.00 104.77 ? 45   LEU A C     1 
ATOM   332   O  O     . LEU A 1  45   ? 483.652 10.167  704.181 1.00 108.73 ? 45   LEU A O     1 
ATOM   333   C  CB    . LEU A 1  45   ? 481.017 8.850   705.339 1.00 92.33  ? 45   LEU A CB    1 
ATOM   334   C  CG    . LEU A 1  45   ? 480.568 7.590   706.109 1.00 87.01  ? 45   LEU A CG    1 
ATOM   335   C  CD1   . LEU A 1  45   ? 479.420 6.880   705.438 1.00 86.12  ? 45   LEU A CD1   1 
ATOM   336   C  CD2   . LEU A 1  45   ? 481.650 6.590   706.389 1.00 88.73  ? 45   LEU A CD2   1 
ATOM   337   N  N     . SER A 1  46   ? 482.344 11.884  704.836 1.00 109.30 ? 46   SER A N     1 
ATOM   338   C  CA    . SER A 1  46   ? 482.779 12.802  703.789 1.00 106.30 ? 46   SER A CA    1 
ATOM   339   C  C     . SER A 1  46   ? 483.736 13.890  704.266 1.00 116.26 ? 46   SER A C     1 
ATOM   340   O  O     . SER A 1  46   ? 484.896 13.925  703.850 1.00 122.73 ? 46   SER A O     1 
ATOM   341   C  CB    . SER A 1  46   ? 481.546 13.447  703.154 1.00 99.82  ? 46   SER A CB    1 
ATOM   342   O  OG    . SER A 1  46   ? 480.873 14.294  704.069 1.00 96.70  ? 46   SER A OG    1 
ATOM   343   N  N     . SER A 1  47   ? 483.295 14.741  705.187 1.00 114.88 ? 47   SER A N     1 
ATOM   344   C  CA    . SER A 1  47   ? 483.895 16.043  705.447 1.00 113.15 ? 47   SER A CA    1 
ATOM   345   C  C     . SER A 1  47   ? 484.924 16.057  706.552 1.00 106.92 ? 47   SER A C     1 
ATOM   346   O  O     . SER A 1  47   ? 485.354 17.141  706.955 1.00 104.20 ? 47   SER A O     1 
ATOM   347   C  CB    . SER A 1  47   ? 482.805 17.066  705.713 1.00 110.57 ? 47   SER A CB    1 
ATOM   348   O  OG    . SER A 1  47   ? 481.876 16.996  704.642 1.00 111.04 ? 47   SER A OG    1 
ATOM   349   N  N     . ILE A 1  48   ? 485.281 14.906  707.098 1.00 113.18 ? 48   ILE A N     1 
ATOM   350   C  CA    . ILE A 1  48   ? 486.253 14.860  708.191 1.00 115.81 ? 48   ILE A CA    1 
ATOM   351   C  C     . ILE A 1  48   ? 487.687 14.947  707.672 1.00 121.69 ? 48   ILE A C     1 
ATOM   352   O  O     . ILE A 1  48   ? 488.096 14.080  706.881 1.00 128.90 ? 48   ILE A O     1 
ATOM   353   C  CB    . ILE A 1  48   ? 486.089 13.572  708.998 1.00 112.98 ? 48   ILE A CB    1 
ATOM   354   C  CG1   . ILE A 1  48   ? 484.669 13.500  709.555 1.00 117.64 ? 48   ILE A CG1   1 
ATOM   355   C  CG2   . ILE A 1  48   ? 487.116 13.533  710.079 1.00 110.43 ? 48   ILE A CG2   1 
ATOM   356   C  CD1   . ILE A 1  48   ? 484.175 14.762  710.208 1.00 120.19 ? 48   ILE A CD1   1 
ATOM   357   N  N     . PRO A 1  49   ? 488.445 16.003  707.992 1.00 111.55 ? 49   PRO A N     1 
ATOM   358   C  CA    . PRO A 1  49   ? 489.830 16.109  707.494 1.00 109.56 ? 49   PRO A CA    1 
ATOM   359   C  C     . PRO A 1  49   ? 490.708 14.946  707.955 1.00 107.10 ? 49   PRO A C     1 
ATOM   360   O  O     . PRO A 1  49   ? 490.465 14.325  708.995 1.00 107.52 ? 49   PRO A O     1 
ATOM   361   C  CB    . PRO A 1  49   ? 490.315 17.451  708.056 1.00 109.32 ? 49   PRO A CB    1 
ATOM   362   C  CG    . PRO A 1  49   ? 489.040 18.245  708.207 1.00 109.77 ? 49   PRO A CG    1 
ATOM   363   C  CD    . PRO A 1  49   ? 488.002 17.239  708.657 1.00 110.32 ? 49   PRO A CD    1 
ATOM   364   N  N     . GLY A 1  50   ? 491.759 14.685  707.171 1.00 106.97 ? 50   GLY A N     1 
ATOM   365   C  CA    . GLY A 1  50   ? 492.657 13.566  707.368 1.00 114.59 ? 50   GLY A CA    1 
ATOM   366   C  C     . GLY A 1  50   ? 493.950 13.739  706.585 1.00 122.80 ? 50   GLY A C     1 
ATOM   367   O  O     . GLY A 1  50   ? 494.314 14.847  706.189 1.00 129.21 ? 50   GLY A O     1 
ATOM   368   N  N     . THR A 1  51   ? 494.698 12.638  706.440 1.00 128.81 ? 51   THR A N     1 
ATOM   369   C  CA    . THR A 1  51   ? 495.937 12.611  705.657 1.00 127.24 ? 51   THR A CA    1 
ATOM   370   C  C     . THR A 1  51   ? 495.986 11.486  704.627 1.00 135.14 ? 51   THR A C     1 
ATOM   371   O  O     . THR A 1  51   ? 495.291 10.468  704.754 1.00 142.29 ? 51   THR A O     1 
ATOM   372   C  CB    . THR A 1  51   ? 497.155 12.479  706.505 1.00 118.58 ? 51   THR A CB    1 
ATOM   373   O  OG1   . THR A 1  51   ? 497.069 11.265  707.253 1.00 118.75 ? 51   THR A OG1   1 
ATOM   374   C  CG2   . THR A 1  51   ? 497.217 13.672  707.425 1.00 116.46 ? 51   THR A CG2   1 
ATOM   375   N  N     . ALA A 1  52   ? 496.690 11.763  703.524 1.00 131.05 ? 52   ALA A N     1 
ATOM   376   C  CA    . ALA A 1  52   ? 496.950 10.772  702.484 1.00 126.89 ? 52   ALA A CA    1 
ATOM   377   C  C     . ALA A 1  52   ? 498.254 11.112  701.754 1.00 121.66 ? 52   ALA A C     1 
ATOM   378   O  O     . ALA A 1  52   ? 498.683 12.271  701.742 1.00 122.33 ? 52   ALA A O     1 
ATOM   379   C  CB    . ALA A 1  52   ? 495.783 10.669  701.493 1.00 128.24 ? 52   ALA A CB    1 
ATOM   380   N  N     . VAL A 1  53   ? 498.946 10.070  701.260 1.00 118.15 ? 53   VAL A N     1 
ATOM   381   C  CA    . VAL A 1  53   ? 500.107 10.250  700.373 1.00 118.25 ? 53   VAL A CA    1 
ATOM   382   C  C     . VAL A 1  53   ? 499.639 10.958  699.100 1.00 117.24 ? 53   VAL A C     1 
ATOM   383   O  O     . VAL A 1  53   ? 498.805 10.418  698.359 1.00 118.96 ? 53   VAL A O     1 
ATOM   384   C  CB    . VAL A 1  53   ? 500.722 8.889   700.047 1.00 114.28 ? 53   VAL A CB    1 
ATOM   385   C  CG1   . VAL A 1  53   ? 501.791 9.009   698.990 1.00 105.09 ? 53   VAL A CG1   1 
ATOM   386   C  CG2   . VAL A 1  53   ? 501.208 8.236   701.291 1.00 119.29 ? 53   VAL A CG2   1 
ATOM   387   N  N     . THR A 1  54   ? 500.181 12.150  698.804 1.00 115.74 ? 54   THR A N     1 
ATOM   388   C  CA    . THR A 1  54   ? 499.800 12.784  697.536 1.00 112.51 ? 54   THR A CA    1 
ATOM   389   C  C     . THR A 1  54   ? 500.779 12.692  696.350 1.00 115.87 ? 54   THR A C     1 
ATOM   390   O  O     . THR A 1  54   ? 500.337 12.871  695.204 1.00 112.99 ? 54   THR A O     1 
ATOM   391   C  CB    . THR A 1  54   ? 499.477 14.266  697.806 1.00 108.87 ? 54   THR A CB    1 
ATOM   392   O  OG1   . THR A 1  54   ? 500.649 14.940  698.273 1.00 113.04 ? 54   THR A OG1   1 
ATOM   393   C  CG2   . THR A 1  54   ? 498.406 14.405  698.846 1.00 105.80 ? 54   THR A CG2   1 
ATOM   394   N  N     . SER A 1  55   ? 502.054 12.356  696.548 1.00 117.81 ? 55   SER A N     1 
ATOM   395   C  CA    . SER A 1  55   ? 503.019 12.332  695.441 1.00 116.57 ? 55   SER A CA    1 
ATOM   396   C  C     . SER A 1  55   ? 504.183 11.408  695.790 1.00 118.80 ? 55   SER A C     1 
ATOM   397   O  O     . SER A 1  55   ? 504.510 11.226  696.959 1.00 126.60 ? 55   SER A O     1 
ATOM   398   C  CB    . SER A 1  55   ? 503.517 13.750  695.126 1.00 113.21 ? 55   SER A CB    1 
ATOM   399   O  OG    . SER A 1  55   ? 504.326 13.787  693.974 1.00 110.95 ? 55   SER A OG    1 
ATOM   400   N  N     . VAL A 1  56   ? 504.841 10.854  694.786 1.00 117.65 ? 56   VAL A N     1 
ATOM   401   C  CA    . VAL A 1  56   ? 505.985 9.982   695.044 1.00 124.01 ? 56   VAL A CA    1 
ATOM   402   C  C     . VAL A 1  56   ? 507.081 10.306  694.033 1.00 129.77 ? 56   VAL A C     1 
ATOM   403   O  O     . VAL A 1  56   ? 506.790 10.498  692.849 1.00 132.02 ? 56   VAL A O     1 
ATOM   404   C  CB    . VAL A 1  56   ? 505.596 8.490   694.945 1.00 120.51 ? 56   VAL A CB    1 
ATOM   405   C  CG1   . VAL A 1  56   ? 506.804 7.578   695.194 1.00 120.26 ? 56   VAL A CG1   1 
ATOM   406   C  CG2   . VAL A 1  56   ? 504.467 8.163   695.873 1.00 118.76 ? 56   VAL A CG2   1 
ATOM   407   N  N     . TYR A 1  57   ? 508.324 10.458  694.500 1.00 132.95 ? 57   TYR A N     1 
ATOM   408   C  CA    . TYR A 1  57   ? 509.465 10.526  693.593 1.00 137.32 ? 57   TYR A CA    1 
ATOM   409   C  C     . TYR A 1  57   ? 510.393 9.377   693.952 1.00 139.17 ? 57   TYR A C     1 
ATOM   410   O  O     . TYR A 1  57   ? 510.884 9.309   695.082 1.00 142.42 ? 57   TYR A O     1 
ATOM   411   C  CB    . TYR A 1  57   ? 510.255 11.837  693.657 1.00 145.30 ? 57   TYR A CB    1 
ATOM   412   C  CG    . TYR A 1  57   ? 511.614 11.697  692.962 1.00 148.37 ? 57   TYR A CG    1 
ATOM   413   C  CD1   . TYR A 1  57   ? 511.671 11.650  691.575 1.00 149.24 ? 57   TYR A CD1   1 
ATOM   414   C  CD2   . TYR A 1  57   ? 512.811 11.569  693.665 1.00 149.35 ? 57   TYR A CD2   1 
ATOM   415   C  CE1   . TYR A 1  57   ? 512.883 11.515  690.893 1.00 153.21 ? 57   TYR A CE1   1 
ATOM   416   C  CE2   . TYR A 1  57   ? 514.041 11.421  692.980 1.00 151.69 ? 57   TYR A CE2   1 
ATOM   417   C  CZ    . TYR A 1  57   ? 514.062 11.399  691.589 1.00 151.44 ? 57   TYR A CZ    1 
ATOM   418   O  OH    . TYR A 1  57   ? 515.226 11.264  690.858 1.00 147.22 ? 57   TYR A OH    1 
ATOM   419   N  N     . ILE A 1  58   ? 510.589 8.458   693.024 1.00 134.94 ? 58   ILE A N     1 
ATOM   420   C  CA    . ILE A 1  58   ? 511.528 7.359   693.187 1.00 136.58 ? 58   ILE A CA    1 
ATOM   421   C  C     . ILE A 1  58   ? 512.739 7.617   692.313 1.00 139.50 ? 58   ILE A C     1 
ATOM   422   O  O     . ILE A 1  58   ? 512.598 7.970   691.137 1.00 150.96 ? 58   ILE A O     1 
ATOM   423   C  CB    . ILE A 1  58   ? 510.873 6.005   692.872 1.00 136.55 ? 58   ILE A CB    1 
ATOM   424   C  CG1   . ILE A 1  58   ? 509.594 5.893   693.700 1.00 133.46 ? 58   ILE A CG1   1 
ATOM   425   C  CG2   . ILE A 1  58   ? 511.868 4.850   693.052 1.00 140.24 ? 58   ILE A CG2   1 
ATOM   426   C  CD1   . ILE A 1  58   ? 508.841 4.622   693.522 1.00 133.01 ? 58   ILE A CD1   1 
ATOM   427   N  N     . GLU A 1  59   ? 513.925 7.404   692.873 1.00 131.32 ? 59   GLU A N     1 
ATOM   428   C  CA    . GLU A 1  59   ? 515.136 7.710   692.137 1.00 129.58 ? 59   GLU A CA    1 
ATOM   429   C  C     . GLU A 1  59   ? 515.278 6.760   690.958 1.00 129.95 ? 59   GLU A C     1 
ATOM   430   O  O     . GLU A 1  59   ? 514.988 5.566   691.073 1.00 131.53 ? 59   GLU A O     1 
ATOM   431   C  CB    . GLU A 1  59   ? 516.338 7.572   693.055 1.00 134.21 ? 59   GLU A CB    1 
ATOM   432   C  CG    . GLU A 1  59   ? 517.629 8.014   692.437 1.00 142.41 ? 59   GLU A CG    1 
ATOM   433   C  CD    . GLU A 1  59   ? 518.822 7.673   693.305 1.00 151.51 ? 59   GLU A CD    1 
ATOM   434   O  OE1   . GLU A 1  59   ? 518.628 7.426   694.520 1.00 150.34 ? 59   GLU A OE1   1 
ATOM   435   O  OE2   . GLU A 1  59   ? 519.950 7.609   692.756 1.00 158.89 ? 59   GLU A OE2   1 
ATOM   436   N  N     . ASP A 1  60   ? 515.699 7.314   689.808 1.00 122.57 ? 60   ASP A N     1 
ATOM   437   C  CA    . ASP A 1  60   ? 515.812 6.568   688.552 1.00 119.83 ? 60   ASP A CA    1 
ATOM   438   C  C     . ASP A 1  60   ? 514.455 6.054   688.055 1.00 128.79 ? 60   ASP A C     1 
ATOM   439   O  O     . ASP A 1  60   ? 514.375 4.948   687.521 1.00 132.88 ? 60   ASP A O     1 
ATOM   440   C  CB    . ASP A 1  60   ? 516.823 5.416   688.639 1.00 141.13 ? 60   ASP A CB    1 
ATOM   441   C  CG    . ASP A 1  60   ? 518.261 5.900   688.818 1.00 147.59 ? 60   ASP A CG    1 
ATOM   442   O  OD1   . ASP A 1  60   ? 518.573 6.989   688.299 1.00 149.61 ? 60   ASP A OD1   1 
ATOM   443   O  OD2   . ASP A 1  60   ? 519.097 5.183   689.423 1.00 149.73 ? 60   ASP A OD2   1 
ATOM   444   N  N     . VAL A 1  61   ? 513.359 6.782   688.310 1.00 129.15 ? 61   VAL A N     1 
ATOM   445   C  CA    . VAL A 1  61   ? 512.023 6.431   687.803 1.00 124.33 ? 61   VAL A CA    1 
ATOM   446   C  C     . VAL A 1  61   ? 511.321 7.671   687.251 1.00 124.53 ? 61   VAL A C     1 
ATOM   447   O  O     . VAL A 1  61   ? 511.088 8.633   687.993 1.00 127.70 ? 61   VAL A O     1 
ATOM   448   C  CB    . VAL A 1  61   ? 511.145 5.764   688.873 1.00 124.85 ? 61   VAL A CB    1 
ATOM   449   C  CG1   . VAL A 1  61   ? 509.684 5.788   688.444 1.00 121.27 ? 61   VAL A CG1   1 
ATOM   450   C  CG2   . VAL A 1  61   ? 511.584 4.349   689.058 1.00 128.35 ? 61   VAL A CG2   1 
ATOM   451   N  N     . LEU A 1  62   ? 510.982 7.651   685.959 1.00 117.04 ? 62   LEU A N     1 
ATOM   452   C  CA    . LEU A 1  62   ? 510.410 8.823   685.307 1.00 117.02 ? 62   LEU A CA    1 
ATOM   453   C  C     . LEU A 1  62   ? 508.882 8.906   685.388 1.00 114.73 ? 62   LEU A C     1 
ATOM   454   O  O     . LEU A 1  62   ? 508.329 10.011  685.255 1.00 107.82 ? 62   LEU A O     1 
ATOM   455   C  CB    . LEU A 1  62   ? 510.819 8.837   683.841 1.00 120.96 ? 62   LEU A CB    1 
ATOM   456   C  CG    . LEU A 1  62   ? 512.316 8.927   683.569 1.00 124.17 ? 62   LEU A CG    1 
ATOM   457   C  CD1   . LEU A 1  62   ? 512.595 8.542   682.130 1.00 122.13 ? 62   LEU A CD1   1 
ATOM   458   C  CD2   . LEU A 1  62   ? 512.842 10.320  683.869 1.00 127.31 ? 62   LEU A CD2   1 
ATOM   459   N  N     . HIS A 1  63   ? 508.187 7.802   685.657 1.00 114.85 ? 63   HIS A N     1 
ATOM   460   C  CA    . HIS A 1  63   ? 506.730 7.833   685.623 1.00 112.43 ? 63   HIS A CA    1 
ATOM   461   C  C     . HIS A 1  63   ? 506.175 6.549   686.248 1.00 112.81 ? 63   HIS A C     1 
ATOM   462   O  O     . HIS A 1  63   ? 506.916 5.590   686.490 1.00 107.38 ? 63   HIS A O     1 
ATOM   463   C  CB    . HIS A 1  63   ? 506.247 7.952   684.195 1.00 113.26 ? 63   HIS A CB    1 
ATOM   464   C  CG    . HIS A 1  63   ? 506.761 6.866   683.310 1.00 116.89 ? 63   HIS A CG    1 
ATOM   465   N  ND1   . HIS A 1  63   ? 506.306 5.567   683.406 1.00 117.37 ? 63   HIS A ND1   1 
ATOM   466   C  CD2   . HIS A 1  63   ? 507.636 6.884   682.283 1.00 120.38 ? 63   HIS A CD2   1 
ATOM   467   C  CE1   . HIS A 1  63   ? 506.900 4.824   682.497 1.00 117.97 ? 63   HIS A CE1   1 
ATOM   468   N  NE2   . HIS A 1  63   ? 507.711 5.600   681.798 1.00 122.24 ? 63   HIS A NE2   1 
ATOM   469   N  N     . GLU A 1  64   ? 504.833 6.484   686.367 1.00 104.58 ? 64   GLU A N     1 
ATOM   470   C  CA    . GLU A 1  64   ? 504.165 5.415   687.127 1.00 113.72 ? 64   GLU A CA    1 
ATOM   471   C  C     . GLU A 1  64   ? 504.334 4.015   686.538 1.00 112.89 ? 64   GLU A C     1 
ATOM   472   O  O     . GLU A 1  64   ? 504.287 3.031   687.283 1.00 114.61 ? 64   GLU A O     1 
ATOM   473   C  CB    . GLU A 1  64   ? 502.660 5.715   687.276 1.00 111.87 ? 64   GLU A CB    1 
ATOM   474   C  CG    . GLU A 1  64   ? 501.886 4.681   688.144 1.00 118.53 ? 64   GLU A CG    1 
ATOM   475   C  CD    . GLU A 1  64   ? 500.522 5.165   688.662 1.00 126.54 ? 64   GLU A CD    1 
ATOM   476   O  OE1   . GLU A 1  64   ? 500.106 6.312   688.370 1.00 128.05 ? 64   GLU A OE1   1 
ATOM   477   O  OE2   . GLU A 1  64   ? 499.853 4.381   689.377 1.00 130.96 ? 64   GLU A OE2   1 
ATOM   478   N  N     . PHE A 1  65   ? 504.569 3.892   685.251 1.00 116.82 ? 65   PHE A N     1 
ATOM   479   C  CA    . PHE A 1  65   ? 504.576 2.606   684.572 1.00 116.00 ? 65   PHE A CA    1 
ATOM   480   C  C     . PHE A 1  65   ? 505.931 1.961   684.583 1.00 121.60 ? 65   PHE A C     1 
ATOM   481   O  O     . PHE A 1  65   ? 506.121 0.962   683.893 1.00 120.74 ? 65   PHE A O     1 
ATOM   482   C  CB    . PHE A 1  65   ? 504.071 2.762   683.149 1.00 107.28 ? 65   PHE A CB    1 
ATOM   483   C  CG    . PHE A 1  65   ? 502.753 3.423   683.100 1.00 105.48 ? 65   PHE A CG    1 
ATOM   484   C  CD1   . PHE A 1  65   ? 502.658 4.792   682.922 1.00 106.58 ? 65   PHE A CD1   1 
ATOM   485   C  CD2   . PHE A 1  65   ? 501.598 2.692   683.325 1.00 107.71 ? 65   PHE A CD2   1 
ATOM   486   C  CE1   . PHE A 1  65   ? 501.420 5.418   682.904 1.00 113.21 ? 65   PHE A CE1   1 
ATOM   487   C  CE2   . PHE A 1  65   ? 500.348 3.311   683.324 1.00 112.94 ? 65   PHE A CE2   1 
ATOM   488   C  CZ    . PHE A 1  65   ? 500.255 4.674   683.114 1.00 115.19 ? 65   PHE A CZ    1 
ATOM   489   N  N     . SER A 1  66   ? 506.862 2.501   685.358 1.00 121.83 ? 66   SER A N     1 
ATOM   490   C  CA    . SER A 1  66   ? 508.190 1.935   685.476 1.00 129.87 ? 66   SER A CA    1 
ATOM   491   C  C     . SER A 1  66   ? 508.175 0.627   686.297 1.00 121.27 ? 66   SER A C     1 
ATOM   492   O  O     . SER A 1  66   ? 507.134 0.154   686.764 1.00 110.38 ? 66   SER A O     1 
ATOM   493   C  CB    . SER A 1  66   ? 509.109 3.011   686.056 1.00 130.66 ? 66   SER A CB    1 
ATOM   494   O  OG    . SER A 1  66   ? 509.130 4.174   685.217 1.00 130.05 ? 66   SER A OG    1 
ATOM   495   N  N     . THR A 1  67   ? 509.365 0.020   686.418 1.00 128.40 ? 67   THR A N     1 
ATOM   496   C  CA    . THR A 1  67   ? 509.615 -1.223  687.148 1.00 129.24 ? 67   THR A CA    1 
ATOM   497   C  C     . THR A 1  67   ? 511.047 -1.162  687.703 1.00 132.58 ? 67   THR A C     1 
ATOM   498   O  O     . THR A 1  67   ? 511.941 -0.642  687.029 1.00 141.01 ? 67   THR A O     1 
ATOM   499   C  CB    . THR A 1  67   ? 509.416 -2.414  686.197 1.00 126.17 ? 67   THR A CB    1 
ATOM   500   O  OG1   . THR A 1  67   ? 509.996 -3.598  686.747 1.00 127.38 ? 67   THR A OG1   1 
ATOM   501   C  CG2   . THR A 1  67   ? 510.106 -2.102  684.842 1.00 127.67 ? 67   THR A CG2   1 
ATOM   502   N  N     . ILE A 1  68   ? 511.264 -1.673  688.911 1.00 127.60 ? 68   ILE A N     1 
ATOM   503   C  CA    . ILE A 1  68   ? 512.530 -1.511  689.641 1.00 135.69 ? 68   ILE A CA    1 
ATOM   504   C  C     . ILE A 1  68   ? 513.329 -2.810  689.682 1.00 138.42 ? 68   ILE A C     1 
ATOM   505   O  O     . ILE A 1  68   ? 512.769 -3.856  690.031 1.00 143.47 ? 68   ILE A O     1 
ATOM   506   C  CB    . ILE A 1  68   ? 512.306 -1.016  691.082 1.00 141.77 ? 68   ILE A CB    1 
ATOM   507   C  CG1   . ILE A 1  68   ? 511.331 0.155   691.124 1.00 146.38 ? 68   ILE A CG1   1 
ATOM   508   C  CG2   . ILE A 1  68   ? 513.648 -0.643  691.714 1.00 142.89 ? 68   ILE A CG2   1 
ATOM   509   C  CD1   . ILE A 1  68   ? 511.985 1.467   690.834 1.00 149.15 ? 68   ILE A CD1   1 
ATOM   510   N  N     . PRO A 1  69   ? 514.605 -2.797  689.275 1.00 139.13 ? 69   PRO A N     1 
ATOM   511   C  CA    . PRO A 1  69   ? 515.452 -3.997  689.372 1.00 148.86 ? 69   PRO A CA    1 
ATOM   512   C  C     . PRO A 1  69   ? 515.618 -4.394  690.832 1.00 156.52 ? 69   PRO A C     1 
ATOM   513   O  O     . PRO A 1  69   ? 515.879 -3.543  691.687 1.00 131.60 ? 69   PRO A O     1 
ATOM   514   C  CB    . PRO A 1  69   ? 516.784 -3.545  688.767 1.00 131.00 ? 69   PRO A CB    1 
ATOM   515   C  CG    . PRO A 1  69   ? 516.463 -2.368  687.941 1.00 134.76 ? 69   PRO A CG    1 
ATOM   516   C  CD    . PRO A 1  69   ? 515.329 -1.675  688.655 1.00 137.81 ? 69   PRO A CD    1 
ATOM   517   N  N     . GLY A 1  70   ? 515.459 -5.685  691.127 1.00 154.96 ? 70   GLY A N     1 
ATOM   518   C  CA    . GLY A 1  70   ? 515.568 -6.167  692.492 1.00 157.89 ? 70   GLY A CA    1 
ATOM   519   C  C     . GLY A 1  70   ? 514.260 -6.184  693.250 1.00 156.17 ? 70   GLY A C     1 
ATOM   520   O  O     . GLY A 1  70   ? 514.157 -6.857  694.281 1.00 161.24 ? 70   GLY A O     1 
ATOM   521   N  N     . VAL A 1  71   ? 513.280 -5.436  692.788 1.00 146.30 ? 71   VAL A N     1 
ATOM   522   C  CA    . VAL A 1  71   ? 511.989 -5.334  693.434 1.00 134.98 ? 71   VAL A CA    1 
ATOM   523   C  C     . VAL A 1  71   ? 510.992 -6.222  692.711 1.00 132.81 ? 71   VAL A C     1 
ATOM   524   O  O     . VAL A 1  71   ? 510.980 -6.303  691.473 1.00 139.69 ? 71   VAL A O     1 
ATOM   525   C  CB    . VAL A 1  71   ? 511.519 -3.874  693.439 1.00 126.45 ? 71   VAL A CB    1 
ATOM   526   C  CG1   . VAL A 1  71   ? 510.196 -3.764  694.146 1.00 125.96 ? 71   VAL A CG1   1 
ATOM   527   C  CG2   . VAL A 1  71   ? 512.554 -3.007  694.090 1.00 125.25 ? 71   VAL A CG2   1 
ATOM   528   N  N     . LYS A 1  72   ? 510.154 -6.891  693.491 1.00 126.75 ? 72   LYS A N     1 
ATOM   529   C  CA    . LYS A 1  72   ? 509.131 -7.777  692.956 1.00 123.69 ? 72   LYS A CA    1 
ATOM   530   C  C     . LYS A 1  72   ? 507.963 -6.970  692.411 1.00 123.19 ? 72   LYS A C     1 
ATOM   531   O  O     . LYS A 1  72   ? 507.472 -7.217  691.301 1.00 124.87 ? 72   LYS A O     1 
ATOM   532   C  CB    . LYS A 1  72   ? 508.676 -8.741  694.059 1.00 122.66 ? 72   LYS A CB    1 
ATOM   533   C  CG    . LYS A 1  72   ? 507.671 -9.818  693.676 1.00 120.35 ? 72   LYS A CG    1 
ATOM   534   C  CD    . LYS A 1  72   ? 507.215 -10.564 694.932 1.00 125.25 ? 72   LYS A CD    1 
ATOM   535   C  CE    . LYS A 1  72   ? 506.311 -11.759 694.633 1.00 126.77 ? 72   LYS A CE    1 
ATOM   536   N  NZ    . LYS A 1  72   ? 505.572 -12.255 695.848 1.00 130.09 ? 72   LYS A NZ    1 
ATOM   537   N  N     . GLU A 1  73   ? 507.528 -5.986  693.182 1.00 128.06 ? 73   GLU A N     1 
ATOM   538   C  CA    . GLU A 1  73   ? 506.383 -5.170  692.823 1.00 129.39 ? 73   GLU A CA    1 
ATOM   539   C  C     . GLU A 1  73   ? 506.731 -4.131  691.756 1.00 124.54 ? 73   GLU A C     1 
ATOM   540   O  O     . GLU A 1  73   ? 507.825 -3.556  691.752 1.00 122.53 ? 73   GLU A O     1 
ATOM   541   C  CB    . GLU A 1  73   ? 505.834 -4.454  694.067 1.00 132.31 ? 73   GLU A CB    1 
ATOM   542   C  CG    . GLU A 1  73   ? 505.043 -5.290  695.126 1.00 135.04 ? 73   GLU A CG    1 
ATOM   543   C  CD    . GLU A 1  73   ? 505.903 -6.066  696.154 1.00 139.42 ? 73   GLU A CD    1 
ATOM   544   O  OE1   . GLU A 1  73   ? 505.321 -6.649  697.104 1.00 138.65 ? 73   GLU A OE1   1 
ATOM   545   O  OE2   . GLU A 1  73   ? 507.148 -6.075  696.042 1.00 143.20 ? 73   GLU A OE2   1 
ATOM   546   N  N     . ASP A 1  74   ? 505.814 -3.957  690.808 1.00 126.84 ? 74   ASP A N     1 
ATOM   547   C  CA    . ASP A 1  74   ? 505.866 -2.863  689.854 1.00 125.67 ? 74   ASP A CA    1 
ATOM   548   C  C     . ASP A 1  74   ? 505.466 -1.558  690.543 1.00 125.28 ? 74   ASP A C     1 
ATOM   549   O  O     . ASP A 1  74   ? 504.844 -1.567  691.611 1.00 130.93 ? 74   ASP A O     1 
ATOM   550   C  CB    . ASP A 1  74   ? 504.890 -3.140  688.724 1.00 130.48 ? 74   ASP A CB    1 
ATOM   551   C  CG    . ASP A 1  74   ? 503.512 -3.554  689.248 1.00 138.71 ? 74   ASP A CG    1 
ATOM   552   O  OD1   . ASP A 1  74   ? 502.604 -2.694  689.394 1.00 140.72 ? 74   ASP A OD1   1 
ATOM   553   O  OD2   . ASP A 1  74   ? 503.353 -4.751  689.559 1.00 144.85 ? 74   ASP A OD2   1 
ATOM   554   N  N     . VAL A 1  75   ? 505.841 -0.425  689.938 1.00 118.94 ? 75   VAL A N     1 
ATOM   555   C  CA    . VAL A 1  75   ? 505.553 0.884   690.541 1.00 118.04 ? 75   VAL A CA    1 
ATOM   556   C  C     . VAL A 1  75   ? 504.051 1.101   690.797 1.00 115.02 ? 75   VAL A C     1 
ATOM   557   O  O     . VAL A 1  75   ? 503.672 1.736   691.791 1.00 119.56 ? 75   VAL A O     1 
ATOM   558   C  CB    . VAL A 1  75   ? 506.168 2.017   689.713 1.00 102.68 ? 75   VAL A CB    1 
ATOM   559   C  CG1   . VAL A 1  75   ? 505.777 3.372   690.274 1.00 102.43 ? 75   VAL A CG1   1 
ATOM   560   C  CG2   . VAL A 1  75   ? 507.638 1.876   689.766 1.00 105.94 ? 75   VAL A CG2   1 
ATOM   561   N  N     . VAL A 1  76   ? 503.167 0.591   689.931 1.00 103.11 ? 76   VAL A N     1 
ATOM   562   C  CA    . VAL A 1  76   ? 501.733 0.770   690.187 1.00 101.23 ? 76   VAL A CA    1 
ATOM   563   C  C     . VAL A 1  76   ? 501.344 0.180   691.542 1.00 104.23 ? 76   VAL A C     1 
ATOM   564   O  O     . VAL A 1  76   ? 500.606 0.796   692.322 1.00 102.89 ? 76   VAL A O     1 
ATOM   565   C  CB    . VAL A 1  76   ? 500.899 0.178   689.042 1.00 98.77  ? 76   VAL A CB    1 
ATOM   566   C  CG1   . VAL A 1  76   ? 499.434 0.291   689.379 1.00 97.81  ? 76   VAL A CG1   1 
ATOM   567   C  CG2   . VAL A 1  76   ? 501.139 1.005   687.832 1.00 90.77  ? 76   VAL A CG2   1 
ATOM   568   N  N     . GLU A 1  77   ? 501.807 -1.037  691.817 1.00 106.29 ? 77   GLU A N     1 
ATOM   569   C  CA    . GLU A 1  77   ? 501.550 -1.699  693.090 1.00 103.73 ? 77   GLU A CA    1 
ATOM   570   C  C     . GLU A 1  77   ? 502.258 -0.991  694.229 1.00 108.56 ? 77   GLU A C     1 
ATOM   571   O  O     . GLU A 1  77   ? 501.749 -0.937  695.355 1.00 107.21 ? 77   GLU A O     1 
ATOM   572   C  CB    . GLU A 1  77   ? 502.025 -3.143  693.040 1.00 103.37 ? 77   GLU A CB    1 
ATOM   573   C  CG    . GLU A 1  77   ? 501.801 -3.909  694.325 1.00 102.50 ? 77   GLU A CG    1 
ATOM   574   C  CD    . GLU A 1  77   ? 501.940 -5.405  694.133 1.00 106.84 ? 77   GLU A CD    1 
ATOM   575   O  OE1   . GLU A 1  77   ? 501.510 -6.167  695.029 1.00 104.23 ? 77   GLU A OE1   1 
ATOM   576   O  OE2   . GLU A 1  77   ? 502.466 -5.816  693.070 1.00 104.59 ? 77   GLU A OE2   1 
ATOM   577   N  N     . ILE A 1  78   ? 503.466 -0.486  693.971 1.00 119.20 ? 78   ILE A N     1 
ATOM   578   C  CA    . ILE A 1  78   ? 504.203 0.223   695.015 1.00 121.25 ? 78   ILE A CA    1 
ATOM   579   C  C     . ILE A 1  78   ? 503.414 1.440   695.475 1.00 118.35 ? 78   ILE A C     1 
ATOM   580   O  O     . ILE A 1  78   ? 503.202 1.652   696.677 1.00 117.68 ? 78   ILE A O     1 
ATOM   581   C  CB    . ILE A 1  78   ? 505.596 0.628   694.481 1.00 120.27 ? 78   ILE A CB    1 
ATOM   582   C  CG1   . ILE A 1  78   ? 506.483 -0.600  694.278 1.00 119.72 ? 78   ILE A CG1   1 
ATOM   583   C  CG2   . ILE A 1  78   ? 506.252 1.693   695.360 1.00 123.92 ? 78   ILE A CG2   1 
ATOM   584   C  CD1   . ILE A 1  78   ? 506.589 -1.462  695.477 1.00 122.49 ? 78   ILE A CD1   1 
ATOM   585   N  N     . ILE A 1  79   ? 502.930 2.230   694.518 1.00 112.29 ? 79   ILE A N     1 
ATOM   586   C  CA    . ILE A 1  79   ? 502.116 3.386   694.849 1.00 109.36 ? 79   ILE A CA    1 
ATOM   587   C  C     . ILE A 1  79   ? 500.792 2.948   695.449 1.00 107.05 ? 79   ILE A C     1 
ATOM   588   O  O     . ILE A 1  79   ? 500.243 3.608   696.335 1.00 109.26 ? 79   ILE A O     1 
ATOM   589   C  CB    . ILE A 1  79   ? 501.928 4.251   693.600 1.00 106.80 ? 79   ILE A CB    1 
ATOM   590   C  CG1   . ILE A 1  79   ? 503.260 4.880   693.256 1.00 120.11 ? 79   ILE A CG1   1 
ATOM   591   C  CG2   . ILE A 1  79   ? 500.957 5.358   693.858 1.00 99.72  ? 79   ILE A CG2   1 
ATOM   592   C  CD1   . ILE A 1  79   ? 503.209 5.702   692.014 1.00 129.06 ? 79   ILE A CD1   1 
ATOM   593   N  N     . LEU A 1  80   ? 500.248 1.840   694.950 1.00 108.85 ? 80   LEU A N     1 
ATOM   594   C  CA    . LEU A 1  80   ? 499.022 1.258   695.496 1.00 107.54 ? 80   LEU A CA    1 
ATOM   595   C  C     . LEU A 1  80   ? 499.163 0.893   696.986 1.00 107.14 ? 80   LEU A C     1 
ATOM   596   O  O     . LEU A 1  80   ? 498.186 0.971   697.748 1.00 101.31 ? 80   LEU A O     1 
ATOM   597   C  CB    . LEU A 1  80   ? 498.651 0.032   694.658 1.00 105.25 ? 80   LEU A CB    1 
ATOM   598   C  CG    . LEU A 1  80   ? 497.238 -0.115  694.111 1.00 96.40  ? 80   LEU A CG    1 
ATOM   599   C  CD1   . LEU A 1  80   ? 496.867 1.205   693.447 1.00 92.16  ? 80   LEU A CD1   1 
ATOM   600   C  CD2   . LEU A 1  80   ? 497.142 -1.276  693.160 1.00 92.40  ? 80   LEU A CD2   1 
ATOM   601   N  N     . ASN A 1  81   ? 500.351 0.421   697.400 1.00 112.03 ? 81   ASN A N     1 
ATOM   602   C  CA    . ASN A 1  81   ? 500.587 0.136   698.813 1.00 114.71 ? 81   ASN A CA    1 
ATOM   603   C  C     . ASN A 1  81   ? 500.781 1.420   699.598 1.00 119.71 ? 81   ASN A C     1 
ATOM   604   O  O     . ASN A 1  81   ? 500.262 1.548   700.711 1.00 127.66 ? 81   ASN A O     1 
ATOM   605   C  CB    . ASN A 1  81   ? 501.801 -0.778  698.994 1.00 116.67 ? 81   ASN A CB    1 
ATOM   606   C  CG    . ASN A 1  81   ? 501.590 -2.158  698.401 1.00 117.51 ? 81   ASN A CG    1 
ATOM   607   O  OD1   . ASN A 1  81   ? 500.451 -2.577  698.160 1.00 117.37 ? 81   ASN A OD1   1 
ATOM   608   N  ND2   . ASN A 1  81   ? 502.688 -2.857  698.120 1.00 116.18 ? 81   ASN A ND2   1 
ATOM   609   N  N     . LEU A 1  82   ? 501.485 2.393   699.016 1.00 115.79 ? 82   LEU A N     1 
ATOM   610   C  CA    . LEU A 1  82   ? 501.655 3.691   699.657 1.00 121.83 ? 82   LEU A CA    1 
ATOM   611   C  C     . LEU A 1  82   ? 500.347 4.460   699.786 1.00 129.14 ? 82   LEU A C     1 
ATOM   612   O  O     . LEU A 1  82   ? 500.265 5.385   700.601 1.00 138.98 ? 82   LEU A O     1 
ATOM   613   C  CB    . LEU A 1  82   ? 502.635 4.550   698.880 1.00 118.78 ? 82   LEU A CB    1 
ATOM   614   C  CG    . LEU A 1  82   ? 504.049 4.004   698.881 1.00 127.55 ? 82   LEU A CG    1 
ATOM   615   C  CD1   . LEU A 1  82   ? 504.826 4.680   697.778 1.00 129.97 ? 82   LEU A CD1   1 
ATOM   616   C  CD2   . LEU A 1  82   ? 504.731 4.203   700.227 1.00 135.63 ? 82   LEU A CD2   1 
ATOM   617   N  N     . LYS A 1  83   ? 499.332 4.135   698.983 1.00 129.25 ? 83   LYS A N     1 
ATOM   618   C  CA    . LYS A 1  83   ? 498.051 4.807   699.159 1.00 125.93 ? 83   LYS A CA    1 
ATOM   619   C  C     . LYS A 1  83   ? 497.304 4.375   700.411 1.00 126.90 ? 83   LYS A C     1 
ATOM   620   O  O     . LYS A 1  83   ? 496.406 5.098   700.842 1.00 129.48 ? 83   LYS A O     1 
ATOM   621   C  CB    . LYS A 1  83   ? 497.234 4.601   697.890 1.00 123.69 ? 83   LYS A CB    1 
ATOM   622   C  CG    . LYS A 1  83   ? 496.256 5.700   697.613 1.00 126.08 ? 83   LYS A CG    1 
ATOM   623   C  CD    . LYS A 1  83   ? 495.590 5.474   696.255 1.00 128.37 ? 83   LYS A CD    1 
ATOM   624   C  CE    . LYS A 1  83   ? 494.717 4.229   696.154 1.00 129.91 ? 83   LYS A CE    1 
ATOM   625   N  NZ    . LYS A 1  83   ? 494.049 4.174   694.802 1.00 126.09 ? 83   LYS A NZ    1 
ATOM   626   N  N     . GLU A 1  84   ? 497.701 3.283   701.047 1.00 129.08 ? 84   GLU A N     1 
ATOM   627   C  CA    . GLU A 1  84   ? 497.054 2.812   702.260 1.00 132.35 ? 84   GLU A CA    1 
ATOM   628   C  C     . GLU A 1  84   ? 497.752 3.322   703.501 1.00 137.00 ? 84   GLU A C     1 
ATOM   629   O  O     . GLU A 1  84   ? 497.245 3.121   704.615 1.00 143.04 ? 84   GLU A O     1 
ATOM   630   C  CB    . GLU A 1  84   ? 496.971 1.283   702.293 1.00 136.46 ? 84   GLU A CB    1 
ATOM   631   C  CG    . GLU A 1  84   ? 496.114 0.663   701.209 1.00 141.67 ? 84   GLU A CG    1 
ATOM   632   C  CD    . GLU A 1  84   ? 494.692 1.230   701.212 1.00 147.42 ? 84   GLU A CD    1 
ATOM   633   O  OE1   . GLU A 1  84   ? 494.163 1.453   702.334 1.00 154.83 ? 84   GLU A OE1   1 
ATOM   634   O  OE2   . GLU A 1  84   ? 494.087 1.399   700.117 1.00 143.46 ? 84   GLU A OE2   1 
ATOM   635   N  N     . LEU A 1  85   ? 498.848 4.048   703.321 1.00 130.70 ? 85   LEU A N     1 
ATOM   636   C  CA    . LEU A 1  85   ? 499.648 4.508   704.443 1.00 132.14 ? 85   LEU A CA    1 
ATOM   637   C  C     . LEU A 1  85   ? 498.902 5.590   705.225 1.00 134.75 ? 85   LEU A C     1 
ATOM   638   O  O     . LEU A 1  85   ? 498.420 6.569   704.645 1.00 140.43 ? 85   LEU A O     1 
ATOM   639   C  CB    . LEU A 1  85   ? 500.973 5.054   703.932 1.00 125.72 ? 85   LEU A CB    1 
ATOM   640   C  CG    . LEU A 1  85   ? 501.989 5.381   705.010 1.00 125.66 ? 85   LEU A CG    1 
ATOM   641   C  CD1   . LEU A 1  85   ? 502.474 4.060   705.602 1.00 127.86 ? 85   LEU A CD1   1 
ATOM   642   C  CD2   . LEU A 1  85   ? 503.123 6.221   704.488 1.00 125.57 ? 85   LEU A CD2   1 
ATOM   643   N  N     . VAL A 1  86   ? 498.756 5.376   706.531 1.00 129.73 ? 86   VAL A N     1 
ATOM   644   C  CA    . VAL A 1  86   ? 498.100 6.311   707.440 1.00 132.39 ? 86   VAL A CA    1 
ATOM   645   C  C     . VAL A 1  86   ? 499.133 7.053   708.264 1.00 124.30 ? 86   VAL A C     1 
ATOM   646   O  O     . VAL A 1  86   ? 499.835 6.438   709.072 1.00 140.04 ? 86   VAL A O     1 
ATOM   647   C  CB    . VAL A 1  86   ? 497.114 5.582   708.361 1.00 139.31 ? 86   VAL A CB    1 
ATOM   648   C  CG1   . VAL A 1  86   ? 496.325 6.584   709.201 1.00 136.60 ? 86   VAL A CG1   1 
ATOM   649   C  CG2   . VAL A 1  86   ? 496.177 4.721   707.522 1.00 140.70 ? 86   VAL A CG2   1 
ATOM   650   N  N     . VAL A 1  87   ? 499.200 8.372   708.111 1.00 125.72 ? 87   VAL A N     1 
ATOM   651   C  CA    . VAL A 1  87   ? 500.249 9.180   708.734 1.00 137.77 ? 87   VAL A CA    1 
ATOM   652   C  C     . VAL A 1  87   ? 499.613 10.269  709.578 1.00 138.35 ? 87   VAL A C     1 
ATOM   653   O  O     . VAL A 1  87   ? 498.969 11.176  709.039 1.00 139.10 ? 87   VAL A O     1 
ATOM   654   C  CB    . VAL A 1  87   ? 501.201 9.806   707.707 1.00 147.03 ? 87   VAL A CB    1 
ATOM   655   C  CG1   . VAL A 1  87   ? 502.219 10.690  708.424 1.00 151.71 ? 87   VAL A CG1   1 
ATOM   656   C  CG2   . VAL A 1  87   ? 501.904 8.721   706.888 1.00 150.08 ? 87   VAL A CG2   1 
ATOM   657   N  N     . ARG A 1  88   ? 499.842 10.209  710.891 1.00 139.03 ? 88   ARG A N     1 
ATOM   658   C  CA    . ARG A 1  88   ? 499.267 11.146  711.851 1.00 141.15 ? 88   ARG A CA    1 
ATOM   659   C  C     . ARG A 1  88   ? 500.223 12.307  712.140 1.00 136.46 ? 88   ARG A C     1 
ATOM   660   O  O     . ARG A 1  88   ? 501.376 12.084  712.517 1.00 138.58 ? 88   ARG A O     1 
ATOM   661   C  CB    . ARG A 1  88   ? 498.938 10.428  713.148 1.00 136.85 ? 88   ARG A CB    1 
ATOM   662   C  CG    . ARG A 1  88   ? 498.444 11.393  714.163 1.00 143.93 ? 88   ARG A CG    1 
ATOM   663   C  CD    . ARG A 1  88   ? 498.363 10.789  715.521 1.00 145.93 ? 88   ARG A CD    1 
ATOM   664   N  NE    . ARG A 1  88   ? 497.831 11.760  716.457 1.00 145.08 ? 88   ARG A NE    1 
ATOM   665   C  CZ    . ARG A 1  88   ? 497.793 11.552  717.760 1.00 154.63 ? 88   ARG A CZ    1 
ATOM   666   N  NH1   . ARG A 1  88   ? 498.273 10.412  718.237 1.00 149.80 ? 88   ARG A NH1   1 
ATOM   667   N  NH2   . ARG A 1  88   ? 497.294 12.476  718.574 1.00 155.96 ? 88   ARG A NH2   1 
ATOM   668   N  N     . PHE A 1  89   ? 499.718 13.543  712.023 1.00 136.26 ? 89   PHE A N     1 
ATOM   669   C  CA    . PHE A 1  89   ? 500.473 14.756  712.349 1.00 140.53 ? 89   PHE A CA    1 
ATOM   670   C  C     . PHE A 1  89   ? 500.194 15.213  713.773 1.00 152.37 ? 89   PHE A C     1 
ATOM   671   O  O     . PHE A 1  89   ? 499.072 15.610  714.098 1.00 155.50 ? 89   PHE A O     1 
ATOM   672   C  CB    . PHE A 1  89   ? 500.097 15.919  711.425 1.00 139.29 ? 89   PHE A CB    1 
ATOM   673   C  CG    . PHE A 1  89   ? 500.508 15.752  709.989 1.00 143.48 ? 89   PHE A CG    1 
ATOM   674   C  CD1   . PHE A 1  89   ? 500.026 14.714  709.209 1.00 141.23 ? 89   PHE A CD1   1 
ATOM   675   C  CD2   . PHE A 1  89   ? 501.352 16.683  709.398 1.00 145.85 ? 89   PHE A CD2   1 
ATOM   676   C  CE1   . PHE A 1  89   ? 500.408 14.588  707.880 1.00 138.53 ? 89   PHE A CE1   1 
ATOM   677   C  CE2   . PHE A 1  89   ? 501.736 16.565  708.068 1.00 143.27 ? 89   PHE A CE2   1 
ATOM   678   C  CZ    . PHE A 1  89   ? 501.264 15.516  707.308 1.00 139.16 ? 89   PHE A CZ    1 
ATOM   679   N  N     . LEU A 1  90   ? 501.235 15.226  714.603 1.00 164.29 ? 90   LEU A N     1 
ATOM   680   C  CA    . LEU A 1  90   ? 501.070 15.659  715.987 1.00 148.96 ? 90   LEU A CA    1 
ATOM   681   C  C     . LEU A 1  90   ? 500.879 17.172  716.072 1.00 150.01 ? 90   LEU A C     1 
ATOM   682   O  O     . LEU A 1  90   ? 500.013 17.640  716.810 1.00 151.51 ? 90   LEU A O     1 
ATOM   683   C  CB    . LEU A 1  90   ? 502.226 15.163  716.852 1.00 152.17 ? 90   LEU A CB    1 
ATOM   684   C  CG    . LEU A 1  90   ? 502.071 13.664  717.173 1.00 152.05 ? 90   LEU A CG    1 
ATOM   685   C  CD1   . LEU A 1  90   ? 500.642 13.355  717.514 1.00 151.30 ? 90   LEU A CD1   1 
ATOM   686   C  CD2   . LEU A 1  90   ? 502.537 12.715  716.106 1.00 149.32 ? 90   LEU A CD2   1 
ATOM   687   N  N     . ASN A 1  91   ? 501.594 17.949  715.259 1.00 161.29 ? 91   ASN A N     1 
ATOM   688   C  CA    . ASN A 1  91   ? 501.412 19.403  715.266 1.00 161.79 ? 91   ASN A CA    1 
ATOM   689   C  C     . ASN A 1  91   ? 500.243 19.800  714.378 1.00 159.80 ? 91   ASN A C     1 
ATOM   690   O  O     . ASN A 1  91   ? 500.279 19.546  713.169 1.00 156.99 ? 91   ASN A O     1 
ATOM   691   C  CB    . ASN A 1  91   ? 502.660 20.113  714.764 1.00 150.80 ? 91   ASN A CB    1 
ATOM   692   C  CG    . ASN A 1  91   ? 502.539 21.637  714.820 1.00 152.19 ? 91   ASN A CG    1 
ATOM   693   O  OD1   . ASN A 1  91   ? 501.465 22.212  714.629 1.00 151.18 ? 91   ASN A OD1   1 
ATOM   694   N  ND2   . ASN A 1  91   ? 503.660 22.296  715.071 1.00 158.65 ? 91   ASN A ND2   1 
ATOM   695   N  N     . PRO A 1  92   ? 499.185 20.391  714.938 1.00 158.93 ? 92   PRO A N     1 
ATOM   696   C  CA    . PRO A 1  92   ? 498.019 20.758  714.125 1.00 160.64 ? 92   PRO A CA    1 
ATOM   697   C  C     . PRO A 1  92   ? 498.295 21.797  713.062 1.00 164.05 ? 92   PRO A C     1 
ATOM   698   O  O     . PRO A 1  92   ? 497.510 21.894  712.109 1.00 163.65 ? 92   PRO A O     1 
ATOM   699   C  CB    . PRO A 1  92   ? 497.037 21.310  715.166 1.00 163.58 ? 92   PRO A CB    1 
ATOM   700   C  CG    . PRO A 1  92   ? 497.440 20.673  716.434 1.00 164.37 ? 92   PRO A CG    1 
ATOM   701   C  CD    . PRO A 1  92   ? 498.934 20.587  716.370 1.00 163.10 ? 92   PRO A CD    1 
ATOM   702   N  N     . SER A 1  93   ? 499.373 22.574  713.174 1.00 163.89 ? 93   SER A N     1 
ATOM   703   C  CA    . SER A 1  93   ? 499.599 23.591  712.156 1.00 160.93 ? 93   SER A CA    1 
ATOM   704   C  C     . SER A 1  93   ? 500.303 23.053  710.919 1.00 159.12 ? 93   SER A C     1 
ATOM   705   O  O     . SER A 1  93   ? 500.419 23.781  709.927 1.00 160.21 ? 93   SER A O     1 
ATOM   706   C  CB    . SER A 1  93   ? 500.410 24.738  712.745 1.00 155.68 ? 93   SER A CB    1 
ATOM   707   O  OG    . SER A 1  93   ? 499.758 25.229  713.886 1.00 157.80 ? 93   SER A OG    1 
ATOM   708   N  N     . LEU A 1  94   ? 500.771 21.811  710.958 1.00 160.79 ? 94   LEU A N     1 
ATOM   709   C  CA    . LEU A 1  94   ? 501.603 21.244  709.901 1.00 160.95 ? 94   LEU A CA    1 
ATOM   710   C  C     . LEU A 1  94   ? 500.733 20.496  708.894 1.00 157.44 ? 94   LEU A C     1 
ATOM   711   O  O     . LEU A 1  94   ? 500.134 19.467  709.226 1.00 156.35 ? 94   LEU A O     1 
ATOM   712   C  CB    . LEU A 1  94   ? 502.659 20.342  710.527 1.00 161.08 ? 94   LEU A CB    1 
ATOM   713   C  CG    . LEU A 1  94   ? 503.597 19.593  709.612 1.00 154.31 ? 94   LEU A CG    1 
ATOM   714   C  CD1   . LEU A 1  94   ? 504.406 20.645  708.907 1.00 154.43 ? 94   LEU A CD1   1 
ATOM   715   C  CD2   . LEU A 1  94   ? 504.478 18.702  710.465 1.00 156.03 ? 94   LEU A CD2   1 
ATOM   716   N  N     . GLN A 1  95   ? 500.604 21.041  707.687 1.00 158.57 ? 95   GLN A N     1 
ATOM   717   C  CA    . GLN A 1  95   ? 499.772 20.398  706.685 1.00 159.29 ? 95   GLN A CA    1 
ATOM   718   C  C     . GLN A 1  95   ? 500.529 19.534  705.672 1.00 159.43 ? 95   GLN A C     1 
ATOM   719   O  O     . GLN A 1  95   ? 499.874 18.815  704.905 1.00 160.09 ? 95   GLN A O     1 
ATOM   720   C  CB    . GLN A 1  95   ? 498.920 21.442  705.949 1.00 165.19 ? 95   GLN A CB    1 
ATOM   721   C  CG    . GLN A 1  95   ? 497.911 22.150  706.860 1.00 171.50 ? 95   GLN A CG    1 
ATOM   722   C  CD    . GLN A 1  95   ? 497.110 23.236  706.148 1.00 172.43 ? 95   GLN A CD    1 
ATOM   723   O  OE1   . GLN A 1  95   ? 496.856 23.150  704.942 1.00 170.36 ? 95   GLN A OE1   1 
ATOM   724   N  NE2   . GLN A 1  95   ? 496.721 24.269  706.894 1.00 174.33 ? 95   GLN A NE2   1 
ATOM   725   N  N     . THR A 1  96   ? 501.865 19.605  705.601 1.00 156.02 ? 96   THR A N     1 
ATOM   726   C  CA    . THR A 1  96   ? 502.598 18.813  704.608 1.00 148.10 ? 96   THR A CA    1 
ATOM   727   C  C     . THR A 1  96   ? 504.030 18.487  705.059 1.00 143.31 ? 96   THR A C     1 
ATOM   728   O  O     . THR A 1  96   ? 504.685 19.306  705.717 1.00 144.07 ? 96   THR A O     1 
ATOM   729   C  CB    . THR A 1  96   ? 502.588 19.519  703.234 1.00 135.25 ? 96   THR A CB    1 
ATOM   730   O  OG1   . THR A 1  96   ? 503.389 18.792  702.295 1.00 131.44 ? 96   THR A OG1   1 
ATOM   731   C  CG2   . THR A 1  96   ? 503.076 20.964  703.324 1.00 133.29 ? 96   THR A CG2   1 
ATOM   732   N  N     . VAL A 1  97   ? 504.505 17.277  704.706 1.00 144.73 ? 97   VAL A N     1 
ATOM   733   C  CA    . VAL A 1  97   ? 505.862 16.810  705.027 1.00 148.03 ? 97   VAL A CA    1 
ATOM   734   C  C     . VAL A 1  97   ? 506.456 16.094  703.823 1.00 149.89 ? 97   VAL A C     1 
ATOM   735   O  O     . VAL A 1  97   ? 505.936 16.209  702.710 1.00 150.28 ? 97   VAL A O     1 
ATOM   736   C  CB    . VAL A 1  97   ? 505.896 15.850  706.225 1.00 151.92 ? 97   VAL A CB    1 
ATOM   737   C  CG1   . VAL A 1  97   ? 505.383 16.526  707.456 1.00 158.65 ? 97   VAL A CG1   1 
ATOM   738   C  CG2   . VAL A 1  97   ? 505.110 14.584  705.897 1.00 150.13 ? 97   VAL A CG2   1 
ATOM   739   N  N     . THR A 1  98   ? 507.550 15.354  704.026 1.00 145.68 ? 98   THR A N     1 
ATOM   740   C  CA    . THR A 1  98   ? 508.072 14.496  702.963 1.00 136.58 ? 98   THR A CA    1 
ATOM   741   C  C     . THR A 1  98   ? 508.872 13.359  703.588 1.00 135.05 ? 98   THR A C     1 
ATOM   742   O  O     . THR A 1  98   ? 509.966 13.586  704.105 1.00 137.36 ? 98   THR A O     1 
ATOM   743   C  CB    . THR A 1  98   ? 508.920 15.293  701.995 1.00 140.65 ? 98   THR A CB    1 
ATOM   744   O  OG1   . THR A 1  98   ? 508.129 16.339  701.412 1.00 141.01 ? 98   THR A OG1   1 
ATOM   745   C  CG2   . THR A 1  98   ? 509.345 14.388  700.869 1.00 142.37 ? 98   THR A CG2   1 
ATOM   746   N  N     . LEU A 1  99   ? 508.335 12.145  703.508 1.00 129.55 ? 99   LEU A N     1 
ATOM   747   C  CA    . LEU A 1  99   ? 508.986 10.937  704.009 1.00 134.02 ? 99   LEU A CA    1 
ATOM   748   C  C     . LEU A 1  99   ? 510.048 10.387  703.079 1.00 134.21 ? 99   LEU A C     1 
ATOM   749   O  O     . LEU A 1  99   ? 509.881 10.394  701.864 1.00 137.72 ? 99   LEU A O     1 
ATOM   750   C  CB    . LEU A 1  99   ? 507.950 9.849   704.233 1.00 139.44 ? 99   LEU A CB    1 
ATOM   751   C  CG    . LEU A 1  99   ? 507.201 9.833   705.552 1.00 147.11 ? 99   LEU A CG    1 
ATOM   752   C  CD1   . LEU A 1  99   ? 506.371 11.098  705.738 1.00 148.36 ? 99   LEU A CD1   1 
ATOM   753   C  CD2   . LEU A 1  99   ? 506.324 8.589   705.539 1.00 147.11 ? 99   LEU A CD2   1 
ATOM   754   N  N     . LEU A 1  100  ? 511.149 9.923   703.671 1.00 138.67 ? 100  LEU A N     1 
ATOM   755   C  CA    . LEU A 1  100  ? 512.282 9.320   702.976 1.00 136.81 ? 100  LEU A CA    1 
ATOM   756   C  C     . LEU A 1  100  ? 512.456 7.849   703.337 1.00 138.28 ? 100  LEU A C     1 
ATOM   757   O  O     . LEU A 1  100  ? 512.237 7.453   704.485 1.00 141.86 ? 100  LEU A O     1 
ATOM   758   C  CB    . LEU A 1  100  ? 513.573 10.072  703.295 1.00 141.19 ? 100  LEU A CB    1 
ATOM   759   C  CG    . LEU A 1  100  ? 513.562 11.506  702.781 1.00 142.36 ? 100  LEU A CG    1 
ATOM   760   C  CD1   . LEU A 1  100  ? 513.773 12.488  703.911 1.00 144.34 ? 100  LEU A CD1   1 
ATOM   761   C  CD2   . LEU A 1  100  ? 514.628 11.660  701.701 1.00 149.13 ? 100  LEU A CD2   1 
ATOM   762   N  N     . LEU A 1  101  ? 512.809 7.034   702.341 1.00 139.46 ? 101  LEU A N     1 
ATOM   763   C  CA    . LEU A 1  101  ? 513.040 5.606   702.537 1.00 141.22 ? 101  LEU A CA    1 
ATOM   764   C  C     . LEU A 1  101  ? 514.296 5.213   701.760 1.00 139.59 ? 101  LEU A C     1 
ATOM   765   O  O     . LEU A 1  101  ? 514.474 5.652   700.625 1.00 138.03 ? 101  LEU A O     1 
ATOM   766   C  CB    . LEU A 1  101  ? 511.823 4.783   702.063 1.00 133.33 ? 101  LEU A CB    1 
ATOM   767   C  CG    . LEU A 1  101  ? 511.693 3.283   702.368 1.00 133.84 ? 101  LEU A CG    1 
ATOM   768   C  CD1   . LEU A 1  101  ? 510.233 2.901   702.545 1.00 130.99 ? 101  LEU A CD1   1 
ATOM   769   C  CD2   . LEU A 1  101  ? 512.368 2.364   701.373 1.00 133.88 ? 101  LEU A CD2   1 
ATOM   770   N  N     . LYS A 1  102  ? 515.224 4.510   702.407 1.00 144.98 ? 102  LYS A N     1 
ATOM   771   C  CA    . LYS A 1  102  ? 516.379 3.908   701.739 1.00 152.42 ? 102  LYS A CA    1 
ATOM   772   C  C     . LYS A 1  102  ? 516.551 2.485   702.258 1.00 159.40 ? 102  LYS A C     1 
ATOM   773   O  O     . LYS A 1  102  ? 516.778 2.283   703.457 1.00 164.75 ? 102  LYS A O     1 
ATOM   774   C  CB    . LYS A 1  102  ? 517.638 4.757   701.920 1.00 164.31 ? 102  LYS A CB    1 
ATOM   775   C  CG    . LYS A 1  102  ? 517.507 6.081   701.179 1.00 166.58 ? 102  LYS A CG    1 
ATOM   776   C  CD    . LYS A 1  102  ? 518.473 7.143   701.650 1.00 174.03 ? 102  LYS A CD    1 
ATOM   777   C  CE    . LYS A 1  102  ? 518.270 8.403   700.824 1.00 171.92 ? 102  LYS A CE    1 
ATOM   778   N  NZ    . LYS A 1  102  ? 516.864 8.903   700.977 1.00 167.94 ? 102  LYS A NZ    1 
ATOM   779   N  N     . ALA A 1  103  ? 516.515 1.511   701.349 1.00 155.40 ? 103  ALA A N     1 
ATOM   780   C  CA    . ALA A 1  103  ? 516.590 0.091   701.682 1.00 154.92 ? 103  ALA A CA    1 
ATOM   781   C  C     . ALA A 1  103  ? 517.412 -0.646  700.629 1.00 149.59 ? 103  ALA A C     1 
ATOM   782   O  O     . ALA A 1  103  ? 517.565 -0.164  699.510 1.00 145.31 ? 103  ALA A O     1 
ATOM   783   C  CB    . ALA A 1  103  ? 515.184 -0.519  701.795 1.00 149.36 ? 103  ALA A CB    1 
ATOM   784   N  N     . GLU A 1  104  ? 518.029 -1.762  701.025 1.00 151.30 ? 104  GLU A N     1 
ATOM   785   C  CA    . GLU A 1  104  ? 518.746 -2.627  700.088 1.00 151.08 ? 104  GLU A CA    1 
ATOM   786   C  C     . GLU A 1  104  ? 518.676 -4.073  700.580 1.00 153.61 ? 104  GLU A C     1 
ATOM   787   O  O     . GLU A 1  104  ? 517.968 -4.386  701.538 1.00 156.82 ? 104  GLU A O     1 
ATOM   788   C  CB    . GLU A 1  104  ? 520.213 -2.182  699.994 1.00 163.09 ? 104  GLU A CB    1 
ATOM   789   C  CG    . GLU A 1  104  ? 520.640 -1.170  701.096 1.00 174.18 ? 104  GLU A CG    1 
ATOM   790   C  CD    . GLU A 1  104  ? 522.139 -0.805  701.066 1.00 181.59 ? 104  GLU A CD    1 
ATOM   791   O  OE1   . GLU A 1  104  ? 522.751 -0.920  699.984 1.00 183.33 ? 104  GLU A OE1   1 
ATOM   792   O  OE2   . GLU A 1  104  ? 522.705 -0.411  702.121 1.00 183.40 ? 104  GLU A OE2   1 
ATOM   793   N  N     . GLY A 1  105  ? 519.388 -4.968  699.896 1.00 160.11 ? 105  GLY A N     1 
ATOM   794   C  CA    . GLY A 1  105  ? 519.558 -6.341  700.324 1.00 173.18 ? 105  GLY A CA    1 
ATOM   795   C  C     . GLY A 1  105  ? 518.315 -7.202  700.348 1.00 173.51 ? 105  GLY A C     1 
ATOM   796   O  O     . GLY A 1  105  ? 517.222 -6.773  699.962 1.00 178.19 ? 105  GLY A O     1 
ATOM   797   N  N     . PRO A 1  106  ? 518.477 -8.476  700.750 1.00 187.51 ? 106  PRO A N     1 
ATOM   798   C  CA    . PRO A 1  106  ? 517.316 -9.373  700.816 1.00 191.01 ? 106  PRO A CA    1 
ATOM   799   C  C     . PRO A 1  106  ? 516.376 -8.991  701.950 1.00 189.35 ? 106  PRO A C     1 
ATOM   800   O  O     . PRO A 1  106  ? 516.335 -9.730  702.939 1.00 197.15 ? 106  PRO A O     1 
ATOM   801   C  CB    . PRO A 1  106  ? 517.950 -10.743 701.102 1.00 191.94 ? 106  PRO A CB    1 
ATOM   802   C  CG    . PRO A 1  106  ? 519.355 -10.619 700.686 1.00 194.18 ? 106  PRO A CG    1 
ATOM   803   C  CD    . PRO A 1  106  ? 519.742 -9.199  700.952 1.00 195.20 ? 106  PRO A CD    1 
ATOM   804   N  N     . LYS A 1  107  ? 515.625 -7.891  701.864 1.00 179.46 ? 107  LYS A N     1 
ATOM   805   C  CA    . LYS A 1  107  ? 514.700 -7.534  702.935 1.00 173.50 ? 107  LYS A CA    1 
ATOM   806   C  C     . LYS A 1  107  ? 513.342 -7.201  702.355 1.00 159.38 ? 107  LYS A C     1 
ATOM   807   O  O     . LYS A 1  107  ? 513.243 -6.735  701.224 1.00 155.84 ? 107  LYS A O     1 
ATOM   808   C  CB    . LYS A 1  107  ? 515.191 -6.372  703.831 1.00 180.70 ? 107  LYS A CB    1 
ATOM   809   C  CG    . LYS A 1  107  ? 514.812 -4.936  703.477 1.00 177.59 ? 107  LYS A CG    1 
ATOM   810   C  CD    . LYS A 1  107  ? 515.069 -4.099  704.748 1.00 178.45 ? 107  LYS A CD    1 
ATOM   811   C  CE    . LYS A 1  107  ? 515.404 -2.651  704.471 1.00 174.79 ? 107  LYS A CE    1 
ATOM   812   N  NZ    . LYS A 1  107  ? 515.403 -1.828  705.707 1.00 174.25 ? 107  LYS A NZ    1 
ATOM   813   N  N     . GLU A 1  108  ? 512.302 -7.382  703.155 1.00 152.41 ? 108  GLU A N     1 
ATOM   814   C  CA    . GLU A 1  108  ? 510.966 -6.956  702.769 1.00 144.41 ? 108  GLU A CA    1 
ATOM   815   C  C     . GLU A 1  108  ? 510.648 -5.637  703.450 1.00 137.52 ? 108  GLU A C     1 
ATOM   816   O  O     . GLU A 1  108  ? 510.356 -5.609  704.646 1.00 143.10 ? 108  GLU A O     1 
ATOM   817   C  CB    . GLU A 1  108  ? 509.916 -7.987  703.179 1.00 144.40 ? 108  GLU A CB    1 
ATOM   818   C  CG    . GLU A 1  108  ? 510.032 -9.377  702.612 1.00 146.92 ? 108  GLU A CG    1 
ATOM   819   C  CD    . GLU A 1  108  ? 508.937 -10.303 703.147 1.00 147.96 ? 108  GLU A CD    1 
ATOM   820   O  OE1   . GLU A 1  108  ? 508.101 -9.850  703.970 1.00 144.47 ? 108  GLU A OE1   1 
ATOM   821   O  OE2   . GLU A 1  108  ? 508.871 -11.465 702.688 1.00 150.49 ? 108  GLU A OE2   1 
ATOM   822   N  N     . VAL A 1  109  ? 510.668 -4.549  702.678 1.00 135.39 ? 109  VAL A N     1 
ATOM   823   C  CA    . VAL A 1  109  ? 510.470 -3.216  703.240 1.00 135.18 ? 109  VAL A CA    1 
ATOM   824   C  C     . VAL A 1  109  ? 509.021 -3.042  703.677 1.00 139.26 ? 109  VAL A C     1 
ATOM   825   O  O     . VAL A 1  109  ? 508.095 -3.215  702.873 1.00 138.95 ? 109  VAL A O     1 
ATOM   826   C  CB    . VAL A 1  109  ? 510.878 -2.147  702.215 1.00 133.65 ? 109  VAL A CB    1 
ATOM   827   C  CG1   . VAL A 1  109  ? 510.827 -0.755  702.807 1.00 133.97 ? 109  VAL A CG1   1 
ATOM   828   C  CG2   . VAL A 1  109  ? 512.288 -2.440  701.752 1.00 136.32 ? 109  VAL A CG2   1 
ATOM   829   N  N     . LYS A 1  110  ? 508.824 -2.627  704.938 1.00 139.96 ? 110  LYS A N     1 
ATOM   830   C  CA    . LYS A 1  110  ? 507.523 -2.297  705.503 1.00 132.82 ? 110  LYS A CA    1 
ATOM   831   C  C     . LYS A 1  110  ? 507.487 -0.803  705.814 1.00 132.75 ? 110  LYS A C     1 
ATOM   832   O  O     . LYS A 1  110  ? 508.482 -0.096  705.676 1.00 134.19 ? 110  LYS A O     1 
ATOM   833   C  CB    . LYS A 1  110  ? 507.236 -3.131  706.747 1.00 135.24 ? 110  LYS A CB    1 
ATOM   834   C  CG    . LYS A 1  110  ? 507.532 -4.605  706.621 1.00 136.39 ? 110  LYS A CG    1 
ATOM   835   C  CD    . LYS A 1  110  ? 506.627 -5.324  705.661 1.00 133.01 ? 110  LYS A CD    1 
ATOM   836   C  CE    . LYS A 1  110  ? 507.009 -6.790  705.625 1.00 134.69 ? 110  LYS A CE    1 
ATOM   837   N  NZ    . LYS A 1  110  ? 506.156 -7.636  704.759 1.00 131.80 ? 110  LYS A NZ    1 
ATOM   838   N  N     . ALA A 1  111  ? 506.359 -0.332  706.341 1.00 144.50 ? 111  ALA A N     1 
ATOM   839   C  CA    . ALA A 1  111  ? 506.256 1.093   706.652 1.00 149.39 ? 111  ALA A CA    1 
ATOM   840   C  C     . ALA A 1  111  ? 507.153 1.549   707.807 1.00 151.63 ? 111  ALA A C     1 
ATOM   841   O  O     . ALA A 1  111  ? 507.405 2.754   707.919 1.00 152.48 ? 111  ALA A O     1 
ATOM   842   C  CB    . ALA A 1  111  ? 504.793 1.447   706.948 1.00 147.83 ? 111  ALA A CB    1 
ATOM   843   N  N     . ARG A 1  112  ? 507.639 0.636   708.665 1.00 151.59 ? 112  ARG A N     1 
ATOM   844   C  CA    . ARG A 1  112  ? 508.492 1.050   709.788 1.00 151.57 ? 112  ARG A CA    1 
ATOM   845   C  C     . ARG A 1  112  ? 509.741 1.756   709.255 1.00 157.37 ? 112  ARG A C     1 
ATOM   846   O  O     . ARG A 1  112  ? 510.217 2.734   709.845 1.00 162.95 ? 112  ARG A O     1 
ATOM   847   C  CB    . ARG A 1  112  ? 508.829 -0.122  710.730 1.00 145.76 ? 112  ARG A CB    1 
ATOM   848   C  CG    . ARG A 1  112  ? 509.171 -1.441  710.081 1.00 145.53 ? 112  ARG A CG    1 
ATOM   849   C  CD    . ARG A 1  112  ? 509.096 -2.601  711.053 1.00 152.82 ? 112  ARG A CD    1 
ATOM   850   N  NE    . ARG A 1  112  ? 507.722 -3.057  711.239 1.00 155.94 ? 112  ARG A NE    1 
ATOM   851   C  CZ    . ARG A 1  112  ? 507.071 -3.071  712.405 1.00 162.12 ? 112  ARG A CZ    1 
ATOM   852   N  NH1   . ARG A 1  112  ? 505.810 -3.501  712.461 1.00 160.99 ? 112  ARG A NH1   1 
ATOM   853   N  NH2   . ARG A 1  112  ? 507.675 -2.674  713.523 1.00 167.31 ? 112  ARG A NH2   1 
ATOM   854   N  N     . ASP A 1  113  ? 510.264 1.284   708.114 1.00 153.32 ? 113  ASP A N     1 
ATOM   855   C  CA    . ASP A 1  113  ? 511.575 1.606   707.570 1.00 150.46 ? 113  ASP A CA    1 
ATOM   856   C  C     . ASP A 1  113  ? 511.671 3.049   707.109 1.00 150.27 ? 113  ASP A C     1 
ATOM   857   O  O     . ASP A 1  113  ? 512.770 3.488   706.755 1.00 157.89 ? 113  ASP A O     1 
ATOM   858   C  CB    . ASP A 1  113  ? 511.906 0.718   706.365 1.00 143.38 ? 113  ASP A CB    1 
ATOM   859   C  CG    . ASP A 1  113  ? 511.863 -0.755  706.681 1.00 143.80 ? 113  ASP A CG    1 
ATOM   860   O  OD1   . ASP A 1  113  ? 510.802 -1.365  706.473 1.00 141.28 ? 113  ASP A OD1   1 
ATOM   861   O  OD2   . ASP A 1  113  ? 512.888 -1.311  707.112 1.00 148.32 ? 113  ASP A OD2   1 
ATOM   862   N  N     . PHE A 1  114  ? 510.559 3.778   707.059 1.00 143.60 ? 114  PHE A N     1 
ATOM   863   C  CA    . PHE A 1  114  ? 510.639 5.194   706.741 1.00 144.06 ? 114  PHE A CA    1 
ATOM   864   C  C     . PHE A 1  114  ? 511.493 5.879   707.794 1.00 146.56 ? 114  PHE A C     1 
ATOM   865   O  O     . PHE A 1  114  ? 511.380 5.605   708.988 1.00 145.76 ? 114  PHE A O     1 
ATOM   866   C  CB    . PHE A 1  114  ? 509.254 5.812   706.689 1.00 147.90 ? 114  PHE A CB    1 
ATOM   867   C  CG    . PHE A 1  114  ? 508.528 5.565   705.391 1.00 148.31 ? 114  PHE A CG    1 
ATOM   868   C  CD1   . PHE A 1  114  ? 507.407 4.733   705.358 1.00 147.17 ? 114  PHE A CD1   1 
ATOM   869   C  CD2   . PHE A 1  114  ? 508.985 6.126   704.206 1.00 149.00 ? 114  PHE A CD2   1 
ATOM   870   C  CE1   . PHE A 1  114  ? 506.732 4.496   704.178 1.00 146.19 ? 114  PHE A CE1   1 
ATOM   871   C  CE2   . PHE A 1  114  ? 508.318 5.885   703.009 1.00 149.31 ? 114  PHE A CE2   1 
ATOM   872   C  CZ    . PHE A 1  114  ? 507.191 5.066   702.992 1.00 147.26 ? 114  PHE A CZ    1 
ATOM   873   N  N     . LEU A 1  115  ? 512.381 6.741   707.336 1.00 152.16 ? 115  LEU A N     1 
ATOM   874   C  CA    . LEU A 1  115  ? 513.240 7.495   708.231 1.00 154.49 ? 115  LEU A CA    1 
ATOM   875   C  C     . LEU A 1  115  ? 512.405 8.431   709.095 1.00 152.76 ? 115  LEU A C     1 
ATOM   876   O  O     . LEU A 1  115  ? 511.643 9.249   708.553 1.00 145.42 ? 115  LEU A O     1 
ATOM   877   C  CB    . LEU A 1  115  ? 514.274 8.264   707.405 1.00 154.23 ? 115  LEU A CB    1 
ATOM   878   C  CG    . LEU A 1  115  ? 515.381 7.395   706.754 1.00 151.85 ? 115  LEU A CG    1 
ATOM   879   C  CD1   . LEU A 1  115  ? 516.407 8.216   705.962 1.00 152.15 ? 115  LEU A CD1   1 
ATOM   880   C  CD2   . LEU A 1  115  ? 516.068 6.426   707.696 1.00 153.74 ? 115  LEU A CD2   1 
ATOM   881   N  N     . PRO A 1  116  ? 512.485 8.300   710.425 1.00 156.94 ? 116  PRO A N     1 
ATOM   882   C  CA    . PRO A 1  116  ? 511.627 9.065   711.355 1.00 157.54 ? 116  PRO A CA    1 
ATOM   883   C  C     . PRO A 1  116  ? 511.718 10.590  711.275 1.00 154.98 ? 116  PRO A C     1 
ATOM   884   O  O     . PRO A 1  116  ? 512.810 11.168  711.256 1.00 153.92 ? 116  PRO A O     1 
ATOM   885   C  CB    . PRO A 1  116  ? 512.096 8.568   712.727 1.00 155.44 ? 116  PRO A CB    1 
ATOM   886   C  CG    . PRO A 1  116  ? 512.648 7.197   712.463 1.00 155.98 ? 116  PRO A CG    1 
ATOM   887   C  CD    . PRO A 1  116  ? 513.325 7.315   711.129 1.00 158.17 ? 116  PRO A CD    1 
ATOM   888   N  N     . VAL A 1  117  ? 510.548 11.245  711.323 1.00 149.58 ? 117  VAL A N     1 
ATOM   889   C  CA    . VAL A 1  117  ? 510.445 12.704  711.318 1.00 149.77 ? 117  VAL A CA    1 
ATOM   890   C  C     . VAL A 1  117  ? 509.637 13.132  712.535 1.00 165.80 ? 117  VAL A C     1 
ATOM   891   O  O     . VAL A 1  117  ? 508.720 12.426  712.964 1.00 168.19 ? 117  VAL A O     1 
ATOM   892   C  CB    . VAL A 1  117  ? 509.810 13.279  710.036 1.00 145.96 ? 117  VAL A CB    1 
ATOM   893   C  CG1   . VAL A 1  117  ? 509.686 14.810  710.136 1.00 146.57 ? 117  VAL A CG1   1 
ATOM   894   C  CG2   . VAL A 1  117  ? 510.620 12.886  708.805 1.00 165.30 ? 117  VAL A CG2   1 
ATOM   895   N  N     . ALA A 1  118  ? 510.027 14.256  713.130 1.00 164.61 ? 118  ALA A N     1 
ATOM   896   C  CA    . ALA A 1  118  ? 509.367 14.769  714.321 1.00 166.11 ? 118  ALA A CA    1 
ATOM   897   C  C     . ALA A 1  118  ? 507.918 15.129  714.038 1.00 168.91 ? 118  ALA A C     1 
ATOM   898   O  O     . ALA A 1  118  ? 507.562 15.572  712.942 1.00 169.53 ? 118  ALA A O     1 
ATOM   899   C  CB    . ALA A 1  118  ? 510.089 16.000  714.853 1.00 171.00 ? 118  ALA A CB    1 
ATOM   900   N  N     . ASP A 1  119  ? 507.079 14.908  715.042 1.00 168.71 ? 119  ASP A N     1 
ATOM   901   C  CA    . ASP A 1  119  ? 505.644 15.171  714.990 1.00 166.58 ? 119  ASP A CA    1 
ATOM   902   C  C     . ASP A 1  119  ? 504.902 14.360  713.929 1.00 156.98 ? 119  ASP A C     1 
ATOM   903   O  O     . ASP A 1  119  ? 503.862 14.806  713.432 1.00 147.68 ? 119  ASP A O     1 
ATOM   904   C  CB    . ASP A 1  119  ? 505.381 16.670  714.778 1.00 174.30 ? 119  ASP A CB    1 
ATOM   905   C  CG    . ASP A 1  119  ? 505.795 17.524  715.983 1.00 183.99 ? 119  ASP A CG    1 
ATOM   906   O  OD1   . ASP A 1  119  ? 506.005 16.971  717.093 1.00 186.44 ? 119  ASP A OD1   1 
ATOM   907   O  OD2   . ASP A 1  119  ? 505.925 18.757  715.808 1.00 186.35 ? 119  ASP A OD2   1 
ATOM   908   N  N     . VAL A 1  120  ? 505.433 13.205  713.522 1.00 155.59 ? 120  VAL A N     1 
ATOM   909   C  CA    . VAL A 1  120  ? 504.773 12.340  712.545 1.00 153.27 ? 120  VAL A CA    1 
ATOM   910   C  C     . VAL A 1  120  ? 504.925 10.889  712.997 1.00 143.96 ? 120  VAL A C     1 
ATOM   911   O  O     . VAL A 1  120  ? 506.045 10.417  713.225 1.00 146.05 ? 120  VAL A O     1 
ATOM   912   C  CB    . VAL A 1  120  ? 505.250 12.535  711.099 1.00 151.40 ? 120  VAL A CB    1 
ATOM   913   C  CG1   . VAL A 1  120  ? 504.899 13.940  710.624 1.00 150.82 ? 120  VAL A CG1   1 
ATOM   914   C  CG2   . VAL A 1  120  ? 506.705 12.276  710.967 1.00 155.66 ? 120  VAL A CG2   1 
ATOM   915   N  N     . GLU A 1  121  ? 503.802 10.202  713.169 1.00 143.30 ? 121  GLU A N     1 
ATOM   916   C  CA    . GLU A 1  121  ? 503.758 8.824   713.634 1.00 146.08 ? 121  GLU A CA    1 
ATOM   917   C  C     . GLU A 1  121  ? 503.078 7.979   712.571 1.00 142.52 ? 121  GLU A C     1 
ATOM   918   O  O     . GLU A 1  121  ? 501.952 8.283   712.156 1.00 141.35 ? 121  GLU A O     1 
ATOM   919   C  CB    . GLU A 1  121  ? 503.004 8.719   714.964 1.00 149.09 ? 121  GLU A CB    1 
ATOM   920   C  CG    . GLU A 1  121  ? 502.891 7.311   715.518 1.00 154.38 ? 121  GLU A CG    1 
ATOM   921   C  CD    . GLU A 1  121  ? 501.905 7.212   716.671 1.00 160.11 ? 121  GLU A CD    1 
ATOM   922   O  OE1   . GLU A 1  121  ? 501.388 8.258   717.135 1.00 161.49 ? 121  GLU A OE1   1 
ATOM   923   O  OE2   . GLU A 1  121  ? 501.603 6.074   717.076 1.00 162.56 ? 121  GLU A OE2   1 
ATOM   924   N  N     . ILE A 1  122  ? 503.707 6.859   712.225 1.00 142.29 ? 122  ILE A N     1 
ATOM   925   C  CA    . ILE A 1  122  ? 503.152 5.943   711.240 1.00 136.30 ? 122  ILE A CA    1 
ATOM   926   C  C     . ILE A 1  122  ? 502.271 4.943   711.967 1.00 136.78 ? 122  ILE A C     1 
ATOM   927   O  O     . ILE A 1  122  ? 502.745 4.075   712.699 1.00 139.24 ? 122  ILE A O     1 
ATOM   928   C  CB    . ILE A 1  122  ? 504.254 5.239   710.438 1.00 136.03 ? 122  ILE A CB    1 
ATOM   929   C  CG1   . ILE A 1  122  ? 504.799 6.161   709.344 1.00 134.40 ? 122  ILE A CG1   1 
ATOM   930   C  CG2   . ILE A 1  122  ? 503.760 3.928   709.850 1.00 133.95 ? 122  ILE A CG2   1 
ATOM   931   C  CD1   . ILE A 1  122  ? 505.836 7.152   709.775 1.00 137.11 ? 122  ILE A CD1   1 
ATOM   932   N  N     . MET A 1  123  ? 500.974 5.052   711.717 1.00 134.46 ? 123  MET A N     1 
ATOM   933   C  CA    . MET A 1  123  ? 499.981 4.296   712.452 1.00 139.69 ? 123  MET A CA    1 
ATOM   934   C  C     . MET A 1  123  ? 499.944 2.821   712.072 1.00 141.43 ? 123  MET A C     1 
ATOM   935   O  O     . MET A 1  123  ? 499.450 2.008   712.853 1.00 147.81 ? 123  MET A O     1 
ATOM   936   C  CB    . MET A 1  123  ? 498.627 4.967   712.261 1.00 139.39 ? 123  MET A CB    1 
ATOM   937   C  CG    . MET A 1  123  ? 498.701 6.473   712.489 1.00 143.31 ? 123  MET A CG    1 
ATOM   938   S  SD    . MET A 1  123  ? 499.197 6.869   714.192 1.00 148.45 ? 123  MET A SD    1 
ATOM   939   C  CE    . MET A 1  123  ? 498.056 5.872   715.151 1.00 144.36 ? 123  MET A CE    1 
ATOM   940   N  N     . ASN A 1  124  ? 500.459 2.442   710.917 1.00 138.92 ? 124  ASN A N     1 
ATOM   941   C  CA    . ASN A 1  124  ? 500.510 1.039   710.511 1.00 139.12 ? 124  ASN A CA    1 
ATOM   942   C  C     . ASN A 1  124  ? 501.929 0.677   710.084 1.00 144.55 ? 124  ASN A C     1 
ATOM   943   O  O     . ASN A 1  124  ? 502.235 0.584   708.887 1.00 148.70 ? 124  ASN A O     1 
ATOM   944   C  CB    . ASN A 1  124  ? 499.453 0.737   709.435 1.00 137.32 ? 124  ASN A CB    1 
ATOM   945   C  CG    . ASN A 1  124  ? 499.518 1.675   708.213 1.00 129.41 ? 124  ASN A CG    1 
ATOM   946   O  OD1   . ASN A 1  124  ? 500.118 2.750   708.269 1.00 130.44 ? 124  ASN A OD1   1 
ATOM   947   N  ND2   . ASN A 1  124  ? 498.885 1.258   707.104 1.00 121.15 ? 124  ASN A ND2   1 
ATOM   948   N  N     . PRO A 1  125  ? 502.844 0.512   711.044 1.00 143.38 ? 125  PRO A N     1 
ATOM   949   C  CA    . PRO A 1  125  ? 504.242 0.257   710.685 1.00 143.48 ? 125  PRO A CA    1 
ATOM   950   C  C     . PRO A 1  125  ? 504.487 -1.125  710.118 1.00 142.89 ? 125  PRO A C     1 
ATOM   951   O  O     . PRO A 1  125  ? 505.605 -1.402  709.681 1.00 144.71 ? 125  PRO A O     1 
ATOM   952   C  CB    . PRO A 1  125  ? 504.978 0.421   712.021 1.00 145.68 ? 125  PRO A CB    1 
ATOM   953   C  CG    . PRO A 1  125  ? 503.906 0.577   713.066 1.00 146.44 ? 125  PRO A CG    1 
ATOM   954   C  CD    . PRO A 1  125  ? 502.606 0.191   712.447 1.00 139.02 ? 125  PRO A CD    1 
ATOM   955   N  N     . ASP A 1  126  ? 503.484 -1.989  710.084 1.00 147.46 ? 126  ASP A N     1 
ATOM   956   C  CA    . ASP A 1  126  ? 503.631 -3.351  709.590 1.00 153.30 ? 126  ASP A CA    1 
ATOM   957   C  C     . ASP A 1  126  ? 503.292 -3.514  708.113 1.00 152.83 ? 126  ASP A C     1 
ATOM   958   O  O     . ASP A 1  126  ? 503.590 -4.566  707.533 1.00 151.89 ? 126  ASP A O     1 
ATOM   959   C  CB    . ASP A 1  126  ? 502.731 -4.302  710.382 1.00 161.04 ? 126  ASP A CB    1 
ATOM   960   C  CG    . ASP A 1  126  ? 503.437 -5.564  710.771 1.00 170.49 ? 126  ASP A CG    1 
ATOM   961   O  OD1   . ASP A 1  126  ? 504.413 -5.908  710.063 1.00 174.02 ? 126  ASP A OD1   1 
ATOM   962   O  OD2   . ASP A 1  126  ? 502.973 -6.258  711.700 1.00 176.67 ? 126  ASP A OD2   1 
ATOM   963   N  N     . LEU A 1  127  ? 502.761 -2.473  707.487 1.00 149.87 ? 127  LEU A N     1 
ATOM   964   C  CA    . LEU A 1  127  ? 502.315 -2.514  706.101 1.00 146.20 ? 127  LEU A CA    1 
ATOM   965   C  C     . LEU A 1  127  ? 503.429 -2.855  705.125 1.00 151.78 ? 127  LEU A C     1 
ATOM   966   O  O     . LEU A 1  127  ? 504.496 -2.240  705.143 1.00 158.32 ? 127  LEU A O     1 
ATOM   967   C  CB    . LEU A 1  127  ? 501.666 -1.175  705.767 1.00 138.94 ? 127  LEU A CB    1 
ATOM   968   C  CG    . LEU A 1  127  ? 501.241 -0.810  704.363 1.00 130.04 ? 127  LEU A CG    1 
ATOM   969   C  CD1   . LEU A 1  127  ? 499.850 -1.338  704.156 1.00 128.14 ? 127  LEU A CD1   1 
ATOM   970   C  CD2   . LEU A 1  127  ? 501.227 0.705   704.280 1.00 126.34 ? 127  LEU A CD2   1 
ATOM   971   N  N     . HIS A 1  128  ? 503.175 -3.845  704.270 1.00 149.08 ? 128  HIS A N     1 
ATOM   972   C  CA    . HIS A 1  128  ? 504.168 -4.230  703.273 1.00 148.89 ? 128  HIS A CA    1 
ATOM   973   C  C     . HIS A 1  128  ? 504.275 -3.193  702.159 1.00 143.57 ? 128  HIS A C     1 
ATOM   974   O  O     . HIS A 1  128  ? 503.268 -2.668  701.674 1.00 140.76 ? 128  HIS A O     1 
ATOM   975   C  CB    . HIS A 1  128  ? 503.829 -5.583  702.651 1.00 151.85 ? 128  HIS A CB    1 
ATOM   976   C  CG    . HIS A 1  128  ? 504.884 -6.077  701.710 1.00 153.79 ? 128  HIS A CG    1 
ATOM   977   N  ND1   . HIS A 1  128  ? 505.840 -6.999  702.072 1.00 157.69 ? 128  HIS A ND1   1 
ATOM   978   C  CD2   . HIS A 1  128  ? 505.156 -5.741  700.427 1.00 152.46 ? 128  HIS A CD2   1 
ATOM   979   C  CE1   . HIS A 1  128  ? 506.647 -7.221  701.051 1.00 156.91 ? 128  HIS A CE1   1 
ATOM   980   N  NE2   . HIS A 1  128  ? 506.254 -6.471  700.039 1.00 154.19 ? 128  HIS A NE2   1 
ATOM   981   N  N     . ILE A 1  129  ? 505.512 -2.924  701.727 1.00 139.69 ? 129  ILE A N     1 
ATOM   982   C  CA    . ILE A 1  129  ? 505.732 -1.944  700.670 1.00 137.17 ? 129  ILE A CA    1 
ATOM   983   C  C     . ILE A 1  129  ? 506.325 -2.585  699.420 1.00 140.03 ? 129  ILE A C     1 
ATOM   984   O  O     . ILE A 1  129  ? 505.688 -2.582  698.360 1.00 142.12 ? 129  ILE A O     1 
ATOM   985   C  CB    . ILE A 1  129  ? 506.646 -0.807  701.154 1.00 132.73 ? 129  ILE A CB    1 
ATOM   986   C  CG1   . ILE A 1  129  ? 505.959 0.009   702.239 1.00 131.45 ? 129  ILE A CG1   1 
ATOM   987   C  CG2   . ILE A 1  129  ? 506.966 0.116   699.995 1.00 129.79 ? 129  ILE A CG2   1 
ATOM   988   C  CD1   . ILE A 1  129  ? 504.520 0.280   701.958 1.00 128.49 ? 129  ILE A CD1   1 
ATOM   989   N  N     . ALA A 1  130  ? 507.535 -3.145  699.523 1.00 143.28 ? 130  ALA A N     1 
ATOM   990   C  CA    . ALA A 1  130  ? 508.135 -3.860  698.401 1.00 141.83 ? 130  ALA A CA    1 
ATOM   991   C  C     . ALA A 1  130  ? 508.965 -5.035  698.887 1.00 148.09 ? 130  ALA A C     1 
ATOM   992   O  O     . ALA A 1  130  ? 509.644 -4.928  699.907 1.00 157.43 ? 130  ALA A O     1 
ATOM   993   C  CB    . ALA A 1  130  ? 509.040 -2.920  697.602 1.00 141.44 ? 130  ALA A CB    1 
ATOM   994   N  N     . THR A 1  131  ? 508.976 -6.132  698.131 1.00 144.03 ? 131  THR A N     1 
ATOM   995   C  CA    . THR A 1  131  ? 509.891 -7.221  698.449 1.00 145.67 ? 131  THR A CA    1 
ATOM   996   C  C     . THR A 1  131  ? 511.163 -7.055  697.628 1.00 144.97 ? 131  THR A C     1 
ATOM   997   O  O     . THR A 1  131  ? 511.129 -7.125  696.399 1.00 150.36 ? 131  THR A O     1 
ATOM   998   C  CB    . THR A 1  131  ? 509.254 -8.589  698.206 1.00 150.04 ? 131  THR A CB    1 
ATOM   999   O  OG1   . THR A 1  131  ? 508.281 -8.852  699.226 1.00 151.21 ? 131  THR A OG1   1 
ATOM   1000  C  CG2   . THR A 1  131  ? 510.320 -9.687  698.261 1.00 156.54 ? 131  THR A CG2   1 
ATOM   1001  N  N     . LEU A 1  132  ? 512.288 -6.892  698.300 1.00 143.74 ? 132  LEU A N     1 
ATOM   1002  C  CA    . LEU A 1  132  ? 513.561 -6.700  697.623 1.00 145.19 ? 132  LEU A CA    1 
ATOM   1003  C  C     . LEU A 1  132  ? 514.405 -7.970  697.723 1.00 148.20 ? 132  LEU A C     1 
ATOM   1004  O  O     . LEU A 1  132  ? 514.278 -8.746  698.672 1.00 151.91 ? 132  LEU A O     1 
ATOM   1005  C  CB    . LEU A 1  132  ? 514.304 -5.481  698.180 1.00 137.52 ? 132  LEU A CB    1 
ATOM   1006  C  CG    . LEU A 1  132  ? 513.925 -4.172  697.466 1.00 134.47 ? 132  LEU A CG    1 
ATOM   1007  C  CD1   . LEU A 1  132  ? 512.454 -3.856  697.654 1.00 130.74 ? 132  LEU A CD1   1 
ATOM   1008  C  CD2   . LEU A 1  132  ? 514.770 -2.980  697.879 1.00 136.62 ? 132  LEU A CD2   1 
ATOM   1009  N  N     . GLU A 1  133  ? 515.268 -8.179  696.737 1.00 146.47 ? 133  GLU A N     1 
ATOM   1010  C  CA    . GLU A 1  133  ? 516.046 -9.399  696.545 1.00 145.75 ? 133  GLU A CA    1 
ATOM   1011  C  C     . GLU A 1  133  ? 517.506 -8.974  696.557 1.00 148.89 ? 133  GLU A C     1 
ATOM   1012  O  O     . GLU A 1  133  ? 517.803 -7.780  696.475 1.00 146.93 ? 133  GLU A O     1 
ATOM   1013  C  CB    . GLU A 1  133  ? 515.638 -10.061 695.223 1.00 142.64 ? 133  GLU A CB    1 
ATOM   1014  C  CG    . GLU A 1  133  ? 516.758 -10.173 694.170 1.00 145.33 ? 133  GLU A CG    1 
ATOM   1015  C  CD    . GLU A 1  133  ? 516.222 -10.276 692.759 1.00 144.09 ? 133  GLU A CD    1 
ATOM   1016  O  OE1   . GLU A 1  133  ? 515.300 -9.501  692.444 1.00 135.66 ? 133  GLU A OE1   1 
ATOM   1017  O  OE2   . GLU A 1  133  ? 516.717 -11.070 691.941 1.00 146.92 ? 133  GLU A OE2   1 
ATOM   1018  N  N     . GLU A 1  134  ? 518.429 -9.936  696.668 1.00 154.15 ? 134  GLU A N     1 
ATOM   1019  C  CA    . GLU A 1  134  ? 519.846 -9.574  696.711 1.00 163.12 ? 134  GLU A CA    1 
ATOM   1020  C  C     . GLU A 1  134  ? 520.182 -8.680  695.538 1.00 158.04 ? 134  GLU A C     1 
ATOM   1021  O  O     . GLU A 1  134  ? 519.975 -9.044  694.375 1.00 158.20 ? 134  GLU A O     1 
ATOM   1022  C  CB    . GLU A 1  134  ? 520.743 -10.814 696.711 1.00 167.31 ? 134  GLU A CB    1 
ATOM   1023  C  CG    . GLU A 1  134  ? 521.422 -11.052 698.065 1.00 171.27 ? 134  GLU A CG    1 
ATOM   1024  C  CD    . GLU A 1  134  ? 522.448 -9.991  698.402 1.00 175.59 ? 134  GLU A CD    1 
ATOM   1025  O  OE1   . GLU A 1  134  ? 522.674 -9.738  699.606 1.00 178.34 ? 134  GLU A OE1   1 
ATOM   1026  O  OE2   . GLU A 1  134  ? 523.026 -9.408  697.464 1.00 176.29 ? 134  GLU A OE2   1 
ATOM   1027  N  N     . GLY A 1  135  ? 520.710 -7.505  695.867 1.00 154.99 ? 135  GLY A N     1 
ATOM   1028  C  CA    . GLY A 1  135  ? 521.007 -6.488  694.893 1.00 153.74 ? 135  GLY A CA    1 
ATOM   1029  C  C     . GLY A 1  135  ? 519.863 -5.521  694.659 1.00 159.05 ? 135  GLY A C     1 
ATOM   1030  O  O     . GLY A 1  135  ? 520.057 -4.508  693.977 1.00 157.95 ? 135  GLY A O     1 
ATOM   1031  N  N     . GLY A 1  136  ? 518.688 -5.821  695.210 1.00 157.64 ? 136  GLY A N     1 
ATOM   1032  C  CA    . GLY A 1  136  ? 517.518 -4.953  695.115 1.00 155.53 ? 136  GLY A CA    1 
ATOM   1033  C  C     . GLY A 1  136  ? 517.703 -3.685  695.935 1.00 164.68 ? 136  GLY A C     1 
ATOM   1034  O  O     . GLY A 1  136  ? 518.061 -3.751  697.117 1.00 174.72 ? 136  GLY A O     1 
ATOM   1035  N  N     . ARG A 1  137  ? 517.462 -2.522  695.322 1.00 166.38 ? 137  ARG A N     1 
ATOM   1036  C  CA    . ARG A 1  137  ? 517.647 -1.246  696.012 1.00 166.68 ? 137  ARG A CA    1 
ATOM   1037  C  C     . ARG A 1  137  ? 516.337 -0.448  695.994 1.00 168.27 ? 137  ARG A C     1 
ATOM   1038  O  O     . ARG A 1  137  ? 515.373 -0.825  695.327 1.00 174.20 ? 137  ARG A O     1 
ATOM   1039  C  CB    . ARG A 1  137  ? 518.753 -0.431  695.327 1.00 168.60 ? 137  ARG A CB    1 
ATOM   1040  C  CG    . ARG A 1  137  ? 520.153 -1.059  695.334 1.00 175.02 ? 137  ARG A CG    1 
ATOM   1041  C  CD    . ARG A 1  137  ? 520.782 -1.244  696.710 1.00 180.40 ? 137  ARG A CD    1 
ATOM   1042  N  NE    . ARG A 1  137  ? 522.204 -1.601  696.609 1.00 185.49 ? 137  ARG A NE    1 
ATOM   1043  C  CZ    . ARG A 1  137  ? 522.753 -2.735  697.048 1.00 186.56 ? 137  ARG A CZ    1 
ATOM   1044  N  NH1   . ARG A 1  137  ? 522.010 -3.666  697.632 1.00 184.34 ? 137  ARG A NH1   1 
ATOM   1045  N  NH2   . ARG A 1  137  ? 524.057 -2.940  696.894 1.00 190.01 ? 137  ARG A NH2   1 
ATOM   1046  N  N     . LEU A 1  138  ? 516.282 0.643   696.779 1.00 157.70 ? 138  LEU A N     1 
ATOM   1047  C  CA    . LEU A 1  138  ? 515.106 1.520   696.832 1.00 146.59 ? 138  LEU A CA    1 
ATOM   1048  C  C     . LEU A 1  138  ? 515.304 2.824   697.606 1.00 151.47 ? 138  LEU A C     1 
ATOM   1049  O  O     . LEU A 1  138  ? 515.523 2.793   698.819 1.00 164.83 ? 138  LEU A O     1 
ATOM   1050  C  CB    . LEU A 1  138  ? 513.923 0.767   697.434 1.00 137.20 ? 138  LEU A CB    1 
ATOM   1051  C  CG    . LEU A 1  138  ? 512.656 1.617   697.381 1.00 128.28 ? 138  LEU A CG    1 
ATOM   1052  C  CD1   . LEU A 1  138  ? 512.447 2.097   695.981 1.00 127.77 ? 138  LEU A CD1   1 
ATOM   1053  C  CD2   . LEU A 1  138  ? 511.423 0.849   697.873 1.00 126.30 ? 138  LEU A CD2   1 
ATOM   1054  N  N     . ASN A 1  139  ? 515.282 3.969   696.919 1.00 145.27 ? 139  ASN A N     1 
ATOM   1055  C  CA    . ASN A 1  139  ? 515.418 5.292   697.537 1.00 147.97 ? 139  ASN A CA    1 
ATOM   1056  C  C     . ASN A 1  139  ? 514.285 6.200   697.073 1.00 136.17 ? 139  ASN A C     1 
ATOM   1057  O  O     . ASN A 1  139  ? 514.259 6.575   695.900 1.00 138.11 ? 139  ASN A O     1 
ATOM   1058  C  CB    . ASN A 1  139  ? 516.791 5.893   697.199 1.00 161.73 ? 139  ASN A CB    1 
ATOM   1059  C  CG    . ASN A 1  139  ? 516.890 7.391   697.500 1.00 170.70 ? 139  ASN A CG    1 
ATOM   1060  O  OD1   . ASN A 1  139  ? 516.244 7.909   698.414 1.00 175.78 ? 139  ASN A OD1   1 
ATOM   1061  N  ND2   . ASN A 1  139  ? 517.733 8.087   696.737 1.00 171.02 ? 139  ASN A ND2   1 
ATOM   1062  N  N     . MET A 1  140  ? 513.362 6.588   697.964 1.00 130.01 ? 140  MET A N     1 
ATOM   1063  C  CA    . MET A 1  140  ? 512.223 7.381   697.497 1.00 128.11 ? 140  MET A CA    1 
ATOM   1064  C  C     . MET A 1  140  ? 511.850 8.511   698.443 1.00 127.25 ? 140  MET A C     1 
ATOM   1065  O  O     . MET A 1  140  ? 512.316 8.580   699.576 1.00 132.15 ? 140  MET A O     1 
ATOM   1066  C  CB    . MET A 1  140  ? 510.990 6.514   697.235 1.00 127.03 ? 140  MET A CB    1 
ATOM   1067  C  CG    . MET A 1  140  ? 510.499 5.588   698.306 1.00 132.77 ? 140  MET A CG    1 
ATOM   1068  S  SD    . MET A 1  140  ? 509.047 4.825   697.528 1.00 136.67 ? 140  MET A SD    1 
ATOM   1069  C  CE    . MET A 1  140  ? 508.714 3.391   698.536 1.00 142.05 ? 140  MET A CE    1 
ATOM   1070  N  N     . GLU A 1  141  ? 511.079 9.459   697.900 1.00 124.78 ? 141  GLU A N     1 
ATOM   1071  C  CA    . GLU A 1  141  ? 510.523 10.597  698.629 1.00 124.95 ? 141  GLU A CA    1 
ATOM   1072  C  C     . GLU A 1  141  ? 509.026 10.682  698.393 1.00 126.19 ? 141  GLU A C     1 
ATOM   1073  O  O     . GLU A 1  141  ? 508.593 10.950  697.271 1.00 133.59 ? 141  GLU A O     1 
ATOM   1074  C  CB    . GLU A 1  141  ? 511.205 11.914  698.252 1.00 140.00 ? 141  GLU A CB    1 
ATOM   1075  C  CG    . GLU A 1  141  ? 512.726 11.876  698.283 1.00 142.88 ? 141  GLU A CG    1 
ATOM   1076  C  CD    . GLU A 1  141  ? 513.333 13.179  697.805 1.00 151.78 ? 141  GLU A CD    1 
ATOM   1077  O  OE1   . GLU A 1  141  ? 512.541 14.064  697.410 1.00 154.98 ? 141  GLU A OE1   1 
ATOM   1078  O  OE2   . GLU A 1  141  ? 514.575 13.347  697.894 1.00 153.00 ? 141  GLU A OE2   1 
ATOM   1079  N  N     . VAL A 1  142  ? 508.238 10.473  699.444 1.00 123.37 ? 142  VAL A N     1 
ATOM   1080  C  CA    . VAL A 1  142  ? 506.778 10.550  699.387 1.00 125.49 ? 142  VAL A CA    1 
ATOM   1081  C  C     . VAL A 1  142  ? 506.255 11.798  700.104 1.00 128.17 ? 142  VAL A C     1 
ATOM   1082  O  O     . VAL A 1  142  ? 506.559 12.007  701.281 1.00 136.35 ? 142  VAL A O     1 
ATOM   1083  C  CB    . VAL A 1  142  ? 506.153 9.277   699.976 1.00 129.25 ? 142  VAL A CB    1 
ATOM   1084  C  CG1   . VAL A 1  142  ? 506.124 8.196   698.929 1.00 135.09 ? 142  VAL A CG1   1 
ATOM   1085  C  CG2   . VAL A 1  142  ? 506.987 8.783   701.113 1.00 130.80 ? 142  VAL A CG2   1 
ATOM   1086  N  N     . ARG A 1  143  ? 505.493 12.639  699.394 1.00 123.32 ? 143  ARG A N     1 
ATOM   1087  C  CA    . ARG A 1  143  ? 504.873 13.832  699.966 1.00 117.80 ? 143  ARG A CA    1 
ATOM   1088  C  C     . ARG A 1  143  ? 503.494 13.468  700.491 1.00 127.55 ? 143  ARG A C     1 
ATOM   1089  O  O     . ARG A 1  143  ? 502.631 13.031  699.720 1.00 129.90 ? 143  ARG A O     1 
ATOM   1090  C  CB    . ARG A 1  143  ? 504.749 14.964  698.956 1.00 116.45 ? 143  ARG A CB    1 
ATOM   1091  C  CG    . ARG A 1  143  ? 503.791 16.032  699.375 1.00 116.33 ? 143  ARG A CG    1 
ATOM   1092  C  CD    . ARG A 1  143  ? 503.971 17.304  698.588 1.00 128.34 ? 143  ARG A CD    1 
ATOM   1093  N  NE    . ARG A 1  143  ? 502.894 18.249  698.865 1.00 135.72 ? 143  ARG A NE    1 
ATOM   1094  C  CZ    . ARG A 1  143  ? 502.813 19.484  698.376 1.00 139.34 ? 143  ARG A CZ    1 
ATOM   1095  N  NH1   . ARG A 1  143  ? 503.760 19.960  697.569 1.00 139.68 ? 143  ARG A NH1   1 
ATOM   1096  N  NH2   . ARG A 1  143  ? 501.775 20.248  698.705 1.00 140.68 ? 143  ARG A NH2   1 
ATOM   1097  N  N     . VAL A 1  144  ? 503.298 13.649  701.799 1.00 136.06 ? 144  VAL A N     1 
ATOM   1098  C  CA    . VAL A 1  144  ? 502.037 13.409  702.499 1.00 127.38 ? 144  VAL A CA    1 
ATOM   1099  C  C     . VAL A 1  144  ? 501.397 14.734  702.906 1.00 125.38 ? 144  VAL A C     1 
ATOM   1100  O  O     . VAL A 1  144  ? 502.081 15.607  703.456 1.00 124.04 ? 144  VAL A O     1 
ATOM   1101  C  CB    . VAL A 1  144  ? 502.268 12.534  703.743 1.00 125.80 ? 144  VAL A CB    1 
ATOM   1102  C  CG1   . VAL A 1  144  ? 500.994 12.382  704.481 1.00 130.97 ? 144  VAL A CG1   1 
ATOM   1103  C  CG2   . VAL A 1  144  ? 502.820 11.172  703.374 1.00 119.84 ? 144  VAL A CG2   1 
ATOM   1104  N  N     . ASP A 1  145  ? 500.097 14.899  702.618 1.00 131.49 ? 145  ASP A N     1 
ATOM   1105  C  CA    . ASP A 1  145  ? 499.379 16.128  702.955 1.00 140.28 ? 145  ASP A CA    1 
ATOM   1106  C  C     . ASP A 1  145  ? 498.146 15.854  703.809 1.00 143.92 ? 145  ASP A C     1 
ATOM   1107  O  O     . ASP A 1  145  ? 497.565 14.761  703.790 1.00 141.93 ? 145  ASP A O     1 
ATOM   1108  C  CB    . ASP A 1  145  ? 498.933 16.921  701.728 1.00 144.67 ? 145  ASP A CB    1 
ATOM   1109  C  CG    . ASP A 1  145  ? 500.049 17.720  701.118 1.00 151.44 ? 145  ASP A CG    1 
ATOM   1110  O  OD1   . ASP A 1  145  ? 500.227 18.870  701.569 1.00 155.00 ? 145  ASP A OD1   1 
ATOM   1111  O  OD2   . ASP A 1  145  ? 500.742 17.216  700.210 1.00 152.84 ? 145  ASP A OD2   1 
ATOM   1112  N  N     . ARG A 1  146  ? 497.676 16.931  704.438 1.00 146.47 ? 146  ARG A N     1 
ATOM   1113  C  CA    . ARG A 1  146  ? 496.412 16.956  705.150 1.00 142.73 ? 146  ARG A CA    1 
ATOM   1114  C  C     . ARG A 1  146  ? 495.406 17.566  704.198 1.00 143.23 ? 146  ARG A C     1 
ATOM   1115  O  O     . ARG A 1  146  ? 495.698 18.565  703.536 1.00 147.30 ? 146  ARG A O     1 
ATOM   1116  C  CB    . ARG A 1  146  ? 496.516 17.825  706.405 1.00 144.22 ? 146  ARG A CB    1 
ATOM   1117  C  CG    . ARG A 1  146  ? 495.223 17.949  707.190 1.00 147.46 ? 146  ARG A CG    1 
ATOM   1118  C  CD    . ARG A 1  146  ? 495.336 18.889  708.414 1.00 152.17 ? 146  ARG A CD    1 
ATOM   1119  N  NE    . ARG A 1  146  ? 495.849 18.292  709.652 1.00 155.43 ? 146  ARG A NE    1 
ATOM   1120  C  CZ    . ARG A 1  146  ? 496.980 18.664  710.255 1.00 156.62 ? 146  ARG A CZ    1 
ATOM   1121  N  NH1   . ARG A 1  146  ? 497.731 19.635  709.743 1.00 156.07 ? 146  ARG A NH1   1 
ATOM   1122  N  NH2   . ARG A 1  146  ? 497.362 18.070  711.379 1.00 156.77 ? 146  ARG A NH2   1 
ATOM   1123  N  N     . GLY A 1  147  ? 494.228 16.967  704.130 1.00 137.70 ? 147  GLY A N     1 
ATOM   1124  C  CA    . GLY A 1  147  ? 493.203 17.454  703.228 1.00 134.26 ? 147  GLY A CA    1 
ATOM   1125  C  C     . GLY A 1  147  ? 491.893 16.791  703.564 1.00 129.85 ? 147  GLY A C     1 
ATOM   1126  O  O     . GLY A 1  147  ? 491.799 15.997  704.500 1.00 131.35 ? 147  GLY A O     1 
ATOM   1127  N  N     . VAL A 1  148  ? 490.882 17.092  702.766 1.00 126.18 ? 148  VAL A N     1 
ATOM   1128  C  CA    . VAL A 1  148  ? 489.568 16.528  703.027 1.00 123.52 ? 148  VAL A CA    1 
ATOM   1129  C  C     . VAL A 1  148  ? 489.071 15.768  701.817 1.00 120.62 ? 148  VAL A C     1 
ATOM   1130  O  O     . VAL A 1  148  ? 489.343 16.128  700.667 1.00 115.43 ? 148  VAL A O     1 
ATOM   1131  C  CB    . VAL A 1  148  ? 488.539 17.588  703.438 1.00 124.55 ? 148  VAL A CB    1 
ATOM   1132  C  CG1   . VAL A 1  148  ? 487.509 16.944  704.326 1.00 126.34 ? 148  VAL A CG1   1 
ATOM   1133  C  CG2   . VAL A 1  148  ? 489.227 18.731  704.162 1.00 128.86 ? 148  VAL A CG2   1 
ATOM   1134  N  N     . GLY A 1  149  ? 488.306 14.719  702.099 1.00 118.48 ? 149  GLY A N     1 
ATOM   1135  C  CA    . GLY A 1  149  ? 487.647 13.964  701.060 1.00 117.48 ? 149  GLY A CA    1 
ATOM   1136  C  C     . GLY A 1  149  ? 488.624 13.169  700.210 1.00 115.75 ? 149  GLY A C     1 
ATOM   1137  O  O     . GLY A 1  149  ? 489.704 12.760  700.659 1.00 116.52 ? 149  GLY A O     1 
ATOM   1138  N  N     . TYR A 1  150  ? 488.207 12.933  698.955 1.00 117.80 ? 150  TYR A N     1 
ATOM   1139  C  CA    . TYR A 1  150  ? 488.937 12.152  697.943 1.00 114.88 ? 150  TYR A CA    1 
ATOM   1140  C  C     . TYR A 1  150  ? 489.368 13.040  696.770 1.00 109.14 ? 150  TYR A C     1 
ATOM   1141  O  O     . TYR A 1  150  ? 488.530 13.489  695.982 1.00 100.67 ? 150  TYR A O     1 
ATOM   1142  C  CB    . TYR A 1  150  ? 488.053 10.994  697.461 1.00 110.83 ? 150  TYR A CB    1 
ATOM   1143  C  CG    . TYR A 1  150  ? 488.508 10.268  696.224 1.00 105.24 ? 150  TYR A CG    1 
ATOM   1144  C  CD1   . TYR A 1  150  ? 489.591 9.407   696.262 1.00 105.14 ? 150  TYR A CD1   1 
ATOM   1145  C  CD2   . TYR A 1  150  ? 487.842 10.423  695.029 1.00 108.14 ? 150  TYR A CD2   1 
ATOM   1146  C  CE1   . TYR A 1  150  ? 490.011 8.725   695.126 1.00 107.04 ? 150  TYR A CE1   1 
ATOM   1147  C  CE2   . TYR A 1  150  ? 488.258 9.748   693.880 1.00 109.54 ? 150  TYR A CE2   1 
ATOM   1148  C  CZ    . TYR A 1  150  ? 489.348 8.900   693.928 1.00 106.91 ? 150  TYR A CZ    1 
ATOM   1149  O  OH    . TYR A 1  150  ? 489.753 8.229   692.784 1.00 101.31 ? 150  TYR A OH    1 
ATOM   1150  N  N     . VAL A 1  151  ? 490.665 13.289  696.638 1.00 112.13 ? 151  VAL A N     1 
ATOM   1151  C  CA    . VAL A 1  151  ? 491.131 14.107  695.527 1.00 110.83 ? 151  VAL A CA    1 
ATOM   1152  C  C     . VAL A 1  151  ? 491.978 13.222  694.613 1.00 118.81 ? 151  VAL A C     1 
ATOM   1153  O  O     . VAL A 1  151  ? 493.117 12.860  694.969 1.00 122.63 ? 151  VAL A O     1 
ATOM   1154  C  CB    . VAL A 1  151  ? 491.901 15.341  696.017 1.00 103.49 ? 151  VAL A CB    1 
ATOM   1155  C  CG1   . VAL A 1  151  ? 492.390 16.153  694.860 1.00 101.74 ? 151  VAL A CG1   1 
ATOM   1156  C  CG2   . VAL A 1  151  ? 490.987 16.203  696.810 1.00 102.01 ? 151  VAL A CG2   1 
ATOM   1157  N  N     . PRO A 1  152  ? 491.453 12.845  693.432 1.00 113.69 ? 152  PRO A N     1 
ATOM   1158  C  CA    . PRO A 1  152  ? 492.174 11.957  692.503 1.00 105.58 ? 152  PRO A CA    1 
ATOM   1159  C  C     . PRO A 1  152  ? 493.419 12.614  691.933 1.00 97.64  ? 152  PRO A C     1 
ATOM   1160  O  O     . PRO A 1  152  ? 493.451 13.828  691.710 1.00 94.39  ? 152  PRO A O     1 
ATOM   1161  C  CB    . PRO A 1  152  ? 491.145 11.694  691.406 1.00 105.36 ? 152  PRO A CB    1 
ATOM   1162  C  CG    . PRO A 1  152  ? 490.345 12.943  691.392 1.00 108.49 ? 152  PRO A CG    1 
ATOM   1163  C  CD    . PRO A 1  152  ? 490.190 13.318  692.852 1.00 111.50 ? 152  PRO A CD    1 
ATOM   1164  N  N     . ALA A 1  153  ? 494.401 11.773  691.573 1.00 95.05  ? 153  ALA A N     1 
ATOM   1165  C  CA    . ALA A 1  153  ? 495.681 12.279  691.072 1.00 93.42  ? 153  ALA A CA    1 
ATOM   1166  C  C     . ALA A 1  153  ? 495.536 13.254  689.917 1.00 91.86  ? 153  ALA A C     1 
ATOM   1167  O  O     . ALA A 1  153  ? 496.118 14.338  689.953 1.00 90.26  ? 153  ALA A O     1 
ATOM   1168  C  CB    . ALA A 1  153  ? 496.540 11.101  690.617 1.00 90.87  ? 153  ALA A CB    1 
ATOM   1169  N  N     . GLU A 1  154  ? 494.609 12.996  689.006 1.00 95.70  ? 154  GLU A N     1 
ATOM   1170  C  CA    . GLU A 1  154  ? 494.407 13.914  687.892 1.00 102.58 ? 154  GLU A CA    1 
ATOM   1171  C  C     . GLU A 1  154  ? 494.009 15.299  688.379 1.00 110.95 ? 154  GLU A C     1 
ATOM   1172  O  O     . GLU A 1  154  ? 494.295 16.296  687.708 1.00 113.49 ? 154  GLU A O     1 
ATOM   1173  C  CB    . GLU A 1  154  ? 493.369 13.355  686.920 1.00 112.03 ? 154  GLU A CB    1 
ATOM   1174  C  CG    . GLU A 1  154  ? 493.601 11.892  686.534 1.00 125.29 ? 154  GLU A CG    1 
ATOM   1175  C  CD    . GLU A 1  154  ? 492.999 10.901  687.517 1.00 136.57 ? 154  GLU A CD    1 
ATOM   1176  O  OE1   . GLU A 1  154  ? 491.844 10.463  687.306 1.00 138.97 ? 154  GLU A OE1   1 
ATOM   1177  O  OE2   . GLU A 1  154  ? 493.718 10.514  688.474 1.00 140.07 ? 154  GLU A OE2   1 
ATOM   1178  N  N     . LYS A 1  155  ? 493.291 15.376  689.502 1.00 111.19 ? 155  LYS A N     1 
ATOM   1179  C  CA    . LYS A 1  155  ? 492.855 16.664  690.025 1.00 104.50 ? 155  LYS A CA    1 
ATOM   1180  C  C     . LYS A 1  155  ? 494.002 17.493  690.595 1.00 105.93 ? 155  LYS A C     1 
ATOM   1181  O  O     . LYS A 1  155  ? 494.195 18.648  690.205 1.00 108.52 ? 155  LYS A O     1 
ATOM   1182  C  CB    . LYS A 1  155  ? 491.798 16.443  691.083 1.00 99.69  ? 155  LYS A CB    1 
ATOM   1183  C  CG    . LYS A 1  155  ? 490.420 16.390  690.510 1.00 105.04 ? 155  LYS A CG    1 
ATOM   1184  C  CD    . LYS A 1  155  ? 489.934 17.751  690.015 1.00 113.38 ? 155  LYS A CD    1 
ATOM   1185  C  CE    . LYS A 1  155  ? 488.576 17.633  689.257 1.00 113.73 ? 155  LYS A CE    1 
ATOM   1186  N  NZ    . LYS A 1  155  ? 488.552 16.872  687.961 1.00 107.02 ? 155  LYS A NZ    1 
ATOM   1187  N  N     . HIS A 1  156  ? 494.753 16.944  691.555 1.00 112.98 ? 156  HIS A N     1 
ATOM   1188  C  CA    . HIS A 1  156  ? 495.776 17.767  692.210 1.00 119.59 ? 156  HIS A CA    1 
ATOM   1189  C  C     . HIS A 1  156  ? 497.063 17.863  691.399 1.00 126.66 ? 156  HIS A C     1 
ATOM   1190  O  O     . HIS A 1  156  ? 497.718 18.911  691.421 1.00 133.15 ? 156  HIS A O     1 
ATOM   1191  C  CB    . HIS A 1  156  ? 496.031 17.305  693.657 1.00 115.09 ? 156  HIS A CB    1 
ATOM   1192  C  CG    . HIS A 1  156  ? 496.600 15.927  693.802 1.00 110.90 ? 156  HIS A CG    1 
ATOM   1193  N  ND1   . HIS A 1  156  ? 497.922 15.637  693.542 1.00 111.82 ? 156  HIS A ND1   1 
ATOM   1194  C  CD2   . HIS A 1  156  ? 496.022 14.756  694.164 1.00 107.86 ? 156  HIS A CD2   1 
ATOM   1195  C  CE1   . HIS A 1  156  ? 498.143 14.354  693.769 1.00 110.58 ? 156  HIS A CE1   1 
ATOM   1196  N  NE2   . HIS A 1  156  ? 497.004 13.794  694.137 1.00 109.29 ? 156  HIS A NE2   1 
ATOM   1197  N  N     . GLY A 1  157  ? 497.466 16.787  690.726 1.00 127.81 ? 157  GLY A N     1 
ATOM   1198  C  CA    . GLY A 1  157  ? 498.675 16.834  689.896 1.00 125.39 ? 157  GLY A CA    1 
ATOM   1199  C  C     . GLY A 1  157  ? 499.895 17.336  690.631 1.00 127.01 ? 157  GLY A C     1 
ATOM   1200  O  O     . GLY A 1  157  ? 500.735 18.034  690.045 1.00 127.58 ? 157  GLY A O     1 
ATOM   1201  N  N     . ILE A 1  158  ? 500.033 16.944  691.901 1.00 126.49 ? 158  ILE A N     1 
ATOM   1202  C  CA    . ILE A 1  158  ? 501.070 17.437  692.811 1.00 128.78 ? 158  ILE A CA    1 
ATOM   1203  C  C     . ILE A 1  158  ? 502.405 16.813  692.456 1.00 126.47 ? 158  ILE A C     1 
ATOM   1204  O  O     . ILE A 1  158  ? 502.567 15.587  692.509 1.00 124.36 ? 158  ILE A O     1 
ATOM   1205  C  CB    . ILE A 1  158  ? 500.725 17.143  694.277 1.00 130.17 ? 158  ILE A CB    1 
ATOM   1206  C  CG1   . ILE A 1  158  ? 499.509 17.943  694.743 1.00 123.70 ? 158  ILE A CG1   1 
ATOM   1207  C  CG2   . ILE A 1  158  ? 501.952 17.374  695.179 1.00 133.38 ? 158  ILE A CG2   1 
ATOM   1208  C  CD1   . ILE A 1  158  ? 499.107 17.552  696.124 1.00 121.55 ? 158  ILE A CD1   1 
ATOM   1209  N  N     . LYS A 1  159  ? 503.386 17.660  692.156 1.00 128.62 ? 159  LYS A N     1 
ATOM   1210  C  CA    . LYS A 1  159  ? 504.728 17.191  691.853 1.00 132.21 ? 159  LYS A CA    1 
ATOM   1211  C  C     . LYS A 1  159  ? 505.751 18.030  692.610 1.00 134.32 ? 159  LYS A C     1 
ATOM   1212  O  O     . LYS A 1  159  ? 505.848 19.248  692.410 1.00 133.26 ? 159  LYS A O     1 
ATOM   1213  C  CB    . LYS A 1  159  ? 504.995 17.273  690.336 1.00 130.04 ? 159  LYS A CB    1 
ATOM   1214  C  CG    . LYS A 1  159  ? 504.149 16.355  689.426 1.00 128.05 ? 159  LYS A CG    1 
ATOM   1215  C  CD    . LYS A 1  159  ? 504.185 16.829  687.950 1.00 129.23 ? 159  LYS A CD    1 
ATOM   1216  C  CE    . LYS A 1  159  ? 503.743 15.747  686.922 1.00 125.00 ? 159  LYS A CE    1 
ATOM   1217  N  NZ    . LYS A 1  159  ? 504.868 14.920  686.370 1.00 123.38 ? 159  LYS A NZ    1 
ATOM   1218  N  N     . ASP A 1  160  ? 506.514 17.367  693.485 1.00 135.75 ? 160  ASP A N     1 
ATOM   1219  C  CA    . ASP A 1  160  ? 507.592 18.056  694.168 1.00 144.04 ? 160  ASP A CA    1 
ATOM   1220  C  C     . ASP A 1  160  ? 508.767 18.312  693.228 1.00 154.11 ? 160  ASP A C     1 
ATOM   1221  O  O     . ASP A 1  160  ? 509.443 19.340  693.342 1.00 162.99 ? 160  ASP A O     1 
ATOM   1222  C  CB    . ASP A 1  160  ? 508.056 17.254  695.387 1.00 146.86 ? 160  ASP A CB    1 
ATOM   1223  C  CG    . ASP A 1  160  ? 507.257 17.572  696.642 1.00 147.14 ? 160  ASP A CG    1 
ATOM   1224  O  OD1   . ASP A 1  160  ? 506.509 18.573  696.608 1.00 146.28 ? 160  ASP A OD1   1 
ATOM   1225  O  OD2   . ASP A 1  160  ? 507.439 16.887  697.686 1.00 147.10 ? 160  ASP A OD2   1 
ATOM   1226  N  N     . ARG A 1  161  ? 509.024 17.401  692.294 1.00 153.01 ? 161  ARG A N     1 
ATOM   1227  C  CA    . ARG A 1  161  ? 510.079 17.566  691.307 1.00 154.88 ? 161  ARG A CA    1 
ATOM   1228  C  C     . ARG A 1  161  ? 509.584 17.063  689.955 1.00 156.74 ? 161  ARG A C     1 
ATOM   1229  O  O     . ARG A 1  161  ? 508.422 16.685  689.801 1.00 159.18 ? 161  ARG A O     1 
ATOM   1230  C  CB    . ARG A 1  161  ? 511.356 16.884  691.795 1.00 158.28 ? 161  ARG A CB    1 
ATOM   1231  C  CG    . ARG A 1  161  ? 511.247 15.398  692.015 1.00 157.39 ? 161  ARG A CG    1 
ATOM   1232  C  CD    . ARG A 1  161  ? 512.614 14.899  692.413 1.00 163.79 ? 161  ARG A CD    1 
ATOM   1233  N  NE    . ARG A 1  161  ? 512.993 15.374  693.738 1.00 168.04 ? 161  ARG A NE    1 
ATOM   1234  C  CZ    . ARG A 1  161  ? 514.239 15.377  694.200 1.00 174.51 ? 161  ARG A CZ    1 
ATOM   1235  N  NH1   . ARG A 1  161  ? 515.241 14.939  693.441 1.00 175.96 ? 161  ARG A NH1   1 
ATOM   1236  N  NH2   . ARG A 1  161  ? 514.487 15.827  695.423 1.00 178.98 ? 161  ARG A NH2   1 
ATOM   1237  N  N     . ILE A 1  162  ? 510.477 17.055  688.965 1.00 155.02 ? 162  ILE A N     1 
ATOM   1238  C  CA    . ILE A 1  162  ? 510.081 16.760  687.586 1.00 147.93 ? 162  ILE A CA    1 
ATOM   1239  C  C     . ILE A 1  162  ? 509.519 15.345  687.461 1.00 141.91 ? 162  ILE A C     1 
ATOM   1240  O  O     . ILE A 1  162  ? 508.462 15.138  686.854 1.00 139.85 ? 162  ILE A O     1 
ATOM   1241  C  CB    . ILE A 1  162  ? 511.270 16.981  686.624 1.00 150.61 ? 162  ILE A CB    1 
ATOM   1242  C  CG1   . ILE A 1  162  ? 511.719 18.447  686.606 1.00 154.35 ? 162  ILE A CG1   1 
ATOM   1243  C  CG2   . ILE A 1  162  ? 510.903 16.551  685.216 1.00 148.84 ? 162  ILE A CG2   1 
ATOM   1244  C  CD1   . ILE A 1  162  ? 510.697 19.407  685.996 1.00 152.45 ? 162  ILE A CD1   1 
ATOM   1245  N  N     . ASN A 1  163  ? 510.168 14.367  688.087 1.00 139.16 ? 163  ASN A N     1 
ATOM   1246  C  CA    . ASN A 1  163  ? 509.800 12.956  687.990 1.00 135.98 ? 163  ASN A CA    1 
ATOM   1247  C  C     . ASN A 1  163  ? 508.764 12.505  688.996 1.00 128.25 ? 163  ASN A C     1 
ATOM   1248  O  O     . ASN A 1  163  ? 508.558 11.296  689.132 1.00 125.33 ? 163  ASN A O     1 
ATOM   1249  C  CB    . ASN A 1  163  ? 511.030 12.072  688.155 1.00 142.55 ? 163  ASN A CB    1 
ATOM   1250  C  CG    . ASN A 1  163  ? 512.006 12.209  687.017 1.00 145.83 ? 163  ASN A CG    1 
ATOM   1251  O  OD1   . ASN A 1  163  ? 511.634 12.615  685.910 1.00 146.21 ? 163  ASN A OD1   1 
ATOM   1252  N  ND2   . ASN A 1  163  ? 513.278 11.905  687.294 1.00 146.75 ? 163  ASN A ND2   1 
ATOM   1253  N  N     . ALA A 1  164  ? 508.175 13.425  689.753 1.00 129.27 ? 164  ALA A N     1 
ATOM   1254  C  CA    . ALA A 1  164  ? 507.163 13.074  690.750 1.00 122.49 ? 164  ALA A CA    1 
ATOM   1255  C  C     . ALA A 1  164  ? 505.913 12.493  690.092 1.00 114.28 ? 164  ALA A C     1 
ATOM   1256  O  O     . ALA A 1  164  ? 505.483 12.940  689.026 1.00 112.92 ? 164  ALA A O     1 
ATOM   1257  C  CB    . ALA A 1  164  ? 506.786 14.292  691.597 1.00 123.74 ? 164  ALA A CB    1 
ATOM   1258  N  N     . ILE A 1  165  ? 505.323 11.497  690.742 1.00 115.03 ? 165  ILE A N     1 
ATOM   1259  C  CA    . ILE A 1  165  ? 504.114 10.839  690.264 1.00 100.35 ? 165  ILE A CA    1 
ATOM   1260  C  C     . ILE A 1  165  ? 502.947 11.285  691.138 1.00 99.68  ? 165  ILE A C     1 
ATOM   1261  O  O     . ILE A 1  165  ? 502.884 10.907  692.317 1.00 102.28 ? 165  ILE A O     1 
ATOM   1262  C  CB    . ILE A 1  165  ? 504.230 9.314   690.360 1.00 100.18 ? 165  ILE A CB    1 
ATOM   1263  C  CG1   . ILE A 1  165  ? 505.406 8.741   689.580 1.00 101.24 ? 165  ILE A CG1   1 
ATOM   1264  C  CG2   . ILE A 1  165  ? 502.847 8.667   690.137 1.00 97.27  ? 165  ILE A CG2   1 
ATOM   1265  C  CD1   . ILE A 1  165  ? 505.633 7.278   689.901 1.00 101.80 ? 165  ILE A CD1   1 
ATOM   1266  N  N     . PRO A 1  166  ? 502.025 12.095  690.642 1.00 103.32 ? 166  PRO A N     1 
ATOM   1267  C  CA    . PRO A 1  166  ? 500.861 12.396  691.453 1.00 110.88 ? 166  PRO A CA    1 
ATOM   1268  C  C     . PRO A 1  166  ? 500.166 11.081  691.773 1.00 115.53 ? 166  PRO A C     1 
ATOM   1269  O  O     . PRO A 1  166  ? 500.136 10.159  690.935 1.00 110.13 ? 166  PRO A O     1 
ATOM   1270  C  CB    . PRO A 1  166  ? 500.030 13.316  690.558 1.00 106.32 ? 166  PRO A CB    1 
ATOM   1271  C  CG    . PRO A 1  166  ? 501.005 13.984  689.749 1.00 105.71 ? 166  PRO A CG    1 
ATOM   1272  C  CD    . PRO A 1  166  ? 502.074 12.963  689.463 1.00 107.43 ? 166  PRO A CD    1 
ATOM   1273  N  N     . VAL A 1  167  ? 499.680 10.992  693.033 1.00 118.63 ? 167  VAL A N     1 
ATOM   1274  C  CA    . VAL A 1  167  ? 499.021 9.820   693.607 1.00 111.73 ? 167  VAL A CA    1 
ATOM   1275  C  C     . VAL A 1  167  ? 497.621 10.189  694.083 1.00 108.60 ? 167  VAL A C     1 
ATOM   1276  O  O     . VAL A 1  167  ? 497.402 11.302  694.572 1.00 111.25 ? 167  VAL A O     1 
ATOM   1277  C  CB    . VAL A 1  167  ? 499.845 9.243   694.779 1.00 112.94 ? 167  VAL A CB    1 
ATOM   1278  C  CG1   . VAL A 1  167  ? 499.177 8.004   695.327 1.00 114.18 ? 167  VAL A CG1   1 
ATOM   1279  C  CG2   . VAL A 1  167  ? 501.279 8.934   694.342 1.00 113.70 ? 167  VAL A CG2   1 
ATOM   1280  N  N     . ASP A 1  168  ? 496.665 9.275   693.883 1.00 108.75 ? 168  ASP A N     1 
ATOM   1281  C  CA    . ASP A 1  168  ? 495.306 9.409   694.421 1.00 113.42 ? 168  ASP A CA    1 
ATOM   1282  C  C     . ASP A 1  168  ? 495.302 9.539   695.956 1.00 118.35 ? 168  ASP A C     1 
ATOM   1283  O  O     . ASP A 1  168  ? 495.879 8.710   696.670 1.00 124.10 ? 168  ASP A O     1 
ATOM   1284  C  CB    . ASP A 1  168  ? 494.489 8.212   693.936 1.00 117.13 ? 168  ASP A CB    1 
ATOM   1285  C  CG    . ASP A 1  168  ? 494.167 8.303   692.443 1.00 120.90 ? 168  ASP A CG    1 
ATOM   1286  O  OD1   . ASP A 1  168  ? 493.994 9.432   691.936 1.00 120.16 ? 168  ASP A OD1   1 
ATOM   1287  O  OD2   . ASP A 1  168  ? 494.192 7.261   691.749 1.00 122.59 ? 168  ASP A OD2   1 
ATOM   1288  N  N     . ALA A 1  169  ? 494.654 10.579  696.476 1.00 114.93 ? 169  ALA A N     1 
ATOM   1289  C  CA    . ALA A 1  169  ? 494.619 10.847  697.918 1.00 117.69 ? 169  ALA A CA    1 
ATOM   1290  C  C     . ALA A 1  169  ? 493.248 10.606  698.545 1.00 121.84 ? 169  ALA A C     1 
ATOM   1291  O  O     . ALA A 1  169  ? 492.298 11.344  698.255 1.00 116.70 ? 169  ALA A O     1 
ATOM   1292  C  CB    . ALA A 1  169  ? 495.065 12.275  698.222 1.00 122.76 ? 169  ALA A CB    1 
ATOM   1293  N  N     . VAL A 1  170  ? 493.137 9.603   699.419 1.00 124.07 ? 170  VAL A N     1 
ATOM   1294  C  CA    . VAL A 1  170  ? 491.947 9.467   700.255 1.00 119.78 ? 170  VAL A CA    1 
ATOM   1295  C  C     . VAL A 1  170  ? 492.313 10.087  701.604 1.00 122.47 ? 170  VAL A C     1 
ATOM   1296  O  O     . VAL A 1  170  ? 492.905 9.451   702.499 1.00 127.87 ? 170  VAL A O     1 
ATOM   1297  C  CB    . VAL A 1  170  ? 491.522 8.006   700.401 1.00 100.57 ? 170  VAL A CB    1 
ATOM   1298  C  CG1   . VAL A 1  170  ? 490.267 7.939   701.169 1.00 101.32 ? 170  VAL A CG1   1 
ATOM   1299  C  CG2   . VAL A 1  170  ? 491.324 7.386   699.062 1.00 97.51  ? 170  VAL A CG2   1 
ATOM   1300  N  N     . PHE A 1  171  ? 491.829 11.302  701.806 1.00 115.99 ? 171  PHE A N     1 
ATOM   1301  C  CA    . PHE A 1  171  ? 492.315 12.018  702.960 1.00 113.34 ? 171  PHE A CA    1 
ATOM   1302  C  C     . PHE A 1  171  ? 491.606 11.534  704.190 1.00 118.67 ? 171  PHE A C     1 
ATOM   1303  O  O     . PHE A 1  171  ? 492.270 11.116  705.145 1.00 114.62 ? 171  PHE A O     1 
ATOM   1304  C  CB    . PHE A 1  171  ? 492.072 13.518  702.796 1.00 117.47 ? 171  PHE A CB    1 
ATOM   1305  C  CG    . PHE A 1  171  ? 493.019 14.203  701.852 1.00 122.39 ? 171  PHE A CG    1 
ATOM   1306  C  CD1   . PHE A 1  171  ? 494.394 14.164  702.067 1.00 126.76 ? 171  PHE A CD1   1 
ATOM   1307  C  CD2   . PHE A 1  171  ? 492.543 14.911  700.755 1.00 121.81 ? 171  PHE A CD2   1 
ATOM   1308  C  CE1   . PHE A 1  171  ? 495.285 14.806  701.194 1.00 123.76 ? 171  PHE A CE1   1 
ATOM   1309  C  CE2   . PHE A 1  171  ? 493.432 15.548  699.871 1.00 121.60 ? 171  PHE A CE2   1 
ATOM   1310  C  CZ    . PHE A 1  171  ? 494.800 15.495  700.091 1.00 120.44 ? 171  PHE A CZ    1 
ATOM   1311  N  N     . SER A 1  172  ? 490.280 11.346  704.045 1.00 126.80 ? 172  SER A N     1 
ATOM   1312  C  CA    . SER A 1  172  ? 489.339 11.087  705.126 1.00 131.79 ? 172  SER A CA    1 
ATOM   1313  C  C     . SER A 1  172  ? 489.835 9.958   706.024 1.00 135.56 ? 172  SER A C     1 
ATOM   1314  O  O     . SER A 1  172  ? 490.087 8.837   705.537 1.00 135.47 ? 172  SER A O     1 
ATOM   1315  C  CB    . SER A 1  172  ? 487.949 10.770  704.567 1.00 128.68 ? 172  SER A CB    1 
ATOM   1316  O  OG    . SER A 1  172  ? 487.038 10.343  705.578 1.00 129.07 ? 172  SER A OG    1 
ATOM   1317  N  N     . PRO A 1  173  ? 489.990 10.227  707.334 1.00 134.82 ? 173  PRO A N     1 
ATOM   1318  C  CA    . PRO A 1  173  ? 490.387 9.200   708.315 1.00 132.49 ? 173  PRO A CA    1 
ATOM   1319  C  C     . PRO A 1  173  ? 489.318 8.203   708.672 1.00 126.05 ? 173  PRO A C     1 
ATOM   1320  O  O     . PRO A 1  173  ? 489.654 7.146   709.215 1.00 119.19 ? 173  PRO A O     1 
ATOM   1321  C  CB    . PRO A 1  173  ? 490.802 10.032  709.529 1.00 121.71 ? 173  PRO A CB    1 
ATOM   1322  C  CG    . PRO A 1  173  ? 489.950 11.223  709.433 1.00 121.78 ? 173  PRO A CG    1 
ATOM   1323  C  CD    . PRO A 1  173  ? 489.801 11.537  707.975 1.00 132.70 ? 173  PRO A CD    1 
ATOM   1324  N  N     . VAL A 1  174  ? 488.055 8.485   708.386 1.00 107.88 ? 174  VAL A N     1 
ATOM   1325  C  CA    . VAL A 1  174  ? 486.967 7.609   708.802 1.00 102.37 ? 174  VAL A CA    1 
ATOM   1326  C  C     . VAL A 1  174  ? 486.881 6.419   707.860 1.00 100.12 ? 174  VAL A C     1 
ATOM   1327  O  O     . VAL A 1  174  ? 486.562 6.571   706.675 1.00 100.89 ? 174  VAL A O     1 
ATOM   1328  C  CB    . VAL A 1  174  ? 485.657 8.397   708.792 1.00 103.45 ? 174  VAL A CB    1 
ATOM   1329  C  CG1   . VAL A 1  174  ? 484.491 7.552   709.270 1.00 100.27 ? 174  VAL A CG1   1 
ATOM   1330  C  CG2   . VAL A 1  174  ? 485.852 9.669   709.589 1.00 103.87 ? 174  VAL A CG2   1 
ATOM   1331  N  N     . ARG A 1  175  ? 487.125 5.223   708.404 1.00 101.19 ? 175  ARG A N     1 
ATOM   1332  C  CA    . ARG A 1  175  ? 486.998 4.004   707.619 1.00 108.48 ? 175  ARG A CA    1 
ATOM   1333  C  C     . ARG A 1  175  ? 485.543 3.506   707.580 1.00 110.10 ? 175  ARG A C     1 
ATOM   1334  O  O     . ARG A 1  175  ? 485.070 3.094   706.512 1.00 112.36 ? 175  ARG A O     1 
ATOM   1335  C  CB    . ARG A 1  175  ? 488.063 2.996   708.077 1.00 113.33 ? 175  ARG A CB    1 
ATOM   1336  C  CG    . ARG A 1  175  ? 489.566 3.590   707.912 1.00 124.58 ? 175  ARG A CG    1 
ATOM   1337  C  CD    . ARG A 1  175  ? 490.073 4.072   706.422 1.00 132.57 ? 175  ARG A CD    1 
ATOM   1338  N  NE    . ARG A 1  175  ? 491.410 4.765   706.354 1.00 138.86 ? 175  ARG A NE    1 
ATOM   1339  C  CZ    . ARG A 1  175  ? 492.013 5.241   705.239 1.00 137.82 ? 175  ARG A CZ    1 
ATOM   1340  N  NH1   . ARG A 1  175  ? 491.432 5.123   704.048 1.00 136.18 ? 175  ARG A NH1   1 
ATOM   1341  N  NH2   . ARG A 1  175  ? 493.202 5.857   705.305 1.00 134.26 ? 175  ARG A NH2   1 
ATOM   1342  N  N     . ARG A 1  176  ? 484.806 3.523   708.700 1.00 111.43 ? 176  ARG A N     1 
ATOM   1343  C  CA    . ARG A 1  176  ? 483.418 3.041   708.675 1.00 110.04 ? 176  ARG A CA    1 
ATOM   1344  C  C     . ARG A 1  176  ? 482.582 3.732   709.748 1.00 108.78 ? 176  ARG A C     1 
ATOM   1345  O  O     . ARG A 1  176  ? 483.068 4.041   710.836 1.00 115.37 ? 176  ARG A O     1 
ATOM   1346  C  CB    . ARG A 1  176  ? 483.328 1.514   708.820 1.00 116.21 ? 176  ARG A CB    1 
ATOM   1347  C  CG    . ARG A 1  176  ? 481.908 0.929   708.822 1.00 119.33 ? 176  ARG A CG    1 
ATOM   1348  C  CD    . ARG A 1  176  ? 481.829 -0.307  707.924 1.00 128.52 ? 176  ARG A CD    1 
ATOM   1349  N  NE    . ARG A 1  176  ? 482.777 -1.329  708.356 1.00 141.32 ? 176  ARG A NE    1 
ATOM   1350  C  CZ    . ARG A 1  176  ? 482.511 -2.343  709.170 1.00 147.64 ? 176  ARG A CZ    1 
ATOM   1351  N  NH1   . ARG A 1  176  ? 481.293 -2.498  709.668 1.00 149.13 ? 176  ARG A NH1   1 
ATOM   1352  N  NH2   . ARG A 1  176  ? 483.481 -3.201  709.483 1.00 151.27 ? 176  ARG A NH2   1 
ATOM   1353  N  N     . VAL A 1  177  ? 481.306 3.952   709.432 1.00 99.85  ? 177  VAL A N     1 
ATOM   1354  C  CA    . VAL A 1  177  ? 480.301 4.504   710.345 1.00 94.73  ? 177  VAL A CA    1 
ATOM   1355  C  C     . VAL A 1  177  ? 478.988 3.744   710.241 1.00 96.07  ? 177  VAL A C     1 
ATOM   1356  O  O     . VAL A 1  177  ? 478.388 3.667   709.165 1.00 96.71  ? 177  VAL A O     1 
ATOM   1357  C  CB    . VAL A 1  177  ? 480.050 6.002   710.076 1.00 94.37  ? 177  VAL A CB    1 
ATOM   1358  C  CG1   . VAL A 1  177  ? 479.077 6.555   711.007 1.00 86.14  ? 177  VAL A CG1   1 
ATOM   1359  C  CG2   . VAL A 1  177  ? 481.320 6.778   710.329 1.00 89.48  ? 177  VAL A CG2   1 
ATOM   1360  N  N     . ALA A 1  178  ? 478.518 3.224   711.367 1.00 105.83 ? 178  ALA A N     1 
ATOM   1361  C  CA    . ALA A 1  178  ? 477.189 2.640   711.476 1.00 109.62 ? 178  ALA A CA    1 
ATOM   1362  C  C     . ALA A 1  178  ? 476.520 3.274   712.691 1.00 110.45 ? 178  ALA A C     1 
ATOM   1363  O  O     . ALA A 1  178  ? 477.189 3.693   713.646 1.00 111.19 ? 178  ALA A O     1 
ATOM   1364  C  CB    . ALA A 1  178  ? 477.248 1.112   711.617 1.00 113.92 ? 178  ALA A CB    1 
ATOM   1365  N  N     . PHE A 1  179  ? 475.193 3.255   712.717 1.00 106.04 ? 179  PHE A N     1 
ATOM   1366  C  CA    . PHE A 1  179  ? 474.545 3.681   713.942 1.00 110.11 ? 179  PHE A CA    1 
ATOM   1367  C  C     . PHE A 1  179  ? 473.310 2.844   714.225 1.00 111.51 ? 179  PHE A C     1 
ATOM   1368  O  O     . PHE A 1  179  ? 472.565 2.501   713.302 1.00 115.97 ? 179  PHE A O     1 
ATOM   1369  C  CB    . PHE A 1  179  ? 474.275 5.201   713.903 1.00 101.38 ? 179  PHE A CB    1 
ATOM   1370  C  CG    . PHE A 1  179  ? 473.200 5.641   712.967 1.00 94.01  ? 179  PHE A CG    1 
ATOM   1371  C  CD1   . PHE A 1  179  ? 471.875 5.647   713.353 1.00 86.65  ? 179  PHE A CD1   1 
ATOM   1372  C  CD2   . PHE A 1  179  ? 473.514 6.034   711.689 1.00 98.04  ? 179  PHE A CD2   1 
ATOM   1373  C  CE1   . PHE A 1  179  ? 470.888 6.067   712.493 1.00 87.33  ? 179  PHE A CE1   1 
ATOM   1374  C  CE2   . PHE A 1  179  ? 472.521 6.435   710.812 1.00 98.06  ? 179  PHE A CE2   1 
ATOM   1375  C  CZ    . PHE A 1  179  ? 471.205 6.452   711.227 1.00 93.62  ? 179  PHE A CZ    1 
ATOM   1376  N  N     . GLN A 1  180  ? 473.207 2.383   715.474 1.00 112.44 ? 180  GLN A N     1 
ATOM   1377  C  CA    . GLN A 1  180  ? 472.078 1.599   715.956 1.00 113.41 ? 180  GLN A CA    1 
ATOM   1378  C  C     . GLN A 1  180  ? 471.044 2.528   716.591 1.00 111.03 ? 180  GLN A C     1 
ATOM   1379  O  O     . GLN A 1  180  ? 471.398 3.459   717.316 1.00 122.45 ? 180  GLN A O     1 
ATOM   1380  C  CB    . GLN A 1  180  ? 472.583 0.595   716.989 1.00 123.42 ? 180  GLN A CB    1 
ATOM   1381  C  CG    . GLN A 1  180  ? 471.725 -0.610  717.211 1.00 131.88 ? 180  GLN A CG    1 
ATOM   1382  C  CD    . GLN A 1  180  ? 472.002 -1.680  716.182 1.00 139.62 ? 180  GLN A CD    1 
ATOM   1383  O  OE1   . GLN A 1  180  ? 472.812 -1.486  715.259 1.00 141.15 ? 180  GLN A OE1   1 
ATOM   1384  N  NE2   . GLN A 1  180  ? 471.367 -2.838  716.353 1.00 143.97 ? 180  GLN A NE2   1 
ATOM   1385  N  N     . VAL A 1  181  ? 469.771 2.285   716.317 1.00 95.55  ? 181  VAL A N     1 
ATOM   1386  C  CA    . VAL A 1  181  ? 468.667 2.949   717.002 1.00 91.03  ? 181  VAL A CA    1 
ATOM   1387  C  C     . VAL A 1  181  ? 467.791 1.901   717.660 1.00 91.15  ? 181  VAL A C     1 
ATOM   1388  O  O     . VAL A 1  181  ? 467.205 1.065   716.963 1.00 91.58  ? 181  VAL A O     1 
ATOM   1389  C  CB    . VAL A 1  181  ? 467.862 3.845   716.056 1.00 89.95  ? 181  VAL A CB    1 
ATOM   1390  C  CG1   . VAL A 1  181  ? 466.605 4.318   716.720 1.00 90.37  ? 181  VAL A CG1   1 
ATOM   1391  C  CG2   . VAL A 1  181  ? 468.692 5.068   715.718 1.00 89.51  ? 181  VAL A CG2   1 
ATOM   1392  N  N     . GLU A 1  182  ? 467.759 1.888   718.997 1.00 98.06  ? 182  GLU A N     1 
ATOM   1393  C  CA    . GLU A 1  182  ? 467.006 0.901   719.768 1.00 95.42  ? 182  GLU A CA    1 
ATOM   1394  C  C     . GLU A 1  182  ? 465.908 1.541   720.616 1.00 104.99 ? 182  GLU A C     1 
ATOM   1395  O  O     . GLU A 1  182  ? 465.980 2.720   720.985 1.00 105.85 ? 182  GLU A O     1 
ATOM   1396  C  CB    . GLU A 1  182  ? 467.965 0.175   720.663 1.00 94.01  ? 182  GLU A CB    1 
ATOM   1397  C  CG    . GLU A 1  182  ? 468.872 -0.552  719.818 1.00 93.79  ? 182  GLU A CG    1 
ATOM   1398  C  CD    . GLU A 1  182  ? 470.042 -1.021  720.556 1.00 105.66 ? 182  GLU A CD    1 
ATOM   1399  O  OE1   . GLU A 1  182  ? 470.007 -2.189  720.970 1.00 116.04 ? 182  GLU A OE1   1 
ATOM   1400  O  OE2   . GLU A 1  182  ? 470.962 -0.192  720.772 1.00 107.56 ? 182  GLU A OE2   1 
ATOM   1401  N  N     . ASP A 1  183  ? 464.908 0.733   720.970 1.00 109.39 ? 183  ASP A N     1 
ATOM   1402  C  CA    . ASP A 1  183  ? 463.804 1.224   721.789 1.00 113.23 ? 183  ASP A CA    1 
ATOM   1403  C  C     . ASP A 1  183  ? 464.233 1.402   723.250 1.00 110.04 ? 183  ASP A C     1 
ATOM   1404  O  O     . ASP A 1  183  ? 465.002 0.606   723.800 1.00 103.73 ? 183  ASP A O     1 
ATOM   1405  C  CB    . ASP A 1  183  ? 462.613 0.272   721.737 1.00 124.14 ? 183  ASP A CB    1 
ATOM   1406  C  CG    . ASP A 1  183  ? 461.283 1.004   721.855 1.00 136.01 ? 183  ASP A CG    1 
ATOM   1407  O  OD1   . ASP A 1  183  ? 461.326 2.218   722.143 1.00 142.39 ? 183  ASP A OD1   1 
ATOM   1408  O  OD2   . ASP A 1  183  ? 460.203 0.375   721.715 1.00 138.90 ? 183  ASP A OD2   1 
ATOM   1409  N  N     . THR A 1  184  ? 463.674 2.426   723.901 1.00 113.02 ? 184  THR A N     1 
ATOM   1410  C  CA    . THR A 1  184  ? 463.960 2.689   725.308 1.00 111.89 ? 184  THR A CA    1 
ATOM   1411  C  C     . THR A 1  184  ? 462.809 3.497   725.912 1.00 116.64 ? 184  THR A C     1 
ATOM   1412  O  O     . THR A 1  184  ? 461.928 3.992   725.199 1.00 112.92 ? 184  THR A O     1 
ATOM   1413  C  CB    . THR A 1  184  ? 465.296 3.426   725.463 1.00 108.73 ? 184  THR A CB    1 
ATOM   1414  O  OG1   . THR A 1  184  ? 465.943 2.990   726.646 1.00 111.76 ? 184  THR A OG1   1 
ATOM   1415  C  CG2   . THR A 1  184  ? 465.088 4.932   725.580 1.00 109.95 ? 184  THR A CG2   1 
ATOM   1416  N  N     . ARG A 1  185  ? 462.763 3.531   727.244 1.00 127.71 ? 185  ARG A N     1 
ATOM   1417  C  CA    . ARG A 1  185  ? 461.717 4.244   727.969 1.00 128.76 ? 185  ARG A CA    1 
ATOM   1418  C  C     . ARG A 1  185  ? 462.289 4.927   729.205 1.00 126.98 ? 185  ARG A C     1 
ATOM   1419  O  O     . ARG A 1  185  ? 463.313 4.506   729.750 1.00 130.73 ? 185  ARG A O     1 
ATOM   1420  C  CB    . ARG A 1  185  ? 460.493 3.389   728.386 1.00 135.15 ? 185  ARG A CB    1 
ATOM   1421  C  CG    . ARG A 1  185  ? 460.726 2.221   729.315 1.00 146.57 ? 185  ARG A CG    1 
ATOM   1422  C  CD    . ARG A 1  185  ? 459.425 1.376   729.520 1.00 159.15 ? 185  ARG A CD    1 
ATOM   1423  N  NE    . ARG A 1  185  ? 458.285 2.240   729.921 1.00 168.22 ? 185  ARG A NE    1 
ATOM   1424  C  CZ    . ARG A 1  185  ? 457.028 1.846   730.171 1.00 168.11 ? 185  ARG A CZ    1 
ATOM   1425  N  NH1   . ARG A 1  185  ? 456.678 0.570   730.081 1.00 169.49 ? 185  ARG A NH1   1 
ATOM   1426  N  NH2   . ARG A 1  185  ? 456.109 2.743   730.524 1.00 165.94 ? 185  ARG A NH2   1 
ATOM   1427  N  N     . LEU A 1  186  ? 461.647 6.046   729.572 1.00 123.21 ? 186  LEU A N     1 
ATOM   1428  C  CA    . LEU A 1  186  ? 461.805 6.781   730.829 1.00 126.37 ? 186  LEU A CA    1 
ATOM   1429  C  C     . LEU A 1  186  ? 460.719 6.397   731.858 1.00 131.48 ? 186  LEU A C     1 
ATOM   1430  O  O     . LEU A 1  186  ? 460.529 7.089   732.871 1.00 129.50 ? 186  LEU A O     1 
ATOM   1431  C  CB    . LEU A 1  186  ? 461.780 8.284   730.555 1.00 123.09 ? 186  LEU A CB    1 
ATOM   1432  C  CG    . LEU A 1  186  ? 462.599 9.165   731.498 1.00 122.97 ? 186  LEU A CG    1 
ATOM   1433  C  CD1   . LEU A 1  186  ? 463.720 8.382   732.142 1.00 125.31 ? 186  LEU A CD1   1 
ATOM   1434  C  CD2   . LEU A 1  186  ? 463.146 10.369  730.793 1.00 121.47 ? 186  LEU A CD2   1 
ATOM   1435  N  N     . GLY A 1  187  ? 459.970 5.336   731.566 1.00 138.73 ? 187  GLY A N     1 
ATOM   1436  C  CA    . GLY A 1  187  ? 459.122 4.599   732.462 1.00 123.73 ? 187  GLY A CA    1 
ATOM   1437  C  C     . GLY A 1  187  ? 457.770 5.241   732.535 1.00 152.81 ? 187  GLY A C     1 
ATOM   1438  O  O     . GLY A 1  187  ? 456.787 4.569   732.856 1.00 170.87 ? 187  GLY A O     1 
ATOM   1439  N  N     . GLN A 1  188  ? 457.671 6.456   732.035 1.00 150.24 ? 188  GLN A N     1 
ATOM   1440  C  CA    . GLN A 1  188  ? 456.447 7.209   731.875 1.00 154.68 ? 188  GLN A CA    1 
ATOM   1441  C  C     . GLN A 1  188  ? 455.973 7.076   730.441 1.00 154.34 ? 188  GLN A C     1 
ATOM   1442  O  O     . GLN A 1  188  ? 454.790 6.811   730.203 1.00 153.61 ? 188  GLN A O     1 
ATOM   1443  C  CB    . GLN A 1  188  ? 456.714 8.671   732.297 1.00 165.29 ? 188  GLN A CB    1 
ATOM   1444  C  CG    . GLN A 1  188  ? 455.551 9.679   732.438 1.00 173.90 ? 188  GLN A CG    1 
ATOM   1445  C  CD    . GLN A 1  188  ? 455.134 10.328  731.082 1.00 177.25 ? 188  GLN A CD    1 
ATOM   1446  O  OE1   . GLN A 1  188  ? 454.685 9.661   730.151 1.00 176.21 ? 188  GLN A OE1   1 
ATOM   1447  N  NE2   . GLN A 1  188  ? 455.321 11.646  730.982 1.00 178.85 ? 188  GLN A NE2   1 
ATOM   1448  N  N     . ARG A 1  189  ? 456.931 7.092   729.505 1.00 145.81 ? 189  ARG A N     1 
ATOM   1449  C  CA    . ARG A 1  189  ? 456.715 7.176   728.073 1.00 133.43 ? 189  ARG A CA    1 
ATOM   1450  C  C     . ARG A 1  189  ? 457.475 6.055   727.377 1.00 124.84 ? 189  ARG A C     1 
ATOM   1451  O  O     . ARG A 1  189  ? 458.499 5.592   727.884 1.00 117.46 ? 189  ARG A O     1 
ATOM   1452  C  CB    . ARG A 1  189  ? 457.237 8.465   727.466 1.00 132.18 ? 189  ARG A CB    1 
ATOM   1453  C  CG    . ARG A 1  189  ? 458.152 9.314   728.318 1.00 133.71 ? 189  ARG A CG    1 
ATOM   1454  C  CD    . ARG A 1  189  ? 458.140 10.722  727.708 1.00 135.73 ? 189  ARG A CD    1 
ATOM   1455  N  NE    . ARG A 1  189  ? 458.175 11.863  728.617 1.00 139.86 ? 189  ARG A NE    1 
ATOM   1456  C  CZ    . ARG A 1  189  ? 459.051 12.055  729.593 1.00 142.44 ? 189  ARG A CZ    1 
ATOM   1457  N  NH1   . ARG A 1  189  ? 460.003 11.174  729.837 1.00 141.43 ? 189  ARG A NH1   1 
ATOM   1458  N  NH2   . ARG A 1  189  ? 458.975 13.153  730.328 1.00 150.11 ? 189  ARG A NH2   1 
ATOM   1459  N  N     . THR A 1  190  ? 456.940 5.596   726.231 1.00 124.94 ? 190  THR A N     1 
ATOM   1460  C  CA    . THR A 1  190  ? 457.459 4.449   725.477 1.00 118.24 ? 190  THR A CA    1 
ATOM   1461  C  C     . THR A 1  190  ? 457.709 4.852   724.025 1.00 110.16 ? 190  THR A C     1 
ATOM   1462  O  O     . THR A 1  190  ? 457.326 5.938   723.577 1.00 105.87 ? 190  THR A O     1 
ATOM   1463  C  CB    . THR A 1  190  ? 456.543 3.207   725.514 1.00 113.77 ? 190  THR A CB    1 
ATOM   1464  O  OG1   . THR A 1  190  ? 455.189 3.573   725.201 1.00 111.42 ? 190  THR A OG1   1 
ATOM   1465  C  CG2   . THR A 1  190  ? 456.655 2.467   726.825 1.00 115.62 ? 190  THR A CG2   1 
ATOM   1466  N  N     . ASP A 1  191  ? 458.470 4.008   723.333 1.00 114.53 ? 191  ASP A N     1 
ATOM   1467  C  CA    . ASP A 1  191  ? 458.892 4.259   721.955 1.00 121.05 ? 191  ASP A CA    1 
ATOM   1468  C  C     . ASP A 1  191  ? 459.879 5.425   721.903 1.00 123.23 ? 191  ASP A C     1 
ATOM   1469  O  O     . ASP A 1  191  ? 459.990 6.130   720.901 1.00 120.82 ? 191  ASP A O     1 
ATOM   1470  C  CB    . ASP A 1  191  ? 457.715 4.491   720.993 1.00 126.70 ? 191  ASP A CB    1 
ATOM   1471  C  CG    . ASP A 1  191  ? 458.063 4.109   719.530 1.00 127.58 ? 191  ASP A CG    1 
ATOM   1472  O  OD1   . ASP A 1  191  ? 459.258 3.833   719.252 1.00 126.79 ? 191  ASP A OD1   1 
ATOM   1473  O  OD2   . ASP A 1  191  ? 457.151 4.104   718.656 1.00 124.55 ? 191  ASP A OD2   1 
ATOM   1474  N  N     . LEU A 1  192  ? 460.618 5.620   722.979 1.00 128.72 ? 192  LEU A N     1 
ATOM   1475  C  CA    . LEU A 1  192  ? 461.720 6.558   722.983 1.00 126.53 ? 192  LEU A CA    1 
ATOM   1476  C  C     . LEU A 1  192  ? 462.900 5.906   722.255 1.00 117.28 ? 192  LEU A C     1 
ATOM   1477  O  O     . LEU A 1  192  ? 462.912 4.694   722.017 1.00 117.68 ? 192  LEU A O     1 
ATOM   1478  C  CB    . LEU A 1  192  ? 462.025 6.915   724.440 1.00 137.88 ? 192  LEU A CB    1 
ATOM   1479  C  CG    . LEU A 1  192  ? 461.022 7.872   725.127 1.00 140.48 ? 192  LEU A CG    1 
ATOM   1480  C  CD1   . LEU A 1  192  ? 461.673 8.692   726.218 1.00 140.91 ? 192  LEU A CD1   1 
ATOM   1481  C  CD2   . LEU A 1  192  ? 460.240 8.765   724.136 1.00 142.04 ? 192  LEU A CD2   1 
ATOM   1482  N  N     . ASP A 1  193  ? 463.874 6.709   721.843 1.00 111.69 ? 193  ASP A N     1 
ATOM   1483  C  CA    . ASP A 1  193  ? 464.966 6.196   721.016 1.00 104.86 ? 193  ASP A CA    1 
ATOM   1484  C  C     . ASP A 1  193  ? 466.303 6.173   721.748 1.00 106.48 ? 193  ASP A C     1 
ATOM   1485  O  O     . ASP A 1  193  ? 466.688 7.178   722.353 1.00 94.24  ? 193  ASP A O     1 
ATOM   1486  C  CB    . ASP A 1  193  ? 465.097 7.042   719.742 1.00 102.82 ? 193  ASP A CB    1 
ATOM   1487  C  CG    . ASP A 1  193  ? 464.152 6.591   718.629 1.00 103.84 ? 193  ASP A CG    1 
ATOM   1488  O  OD1   . ASP A 1  193  ? 463.540 5.514   718.775 1.00 104.12 ? 193  ASP A OD1   1 
ATOM   1489  O  OD2   . ASP A 1  193  ? 464.028 7.309   717.605 1.00 103.86 ? 193  ASP A OD2   1 
ATOM   1490  N  N     . LYS A 1  194  ? 467.031 5.046   721.659 1.00 92.03  ? 194  LYS A N     1 
ATOM   1491  C  CA    . LYS A 1  194  ? 468.405 4.987   722.154 1.00 99.83  ? 194  LYS A CA    1 
ATOM   1492  C  C     . LYS A 1  194  ? 469.358 4.839   720.964 1.00 100.16 ? 194  LYS A C     1 
ATOM   1493  O  O     . LYS A 1  194  ? 469.434 3.774   720.332 1.00 100.97 ? 194  LYS A O     1 
ATOM   1494  C  CB    . LYS A 1  194  ? 468.584 3.826   723.128 1.00 100.91 ? 194  LYS A CB    1 
ATOM   1495  C  CG    . LYS A 1  194  ? 470.027 3.331   723.325 1.00 104.94 ? 194  LYS A CG    1 
ATOM   1496  C  CD    . LYS A 1  194  ? 470.058 1.898   723.885 1.00 104.90 ? 194  LYS A CD    1 
ATOM   1497  C  CE    . LYS A 1  194  ? 471.326 1.564   724.663 1.00 103.79 ? 194  LYS A CE    1 
ATOM   1498  N  NZ    . LYS A 1  194  ? 471.235 0.189   725.251 1.00 105.60 ? 194  LYS A NZ    1 
ATOM   1499  N  N     . LEU A 1  195  ? 470.239 5.816   720.821 1.00 100.87 ? 195  LEU A N     1 
ATOM   1500  C  CA    . LEU A 1  195  ? 471.081 5.959   719.651 1.00 96.94  ? 195  LEU A CA    1 
ATOM   1501  C  C     . LEU A 1  195  ? 472.498 5.555   719.993 1.00 98.79  ? 195  LEU A C     1 
ATOM   1502  O  O     . LEU A 1  195  ? 473.077 6.073   720.944 1.00 104.19 ? 195  LEU A O     1 
ATOM   1503  C  CB    . LEU A 1  195  ? 471.035 7.411   719.166 1.00 93.90  ? 195  LEU A CB    1 
ATOM   1504  C  CG    . LEU A 1  195  ? 472.032 7.842   718.100 1.00 92.48  ? 195  LEU A CG    1 
ATOM   1505  C  CD1   . LEU A 1  195  ? 471.728 7.058   716.858 1.00 85.68  ? 195  LEU A CD1   1 
ATOM   1506  C  CD2   . LEU A 1  195  ? 471.850 9.314   717.827 1.00 95.74  ? 195  LEU A CD2   1 
ATOM   1507  N  N     . THR A 1  196  ? 473.074 4.673   719.200 1.00 103.93 ? 196  THR A N     1 
ATOM   1508  C  CA    . THR A 1  196  ? 474.453 4.260   719.417 1.00 109.96 ? 196  THR A CA    1 
ATOM   1509  C  C     . THR A 1  196  ? 475.229 4.425   718.116 1.00 106.11 ? 196  THR A C     1 
ATOM   1510  O  O     . THR A 1  196  ? 474.899 3.778   717.116 1.00 102.55 ? 196  THR A O     1 
ATOM   1511  C  CB    . THR A 1  196  ? 474.501 2.820   719.918 1.00 113.58 ? 196  THR A CB    1 
ATOM   1512  O  OG1   . THR A 1  196  ? 473.383 2.596   720.799 1.00 111.17 ? 196  THR A OG1   1 
ATOM   1513  C  CG2   . THR A 1  196  ? 475.824 2.558   720.651 1.00 114.54 ? 196  THR A CG2   1 
ATOM   1514  N  N     . LEU A 1  197  ? 476.204 5.339   718.117 1.00 106.87 ? 197  LEU A N     1 
ATOM   1515  C  CA    . LEU A 1  197  ? 477.085 5.614   716.974 1.00 112.43 ? 197  LEU A CA    1 
ATOM   1516  C  C     . LEU A 1  197  ? 478.383 4.810   717.057 1.00 119.08 ? 197  LEU A C     1 
ATOM   1517  O  O     . LEU A 1  197  ? 479.153 4.977   718.014 1.00 127.23 ? 197  LEU A O     1 
ATOM   1518  C  CB    . LEU A 1  197  ? 477.408 7.103   716.815 1.00 109.74 ? 197  LEU A CB    1 
ATOM   1519  C  CG    . LEU A 1  197  ? 476.500 8.051   716.031 1.00 99.99  ? 197  LEU A CG    1 
ATOM   1520  C  CD1   . LEU A 1  197  ? 476.965 9.493   716.122 1.00 98.93  ? 197  LEU A CD1   1 
ATOM   1521  C  CD2   . LEU A 1  197  ? 476.615 7.622   714.597 1.00 90.14  ? 197  LEU A CD2   1 
ATOM   1522  N  N     . ARG A 1  198  ? 478.580 3.872   716.118 1.00 108.63 ? 198  ARG A N     1 
ATOM   1523  C  CA    . ARG A 1  198  ? 479.840 3.139   715.987 1.00 106.93 ? 198  ARG A CA    1 
ATOM   1524  C  C     . ARG A 1  198  ? 480.696 3.836   714.934 1.00 109.07 ? 198  ARG A C     1 
ATOM   1525  O  O     . ARG A 1  198  ? 480.248 4.029   713.804 1.00 114.95 ? 198  ARG A O     1 
ATOM   1526  C  CB    . ARG A 1  198  ? 479.605 1.671   715.637 1.00 102.46 ? 198  ARG A CB    1 
ATOM   1527  C  CG    . ARG A 1  198  ? 478.357 1.145   716.269 1.00 100.24 ? 198  ARG A CG    1 
ATOM   1528  C  CD    . ARG A 1  198  ? 478.477 -0.282  716.767 1.00 104.08 ? 198  ARG A CD    1 
ATOM   1529  N  NE    . ARG A 1  198  ? 478.191 -1.302  715.770 1.00 107.37 ? 198  ARG A NE    1 
ATOM   1530  C  CZ    . ARG A 1  198  ? 478.810 -2.479  715.729 1.00 113.14 ? 198  ARG A CZ    1 
ATOM   1531  N  NH1   . ARG A 1  198  ? 478.468 -3.375  714.798 1.00 114.82 ? 198  ARG A NH1   1 
ATOM   1532  N  NH2   . ARG A 1  198  ? 479.752 -2.766  716.637 1.00 111.49 ? 198  ARG A NH2   1 
ATOM   1533  N  N     . ILE A 1  199  ? 481.938 4.169   715.293 1.00 107.03 ? 199  ILE A N     1 
ATOM   1534  C  CA    . ILE A 1  199  ? 482.837 4.956   714.450 1.00 103.91 ? 199  ILE A CA    1 
ATOM   1535  C  C     . ILE A 1  199  ? 484.168 4.223   714.407 1.00 104.09 ? 199  ILE A C     1 
ATOM   1536  O  O     . ILE A 1  199  ? 484.846 4.106   715.444 1.00 107.52 ? 199  ILE A O     1 
ATOM   1537  C  CB    . ILE A 1  199  ? 483.093 6.357   715.048 1.00 104.53 ? 199  ILE A CB    1 
ATOM   1538  C  CG1   . ILE A 1  199  ? 481.854 7.237   715.086 1.00 99.61  ? 199  ILE A CG1   1 
ATOM   1539  C  CG2   . ILE A 1  199  ? 484.146 7.099   714.234 1.00 102.55 ? 199  ILE A CG2   1 
ATOM   1540  C  CD1   . ILE A 1  199  ? 481.073 7.145   713.929 1.00 100.28 ? 199  ILE A CD1   1 
ATOM   1541  N  N     . TRP A 1  200  ? 484.574 3.786   713.213 1.00 100.25 ? 200  TRP A N     1 
ATOM   1542  C  CA    . TRP A 1  200  ? 485.893 3.201   712.981 1.00 102.98 ? 200  TRP A CA    1 
ATOM   1543  C  C     . TRP A 1  200  ? 486.831 4.175   712.275 1.00 104.17 ? 200  TRP A C     1 
ATOM   1544  O  O     . TRP A 1  200  ? 486.404 4.958   711.427 1.00 101.92 ? 200  TRP A O     1 
ATOM   1545  C  CB    . TRP A 1  200  ? 485.832 1.933   712.158 1.00 101.76 ? 200  TRP A CB    1 
ATOM   1546  C  CG    . TRP A 1  200  ? 485.191 0.753   712.716 1.00 101.37 ? 200  TRP A CG    1 
ATOM   1547  C  CD1   . TRP A 1  200  ? 485.826 -0.346  713.205 1.00 103.99 ? 200  TRP A CD1   1 
ATOM   1548  C  CD2   . TRP A 1  200  ? 483.795 0.464   712.756 1.00 98.38  ? 200  TRP A CD2   1 
ATOM   1549  N  NE1   . TRP A 1  200  ? 484.909 -1.293  713.577 1.00 102.85 ? 200  TRP A NE1   1 
ATOM   1550  C  CE2   . TRP A 1  200  ? 483.652 -0.819  713.308 1.00 99.42  ? 200  TRP A CE2   1 
ATOM   1551  C  CE3   . TRP A 1  200  ? 482.654 1.171   712.400 1.00 105.04 ? 200  TRP A CE3   1 
ATOM   1552  C  CZ2   . TRP A 1  200  ? 482.415 -1.409  713.508 1.00 97.40  ? 200  TRP A CZ2   1 
ATOM   1553  C  CZ3   . TRP A 1  200  ? 481.425 0.582   712.603 1.00 102.38 ? 200  TRP A CZ3   1 
ATOM   1554  C  CH2   . TRP A 1  200  ? 481.317 -0.694  713.144 1.00 100.43 ? 200  TRP A CH2   1 
ATOM   1555  N  N     . THR A 1  201  ? 488.084 4.212   712.704 1.00 108.01 ? 201  THR A N     1 
ATOM   1556  C  CA    . THR A 1  201  ? 488.999 5.174   712.121 1.00 118.12 ? 201  THR A CA    1 
ATOM   1557  C  C     . THR A 1  201  ? 490.338 4.506   711.856 1.00 119.64 ? 201  THR A C     1 
ATOM   1558  O  O     . THR A 1  201  ? 490.618 3.418   712.366 1.00 120.98 ? 201  THR A O     1 
ATOM   1559  C  CB    . THR A 1  201  ? 489.173 6.399   713.016 1.00 128.45 ? 201  THR A CB    1 
ATOM   1560  O  OG1   . THR A 1  201  ? 487.897 6.799   713.501 1.00 132.32 ? 201  THR A OG1   1 
ATOM   1561  C  CG2   . THR A 1  201  ? 489.656 7.533   712.213 1.00 133.21 ? 201  THR A CG2   1 
ATOM   1562  N  N     . ASP A 1  202  ? 491.161 5.165   711.023 1.00 124.53 ? 202  ASP A N     1 
ATOM   1563  C  CA    . ASP A 1  202  ? 492.493 4.657   710.719 1.00 131.74 ? 202  ASP A CA    1 
ATOM   1564  C  C     . ASP A 1  202  ? 493.495 4.982   711.818 1.00 139.76 ? 202  ASP A C     1 
ATOM   1565  O  O     . ASP A 1  202  ? 494.615 4.463   711.777 1.00 145.40 ? 202  ASP A O     1 
ATOM   1566  C  CB    . ASP A 1  202  ? 493.021 5.167   709.353 1.00 136.63 ? 202  ASP A CB    1 
ATOM   1567  C  CG    . ASP A 1  202  ? 493.111 6.704   709.240 1.00 137.49 ? 202  ASP A CG    1 
ATOM   1568  O  OD1   . ASP A 1  202  ? 493.026 7.416   710.264 1.00 136.50 ? 202  ASP A OD1   1 
ATOM   1569  O  OD2   . ASP A 1  202  ? 493.343 7.192   708.100 1.00 138.66 ? 202  ASP A OD2   1 
ATOM   1570  N  N     . GLY A 1  203  ? 493.116 5.817   712.794 1.00 137.27 ? 203  GLY A N     1 
ATOM   1571  C  CA    . GLY A 1  203  ? 493.962 6.175   713.911 1.00 139.39 ? 203  GLY A CA    1 
ATOM   1572  C  C     . GLY A 1  203  ? 494.634 7.537   713.831 1.00 138.99 ? 203  GLY A C     1 
ATOM   1573  O  O     . GLY A 1  203  ? 495.128 8.015   714.861 1.00 141.90 ? 203  GLY A O     1 
ATOM   1574  N  N     . SER A 1  204  ? 494.705 8.171   712.647 1.00 134.18 ? 204  SER A N     1 
ATOM   1575  C  CA    . SER A 1  204  ? 495.321 9.498   712.614 1.00 133.14 ? 204  SER A CA    1 
ATOM   1576  C  C     . SER A 1  204  ? 494.463 10.463  713.420 1.00 131.64 ? 204  SER A C     1 
ATOM   1577  O  O     . SER A 1  204  ? 494.976 11.236  714.239 1.00 137.39 ? 204  SER A O     1 
ATOM   1578  C  CB    . SER A 1  204  ? 495.584 9.983   711.169 1.00 129.75 ? 204  SER A CB    1 
ATOM   1579  O  OG    . SER A 1  204  ? 494.452 10.056  710.310 1.00 124.84 ? 204  SER A OG    1 
ATOM   1580  N  N     . VAL A 1  205  ? 493.148 10.342  713.292 1.00 125.63 ? 205  VAL A N     1 
ATOM   1581  C  CA    . VAL A 1  205  ? 492.246 10.965  714.240 1.00 128.83 ? 205  VAL A CA    1 
ATOM   1582  C  C     . VAL A 1  205  ? 491.410 9.836   714.823 1.00 132.55 ? 205  VAL A C     1 
ATOM   1583  O  O     . VAL A 1  205  ? 491.244 8.762   714.235 1.00 129.57 ? 205  VAL A O     1 
ATOM   1584  C  CB    . VAL A 1  205  ? 491.337 12.076  713.659 1.00 124.16 ? 205  VAL A CB    1 
ATOM   1585  C  CG1   . VAL A 1  205  ? 492.004 12.809  712.512 1.00 122.72 ? 205  VAL A CG1   1 
ATOM   1586  C  CG2   . VAL A 1  205  ? 489.954 11.538  713.304 1.00 117.07 ? 205  VAL A CG2   1 
ATOM   1587  N  N     . THR A 1  206  ? 490.914 10.088  716.006 1.00 141.13 ? 206  THR A N     1 
ATOM   1588  C  CA    . THR A 1  206  ? 490.188 9.228   716.908 1.00 137.09 ? 206  THR A CA    1 
ATOM   1589  C  C     . THR A 1  206  ? 488.694 9.288   716.658 1.00 137.18 ? 206  THR A C     1 
ATOM   1590  O  O     . THR A 1  206  ? 488.164 10.347  716.305 1.00 143.12 ? 206  THR A O     1 
ATOM   1591  C  CB    . THR A 1  206  ? 490.527 9.618   718.307 1.00 136.65 ? 206  THR A CB    1 
ATOM   1592  O  OG1   . THR A 1  206  ? 491.690 8.868   718.642 1.00 137.87 ? 206  THR A OG1   1 
ATOM   1593  C  CG2   . THR A 1  206  ? 489.393 9.365   719.276 1.00 143.55 ? 206  THR A CG2   1 
ATOM   1594  N  N     . PRO A 1  207  ? 488.027 8.147   716.833 1.00 129.60 ? 207  PRO A N     1 
ATOM   1595  C  CA    . PRO A 1  207  ? 486.573 8.137   716.662 1.00 124.98 ? 207  PRO A CA    1 
ATOM   1596  C  C     . PRO A 1  207  ? 485.877 9.281   717.378 1.00 123.80 ? 207  PRO A C     1 
ATOM   1597  O  O     . PRO A 1  207  ? 485.000 9.926   716.789 1.00 122.45 ? 207  PRO A O     1 
ATOM   1598  C  CB    . PRO A 1  207  ? 486.185 6.775   717.253 1.00 121.85 ? 207  PRO A CB    1 
ATOM   1599  C  CG    . PRO A 1  207  ? 487.350 5.904   716.999 1.00 120.98 ? 207  PRO A CG    1 
ATOM   1600  C  CD    . PRO A 1  207  ? 488.563 6.799   717.110 1.00 127.65 ? 207  PRO A CD    1 
ATOM   1601  N  N     . LEU A 1  208  ? 486.307 9.607   718.602 1.00 124.77 ? 208  LEU A N     1 
ATOM   1602  C  CA    . LEU A 1  208  ? 485.730 10.745  719.317 1.00 125.24 ? 208  LEU A CA    1 
ATOM   1603  C  C     . LEU A 1  208  ? 486.005 12.078  718.633 1.00 124.41 ? 208  LEU A C     1 
ATOM   1604  O  O     . LEU A 1  208  ? 485.082 12.873  718.411 1.00 122.94 ? 208  LEU A O     1 
ATOM   1605  C  CB    . LEU A 1  208  ? 486.262 10.792  720.752 1.00 128.27 ? 208  LEU A CB    1 
ATOM   1606  C  CG    . LEU A 1  208  ? 485.709 11.994  721.531 1.00 131.31 ? 208  LEU A CG    1 
ATOM   1607  C  CD1   . LEU A 1  208  ? 484.180 11.994  721.563 1.00 121.33 ? 208  LEU A CD1   1 
ATOM   1608  C  CD2   . LEU A 1  208  ? 486.311 12.107  722.925 1.00 135.96 ? 208  LEU A CD2   1 
ATOM   1609  N  N     . GLU A 1  209  ? 487.255 12.319  718.241 1.00 123.10 ? 209  GLU A N     1 
ATOM   1610  C  CA    . GLU A 1  209  ? 487.570 13.564  717.555 1.00 123.87 ? 209  GLU A CA    1 
ATOM   1611  C  C     . GLU A 1  209  ? 486.720 13.733  716.300 1.00 122.75 ? 209  GLU A C     1 
ATOM   1612  O  O     . GLU A 1  209  ? 486.139 14.801  716.067 1.00 123.05 ? 209  GLU A O     1 
ATOM   1613  C  CB    . GLU A 1  209  ? 489.033 13.574  717.180 1.00 124.18 ? 209  GLU A CB    1 
ATOM   1614  C  CG    . GLU A 1  209  ? 489.977 13.360  718.281 1.00 129.17 ? 209  GLU A CG    1 
ATOM   1615  C  CD    . GLU A 1  209  ? 491.368 13.322  717.723 1.00 131.85 ? 209  GLU A CD    1 
ATOM   1616  O  OE1   . GLU A 1  209  ? 492.277 12.704  718.313 1.00 137.42 ? 209  GLU A OE1   1 
ATOM   1617  O  OE2   . GLU A 1  209  ? 491.543 13.935  716.654 1.00 131.16 ? 209  GLU A OE2   1 
ATOM   1618  N  N     . ALA A 1  210  ? 486.571 12.657  715.530 1.00 118.87 ? 210  ALA A N     1 
ATOM   1619  C  CA    . ALA A 1  210  ? 485.733 12.686  714.341 1.00 113.89 ? 210  ALA A CA    1 
ATOM   1620  C  C     . ALA A 1  210  ? 484.325 13.158  714.684 1.00 118.16 ? 210  ALA A C     1 
ATOM   1621  O  O     . ALA A 1  210  ? 483.820 14.136  714.115 1.00 117.55 ? 210  ALA A O     1 
ATOM   1622  C  CB    . ALA A 1  210  ? 485.709 11.290  713.717 1.00 106.52 ? 210  ALA A CB    1 
ATOM   1623  N  N     . LEU A 1  211  ? 483.692 12.479  715.640 1.00 119.61 ? 211  LEU A N     1 
ATOM   1624  C  CA    . LEU A 1  211  ? 482.339 12.823  716.056 1.00 112.87 ? 211  LEU A CA    1 
ATOM   1625  C  C     . LEU A 1  211  ? 482.218 14.292  716.448 1.00 111.89 ? 211  LEU A C     1 
ATOM   1626  O  O     . LEU A 1  211  ? 481.242 14.957  716.090 1.00 107.70 ? 211  LEU A O     1 
ATOM   1627  C  CB    . LEU A 1  211  ? 481.942 11.913  717.212 1.00 110.60 ? 211  LEU A CB    1 
ATOM   1628  C  CG    . LEU A 1  211  ? 480.643 12.219  717.933 1.00 111.05 ? 211  LEU A CG    1 
ATOM   1629  C  CD1   . LEU A 1  211  ? 479.448 12.250  716.965 1.00 103.60 ? 211  LEU A CD1   1 
ATOM   1630  C  CD2   . LEU A 1  211  ? 480.454 11.203  719.061 1.00 116.92 ? 211  LEU A CD2   1 
ATOM   1631  N  N     . ASN A 1  212  ? 483.190 14.820  717.185 1.00 117.02 ? 212  ASN A N     1 
ATOM   1632  C  CA    . ASN A 1  212  ? 483.116 16.231  717.550 1.00 123.37 ? 212  ASN A CA    1 
ATOM   1633  C  C     . ASN A 1  212  ? 483.219 17.128  716.324 1.00 130.67 ? 212  ASN A C     1 
ATOM   1634  O  O     . ASN A 1  212  ? 482.458 18.095  716.193 1.00 136.45 ? 212  ASN A O     1 
ATOM   1635  C  CB    . ASN A 1  212  ? 484.197 16.588  718.556 1.00 125.01 ? 212  ASN A CB    1 
ATOM   1636  C  CG    . ASN A 1  212  ? 483.942 15.992  719.891 1.00 123.40 ? 212  ASN A CG    1 
ATOM   1637  O  OD1   . ASN A 1  212  ? 482.801 15.947  720.345 1.00 123.94 ? 212  ASN A OD1   1 
ATOM   1638  N  ND2   . ASN A 1  212  ? 484.992 15.514  720.536 1.00 125.59 ? 212  ASN A ND2   1 
ATOM   1639  N  N     . GLN A 1  213  ? 484.139 16.810  715.405 1.00 126.28 ? 213  GLN A N     1 
ATOM   1640  C  CA    . GLN A 1  213  ? 484.271 17.604  714.190 1.00 120.37 ? 213  GLN A CA    1 
ATOM   1641  C  C     . GLN A 1  213  ? 483.003 17.540  713.367 1.00 111.71 ? 213  GLN A C     1 
ATOM   1642  O  O     . GLN A 1  213  ? 482.529 18.565  712.864 1.00 109.22 ? 213  GLN A O     1 
ATOM   1643  C  CB    . GLN A 1  213  ? 485.448 17.081  713.387 1.00 116.56 ? 213  GLN A CB    1 
ATOM   1644  C  CG    . GLN A 1  213  ? 486.727 17.192  714.161 1.00 130.26 ? 213  GLN A CG    1 
ATOM   1645  C  CD    . GLN A 1  213  ? 487.943 16.728  713.385 1.00 141.84 ? 213  GLN A CD    1 
ATOM   1646  O  OE1   . GLN A 1  213  ? 488.293 17.290  712.342 1.00 147.39 ? 213  GLN A OE1   1 
ATOM   1647  N  NE2   . GLN A 1  213  ? 488.609 15.697  713.900 1.00 144.91 ? 213  GLN A NE2   1 
ATOM   1648  N  N     . ALA A 1  214  ? 482.396 16.358  713.295 1.00 111.86 ? 214  ALA A N     1 
ATOM   1649  C  CA    . ALA A 1  214  ? 481.145 16.209  712.562 1.00 113.03 ? 214  ALA A CA    1 
ATOM   1650  C  C     . ALA A 1  214  ? 480.057 17.090  713.163 1.00 114.47 ? 214  ALA A C     1 
ATOM   1651  O  O     . ALA A 1  214  ? 479.379 17.841  712.452 1.00 115.01 ? 214  ALA A O     1 
ATOM   1652  C  CB    . ALA A 1  214  ? 480.723 14.738  712.539 1.00 113.76 ? 214  ALA A CB    1 
ATOM   1653  N  N     . VAL A 1  215  ? 479.859 16.983  714.475 1.00 115.68 ? 215  VAL A N     1 
ATOM   1654  C  CA    . VAL A 1  215  ? 478.878 17.814  715.170 1.00 115.85 ? 215  VAL A CA    1 
ATOM   1655  C  C     . VAL A 1  215  ? 479.169 19.290  714.938 1.00 117.09 ? 215  VAL A C     1 
ATOM   1656  O  O     . VAL A 1  215  ? 478.265 20.082  714.628 1.00 113.82 ? 215  VAL A O     1 
ATOM   1657  C  CB    . VAL A 1  215  ? 478.869 17.467  716.675 1.00 108.99 ? 215  VAL A CB    1 
ATOM   1658  C  CG1   . VAL A 1  215  ? 478.017 18.444  717.443 1.00 109.58 ? 215  VAL A CG1   1 
ATOM   1659  C  CG2   . VAL A 1  215  ? 478.355 16.060  716.877 1.00 102.20 ? 215  VAL A CG2   1 
ATOM   1660  N  N     . GLU A 1  216  ? 480.442 19.672  715.048 1.00 116.88 ? 216  GLU A N     1 
ATOM   1661  C  CA    . GLU A 1  216  ? 480.815 21.058  714.825 1.00 119.83 ? 216  GLU A CA    1 
ATOM   1662  C  C     . GLU A 1  216  ? 480.498 21.506  713.405 1.00 114.05 ? 216  GLU A C     1 
ATOM   1663  O  O     . GLU A 1  216  ? 480.083 22.652  713.195 1.00 111.96 ? 216  GLU A O     1 
ATOM   1664  C  CB    . GLU A 1  216  ? 482.292 21.247  715.150 1.00 128.89 ? 216  GLU A CB    1 
ATOM   1665  C  CG    . GLU A 1  216  ? 482.803 22.617  714.834 1.00 136.79 ? 216  GLU A CG    1 
ATOM   1666  C  CD    . GLU A 1  216  ? 482.044 23.698  715.573 1.00 144.06 ? 216  GLU A CD    1 
ATOM   1667  O  OE1   . GLU A 1  216  ? 481.391 23.426  716.624 1.00 142.51 ? 216  GLU A OE1   1 
ATOM   1668  O  OE2   . GLU A 1  216  ? 482.087 24.836  715.061 1.00 149.61 ? 216  GLU A OE2   1 
ATOM   1669  N  N     . ILE A 1  217  ? 480.712 20.638  712.410 1.00 112.65 ? 217  ILE A N     1 
ATOM   1670  C  CA    . ILE A 1  217  ? 480.326 20.994  711.042 1.00 108.60 ? 217  ILE A CA    1 
ATOM   1671  C  C     . ILE A 1  217  ? 478.825 21.220  710.949 1.00 99.00  ? 217  ILE A C     1 
ATOM   1672  O  O     . ILE A 1  217  ? 478.361 22.301  710.564 1.00 99.36  ? 217  ILE A O     1 
ATOM   1673  C  CB    . ILE A 1  217  ? 480.772 19.904  710.063 1.00 100.42 ? 217  ILE A CB    1 
ATOM   1674  C  CG1   . ILE A 1  217  ? 482.273 19.975  709.880 1.00 107.37 ? 217  ILE A CG1   1 
ATOM   1675  C  CG2   . ILE A 1  217  ? 480.028 20.063  708.745 1.00 96.19  ? 217  ILE A CG2   1 
ATOM   1676  C  CD1   . ILE A 1  217  ? 482.822 18.755  709.230 1.00 111.62 ? 217  ILE A CD1   1 
ATOM   1677  N  N     . LEU A 1  218  ? 478.054 20.262  711.457 1.00 97.92  ? 218  LEU A N     1 
ATOM   1678  C  CA    . LEU A 1  218  ? 476.607 20.375  711.397 1.00 98.30  ? 218  LEU A CA    1 
ATOM   1679  C  C     . LEU A 1  218  ? 476.149 21.615  712.136 1.00 103.05 ? 218  LEU A C     1 
ATOM   1680  O  O     . LEU A 1  218  ? 475.296 22.358  711.636 1.00 107.56 ? 218  LEU A O     1 
ATOM   1681  C  CB    . LEU A 1  218  ? 475.979 19.090  711.941 1.00 97.47  ? 218  LEU A CB    1 
ATOM   1682  C  CG    . LEU A 1  218  ? 474.466 18.865  711.936 1.00 94.96  ? 218  LEU A CG    1 
ATOM   1683  C  CD1   . LEU A 1  218  ? 473.812 19.350  710.694 1.00 87.88  ? 218  LEU A CD1   1 
ATOM   1684  C  CD2   . LEU A 1  218  ? 474.233 17.352  712.070 1.00 87.98  ? 218  LEU A CD2   1 
ATOM   1685  N  N     . ARG A 1  219  ? 476.735 21.876  713.305 1.00 104.78 ? 219  ARG A N     1 
ATOM   1686  C  CA    . ARG A 1  219  ? 476.390 23.070  714.067 1.00 110.21 ? 219  ARG A CA    1 
ATOM   1687  C  C     . ARG A 1  219  ? 476.645 24.325  713.250 1.00 113.79 ? 219  ARG A C     1 
ATOM   1688  O  O     . ARG A 1  219  ? 475.758 25.163  713.046 1.00 112.70 ? 219  ARG A O     1 
ATOM   1689  C  CB    . ARG A 1  219  ? 477.205 23.124  715.353 1.00 112.05 ? 219  ARG A CB    1 
ATOM   1690  C  CG    . ARG A 1  219  ? 476.926 24.356  716.166 1.00 114.46 ? 219  ARG A CG    1 
ATOM   1691  C  CD    . ARG A 1  219  ? 478.196 24.910  716.781 1.00 121.56 ? 219  ARG A CD    1 
ATOM   1692  N  NE    . ARG A 1  219  ? 478.349 26.351  716.579 1.00 128.74 ? 219  ARG A NE    1 
ATOM   1693  C  CZ    . ARG A 1  219  ? 479.363 26.920  715.936 1.00 132.72 ? 219  ARG A CZ    1 
ATOM   1694  N  NH1   . ARG A 1  219  ? 479.420 28.240  715.785 1.00 133.79 ? 219  ARG A NH1   1 
ATOM   1695  N  NH2   . ARG A 1  219  ? 480.350 26.170  715.485 1.00 135.15 ? 219  ARG A NH2   1 
ATOM   1696  N  N     . GLU A 1  220  ? 477.874 24.461  712.779 1.00 117.74 ? 220  GLU A N     1 
ATOM   1697  C  CA    . GLU A 1  220  ? 478.257 25.597  711.966 1.00 120.48 ? 220  GLU A CA    1 
ATOM   1698  C  C     . GLU A 1  220  ? 477.354 25.759  710.758 1.00 109.80 ? 220  GLU A C     1 
ATOM   1699  O  O     . GLU A 1  220  ? 477.059 26.884  710.352 1.00 111.38 ? 220  GLU A O     1 
ATOM   1700  C  CB    . GLU A 1  220  ? 479.733 25.432  711.589 1.00 130.28 ? 220  GLU A CB    1 
ATOM   1701  C  CG    . GLU A 1  220  ? 480.368 26.529  710.759 1.00 140.16 ? 220  GLU A CG    1 
ATOM   1702  C  CD    . GLU A 1  220  ? 481.793 26.159  710.346 1.00 145.70 ? 220  GLU A CD    1 
ATOM   1703  O  OE1   . GLU A 1  220  ? 482.565 25.710  711.230 1.00 148.25 ? 220  GLU A OE1   1 
ATOM   1704  O  OE2   . GLU A 1  220  ? 482.112 26.250  709.135 1.00 144.90 ? 220  GLU A OE2   1 
ATOM   1705  N  N     . HIS A 1  221  ? 476.839 24.662  710.223 1.00 107.49 ? 221  HIS A N     1 
ATOM   1706  C  CA    . HIS A 1  221  ? 475.944 24.763  709.072 1.00 108.93 ? 221  HIS A CA    1 
ATOM   1707  C  C     . HIS A 1  221  ? 474.593 25.396  709.396 1.00 109.39 ? 221  HIS A C     1 
ATOM   1708  O  O     . HIS A 1  221  ? 474.080 26.215  708.621 1.00 108.67 ? 221  HIS A O     1 
ATOM   1709  C  CB    . HIS A 1  221  ? 475.725 23.369  708.503 1.00 106.59 ? 221  HIS A CB    1 
ATOM   1710  C  CG    . HIS A 1  221  ? 476.646 23.033  707.376 1.00 110.80 ? 221  HIS A CG    1 
ATOM   1711  N  ND1   . HIS A 1  221  ? 476.446 23.475  706.089 1.00 110.16 ? 221  HIS A ND1   1 
ATOM   1712  C  CD2   . HIS A 1  221  ? 477.788 22.303  707.354 1.00 111.49 ? 221  HIS A CD2   1 
ATOM   1713  C  CE1   . HIS A 1  221  ? 477.418 23.016  705.319 1.00 109.62 ? 221  HIS A CE1   1 
ATOM   1714  N  NE2   . HIS A 1  221  ? 478.242 22.301  706.063 1.00 109.10 ? 221  HIS A NE2   1 
ATOM   1715  N  N     . LEU A 1  222  ? 474.013 25.060  710.537 1.00 111.23 ? 222  LEU A N     1 
ATOM   1716  C  CA    . LEU A 1  222  ? 472.743 25.664  710.918 1.00 110.13 ? 222  LEU A CA    1 
ATOM   1717  C  C     . LEU A 1  222  ? 472.839 27.178  711.077 1.00 114.71 ? 222  LEU A C     1 
ATOM   1718  O  O     . LEU A 1  222  ? 471.855 27.890  710.835 1.00 114.14 ? 222  LEU A O     1 
ATOM   1719  C  CB    . LEU A 1  222  ? 472.267 24.993  712.201 1.00 108.80 ? 222  LEU A CB    1 
ATOM   1720  C  CG    . LEU A 1  222  ? 471.947 23.538  711.843 1.00 103.15 ? 222  LEU A CG    1 
ATOM   1721  C  CD1   . LEU A 1  222  ? 471.634 22.729  713.060 1.00 101.71 ? 222  LEU A CD1   1 
ATOM   1722  C  CD2   . LEU A 1  222  ? 470.835 23.444  710.841 1.00 102.66 ? 222  LEU A CD2   1 
ATOM   1723  N  N     . THR A 1  223  ? 474.022 27.685  711.439 1.00 112.71 ? 223  THR A N     1 
ATOM   1724  C  CA    . THR A 1  223  ? 474.261 29.124  711.495 1.00 118.70 ? 223  THR A CA    1 
ATOM   1725  C  C     . THR A 1  223  ? 473.880 29.833  710.200 1.00 122.65 ? 223  THR A C     1 
ATOM   1726  O  O     . THR A 1  223  ? 473.428 30.987  710.250 1.00 124.96 ? 223  THR A O     1 
ATOM   1727  C  CB    . THR A 1  223  ? 475.707 29.405  711.872 1.00 122.09 ? 223  THR A CB    1 
ATOM   1728  O  OG1   . THR A 1  223  ? 476.570 28.992  710.811 1.00 130.54 ? 223  THR A OG1   1 
ATOM   1729  C  CG2   . THR A 1  223  ? 476.055 28.626  713.122 1.00 121.23 ? 223  THR A CG2   1 
ATOM   1730  N  N     . TYR A 1  224  ? 474.071 29.175  709.032 1.00 125.16 ? 224  TYR A N     1 
ATOM   1731  C  CA    . TYR A 1  224  ? 473.903 29.795  707.708 1.00 121.43 ? 224  TYR A CA    1 
ATOM   1732  C  C     . TYR A 1  224  ? 472.487 30.277  707.464 1.00 118.78 ? 224  TYR A C     1 
ATOM   1733  O  O     . TYR A 1  224  ? 472.242 30.958  706.462 1.00 115.98 ? 224  TYR A O     1 
ATOM   1734  C  CB    . TYR A 1  224  ? 474.314 28.852  706.587 1.00 124.44 ? 224  TYR A CB    1 
ATOM   1735  C  CG    . TYR A 1  224  ? 475.746 28.394  706.693 1.00 132.67 ? 224  TYR A CG    1 
ATOM   1736  C  CD1   . TYR A 1  224  ? 476.736 29.272  707.133 1.00 139.22 ? 224  TYR A CD1   1 
ATOM   1737  C  CD2   . TYR A 1  224  ? 476.132 27.120  706.274 1.00 130.72 ? 224  TYR A CD2   1 
ATOM   1738  C  CE1   . TYR A 1  224  ? 478.062 28.878  707.217 1.00 142.31 ? 224  TYR A CE1   1 
ATOM   1739  C  CE2   . TYR A 1  224  ? 477.460 26.715  706.346 1.00 132.31 ? 224  TYR A CE2   1 
ATOM   1740  C  CZ    . TYR A 1  224  ? 478.421 27.598  706.819 1.00 139.12 ? 224  TYR A CZ    1 
ATOM   1741  O  OH    . TYR A 1  224  ? 479.741 27.201  706.903 1.00 140.94 ? 224  TYR A OH    1 
ATOM   1742  N  N     . PHE A 1  225  ? 471.550 29.842  708.285 1.00 116.56 ? 225  PHE A N     1 
ATOM   1743  C  CA    . PHE A 1  225  ? 470.154 30.199  708.190 1.00 116.58 ? 225  PHE A CA    1 
ATOM   1744  C  C     . PHE A 1  225  ? 469.899 31.547  708.841 1.00 125.68 ? 225  PHE A C     1 
ATOM   1745  O  O     . PHE A 1  225  ? 468.747 31.961  708.953 1.00 127.37 ? 225  PHE A O     1 
ATOM   1746  C  CB    . PHE A 1  225  ? 469.302 29.139  708.866 1.00 108.09 ? 225  PHE A CB    1 
ATOM   1747  C  CG    . PHE A 1  225  ? 469.197 27.882  708.085 1.00 105.35 ? 225  PHE A CG    1 
ATOM   1748  C  CD1   . PHE A 1  225  ? 468.217 27.737  707.114 1.00 101.90 ? 225  PHE A CD1   1 
ATOM   1749  C  CD2   . PHE A 1  225  ? 470.088 26.841  708.295 1.00 106.78 ? 225  PHE A CD2   1 
ATOM   1750  C  CE1   . PHE A 1  225  ? 468.112 26.563  706.375 1.00 95.21  ? 225  PHE A CE1   1 
ATOM   1751  C  CE2   . PHE A 1  225  ? 469.986 25.655  707.551 1.00 102.29 ? 225  PHE A CE2   1 
ATOM   1752  C  CZ    . PHE A 1  225  ? 469.000 25.521  706.589 1.00 94.51  ? 225  PHE A CZ    1 
ATOM   1753  N  N     . SER A 1  226  ? 470.940 32.206  709.348 1.00 139.90 ? 226  SER A N     1 
ATOM   1754  C  CA    . SER A 1  226  ? 470.718 33.429  710.106 1.00 158.23 ? 226  SER A CA    1 
ATOM   1755  C  C     . SER A 1  226  ? 470.155 34.565  709.258 1.00 166.64 ? 226  SER A C     1 
ATOM   1756  O  O     . SER A 1  226  ? 469.066 35.071  709.543 1.00 171.97 ? 226  SER A O     1 
ATOM   1757  C  CB    . SER A 1  226  ? 472.039 33.855  710.763 1.00 165.25 ? 226  SER A CB    1 
ATOM   1758  O  OG    . SER A 1  226  ? 473.079 34.017  709.800 1.00 164.52 ? 226  SER A OG    1 
ATOM   1759  N  N     . ASN A 1  227  ? 470.862 34.986  708.210 1.00 174.11 ? 227  ASN A N     1 
ATOM   1760  C  CA    . ASN A 1  227  ? 470.433 36.206  707.533 1.00 176.21 ? 227  ASN A CA    1 
ATOM   1761  C  C     . ASN A 1  227  ? 469.581 35.920  706.300 1.00 172.36 ? 227  ASN A C     1 
ATOM   1762  O  O     . ASN A 1  227  ? 470.135 35.521  705.260 1.00 171.75 ? 227  ASN A O     1 
ATOM   1763  C  CB    . ASN A 1  227  ? 471.651 37.056  707.174 1.00 182.67 ? 227  ASN A CB    1 
ATOM   1764  C  CG    . ASN A 1  227  ? 472.463 37.456  708.410 1.00 189.58 ? 227  ASN A CG    1 
ATOM   1765  O  OD1   . ASN A 1  227  ? 471.926 37.554  709.521 1.00 193.85 ? 227  ASN A OD1   1 
ATOM   1766  N  ND2   . ASN A 1  227  ? 473.762 37.661  708.224 1.00 189.22 ? 227  ASN A ND2   1 
ATOM   1767  N  N     . PRO A 1  228  ? 468.263 36.135  706.350 1.00 162.90 ? 228  PRO A N     1 
ATOM   1768  C  CA    . PRO A 1  228  ? 467.380 35.833  705.216 1.00 158.54 ? 228  PRO A CA    1 
ATOM   1769  C  C     . PRO A 1  228  ? 467.461 36.912  704.134 1.00 162.16 ? 228  PRO A C     1 
ATOM   1770  O  O     . PRO A 1  228  ? 468.188 37.899  704.264 1.00 168.90 ? 228  PRO A O     1 
ATOM   1771  C  CB    . PRO A 1  228  ? 465.990 35.798  705.852 1.00 152.69 ? 228  PRO A CB    1 
ATOM   1772  C  CG    . PRO A 1  228  ? 466.215 35.880  707.323 1.00 156.93 ? 228  PRO A CG    1 
ATOM   1773  C  CD    . PRO A 1  228  ? 467.490 36.623  707.492 1.00 163.82 ? 228  PRO A CD    1 
ATOM   1774  N  N     . GLN A 1  229  ? 466.654 36.726  703.078 1.00 153.69 ? 229  GLN A N     1 
ATOM   1775  C  CA    . GLN A 1  229  ? 466.395 37.761  702.064 1.00 145.91 ? 229  GLN A CA    1 
ATOM   1776  C  C     . GLN A 1  229  ? 465.161 37.456  701.201 1.00 137.95 ? 229  GLN A C     1 
ATOM   1777  O  O     . GLN A 1  229  ? 465.258 36.845  700.135 1.00 131.17 ? 229  GLN A O     1 
ATOM   1778  C  CB    . GLN A 1  229  ? 467.612 37.949  701.171 1.00 144.95 ? 229  GLN A CB    1 
ATOM   1779  C  CG    . GLN A 1  229  ? 468.441 39.184  701.509 1.00 150.33 ? 229  GLN A CG    1 
ATOM   1780  C  CD    . GLN A 1  229  ? 469.831 38.834  702.004 1.00 150.97 ? 229  GLN A CD    1 
ATOM   1781  O  OE1   . GLN A 1  229  ? 470.120 37.665  702.287 1.00 147.93 ? 229  GLN A OE1   1 
ATOM   1782  N  NE2   . GLN A 1  229  ? 470.703 39.842  702.110 1.00 153.42 ? 229  GLN A NE2   1 
ATOM   1783  N  N     . LEU B 1  6    ? 485.005 28.600  699.824 1.00 187.76 ? 6    LEU B N     1 
ATOM   1784  C  CA    . LEU B 1  6    ? 483.796 28.294  700.587 1.00 180.89 ? 6    LEU B CA    1 
ATOM   1785  C  C     . LEU B 1  6    ? 483.166 29.556  701.137 1.00 181.49 ? 6    LEU B C     1 
ATOM   1786  O  O     . LEU B 1  6    ? 483.449 29.928  702.273 1.00 185.40 ? 6    LEU B O     1 
ATOM   1787  C  CB    . LEU B 1  6    ? 484.090 27.361  701.767 1.00 178.84 ? 6    LEU B CB    1 
ATOM   1788  C  CG    . LEU B 1  6    ? 484.844 26.050  701.581 1.00 176.58 ? 6    LEU B CG    1 
ATOM   1789  C  CD1   . LEU B 1  6    ? 484.237 25.310  700.401 1.00 171.19 ? 6    LEU B CD1   1 
ATOM   1790  C  CD2   . LEU B 1  6    ? 486.366 26.265  701.429 1.00 181.17 ? 6    LEU B CD2   1 
ATOM   1791  N  N     . LYS B 1  7    ? 482.315 30.228  700.372 1.00 173.98 ? 7    LYS B N     1 
ATOM   1792  C  CA    . LYS B 1  7    ? 481.653 31.369  700.986 1.00 165.91 ? 7    LYS B CA    1 
ATOM   1793  C  C     . LYS B 1  7    ? 480.461 30.947  701.848 1.00 154.99 ? 7    LYS B C     1 
ATOM   1794  O  O     . LYS B 1  7    ? 480.074 29.776  701.927 1.00 149.82 ? 7    LYS B O     1 
ATOM   1795  C  CB    . LYS B 1  7    ? 481.304 32.429  699.942 1.00 160.29 ? 7    LYS B CB    1 
ATOM   1796  C  CG    . LYS B 1  7    ? 482.527 32.942  699.233 1.00 160.15 ? 7    LYS B CG    1 
ATOM   1797  C  CD    . LYS B 1  7    ? 483.331 33.734  700.278 1.00 160.59 ? 7    LYS B CD    1 
ATOM   1798  C  CE    . LYS B 1  7    ? 484.408 34.637  699.686 1.00 166.35 ? 7    LYS B CE    1 
ATOM   1799  N  NZ    . LYS B 1  7    ? 485.572 33.883  699.144 1.00 169.21 ? 7    LYS B NZ    1 
ATOM   1800  N  N     . ALA B 1  8    ? 479.830 31.963  702.413 1.00 147.70 ? 8    ALA B N     1 
ATOM   1801  C  CA    . ALA B 1  8    ? 478.629 31.807  703.211 1.00 137.21 ? 8    ALA B CA    1 
ATOM   1802  C  C     . ALA B 1  8    ? 477.389 31.711  702.340 1.00 128.92 ? 8    ALA B C     1 
ATOM   1803  O  O     . ALA B 1  8    ? 477.044 32.685  701.659 1.00 128.73 ? 8    ALA B O     1 
ATOM   1804  C  CB    . ALA B 1  8    ? 478.491 32.980  704.165 1.00 140.41 ? 8    ALA B CB    1 
ATOM   1805  N  N     . PRO B 1  9    ? 476.687 30.583  702.354 1.00 115.99 ? 9    PRO B N     1 
ATOM   1806  C  CA    . PRO B 1  9    ? 475.528 30.405  701.473 1.00 108.98 ? 9    PRO B CA    1 
ATOM   1807  C  C     . PRO B 1  9    ? 474.563 31.569  701.640 1.00 102.02 ? 9    PRO B C     1 
ATOM   1808  O  O     . PRO B 1  9    ? 474.465 32.171  702.708 1.00 103.66 ? 9    PRO B O     1 
ATOM   1809  C  CB    . PRO B 1  9    ? 474.918 29.090  701.960 1.00 105.75 ? 9    PRO B CB    1 
ATOM   1810  C  CG    . PRO B 1  9    ? 476.077 28.350  702.564 1.00 109.40 ? 9    PRO B CG    1 
ATOM   1811  C  CD    . PRO B 1  9    ? 476.939 29.403  703.198 1.00 115.03 ? 9    PRO B CD    1 
ATOM   1812  N  N     . VAL B 1  10   ? 473.875 31.894  700.587 1.00 101.56 ? 10   VAL B N     1 
ATOM   1813  C  CA    . VAL B 1  10   ? 472.809 32.874  700.692 1.00 108.38 ? 10   VAL B CA    1 
ATOM   1814  C  C     . VAL B 1  10   ? 471.503 32.163  700.993 1.00 112.67 ? 10   VAL B C     1 
ATOM   1815  O  O     . VAL B 1  10   ? 471.178 31.091  700.447 1.00 109.53 ? 10   VAL B O     1 
ATOM   1816  C  CB    . VAL B 1  10   ? 472.695 33.716  699.413 1.00 115.52 ? 10   VAL B CB    1 
ATOM   1817  C  CG1   . VAL B 1  10   ? 473.991 34.451  699.173 1.00 123.34 ? 10   VAL B CG1   1 
ATOM   1818  C  CG2   . VAL B 1  10   ? 472.331 32.838  698.211 1.00 118.12 ? 10   VAL B CG2   1 
ATOM   1819  N  N     . PHE B 1  11   ? 470.755 32.790  701.899 1.00 118.97 ? 11   PHE B N     1 
ATOM   1820  C  CA    . PHE B 1  11   ? 469.503 32.286  702.436 1.00 111.32 ? 11   PHE B CA    1 
ATOM   1821  C  C     . PHE B 1  11   ? 468.398 33.200  701.923 1.00 102.17 ? 11   PHE B C     1 
ATOM   1822  O  O     . PHE B 1  11   ? 468.425 34.414  702.156 1.00 98.44  ? 11   PHE B O     1 
ATOM   1823  C  CB    . PHE B 1  11   ? 469.620 32.300  703.954 1.00 116.87 ? 11   PHE B CB    1 
ATOM   1824  C  CG    . PHE B 1  11   ? 468.422 31.812  704.665 1.00 119.58 ? 11   PHE B CG    1 
ATOM   1825  C  CD1   . PHE B 1  11   ? 467.536 30.938  704.049 1.00 120.53 ? 11   PHE B CD1   1 
ATOM   1826  C  CD2   . PHE B 1  11   ? 468.175 32.225  705.959 1.00 115.65 ? 11   PHE B CD2   1 
ATOM   1827  C  CE1   . PHE B 1  11   ? 466.411 30.481  704.730 1.00 114.98 ? 11   PHE B CE1   1 
ATOM   1828  C  CE2   . PHE B 1  11   ? 467.066 31.782  706.622 1.00 113.87 ? 11   PHE B CE2   1 
ATOM   1829  C  CZ    . PHE B 1  11   ? 466.181 30.901  706.012 1.00 111.23 ? 11   PHE B CZ    1 
ATOM   1830  N  N     . THR B 1  12   ? 467.420 32.611  701.249 1.00 107.36 ? 12   THR B N     1 
ATOM   1831  C  CA    . THR B 1  12   ? 466.428 33.379  700.514 1.00 115.08 ? 12   THR B CA    1 
ATOM   1832  C  C     . THR B 1  12   ? 465.039 32.924  700.894 1.00 118.95 ? 12   THR B C     1 
ATOM   1833  O  O     . THR B 1  12   ? 464.765 31.720  700.971 1.00 118.90 ? 12   THR B O     1 
ATOM   1834  C  CB    . THR B 1  12   ? 466.590 33.243  698.996 1.00 123.35 ? 12   THR B CB    1 
ATOM   1835  O  OG1   . THR B 1  12   ? 467.945 33.525  698.616 1.00 128.78 ? 12   THR B OG1   1 
ATOM   1836  C  CG2   . THR B 1  12   ? 465.662 34.234  698.288 1.00 128.39 ? 12   THR B CG2   1 
ATOM   1837  N  N     . VAL B 1  13   ? 464.175 33.887  701.146 1.00 113.64 ? 13   VAL B N     1 
ATOM   1838  C  CA    . VAL B 1  13   ? 462.854 33.613  701.660 1.00 108.29 ? 13   VAL B CA    1 
ATOM   1839  C  C     . VAL B 1  13   ? 461.833 34.155  700.676 1.00 111.37 ? 13   VAL B C     1 
ATOM   1840  O  O     . VAL B 1  13   ? 461.991 35.266  700.161 1.00 121.02 ? 13   VAL B O     1 
ATOM   1841  C  CB    . VAL B 1  13   ? 462.684 34.245  703.048 1.00 106.53 ? 13   VAL B CB    1 
ATOM   1842  C  CG1   . VAL B 1  13   ? 461.382 33.803  703.648 1.00 105.75 ? 13   VAL B CG1   1 
ATOM   1843  C  CG2   . VAL B 1  13   ? 463.864 33.868  703.936 1.00 103.33 ? 13   VAL B CG2   1 
ATOM   1844  N  N     . ARG B 1  14   ? 460.782 33.377  700.432 1.00 109.05 ? 14   ARG B N     1 
ATOM   1845  C  CA    . ARG B 1  14   ? 459.653 33.809  699.618 1.00 110.45 ? 14   ARG B CA    1 
ATOM   1846  C  C     . ARG B 1  14   ? 458.423 33.399  700.420 1.00 118.31 ? 14   ARG B C     1 
ATOM   1847  O  O     . ARG B 1  14   ? 458.202 32.211  700.669 1.00 116.32 ? 14   ARG B O     1 
ATOM   1848  C  CB    . ARG B 1  14   ? 459.618 33.157  698.229 1.00 113.08 ? 14   ARG B CB    1 
ATOM   1849  C  CG    . ARG B 1  14   ? 459.670 34.141  697.021 1.00 121.53 ? 14   ARG B CG    1 
ATOM   1850  C  CD    . ARG B 1  14   ? 459.794 33.401  695.676 1.00 124.74 ? 14   ARG B CD    1 
ATOM   1851  N  NE    . ARG B 1  14   ? 460.645 32.208  695.725 1.00 127.20 ? 14   ARG B NE    1 
ATOM   1852  C  CZ    . ARG B 1  14   ? 461.721 31.992  694.961 1.00 128.66 ? 14   ARG B CZ    1 
ATOM   1853  N  NH1   . ARG B 1  14   ? 462.091 32.886  694.047 1.00 131.76 ? 14   ARG B NH1   1 
ATOM   1854  N  NH2   . ARG B 1  14   ? 462.422 30.865  695.100 1.00 124.79 ? 14   ARG B NH2   1 
ATOM   1855  N  N     . THR B 1  15   ? 457.647 34.386  700.864 1.00 122.09 ? 15   THR B N     1 
ATOM   1856  C  CA    . THR B 1  15   ? 456.529 34.165  701.774 1.00 124.05 ? 15   THR B CA    1 
ATOM   1857  C  C     . THR B 1  15   ? 455.219 34.629  701.162 1.00 134.46 ? 15   THR B C     1 
ATOM   1858  O  O     . THR B 1  15   ? 455.164 35.626  700.432 1.00 136.38 ? 15   THR B O     1 
ATOM   1859  C  CB    . THR B 1  15   ? 456.730 34.848  703.130 1.00 109.57 ? 15   THR B CB    1 
ATOM   1860  O  OG1   . THR B 1  15   ? 456.588 36.268  702.978 1.00 106.99 ? 15   THR B OG1   1 
ATOM   1861  C  CG2   . THR B 1  15   ? 458.064 34.497  703.704 1.00 103.12 ? 15   THR B CG2   1 
ATOM   1862  N  N     . GLN B 1  16   ? 454.161 33.901  701.511 1.00 147.18 ? 16   GLN B N     1 
ATOM   1863  C  CA    . GLN B 1  16   ? 452.793 34.313  701.230 1.00 156.53 ? 16   GLN B CA    1 
ATOM   1864  C  C     . GLN B 1  16   ? 451.979 34.470  702.492 1.00 155.93 ? 16   GLN B C     1 
ATOM   1865  O  O     . GLN B 1  16   ? 450.995 33.747  702.670 1.00 157.40 ? 16   GLN B O     1 
ATOM   1866  C  CB    . GLN B 1  16   ? 452.061 33.269  700.411 1.00 166.14 ? 16   GLN B CB    1 
ATOM   1867  C  CG    . GLN B 1  16   ? 452.515 33.061  699.032 1.00 176.81 ? 16   GLN B CG    1 
ATOM   1868  C  CD    . GLN B 1  16   ? 451.543 32.154  698.313 1.00 184.42 ? 16   GLN B CD    1 
ATOM   1869  O  OE1   . GLN B 1  16   ? 450.397 31.993  698.744 1.00 188.09 ? 16   GLN B OE1   1 
ATOM   1870  N  NE2   . GLN B 1  16   ? 451.994 31.546  697.228 1.00 188.75 ? 16   GLN B NE2   1 
ATOM   1871  N  N     . GLY B 1  17   ? 452.349 35.392  703.367 1.00 148.84 ? 17   GLY B N     1 
ATOM   1872  C  CA    . GLY B 1  17   ? 451.557 35.466  704.570 1.00 139.81 ? 17   GLY B CA    1 
ATOM   1873  C  C     . GLY B 1  17   ? 452.058 34.565  705.667 1.00 125.09 ? 17   GLY B C     1 
ATOM   1874  O  O     . GLY B 1  17   ? 453.242 34.207  705.704 1.00 120.01 ? 17   GLY B O     1 
ATOM   1875  N  N     . ARG B 1  18   ? 451.141 34.077  706.487 1.00 117.67 ? 18   ARG B N     1 
ATOM   1876  C  CA    . ARG B 1  18   ? 451.566 33.204  707.559 1.00 117.37 ? 18   ARG B CA    1 
ATOM   1877  C  C     . ARG B 1  18   ? 451.425 31.719  707.251 1.00 119.26 ? 18   ARG B C     1 
ATOM   1878  O  O     . ARG B 1  18   ? 451.811 30.904  708.094 1.00 122.87 ? 18   ARG B O     1 
ATOM   1879  C  CB    . ARG B 1  18   ? 450.724 33.527  708.823 1.00 119.18 ? 18   ARG B CB    1 
ATOM   1880  C  CG    . ARG B 1  18   ? 450.864 34.975  709.385 1.00 117.29 ? 18   ARG B CG    1 
ATOM   1881  C  CD    . ARG B 1  18   ? 449.957 35.266  710.600 1.00 115.00 ? 18   ARG B CD    1 
ATOM   1882  N  NE    . ARG B 1  18   ? 450.066 34.261  711.652 1.00 112.64 ? 18   ARG B NE    1 
ATOM   1883  C  CZ    . ARG B 1  18   ? 451.041 34.246  712.563 1.00 109.20 ? 18   ARG B CZ    1 
ATOM   1884  N  NH1   . ARG B 1  18   ? 451.075 33.290  713.490 1.00 105.94 ? 18   ARG B NH1   1 
ATOM   1885  N  NH2   . ARG B 1  18   ? 451.969 35.205  712.571 1.00 106.76 ? 18   ARG B NH2   1 
ATOM   1886  N  N     . GLU B 1  19   ? 450.846 31.317  706.121 1.00 113.58 ? 19   GLU B N     1 
ATOM   1887  C  CA    . GLU B 1  19   ? 450.683 29.874  705.961 1.00 115.41 ? 19   GLU B CA    1 
ATOM   1888  C  C     . GLU B 1  19   ? 451.683 29.194  705.030 1.00 114.22 ? 19   GLU B C     1 
ATOM   1889  O  O     . GLU B 1  19   ? 451.708 27.956  705.000 1.00 113.81 ? 19   GLU B O     1 
ATOM   1890  C  CB    . GLU B 1  19   ? 449.270 29.567  705.463 1.00 116.29 ? 19   GLU B CB    1 
ATOM   1891  C  CG    . GLU B 1  19   ? 448.145 30.162  706.298 1.00 116.95 ? 19   GLU B CG    1 
ATOM   1892  C  CD    . GLU B 1  19   ? 446.771 29.884  705.710 1.00 123.14 ? 19   GLU B CD    1 
ATOM   1893  O  OE1   . GLU B 1  19   ? 446.205 30.752  704.989 1.00 124.76 ? 19   GLU B OE1   1 
ATOM   1894  O  OE2   . GLU B 1  19   ? 446.262 28.776  705.977 1.00 126.45 ? 19   GLU B OE2   1 
ATOM   1895  N  N     . TYR B 1  20   ? 452.524 29.936  704.302 1.00 120.53 ? 20   TYR B N     1 
ATOM   1896  C  CA    . TYR B 1  20   ? 453.418 29.270  703.356 1.00 116.77 ? 20   TYR B CA    1 
ATOM   1897  C  C     . TYR B 1  20   ? 454.683 30.086  703.125 1.00 114.75 ? 20   TYR B C     1 
ATOM   1898  O  O     . TYR B 1  20   ? 454.632 31.313  702.992 1.00 117.51 ? 20   TYR B O     1 
ATOM   1899  C  CB    . TYR B 1  20   ? 452.750 28.989  702.004 1.00 125.65 ? 20   TYR B CB    1 
ATOM   1900  C  CG    . TYR B 1  20   ? 453.725 28.353  701.021 1.00 132.43 ? 20   TYR B CG    1 
ATOM   1901  C  CD1   . TYR B 1  20   ? 453.941 26.977  701.022 1.00 133.74 ? 20   TYR B CD1   1 
ATOM   1902  C  CD2   . TYR B 1  20   ? 454.461 29.123  700.120 1.00 136.21 ? 20   TYR B CD2   1 
ATOM   1903  C  CE1   . TYR B 1  20   ? 454.853 26.376  700.141 1.00 133.96 ? 20   TYR B CE1   1 
ATOM   1904  C  CE2   . TYR B 1  20   ? 455.374 28.528  699.236 1.00 135.75 ? 20   TYR B CE2   1 
ATOM   1905  C  CZ    . TYR B 1  20   ? 455.566 27.161  699.252 1.00 133.86 ? 20   TYR B CZ    1 
ATOM   1906  O  OH    . TYR B 1  20   ? 456.470 26.587  698.379 1.00 131.06 ? 20   TYR B OH    1 
ATOM   1907  N  N     . GLY B 1  21   ? 455.794 29.392  702.984 1.00 105.39 ? 21   GLY B N     1 
ATOM   1908  C  CA    . GLY B 1  21   ? 457.053 30.045  702.678 1.00 109.84 ? 21   GLY B CA    1 
ATOM   1909  C  C     . GLY B 1  21   ? 457.982 29.100  701.948 1.00 110.41 ? 21   GLY B C     1 
ATOM   1910  O  O     . GLY B 1  21   ? 457.904 27.873  702.103 1.00 113.22 ? 21   GLY B O     1 
ATOM   1911  N  N     . GLU B 1  22   ? 458.898 29.682  701.172 1.00 110.86 ? 22   GLU B N     1 
ATOM   1912  C  CA    . GLU B 1  22   ? 459.923 28.941  700.448 1.00 102.83 ? 22   GLU B CA    1 
ATOM   1913  C  C     . GLU B 1  22   ? 461.268 29.444  700.917 1.00 99.91  ? 22   GLU B C     1 
ATOM   1914  O  O     . GLU B 1  22   ? 461.517 30.658  700.937 1.00 100.69 ? 22   GLU B O     1 
ATOM   1915  C  CB    . GLU B 1  22   ? 459.874 29.172  698.949 1.00 109.20 ? 22   GLU B CB    1 
ATOM   1916  C  CG    . GLU B 1  22   ? 458.633 28.826  698.253 1.00 115.68 ? 22   GLU B CG    1 
ATOM   1917  C  CD    . GLU B 1  22   ? 458.844 28.963  696.777 1.00 123.46 ? 22   GLU B CD    1 
ATOM   1918  O  OE1   . GLU B 1  22   ? 458.163 29.807  696.147 1.00 130.91 ? 22   GLU B OE1   1 
ATOM   1919  O  OE2   . GLU B 1  22   ? 459.740 28.254  696.261 1.00 121.42 ? 22   GLU B OE2   1 
ATOM   1920  N  N     . PHE B 1  23   ? 462.165 28.512  701.192 1.00 95.95  ? 23   PHE B N     1 
ATOM   1921  C  CA    . PHE B 1  23   ? 463.436 28.866  701.792 1.00 102.42 ? 23   PHE B CA    1 
ATOM   1922  C  C     . PHE B 1  23   ? 464.503 28.165  700.996 1.00 96.77  ? 23   PHE B C     1 
ATOM   1923  O  O     . PHE B 1  23   ? 464.551 26.931  700.957 1.00 93.87  ? 23   PHE B O     1 
ATOM   1924  C  CB    . PHE B 1  23   ? 463.429 28.474  703.271 1.00 106.71 ? 23   PHE B CB    1 
ATOM   1925  C  CG    . PHE B 1  23   ? 462.175 28.927  703.977 1.00 111.05 ? 23   PHE B CG    1 
ATOM   1926  C  CD1   . PHE B 1  23   ? 462.095 30.212  704.494 1.00 115.35 ? 23   PHE B CD1   1 
ATOM   1927  C  CD2   . PHE B 1  23   ? 461.044 28.121  704.033 1.00 112.05 ? 23   PHE B CD2   1 
ATOM   1928  C  CE1   . PHE B 1  23   ? 460.946 30.661  705.103 1.00 115.95 ? 23   PHE B CE1   1 
ATOM   1929  C  CE2   . PHE B 1  23   ? 459.882 28.572  704.641 1.00 113.61 ? 23   PHE B CE2   1 
ATOM   1930  C  CZ    . PHE B 1  23   ? 459.837 29.843  705.173 1.00 115.49 ? 23   PHE B CZ    1 
ATOM   1931  N  N     . VAL B 1  24   ? 465.353 28.975  700.380 1.00 102.86 ? 24   VAL B N     1 
ATOM   1932  C  CA    . VAL B 1  24   ? 466.392 28.508  699.488 1.00 106.10 ? 24   VAL B CA    1 
ATOM   1933  C  C     . VAL B 1  24   ? 467.739 28.808  700.114 1.00 111.60 ? 24   VAL B C     1 
ATOM   1934  O  O     . VAL B 1  24   ? 468.016 29.960  700.476 1.00 114.77 ? 24   VAL B O     1 
ATOM   1935  C  CB    . VAL B 1  24   ? 466.256 29.195  698.119 1.00 109.96 ? 24   VAL B CB    1 
ATOM   1936  C  CG1   . VAL B 1  24   ? 467.395 28.794  697.217 1.00 116.77 ? 24   VAL B CG1   1 
ATOM   1937  C  CG2   . VAL B 1  24   ? 464.879 28.888  697.478 1.00 109.21 ? 24   VAL B CG2   1 
ATOM   1938  N  N     . LEU B 1  25   ? 468.561 27.769  700.283 1.00 107.00 ? 25   LEU B N     1 
ATOM   1939  C  CA    . LEU B 1  25   ? 469.920 27.916  700.792 1.00 105.60 ? 25   LEU B CA    1 
ATOM   1940  C  C     . LEU B 1  25   ? 470.860 27.403  699.708 1.00 107.17 ? 25   LEU B C     1 
ATOM   1941  O  O     . LEU B 1  25   ? 470.847 26.203  699.417 1.00 110.37 ? 25   LEU B O     1 
ATOM   1942  C  CB    . LEU B 1  25   ? 470.101 27.129  702.083 1.00 96.59  ? 25   LEU B CB    1 
ATOM   1943  C  CG    . LEU B 1  25   ? 471.447 27.432  702.712 1.00 96.00  ? 25   LEU B CG    1 
ATOM   1944  C  CD1   . LEU B 1  25   ? 471.498 28.957  702.899 1.00 97.22  ? 25   LEU B CD1   1 
ATOM   1945  C  CD2   . LEU B 1  25   ? 471.599 26.686  704.012 1.00 93.88  ? 25   LEU B CD2   1 
ATOM   1946  N  N     . GLU B 1  26   ? 471.664 28.269  699.094 1.00 112.86 ? 26   GLU B N     1 
ATOM   1947  C  CA    . GLU B 1  26   ? 472.638 27.763  698.131 1.00 112.35 ? 26   GLU B CA    1 
ATOM   1948  C  C     . GLU B 1  26   ? 473.845 28.685  698.096 1.00 111.70 ? 26   GLU B C     1 
ATOM   1949  O  O     . GLU B 1  26   ? 473.723 29.876  698.404 1.00 111.46 ? 26   GLU B O     1 
ATOM   1950  C  CB    . GLU B 1  26   ? 472.000 27.640  696.740 1.00 114.45 ? 26   GLU B CB    1 
ATOM   1951  C  CG    . GLU B 1  26   ? 471.613 28.953  696.132 1.00 118.14 ? 26   GLU B CG    1 
ATOM   1952  C  CD    . GLU B 1  26   ? 471.218 28.791  694.691 1.00 124.37 ? 26   GLU B CD    1 
ATOM   1953  O  OE1   . GLU B 1  26   ? 472.002 28.236  693.895 1.00 127.46 ? 26   GLU B OE1   1 
ATOM   1954  O  OE2   . GLU B 1  26   ? 470.116 29.267  694.344 1.00 126.26 ? 26   GLU B OE2   1 
ATOM   1955  N  N     . PRO B 1  27   ? 475.027 28.174  697.699 1.00 106.42 ? 27   PRO B N     1 
ATOM   1956  C  CA    . PRO B 1  27   ? 475.501 26.801  697.433 1.00 106.49 ? 27   PRO B CA    1 
ATOM   1957  C  C     . PRO B 1  27   ? 475.949 25.998  698.652 1.00 105.40 ? 27   PRO B C     1 
ATOM   1958  O  O     . PRO B 1  27   ? 476.440 26.581  699.610 1.00 111.86 ? 27   PRO B O     1 
ATOM   1959  C  CB    . PRO B 1  27   ? 476.718 27.038  696.561 1.00 109.30 ? 27   PRO B CB    1 
ATOM   1960  C  CG    . PRO B 1  27   ? 477.271 28.319  697.084 1.00 111.77 ? 27   PRO B CG    1 
ATOM   1961  C  CD    . PRO B 1  27   ? 476.082 29.165  697.432 1.00 112.26 ? 27   PRO B CD    1 
ATOM   1962  N  N     . LEU B 1  28   ? 475.836 24.674  698.595 1.00 103.58 ? 28   LEU B N     1 
ATOM   1963  C  CA    . LEU B 1  28   ? 476.343 23.789  699.638 1.00 103.56 ? 28   LEU B CA    1 
ATOM   1964  C  C     . LEU B 1  28   ? 477.307 22.758  699.072 1.00 99.98  ? 28   LEU B C     1 
ATOM   1965  O  O     . LEU B 1  28   ? 477.238 22.407  697.898 1.00 99.50  ? 28   LEU B O     1 
ATOM   1966  C  CB    . LEU B 1  28   ? 475.218 23.013  700.375 1.00 108.34 ? 28   LEU B CB    1 
ATOM   1967  C  CG    . LEU B 1  28   ? 474.042 23.617  701.163 1.00 107.02 ? 28   LEU B CG    1 
ATOM   1968  C  CD1   . LEU B 1  28   ? 473.076 22.500  701.590 1.00 103.39 ? 28   LEU B CD1   1 
ATOM   1969  C  CD2   . LEU B 1  28   ? 474.501 24.426  702.360 1.00 107.66 ? 28   LEU B CD2   1 
ATOM   1970  N  N     . GLU B 1  29   ? 478.204 22.276  699.919 1.00 99.43  ? 29   GLU B N     1 
ATOM   1971  C  CA    . GLU B 1  29   ? 479.145 21.234  699.531 1.00 104.52 ? 29   GLU B CA    1 
ATOM   1972  C  C     . GLU B 1  29   ? 478.394 19.947  699.182 1.00 93.38  ? 29   GLU B C     1 
ATOM   1973  O  O     . GLU B 1  29   ? 477.232 19.757  699.545 1.00 85.48  ? 29   GLU B O     1 
ATOM   1974  C  CB    . GLU B 1  29   ? 480.127 20.959  700.665 1.00 121.07 ? 29   GLU B CB    1 
ATOM   1975  C  CG    . GLU B 1  29   ? 481.403 20.208  700.298 1.00 134.80 ? 29   GLU B CG    1 
ATOM   1976  C  CD    . GLU B 1  29   ? 482.414 20.231  701.447 1.00 149.29 ? 29   GLU B CD    1 
ATOM   1977  O  OE1   . GLU B 1  29   ? 482.244 19.462  702.425 1.00 152.23 ? 29   GLU B OE1   1 
ATOM   1978  O  OE2   . GLU B 1  29   ? 483.361 21.050  701.389 1.00 156.87 ? 29   GLU B OE2   1 
ATOM   1979  N  N     . ARG B 1  30   ? 479.042 19.094  698.399 1.00 92.92  ? 30   ARG B N     1 
ATOM   1980  C  CA    . ARG B 1  30   ? 478.375 17.904  697.896 1.00 94.96  ? 30   ARG B CA    1 
ATOM   1981  C  C     . ARG B 1  30   ? 477.803 17.057  699.031 1.00 99.20  ? 30   ARG B C     1 
ATOM   1982  O  O     . ARG B 1  30   ? 478.535 16.615  699.922 1.00 102.67 ? 30   ARG B O     1 
ATOM   1983  C  CB    . ARG B 1  30   ? 479.359 17.070  697.086 1.00 94.37  ? 30   ARG B CB    1 
ATOM   1984  C  CG    . ARG B 1  30   ? 478.758 15.778  696.583 1.00 95.39  ? 30   ARG B CG    1 
ATOM   1985  C  CD    . ARG B 1  30   ? 479.812 14.922  695.935 1.00 104.13 ? 30   ARG B CD    1 
ATOM   1986  N  NE    . ARG B 1  30   ? 480.663 14.291  696.939 1.00 114.65 ? 30   ARG B NE    1 
ATOM   1987  C  CZ    . ARG B 1  30   ? 481.655 13.440  696.675 1.00 121.50 ? 30   ARG B CZ    1 
ATOM   1988  N  NH1   . ARG B 1  30   ? 481.944 13.094  695.427 1.00 115.82 ? 30   ARG B NH1   1 
ATOM   1989  N  NH2   . ARG B 1  30   ? 482.362 12.930  697.679 1.00 130.05 ? 30   ARG B NH2   1 
ATOM   1990  N  N     . GLY B 1  31   ? 476.498 16.769  698.947 1.00 101.56 ? 31   GLY B N     1 
ATOM   1991  C  CA    . GLY B 1  31   ? 475.786 15.906  699.873 1.00 103.48 ? 31   GLY B CA    1 
ATOM   1992  C  C     . GLY B 1  31   ? 475.000 16.641  700.947 1.00 99.42  ? 31   GLY B C     1 
ATOM   1993  O  O     . GLY B 1  31   ? 474.024 16.091  701.485 1.00 95.49  ? 31   GLY B O     1 
ATOM   1994  N  N     . PHE B 1  32   ? 475.367 17.888  701.227 1.00 89.72  ? 32   PHE B N     1 
ATOM   1995  C  CA    . PHE B 1  32   ? 474.803 18.618  702.349 1.00 92.47  ? 32   PHE B CA    1 
ATOM   1996  C  C     . PHE B 1  32   ? 473.363 19.045  702.144 1.00 97.24  ? 32   PHE B C     1 
ATOM   1997  O  O     . PHE B 1  32   ? 472.696 19.378  703.136 1.00 100.37 ? 32   PHE B O     1 
ATOM   1998  C  CB    . PHE B 1  32   ? 475.733 19.756  702.730 1.00 99.31  ? 32   PHE B CB    1 
ATOM   1999  C  CG    . PHE B 1  32   ? 476.749 19.328  703.741 1.00 102.58 ? 32   PHE B CG    1 
ATOM   2000  C  CD1   . PHE B 1  32   ? 477.957 18.784  703.359 1.00 104.44 ? 32   PHE B CD1   1 
ATOM   2001  C  CD2   . PHE B 1  32   ? 476.473 19.476  705.103 1.00 103.91 ? 32   PHE B CD2   1 
ATOM   2002  C  CE1   . PHE B 1  32   ? 478.864 18.366  704.320 1.00 107.03 ? 32   PHE B CE1   1 
ATOM   2003  C  CE2   . PHE B 1  32   ? 477.380 19.088  706.076 1.00 102.96 ? 32   PHE B CE2   1 
ATOM   2004  C  CZ    . PHE B 1  32   ? 478.574 18.530  705.696 1.00 106.14 ? 32   PHE B CZ    1 
ATOM   2005  N  N     . GLY B 1  33   ? 472.862 19.063  700.906 1.00 93.43  ? 33   GLY B N     1 
ATOM   2006  C  CA    . GLY B 1  33   ? 471.461 19.412  700.732 1.00 90.85  ? 33   GLY B CA    1 
ATOM   2007  C  C     . GLY B 1  33   ? 470.557 18.467  701.509 1.00 80.20  ? 33   GLY B C     1 
ATOM   2008  O  O     . GLY B 1  33   ? 469.681 18.899  702.250 1.00 75.75  ? 33   GLY B O     1 
ATOM   2009  N  N     . VAL B 1  34   ? 470.809 17.161  701.403 1.00 78.31  ? 34   VAL B N     1 
ATOM   2010  C  CA    . VAL B 1  34   ? 470.016 16.173  702.135 1.00 76.83  ? 34   VAL B CA    1 
ATOM   2011  C  C     . VAL B 1  34   ? 470.531 16.026  703.564 1.00 80.42  ? 34   VAL B C     1 
ATOM   2012  O  O     . VAL B 1  34   ? 469.801 15.523  704.433 1.00 80.11  ? 34   VAL B O     1 
ATOM   2013  C  CB    . VAL B 1  34   ? 469.891 14.836  701.359 1.00 73.35  ? 34   VAL B CB    1 
ATOM   2014  C  CG1   . VAL B 1  34   ? 470.067 15.083  699.871 1.00 79.34  ? 34   VAL B CG1   1 
ATOM   2015  C  CG2   . VAL B 1  34   ? 470.848 13.724  701.846 1.00 65.71  ? 34   VAL B CG2   1 
ATOM   2016  N  N     . THR B 1  35   ? 471.787 16.401  703.837 1.00 84.86  ? 35   THR B N     1 
ATOM   2017  C  CA    . THR B 1  35   ? 472.256 16.295  705.214 1.00 83.91  ? 35   THR B CA    1 
ATOM   2018  C  C     . THR B 1  35   ? 471.498 17.276  706.110 1.00 88.13  ? 35   THR B C     1 
ATOM   2019  O  O     . THR B 1  35   ? 471.150 16.936  707.242 1.00 86.14  ? 35   THR B O     1 
ATOM   2020  C  CB    . THR B 1  35   ? 473.779 16.535  705.289 1.00 83.25  ? 35   THR B CB    1 
ATOM   2021  O  OG1   . THR B 1  35   ? 474.500 15.393  704.772 1.00 83.94  ? 35   THR B OG1   1 
ATOM   2022  C  CG2   . THR B 1  35   ? 474.226 16.791  706.741 1.00 78.48  ? 35   THR B CG2   1 
ATOM   2023  N  N     . LEU B 1  36   ? 471.254 18.508  705.646 1.00 86.86  ? 36   LEU B N     1 
ATOM   2024  C  CA    . LEU B 1  36   ? 470.377 19.387  706.417 1.00 82.82  ? 36   LEU B CA    1 
ATOM   2025  C  C     . LEU B 1  36   ? 468.893 19.154  706.178 1.00 84.83  ? 36   LEU B C     1 
ATOM   2026  O  O     . LEU B 1  36   ? 468.113 19.075  707.125 1.00 91.75  ? 36   LEU B O     1 
ATOM   2027  C  CB    . LEU B 1  36   ? 470.657 20.835  706.074 1.00 79.16  ? 36   LEU B CB    1 
ATOM   2028  C  CG    . LEU B 1  36   ? 472.078 21.230  706.308 1.00 83.84  ? 36   LEU B CG    1 
ATOM   2029  C  CD1   . LEU B 1  36   ? 472.133 22.694  706.026 1.00 89.70  ? 36   LEU B CD1   1 
ATOM   2030  C  CD2   . LEU B 1  36   ? 472.342 20.943  707.750 1.00 86.14  ? 36   LEU B CD2   1 
ATOM   2031  N  N     . GLY B 1  37   ? 468.492 18.998  704.923 1.00 85.19  ? 37   GLY B N     1 
ATOM   2032  C  CA    . GLY B 1  37   ? 467.069 18.950  704.603 1.00 88.91  ? 37   GLY B CA    1 
ATOM   2033  C  C     . GLY B 1  37   ? 466.303 17.813  705.252 1.00 87.02  ? 37   GLY B C     1 
ATOM   2034  O  O     . GLY B 1  37   ? 465.227 18.014  705.812 1.00 86.78  ? 37   GLY B O     1 
ATOM   2035  N  N     . ASN B 1  38   ? 466.863 16.615  705.223 1.00 89.57  ? 38   ASN B N     1 
ATOM   2036  C  CA    . ASN B 1  38   ? 466.137 15.477  705.773 1.00 89.99  ? 38   ASN B CA    1 
ATOM   2037  C  C     . ASN B 1  38   ? 465.931 15.634  707.267 1.00 90.90  ? 38   ASN B C     1 
ATOM   2038  O  O     . ASN B 1  38   ? 464.789 15.467  707.732 1.00 98.10  ? 38   ASN B O     1 
ATOM   2039  C  CB    . ASN B 1  38   ? 466.866 14.189  705.410 1.00 99.12  ? 38   ASN B CB    1 
ATOM   2040  C  CG    . ASN B 1  38   ? 465.930 13.073  705.150 1.00 105.99 ? 38   ASN B CG    1 
ATOM   2041  O  OD1   . ASN B 1  38   ? 465.705 12.707  703.991 1.00 101.58 ? 38   ASN B OD1   1 
ATOM   2042  N  ND2   . ASN B 1  38   ? 465.334 12.525  706.227 1.00 111.58 ? 38   ASN B ND2   1 
ATOM   2043  N  N     . PRO B 1  39   ? 466.954 15.924  708.073 1.00 88.12  ? 39   PRO B N     1 
ATOM   2044  C  CA    . PRO B 1  39   ? 466.715 16.096  709.526 1.00 85.71  ? 39   PRO B CA    1 
ATOM   2045  C  C     . PRO B 1  39   ? 465.750 17.209  709.854 1.00 83.10  ? 39   PRO B C     1 
ATOM   2046  O  O     . PRO B 1  39   ? 464.842 17.002  710.665 1.00 83.72  ? 39   PRO B O     1 
ATOM   2047  C  CB    . PRO B 1  39   ? 468.106 16.383  710.081 1.00 83.28  ? 39   PRO B CB    1 
ATOM   2048  C  CG    . PRO B 1  39   ? 468.984 15.776  709.086 1.00 85.12  ? 39   PRO B CG    1 
ATOM   2049  C  CD    . PRO B 1  39   ? 468.385 15.912  707.762 1.00 85.47  ? 39   PRO B CD    1 
ATOM   2050  N  N     . LEU B 1  40   ? 465.906 18.377  709.228 1.00 81.05  ? 40   LEU B N     1 
ATOM   2051  C  CA    . LEU B 1  40   ? 464.993 19.489  709.489 1.00 82.74  ? 40   LEU B CA    1 
ATOM   2052  C  C     . LEU B 1  40   ? 463.542 19.092  709.233 1.00 85.16  ? 40   LEU B C     1 
ATOM   2053  O  O     . LEU B 1  40   ? 462.643 19.451  710.008 1.00 90.59  ? 40   LEU B O     1 
ATOM   2054  C  CB    . LEU B 1  40   ? 465.359 20.710  708.665 1.00 80.99  ? 40   LEU B CB    1 
ATOM   2055  C  CG    . LEU B 1  40   ? 466.683 21.315  709.086 1.00 82.22  ? 40   LEU B CG    1 
ATOM   2056  C  CD1   . LEU B 1  40   ? 466.822 22.706  708.456 1.00 86.74  ? 40   LEU B CD1   1 
ATOM   2057  C  CD2   . LEU B 1  40   ? 466.780 21.357  710.603 1.00 84.77  ? 40   LEU B CD2   1 
ATOM   2058  N  N     . ARG B 1  41   ? 463.296 18.331  708.164 1.00 79.30  ? 41   ARG B N     1 
ATOM   2059  C  CA    . ARG B 1  41   ? 461.932 17.917  707.858 1.00 78.95  ? 41   ARG B CA    1 
ATOM   2060  C  C     . ARG B 1  41   ? 461.380 17.021  708.959 1.00 87.49  ? 41   ARG B C     1 
ATOM   2061  O  O     . ARG B 1  41   ? 460.252 17.226  709.433 1.00 89.48  ? 41   ARG B O     1 
ATOM   2062  C  CB    . ARG B 1  41   ? 461.897 17.191  706.505 1.00 73.97  ? 41   ARG B CB    1 
ATOM   2063  C  CG    . ARG B 1  41   ? 460.558 16.604  706.154 1.00 70.55  ? 41   ARG B CG    1 
ATOM   2064  C  CD    . ARG B 1  41   ? 460.558 15.850  704.856 1.00 69.01  ? 41   ARG B CD    1 
ATOM   2065  N  NE    . ARG B 1  41   ? 459.210 15.374  704.520 1.00 76.03  ? 41   ARG B NE    1 
ATOM   2066  C  CZ    . ARG B 1  41   ? 458.690 14.201  704.892 1.00 80.97  ? 41   ARG B CZ    1 
ATOM   2067  N  NH1   . ARG B 1  41   ? 459.422 13.330  705.609 1.00 79.69  ? 41   ARG B NH1   1 
ATOM   2068  N  NH2   . ARG B 1  41   ? 457.432 13.896  704.543 1.00 79.88  ? 41   ARG B NH2   1 
ATOM   2069  N  N     . ARG B 1  42   ? 462.188 16.072  709.432 1.00 82.49  ? 42   ARG B N     1 
ATOM   2070  C  CA    . ARG B 1  42   ? 461.721 15.189  710.487 1.00 72.41  ? 42   ARG B CA    1 
ATOM   2071  C  C     . ARG B 1  42   ? 461.326 16.009  711.698 1.00 75.67  ? 42   ARG B C     1 
ATOM   2072  O  O     . ARG B 1  42   ? 460.245 15.826  712.264 1.00 85.06  ? 42   ARG B O     1 
ATOM   2073  C  CB    . ARG B 1  42   ? 462.836 14.240  710.890 1.00 64.23  ? 42   ARG B CB    1 
ATOM   2074  C  CG    . ARG B 1  42   ? 463.151 13.256  709.874 1.00 66.59  ? 42   ARG B CG    1 
ATOM   2075  C  CD    . ARG B 1  42   ? 464.268 12.386  710.350 1.00 71.54  ? 42   ARG B CD    1 
ATOM   2076  N  NE    . ARG B 1  42   ? 463.937 11.430  711.394 1.00 65.36  ? 42   ARG B NE    1 
ATOM   2077  C  CZ    . ARG B 1  42   ? 463.411 10.226  711.132 1.00 70.02  ? 42   ARG B CZ    1 
ATOM   2078  N  NH1   . ARG B 1  42   ? 463.176 9.816   709.884 1.00 62.40  ? 42   ARG B NH1   1 
ATOM   2079  N  NH2   . ARG B 1  42   ? 463.156 9.390   712.117 1.00 83.92  ? 42   ARG B NH2   1 
ATOM   2080  N  N     . ILE B 1  43   ? 462.146 17.001  712.031 1.00 75.57  ? 43   ILE B N     1 
ATOM   2081  C  CA    . ILE B 1  43   ? 461.876 17.851  713.176 1.00 79.81  ? 43   ILE B CA    1 
ATOM   2082  C  C     . ILE B 1  43   ? 460.631 18.693  712.929 1.00 88.58  ? 43   ILE B C     1 
ATOM   2083  O  O     . ILE B 1  43   ? 459.766 18.805  713.813 1.00 92.47  ? 43   ILE B O     1 
ATOM   2084  C  CB    . ILE B 1  43   ? 463.107 18.718  713.472 1.00 81.38  ? 43   ILE B CB    1 
ATOM   2085  C  CG1   . ILE B 1  43   ? 464.261 17.829  713.981 1.00 81.26  ? 43   ILE B CG1   1 
ATOM   2086  C  CG2   . ILE B 1  43   ? 462.740 19.825  714.479 1.00 80.94  ? 43   ILE B CG2   1 
ATOM   2087  C  CD1   . ILE B 1  43   ? 465.638 18.550  714.102 1.00 79.93  ? 43   ILE B CD1   1 
ATOM   2088  N  N     . LEU B 1  44   ? 460.575 19.381  711.773 1.00 83.16  ? 44   LEU B N     1 
ATOM   2089  C  CA    . LEU B 1  44   ? 459.436 20.238  711.421 1.00 83.87  ? 44   LEU B CA    1 
ATOM   2090  C  C     . LEU B 1  44   ? 458.071 19.548  711.467 1.00 83.53  ? 44   LEU B C     1 
ATOM   2091  O  O     . LEU B 1  44   ? 457.044 20.195  711.720 1.00 82.40  ? 44   LEU B O     1 
ATOM   2092  C  CB    . LEU B 1  44   ? 459.611 20.761  710.011 1.00 81.98  ? 44   LEU B CB    1 
ATOM   2093  C  CG    . LEU B 1  44   ? 460.570 21.906  709.747 1.00 84.67  ? 44   LEU B CG    1 
ATOM   2094  C  CD1   . LEU B 1  44   ? 460.942 21.900  708.244 1.00 83.83  ? 44   LEU B CD1   1 
ATOM   2095  C  CD2   . LEU B 1  44   ? 460.025 23.250  710.236 1.00 85.58  ? 44   LEU B CD2   1 
ATOM   2096  N  N     . LEU B 1  45   ? 458.029 18.253  711.182 1.00 87.40  ? 45   LEU B N     1 
ATOM   2097  C  CA    . LEU B 1  45   ? 456.793 17.477  711.271 1.00 84.95  ? 45   LEU B CA    1 
ATOM   2098  C  C     . LEU B 1  45   ? 456.488 16.953  712.667 1.00 82.31  ? 45   LEU B C     1 
ATOM   2099  O  O     . LEU B 1  45   ? 455.337 16.968  713.096 1.00 84.74  ? 45   LEU B O     1 
ATOM   2100  C  CB    . LEU B 1  45   ? 456.862 16.291  710.317 1.00 86.64  ? 45   LEU B CB    1 
ATOM   2101  C  CG    . LEU B 1  45   ? 456.846 16.608  708.826 1.00 82.89  ? 45   LEU B CG    1 
ATOM   2102  C  CD1   . LEU B 1  45   ? 456.996 15.321  708.049 1.00 78.29  ? 45   LEU B CD1   1 
ATOM   2103  C  CD2   . LEU B 1  45   ? 455.638 17.414  708.405 1.00 84.39  ? 45   LEU B CD2   1 
ATOM   2104  N  N     . SER B 1  46   ? 457.496 16.447  713.369 1.00 80.42  ? 46   SER B N     1 
ATOM   2105  C  CA    . SER B 1  46   ? 457.340 15.806  714.672 1.00 87.21  ? 46   SER B CA    1 
ATOM   2106  C  C     . SER B 1  46   ? 457.354 16.753  715.878 1.00 90.05  ? 46   SER B C     1 
ATOM   2107  O  O     . SER B 1  46   ? 456.595 16.549  716.828 1.00 85.60  ? 46   SER B O     1 
ATOM   2108  C  CB    . SER B 1  46   ? 458.433 14.727  714.821 1.00 86.07  ? 46   SER B CB    1 
ATOM   2109  O  OG    . SER B 1  46   ? 459.748 15.258  714.966 1.00 83.17  ? 46   SER B OG    1 
ATOM   2110  N  N     . SER B 1  47   ? 458.274 17.699  715.932 1.00 90.81  ? 47   SER B N     1 
ATOM   2111  C  CA    . SER B 1  47   ? 458.495 18.424  717.168 1.00 91.90  ? 47   SER B CA    1 
ATOM   2112  C  C     . SER B 1  47   ? 457.932 19.843  717.263 1.00 92.32  ? 47   SER B C     1 
ATOM   2113  O  O     . SER B 1  47   ? 458.205 20.513  718.255 1.00 97.23  ? 47   SER B O     1 
ATOM   2114  C  CB    . SER B 1  47   ? 459.972 18.385  717.457 1.00 95.34  ? 47   SER B CB    1 
ATOM   2115  O  OG    . SER B 1  47   ? 460.256 17.010  717.683 1.00 93.76  ? 47   SER B OG    1 
ATOM   2116  N  N     . ILE B 1  48   ? 457.273 20.387  716.253 1.00 99.10  ? 48   ILE B N     1 
ATOM   2117  C  CA    . ILE B 1  48   ? 456.855 21.778  716.444 1.00 108.58 ? 48   ILE B CA    1 
ATOM   2118  C  C     . ILE B 1  48   ? 455.580 21.948  717.269 1.00 115.53 ? 48   ILE B C     1 
ATOM   2119  O  O     . ILE B 1  48   ? 454.525 21.418  716.890 1.00 119.73 ? 48   ILE B O     1 
ATOM   2120  C  CB    . ILE B 1  48   ? 456.748 22.522  715.112 1.00 113.85 ? 48   ILE B CB    1 
ATOM   2121  C  CG1   . ILE B 1  48   ? 458.108 22.450  714.434 1.00 117.59 ? 48   ILE B CG1   1 
ATOM   2122  C  CG2   . ILE B 1  48   ? 456.346 23.967  715.356 1.00 117.07 ? 48   ILE B CG2   1 
ATOM   2123  C  CD1   . ILE B 1  48   ? 459.165 23.236  715.196 1.00 119.36 ? 48   ILE B CD1   1 
ATOM   2124  N  N     . PRO B 1  49   ? 455.663 22.668  718.402 1.00 111.62 ? 49   PRO B N     1 
ATOM   2125  C  CA    . PRO B 1  49   ? 454.531 22.840  719.327 1.00 105.93 ? 49   PRO B CA    1 
ATOM   2126  C  C     . PRO B 1  49   ? 453.344 23.562  718.708 1.00 107.24 ? 49   PRO B C     1 
ATOM   2127  O  O     . PRO B 1  49   ? 453.500 24.591  718.041 1.00 104.26 ? 49   PRO B O     1 
ATOM   2128  C  CB    . PRO B 1  49   ? 455.134 23.659  720.471 1.00 102.13 ? 49   PRO B CB    1 
ATOM   2129  C  CG    . PRO B 1  49   ? 456.171 24.454  719.858 1.00 103.62 ? 49   PRO B CG    1 
ATOM   2130  C  CD    . PRO B 1  49   ? 456.799 23.503  718.830 1.00 112.52 ? 49   PRO B CD    1 
ATOM   2131  N  N     . GLY B 1  50   ? 452.157 22.976  718.881 1.00 115.48 ? 50   GLY B N     1 
ATOM   2132  C  CA    . GLY B 1  50   ? 450.925 23.505  718.319 1.00 119.30 ? 50   GLY B CA    1 
ATOM   2133  C  C     . GLY B 1  50   ? 449.756 23.052  719.168 1.00 118.46 ? 50   GLY B C     1 
ATOM   2134  O  O     . GLY B 1  50   ? 449.977 22.502  720.249 1.00 119.34 ? 50   GLY B O     1 
ATOM   2135  N  N     . THR B 1  51   ? 448.521 23.329  718.747 1.00 115.91 ? 51   THR B N     1 
ATOM   2136  C  CA    . THR B 1  51   ? 447.334 22.995  719.526 1.00 109.60 ? 51   THR B CA    1 
ATOM   2137  C  C     . THR B 1  51   ? 446.385 22.146  718.689 1.00 108.31 ? 51   THR B C     1 
ATOM   2138  O  O     . THR B 1  51   ? 446.311 22.288  717.456 1.00 117.53 ? 51   THR B O     1 
ATOM   2139  C  CB    . THR B 1  51   ? 446.621 24.247  720.037 1.00 106.25 ? 51   THR B CB    1 
ATOM   2140  O  OG1   . THR B 1  51   ? 445.702 24.713  719.047 1.00 113.73 ? 51   THR B OG1   1 
ATOM   2141  C  CG2   . THR B 1  51   ? 447.623 25.348  720.314 1.00 106.85 ? 51   THR B CG2   1 
ATOM   2142  N  N     . ALA B 1  52   ? 445.586 21.336  719.382 1.00 101.50 ? 52   ALA B N     1 
ATOM   2143  C  CA    . ALA B 1  52   ? 444.652 20.431  718.730 1.00 90.29  ? 52   ALA B CA    1 
ATOM   2144  C  C     . ALA B 1  52   ? 443.442 20.160  719.611 1.00 99.97  ? 52   ALA B C     1 
ATOM   2145  O  O     . ALA B 1  52   ? 443.522 20.190  720.844 1.00 102.70 ? 52   ALA B O     1 
ATOM   2146  C  CB    . ALA B 1  52   ? 445.330 19.098  718.421 1.00 79.95  ? 52   ALA B CB    1 
ATOM   2147  N  N     . VAL B 1  53   ? 442.331 19.820  718.962 1.00 102.09 ? 53   VAL B N     1 
ATOM   2148  C  CA    . VAL B 1  53   ? 441.149 19.381  719.690 1.00 101.43 ? 53   VAL B CA    1 
ATOM   2149  C  C     . VAL B 1  53   ? 441.392 17.933  720.073 1.00 102.25 ? 53   VAL B C     1 
ATOM   2150  O  O     . VAL B 1  53   ? 441.486 17.064  719.205 1.00 107.24 ? 53   VAL B O     1 
ATOM   2151  C  CB    . VAL B 1  53   ? 439.877 19.512  718.842 1.00 101.98 ? 53   VAL B CB    1 
ATOM   2152  C  CG1   . VAL B 1  53   ? 438.748 18.715  719.475 1.00 104.05 ? 53   VAL B CG1   1 
ATOM   2153  C  CG2   . VAL B 1  53   ? 439.470 20.971  718.691 1.00 106.56 ? 53   VAL B CG2   1 
ATOM   2154  N  N     . THR B 1  54   ? 441.509 17.672  721.376 1.00 101.57 ? 54   THR B N     1 
ATOM   2155  C  CA    . THR B 1  54   ? 441.739 16.302  721.794 1.00 102.16 ? 54   THR B CA    1 
ATOM   2156  C  C     . THR B 1  54   ? 440.479 15.590  722.262 1.00 104.32 ? 54   THR B C     1 
ATOM   2157  O  O     . THR B 1  54   ? 440.492 14.359  722.353 1.00 105.13 ? 54   THR B O     1 
ATOM   2158  C  CB    . THR B 1  54   ? 442.764 16.261  722.932 1.00 106.03 ? 54   THR B CB    1 
ATOM   2159  O  OG1   . THR B 1  54   ? 442.356 17.151  723.977 1.00 111.32 ? 54   THR B OG1   1 
ATOM   2160  C  CG2   . THR B 1  54   ? 444.083 16.737  722.437 1.00 107.80 ? 54   THR B CG2   1 
ATOM   2161  N  N     . SER B 1  55   ? 439.415 16.310  722.610 1.00 103.55 ? 55   SER B N     1 
ATOM   2162  C  CA    . SER B 1  55   ? 438.267 15.584  723.130 1.00 101.29 ? 55   SER B CA    1 
ATOM   2163  C  C     . SER B 1  55   ? 437.007 16.433  722.959 1.00 98.84  ? 55   SER B C     1 
ATOM   2164  O  O     . SER B 1  55   ? 437.043 17.659  723.137 1.00 96.43  ? 55   SER B O     1 
ATOM   2165  C  CB    . SER B 1  55   ? 438.482 15.170  724.577 1.00 99.78  ? 55   SER B CB    1 
ATOM   2166  O  OG    . SER B 1  55   ? 437.746 13.992  724.817 1.00 102.70 ? 55   SER B OG    1 
ATOM   2167  N  N     . VAL B 1  56   ? 435.872 15.762  722.742 1.00 100.31 ? 56   VAL B N     1 
ATOM   2168  C  CA    . VAL B 1  56   ? 434.595 16.447  722.548 1.00 101.44 ? 56   VAL B CA    1 
ATOM   2169  C  C     . VAL B 1  56   ? 433.458 15.662  723.207 1.00 106.61 ? 56   VAL B C     1 
ATOM   2170  O  O     . VAL B 1  56   ? 433.385 14.433  723.088 1.00 109.96 ? 56   VAL B O     1 
ATOM   2171  C  CB    . VAL B 1  56   ? 434.303 16.643  721.041 1.00 98.23  ? 56   VAL B CB    1 
ATOM   2172  C  CG1   . VAL B 1  56   ? 434.176 15.301  720.339 1.00 97.17  ? 56   VAL B CG1   1 
ATOM   2173  C  CG2   . VAL B 1  56   ? 433.044 17.474  720.808 1.00 97.98  ? 56   VAL B CG2   1 
ATOM   2174  N  N     . TYR B 1  57   ? 432.614 16.369  723.957 1.00 106.11 ? 57   TYR B N     1 
ATOM   2175  C  CA    . TYR B 1  57   ? 431.371 15.849  724.517 1.00 111.71 ? 57   TYR B CA    1 
ATOM   2176  C  C     . TYR B 1  57   ? 430.234 16.632  723.885 1.00 111.56 ? 57   TYR B C     1 
ATOM   2177  O  O     . TYR B 1  57   ? 430.194 17.861  724.004 1.00 114.09 ? 57   TYR B O     1 
ATOM   2178  C  CB    . TYR B 1  57   ? 431.354 15.926  726.036 1.00 119.80 ? 57   TYR B CB    1 
ATOM   2179  C  CG    . TYR B 1  57   ? 430.009 15.583  726.627 1.00 129.27 ? 57   TYR B CG    1 
ATOM   2180  C  CD1   . TYR B 1  57   ? 429.558 14.269  726.749 1.00 132.20 ? 57   TYR B CD1   1 
ATOM   2181  C  CD2   . TYR B 1  57   ? 429.219 16.593  727.147 1.00 135.12 ? 57   TYR B CD2   1 
ATOM   2182  C  CE1   . TYR B 1  57   ? 428.301 13.996  727.332 1.00 135.02 ? 57   TYR B CE1   1 
ATOM   2183  C  CE2   . TYR B 1  57   ? 427.988 16.336  727.736 1.00 139.06 ? 57   TYR B CE2   1 
ATOM   2184  C  CZ    . TYR B 1  57   ? 427.528 15.050  727.830 1.00 138.17 ? 57   TYR B CZ    1 
ATOM   2185  O  OH    . TYR B 1  57   ? 426.292 14.868  728.417 1.00 141.91 ? 57   TYR B OH    1 
ATOM   2186  N  N     . ILE B 1  58   ? 429.291 15.920  723.265 1.00 110.90 ? 58   ILE B N     1 
ATOM   2187  C  CA    . ILE B 1  58   ? 428.085 16.499  722.669 1.00 114.02 ? 58   ILE B CA    1 
ATOM   2188  C  C     . ILE B 1  58   ? 426.823 15.967  723.341 1.00 115.57 ? 58   ILE B C     1 
ATOM   2189  O  O     . ILE B 1  58   ? 426.681 14.754  723.538 1.00 117.48 ? 58   ILE B O     1 
ATOM   2190  C  CB    . ILE B 1  58   ? 428.065 16.231  721.152 1.00 111.98 ? 58   ILE B CB    1 
ATOM   2191  C  CG1   . ILE B 1  58   ? 429.396 16.680  720.543 1.00 113.29 ? 58   ILE B CG1   1 
ATOM   2192  C  CG2   . ILE B 1  58   ? 426.928 16.949  720.490 1.00 113.87 ? 58   ILE B CG2   1 
ATOM   2193  C  CD1   . ILE B 1  58   ? 429.589 16.323  719.087 1.00 112.74 ? 58   ILE B CD1   1 
ATOM   2194  N  N     . GLU B 1  59   ? 425.925 16.884  723.714 1.00 116.11 ? 59   GLU B N     1 
ATOM   2195  C  CA    . GLU B 1  59   ? 424.931 16.537  724.708 1.00 127.65 ? 59   GLU B CA    1 
ATOM   2196  C  C     . GLU B 1  59   ? 424.202 15.215  724.505 1.00 132.65 ? 59   GLU B C     1 
ATOM   2197  O  O     . GLU B 1  59   ? 424.503 14.248  725.205 1.00 137.89 ? 59   GLU B O     1 
ATOM   2198  C  CB    . GLU B 1  59   ? 423.905 17.678  724.747 1.00 134.68 ? 59   GLU B CB    1 
ATOM   2199  C  CG    . GLU B 1  59   ? 422.777 17.620  725.828 1.00 143.58 ? 59   GLU B CG    1 
ATOM   2200  C  CD    . GLU B 1  59   ? 422.925 18.624  726.981 1.00 148.27 ? 59   GLU B CD    1 
ATOM   2201  O  OE1   . GLU B 1  59   ? 423.970 19.315  727.040 1.00 148.51 ? 59   GLU B OE1   1 
ATOM   2202  O  OE2   . GLU B 1  59   ? 421.954 18.776  727.778 1.00 149.43 ? 59   GLU B OE2   1 
ATOM   2203  N  N     . ASP B 1  60   ? 423.341 15.097  723.508 1.00 135.21 ? 60   ASP B N     1 
ATOM   2204  C  CA    . ASP B 1  60   ? 422.571 13.851  723.418 1.00 140.73 ? 60   ASP B CA    1 
ATOM   2205  C  C     . ASP B 1  60   ? 423.215 12.819  722.515 1.00 142.49 ? 60   ASP B C     1 
ATOM   2206  O  O     . ASP B 1  60   ? 422.518 12.136  721.756 1.00 147.14 ? 60   ASP B O     1 
ATOM   2207  C  CB    . ASP B 1  60   ? 421.118 14.132  723.060 1.00 150.18 ? 60   ASP B CB    1 
ATOM   2208  C  CG    . ASP B 1  60   ? 420.387 14.885  724.192 1.00 156.78 ? 60   ASP B CG    1 
ATOM   2209  O  OD1   . ASP B 1  60   ? 420.607 14.512  725.363 1.00 158.09 ? 60   ASP B OD1   1 
ATOM   2210  O  OD2   . ASP B 1  60   ? 419.604 15.829  723.938 1.00 160.10 ? 60   ASP B OD2   1 
ATOM   2211  N  N     . VAL B 1  61   ? 424.532 12.667  722.571 1.00 135.03 ? 61   VAL B N     1 
ATOM   2212  C  CA    . VAL B 1  61   ? 425.244 11.756  721.690 1.00 129.03 ? 61   VAL B CA    1 
ATOM   2213  C  C     . VAL B 1  61   ? 426.103 10.809  722.498 1.00 127.91 ? 61   VAL B C     1 
ATOM   2214  O  O     . VAL B 1  61   ? 427.027 11.242  723.199 1.00 130.19 ? 61   VAL B O     1 
ATOM   2215  C  CB    . VAL B 1  61   ? 426.086 12.524  720.679 1.00 125.21 ? 61   VAL B CB    1 
ATOM   2216  C  CG1   . VAL B 1  61   ? 426.945 11.566  719.940 1.00 125.89 ? 61   VAL B CG1   1 
ATOM   2217  C  CG2   . VAL B 1  61   ? 425.144 13.234  719.728 1.00 125.19 ? 61   VAL B CG2   1 
ATOM   2218  N  N     . LEU B 1  62   ? 425.855 9.516   722.334 1.00 129.60 ? 62   LEU B N     1 
ATOM   2219  C  CA    . LEU B 1  62   ? 426.594 8.522   723.097 1.00 133.51 ? 62   LEU B CA    1 
ATOM   2220  C  C     . LEU B 1  62   ? 427.987 8.255   722.524 1.00 129.94 ? 62   LEU B C     1 
ATOM   2221  O  O     . LEU B 1  62   ? 428.990 8.367   723.241 1.00 124.25 ? 62   LEU B O     1 
ATOM   2222  C  CB    . LEU B 1  62   ? 425.762 7.240   723.161 1.00 135.77 ? 62   LEU B CB    1 
ATOM   2223  C  CG    . LEU B 1  62   ? 424.354 7.577   723.664 1.00 141.59 ? 62   LEU B CG    1 
ATOM   2224  C  CD1   . LEU B 1  62   ? 423.485 6.346   723.905 1.00 146.01 ? 62   LEU B CD1   1 
ATOM   2225  C  CD2   . LEU B 1  62   ? 424.466 8.395   724.929 1.00 144.91 ? 62   LEU B CD2   1 
ATOM   2226  N  N     . HIS B 1  63   ? 428.097 8.035   721.220 1.00 133.72 ? 63   HIS B N     1 
ATOM   2227  C  CA    . HIS B 1  63   ? 429.400 7.729   720.651 1.00 131.65 ? 63   HIS B CA    1 
ATOM   2228  C  C     . HIS B 1  63   ? 429.567 8.413   719.302 1.00 124.77 ? 63   HIS B C     1 
ATOM   2229  O  O     . HIS B 1  63   ? 428.670 9.098   718.798 1.00 123.42 ? 63   HIS B O     1 
ATOM   2230  C  CB    . HIS B 1  63   ? 429.605 6.202   720.567 1.00 138.83 ? 63   HIS B CB    1 
ATOM   2231  C  CG    . HIS B 1  63   ? 428.502 5.478   719.859 1.00 148.66 ? 63   HIS B CG    1 
ATOM   2232  N  ND1   . HIS B 1  63   ? 428.368 5.465   718.485 1.00 149.74 ? 63   HIS B ND1   1 
ATOM   2233  C  CD2   . HIS B 1  63   ? 427.459 4.763   720.345 1.00 154.36 ? 63   HIS B CD2   1 
ATOM   2234  C  CE1   . HIS B 1  63   ? 427.299 4.762   718.156 1.00 153.72 ? 63   HIS B CE1   1 
ATOM   2235  N  NE2   . HIS B 1  63   ? 426.726 4.329   719.267 1.00 157.23 ? 63   HIS B NE2   1 
ATOM   2236  N  N     . GLU B 1  64   ? 430.690 8.106   718.668 1.00 121.71 ? 64   GLU B N     1 
ATOM   2237  C  CA    . GLU B 1  64   ? 431.133 8.828   717.480 1.00 119.86 ? 64   GLU B CA    1 
ATOM   2238  C  C     . GLU B 1  64   ? 430.205 8.564   716.307 1.00 118.02 ? 64   GLU B C     1 
ATOM   2239  O  O     . GLU B 1  64   ? 430.121 9.383   715.384 1.00 111.47 ? 64   GLU B O     1 
ATOM   2240  C  CB    . GLU B 1  64   ? 432.593 8.506   717.200 1.00 116.86 ? 64   GLU B CB    1 
ATOM   2241  C  CG    . GLU B 1  64   ? 433.213 9.260   716.064 1.00 113.44 ? 64   GLU B CG    1 
ATOM   2242  C  CD    . GLU B 1  64   ? 434.697 8.981   715.974 1.00 109.20 ? 64   GLU B CD    1 
ATOM   2243  O  OE1   . GLU B 1  64   ? 435.230 8.350   716.927 1.00 104.70 ? 64   GLU B OE1   1 
ATOM   2244  O  OE2   . GLU B 1  64   ? 435.330 9.434   714.991 1.00 109.43 ? 64   GLU B OE2   1 
ATOM   2245  N  N     . PHE B 1  65   ? 429.616 7.381   716.250 1.00 123.10 ? 65   PHE B N     1 
ATOM   2246  C  CA    . PHE B 1  65   ? 428.781 7.039   715.119 1.00 124.46 ? 65   PHE B CA    1 
ATOM   2247  C  C     . PHE B 1  65   ? 427.305 7.362   715.335 1.00 123.26 ? 65   PHE B C     1 
ATOM   2248  O  O     . PHE B 1  65   ? 426.479 7.007   714.492 1.00 119.58 ? 65   PHE B O     1 
ATOM   2249  C  CB    . PHE B 1  65   ? 429.023 5.580   714.794 1.00 129.17 ? 65   PHE B CB    1 
ATOM   2250  C  CG    . PHE B 1  65   ? 430.468 5.302   714.544 1.00 124.12 ? 65   PHE B CG    1 
ATOM   2251  C  CD1   . PHE B 1  65   ? 431.267 6.300   714.008 1.00 119.58 ? 65   PHE B CD1   1 
ATOM   2252  C  CD2   . PHE B 1  65   ? 431.037 4.088   714.857 1.00 124.02 ? 65   PHE B CD2   1 
ATOM   2253  C  CE1   . PHE B 1  65   ? 432.597 6.096   713.773 1.00 116.26 ? 65   PHE B CE1   1 
ATOM   2254  C  CE2   . PHE B 1  65   ? 432.381 3.880   714.621 1.00 122.99 ? 65   PHE B CE2   1 
ATOM   2255  C  CZ    . PHE B 1  65   ? 433.160 4.886   714.076 1.00 117.77 ? 65   PHE B CZ    1 
ATOM   2256  N  N     . SER B 1  66   ? 426.935 7.990   716.444 1.00 127.77 ? 66   SER B N     1 
ATOM   2257  C  CA    . SER B 1  66   ? 425.535 8.371   716.551 1.00 142.06 ? 66   SER B CA    1 
ATOM   2258  C  C     . SER B 1  66   ? 425.254 9.475   715.521 1.00 139.56 ? 66   SER B C     1 
ATOM   2259  O  O     . SER B 1  66   ? 426.166 10.044  714.914 1.00 128.20 ? 66   SER B O     1 
ATOM   2260  C  CB    . SER B 1  66   ? 425.112 8.820   717.976 1.00 147.84 ? 66   SER B CB    1 
ATOM   2261  O  OG    . SER B 1  66   ? 425.330 7.869   719.021 1.00 148.76 ? 66   SER B OG    1 
ATOM   2262  N  N     . THR B 1  67   ? 423.973 9.661   715.222 1.00 149.87 ? 67   THR B N     1 
ATOM   2263  C  CA    . THR B 1  67   ? 423.524 10.747  714.367 1.00 143.61 ? 67   THR B CA    1 
ATOM   2264  C  C     . THR B 1  67   ? 422.749 11.711  715.258 1.00 138.66 ? 67   THR B C     1 
ATOM   2265  O  O     . THR B 1  67   ? 422.068 11.291  716.204 1.00 132.12 ? 67   THR B O     1 
ATOM   2266  C  CB    . THR B 1  67   ? 422.643 10.274  713.198 1.00 143.17 ? 67   THR B CB    1 
ATOM   2267  O  OG1   . THR B 1  67   ? 422.143 11.416  712.489 1.00 143.76 ? 67   THR B OG1   1 
ATOM   2268  C  CG2   . THR B 1  67   ? 421.446 9.425   713.707 1.00 145.37 ? 67   THR B CG2   1 
ATOM   2269  N  N     . ILE B 1  68   ? 422.869 12.999  714.964 1.00 134.79 ? 68   ILE B N     1 
ATOM   2270  C  CA    . ILE B 1  68   ? 422.187 14.036  715.727 1.00 131.79 ? 68   ILE B CA    1 
ATOM   2271  C  C     . ILE B 1  68   ? 420.927 14.435  714.972 1.00 135.35 ? 68   ILE B C     1 
ATOM   2272  O  O     . ILE B 1  68   ? 421.016 14.835  713.794 1.00 139.52 ? 68   ILE B O     1 
ATOM   2273  C  CB    . ILE B 1  68   ? 423.061 15.271  715.969 1.00 118.23 ? 68   ILE B CB    1 
ATOM   2274  C  CG1   . ILE B 1  68   ? 424.342 14.915  716.670 1.00 107.58 ? 68   ILE B CG1   1 
ATOM   2275  C  CG2   . ILE B 1  68   ? 422.300 16.322  716.747 1.00 120.59 ? 68   ILE B CG2   1 
ATOM   2276  C  CD1   . ILE B 1  68   ? 425.137 16.153  716.938 1.00 106.40 ? 68   ILE B CD1   1 
ATOM   2277  N  N     . PRO B 1  69   ? 419.761 14.315  715.591 1.00 129.02 ? 69   PRO B N     1 
ATOM   2278  C  CA    . PRO B 1  69   ? 418.526 14.792  714.975 1.00 131.11 ? 69   PRO B CA    1 
ATOM   2279  C  C     . PRO B 1  69   ? 418.523 16.311  714.956 1.00 128.86 ? 69   PRO B C     1 
ATOM   2280  O  O     . PRO B 1  69   ? 418.945 16.953  715.923 1.00 126.25 ? 69   PRO B O     1 
ATOM   2281  C  CB    . PRO B 1  69   ? 417.439 14.223  715.890 1.00 137.58 ? 69   PRO B CB    1 
ATOM   2282  C  CG    . PRO B 1  69   ? 418.154 13.127  716.700 1.00 132.57 ? 69   PRO B CG    1 
ATOM   2283  C  CD    . PRO B 1  69   ? 419.529 13.607  716.858 1.00 126.22 ? 69   PRO B CD    1 
ATOM   2284  N  N     . GLY B 1  70   ? 418.117 16.889  713.821 1.00 130.53 ? 70   GLY B N     1 
ATOM   2285  C  CA    . GLY B 1  70   ? 418.074 18.329  713.709 1.00 133.68 ? 70   GLY B CA    1 
ATOM   2286  C  C     . GLY B 1  70   ? 419.379 18.925  713.261 1.00 132.70 ? 70   GLY B C     1 
ATOM   2287  O  O     . GLY B 1  70   ? 419.446 20.137  713.010 1.00 134.75 ? 70   GLY B O     1 
ATOM   2288  N  N     . VAL B 1  71   ? 420.437 18.126  713.229 1.00 132.00 ? 71   VAL B N     1 
ATOM   2289  C  CA    . VAL B 1  71   ? 421.725 18.555  712.721 1.00 132.99 ? 71   VAL B CA    1 
ATOM   2290  C  C     . VAL B 1  71   ? 422.084 17.717  711.504 1.00 135.43 ? 71   VAL B C     1 
ATOM   2291  O  O     . VAL B 1  71   ? 422.051 16.479  711.563 1.00 132.48 ? 71   VAL B O     1 
ATOM   2292  C  CB    . VAL B 1  71   ? 422.805 18.436  713.801 1.00 132.13 ? 71   VAL B CB    1 
ATOM   2293  C  CG1   . VAL B 1  71   ? 424.146 18.830  713.224 1.00 129.95 ? 71   VAL B CG1   1 
ATOM   2294  C  CG2   . VAL B 1  71   ? 422.429 19.318  714.999 1.00 134.84 ? 71   VAL B CG2   1 
ATOM   2295  N  N     . LYS B 1  72   ? 422.455 18.427  710.423 1.00 140.40 ? 72   LYS B N     1 
ATOM   2296  C  CA    . LYS B 1  72   ? 422.805 17.876  709.113 1.00 135.00 ? 72   LYS B CA    1 
ATOM   2297  C  C     . LYS B 1  72   ? 424.047 16.992  709.149 1.00 127.27 ? 72   LYS B C     1 
ATOM   2298  O  O     . LYS B 1  72   ? 423.999 15.811  708.790 1.00 126.22 ? 72   LYS B O     1 
ATOM   2299  C  CB    . LYS B 1  72   ? 423.024 19.038  708.150 1.00 141.23 ? 72   LYS B CB    1 
ATOM   2300  C  CG    . LYS B 1  72   ? 423.457 18.647  706.759 1.00 150.71 ? 72   LYS B CG    1 
ATOM   2301  C  CD    . LYS B 1  72   ? 423.671 19.868  705.869 1.00 155.44 ? 72   LYS B CD    1 
ATOM   2302  C  CE    . LYS B 1  72   ? 424.096 19.452  704.475 1.00 155.60 ? 72   LYS B CE    1 
ATOM   2303  N  NZ    . LYS B 1  72   ? 424.222 20.644  703.603 1.00 158.86 ? 72   LYS B NZ    1 
ATOM   2304  N  N     . GLU B 1  73   ? 425.168 17.552  709.596 1.00 117.39 ? 73   GLU B N     1 
ATOM   2305  C  CA    . GLU B 1  73   ? 426.408 16.802  709.713 1.00 113.24 ? 73   GLU B CA    1 
ATOM   2306  C  C     . GLU B 1  73   ? 426.218 15.608  710.626 1.00 117.40 ? 73   GLU B C     1 
ATOM   2307  O  O     . GLU B 1  73   ? 425.479 15.667  711.613 1.00 128.12 ? 73   GLU B O     1 
ATOM   2308  C  CB    . GLU B 1  73   ? 427.523 17.686  710.271 1.00 108.70 ? 73   GLU B CB    1 
ATOM   2309  C  CG    . GLU B 1  73   ? 427.950 18.798  709.339 1.00 112.37 ? 73   GLU B CG    1 
ATOM   2310  C  CD    . GLU B 1  73   ? 427.037 20.018  709.402 1.00 117.09 ? 73   GLU B CD    1 
ATOM   2311  O  OE1   . GLU B 1  73   ? 425.928 19.914  709.990 1.00 119.28 ? 73   GLU B OE1   1 
ATOM   2312  O  OE2   . GLU B 1  73   ? 427.414 21.068  708.818 1.00 115.75 ? 73   GLU B OE2   1 
ATOM   2313  N  N     . ASP B 1  74   ? 426.919 14.520  710.323 1.00 118.23 ? 74   ASP B N     1 
ATOM   2314  C  CA    . ASP B 1  74   ? 426.920 13.470  711.324 1.00 120.52 ? 74   ASP B CA    1 
ATOM   2315  C  C     . ASP B 1  74   ? 427.963 13.801  712.387 1.00 116.44 ? 74   ASP B C     1 
ATOM   2316  O  O     . ASP B 1  74   ? 428.664 14.813  712.301 1.00 111.35 ? 74   ASP B O     1 
ATOM   2317  C  CB    . ASP B 1  74   ? 427.124 12.106  710.648 1.00 123.61 ? 74   ASP B CB    1 
ATOM   2318  C  CG    . ASP B 1  74   ? 428.245 12.100  709.635 1.00 124.56 ? 74   ASP B CG    1 
ATOM   2319  O  OD1   . ASP B 1  74   ? 429.417 11.913  710.041 1.00 123.06 ? 74   ASP B OD1   1 
ATOM   2320  O  OD2   . ASP B 1  74   ? 427.934 12.275  708.428 1.00 125.88 ? 74   ASP B OD2   1 
ATOM   2321  N  N     . VAL B 1  75   ? 428.057 12.955  713.418 1.00 118.85 ? 75   VAL B N     1 
ATOM   2322  C  CA    . VAL B 1  75   ? 428.976 13.256  714.517 1.00 114.16 ? 75   VAL B CA    1 
ATOM   2323  C  C     . VAL B 1  75   ? 430.411 13.277  714.015 1.00 109.45 ? 75   VAL B C     1 
ATOM   2324  O  O     . VAL B 1  75   ? 431.205 14.155  714.382 1.00 108.14 ? 75   VAL B O     1 
ATOM   2325  C  CB    . VAL B 1  75   ? 428.792 12.255  715.674 1.00 107.34 ? 75   VAL B CB    1 
ATOM   2326  C  CG1   . VAL B 1  75   ? 429.828 12.519  716.744 1.00 105.87 ? 75   VAL B CG1   1 
ATOM   2327  C  CG2   . VAL B 1  75   ? 427.408 12.378  716.263 1.00 101.92 ? 75   VAL B CG2   1 
ATOM   2328  N  N     . VAL B 1  76   ? 430.756 12.320  713.152 1.00 107.88 ? 76   VAL B N     1 
ATOM   2329  C  CA    . VAL B 1  76   ? 432.107 12.240  712.606 1.00 99.51  ? 76   VAL B CA    1 
ATOM   2330  C  C     . VAL B 1  76   ? 432.471 13.549  711.925 1.00 94.92  ? 76   VAL B C     1 
ATOM   2331  O  O     . VAL B 1  76   ? 433.512 14.158  712.213 1.00 89.36  ? 76   VAL B O     1 
ATOM   2332  C  CB    . VAL B 1  76   ? 432.245 11.045  711.651 1.00 94.37  ? 76   VAL B CB    1 
ATOM   2333  C  CG1   . VAL B 1  76   ? 433.670 10.964  711.206 1.00 96.88  ? 76   VAL B CG1   1 
ATOM   2334  C  CG2   . VAL B 1  76   ? 431.849 9.760   712.333 1.00 91.92  ? 76   VAL B CG2   1 
ATOM   2335  N  N     . GLU B 1  77   ? 431.558 14.044  711.077 1.00 98.83  ? 77   GLU B N     1 
ATOM   2336  C  CA    . GLU B 1  77   ? 431.814 15.267  710.331 1.00 103.24 ? 77   GLU B CA    1 
ATOM   2337  C  C     . GLU B 1  77   ? 432.077 16.444  711.254 1.00 105.31 ? 77   GLU B C     1 
ATOM   2338  O  O     . GLU B 1  77   ? 432.959 17.261  710.973 1.00 107.25 ? 77   GLU B O     1 
ATOM   2339  C  CB    . GLU B 1  77   ? 430.633 15.571  709.411 1.00 110.17 ? 77   GLU B CB    1 
ATOM   2340  C  CG    . GLU B 1  77   ? 430.824 15.105  707.968 1.00 115.49 ? 77   GLU B CG    1 
ATOM   2341  C  CD    . GLU B 1  77   ? 431.672 16.073  707.144 1.00 119.42 ? 77   GLU B CD    1 
ATOM   2342  O  OE1   . GLU B 1  77   ? 431.421 17.305  707.276 1.00 121.74 ? 77   GLU B OE1   1 
ATOM   2343  O  OE2   . GLU B 1  77   ? 432.573 15.599  706.377 1.00 117.34 ? 77   GLU B OE2   1 
ATOM   2344  N  N     . ILE B 1  78   ? 431.334 16.569  712.353 1.00 104.36 ? 78   ILE B N     1 
ATOM   2345  C  CA    . ILE B 1  78   ? 431.621 17.678  713.263 1.00 103.87 ? 78   ILE B CA    1 
ATOM   2346  C  C     . ILE B 1  78   ? 433.028 17.526  713.832 1.00 105.17 ? 78   ILE B C     1 
ATOM   2347  O  O     . ILE B 1  78   ? 433.811 18.482  713.877 1.00 108.24 ? 78   ILE B O     1 
ATOM   2348  C  CB    . ILE B 1  78   ? 430.568 17.789  714.366 1.00 102.86 ? 78   ILE B CB    1 
ATOM   2349  C  CG1   . ILE B 1  78   ? 429.191 17.860  713.716 1.00 101.71 ? 78   ILE B CG1   1 
ATOM   2350  C  CG2   . ILE B 1  78   ? 430.826 19.074  715.083 1.00 95.16  ? 78   ILE B CG2   1 
ATOM   2351  C  CD1   . ILE B 1  78   ? 428.039 17.710  714.662 1.00 101.31 ? 78   ILE B CD1   1 
ATOM   2352  N  N     . ILE B 1  79   ? 433.366 16.319  714.279 1.00 97.04  ? 79   ILE B N     1 
ATOM   2353  C  CA    . ILE B 1  79   ? 434.706 16.066  714.791 1.00 94.25  ? 79   ILE B CA    1 
ATOM   2354  C  C     . ILE B 1  79   ? 435.742 16.416  713.731 1.00 93.41  ? 79   ILE B C     1 
ATOM   2355  O  O     . ILE B 1  79   ? 436.786 17.024  714.016 1.00 90.83  ? 79   ILE B O     1 
ATOM   2356  C  CB    . ILE B 1  79   ? 434.849 14.595  715.230 1.00 90.63  ? 79   ILE B CB    1 
ATOM   2357  C  CG1   . ILE B 1  79   ? 433.981 14.272  716.434 1.00 86.58  ? 79   ILE B CG1   1 
ATOM   2358  C  CG2   . ILE B 1  79   ? 436.316 14.209  715.489 1.00 81.97  ? 79   ILE B CG2   1 
ATOM   2359  C  CD1   . ILE B 1  79   ? 434.054 12.814  716.812 1.00 86.33  ? 79   ILE B CD1   1 
ATOM   2360  N  N     . LEU B 1  80   ? 435.460 16.041  712.486 1.00 94.31  ? 80   LEU B N     1 
ATOM   2361  C  CA    . LEU B 1  80   ? 436.352 16.338  711.369 1.00 93.54  ? 80   LEU B CA    1 
ATOM   2362  C  C     . LEU B 1  80   ? 436.604 17.846  711.249 1.00 94.69  ? 80   LEU B C     1 
ATOM   2363  O  O     . LEU B 1  80   ? 437.756 18.292  711.171 1.00 80.79  ? 80   LEU B O     1 
ATOM   2364  C  CB    . LEU B 1  80   ? 435.701 15.760  710.122 1.00 86.36  ? 80   LEU B CB    1 
ATOM   2365  C  CG    . LEU B 1  80   ? 436.265 14.345  709.970 1.00 80.81  ? 80   LEU B CG    1 
ATOM   2366  C  CD1   . LEU B 1  80   ? 435.838 13.657  708.721 1.00 83.31  ? 80   LEU B CD1   1 
ATOM   2367  C  CD2   . LEU B 1  80   ? 437.722 14.203  710.241 1.00 81.91  ? 80   LEU B CD2   1 
ATOM   2368  N  N     . ASN B 1  81   ? 435.523 18.636  711.149 1.00 101.14 ? 81   ASN B N     1 
ATOM   2369  C  CA    . ASN B 1  81   ? 435.610 20.101  711.134 1.00 96.02  ? 81   ASN B CA    1 
ATOM   2370  C  C     . ASN B 1  81   ? 436.380 20.663  712.327 1.00 91.29  ? 81   ASN B C     1 
ATOM   2371  O  O     . ASN B 1  81   ? 437.160 21.612  712.192 1.00 87.95  ? 81   ASN B O     1 
ATOM   2372  C  CB    . ASN B 1  81   ? 434.213 20.719  711.096 1.00 99.44  ? 81   ASN B CB    1 
ATOM   2373  C  CG    . ASN B 1  81   ? 433.486 20.446  709.799 1.00 106.23 ? 81   ASN B CG    1 
ATOM   2374  O  OD1   . ASN B 1  81   ? 434.090 20.462  708.712 1.00 106.81 ? 81   ASN B OD1   1 
ATOM   2375  N  ND2   . ASN B 1  81   ? 432.186 20.195  709.898 1.00 107.19 ? 81   ASN B ND2   1 
ATOM   2376  N  N     . LEU B 1  82   ? 436.205 20.059  713.501 1.00 90.50  ? 82   LEU B N     1 
ATOM   2377  C  CA    . LEU B 1  82   ? 436.937 20.519  714.678 1.00 90.61  ? 82   LEU B CA    1 
ATOM   2378  C  C     . LEU B 1  82   ? 438.419 20.293  714.530 1.00 83.11  ? 82   LEU B C     1 
ATOM   2379  O  O     . LEU B 1  82   ? 439.220 21.143  714.920 1.00 82.77  ? 82   LEU B O     1 
ATOM   2380  C  CB    . LEU B 1  82   ? 436.443 19.813  715.921 1.00 93.50  ? 82   LEU B CB    1 
ATOM   2381  C  CG    . LEU B 1  82   ? 435.054 20.241  716.319 1.00 94.73  ? 82   LEU B CG    1 
ATOM   2382  C  CD1   . LEU B 1  82   ? 434.525 19.260  717.328 1.00 89.60  ? 82   LEU B CD1   1 
ATOM   2383  C  CD2   . LEU B 1  82   ? 435.204 21.630  716.895 1.00 99.19  ? 82   LEU B CD2   1 
ATOM   2384  N  N     . LYS B 1  83   ? 438.798 19.202  713.892 1.00 81.28  ? 83   LYS B N     1 
ATOM   2385  C  CA    . LYS B 1  83   ? 440.208 19.001  713.634 1.00 84.56  ? 83   LYS B CA    1 
ATOM   2386  C  C     . LYS B 1  83   ? 440.757 20.159  712.807 1.00 87.51  ? 83   LYS B C     1 
ATOM   2387  O  O     . LYS B 1  83   ? 441.907 20.577  712.993 1.00 87.96  ? 83   LYS B O     1 
ATOM   2388  C  CB    . LYS B 1  83   ? 440.411 17.677  712.912 1.00 85.29  ? 83   LYS B CB    1 
ATOM   2389  C  CG    . LYS B 1  83   ? 440.185 16.440  713.725 1.00 84.60  ? 83   LYS B CG    1 
ATOM   2390  C  CD    . LYS B 1  83   ? 440.433 15.231  712.830 1.00 88.31  ? 83   LYS B CD    1 
ATOM   2391  C  CE    . LYS B 1  83   ? 440.327 13.907  713.570 1.00 91.24  ? 83   LYS B CE    1 
ATOM   2392  N  NZ    . LYS B 1  83   ? 440.559 12.707  712.705 1.00 86.30  ? 83   LYS B NZ    1 
ATOM   2393  N  N     . GLU B 1  84   ? 439.912 20.764  711.988 1.00 93.22  ? 84   GLU B N     1 
ATOM   2394  C  CA    . GLU B 1  84   ? 440.291 21.883  711.142 1.00 100.53 ? 84   GLU B CA    1 
ATOM   2395  C  C     . GLU B 1  84   ? 440.372 23.170  711.965 1.00 94.54  ? 84   GLU B C     1 
ATOM   2396  O  O     . GLU B 1  84   ? 440.312 24.276  711.431 1.00 98.04  ? 84   GLU B O     1 
ATOM   2397  C  CB    . GLU B 1  84   ? 439.239 22.052  710.034 1.00 108.96 ? 84   GLU B CB    1 
ATOM   2398  C  CG    . GLU B 1  84   ? 439.083 20.883  709.058 1.00 110.57 ? 84   GLU B CG    1 
ATOM   2399  C  CD    . GLU B 1  84   ? 440.033 20.923  707.916 1.00 110.65 ? 84   GLU B CD    1 
ATOM   2400  O  OE1   . GLU B 1  84   ? 440.893 21.823  707.919 1.00 109.78 ? 84   GLU B OE1   1 
ATOM   2401  O  OE2   . GLU B 1  84   ? 439.942 20.019  707.054 1.00 112.71 ? 84   GLU B OE2   1 
ATOM   2402  N  N     . LEU B 1  85   ? 440.436 23.076  713.271 1.00 91.95  ? 85   LEU B N     1 
ATOM   2403  C  CA    . LEU B 1  85   ? 440.455 24.286  714.073 1.00 96.24  ? 85   LEU B CA    1 
ATOM   2404  C  C     . LEU B 1  85   ? 441.854 24.725  714.509 1.00 103.28 ? 85   LEU B C     1 
ATOM   2405  O  O     . LEU B 1  85   ? 442.619 23.935  715.081 1.00 106.61 ? 85   LEU B O     1 
ATOM   2406  C  CB    . LEU B 1  85   ? 439.511 24.113  715.257 1.00 93.20  ? 85   LEU B CB    1 
ATOM   2407  C  CG    . LEU B 1  85   ? 439.460 25.305  716.187 1.00 88.11  ? 85   LEU B CG    1 
ATOM   2408  C  CD1   . LEU B 1  85   ? 438.853 26.465  715.366 1.00 87.38  ? 85   LEU B CD1   1 
ATOM   2409  C  CD2   . LEU B 1  85   ? 438.637 24.961  717.415 1.00 79.37  ? 85   LEU B CD2   1 
ATOM   2410  N  N     . VAL B 1  86   ? 442.183 25.985  714.212 1.00 99.42  ? 86   VAL B N     1 
ATOM   2411  C  CA    . VAL B 1  86   ? 443.481 26.574  714.527 1.00 100.00 ? 86   VAL B CA    1 
ATOM   2412  C  C     . VAL B 1  86   ? 443.328 27.521  715.712 1.00 95.11  ? 86   VAL B C     1 
ATOM   2413  O  O     . VAL B 1  86   ? 442.740 28.605  715.588 1.00 99.13  ? 86   VAL B O     1 
ATOM   2414  C  CB    . VAL B 1  86   ? 444.054 27.312  713.310 1.00 95.66  ? 86   VAL B CB    1 
ATOM   2415  C  CG1   . VAL B 1  86   ? 445.425 27.926  713.590 1.00 93.68  ? 86   VAL B CG1   1 
ATOM   2416  C  CG2   . VAL B 1  86   ? 444.150 26.345  712.203 1.00 93.41  ? 86   VAL B CG2   1 
ATOM   2417  N  N     . VAL B 1  87   ? 443.872 27.106  716.857 1.00 95.30  ? 87   VAL B N     1 
ATOM   2418  C  CA    . VAL B 1  87   ? 443.751 27.817  718.126 1.00 102.41 ? 87   VAL B CA    1 
ATOM   2419  C  C     . VAL B 1  87   ? 445.136 28.254  718.573 1.00 108.15 ? 87   VAL B C     1 
ATOM   2420  O  O     . VAL B 1  87   ? 446.080 27.458  718.552 1.00 114.26 ? 87   VAL B O     1 
ATOM   2421  C  CB    . VAL B 1  87   ? 443.081 26.973  719.224 1.00 99.39  ? 87   VAL B CB    1 
ATOM   2422  C  CG1   . VAL B 1  87   ? 443.171 27.713  720.535 1.00 101.19 ? 87   VAL B CG1   1 
ATOM   2423  C  CG2   . VAL B 1  87   ? 441.612 26.751  718.907 1.00 98.55  ? 87   VAL B CG2   1 
ATOM   2424  N  N     . ARG B 1  88   ? 445.266 29.510  718.956 1.00 112.53 ? 88   ARG B N     1 
ATOM   2425  C  CA    . ARG B 1  88   ? 446.562 30.062  719.319 1.00 117.91 ? 88   ARG B CA    1 
ATOM   2426  C  C     . ARG B 1  88   ? 446.549 30.439  720.798 1.00 122.88 ? 88   ARG B C     1 
ATOM   2427  O  O     . ARG B 1  88   ? 445.768 31.308  721.204 1.00 123.84 ? 88   ARG B O     1 
ATOM   2428  C  CB    . ARG B 1  88   ? 446.883 31.268  718.451 1.00 124.54 ? 88   ARG B CB    1 
ATOM   2429  C  CG    . ARG B 1  88   ? 448.233 31.858  718.720 1.00 129.96 ? 88   ARG B CG    1 
ATOM   2430  C  CD    . ARG B 1  88   ? 448.464 32.996  717.777 1.00 136.36 ? 88   ARG B CD    1 
ATOM   2431  N  NE    . ARG B 1  88   ? 449.782 33.573  717.955 1.00 144.26 ? 88   ARG B NE    1 
ATOM   2432  C  CZ    . ARG B 1  88   ? 450.245 34.571  717.213 1.00 154.85 ? 88   ARG B CZ    1 
ATOM   2433  N  NH1   . ARG B 1  88   ? 449.481 35.084  716.253 1.00 156.78 ? 88   ARG B NH1   1 
ATOM   2434  N  NH2   . ARG B 1  88   ? 451.468 35.048  717.418 1.00 161.08 ? 88   ARG B NH2   1 
ATOM   2435  N  N     . PHE B 1  89   ? 447.351 29.748  721.622 1.00 120.52 ? 89   PHE B N     1 
ATOM   2436  C  CA    . PHE B 1  89   ? 447.449 30.102  723.040 1.00 114.67 ? 89   PHE B CA    1 
ATOM   2437  C  C     . PHE B 1  89   ? 448.400 31.281  723.203 1.00 118.32 ? 89   PHE B C     1 
ATOM   2438  O  O     . PHE B 1  89   ? 449.612 31.137  723.009 1.00 120.58 ? 89   PHE B O     1 
ATOM   2439  C  CB    . PHE B 1  89   ? 447.993 28.932  723.856 1.00 108.53 ? 89   PHE B CB    1 
ATOM   2440  C  CG    . PHE B 1  89   ? 447.055 27.778  723.990 1.00 103.96 ? 89   PHE B CG    1 
ATOM   2441  C  CD1   . PHE B 1  89   ? 445.753 27.857  723.530 1.00 100.64 ? 89   PHE B CD1   1 
ATOM   2442  C  CD2   . PHE B 1  89   ? 447.484 26.594  724.606 1.00 101.58 ? 89   PHE B CD2   1 
ATOM   2443  C  CE1   . PHE B 1  89   ? 444.883 26.777  723.694 1.00 97.64  ? 89   PHE B CE1   1 
ATOM   2444  C  CE2   . PHE B 1  89   ? 446.623 25.510  724.766 1.00 96.28  ? 89   PHE B CE2   1 
ATOM   2445  C  CZ    . PHE B 1  89   ? 445.324 25.601  724.311 1.00 94.14  ? 89   PHE B CZ    1 
ATOM   2446  N  N     . LEU B 1  90   ? 447.882 32.405  723.688 1.00 115.07 ? 90   LEU B N     1 
ATOM   2447  C  CA    . LEU B 1  90   ? 448.738 33.566  723.891 1.00 122.49 ? 90   LEU B CA    1 
ATOM   2448  C  C     . LEU B 1  90   ? 449.539 33.482  725.179 1.00 127.64 ? 90   LEU B C     1 
ATOM   2449  O  O     . LEU B 1  90   ? 450.642 34.038  725.266 1.00 131.95 ? 90   LEU B O     1 
ATOM   2450  C  CB    . LEU B 1  90   ? 447.905 34.840  723.836 1.00 119.66 ? 90   LEU B CB    1 
ATOM   2451  C  CG    . LEU B 1  90   ? 447.178 35.001  722.504 1.00 121.61 ? 90   LEU B CG    1 
ATOM   2452  C  CD1   . LEU B 1  90   ? 446.220 36.179  722.543 1.00 123.95 ? 90   LEU B CD1   1 
ATOM   2453  C  CD2   . LEU B 1  90   ? 448.192 35.164  721.356 1.00 125.80 ? 90   LEU B CD2   1 
ATOM   2454  N  N     . ASN B 1  91   ? 449.034 32.758  726.151 1.00 133.03 ? 91   ASN B N     1 
ATOM   2455  C  CA    . ASN B 1  91   ? 449.719 32.605  727.421 1.00 135.75 ? 91   ASN B CA    1 
ATOM   2456  C  C     . ASN B 1  91   ? 450.767 31.508  727.389 1.00 130.23 ? 91   ASN B C     1 
ATOM   2457  O  O     . ASN B 1  91   ? 450.448 30.331  727.188 1.00 127.74 ? 91   ASN B O     1 
ATOM   2458  C  CB    . ASN B 1  91   ? 448.710 32.324  728.534 1.00 140.32 ? 91   ASN B CB    1 
ATOM   2459  C  CG    . ASN B 1  91   ? 449.310 32.472  729.919 1.00 148.23 ? 91   ASN B CG    1 
ATOM   2460  O  OD1   . ASN B 1  91   ? 450.531 32.437  730.097 1.00 149.58 ? 91   ASN B OD1   1 
ATOM   2461  N  ND2   . ASN B 1  91   ? 448.445 32.663  730.912 1.00 151.51 ? 91   ASN B ND2   1 
ATOM   2462  N  N     . PRO B 1  92   ? 452.030 31.881  727.530 1.00 119.30 ? 92   PRO B N     1 
ATOM   2463  C  CA    . PRO B 1  92   ? 453.109 30.890  727.481 1.00 116.99 ? 92   PRO B CA    1 
ATOM   2464  C  C     . PRO B 1  92   ? 452.887 29.750  728.455 1.00 111.40 ? 92   PRO B C     1 
ATOM   2465  O  O     . PRO B 1  92   ? 453.361 28.633  728.216 1.00 111.15 ? 92   PRO B O     1 
ATOM   2466  C  CB    . PRO B 1  92   ? 454.347 31.714  727.853 1.00 116.72 ? 92   PRO B CB    1 
ATOM   2467  C  CG    . PRO B 1  92   ? 453.997 33.095  727.415 1.00 119.15 ? 92   PRO B CG    1 
ATOM   2468  C  CD    . PRO B 1  92   ? 452.537 33.254  727.674 1.00 119.68 ? 92   PRO B CD    1 
ATOM   2469  N  N     . SER B 1  93   ? 452.156 29.979  729.542 1.00 114.83 ? 93   SER B N     1 
ATOM   2470  C  CA    . SER B 1  93   ? 452.020 28.928  730.536 1.00 120.73 ? 93   SER B CA    1 
ATOM   2471  C  C     . SER B 1  93   ? 450.761 28.101  730.332 1.00 119.90 ? 93   SER B C     1 
ATOM   2472  O  O     . SER B 1  93   ? 450.593 27.086  731.010 1.00 118.55 ? 93   SER B O     1 
ATOM   2473  C  CB    . SER B 1  93   ? 451.940 29.534  731.960 1.00 121.98 ? 93   SER B CB    1 
ATOM   2474  O  OG    . SER B 1  93   ? 453.017 30.393  732.308 1.00 122.26 ? 93   SER B OG    1 
ATOM   2475  N  N     . LEU B 1  94   ? 449.936 28.439  729.349 1.00 116.43 ? 94   LEU B N     1 
ATOM   2476  C  CA    . LEU B 1  94   ? 448.656 27.765  729.191 1.00 112.97 ? 94   LEU B CA    1 
ATOM   2477  C  C     . LEU B 1  94   ? 448.870 26.424  728.508 1.00 110.34 ? 94   LEU B C     1 
ATOM   2478  O  O     . LEU B 1  94   ? 449.312 26.366  727.358 1.00 116.65 ? 94   LEU B O     1 
ATOM   2479  C  CB    . LEU B 1  94   ? 447.711 28.653  728.393 1.00 110.03 ? 94   LEU B CB    1 
ATOM   2480  C  CG    . LEU B 1  94   ? 446.301 28.143  728.141 1.00 109.69 ? 94   LEU B CG    1 
ATOM   2481  C  CD1   . LEU B 1  94   ? 445.628 27.721  729.441 1.00 111.90 ? 94   LEU B CD1   1 
ATOM   2482  C  CD2   . LEU B 1  94   ? 445.527 29.256  727.454 1.00 110.46 ? 94   LEU B CD2   1 
ATOM   2483  N  N     . GLN B 1  95   ? 448.591 25.345  729.216 1.00 107.10 ? 95   GLN B N     1 
ATOM   2484  C  CA    . GLN B 1  95   ? 448.788 24.010  728.679 1.00 107.15 ? 95   GLN B CA    1 
ATOM   2485  C  C     . GLN B 1  95   ? 447.523 23.307  728.207 1.00 98.28  ? 95   GLN B C     1 
ATOM   2486  O  O     . GLN B 1  95   ? 447.632 22.192  727.675 1.00 93.15  ? 95   GLN B O     1 
ATOM   2487  C  CB    . GLN B 1  95   ? 449.627 23.193  729.639 1.00 119.07 ? 95   GLN B CB    1 
ATOM   2488  C  CG    . GLN B 1  95   ? 451.017 23.811  729.529 1.00 131.48 ? 95   GLN B CG    1 
ATOM   2489  C  CD    . GLN B 1  95   ? 452.128 22.981  730.099 1.00 143.56 ? 95   GLN B CD    1 
ATOM   2490  O  OE1   . GLN B 1  95   ? 451.950 22.277  731.097 1.00 144.85 ? 95   GLN B OE1   1 
ATOM   2491  N  NE2   . GLN B 1  95   ? 453.273 22.986  729.401 1.00 150.31 ? 95   GLN B NE2   1 
ATOM   2492  N  N     . THR B 1  96   ? 446.339 23.899  728.410 1.00 112.17 ? 96   THR B N     1 
ATOM   2493  C  CA    . THR B 1  96   ? 445.089 23.273  727.974 1.00 111.22 ? 96   THR B CA    1 
ATOM   2494  C  C     . THR B 1  96   ? 443.902 24.175  728.301 1.00 111.87 ? 96   THR B C     1 
ATOM   2495  O  O     . THR B 1  96   ? 443.986 25.046  729.167 1.00 116.09 ? 96   THR B O     1 
ATOM   2496  C  CB    . THR B 1  96   ? 444.881 21.906  728.642 1.00 111.47 ? 96   THR B CB    1 
ATOM   2497  O  OG1   . THR B 1  96   ? 443.554 21.442  728.378 1.00 112.68 ? 96   THR B OG1   1 
ATOM   2498  C  CG2   . THR B 1  96   ? 445.093 22.009  730.151 1.00 111.58 ? 96   THR B CG2   1 
ATOM   2499  N  N     . VAL B 1  97   ? 442.797 23.957  727.569 1.00 113.05 ? 97   VAL B N     1 
ATOM   2500  C  CA    . VAL B 1  97   ? 441.550 24.724  727.668 1.00 116.17 ? 97   VAL B CA    1 
ATOM   2501  C  C     . VAL B 1  97   ? 440.391 23.826  727.244 1.00 118.51 ? 97   VAL B C     1 
ATOM   2502  O  O     . VAL B 1  97   ? 440.542 22.968  726.362 1.00 114.09 ? 97   VAL B O     1 
ATOM   2503  C  CB    . VAL B 1  97   ? 441.530 26.009  726.800 1.00 113.34 ? 97   VAL B CB    1 
ATOM   2504  C  CG1   . VAL B 1  97   ? 442.461 27.077  727.366 1.00 115.29 ? 97   VAL B CG1   1 
ATOM   2505  C  CG2   . VAL B 1  97   ? 441.843 25.678  725.337 1.00 109.12 ? 97   VAL B CG2   1 
ATOM   2506  N  N     . THR B 1  98   ? 439.207 24.072  727.831 1.00 123.78 ? 98   THR B N     1 
ATOM   2507  C  CA    . THR B 1  98   ? 437.950 23.494  727.347 1.00 118.79 ? 98   THR B CA    1 
ATOM   2508  C  C     . THR B 1  98   ? 437.129 24.625  726.738 1.00 116.83 ? 98   THR B C     1 
ATOM   2509  O  O     . THR B 1  98   ? 436.850 25.619  727.414 1.00 118.13 ? 98   THR B O     1 
ATOM   2510  C  CB    . THR B 1  98   ? 437.133 22.807  728.465 1.00 114.34 ? 98   THR B CB    1 
ATOM   2511  O  OG1   . THR B 1  98   ? 437.833 21.682  729.030 1.00 113.06 ? 98   THR B OG1   1 
ATOM   2512  C  CG2   . THR B 1  98   ? 435.794 22.289  727.908 1.00 109.68 ? 98   THR B CG2   1 
ATOM   2513  N  N     . LEU B 1  99   ? 436.778 24.491  725.456 1.00 118.41 ? 99   LEU B N     1 
ATOM   2514  C  CA    . LEU B 1  99   ? 435.936 25.467  724.775 1.00 119.09 ? 99   LEU B CA    1 
ATOM   2515  C  C     . LEU B 1  99   ? 434.487 25.005  724.778 1.00 116.03 ? 99   LEU B C     1 
ATOM   2516  O  O     . LEU B 1  99   ? 434.200 23.852  724.438 1.00 115.48 ? 99   LEU B O     1 
ATOM   2517  C  CB    . LEU B 1  99   ? 436.413 25.661  723.339 1.00 124.72 ? 99   LEU B CB    1 
ATOM   2518  C  CG    . LEU B 1  99   ? 437.418 26.782  723.101 1.00 131.71 ? 99   LEU B CG    1 
ATOM   2519  C  CD1   . LEU B 1  99   ? 438.656 26.604  723.966 1.00 134.02 ? 99   LEU B CD1   1 
ATOM   2520  C  CD2   . LEU B 1  99   ? 437.785 26.838  721.622 1.00 130.26 ? 99   LEU B CD2   1 
ATOM   2521  N  N     . LEU B 1  100  ? 433.576 25.912  725.107 1.00 115.18 ? 100  LEU B N     1 
ATOM   2522  C  CA    . LEU B 1  100  ? 432.160 25.586  725.175 1.00 119.55 ? 100  LEU B CA    1 
ATOM   2523  C  C     . LEU B 1  100  ? 431.392 26.295  724.074 1.00 116.66 ? 100  LEU B C     1 
ATOM   2524  O  O     . LEU B 1  100  ? 431.652 27.467  723.772 1.00 113.25 ? 100  LEU B O     1 
ATOM   2525  C  CB    . LEU B 1  100  ? 431.552 25.916  726.557 1.00 123.70 ? 100  LEU B CB    1 
ATOM   2526  C  CG    . LEU B 1  100  ? 432.043 25.160  727.811 1.00 120.27 ? 100  LEU B CG    1 
ATOM   2527  C  CD1   . LEU B 1  100  ? 433.137 25.906  728.583 1.00 117.19 ? 100  LEU B CD1   1 
ATOM   2528  C  CD2   . LEU B 1  100  ? 430.868 24.744  728.742 1.00 124.10 ? 100  LEU B CD2   1 
ATOM   2529  N  N     . LEU B 1  101  ? 430.417 25.581  723.514 1.00 118.95 ? 101  LEU B N     1 
ATOM   2530  C  CA    . LEU B 1  101  ? 429.492 26.138  722.535 1.00 122.85 ? 101  LEU B CA    1 
ATOM   2531  C  C     . LEU B 1  101  ? 428.079 25.616  722.770 1.00 123.49 ? 101  LEU B C     1 
ATOM   2532  O  O     . LEU B 1  101  ? 427.862 24.405  722.883 1.00 118.15 ? 101  LEU B O     1 
ATOM   2533  C  CB    . LEU B 1  101  ? 429.935 25.848  721.092 1.00 123.28 ? 101  LEU B CB    1 
ATOM   2534  C  CG    . LEU B 1  101  ? 428.973 26.519  720.113 1.00 125.92 ? 101  LEU B CG    1 
ATOM   2535  C  CD1   . LEU B 1  101  ? 429.761 27.373  719.145 1.00 126.21 ? 101  LEU B CD1   1 
ATOM   2536  C  CD2   . LEU B 1  101  ? 428.104 25.496  719.396 1.00 125.40 ? 101  LEU B CD2   1 
ATOM   2537  N  N     . LYS B 1  102  ? 427.129 26.538  722.846 1.00 128.65 ? 102  LYS B N     1 
ATOM   2538  C  CA    . LYS B 1  102  ? 425.718 26.209  722.938 1.00 132.03 ? 102  LYS B CA    1 
ATOM   2539  C  C     . LYS B 1  102  ? 424.995 27.097  721.951 1.00 129.10 ? 102  LYS B C     1 
ATOM   2540  O  O     . LYS B 1  102  ? 425.224 28.309  721.924 1.00 126.94 ? 102  LYS B O     1 
ATOM   2541  C  CB    . LYS B 1  102  ? 425.106 26.423  724.332 1.00 144.08 ? 102  LYS B CB    1 
ATOM   2542  C  CG    . LYS B 1  102  ? 425.611 25.578  725.518 1.00 152.88 ? 102  LYS B CG    1 
ATOM   2543  C  CD    . LYS B 1  102  ? 424.471 25.506  726.624 1.00 162.65 ? 102  LYS B CD    1 
ATOM   2544  C  CE    . LYS B 1  102  ? 424.803 24.855  728.020 1.00 162.81 ? 102  LYS B CE    1 
ATOM   2545  N  NZ    . LYS B 1  102  ? 426.083 25.188  728.714 1.00 161.64 ? 102  LYS B NZ    1 
ATOM   2546  N  N     . ALA B 1  103  ? 424.263 26.466  721.038 1.00 128.98 ? 103  ALA B N     1 
ATOM   2547  C  CA    . ALA B 1  103  ? 423.460 27.167  720.041 1.00 135.84 ? 103  ALA B CA    1 
ATOM   2548  C  C     . ALA B 1  103  ? 422.357 26.218  719.580 1.00 140.95 ? 103  ALA B C     1 
ATOM   2549  O  O     . ALA B 1  103  ? 422.466 25.004  719.750 1.00 139.79 ? 103  ALA B O     1 
ATOM   2550  C  CB    . ALA B 1  103  ? 424.299 27.656  718.859 1.00 132.90 ? 103  ALA B CB    1 
ATOM   2551  N  N     . GLU B 1  104  ? 421.329 26.763  718.928 1.00 146.29 ? 104  GLU B N     1 
ATOM   2552  C  CA    . GLU B 1  104  ? 420.195 25.944  718.502 1.00 151.11 ? 104  GLU B CA    1 
ATOM   2553  C  C     . GLU B 1  104  ? 419.439 26.633  717.380 1.00 154.11 ? 104  GLU B C     1 
ATOM   2554  O  O     . GLU B 1  104  ? 419.792 27.727  716.940 1.00 153.19 ? 104  GLU B O     1 
ATOM   2555  C  CB    . GLU B 1  104  ? 419.135 25.688  719.569 1.00 153.88 ? 104  GLU B CB    1 
ATOM   2556  C  CG    . GLU B 1  104  ? 418.625 26.929  720.293 1.00 157.46 ? 104  GLU B CG    1 
ATOM   2557  C  CD    . GLU B 1  104  ? 417.454 26.606  721.197 1.00 163.14 ? 104  GLU B CD    1 
ATOM   2558  O  OE1   . GLU B 1  104  ? 417.600 26.339  722.398 1.00 165.73 ? 104  GLU B OE1   1 
ATOM   2559  O  OE2   . GLU B 1  104  ? 416.329 26.612  720.643 1.00 166.74 ? 104  GLU B OE2   1 
ATOM   2560  N  N     . GLY B 1  105  ? 418.352 25.988  716.961 1.00 162.79 ? 105  GLY B N     1 
ATOM   2561  C  CA    . GLY B 1  105  ? 417.462 26.511  715.958 1.00 166.34 ? 105  GLY B CA    1 
ATOM   2562  C  C     . GLY B 1  105  ? 418.127 26.508  714.601 1.00 168.40 ? 105  GLY B C     1 
ATOM   2563  O  O     . GLY B 1  105  ? 419.187 25.913  714.407 1.00 168.03 ? 105  GLY B O     1 
ATOM   2564  N  N     . PRO B 1  106  ? 417.536 27.181  713.655 1.00 169.84 ? 106  PRO B N     1 
ATOM   2565  C  CA    . PRO B 1  106  ? 418.055 27.268  712.276 1.00 167.16 ? 106  PRO B CA    1 
ATOM   2566  C  C     . PRO B 1  106  ? 419.261 28.186  712.071 1.00 167.38 ? 106  PRO B C     1 
ATOM   2567  O  O     . PRO B 1  106  ? 419.143 29.360  711.737 1.00 170.68 ? 106  PRO B O     1 
ATOM   2568  C  CB    . PRO B 1  106  ? 416.828 27.746  711.494 1.00 169.52 ? 106  PRO B CB    1 
ATOM   2569  C  CG    . PRO B 1  106  ? 416.003 28.497  712.479 1.00 174.19 ? 106  PRO B CG    1 
ATOM   2570  C  CD    . PRO B 1  106  ? 416.198 27.784  713.788 1.00 174.31 ? 106  PRO B CD    1 
ATOM   2571  N  N     . LYS B 1  107  ? 420.457 27.670  712.350 1.00 158.77 ? 107  LYS B N     1 
ATOM   2572  C  CA    . LYS B 1  107  ? 421.688 28.441  712.209 1.00 152.99 ? 107  LYS B CA    1 
ATOM   2573  C  C     . LYS B 1  107  ? 422.853 27.544  711.813 1.00 142.67 ? 107  LYS B C     1 
ATOM   2574  O  O     . LYS B 1  107  ? 422.888 26.367  712.180 1.00 141.44 ? 107  LYS B O     1 
ATOM   2575  C  CB    . LYS B 1  107  ? 422.105 29.261  713.428 1.00 155.78 ? 107  LYS B CB    1 
ATOM   2576  C  CG    . LYS B 1  107  ? 423.214 28.633  714.225 1.00 155.99 ? 107  LYS B CG    1 
ATOM   2577  C  CD    . LYS B 1  107  ? 423.466 29.416  715.473 1.00 161.21 ? 107  LYS B CD    1 
ATOM   2578  C  CE    . LYS B 1  107  ? 424.342 30.593  715.005 1.00 164.11 ? 107  LYS B CE    1 
ATOM   2579  N  NZ    . LYS B 1  107  ? 424.784 31.556  716.040 1.00 169.10 ? 107  LYS B NZ    1 
ATOM   2580  N  N     . GLU B 1  108  ? 423.746 28.080  710.979 1.00 138.46 ? 108  GLU B N     1 
ATOM   2581  C  CA    . GLU B 1  108  ? 424.991 27.400  710.622 1.00 135.98 ? 108  GLU B CA    1 
ATOM   2582  C  C     . GLU B 1  108  ? 426.079 27.900  711.565 1.00 130.49 ? 108  GLU B C     1 
ATOM   2583  O  O     . GLU B 1  108  ? 426.448 29.080  711.525 1.00 129.00 ? 108  GLU B O     1 
ATOM   2584  C  CB    . GLU B 1  108  ? 425.402 27.699  709.187 1.00 146.83 ? 108  GLU B CB    1 
ATOM   2585  C  CG    . GLU B 1  108  ? 424.519 27.167  708.093 1.00 155.48 ? 108  GLU B CG    1 
ATOM   2586  C  CD    . GLU B 1  108  ? 425.164 27.354  706.739 1.00 162.17 ? 108  GLU B CD    1 
ATOM   2587  O  OE1   . GLU B 1  108  ? 426.352 27.755  706.690 1.00 163.75 ? 108  GLU B OE1   1 
ATOM   2588  O  OE2   . GLU B 1  108  ? 424.491 27.100  705.721 1.00 166.83 ? 108  GLU B OE2   1 
ATOM   2589  N  N     . VAL B 1  109  ? 426.587 27.007  712.412 1.00 129.56 ? 109  VAL B N     1 
ATOM   2590  C  CA    . VAL B 1  109  ? 427.524 27.371  713.475 1.00 129.22 ? 109  VAL B CA    1 
ATOM   2591  C  C     . VAL B 1  109  ? 428.949 27.510  712.946 1.00 121.73 ? 109  VAL B C     1 
ATOM   2592  O  O     . VAL B 1  109  ? 429.533 26.550  712.426 1.00 106.14 ? 109  VAL B O     1 
ATOM   2593  C  CB    . VAL B 1  109  ? 427.469 26.355  714.622 1.00 119.22 ? 109  VAL B CB    1 
ATOM   2594  C  CG1   . VAL B 1  109  ? 428.334 26.824  715.788 1.00 109.95 ? 109  VAL B CG1   1 
ATOM   2595  C  CG2   . VAL B 1  109  ? 426.054 26.159  715.066 1.00 112.57 ? 109  VAL B CG2   1 
ATOM   2596  N  N     . LYS B 1  110  ? 429.526 28.695  713.119 1.00 129.64 ? 110  LYS B N     1 
ATOM   2597  C  CA    . LYS B 1  110  ? 430.909 28.920  712.749 1.00 129.33 ? 110  LYS B CA    1 
ATOM   2598  C  C     . LYS B 1  110  ? 431.812 28.857  713.982 1.00 128.56 ? 110  LYS B C     1 
ATOM   2599  O  O     . LYS B 1  110  ? 431.369 28.621  715.109 1.00 129.42 ? 110  LYS B O     1 
ATOM   2600  C  CB    . LYS B 1  110  ? 431.048 30.273  712.046 1.00 139.33 ? 110  LYS B CB    1 
ATOM   2601  C  CG    . LYS B 1  110  ? 430.190 30.500  710.786 1.00 146.38 ? 110  LYS B CG    1 
ATOM   2602  C  CD    . LYS B 1  110  ? 430.455 29.406  709.725 1.00 145.47 ? 110  LYS B CD    1 
ATOM   2603  C  CE    . LYS B 1  110  ? 429.641 29.603  708.447 1.00 146.01 ? 110  LYS B CE    1 
ATOM   2604  N  NZ    . LYS B 1  110  ? 429.864 28.524  707.436 1.00 143.91 ? 110  LYS B NZ    1 
ATOM   2605  N  N     . ALA B 1  111  ? 433.097 29.125  713.756 1.00 124.61 ? 111  ALA B N     1 
ATOM   2606  C  CA    . ALA B 1  111  ? 434.072 29.186  714.837 1.00 123.12 ? 111  ALA B CA    1 
ATOM   2607  C  C     . ALA B 1  111  ? 433.796 30.361  715.764 1.00 128.91 ? 111  ALA B C     1 
ATOM   2608  O  O     . ALA B 1  111  ? 434.001 30.249  716.977 1.00 136.20 ? 111  ALA B O     1 
ATOM   2609  C  CB    . ALA B 1  111  ? 435.488 29.235  714.294 1.00 116.59 ? 111  ALA B CB    1 
ATOM   2610  N  N     . ARG B 1  112  ? 433.358 31.508  715.223 1.00 134.30 ? 112  ARG B N     1 
ATOM   2611  C  CA    . ARG B 1  112  ? 433.258 32.700  716.062 1.00 141.55 ? 112  ARG B CA    1 
ATOM   2612  C  C     . ARG B 1  112  ? 432.321 32.457  717.233 1.00 141.06 ? 112  ARG B C     1 
ATOM   2613  O  O     . ARG B 1  112  ? 432.536 33.003  718.321 1.00 140.77 ? 112  ARG B O     1 
ATOM   2614  C  CB    . ARG B 1  112  ? 432.713 33.901  715.271 1.00 147.11 ? 112  ARG B CB    1 
ATOM   2615  C  CG    . ARG B 1  112  ? 433.241 34.136  713.863 1.00 147.90 ? 112  ARG B CG    1 
ATOM   2616  C  CD    . ARG B 1  112  ? 432.099 34.345  712.844 1.00 151.68 ? 112  ARG B CD    1 
ATOM   2617  N  NE    . ARG B 1  112  ? 430.909 34.980  713.431 1.00 158.51 ? 112  ARG B NE    1 
ATOM   2618  C  CZ    . ARG B 1  112  ? 429.699 34.415  713.508 1.00 159.70 ? 112  ARG B CZ    1 
ATOM   2619  N  NH1   . ARG B 1  112  ? 428.675 35.079  714.052 1.00 161.93 ? 112  ARG B NH1   1 
ATOM   2620  N  NH2   . ARG B 1  112  ? 429.509 33.189  713.033 1.00 157.13 ? 112  ARG B NH2   1 
ATOM   2621  N  N     . ASP B 1  113  ? 431.326 31.585  717.043 1.00 147.11 ? 113  ASP B N     1 
ATOM   2622  C  CA    . ASP B 1  113  ? 430.284 31.349  718.038 1.00 151.36 ? 113  ASP B CA    1 
ATOM   2623  C  C     . ASP B 1  113  ? 430.827 30.819  719.366 1.00 152.80 ? 113  ASP B C     1 
ATOM   2624  O  O     . ASP B 1  113  ? 430.137 30.929  720.389 1.00 153.52 ? 113  ASP B O     1 
ATOM   2625  C  CB    . ASP B 1  113  ? 429.233 30.426  717.421 1.00 155.59 ? 113  ASP B CB    1 
ATOM   2626  C  CG    . ASP B 1  113  ? 428.552 31.062  716.206 1.00 160.07 ? 113  ASP B CG    1 
ATOM   2627  O  OD1   . ASP B 1  113  ? 428.779 32.272  715.970 1.00 162.16 ? 113  ASP B OD1   1 
ATOM   2628  O  OD2   . ASP B 1  113  ? 427.817 30.362  715.473 1.00 159.55 ? 113  ASP B OD2   1 
ATOM   2629  N  N     . PHE B 1  114  ? 432.017 30.214  719.373 1.00 146.14 ? 114  PHE B N     1 
ATOM   2630  C  CA    . PHE B 1  114  ? 432.604 29.767  720.632 1.00 141.05 ? 114  PHE B CA    1 
ATOM   2631  C  C     . PHE B 1  114  ? 432.772 30.932  721.587 1.00 145.34 ? 114  PHE B C     1 
ATOM   2632  O  O     . PHE B 1  114  ? 433.228 32.010  721.198 1.00 149.30 ? 114  PHE B O     1 
ATOM   2633  C  CB    . PHE B 1  114  ? 433.940 29.089  720.403 1.00 132.14 ? 114  PHE B CB    1 
ATOM   2634  C  CG    . PHE B 1  114  ? 433.805 27.655  720.077 1.00 127.88 ? 114  PHE B CG    1 
ATOM   2635  C  CD1   . PHE B 1  114  ? 434.055 26.702  721.033 1.00 127.46 ? 114  PHE B CD1   1 
ATOM   2636  C  CD2   . PHE B 1  114  ? 433.365 27.252  718.846 1.00 126.56 ? 114  PHE B CD2   1 
ATOM   2637  C  CE1   . PHE B 1  114  ? 433.918 25.365  720.752 1.00 123.79 ? 114  PHE B CE1   1 
ATOM   2638  C  CE2   . PHE B 1  114  ? 433.227 25.917  718.561 1.00 123.79 ? 114  PHE B CE2   1 
ATOM   2639  C  CZ    . PHE B 1  114  ? 433.498 24.972  719.519 1.00 120.37 ? 114  PHE B CZ    1 
ATOM   2640  N  N     . LEU B 1  115  ? 432.458 30.691  722.849 1.00 141.76 ? 115  LEU B N     1 
ATOM   2641  C  CA    . LEU B 1  115  ? 432.565 31.736  723.849 1.00 142.24 ? 115  LEU B CA    1 
ATOM   2642  C  C     . LEU B 1  115  ? 434.002 32.191  724.038 1.00 141.56 ? 115  LEU B C     1 
ATOM   2643  O  O     . LEU B 1  115  ? 434.856 31.386  724.445 1.00 139.36 ? 115  LEU B O     1 
ATOM   2644  C  CB    . LEU B 1  115  ? 432.002 31.255  725.161 1.00 138.46 ? 115  LEU B CB    1 
ATOM   2645  C  CG    . LEU B 1  115  ? 430.511 31.080  724.973 1.00 138.75 ? 115  LEU B CG    1 
ATOM   2646  C  CD1   . LEU B 1  115  ? 429.899 30.687  726.292 1.00 142.27 ? 115  LEU B CD1   1 
ATOM   2647  C  CD2   . LEU B 1  115  ? 429.895 32.358  724.410 1.00 140.63 ? 115  LEU B CD2   1 
ATOM   2648  N  N     . PRO B 1  116  ? 434.297 33.462  723.768 1.00 147.08 ? 116  PRO B N     1 
ATOM   2649  C  CA    . PRO B 1  116  ? 435.674 33.964  723.836 1.00 148.12 ? 116  PRO B CA    1 
ATOM   2650  C  C     . PRO B 1  116  ? 436.327 33.602  725.159 1.00 147.31 ? 116  PRO B C     1 
ATOM   2651  O  O     . PRO B 1  116  ? 435.722 33.723  726.224 1.00 149.86 ? 116  PRO B O     1 
ATOM   2652  C  CB    . PRO B 1  116  ? 435.501 35.478  723.688 1.00 154.05 ? 116  PRO B CB    1 
ATOM   2653  C  CG    . PRO B 1  116  ? 434.227 35.633  722.916 1.00 152.71 ? 116  PRO B CG    1 
ATOM   2654  C  CD    . PRO B 1  116  ? 433.336 34.511  723.385 1.00 150.08 ? 116  PRO B CD    1 
ATOM   2655  N  N     . VAL B 1  117  ? 437.572 33.160  725.093 1.00 141.90 ? 117  VAL B N     1 
ATOM   2656  C  CA    . VAL B 1  117  ? 438.320 32.811  726.288 1.00 137.94 ? 117  VAL B CA    1 
ATOM   2657  C  C     . VAL B 1  117  ? 439.601 33.622  726.355 1.00 143.85 ? 117  VAL B C     1 
ATOM   2658  O  O     . VAL B 1  117  ? 440.237 33.906  725.336 1.00 149.27 ? 117  VAL B O     1 
ATOM   2659  C  CB    . VAL B 1  117  ? 438.627 31.303  726.316 1.00 121.67 ? 117  VAL B CB    1 
ATOM   2660  C  CG1   . VAL B 1  117  ? 439.419 30.940  727.541 1.00 116.87 ? 117  VAL B CG1   1 
ATOM   2661  C  CG2   . VAL B 1  117  ? 437.336 30.522  726.271 1.00 115.84 ? 117  VAL B CG2   1 
ATOM   2662  N  N     . ALA B 1  118  ? 439.936 34.032  727.569 1.00 154.91 ? 118  ALA B N     1 
ATOM   2663  C  CA    . ALA B 1  118  ? 441.092 34.870  727.828 1.00 163.05 ? 118  ALA B CA    1 
ATOM   2664  C  C     . ALA B 1  118  ? 442.368 34.140  727.441 1.00 160.39 ? 118  ALA B C     1 
ATOM   2665  O  O     . ALA B 1  118  ? 442.548 32.961  727.770 1.00 158.88 ? 118  ALA B O     1 
ATOM   2666  C  CB    . ALA B 1  118  ? 441.133 35.275  729.305 1.00 170.18 ? 118  ALA B CB    1 
ATOM   2667  N  N     . ASP B 1  119  ? 443.227 34.836  726.703 1.00 159.95 ? 119  ASP B N     1 
ATOM   2668  C  CA    . ASP B 1  119  ? 444.499 34.321  726.218 1.00 156.15 ? 119  ASP B CA    1 
ATOM   2669  C  C     . ASP B 1  119  ? 444.314 33.139  725.260 1.00 147.87 ? 119  ASP B C     1 
ATOM   2670  O  O     . ASP B 1  119  ? 445.233 32.326  725.093 1.00 145.70 ? 119  ASP B O     1 
ATOM   2671  C  CB    . ASP B 1  119  ? 445.360 33.884  727.419 1.00 160.32 ? 119  ASP B CB    1 
ATOM   2672  C  CG    . ASP B 1  119  ? 445.766 35.054  728.328 1.00 165.93 ? 119  ASP B CG    1 
ATOM   2673  O  OD1   . ASP B 1  119  ? 445.192 36.156  728.185 1.00 166.40 ? 119  ASP B OD1   1 
ATOM   2674  O  OD2   . ASP B 1  119  ? 446.602 34.840  729.244 1.00 169.69 ? 119  ASP B OD2   1 
ATOM   2675  N  N     . VAL B 1  120  ? 443.136 33.020  724.639 1.00 140.45 ? 120  VAL B N     1 
ATOM   2676  C  CA    . VAL B 1  120  ? 442.853 32.021  723.606 1.00 134.67 ? 120  VAL B CA    1 
ATOM   2677  C  C     . VAL B 1  120  ? 442.412 32.697  722.314 1.00 136.37 ? 120  VAL B C     1 
ATOM   2678  O  O     . VAL B 1  120  ? 441.325 33.293  722.259 1.00 141.33 ? 120  VAL B O     1 
ATOM   2679  C  CB    . VAL B 1  120  ? 441.806 30.996  724.055 1.00 126.03 ? 120  VAL B CB    1 
ATOM   2680  C  CG1   . VAL B 1  120  ? 441.362 30.139  722.877 1.00 117.70 ? 120  VAL B CG1   1 
ATOM   2681  C  CG2   . VAL B 1  120  ? 442.404 30.114  725.124 1.00 125.20 ? 120  VAL B CG2   1 
ATOM   2682  N  N     . GLU B 1  121  ? 443.243 32.614  721.277 1.00 135.88 ? 121  GLU B N     1 
ATOM   2683  C  CA    . GLU B 1  121  ? 442.950 33.257  720.006 1.00 131.04 ? 121  GLU B CA    1 
ATOM   2684  C  C     . GLU B 1  121  ? 442.476 32.196  719.021 1.00 124.95 ? 121  GLU B C     1 
ATOM   2685  O  O     . GLU B 1  121  ? 443.146 31.170  718.840 1.00 121.97 ? 121  GLU B O     1 
ATOM   2686  C  CB    . GLU B 1  121  ? 444.182 33.967  719.451 1.00 131.83 ? 121  GLU B CB    1 
ATOM   2687  C  CG    . GLU B 1  121  ? 443.962 34.629  718.116 1.00 134.92 ? 121  GLU B CG    1 
ATOM   2688  C  CD    . GLU B 1  121  ? 445.198 35.357  717.646 1.00 139.15 ? 121  GLU B CD    1 
ATOM   2689  O  OE1   . GLU B 1  121  ? 446.227 35.260  718.350 1.00 139.50 ? 121  GLU B OE1   1 
ATOM   2690  O  OE2   . GLU B 1  121  ? 445.150 36.004  716.575 1.00 141.51 ? 121  GLU B OE2   1 
ATOM   2691  N  N     . ILE B 1  122  ? 441.316 32.421  718.414 1.00 125.56 ? 122  ILE B N     1 
ATOM   2692  C  CA    . ILE B 1  122  ? 440.815 31.551  717.355 1.00 125.02 ? 122  ILE B CA    1 
ATOM   2693  C  C     . ILE B 1  122  ? 441.222 32.156  716.013 1.00 126.47 ? 122  ILE B C     1 
ATOM   2694  O  O     . ILE B 1  122  ? 440.725 33.213  715.609 1.00 128.39 ? 122  ILE B O     1 
ATOM   2695  C  CB    . ILE B 1  122  ? 439.306 31.302  717.455 1.00 126.17 ? 122  ILE B CB    1 
ATOM   2696  C  CG1   . ILE B 1  122  ? 438.996 30.411  718.657 1.00 124.67 ? 122  ILE B CG1   1 
ATOM   2697  C  CG2   . ILE B 1  122  ? 438.779 30.689  716.184 1.00 127.79 ? 122  ILE B CG2   1 
ATOM   2698  C  CD1   . ILE B 1  122  ? 439.021 31.102  719.979 1.00 132.20 ? 122  ILE B CD1   1 
ATOM   2699  N  N     . MET B 1  123  ? 442.130 31.470  715.316 1.00 120.73 ? 123  MET B N     1 
ATOM   2700  C  CA    . MET B 1  123  ? 442.735 32.017  714.108 1.00 116.66 ? 123  MET B CA    1 
ATOM   2701  C  C     . MET B 1  123  ? 441.780 32.037  712.936 1.00 117.28 ? 123  MET B C     1 
ATOM   2702  O  O     . MET B 1  123  ? 441.796 32.995  712.154 1.00 117.18 ? 123  MET B O     1 
ATOM   2703  C  CB    . MET B 1  123  ? 443.992 31.238  713.732 1.00 114.40 ? 123  MET B CB    1 
ATOM   2704  C  CG    . MET B 1  123  ? 445.018 31.233  714.816 1.00 119.45 ? 123  MET B CG    1 
ATOM   2705  S  SD    . MET B 1  123  ? 445.716 32.889  714.913 1.00 129.61 ? 123  MET B SD    1 
ATOM   2706  C  CE    . MET B 1  123  ? 446.540 33.049  713.327 1.00 131.64 ? 123  MET B CE    1 
ATOM   2707  N  N     . ASN B 1  124  ? 440.891 31.047  712.847 1.00 116.27 ? 124  ASN B N     1 
ATOM   2708  C  CA    . ASN B 1  124  ? 440.006 30.877  711.696 1.00 116.87 ? 124  ASN B CA    1 
ATOM   2709  C  C     . ASN B 1  124  ? 438.536 30.947  712.090 1.00 118.51 ? 124  ASN B C     1 
ATOM   2710  O  O     . ASN B 1  124  ? 437.801 29.958  711.977 1.00 116.26 ? 124  ASN B O     1 
ATOM   2711  C  CB    . ASN B 1  124  ? 440.280 29.550  710.981 1.00 110.65 ? 124  ASN B CB    1 
ATOM   2712  C  CG    . ASN B 1  124  ? 440.410 28.353  711.936 1.00 112.30 ? 124  ASN B CG    1 
ATOM   2713  O  OD1   . ASN B 1  124  ? 441.039 28.441  712.996 1.00 110.94 ? 124  ASN B OD1   1 
ATOM   2714  N  ND2   . ASN B 1  124  ? 439.812 27.223  711.550 1.00 94.98  ? 124  ASN B ND2   1 
ATOM   2715  N  N     . PRO B 1  125  ? 438.066 32.120  712.519 1.00 129.60 ? 125  PRO B N     1 
ATOM   2716  C  CA    . PRO B 1  125  ? 436.711 32.202  713.073 1.00 136.03 ? 125  PRO B CA    1 
ATOM   2717  C  C     . PRO B 1  125  ? 435.616 31.881  712.068 1.00 140.21 ? 125  PRO B C     1 
ATOM   2718  O  O     . PRO B 1  125  ? 434.492 31.596  712.491 1.00 146.64 ? 125  PRO B O     1 
ATOM   2719  C  CB    . PRO B 1  125  ? 436.620 33.656  713.548 1.00 140.38 ? 125  PRO B CB    1 
ATOM   2720  C  CG    . PRO B 1  125  ? 437.556 34.396  712.678 1.00 139.81 ? 125  PRO B CG    1 
ATOM   2721  C  CD    . PRO B 1  125  ? 438.705 33.446  712.453 1.00 132.55 ? 125  PRO B CD    1 
ATOM   2722  N  N     . ASP B 1  126  ? 435.888 31.924  710.760 1.00 136.01 ? 126  ASP B N     1 
ATOM   2723  C  CA    . ASP B 1  126  ? 434.851 31.664  709.762 1.00 136.65 ? 126  ASP B CA    1 
ATOM   2724  C  C     . ASP B 1  126  ? 434.681 30.183  709.445 1.00 128.75 ? 126  ASP B C     1 
ATOM   2725  O  O     . ASP B 1  126  ? 433.851 29.837  708.593 1.00 125.25 ? 126  ASP B O     1 
ATOM   2726  C  CB    . ASP B 1  126  ? 435.088 32.464  708.477 1.00 143.90 ? 126  ASP B CB    1 
ATOM   2727  C  CG    . ASP B 1  126  ? 433.978 33.509  708.230 1.00 153.47 ? 126  ASP B CG    1 
ATOM   2728  O  OD1   . ASP B 1  126  ? 433.233 33.849  709.189 1.00 157.64 ? 126  ASP B OD1   1 
ATOM   2729  O  OD2   . ASP B 1  126  ? 433.838 33.987  707.083 1.00 155.40 ? 126  ASP B OD2   1 
ATOM   2730  N  N     . LEU B 1  127  ? 435.462 29.319  710.089 1.00 124.38 ? 127  LEU B N     1 
ATOM   2731  C  CA    . LEU B 1  127  ? 435.375 27.880  709.869 1.00 123.21 ? 127  LEU B CA    1 
ATOM   2732  C  C     . LEU B 1  127  ? 433.992 27.343  710.224 1.00 128.81 ? 127  LEU B C     1 
ATOM   2733  O  O     . LEU B 1  127  ? 433.481 27.567  711.328 1.00 133.33 ? 127  LEU B O     1 
ATOM   2734  C  CB    . LEU B 1  127  ? 436.444 27.158  710.696 1.00 113.12 ? 127  LEU B CB    1 
ATOM   2735  C  CG    . LEU B 1  127  ? 436.281 25.635  710.761 1.00 103.85 ? 127  LEU B CG    1 
ATOM   2736  C  CD1   . LEU B 1  127  ? 436.300 24.974  709.396 1.00 104.13 ? 127  LEU B CD1   1 
ATOM   2737  C  CD2   . LEU B 1  127  ? 437.316 25.013  711.704 1.00 96.99  ? 127  LEU B CD2   1 
ATOM   2738  N  N     . HIS B 1  128  ? 433.394 26.616  709.283 1.00 128.76 ? 128  HIS B N     1 
ATOM   2739  C  CA    . HIS B 1  128  ? 432.089 26.034  709.537 1.00 127.72 ? 128  HIS B CA    1 
ATOM   2740  C  C     . HIS B 1  128  ? 432.250 24.875  710.522 1.00 122.28 ? 128  HIS B C     1 
ATOM   2741  O  O     . HIS B 1  128  ? 433.190 24.082  710.434 1.00 120.19 ? 128  HIS B O     1 
ATOM   2742  C  CB    . HIS B 1  128  ? 431.477 25.545  708.227 1.00 131.80 ? 128  HIS B CB    1 
ATOM   2743  C  CG    . HIS B 1  128  ? 430.106 24.971  708.383 1.00 137.35 ? 128  HIS B CG    1 
ATOM   2744  N  ND1   . HIS B 1  128  ? 429.081 25.671  708.985 1.00 140.38 ? 128  HIS B ND1   1 
ATOM   2745  C  CD2   . HIS B 1  128  ? 429.601 23.755  708.072 1.00 137.31 ? 128  HIS B CD2   1 
ATOM   2746  C  CE1   . HIS B 1  128  ? 427.992 24.925  708.999 1.00 141.27 ? 128  HIS B CE1   1 
ATOM   2747  N  NE2   . HIS B 1  128  ? 428.282 23.754  708.459 1.00 138.68 ? 128  HIS B NE2   1 
ATOM   2748  N  N     . ILE B 1  129  ? 431.313 24.745  711.449 1.00 118.60 ? 129  ILE B N     1 
ATOM   2749  C  CA    . ILE B 1  129  ? 431.293 23.614  712.368 1.00 115.07 ? 129  ILE B CA    1 
ATOM   2750  C  C     . ILE B 1  129  ? 430.089 22.722  712.105 1.00 120.10 ? 129  ILE B C     1 
ATOM   2751  O  O     . ILE B 1  129  ? 430.241 21.546  711.772 1.00 120.94 ? 129  ILE B O     1 
ATOM   2752  C  CB    . ILE B 1  129  ? 431.342 24.077  713.839 1.00 108.99 ? 129  ILE B CB    1 
ATOM   2753  C  CG1   . ILE B 1  129  ? 432.762 24.513  714.195 1.00 107.08 ? 129  ILE B CG1   1 
ATOM   2754  C  CG2   . ILE B 1  129  ? 431.037 22.902  714.720 1.00 99.76  ? 129  ILE B CG2   1 
ATOM   2755  C  CD1   . ILE B 1  129  ? 432.841 25.795  715.007 1.00 106.32 ? 129  ILE B CD1   1 
ATOM   2756  N  N     . ALA B 1  130  ? 428.882 23.254  712.257 1.00 123.47 ? 130  ALA B N     1 
ATOM   2757  C  CA    . ALA B 1  130  ? 427.729 22.442  711.907 1.00 128.05 ? 130  ALA B CA    1 
ATOM   2758  C  C     . ALA B 1  130  ? 426.571 23.345  711.502 1.00 133.78 ? 130  ALA B C     1 
ATOM   2759  O  O     . ALA B 1  130  ? 426.465 24.498  711.936 1.00 128.47 ? 130  ALA B O     1 
ATOM   2760  C  CB    . ALA B 1  130  ? 427.340 21.494  713.042 1.00 103.71 ? 130  ALA B CB    1 
ATOM   2761  N  N     . THR B 1  131  ? 425.692 22.788  710.675 1.00 141.92 ? 131  THR B N     1 
ATOM   2762  C  CA    . THR B 1  131  ? 424.443 23.423  710.291 1.00 148.32 ? 131  THR B CA    1 
ATOM   2763  C  C     . THR B 1  131  ? 423.349 22.843  711.166 1.00 147.57 ? 131  THR B C     1 
ATOM   2764  O  O     . THR B 1  131  ? 423.264 21.624  711.347 1.00 148.19 ? 131  THR B O     1 
ATOM   2765  C  CB    . THR B 1  131  ? 424.090 23.198  708.812 1.00 152.38 ? 131  THR B CB    1 
ATOM   2766  O  OG1   . THR B 1  131  ? 423.899 21.803  708.559 1.00 155.21 ? 131  THR B OG1   1 
ATOM   2767  C  CG2   . THR B 1  131  ? 425.165 23.725  707.870 1.00 153.34 ? 131  THR B CG2   1 
ATOM   2768  N  N     . LEU B 1  132  ? 422.552 23.723  711.745 1.00 140.63 ? 132  LEU B N     1 
ATOM   2769  C  CA    . LEU B 1  132  ? 421.457 23.350  712.620 1.00 138.76 ? 132  LEU B CA    1 
ATOM   2770  C  C     . LEU B 1  132  ? 420.154 23.699  711.934 1.00 139.82 ? 132  LEU B C     1 
ATOM   2771  O  O     . LEU B 1  132  ? 419.990 24.812  711.425 1.00 140.82 ? 132  LEU B O     1 
ATOM   2772  C  CB    . LEU B 1  132  ? 421.570 24.039  713.974 1.00 134.90 ? 132  LEU B CB    1 
ATOM   2773  C  CG    . LEU B 1  132  ? 422.486 23.315  714.958 1.00 132.57 ? 132  LEU B CG    1 
ATOM   2774  C  CD1   . LEU B 1  132  ? 423.913 23.204  714.474 1.00 129.72 ? 132  LEU B CD1   1 
ATOM   2775  C  CD2   . LEU B 1  132  ? 422.451 24.047  716.285 1.00 134.98 ? 132  LEU B CD2   1 
ATOM   2776  N  N     . GLU B 1  133  ? 419.244 22.739  711.914 1.00 147.34 ? 133  GLU B N     1 
ATOM   2777  C  CA    . GLU B 1  133  ? 417.958 22.931  711.286 1.00 156.27 ? 133  GLU B CA    1 
ATOM   2778  C  C     . GLU B 1  133  ? 416.970 23.476  712.323 1.00 161.89 ? 133  GLU B C     1 
ATOM   2779  O  O     . GLU B 1  133  ? 417.337 23.758  713.466 1.00 164.43 ? 133  GLU B O     1 
ATOM   2780  C  CB    . GLU B 1  133  ? 417.531 21.563  710.773 1.00 157.83 ? 133  GLU B CB    1 
ATOM   2781  C  CG    . GLU B 1  133  ? 416.554 21.454  709.666 1.00 165.16 ? 133  GLU B CG    1 
ATOM   2782  C  CD    . GLU B 1  133  ? 416.368 19.992  709.324 1.00 166.93 ? 133  GLU B CD    1 
ATOM   2783  O  OE1   . GLU B 1  133  ? 416.906 19.146  710.087 1.00 161.80 ? 133  GLU B OE1   1 
ATOM   2784  O  OE2   . GLU B 1  133  ? 415.782 19.695  708.258 1.00 172.58 ? 133  GLU B OE2   1 
ATOM   2785  N  N     . GLU B 1  134  ? 415.700 23.623  711.948 1.00 165.68 ? 134  GLU B N     1 
ATOM   2786  C  CA    . GLU B 1  134  ? 414.713 24.070  712.925 1.00 169.01 ? 134  GLU B CA    1 
ATOM   2787  C  C     . GLU B 1  134  ? 414.563 23.051  714.047 1.00 164.17 ? 134  GLU B C     1 
ATOM   2788  O  O     . GLU B 1  134  ? 414.316 21.870  713.790 1.00 164.85 ? 134  GLU B O     1 
ATOM   2789  C  CB    . GLU B 1  134  ? 413.371 24.386  712.284 1.00 177.99 ? 134  GLU B CB    1 
ATOM   2790  C  CG    . GLU B 1  134  ? 413.098 25.888  712.382 1.00 185.83 ? 134  GLU B CG    1 
ATOM   2791  C  CD    . GLU B 1  134  ? 412.713 26.332  713.798 1.00 191.32 ? 134  GLU B CD    1 
ATOM   2792  O  OE1   . GLU B 1  134  ? 412.539 27.551  714.019 1.00 195.38 ? 134  GLU B OE1   1 
ATOM   2793  O  OE2   . GLU B 1  134  ? 412.588 25.472  714.696 1.00 192.89 ? 134  GLU B OE2   1 
ATOM   2794  N  N     . GLY B 1  135  ? 414.702 23.501  715.291 1.00 164.30 ? 135  GLY B N     1 
ATOM   2795  C  CA    . GLY B 1  135  ? 414.538 22.595  716.410 1.00 165.30 ? 135  GLY B CA    1 
ATOM   2796  C  C     . GLY B 1  135  ? 415.727 21.701  716.647 1.00 152.81 ? 135  GLY B C     1 
ATOM   2797  O  O     . GLY B 1  135  ? 415.657 20.785  717.474 1.00 131.36 ? 135  GLY B O     1 
ATOM   2798  N  N     . GLY B 1  136  ? 416.813 21.938  715.919 1.00 154.20 ? 136  GLY B N     1 
ATOM   2799  C  CA    . GLY B 1  136  ? 418.054 21.235  716.149 1.00 150.27 ? 136  GLY B CA    1 
ATOM   2800  C  C     . GLY B 1  136  ? 418.802 21.937  717.265 1.00 146.45 ? 136  GLY B C     1 
ATOM   2801  O  O     . GLY B 1  136  ? 418.744 23.158  717.408 1.00 148.53 ? 136  GLY B O     1 
ATOM   2802  N  N     . ARG B 1  137  ? 419.467 21.154  718.101 1.00 147.53 ? 137  ARG B N     1 
ATOM   2803  C  CA    . ARG B 1  137  ? 420.077 21.765  719.264 1.00 147.70 ? 137  ARG B CA    1 
ATOM   2804  C  C     . ARG B 1  137  ? 421.493 21.227  719.442 1.00 140.26 ? 137  ARG B C     1 
ATOM   2805  O  O     . ARG B 1  137  ? 421.715 20.010  719.440 1.00 134.64 ? 137  ARG B O     1 
ATOM   2806  C  CB    . ARG B 1  137  ? 419.169 21.513  720.474 1.00 157.88 ? 137  ARG B CB    1 
ATOM   2807  C  CG    . ARG B 1  137  ? 417.885 22.347  720.327 1.00 167.48 ? 137  ARG B CG    1 
ATOM   2808  C  CD    . ARG B 1  137  ? 416.778 21.891  721.215 1.00 173.98 ? 137  ARG B CD    1 
ATOM   2809  N  NE    . ARG B 1  137  ? 417.208 21.954  722.592 1.00 180.27 ? 137  ARG B NE    1 
ATOM   2810  C  CZ    . ARG B 1  137  ? 417.043 23.041  723.333 1.00 189.93 ? 137  ARG B CZ    1 
ATOM   2811  N  NH1   . ARG B 1  137  ? 416.463 24.112  722.797 1.00 193.37 ? 137  ARG B NH1   1 
ATOM   2812  N  NH2   . ARG B 1  137  ? 417.450 23.073  724.595 1.00 194.13 ? 137  ARG B NH2   1 
ATOM   2813  N  N     . LEU B 1  138  ? 422.452 22.153  719.548 1.00 136.90 ? 138  LEU B N     1 
ATOM   2814  C  CA    . LEU B 1  138  ? 423.865 21.825  719.703 1.00 129.71 ? 138  LEU B CA    1 
ATOM   2815  C  C     . LEU B 1  138  ? 424.490 22.388  720.979 1.00 129.75 ? 138  LEU B C     1 
ATOM   2816  O  O     . LEU B 1  138  ? 424.676 23.605  721.116 1.00 133.28 ? 138  LEU B O     1 
ATOM   2817  C  CB    . LEU B 1  138  ? 424.640 22.342  718.507 1.00 121.81 ? 138  LEU B CB    1 
ATOM   2818  C  CG    . LEU B 1  138  ? 426.037 21.746  718.466 1.00 116.40 ? 138  LEU B CG    1 
ATOM   2819  C  CD1   . LEU B 1  138  ? 425.976 20.239  718.261 1.00 112.99 ? 138  LEU B CD1   1 
ATOM   2820  C  CD2   . LEU B 1  138  ? 426.818 22.436  717.371 1.00 114.99 ? 138  LEU B CD2   1 
ATOM   2821  N  N     . ASN B 1  139  ? 424.865 21.481  721.878 1.00 127.83 ? 139  ASN B N     1 
ATOM   2822  C  CA    . ASN B 1  139  ? 425.546 21.777  723.132 1.00 130.89 ? 139  ASN B CA    1 
ATOM   2823  C  C     . ASN B 1  139  ? 426.794 20.919  723.266 1.00 131.35 ? 139  ASN B C     1 
ATOM   2824  O  O     . ASN B 1  139  ? 426.671 19.699  723.424 1.00 130.06 ? 139  ASN B O     1 
ATOM   2825  C  CB    . ASN B 1  139  ? 424.648 21.510  724.327 1.00 143.25 ? 139  ASN B CB    1 
ATOM   2826  C  CG    . ASN B 1  139  ? 425.220 22.080  725.604 1.00 154.50 ? 139  ASN B CG    1 
ATOM   2827  O  OD1   . ASN B 1  139  ? 426.275 22.710  725.585 1.00 157.65 ? 139  ASN B OD1   1 
ATOM   2828  N  ND2   . ASN B 1  139  ? 424.569 21.800  726.734 1.00 159.06 ? 139  ASN B ND2   1 
ATOM   2829  N  N     . MET B 1  140  ? 427.988 21.528  723.231 1.00 130.65 ? 140  MET B N     1 
ATOM   2830  C  CA    . MET B 1  140  ? 429.215 20.727  723.269 1.00 128.93 ? 140  MET B CA    1 
ATOM   2831  C  C     . MET B 1  140  ? 430.386 21.462  723.915 1.00 122.15 ? 140  MET B C     1 
ATOM   2832  O  O     . MET B 1  140  ? 430.471 22.697  723.906 1.00 122.25 ? 140  MET B O     1 
ATOM   2833  C  CB    . MET B 1  140  ? 429.717 20.175  721.933 1.00 128.16 ? 140  MET B CB    1 
ATOM   2834  C  CG    . MET B 1  140  ? 429.150 20.654  720.650 1.00 133.42 ? 140  MET B CG    1 
ATOM   2835  S  SD    . MET B 1  140  ? 430.437 20.133  719.467 1.00 134.72 ? 140  MET B SD    1 
ATOM   2836  C  CE    . MET B 1  140  ? 429.846 20.913  717.993 1.00 134.88 ? 140  MET B CE    1 
ATOM   2837  N  N     . GLU B 1  141  ? 431.286 20.653  724.479 1.00 120.64 ? 141  GLU B N     1 
ATOM   2838  C  CA    . GLU B 1  141  ? 432.541 21.097  725.064 1.00 121.98 ? 141  GLU B CA    1 
ATOM   2839  C  C     . GLU B 1  141  ? 433.664 20.443  724.280 1.00 119.55 ? 141  GLU B C     1 
ATOM   2840  O  O     . GLU B 1  141  ? 433.634 19.225  724.069 1.00 118.41 ? 141  GLU B O     1 
ATOM   2841  C  CB    . GLU B 1  141  ? 432.630 20.592  726.513 1.00 127.81 ? 141  GLU B CB    1 
ATOM   2842  C  CG    . GLU B 1  141  ? 431.581 21.135  727.460 1.00 138.58 ? 141  GLU B CG    1 
ATOM   2843  C  CD    . GLU B 1  141  ? 431.731 20.631  728.895 1.00 145.16 ? 141  GLU B CD    1 
ATOM   2844  O  OE1   . GLU B 1  141  ? 432.583 19.744  729.157 1.00 149.47 ? 141  GLU B OE1   1 
ATOM   2845  O  OE2   . GLU B 1  141  ? 430.976 21.127  729.759 1.00 145.23 ? 141  GLU B OE2   1 
ATOM   2846  N  N     . VAL B 1  142  ? 434.628 21.248  723.808 1.00 117.83 ? 142  VAL B N     1 
ATOM   2847  C  CA    . VAL B 1  142  ? 435.810 20.734  723.118 1.00 111.41 ? 142  VAL B CA    1 
ATOM   2848  C  C     . VAL B 1  142  ? 437.063 21.047  723.937 1.00 105.86 ? 142  VAL B C     1 
ATOM   2849  O  O     . VAL B 1  142  ? 437.210 22.156  724.470 1.00 108.70 ? 142  VAL B O     1 
ATOM   2850  C  CB    . VAL B 1  142  ? 435.917 21.277  721.672 1.00 113.89 ? 142  VAL B CB    1 
ATOM   2851  C  CG1   . VAL B 1  142  ? 434.553 21.273  721.018 1.00 115.84 ? 142  VAL B CG1   1 
ATOM   2852  C  CG2   . VAL B 1  142  ? 436.505 22.680  721.623 1.00 117.03 ? 142  VAL B CG2   1 
ATOM   2853  N  N     . ARG B 1  143  ? 437.944 20.056  724.079 1.00 98.77  ? 143  ARG B N     1 
ATOM   2854  C  CA    . ARG B 1  143  ? 439.175 20.194  724.857 1.00 100.41 ? 143  ARG B CA    1 
ATOM   2855  C  C     . ARG B 1  143  ? 440.364 20.434  723.926 1.00 104.15 ? 143  ARG B C     1 
ATOM   2856  O  O     . ARG B 1  143  ? 440.621 19.623  723.024 1.00 101.04 ? 143  ARG B O     1 
ATOM   2857  C  CB    . ARG B 1  143  ? 439.437 18.989  725.740 1.00 98.04  ? 143  ARG B CB    1 
ATOM   2858  C  CG    . ARG B 1  143  ? 440.842 18.994  726.256 1.00 100.37 ? 143  ARG B CG    1 
ATOM   2859  C  CD    . ARG B 1  143  ? 440.959 18.089  727.447 1.00 105.72 ? 143  ARG B CD    1 
ATOM   2860  N  NE    . ARG B 1  143  ? 442.320 18.077  727.952 1.00 107.35 ? 143  ARG B NE    1 
ATOM   2861  C  CZ    . ARG B 1  143  ? 442.722 17.337  728.973 1.00 115.58 ? 143  ARG B CZ    1 
ATOM   2862  N  NH1   . ARG B 1  143  ? 441.863 16.539  729.599 1.00 120.37 ? 143  ARG B NH1   1 
ATOM   2863  N  NH2   . ARG B 1  143  ? 443.987 17.391  729.358 1.00 117.71 ? 143  ARG B NH2   1 
ATOM   2864  N  N     . VAL B 1  144  ? 441.053 21.560  724.100 1.00 107.94 ? 144  VAL B N     1 
ATOM   2865  C  CA    . VAL B 1  144  ? 442.153 21.943  723.219 1.00 110.96 ? 144  VAL B CA    1 
ATOM   2866  C  C     . VAL B 1  144  ? 443.449 22.019  724.042 1.00 109.62 ? 144  VAL B C     1 
ATOM   2867  O  O     . VAL B 1  144  ? 443.572 22.846  724.957 1.00 102.00 ? 144  VAL B O     1 
ATOM   2868  C  CB    . VAL B 1  144  ? 441.851 23.252  722.470 1.00 110.16 ? 144  VAL B CB    1 
ATOM   2869  C  CG1   . VAL B 1  144  ? 443.078 23.786  721.753 1.00 98.59  ? 144  VAL B CG1   1 
ATOM   2870  C  CG2   . VAL B 1  144  ? 440.718 23.043  721.482 1.00 97.12  ? 144  VAL B CG2   1 
ATOM   2871  N  N     . ASP B 1  145  ? 444.406 21.141  723.712 1.00 114.30 ? 145  ASP B N     1 
ATOM   2872  C  CA    . ASP B 1  145  ? 445.686 20.976  724.397 1.00 109.96 ? 145  ASP B CA    1 
ATOM   2873  C  C     . ASP B 1  145  ? 446.868 21.412  723.542 1.00 104.24 ? 145  ASP B C     1 
ATOM   2874  O  O     . ASP B 1  145  ? 446.844 21.356  722.309 1.00 103.07 ? 145  ASP B O     1 
ATOM   2875  C  CB    . ASP B 1  145  ? 445.946 19.528  724.806 1.00 111.48 ? 145  ASP B CB    1 
ATOM   2876  C  CG    . ASP B 1  145  ? 445.122 19.098  725.962 1.00 118.34 ? 145  ASP B CG    1 
ATOM   2877  O  OD1   . ASP B 1  145  ? 444.015 18.580  725.736 1.00 121.98 ? 145  ASP B OD1   1 
ATOM   2878  O  OD2   . ASP B 1  145  ? 445.605 19.277  727.101 1.00 119.63 ? 145  ASP B OD2   1 
ATOM   2879  N  N     . ARG B 1  146  ? 447.931 21.783  724.241 1.00 104.94 ? 146  ARG B N     1 
ATOM   2880  C  CA    . ARG B 1  146  ? 449.216 22.058  723.634 1.00 109.62 ? 146  ARG B CA    1 
ATOM   2881  C  C     . ARG B 1  146  ? 450.008 20.768  723.486 1.00 108.97 ? 146  ARG B C     1 
ATOM   2882  O  O     . ARG B 1  146  ? 450.061 19.957  724.409 1.00 113.72 ? 146  ARG B O     1 
ATOM   2883  C  CB    . ARG B 1  146  ? 449.967 23.033  724.546 1.00 121.23 ? 146  ARG B CB    1 
ATOM   2884  C  CG    . ARG B 1  146  ? 451.463 23.127  724.308 1.00 131.79 ? 146  ARG B CG    1 
ATOM   2885  C  CD    . ARG B 1  146  ? 452.123 24.190  725.179 1.00 141.33 ? 146  ARG B CD    1 
ATOM   2886  N  NE    . ARG B 1  146  ? 451.624 25.513  724.826 1.00 147.19 ? 146  ARG B NE    1 
ATOM   2887  C  CZ    . ARG B 1  146  ? 451.870 26.616  725.518 1.00 152.76 ? 146  ARG B CZ    1 
ATOM   2888  N  NH1   . ARG B 1  146  ? 452.616 26.545  726.618 1.00 159.75 ? 146  ARG B NH1   1 
ATOM   2889  N  NH2   . ARG B 1  146  ? 451.372 27.778  725.112 1.00 150.77 ? 146  ARG B NH2   1 
ATOM   2890  N  N     . GLY B 1  147  ? 450.613 20.575  722.323 1.00 104.31 ? 147  GLY B N     1 
ATOM   2891  C  CA    . GLY B 1  147  ? 451.403 19.381  722.090 1.00 102.81 ? 147  GLY B CA    1 
ATOM   2892  C  C     . GLY B 1  147  ? 452.184 19.468  720.791 1.00 103.83 ? 147  GLY B C     1 
ATOM   2893  O  O     . GLY B 1  147  ? 452.168 20.488  720.089 1.00 104.24 ? 147  GLY B O     1 
ATOM   2894  N  N     . VAL B 1  148  ? 452.811 18.349  720.433 1.00 101.80 ? 148  VAL B N     1 
ATOM   2895  C  CA    . VAL B 1  148  ? 453.557 18.260  719.184 1.00 98.88  ? 148  VAL B CA    1 
ATOM   2896  C  C     . VAL B 1  148  ? 453.214 16.993  718.417 1.00 95.22  ? 148  VAL B C     1 
ATOM   2897  O  O     . VAL B 1  148  ? 452.807 15.975  718.990 1.00 93.48  ? 148  VAL B O     1 
ATOM   2898  C  CB    . VAL B 1  148  ? 455.085 18.329  719.404 1.00 97.25  ? 148  VAL B CB    1 
ATOM   2899  C  CG1   . VAL B 1  148  ? 455.485 19.626  720.079 1.00 99.29  ? 148  VAL B CG1   1 
ATOM   2900  C  CG2   . VAL B 1  148  ? 455.559 17.116  720.202 1.00 98.25  ? 148  VAL B CG2   1 
ATOM   2901  N  N     . GLY B 1  149  ? 453.346 17.079  717.099 1.00 89.61  ? 149  GLY B N     1 
ATOM   2902  C  CA    . GLY B 1  149  ? 453.202 15.891  716.303 1.00 86.34  ? 149  GLY B CA    1 
ATOM   2903  C  C     . GLY B 1  149  ? 451.775 15.451  716.087 1.00 88.83  ? 149  GLY B C     1 
ATOM   2904  O  O     . GLY B 1  149  ? 450.867 16.284  715.991 1.00 89.72  ? 149  GLY B O     1 
ATOM   2905  N  N     . TYR B 1  150  ? 451.565 14.133  716.060 1.00 80.94  ? 150  TYR B N     1 
ATOM   2906  C  CA    . TYR B 1  150  ? 450.244 13.555  715.829 1.00 84.79  ? 150  TYR B CA    1 
ATOM   2907  C  C     . TYR B 1  150  ? 450.008 12.357  716.740 1.00 90.95  ? 150  TYR B C     1 
ATOM   2908  O  O     . TYR B 1  150  ? 450.802 11.413  716.737 1.00 90.44  ? 150  TYR B O     1 
ATOM   2909  C  CB    . TYR B 1  150  ? 450.091 13.183  714.351 1.00 78.54  ? 150  TYR B CB    1 
ATOM   2910  C  CG    . TYR B 1  150  ? 448.770 12.578  713.922 1.00 79.82  ? 150  TYR B CG    1 
ATOM   2911  C  CD1   . TYR B 1  150  ? 448.549 11.207  714.042 1.00 80.12  ? 150  TYR B CD1   1 
ATOM   2912  C  CD2   . TYR B 1  150  ? 447.781 13.361  713.323 1.00 77.68  ? 150  TYR B CD2   1 
ATOM   2913  C  CE1   . TYR B 1  150  ? 447.362 10.633  713.634 1.00 81.41  ? 150  TYR B CE1   1 
ATOM   2914  C  CE2   . TYR B 1  150  ? 446.586 12.799  712.901 1.00 78.96  ? 150  TYR B CE2   1 
ATOM   2915  C  CZ    . TYR B 1  150  ? 446.375 11.429  713.065 1.00 81.81  ? 150  TYR B CZ    1 
ATOM   2916  O  OH    . TYR B 1  150  ? 445.182 10.846  712.662 1.00 84.35  ? 150  TYR B OH    1 
ATOM   2917  N  N     . VAL B 1  151  ? 448.981 12.430  717.585 1.00 92.15  ? 151  VAL B N     1 
ATOM   2918  C  CA    . VAL B 1  151  ? 448.635 11.290  718.429 1.00 96.83  ? 151  VAL B CA    1 
ATOM   2919  C  C     . VAL B 1  151  ? 447.223 10.820  718.074 1.00 87.33  ? 151  VAL B C     1 
ATOM   2920  O  O     . VAL B 1  151  ? 446.251 11.548  718.347 1.00 81.22  ? 151  VAL B O     1 
ATOM   2921  C  CB    . VAL B 1  151  ? 448.748 11.711  719.899 1.00 100.52 ? 151  VAL B CB    1 
ATOM   2922  C  CG1   . VAL B 1  151  ? 448.548 10.507  720.865 1.00 102.91 ? 151  VAL B CG1   1 
ATOM   2923  C  CG2   . VAL B 1  151  ? 450.059 12.486  720.114 1.00 100.05 ? 151  VAL B CG2   1 
ATOM   2924  N  N     . PRO B 1  152  ? 447.038 9.607   717.529 1.00 92.48  ? 152  PRO B N     1 
ATOM   2925  C  CA    . PRO B 1  152  ? 445.668 9.159   717.249 1.00 94.66  ? 152  PRO B CA    1 
ATOM   2926  C  C     . PRO B 1  152  ? 444.847 9.107   718.512 1.00 103.75 ? 152  PRO B C     1 
ATOM   2927  O  O     . PRO B 1  152  ? 445.394 8.955   719.597 1.00 111.51 ? 152  PRO B O     1 
ATOM   2928  C  CB    . PRO B 1  152  ? 445.861 7.748   716.672 1.00 93.27  ? 152  PRO B CB    1 
ATOM   2929  C  CG    . PRO B 1  152  ? 447.288 7.343   717.026 1.00 91.02  ? 152  PRO B CG    1 
ATOM   2930  C  CD    . PRO B 1  152  ? 448.054 8.628   717.088 1.00 88.89  ? 152  PRO B CD    1 
ATOM   2931  N  N     . ALA B 1  153  ? 443.521 9.257   718.361 1.00 106.06 ? 153  ALA B N     1 
ATOM   2932  C  CA    . ALA B 1  153  ? 442.608 9.268   719.519 1.00 104.79 ? 153  ALA B CA    1 
ATOM   2933  C  C     . ALA B 1  153  ? 442.677 7.957   720.288 1.00 97.60  ? 153  ALA B C     1 
ATOM   2934  O  O     . ALA B 1  153  ? 442.938 7.926   721.497 1.00 93.39  ? 153  ALA B O     1 
ATOM   2935  C  CB    . ALA B 1  153  ? 441.168 9.545   719.089 1.00 103.38 ? 153  ALA B CB    1 
ATOM   2936  N  N     . GLU B 1  154  ? 442.605 6.857   719.541 1.00 99.99  ? 154  GLU B N     1 
ATOM   2937  C  CA    . GLU B 1  154  ? 442.581 5.498   720.040 1.00 107.35 ? 154  GLU B CA    1 
ATOM   2938  C  C     . GLU B 1  154  ? 443.885 5.148   720.774 1.00 109.85 ? 154  GLU B C     1 
ATOM   2939  O  O     . GLU B 1  154  ? 444.080 3.996   721.160 1.00 112.57 ? 154  GLU B O     1 
ATOM   2940  C  CB    . GLU B 1  154  ? 442.287 4.525   718.837 1.00 107.75 ? 154  GLU B CB    1 
ATOM   2941  C  CG    . GLU B 1  154  ? 440.929 4.664   717.884 1.00 110.15 ? 154  GLU B CG    1 
ATOM   2942  C  CD    . GLU B 1  154  ? 440.888 5.701   716.658 1.00 112.63 ? 154  GLU B CD    1 
ATOM   2943  O  OE1   . GLU B 1  154  ? 441.884 6.387   716.357 1.00 114.71 ? 154  GLU B OE1   1 
ATOM   2944  O  OE2   . GLU B 1  154  ? 439.838 5.825   715.946 1.00 111.61 ? 154  GLU B OE2   1 
ATOM   2945  N  N     . LYS B 1  155  ? 444.742 6.148   721.053 1.00 118.38 ? 155  LYS B N     1 
ATOM   2946  C  CA    . LYS B 1  155  ? 446.047 5.966   721.702 1.00 122.20 ? 155  LYS B CA    1 
ATOM   2947  C  C     . LYS B 1  155  ? 446.327 6.867   722.902 1.00 128.51 ? 155  LYS B C     1 
ATOM   2948  O  O     . LYS B 1  155  ? 446.979 6.433   723.853 1.00 142.50 ? 155  LYS B O     1 
ATOM   2949  C  CB    . LYS B 1  155  ? 447.210 6.198   720.727 1.00 126.53 ? 155  LYS B CB    1 
ATOM   2950  C  CG    . LYS B 1  155  ? 447.537 5.068   719.715 1.00 132.71 ? 155  LYS B CG    1 
ATOM   2951  C  CD    . LYS B 1  155  ? 447.959 3.730   720.320 1.00 137.54 ? 155  LYS B CD    1 
ATOM   2952  C  CE    . LYS B 1  155  ? 448.022 2.632   719.226 1.00 136.59 ? 155  LYS B CE    1 
ATOM   2953  N  NZ    . LYS B 1  155  ? 446.696 2.169   718.663 1.00 134.07 ? 155  LYS B NZ    1 
ATOM   2954  N  N     . HIS B 1  156  ? 445.891 8.132   722.869 1.00 122.51 ? 156  HIS B N     1 
ATOM   2955  C  CA    . HIS B 1  156  ? 446.071 9.023   724.023 1.00 125.65 ? 156  HIS B CA    1 
ATOM   2956  C  C     . HIS B 1  156  ? 444.999 8.763   725.074 1.00 140.61 ? 156  HIS B C     1 
ATOM   2957  O  O     . HIS B 1  156  ? 445.276 8.837   726.277 1.00 143.42 ? 156  HIS B O     1 
ATOM   2958  C  CB    . HIS B 1  156  ? 446.088 10.506  723.654 1.00 110.56 ? 156  HIS B CB    1 
ATOM   2959  C  CG    . HIS B 1  156  ? 444.837 11.010  723.011 1.00 103.31 ? 156  HIS B CG    1 
ATOM   2960  N  ND1   . HIS B 1  156  ? 443.669 11.182  723.715 1.00 102.84 ? 156  HIS B ND1   1 
ATOM   2961  C  CD2   . HIS B 1  156  ? 444.573 11.425  721.752 1.00 102.64 ? 156  HIS B CD2   1 
ATOM   2962  C  CE1   . HIS B 1  156  ? 442.739 11.677  722.918 1.00 101.13 ? 156  HIS B CE1   1 
ATOM   2963  N  NE2   . HIS B 1  156  ? 443.259 11.826  721.717 1.00 99.47  ? 156  HIS B NE2   1 
ATOM   2964  N  N     . GLY B 1  157  ? 443.774 8.463   724.636 1.00 156.54 ? 157  GLY B N     1 
ATOM   2965  C  CA    . GLY B 1  157  ? 442.694 8.155   725.554 1.00 158.80 ? 157  GLY B CA    1 
ATOM   2966  C  C     . GLY B 1  157  ? 442.336 9.133   726.646 1.00 158.68 ? 157  GLY B C     1 
ATOM   2967  O  O     . GLY B 1  157  ? 442.291 8.783   727.831 1.00 164.67 ? 157  GLY B O     1 
ATOM   2968  N  N     . ILE B 1  158  ? 442.061 10.372  726.247 1.00 133.17 ? 158  ILE B N     1 
ATOM   2969  C  CA    . ILE B 1  158  ? 441.689 11.389  727.203 1.00 114.38 ? 158  ILE B CA    1 
ATOM   2970  C  C     . ILE B 1  158  ? 440.178 11.455  727.224 1.00 111.72 ? 158  ILE B C     1 
ATOM   2971  O  O     . ILE B 1  158  ? 439.535 11.454  726.174 1.00 107.84 ? 158  ILE B O     1 
ATOM   2972  C  CB    . ILE B 1  158  ? 442.208 12.760  726.729 1.00 97.36  ? 158  ILE B CB    1 
ATOM   2973  C  CG1   . ILE B 1  158  ? 443.713 12.880  726.749 1.00 95.05  ? 158  ILE B CG1   1 
ATOM   2974  C  CG2   . ILE B 1  158  ? 441.598 13.883  727.509 1.00 98.28  ? 158  ILE B CG2   1 
ATOM   2975  C  CD1   . ILE B 1  158  ? 444.125 14.314  726.515 1.00 95.47  ? 158  ILE B CD1   1 
ATOM   2976  N  N     . LYS B 1  159  ? 439.613 11.372  728.429 1.00 119.24 ? 159  LYS B N     1 
ATOM   2977  C  CA    . LYS B 1  159  ? 438.190 11.547  728.682 1.00 120.16 ? 159  LYS B CA    1 
ATOM   2978  C  C     . LYS B 1  159  ? 438.025 12.479  729.882 1.00 127.14 ? 159  LYS B C     1 
ATOM   2979  O  O     . LYS B 1  159  ? 438.452 12.127  730.987 1.00 127.01 ? 159  LYS B O     1 
ATOM   2980  C  CB    . LYS B 1  159  ? 437.546 10.175  728.860 1.00 117.97 ? 159  LYS B CB    1 
ATOM   2981  C  CG    . LYS B 1  159  ? 437.053 9.669   727.498 1.00 115.68 ? 159  LYS B CG    1 
ATOM   2982  C  CD    . LYS B 1  159  ? 436.424 8.302   727.553 1.00 121.94 ? 159  LYS B CD    1 
ATOM   2983  C  CE    . LYS B 1  159  ? 434.929 8.312   727.445 1.00 130.95 ? 159  LYS B CE    1 
ATOM   2984  N  NZ    . LYS B 1  159  ? 434.441 6.903   727.416 1.00 138.59 ? 159  LYS B NZ    1 
ATOM   2985  N  N     . ASP B 1  160  ? 437.415 13.653  729.688 1.00 130.66 ? 160  ASP B N     1 
ATOM   2986  C  CA    . ASP B 1  160  ? 437.043 14.489  730.834 1.00 128.41 ? 160  ASP B CA    1 
ATOM   2987  C  C     . ASP B 1  160  ? 435.851 13.946  731.594 1.00 129.28 ? 160  ASP B C     1 
ATOM   2988  O  O     . ASP B 1  160  ? 435.775 14.110  732.812 1.00 137.93 ? 160  ASP B O     1 
ATOM   2989  C  CB    . ASP B 1  160  ? 436.703 15.920  730.417 1.00 131.82 ? 160  ASP B CB    1 
ATOM   2990  C  CG    . ASP B 1  160  ? 437.904 16.781  730.230 1.00 135.21 ? 160  ASP B CG    1 
ATOM   2991  O  OD1   . ASP B 1  160  ? 438.980 16.396  730.748 1.00 137.56 ? 160  ASP B OD1   1 
ATOM   2992  O  OD2   . ASP B 1  160  ? 437.745 17.860  729.605 1.00 133.89 ? 160  ASP B OD2   1 
ATOM   2993  N  N     . ARG B 1  161  ? 434.919 13.311  730.896 1.00 124.28 ? 161  ARG B N     1 
ATOM   2994  C  CA    . ARG B 1  161  ? 433.709 12.755  731.472 1.00 132.79 ? 161  ARG B CA    1 
ATOM   2995  C  C     . ARG B 1  161  ? 433.297 11.554  730.639 1.00 142.34 ? 161  ARG B C     1 
ATOM   2996  O  O     . ARG B 1  161  ? 433.933 11.224  729.642 1.00 143.29 ? 161  ARG B O     1 
ATOM   2997  C  CB    . ARG B 1  161  ? 432.609 13.809  731.516 1.00 126.13 ? 161  ARG B CB    1 
ATOM   2998  C  CG    . ARG B 1  161  ? 432.095 14.170  730.160 1.00 118.29 ? 161  ARG B CG    1 
ATOM   2999  C  CD    . ARG B 1  161  ? 430.989 15.173  730.262 1.00 118.37 ? 161  ARG B CD    1 
ATOM   3000  N  NE    . ARG B 1  161  ? 431.487 16.455  730.723 1.00 122.17 ? 161  ARG B NE    1 
ATOM   3001  C  CZ    . ARG B 1  161  ? 430.698 17.442  731.124 1.00 137.31 ? 161  ARG B CZ    1 
ATOM   3002  N  NH1   . ARG B 1  161  ? 429.373 17.291  731.134 1.00 139.16 ? 161  ARG B NH1   1 
ATOM   3003  N  NH2   . ARG B 1  161  ? 431.237 18.585  731.512 1.00 146.15 ? 161  ARG B NH2   1 
ATOM   3004  N  N     . ILE B 1  162  ? 432.210 10.900  731.031 1.00 160.54 ? 162  ILE B N     1 
ATOM   3005  C  CA    . ILE B 1  162  ? 431.748 9.811   730.187 1.00 162.13 ? 162  ILE B CA    1 
ATOM   3006  C  C     . ILE B 1  162  ? 431.101 10.372  728.932 1.00 160.34 ? 162  ILE B C     1 
ATOM   3007  O  O     . ILE B 1  162  ? 430.727 11.546  728.868 1.00 168.34 ? 162  ILE B O     1 
ATOM   3008  C  CB    . ILE B 1  162  ? 430.708 9.008   730.988 1.00 169.71 ? 162  ILE B CB    1 
ATOM   3009  C  CG1   . ILE B 1  162  ? 431.227 8.657   732.371 1.00 178.72 ? 162  ILE B CG1   1 
ATOM   3010  C  CG2   . ILE B 1  162  ? 430.229 7.775   730.228 1.00 171.46 ? 162  ILE B CG2   1 
ATOM   3011  C  CD1   . ILE B 1  162  ? 431.905 7.328   732.403 1.00 181.24 ? 162  ILE B CD1   1 
ATOM   3012  N  N     . ASN B 1  163  ? 431.044 9.545   727.889 1.00 147.01 ? 163  ASN B N     1 
ATOM   3013  C  CA    . ASN B 1  163  ? 430.521 9.965   726.597 1.00 140.51 ? 163  ASN B CA    1 
ATOM   3014  C  C     . ASN B 1  163  ? 431.415 10.965  725.880 1.00 134.33 ? 163  ASN B C     1 
ATOM   3015  O  O     . ASN B 1  163  ? 431.103 11.352  724.734 1.00 133.63 ? 163  ASN B O     1 
ATOM   3016  C  CB    . ASN B 1  163  ? 429.083 10.475  726.695 1.00 139.21 ? 163  ASN B CB    1 
ATOM   3017  C  CG    . ASN B 1  163  ? 428.125 9.341   726.907 1.00 141.67 ? 163  ASN B CG    1 
ATOM   3018  O  OD1   . ASN B 1  163  ? 428.024 8.435   726.070 1.00 138.97 ? 163  ASN B OD1   1 
ATOM   3019  N  ND2   . ASN B 1  163  ? 427.446 9.345   728.055 1.00 147.48 ? 163  ASN B ND2   1 
ATOM   3020  N  N     . ALA B 1  164  ? 432.491 11.423  726.510 1.00 128.34 ? 164  ALA B N     1 
ATOM   3021  C  CA    . ALA B 1  164  ? 433.426 12.287  725.814 1.00 117.58 ? 164  ALA B CA    1 
ATOM   3022  C  C     . ALA B 1  164  ? 434.152 11.417  724.793 1.00 118.21 ? 164  ALA B C     1 
ATOM   3023  O  O     . ALA B 1  164  ? 434.583 10.300  725.108 1.00 120.70 ? 164  ALA B O     1 
ATOM   3024  C  CB    . ALA B 1  164  ? 434.407 12.937  726.793 1.00 111.15 ? 164  ALA B CB    1 
ATOM   3025  N  N     . ILE B 1  165  ? 434.232 11.905  723.560 1.00 111.15 ? 165  ILE B N     1 
ATOM   3026  C  CA    . ILE B 1  165  ? 434.849 11.185  722.449 1.00 107.98 ? 165  ILE B CA    1 
ATOM   3027  C  C     . ILE B 1  165  ? 436.292 11.640  722.259 1.00 106.26 ? 165  ILE B C     1 
ATOM   3028  O  O     . ILE B 1  165  ? 436.541 12.855  722.181 1.00 106.03 ? 165  ILE B O     1 
ATOM   3029  C  CB    . ILE B 1  165  ? 434.093 11.381  721.128 1.00 104.88 ? 165  ILE B CB    1 
ATOM   3030  C  CG1   . ILE B 1  165  ? 432.600 11.217  721.253 1.00 103.65 ? 165  ILE B CG1   1 
ATOM   3031  C  CG2   . ILE B 1  165  ? 434.602 10.382  720.107 1.00 106.06 ? 165  ILE B CG2   1 
ATOM   3032  C  CD1   . ILE B 1  165  ? 431.921 11.439  719.925 1.00 93.46  ? 165  ILE B CD1   1 
ATOM   3033  N  N     . PRO B 1  166  ? 437.266 10.733  722.307 1.00 110.47 ? 166  PRO B N     1 
ATOM   3034  C  CA    . PRO B 1  166  ? 438.641 11.134  722.040 1.00 110.11 ? 166  PRO B CA    1 
ATOM   3035  C  C     . PRO B 1  166  ? 438.777 11.402  720.538 1.00 102.84 ? 166  PRO B C     1 
ATOM   3036  O  O     . PRO B 1  166  ? 438.236 10.666  719.704 1.00 97.84  ? 166  PRO B O     1 
ATOM   3037  C  CB    . PRO B 1  166  ? 439.460 9.911   722.465 1.00 113.65 ? 166  PRO B CB    1 
ATOM   3038  C  CG    . PRO B 1  166  ? 438.548 8.765   722.287 1.00 112.69 ? 166  PRO B CG    1 
ATOM   3039  C  CD    . PRO B 1  166  ? 437.158 9.289   722.573 1.00 113.28 ? 166  PRO B CD    1 
ATOM   3040  N  N     . VAL B 1  167  ? 439.516 12.458  720.205 1.00 99.16  ? 167  VAL B N     1 
ATOM   3041  C  CA    . VAL B 1  167  ? 439.671 12.941  718.844 1.00 99.12  ? 167  VAL B CA    1 
ATOM   3042  C  C     . VAL B 1  167  ? 441.136 12.783  718.467 1.00 103.68 ? 167  VAL B C     1 
ATOM   3043  O  O     . VAL B 1  167  ? 442.017 13.050  719.290 1.00 107.87 ? 167  VAL B O     1 
ATOM   3044  C  CB    . VAL B 1  167  ? 439.239 14.418  718.749 1.00 92.17  ? 167  VAL B CB    1 
ATOM   3045  C  CG1   . VAL B 1  167  ? 439.519 14.992  717.352 1.00 87.86  ? 167  VAL B CG1   1 
ATOM   3046  C  CG2   . VAL B 1  167  ? 437.793 14.596  719.232 1.00 91.89  ? 167  VAL B CG2   1 
ATOM   3047  N  N     . ASP B 1  168  ? 441.398 12.371  717.222 1.00 99.80  ? 168  ASP B N     1 
ATOM   3048  C  CA    . ASP B 1  168  ? 442.766 12.307  716.719 1.00 91.76  ? 168  ASP B CA    1 
ATOM   3049  C  C     . ASP B 1  168  ? 443.375 13.710  716.872 1.00 95.23  ? 168  ASP B C     1 
ATOM   3050  O  O     . ASP B 1  168  ? 442.755 14.700  716.479 1.00 106.36 ? 168  ASP B O     1 
ATOM   3051  C  CB    . ASP B 1  168  ? 442.730 11.835  715.252 1.00 82.75  ? 168  ASP B CB    1 
ATOM   3052  C  CG    . ASP B 1  168  ? 442.069 10.430  715.065 1.00 84.96  ? 168  ASP B CG    1 
ATOM   3053  O  OD1   . ASP B 1  168  ? 442.407 9.477   715.779 1.00 86.88  ? 168  ASP B OD1   1 
ATOM   3054  O  OD2   . ASP B 1  168  ? 441.169 10.249  714.204 1.00 88.38  ? 168  ASP B OD2   1 
ATOM   3055  N  N     . ALA B 1  169  ? 444.507 13.835  717.565 1.00 81.06  ? 169  ALA B N     1 
ATOM   3056  C  CA    . ALA B 1  169  ? 445.022 15.159  717.939 1.00 82.02  ? 169  ALA B CA    1 
ATOM   3057  C  C     . ALA B 1  169  ? 446.066 15.641  716.937 1.00 81.35  ? 169  ALA B C     1 
ATOM   3058  O  O     . ALA B 1  169  ? 447.215 15.206  716.994 1.00 85.96  ? 169  ALA B O     1 
ATOM   3059  C  CB    . ALA B 1  169  ? 445.634 15.105  719.336 1.00 88.17  ? 169  ALA B CB    1 
ATOM   3060  N  N     . VAL B 1  170  ? 445.750 16.645  716.130 1.00 85.74  ? 170  VAL B N     1 
ATOM   3061  C  CA    . VAL B 1  170  ? 446.738 17.162  715.178 1.00 81.33  ? 170  VAL B CA    1 
ATOM   3062  C  C     . VAL B 1  170  ? 447.348 18.426  715.770 1.00 83.24  ? 170  VAL B C     1 
ATOM   3063  O  O     . VAL B 1  170  ? 446.987 19.565  715.402 1.00 84.46  ? 170  VAL B O     1 
ATOM   3064  C  CB    . VAL B 1  170  ? 446.109 17.411  713.807 1.00 87.60  ? 170  VAL B CB    1 
ATOM   3065  C  CG1   . VAL B 1  170  ? 447.150 17.889  712.819 1.00 91.92  ? 170  VAL B CG1   1 
ATOM   3066  C  CG2   . VAL B 1  170  ? 445.438 16.135  713.301 1.00 79.51  ? 170  VAL B CG2   1 
ATOM   3067  N  N     . PHE B 1  171  ? 448.477 18.231  716.441 1.00 83.77  ? 171  PHE B N     1 
ATOM   3068  C  CA    . PHE B 1  171  ? 449.043 19.363  717.143 1.00 94.94  ? 171  PHE B CA    1 
ATOM   3069  C  C     . PHE B 1  171  ? 449.852 20.235  716.222 1.00 96.33  ? 171  PHE B C     1 
ATOM   3070  O  O     . PHE B 1  171  ? 449.573 21.436  716.092 1.00 93.32  ? 171  PHE B O     1 
ATOM   3071  C  CB    . PHE B 1  171  ? 449.986 18.886  718.248 1.00 104.08 ? 171  PHE B CB    1 
ATOM   3072  C  CG    . PHE B 1  171  ? 449.302 18.290  719.447 1.00 111.37 ? 171  PHE B CG    1 
ATOM   3073  C  CD1   . PHE B 1  171  ? 448.427 19.048  720.222 1.00 111.36 ? 171  PHE B CD1   1 
ATOM   3074  C  CD2   . PHE B 1  171  ? 449.585 16.985  719.845 1.00 109.80 ? 171  PHE B CD2   1 
ATOM   3075  C  CE1   . PHE B 1  171  ? 447.821 18.497  721.341 1.00 103.14 ? 171  PHE B CE1   1 
ATOM   3076  C  CE2   . PHE B 1  171  ? 448.972 16.443  720.959 1.00 102.34 ? 171  PHE B CE2   1 
ATOM   3077  C  CZ    . PHE B 1  171  ? 448.095 17.201  721.702 1.00 97.51  ? 171  PHE B CZ    1 
ATOM   3078  N  N     . SER B 1  172  ? 450.658 19.578  715.410 1.00 99.23  ? 172  SER B N     1 
ATOM   3079  C  CA    . SER B 1  172  ? 451.690 20.212  714.625 1.00 103.38 ? 172  SER B CA    1 
ATOM   3080  C  C     . SER B 1  172  ? 451.106 21.343  713.800 1.00 105.61 ? 172  SER B C     1 
ATOM   3081  O  O     . SER B 1  172  ? 450.164 21.124  713.031 1.00 105.37 ? 172  SER B O     1 
ATOM   3082  C  CB    . SER B 1  172  ? 452.375 19.196  713.722 1.00 104.96 ? 172  SER B CB    1 
ATOM   3083  O  OG    . SER B 1  172  ? 453.544 19.763  713.154 1.00 112.01 ? 172  SER B OG    1 
ATOM   3084  N  N     . PRO B 1  173  ? 451.589 22.564  713.986 1.00 99.36  ? 173  PRO B N     1 
ATOM   3085  C  CA    . PRO B 1  173  ? 451.152 23.659  713.126 1.00 103.75 ? 173  PRO B CA    1 
ATOM   3086  C  C     . PRO B 1  173  ? 451.643 23.484  711.693 1.00 112.39 ? 173  PRO B C     1 
ATOM   3087  O  O     . PRO B 1  173  ? 451.061 24.073  710.772 1.00 121.58 ? 173  PRO B O     1 
ATOM   3088  C  CB    . PRO B 1  173  ? 451.735 24.899  713.821 1.00 101.85 ? 173  PRO B CB    1 
ATOM   3089  C  CG    . PRO B 1  173  ? 452.933 24.391  714.554 1.00 99.43  ? 173  PRO B CG    1 
ATOM   3090  C  CD    . PRO B 1  173  ? 452.574 22.999  714.994 1.00 97.77  ? 173  PRO B CD    1 
ATOM   3091  N  N     . VAL B 1  174  ? 452.688 22.688  711.476 1.00 98.13  ? 174  VAL B N     1 
ATOM   3092  C  CA    . VAL B 1  174  ? 453.193 22.405  710.134 1.00 93.43  ? 174  VAL B CA    1 
ATOM   3093  C  C     . VAL B 1  174  ? 452.306 21.356  709.470 1.00 93.97  ? 174  VAL B C     1 
ATOM   3094  O  O     . VAL B 1  174  ? 452.163 20.236  709.982 1.00 94.29  ? 174  VAL B O     1 
ATOM   3095  C  CB    . VAL B 1  174  ? 454.647 21.922  710.186 1.00 90.85  ? 174  VAL B CB    1 
ATOM   3096  C  CG1   . VAL B 1  174  ? 455.081 21.448  708.813 1.00 94.47  ? 174  VAL B CG1   1 
ATOM   3097  C  CG2   . VAL B 1  174  ? 455.550 23.019  710.671 1.00 89.42  ? 174  VAL B CG2   1 
ATOM   3098  N  N     . ARG B 1  175  ? 451.668 21.744  708.349 1.00 93.51  ? 175  ARG B N     1 
ATOM   3099  C  CA    . ARG B 1  175  ? 450.810 20.845  707.578 1.00 93.49  ? 175  ARG B CA    1 
ATOM   3100  C  C     . ARG B 1  175  ? 451.610 19.981  706.604 1.00 94.07  ? 175  ARG B C     1 
ATOM   3101  O  O     . ARG B 1  175  ? 451.208 18.855  706.281 1.00 92.37  ? 175  ARG B O     1 
ATOM   3102  C  CB    . ARG B 1  175  ? 449.818 21.661  706.748 1.00 100.58 ? 175  ARG B CB    1 
ATOM   3103  C  CG    . ARG B 1  175  ? 448.865 22.595  707.453 1.00 109.22 ? 175  ARG B CG    1 
ATOM   3104  C  CD    . ARG B 1  175  ? 447.645 22.773  706.550 1.00 118.75 ? 175  ARG B CD    1 
ATOM   3105  N  NE    . ARG B 1  175  ? 446.537 23.468  707.189 1.00 131.78 ? 175  ARG B NE    1 
ATOM   3106  C  CZ    . ARG B 1  175  ? 445.358 23.686  706.608 1.00 138.04 ? 175  ARG B CZ    1 
ATOM   3107  N  NH1   . ARG B 1  175  ? 445.133 23.261  705.361 1.00 132.34 ? 175  ARG B NH1   1 
ATOM   3108  N  NH2   . ARG B 1  175  ? 444.409 24.342  707.279 1.00 144.37 ? 175  ARG B NH2   1 
ATOM   3109  N  N     . ARG B 1  176  ? 452.660 20.540  706.018 1.00 91.25  ? 176  ARG B N     1 
ATOM   3110  C  CA    . ARG B 1  176  ? 453.474 19.803  705.071 1.00 87.06  ? 176  ARG B CA    1 
ATOM   3111  C  C     . ARG B 1  176  ? 454.876 20.373  704.969 1.00 83.32  ? 176  ARG B C     1 
ATOM   3112  O  O     . ARG B 1  176  ? 455.104 21.579  705.148 1.00 79.22  ? 176  ARG B O     1 
ATOM   3113  C  CB    . ARG B 1  176  ? 452.820 19.689  703.698 1.00 88.66  ? 176  ARG B CB    1 
ATOM   3114  C  CG    . ARG B 1  176  ? 453.680 18.923  702.667 1.00 97.63  ? 176  ARG B CG    1 
ATOM   3115  C  CD    . ARG B 1  176  ? 452.852 18.173  701.679 1.00 101.94 ? 176  ARG B CD    1 
ATOM   3116  N  NE    . ARG B 1  176  ? 452.257 19.071  700.687 1.00 104.19 ? 176  ARG B NE    1 
ATOM   3117  C  CZ    . ARG B 1  176  ? 452.616 19.227  699.421 1.00 100.06 ? 176  ARG B CZ    1 
ATOM   3118  N  NH1   . ARG B 1  176  ? 453.633 18.546  698.899 1.00 102.01 ? 176  ARG B NH1   1 
ATOM   3119  N  NH2   . ARG B 1  176  ? 451.934 20.088  698.679 1.00 94.36  ? 176  ARG B NH2   1 
ATOM   3120  N  N     . VAL B 1  177  ? 455.808 19.466  704.693 1.00 86.24  ? 177  VAL B N     1 
ATOM   3121  C  CA    . VAL B 1  177  ? 457.171 19.802  704.326 1.00 85.66  ? 177  VAL B CA    1 
ATOM   3122  C  C     . VAL B 1  177  ? 457.532 18.960  703.130 1.00 91.00  ? 177  VAL B C     1 
ATOM   3123  O  O     . VAL B 1  177  ? 457.405 17.728  703.162 1.00 93.30  ? 177  VAL B O     1 
ATOM   3124  C  CB    . VAL B 1  177  ? 458.186 19.556  705.442 1.00 87.01  ? 177  VAL B CB    1 
ATOM   3125  C  CG1   . VAL B 1  177  ? 459.574 19.825  704.921 1.00 83.37  ? 177  VAL B CG1   1 
ATOM   3126  C  CG2   . VAL B 1  177  ? 457.919 20.520  706.560 1.00 91.28  ? 177  VAL B CG2   1 
ATOM   3127  N  N     . ALA B 1  178  ? 457.919 19.643  702.064 1.00 93.86  ? 178  ALA B N     1 
ATOM   3128  C  CA    . ALA B 1  178  ? 458.443 19.089  700.835 1.00 95.14  ? 178  ALA B CA    1 
ATOM   3129  C  C     . ALA B 1  178  ? 459.769 19.805  700.638 1.00 92.70  ? 178  ALA B C     1 
ATOM   3130  O  O     . ALA B 1  178  ? 459.866 21.019  700.868 1.00 87.52  ? 178  ALA B O     1 
ATOM   3131  C  CB    . ALA B 1  178  ? 457.489 19.285  699.680 1.00 94.56  ? 178  ALA B CB    1 
ATOM   3132  N  N     . PHE B 1  179  ? 460.810 19.057  700.296 1.00 99.35  ? 179  PHE B N     1 
ATOM   3133  C  CA    . PHE B 1  179  ? 462.101 19.679  700.011 1.00 105.26 ? 179  PHE B CA    1 
ATOM   3134  C  C     . PHE B 1  179  ? 462.718 19.117  698.739 1.00 113.10 ? 179  PHE B C     1 
ATOM   3135  O  O     . PHE B 1  179  ? 462.441 17.977  698.350 1.00 114.51 ? 179  PHE B O     1 
ATOM   3136  C  CB    . PHE B 1  179  ? 463.018 19.612  701.235 1.00 99.62  ? 179  PHE B CB    1 
ATOM   3137  C  CG    . PHE B 1  179  ? 463.870 18.376  701.380 1.00 96.21  ? 179  PHE B CG    1 
ATOM   3138  C  CD1   . PHE B 1  179  ? 465.167 18.368  700.935 1.00 96.07  ? 179  PHE B CD1   1 
ATOM   3139  C  CD2   . PHE B 1  179  ? 463.396 17.253  702.036 1.00 96.49  ? 179  PHE B CD2   1 
ATOM   3140  C  CE1   . PHE B 1  179  ? 465.956 17.263  701.131 1.00 98.19  ? 179  PHE B CE1   1 
ATOM   3141  C  CE2   . PHE B 1  179  ? 464.180 16.144  702.226 1.00 93.62  ? 179  PHE B CE2   1 
ATOM   3142  C  CZ    . PHE B 1  179  ? 465.454 16.147  701.774 1.00 96.69  ? 179  PHE B CZ    1 
ATOM   3143  N  N     . GLN B 1  180  ? 463.444 19.972  698.022 1.00 118.27 ? 180  GLN B N     1 
ATOM   3144  C  CA    . GLN B 1  180  ? 464.050 19.569  696.774 1.00 122.98 ? 180  GLN B CA    1 
ATOM   3145  C  C     . GLN B 1  180  ? 465.478 20.066  696.774 1.00 120.53 ? 180  GLN B C     1 
ATOM   3146  O  O     . GLN B 1  180  ? 465.733 21.225  697.097 1.00 122.62 ? 180  GLN B O     1 
ATOM   3147  C  CB    . GLN B 1  180  ? 463.286 20.134  695.579 1.00 133.51 ? 180  GLN B CB    1 
ATOM   3148  C  CG    . GLN B 1  180  ? 463.680 19.499  694.269 1.00 139.48 ? 180  GLN B CG    1 
ATOM   3149  C  CD    . GLN B 1  180  ? 462.533 19.294  693.334 1.00 141.99 ? 180  GLN B CD    1 
ATOM   3150  O  OE1   . GLN B 1  180  ? 461.402 19.759  693.614 1.00 146.52 ? 180  GLN B OE1   1 
ATOM   3151  N  NE2   . GLN B 1  180  ? 462.737 18.596  692.237 1.00 140.68 ? 180  GLN B NE2   1 
ATOM   3152  N  N     . VAL B 1  181  ? 466.402 19.151  696.480 1.00 117.12 ? 181  VAL B N     1 
ATOM   3153  C  CA    . VAL B 1  181  ? 467.829 19.439  696.340 1.00 118.97 ? 181  VAL B CA    1 
ATOM   3154  C  C     . VAL B 1  181  ? 468.195 19.413  694.862 1.00 123.83 ? 181  VAL B C     1 
ATOM   3155  O  O     . VAL B 1  181  ? 467.867 18.453  694.152 1.00 130.51 ? 181  VAL B O     1 
ATOM   3156  C  CB    . VAL B 1  181  ? 468.672 18.401  697.096 1.00 116.83 ? 181  VAL B CB    1 
ATOM   3157  C  CG1   . VAL B 1  181  ? 470.145 18.763  697.034 1.00 115.99 ? 181  VAL B CG1   1 
ATOM   3158  C  CG2   . VAL B 1  181  ? 468.199 18.248  698.533 1.00 117.20 ? 181  VAL B CG2   1 
ATOM   3159  N  N     . GLU B 1  182  ? 468.963 20.395  694.410 1.00 121.08 ? 182  GLU B N     1 
ATOM   3160  C  CA    . GLU B 1  182  ? 469.388 20.311  693.026 1.00 120.44 ? 182  GLU B CA    1 
ATOM   3161  C  C     . GLU B 1  182  ? 470.857 20.671  692.889 1.00 123.28 ? 182  GLU B C     1 
ATOM   3162  O  O     . GLU B 1  182  ? 471.400 21.457  693.671 1.00 125.07 ? 182  GLU B O     1 
ATOM   3163  C  CB    . GLU B 1  182  ? 468.558 21.273  692.168 1.00 123.94 ? 182  GLU B CB    1 
ATOM   3164  C  CG    . GLU B 1  182  ? 467.049 21.203  692.409 1.00 127.10 ? 182  GLU B CG    1 
ATOM   3165  C  CD    . GLU B 1  182  ? 466.300 22.398  691.841 1.00 131.51 ? 182  GLU B CD    1 
ATOM   3166  O  OE1   . GLU B 1  182  ? 465.879 22.350  690.667 1.00 134.42 ? 182  GLU B OE1   1 
ATOM   3167  O  OE2   . GLU B 1  182  ? 466.143 23.395  692.574 1.00 133.04 ? 182  GLU B OE2   1 
ATOM   3168  N  N     . ASP B 1  183  ? 471.495 20.080  691.879 1.00 123.19 ? 183  ASP B N     1 
ATOM   3169  C  CA    . ASP B 1  183  ? 472.911 20.331  691.670 1.00 119.66 ? 183  ASP B CA    1 
ATOM   3170  C  C     . ASP B 1  183  ? 473.138 21.776  691.240 1.00 110.08 ? 183  ASP B C     1 
ATOM   3171  O  O     . ASP B 1  183  ? 472.333 22.366  690.513 1.00 100.72 ? 183  ASP B O     1 
ATOM   3172  C  CB    . ASP B 1  183  ? 473.503 19.387  690.630 1.00 126.54 ? 183  ASP B CB    1 
ATOM   3173  C  CG    . ASP B 1  183  ? 473.929 18.059  691.232 1.00 133.07 ? 183  ASP B CG    1 
ATOM   3174  O  OD1   . ASP B 1  183  ? 473.843 17.050  690.494 1.00 133.50 ? 183  ASP B OD1   1 
ATOM   3175  O  OD2   . ASP B 1  183  ? 474.213 18.005  692.470 1.00 134.36 ? 183  ASP B OD2   1 
ATOM   3176  N  N     . THR B 1  184  ? 474.266 22.337  691.658 1.00 108.51 ? 184  THR B N     1 
ATOM   3177  C  CA    . THR B 1  184  ? 474.574 23.705  691.292 1.00 112.16 ? 184  THR B CA    1 
ATOM   3178  C  C     . THR B 1  184  ? 476.084 23.871  691.269 1.00 123.68 ? 184  THR B C     1 
ATOM   3179  O  O     . THR B 1  184  ? 476.820 23.086  691.872 1.00 127.41 ? 184  THR B O     1 
ATOM   3180  C  CB    . THR B 1  184  ? 473.957 24.700  692.238 1.00 105.41 ? 184  THR B CB    1 
ATOM   3181  O  OG1   . THR B 1  184  ? 473.922 25.967  691.584 1.00 105.92 ? 184  THR B OG1   1 
ATOM   3182  C  CG2   . THR B 1  184  ? 474.819 24.802  693.496 1.00 105.51 ? 184  THR B CG2   1 
ATOM   3183  N  N     . ARG B 1  185  ? 476.545 24.918  690.576 1.00 136.65 ? 185  ARG B N     1 
ATOM   3184  C  CA    . ARG B 1  185  ? 477.976 25.125  690.373 1.00 141.29 ? 185  ARG B CA    1 
ATOM   3185  C  C     . ARG B 1  185  ? 478.400 26.553  690.696 1.00 139.53 ? 185  ARG B C     1 
ATOM   3186  O  O     . ARG B 1  185  ? 477.703 27.520  690.357 1.00 136.15 ? 185  ARG B O     1 
ATOM   3187  C  CB    . ARG B 1  185  ? 478.484 24.828  688.955 1.00 148.63 ? 185  ARG B CB    1 
ATOM   3188  C  CG    . ARG B 1  185  ? 477.958 25.751  687.892 1.00 154.21 ? 185  ARG B CG    1 
ATOM   3189  C  CD    . ARG B 1  185  ? 478.609 25.464  686.545 1.00 161.59 ? 185  ARG B CD    1 
ATOM   3190  N  NE    . ARG B 1  185  ? 478.480 26.629  685.675 1.00 163.04 ? 185  ARG B NE    1 
ATOM   3191  C  CZ    . ARG B 1  185  ? 479.385 27.603  685.602 1.00 165.36 ? 185  ARG B CZ    1 
ATOM   3192  N  NH1   . ARG B 1  185  ? 480.489 27.558  686.346 1.00 167.10 ? 185  ARG B NH1   1 
ATOM   3193  N  NH2   . ARG B 1  185  ? 479.174 28.630  684.794 1.00 165.80 ? 185  ARG B NH2   1 
ATOM   3194  N  N     . LEU B 1  186  ? 479.527 26.661  691.405 1.00 137.95 ? 186  LEU B N     1 
ATOM   3195  C  CA    . LEU B 1  186  ? 480.235 27.921  691.592 1.00 136.75 ? 186  LEU B CA    1 
ATOM   3196  C  C     . LEU B 1  186  ? 481.586 27.776  690.905 1.00 134.41 ? 186  LEU B C     1 
ATOM   3197  O  O     . LEU B 1  186  ? 482.480 27.060  691.390 1.00 132.30 ? 186  LEU B O     1 
ATOM   3198  C  CB    . LEU B 1  186  ? 480.413 28.298  693.059 1.00 132.56 ? 186  LEU B CB    1 
ATOM   3199  C  CG    . LEU B 1  186  ? 480.559 29.809  693.294 1.00 131.60 ? 186  LEU B CG    1 
ATOM   3200  C  CD1   . LEU B 1  186  ? 482.051 30.229  693.138 1.00 135.47 ? 186  LEU B CD1   1 
ATOM   3201  C  CD2   . LEU B 1  186  ? 479.661 30.620  692.358 1.00 127.41 ? 186  LEU B CD2   1 
ATOM   3202  N  N     . GLY B 1  187  ? 481.721 28.482  689.786 1.00 150.78 ? 187  GLY B N     1 
ATOM   3203  C  CA    . GLY B 1  187  ? 482.931 28.434  689.000 1.00 165.07 ? 187  GLY B CA    1 
ATOM   3204  C  C     . GLY B 1  187  ? 483.180 27.030  688.507 1.00 169.82 ? 187  GLY B C     1 
ATOM   3205  O  O     . GLY B 1  187  ? 482.362 26.436  687.796 1.00 161.43 ? 187  GLY B O     1 
ATOM   3206  N  N     . GLN B 1  188  ? 484.349 26.512  688.893 1.00 191.54 ? 188  GLN B N     1 
ATOM   3207  C  CA    . GLN B 1  188  ? 484.826 25.189  688.509 1.00 197.24 ? 188  GLN B CA    1 
ATOM   3208  C  C     . GLN B 1  188  ? 484.200 24.033  689.289 1.00 192.04 ? 188  GLN B C     1 
ATOM   3209  O  O     . GLN B 1  188  ? 484.091 22.934  688.732 1.00 195.69 ? 188  GLN B O     1 
ATOM   3210  C  CB    . GLN B 1  188  ? 486.340 25.166  688.711 1.00 205.07 ? 188  GLN B CB    1 
ATOM   3211  C  CG    . GLN B 1  188  ? 486.703 25.412  690.189 1.00 213.36 ? 188  GLN B CG    1 
ATOM   3212  C  CD    . GLN B 1  188  ? 486.652 26.886  690.604 1.00 219.51 ? 188  GLN B CD    1 
ATOM   3213  O  OE1   . GLN B 1  188  ? 486.836 27.781  689.774 1.00 223.11 ? 188  GLN B OE1   1 
ATOM   3214  N  NE2   . GLN B 1  188  ? 486.348 27.137  691.885 1.00 220.01 ? 188  GLN B NE2   1 
ATOM   3215  N  N     . ARG B 1  189  ? 483.790 24.223  690.554 1.00 183.66 ? 189  ARG B N     1 
ATOM   3216  C  CA    . ARG B 1  189  ? 483.217 23.102  691.300 1.00 173.09 ? 189  ARG B CA    1 
ATOM   3217  C  C     . ARG B 1  189  ? 481.762 22.967  690.877 1.00 171.15 ? 189  ARG B C     1 
ATOM   3218  O  O     . ARG B 1  189  ? 480.981 23.908  691.043 1.00 167.61 ? 189  ARG B O     1 
ATOM   3219  C  CB    . ARG B 1  189  ? 483.382 23.236  692.815 1.00 157.35 ? 189  ARG B CB    1 
ATOM   3220  C  CG    . ARG B 1  189  ? 483.660 24.592  693.459 1.00 153.32 ? 189  ARG B CG    1 
ATOM   3221  C  CD    . ARG B 1  189  ? 483.810 24.340  695.010 1.00 150.98 ? 189  ARG B CD    1 
ATOM   3222  N  NE    . ARG B 1  189  ? 484.834 25.133  695.726 1.00 149.69 ? 189  ARG B NE    1 
ATOM   3223  C  CZ    . ARG B 1  189  ? 485.447 24.774  696.867 1.00 142.03 ? 189  ARG B CZ    1 
ATOM   3224  N  NH1   . ARG B 1  189  ? 486.349 25.585  697.430 1.00 141.54 ? 189  ARG B NH1   1 
ATOM   3225  N  NH2   . ARG B 1  189  ? 485.197 23.597  697.434 1.00 135.76 ? 189  ARG B NH2   1 
ATOM   3226  N  N     . THR B 1  190  ? 481.415 21.839  690.261 1.00 183.43 ? 190  THR B N     1 
ATOM   3227  C  CA    . THR B 1  190  ? 480.045 21.582  689.830 1.00 186.12 ? 190  THR B CA    1 
ATOM   3228  C  C     . THR B 1  190  ? 479.185 20.662  690.694 1.00 174.52 ? 190  THR B C     1 
ATOM   3229  O  O     . THR B 1  190  ? 478.018 20.439  690.347 1.00 172.23 ? 190  THR B O     1 
ATOM   3230  C  CB    . THR B 1  190  ? 480.120 20.965  688.447 1.00 193.23 ? 190  THR B CB    1 
ATOM   3231  O  OG1   . THR B 1  190  ? 480.714 19.667  688.577 1.00 199.64 ? 190  THR B OG1   1 
ATOM   3232  C  CG2   . THR B 1  190  ? 481.019 21.806  687.573 1.00 201.17 ? 190  THR B CG2   1 
ATOM   3233  N  N     . ASP B 1  191  ? 479.705 20.069  691.749 1.00 155.37 ? 191  ASP B N     1 
ATOM   3234  C  CA    . ASP B 1  191  ? 478.906 19.046  692.403 1.00 140.50 ? 191  ASP B CA    1 
ATOM   3235  C  C     . ASP B 1  191  ? 478.050 19.601  693.543 1.00 129.73 ? 191  ASP B C     1 
ATOM   3236  O  O     . ASP B 1  191  ? 477.429 18.817  694.276 1.00 127.44 ? 191  ASP B O     1 
ATOM   3237  C  CB    . ASP B 1  191  ? 479.731 17.831  692.805 1.00 143.37 ? 191  ASP B CB    1 
ATOM   3238  C  CG    . ASP B 1  191  ? 478.961 16.525  692.505 1.00 144.40 ? 191  ASP B CG    1 
ATOM   3239  O  OD1   . ASP B 1  191  ? 477.720 16.607  692.349 1.00 145.45 ? 191  ASP B OD1   1 
ATOM   3240  O  OD2   . ASP B 1  191  ? 479.567 15.438  692.373 1.00 143.74 ? 191  ASP B OD2   1 
ATOM   3241  N  N     . LEU B 1  192  ? 477.989 20.924  693.700 1.00 120.07 ? 192  LEU B N     1 
ATOM   3242  C  CA    . LEU B 1  192  ? 477.385 21.540  694.877 1.00 112.49 ? 192  LEU B CA    1 
ATOM   3243  C  C     . LEU B 1  192  ? 475.866 21.359  694.922 1.00 108.06 ? 192  LEU B C     1 
ATOM   3244  O  O     . LEU B 1  192  ? 475.199 20.969  693.961 1.00 96.08  ? 192  LEU B O     1 
ATOM   3245  C  CB    . LEU B 1  192  ? 477.682 23.041  694.932 1.00 104.56 ? 192  LEU B CB    1 
ATOM   3246  C  CG    . LEU B 1  192  ? 479.176 23.357  694.877 1.00 103.58 ? 192  LEU B CG    1 
ATOM   3247  C  CD1   . LEU B 1  192  ? 479.447 24.853  695.044 1.00 104.99 ? 192  LEU B CD1   1 
ATOM   3248  C  CD2   . LEU B 1  192  ? 480.031 22.477  695.787 1.00 104.08 ? 192  LEU B CD2   1 
ATOM   3249  N  N     . ASP B 1  193  ? 475.345 21.560  696.115 1.00 106.43 ? 193  ASP B N     1 
ATOM   3250  C  CA    . ASP B 1  193  ? 473.939 21.381  696.398 1.00 102.14 ? 193  ASP B CA    1 
ATOM   3251  C  C     . ASP B 1  193  ? 473.226 22.729  696.520 1.00 96.69  ? 193  ASP B C     1 
ATOM   3252  O  O     . ASP B 1  193  ? 473.795 23.717  696.992 1.00 93.63  ? 193  ASP B O     1 
ATOM   3253  C  CB    . ASP B 1  193  ? 473.831 20.598  697.709 1.00 106.93 ? 193  ASP B CB    1 
ATOM   3254  C  CG    . ASP B 1  193  ? 473.907 19.094  697.505 1.00 110.42 ? 193  ASP B CG    1 
ATOM   3255  O  OD1   . ASP B 1  193  ? 474.791 18.465  698.125 1.00 112.19 ? 193  ASP B OD1   1 
ATOM   3256  O  OD2   . ASP B 1  193  ? 473.152 18.547  696.689 1.00 113.36 ? 193  ASP B OD2   1 
ATOM   3257  N  N     . LYS B 1  194  ? 471.983 22.772  696.062 1.00 98.52  ? 194  LYS B N     1 
ATOM   3258  C  CA    . LYS B 1  194  ? 471.114 23.925  696.253 1.00 100.31 ? 194  LYS B CA    1 
ATOM   3259  C  C     . LYS B 1  194  ? 469.857 23.391  696.928 1.00 98.94  ? 194  LYS B C     1 
ATOM   3260  O  O     . LYS B 1  194  ? 469.173 22.517  696.379 1.00 97.70  ? 194  LYS B O     1 
ATOM   3261  C  CB    . LYS B 1  194  ? 470.783 24.602  694.923 1.00 101.27 ? 194  LYS B CB    1 
ATOM   3262  C  CG    . LYS B 1  194  ? 469.689 25.637  695.037 1.00 100.80 ? 194  LYS B CG    1 
ATOM   3263  C  CD    . LYS B 1  194  ? 469.310 26.173  693.683 1.00 102.16 ? 194  LYS B CD    1 
ATOM   3264  C  CE    . LYS B 1  194  ? 468.087 27.062  693.788 1.00 100.67 ? 194  LYS B CE    1 
ATOM   3265  N  NZ    . LYS B 1  194  ? 467.000 26.533  692.905 1.00 100.52 ? 194  LYS B NZ    1 
ATOM   3266  N  N     . LEU B 1  195  ? 469.581 23.889  698.131 1.00 100.07 ? 195  LEU B N     1 
ATOM   3267  C  CA    . LEU B 1  195  ? 468.489 23.394  698.957 1.00 101.74 ? 195  LEU B CA    1 
ATOM   3268  C  C     . LEU B 1  195  ? 467.264 24.313  698.918 1.00 103.77 ? 195  LEU B C     1 
ATOM   3269  O  O     . LEU B 1  195  ? 467.372 25.523  699.169 1.00 102.63 ? 195  LEU B O     1 
ATOM   3270  C  CB    . LEU B 1  195  ? 468.982 23.195  700.390 1.00 100.13 ? 195  LEU B CB    1 
ATOM   3271  C  CG    . LEU B 1  195  ? 467.914 22.790  701.386 1.00 92.85  ? 195  LEU B CG    1 
ATOM   3272  C  CD1   . LEU B 1  195  ? 467.220 21.546  700.857 1.00 92.72  ? 195  LEU B CD1   1 
ATOM   3273  C  CD2   . LEU B 1  195  ? 468.595 22.504  702.679 1.00 92.04  ? 195  LEU B CD2   1 
ATOM   3274  N  N     . THR B 1  196  ? 466.112 23.733  698.577 1.00 102.88 ? 196  THR B N     1 
ATOM   3275  C  CA    . THR B 1  196  ? 464.824 24.413  698.546 1.00 102.99 ? 196  THR B CA    1 
ATOM   3276  C  C     . THR B 1  196  ? 463.872 23.723  699.516 1.00 104.11 ? 196  THR B C     1 
ATOM   3277  O  O     . THR B 1  196  ? 463.635 22.514  699.405 1.00 104.94 ? 196  THR B O     1 
ATOM   3278  C  CB    . THR B 1  196  ? 464.239 24.470  697.137 1.00 106.98 ? 196  THR B CB    1 
ATOM   3279  O  OG1   . THR B 1  196  ? 464.966 25.442  696.375 1.00 112.66 ? 196  THR B OG1   1 
ATOM   3280  C  CG2   . THR B 1  196  ? 462.761 24.869  697.195 1.00 105.51 ? 196  THR B CG2   1 
ATOM   3281  N  N     . LEU B 1  197  ? 463.360 24.481  700.484 1.00 102.72 ? 197  LEU B N     1 
ATOM   3282  C  CA    . LEU B 1  197  ? 462.512 23.973  701.554 1.00 96.54  ? 197  LEU B CA    1 
ATOM   3283  C  C     . LEU B 1  197  ? 461.137 24.609  701.448 1.00 97.82  ? 197  LEU B C     1 
ATOM   3284  O  O     . LEU B 1  197  ? 461.037 25.839  701.337 1.00 102.13 ? 197  LEU B O     1 
ATOM   3285  C  CB    . LEU B 1  197  ? 463.108 24.321  702.905 1.00 94.57  ? 197  LEU B CB    1 
ATOM   3286  C  CG    . LEU B 1  197  ? 463.656 23.131  703.656 1.00 95.10  ? 197  LEU B CG    1 
ATOM   3287  C  CD1   . LEU B 1  197  ? 463.842 23.495  705.116 1.00 92.87  ? 197  LEU B CD1   1 
ATOM   3288  C  CD2   . LEU B 1  197  ? 462.672 22.010  703.492 1.00 97.00  ? 197  LEU B CD2   1 
ATOM   3289  N  N     . ARG B 1  198  ? 460.080 23.791  701.498 1.00 94.27  ? 198  ARG B N     1 
ATOM   3290  C  CA    . ARG B 1  198  ? 458.725 24.317  701.381 1.00 96.96  ? 198  ARG B CA    1 
ATOM   3291  C  C     . ARG B 1  198  ? 457.964 23.934  702.642 1.00 104.71 ? 198  ARG B C     1 
ATOM   3292  O  O     . ARG B 1  198  ? 457.835 22.741  702.948 1.00 111.56 ? 198  ARG B O     1 
ATOM   3293  C  CB    . ARG B 1  198  ? 458.024 23.693  700.153 1.00 97.34  ? 198  ARG B CB    1 
ATOM   3294  C  CG    . ARG B 1  198  ? 458.657 23.991  698.739 1.00 100.50 ? 198  ARG B CG    1 
ATOM   3295  C  CD    . ARG B 1  198  ? 457.772 23.746  697.432 1.00 97.73  ? 198  ARG B CD    1 
ATOM   3296  N  NE    . ARG B 1  198  ? 457.180 22.408  697.201 1.00 97.74  ? 198  ARG B NE    1 
ATOM   3297  C  CZ    . ARG B 1  198  ? 457.763 21.367  696.575 1.00 102.56 ? 198  ARG B CZ    1 
ATOM   3298  N  NH1   . ARG B 1  198  ? 457.085 20.212  696.447 1.00 102.16 ? 198  ARG B NH1   1 
ATOM   3299  N  NH2   . ARG B 1  198  ? 459.018 21.445  696.099 1.00 101.94 ? 198  ARG B NH2   1 
ATOM   3300  N  N     . ILE B 1  199  ? 457.428 24.941  703.351 1.00 104.55 ? 199  ILE B N     1 
ATOM   3301  C  CA    . ILE B 1  199  ? 456.723 24.739  704.621 1.00 97.68  ? 199  ILE B CA    1 
ATOM   3302  C  C     . ILE B 1  199  ? 455.315 25.319  704.551 1.00 94.15  ? 199  ILE B C     1 
ATOM   3303  O  O     . ILE B 1  199  ? 455.145 26.524  704.316 1.00 90.74  ? 199  ILE B O     1 
ATOM   3304  C  CB    . ILE B 1  199  ? 457.456 25.390  705.806 1.00 99.54  ? 199  ILE B CB    1 
ATOM   3305  C  CG1   . ILE B 1  199  ? 458.965 25.162  705.754 1.00 98.93  ? 199  ILE B CG1   1 
ATOM   3306  C  CG2   . ILE B 1  199  ? 456.840 24.940  707.122 1.00 105.29 ? 199  ILE B CG2   1 
ATOM   3307  C  CD1   . ILE B 1  199  ? 459.592 25.019  707.161 1.00 95.42  ? 199  ILE B CD1   1 
ATOM   3308  N  N     . TRP B 1  200  ? 454.333 24.514  704.936 1.00 97.26  ? 200  TRP B N     1 
ATOM   3309  C  CA    . TRP B 1  200  ? 452.941 24.936  705.010 1.00 106.78 ? 200  TRP B CA    1 
ATOM   3310  C  C     . TRP B 1  200  ? 452.511 24.858  706.467 1.00 119.11 ? 200  TRP B C     1 
ATOM   3311  O  O     . TRP B 1  200  ? 452.549 23.775  707.064 1.00 123.44 ? 200  TRP B O     1 
ATOM   3312  C  CB    . TRP B 1  200  ? 452.007 24.065  704.180 1.00 106.73 ? 200  TRP B CB    1 
ATOM   3313  C  CG    . TRP B 1  200  ? 452.076 24.159  702.696 1.00 108.46 ? 200  TRP B CG    1 
ATOM   3314  C  CD1   . TRP B 1  200  ? 451.289 24.934  701.887 1.00 108.23 ? 200  TRP B CD1   1 
ATOM   3315  C  CD2   . TRP B 1  200  ? 452.836 23.320  701.822 1.00 105.97 ? 200  TRP B CD2   1 
ATOM   3316  N  NE1   . TRP B 1  200  ? 451.583 24.687  700.575 1.00 104.19 ? 200  TRP B NE1   1 
ATOM   3317  C  CE2   . TRP B 1  200  ? 452.524 23.693  700.511 1.00 101.45 ? 200  TRP B CE2   1 
ATOM   3318  C  CE3   . TRP B 1  200  ? 453.786 22.325  702.023 1.00 107.65 ? 200  TRP B CE3   1 
ATOM   3319  C  CZ2   . TRP B 1  200  ? 453.119 23.100  699.418 1.00 100.83 ? 200  TRP B CZ2   1 
ATOM   3320  C  CZ3   . TRP B 1  200  ? 454.378 21.747  700.929 1.00 104.39 ? 200  TRP B CZ3   1 
ATOM   3321  C  CH2   . TRP B 1  200  ? 454.046 22.135  699.651 1.00 101.35 ? 200  TRP B CH2   1 
ATOM   3322  N  N     . THR B 1  201  ? 452.079 25.979  707.042 1.00 121.24 ? 201  THR B N     1 
ATOM   3323  C  CA    . THR B 1  201  ? 451.567 25.917  708.404 1.00 116.91 ? 201  THR B CA    1 
ATOM   3324  C  C     . THR B 1  201  ? 450.080 26.263  708.380 1.00 117.47 ? 201  THR B C     1 
ATOM   3325  O  O     . THR B 1  201  ? 449.497 26.532  707.317 1.00 118.96 ? 201  THR B O     1 
ATOM   3326  C  CB    . THR B 1  201  ? 452.319 26.868  709.343 1.00 116.81 ? 201  THR B CB    1 
ATOM   3327  O  OG1   . THR B 1  201  ? 451.861 28.214  709.154 1.00 119.13 ? 201  THR B OG1   1 
ATOM   3328  C  CG2   . THR B 1  201  ? 453.826 26.841  709.043 1.00 115.66 ? 201  THR B CG2   1 
ATOM   3329  N  N     . ASP B 1  202  ? 449.459 26.223  709.565 1.00 109.15 ? 202  ASP B N     1 
ATOM   3330  C  CA    . ASP B 1  202  ? 448.040 26.528  709.718 1.00 99.82  ? 202  ASP B CA    1 
ATOM   3331  C  C     . ASP B 1  202  ? 447.818 27.993  710.054 1.00 95.91  ? 202  ASP B C     1 
ATOM   3332  O  O     . ASP B 1  202  ? 446.673 28.402  710.242 1.00 94.10  ? 202  ASP B O     1 
ATOM   3333  C  CB    . ASP B 1  202  ? 447.374 25.648  710.804 1.00 99.90  ? 202  ASP B CB    1 
ATOM   3334  C  CG    . ASP B 1  202  ? 448.048 25.755  712.214 1.00 102.48 ? 202  ASP B CG    1 
ATOM   3335  O  OD1   . ASP B 1  202  ? 448.712 26.774  712.516 1.00 104.01 ? 202  ASP B OD1   1 
ATOM   3336  O  OD2   . ASP B 1  202  ? 447.903 24.803  713.033 1.00 102.18 ? 202  ASP B OD2   1 
ATOM   3337  N  N     . GLY B 1  203  ? 448.881 28.795  710.100 1.00 94.48  ? 203  GLY B N     1 
ATOM   3338  C  CA    . GLY B 1  203  ? 448.780 30.214  710.322 1.00 96.76  ? 203  GLY B CA    1 
ATOM   3339  C  C     . GLY B 1  203  ? 449.096 30.623  711.737 1.00 95.79  ? 203  GLY B C     1 
ATOM   3340  O  O     . GLY B 1  203  ? 449.381 31.801  711.973 1.00 96.87  ? 203  GLY B O     1 
ATOM   3341  N  N     . SER B 1  204  ? 448.993 29.688  712.688 1.00 98.89  ? 204  SER B N     1 
ATOM   3342  C  CA    . SER B 1  204  ? 449.335 29.988  714.076 1.00 101.50 ? 204  SER B CA    1 
ATOM   3343  C  C     . SER B 1  204  ? 450.835 30.244  714.216 1.00 105.16 ? 204  SER B C     1 
ATOM   3344  O  O     . SER B 1  204  ? 451.266 31.305  714.686 1.00 107.92 ? 204  SER B O     1 
ATOM   3345  C  CB    . SER B 1  204  ? 448.880 28.838  714.988 1.00 99.21  ? 204  SER B CB    1 
ATOM   3346  O  OG    . SER B 1  204  ? 449.508 27.602  714.667 1.00 95.37  ? 204  SER B OG    1 
ATOM   3347  N  N     . VAL B 1  205  ? 451.646 29.299  713.772 1.00 104.76 ? 205  VAL B N     1 
ATOM   3348  C  CA    . VAL B 1  205  ? 453.078 29.509  713.644 1.00 102.65 ? 205  VAL B CA    1 
ATOM   3349  C  C     . VAL B 1  205  ? 453.344 29.861  712.186 1.00 106.12 ? 205  VAL B C     1 
ATOM   3350  O  O     . VAL B 1  205  ? 452.779 29.253  711.267 1.00 103.85 ? 205  VAL B O     1 
ATOM   3351  C  CB    . VAL B 1  205  ? 453.891 28.287  714.112 1.00 97.76  ? 205  VAL B CB    1 
ATOM   3352  C  CG1   . VAL B 1  205  ? 455.340 28.607  714.034 1.00 99.79  ? 205  VAL B CG1   1 
ATOM   3353  C  CG2   . VAL B 1  205  ? 453.555 27.973  715.545 1.00 101.40 ? 205  VAL B CG2   1 
ATOM   3354  N  N     . THR B 1  206  ? 454.177 30.843  711.980 1.00 107.36 ? 206  THR B N     1 
ATOM   3355  C  CA    . THR B 1  206  ? 454.567 31.274  710.657 1.00 103.62 ? 206  THR B CA    1 
ATOM   3356  C  C     . THR B 1  206  ? 455.606 30.313  710.074 1.00 104.96 ? 206  THR B C     1 
ATOM   3357  O  O     . THR B 1  206  ? 456.360 29.690  710.828 1.00 107.62 ? 206  THR B O     1 
ATOM   3358  C  CB    . THR B 1  206  ? 455.105 32.699  710.758 1.00 106.90 ? 206  THR B CB    1 
ATOM   3359  O  OG1   . THR B 1  206  ? 454.306 33.558  709.940 1.00 110.53 ? 206  THR B OG1   1 
ATOM   3360  C  CG2   . THR B 1  206  ? 456.574 32.816  710.389 1.00 107.14 ? 206  THR B CG2   1 
ATOM   3361  N  N     . PRO B 1  207  ? 455.634 30.126  708.735 1.00 103.78 ? 207  PRO B N     1 
ATOM   3362  C  CA    . PRO B 1  207  ? 456.596 29.164  708.165 1.00 96.78  ? 207  PRO B CA    1 
ATOM   3363  C  C     . PRO B 1  207  ? 458.034 29.441  708.561 1.00 98.20  ? 207  PRO B C     1 
ATOM   3364  O  O     . PRO B 1  207  ? 458.737 28.510  708.977 1.00 98.96  ? 207  PRO B O     1 
ATOM   3365  C  CB    . PRO B 1  207  ? 456.391 29.329  706.656 1.00 93.47  ? 207  PRO B CB    1 
ATOM   3366  C  CG    . PRO B 1  207  ? 455.013 29.772  706.511 1.00 93.22  ? 207  PRO B CG    1 
ATOM   3367  C  CD    . PRO B 1  207  ? 454.779 30.700  707.676 1.00 99.80  ? 207  PRO B CD    1 
ATOM   3368  N  N     . LEU B 1  208  ? 458.482 30.703  708.485 1.00 93.77  ? 208  LEU B N     1 
ATOM   3369  C  CA    . LEU B 1  208  ? 459.833 31.027  708.936 1.00 96.99  ? 208  LEU B CA    1 
ATOM   3370  C  C     . LEU B 1  208  ? 460.021 30.728  710.415 1.00 95.66  ? 208  LEU B C     1 
ATOM   3371  O  O     . LEU B 1  208  ? 461.021 30.112  710.810 1.00 97.41  ? 208  LEU B O     1 
ATOM   3372  C  CB    . LEU B 1  208  ? 460.135 32.506  708.683 1.00 93.06  ? 208  LEU B CB    1 
ATOM   3373  C  CG    . LEU B 1  208  ? 461.513 32.958  709.189 1.00 90.01  ? 208  LEU B CG    1 
ATOM   3374  C  CD1   . LEU B 1  208  ? 462.623 31.982  708.793 1.00 89.52  ? 208  LEU B CD1   1 
ATOM   3375  C  CD2   . LEU B 1  208  ? 461.844 34.373  708.751 1.00 95.90  ? 208  LEU B CD2   1 
ATOM   3376  N  N     . GLU B 1  209  ? 459.008 31.033  711.223 1.00 101.44 ? 209  GLU B N     1 
ATOM   3377  C  CA    . GLU B 1  209  ? 459.081 30.724  712.640 1.00 104.50 ? 209  GLU B CA    1 
ATOM   3378  C  C     . GLU B 1  209  ? 459.271 29.229  712.833 1.00 108.31 ? 209  GLU B C     1 
ATOM   3379  O  O     . GLU B 1  209  ? 460.173 28.796  713.562 1.00 114.67 ? 209  GLU B O     1 
ATOM   3380  C  CB    . GLU B 1  209  ? 457.841 31.245  713.364 1.00 103.18 ? 209  GLU B CB    1 
ATOM   3381  C  CG    . GLU B 1  209  ? 457.864 32.750  713.601 1.00 110.61 ? 209  GLU B CG    1 
ATOM   3382  C  CD    . GLU B 1  209  ? 456.500 33.315  714.027 1.00 116.98 ? 209  GLU B CD    1 
ATOM   3383  O  OE1   . GLU B 1  209  ? 456.339 34.565  714.032 1.00 116.79 ? 209  GLU B OE1   1 
ATOM   3384  O  OE2   . GLU B 1  209  ? 455.588 32.510  714.351 1.00 118.20 ? 209  GLU B OE2   1 
ATOM   3385  N  N     . ALA B 1  210  ? 458.429 28.429  712.181 1.00 99.43  ? 210  ALA B N     1 
ATOM   3386  C  CA    . ALA B 1  210  ? 458.534 26.982  712.289 1.00 96.18  ? 210  ALA B CA    1 
ATOM   3387  C  C     . ALA B 1  210  ? 459.934 26.478  711.957 1.00 100.18 ? 210  ALA B C     1 
ATOM   3388  O  O     . ALA B 1  210  ? 460.505 25.666  712.696 1.00 106.05 ? 210  ALA B O     1 
ATOM   3389  C  CB    . ALA B 1  210  ? 457.508 26.338  711.363 1.00 92.17  ? 210  ALA B CB    1 
ATOM   3390  N  N     . LEU B 1  211  ? 460.509 26.951  710.850 1.00 98.64  ? 211  LEU B N     1 
ATOM   3391  C  CA    . LEU B 1  211  ? 461.869 26.549  710.483 1.00 97.90  ? 211  LEU B CA    1 
ATOM   3392  C  C     . LEU B 1  211  ? 462.877 26.880  711.577 1.00 94.65  ? 211  LEU B C     1 
ATOM   3393  O  O     . LEU B 1  211  ? 463.631 26.008  712.027 1.00 95.40  ? 211  LEU B O     1 
ATOM   3394  C  CB    . LEU B 1  211  ? 462.288 27.163  709.142 1.00 94.31  ? 211  LEU B CB    1 
ATOM   3395  C  CG    . LEU B 1  211  ? 463.743 26.896  708.711 1.00 91.43  ? 211  LEU B CG    1 
ATOM   3396  C  CD1   . LEU B 1  211  ? 464.101 25.404  708.614 1.00 85.83  ? 211  LEU B CD1   1 
ATOM   3397  C  CD2   . LEU B 1  211  ? 464.018 27.597  707.376 1.00 92.30  ? 211  LEU B CD2   1 
ATOM   3398  N  N     . ASN B 1  212  ? 462.901 28.137  712.022 1.00 95.05  ? 212  ASN B N     1 
ATOM   3399  C  CA    . ASN B 1  212  ? 463.847 28.517  713.060 1.00 100.64 ? 212  ASN B CA    1 
ATOM   3400  C  C     . ASN B 1  212  ? 463.722 27.624  714.273 1.00 102.71 ? 212  ASN B C     1 
ATOM   3401  O  O     . ASN B 1  212  ? 464.735 27.145  714.802 1.00 102.46 ? 212  ASN B O     1 
ATOM   3402  C  CB    . ASN B 1  212  ? 463.611 29.961  713.478 1.00 107.02 ? 212  ASN B CB    1 
ATOM   3403  C  CG    . ASN B 1  212  ? 464.010 30.923  712.418 1.00 114.71 ? 212  ASN B CG    1 
ATOM   3404  O  OD1   . ASN B 1  212  ? 463.210 31.753  711.999 1.00 118.51 ? 212  ASN B OD1   1 
ATOM   3405  N  ND2   . ASN B 1  212  ? 465.252 30.807  711.942 1.00 116.79 ? 212  ASN B ND2   1 
ATOM   3406  N  N     . GLN B 1  213  ? 462.492 27.278  714.647 1.00 100.17 ? 213  GLN B N     1 
ATOM   3407  C  CA    . GLN B 1  213  ? 462.332 26.367  715.769 1.00 103.98 ? 213  GLN B CA    1 
ATOM   3408  C  C     . GLN B 1  213  ? 462.971 25.024  715.458 1.00 99.80  ? 213  GLN B C     1 
ATOM   3409  O  O     . GLN B 1  213  ? 463.750 24.497  716.261 1.00 103.34 ? 213  GLN B O     1 
ATOM   3410  C  CB    . GLN B 1  213  ? 460.845 26.246  716.118 1.00 101.95 ? 213  GLN B CB    1 
ATOM   3411  C  CG    . GLN B 1  213  ? 460.278 27.547  716.736 1.00 99.50  ? 213  GLN B CG    1 
ATOM   3412  C  CD    . GLN B 1  213  ? 458.815 27.439  717.154 1.00 92.50  ? 213  GLN B CD    1 
ATOM   3413  O  OE1   . GLN B 1  213  ? 458.354 26.387  717.594 1.00 89.25  ? 213  GLN B OE1   1 
ATOM   3414  N  NE2   . GLN B 1  213  ? 458.089 28.546  717.045 1.00 90.59  ? 213  GLN B NE2   1 
ATOM   3415  N  N     . ALA B 1  214  ? 462.788 24.538  714.243 1.00 100.64 ? 214  ALA B N     1 
ATOM   3416  C  CA    . ALA B 1  214  ? 463.377 23.258  713.897 1.00 101.11 ? 214  ALA B CA    1 
ATOM   3417  C  C     . ALA B 1  214  ? 464.893 23.353  713.969 1.00 105.32 ? 214  ALA B C     1 
ATOM   3418  O  O     . ALA B 1  214  ? 465.556 22.503  714.575 1.00 104.08 ? 214  ALA B O     1 
ATOM   3419  C  CB    . ALA B 1  214  ? 462.901 22.826  712.511 1.00 101.82 ? 214  ALA B CB    1 
ATOM   3420  N  N     . VAL B 1  215  ? 465.451 24.392  713.345 1.00 104.63 ? 215  VAL B N     1 
ATOM   3421  C  CA    . VAL B 1  215  ? 466.886 24.633  713.391 1.00 106.50 ? 215  VAL B CA    1 
ATOM   3422  C  C     . VAL B 1  215  ? 467.383 24.827  714.817 1.00 109.05 ? 215  VAL B C     1 
ATOM   3423  O  O     . VAL B 1  215  ? 468.438 24.301  715.196 1.00 110.48 ? 215  VAL B O     1 
ATOM   3424  C  CB    . VAL B 1  215  ? 467.192 25.874  712.542 1.00 105.32 ? 215  VAL B CB    1 
ATOM   3425  C  CG1   . VAL B 1  215  ? 468.645 26.297  712.691 1.00 107.29 ? 215  VAL B CG1   1 
ATOM   3426  C  CG2   . VAL B 1  215  ? 466.823 25.597  711.108 1.00 105.80 ? 215  VAL B CG2   1 
ATOM   3427  N  N     . GLU B 1  216  ? 466.626 25.558  715.635 1.00 112.29 ? 216  GLU B N     1 
ATOM   3428  C  CA    . GLU B 1  216  ? 467.013 25.764  717.030 1.00 115.96 ? 216  GLU B CA    1 
ATOM   3429  C  C     . GLU B 1  216  ? 467.116 24.436  717.777 1.00 117.38 ? 216  GLU B C     1 
ATOM   3430  O  O     . GLU B 1  216  ? 468.118 24.155  718.447 1.00 120.53 ? 216  GLU B O     1 
ATOM   3431  C  CB    . GLU B 1  216  ? 466.044 26.729  717.715 1.00 120.40 ? 216  GLU B CB    1 
ATOM   3432  C  CG    . GLU B 1  216  ? 466.224 26.899  719.223 1.00 125.09 ? 216  GLU B CG    1 
ATOM   3433  C  CD    . GLU B 1  216  ? 467.615 27.399  719.616 1.00 130.78 ? 216  GLU B CD    1 
ATOM   3434  O  OE1   . GLU B 1  216  ? 468.576 26.607  719.575 1.00 133.01 ? 216  GLU B OE1   1 
ATOM   3435  O  OE2   . GLU B 1  216  ? 467.748 28.595  719.968 1.00 134.79 ? 216  GLU B OE2   1 
ATOM   3436  N  N     . ILE B 1  217  ? 466.075 23.610  717.668 1.00 107.16 ? 217  ILE B N     1 
ATOM   3437  C  CA    . ILE B 1  217  ? 466.074 22.271  718.258 1.00 102.01 ? 217  ILE B CA    1 
ATOM   3438  C  C     . ILE B 1  217  ? 467.313 21.486  717.893 1.00 98.22  ? 217  ILE B C     1 
ATOM   3439  O  O     . ILE B 1  217  ? 467.970 20.879  718.750 1.00 93.77  ? 217  ILE B O     1 
ATOM   3440  C  CB    . ILE B 1  217  ? 464.837 21.491  717.793 1.00 89.86  ? 217  ILE B CB    1 
ATOM   3441  C  CG1   . ILE B 1  217  ? 463.555 22.124  718.340 1.00 89.96  ? 217  ILE B CG1   1 
ATOM   3442  C  CG2   . ILE B 1  217  ? 465.021 19.987  718.072 1.00 89.13  ? 217  ILE B CG2   1 
ATOM   3443  C  CD1   . ILE B 1  217  ? 462.275 21.421  717.907 1.00 87.67  ? 217  ILE B CD1   1 
ATOM   3444  N  N     . LEU B 1  218  ? 467.675 21.530  716.619 1.00 96.55  ? 218  LEU B N     1 
ATOM   3445  C  CA    . LEU B 1  218  ? 468.812 20.754  716.145 1.00 99.93  ? 218  LEU B CA    1 
ATOM   3446  C  C     . LEU B 1  218  ? 470.113 21.217  716.791 1.00 103.60 ? 218  LEU B C     1 
ATOM   3447  O  O     . LEU B 1  218  ? 470.921 20.389  717.226 1.00 106.38 ? 218  LEU B O     1 
ATOM   3448  C  CB    . LEU B 1  218  ? 468.865 20.801  714.624 1.00 96.85  ? 218  LEU B CB    1 
ATOM   3449  C  CG    . LEU B 1  218  ? 469.876 19.811  714.076 1.00 93.82  ? 218  LEU B CG    1 
ATOM   3450  C  CD1   . LEU B 1  218  ? 469.497 18.420  714.581 1.00 88.89  ? 218  LEU B CD1   1 
ATOM   3451  C  CD2   . LEU B 1  218  ? 469.805 19.853  712.579 1.00 91.37  ? 218  LEU B CD2   1 
ATOM   3452  N  N     . ARG B 1  219  ? 470.324 22.528  716.895 1.00 108.90 ? 219  ARG B N     1 
ATOM   3453  C  CA    . ARG B 1  219  ? 471.540 23.007  717.544 1.00 113.79 ? 219  ARG B CA    1 
ATOM   3454  C  C     . ARG B 1  219  ? 471.618 22.459  718.960 1.00 114.35 ? 219  ARG B C     1 
ATOM   3455  O  O     . ARG B 1  219  ? 472.651 21.923  719.387 1.00 113.02 ? 219  ARG B O     1 
ATOM   3456  C  CB    . ARG B 1  219  ? 471.581 24.531  717.546 1.00 118.31 ? 219  ARG B CB    1 
ATOM   3457  C  CG    . ARG B 1  219  ? 472.872 25.100  718.121 1.00 123.52 ? 219  ARG B CG    1 
ATOM   3458  C  CD    . ARG B 1  219  ? 472.674 26.533  718.540 1.00 125.45 ? 219  ARG B CD    1 
ATOM   3459  N  NE    . ARG B 1  219  ? 471.520 26.651  719.418 1.00 123.26 ? 219  ARG B NE    1 
ATOM   3460  C  CZ    . ARG B 1  219  ? 471.536 26.369  720.714 1.00 123.43 ? 219  ARG B CZ    1 
ATOM   3461  N  NH1   . ARG B 1  219  ? 472.659 25.954  721.294 1.00 123.31 ? 219  ARG B NH1   1 
ATOM   3462  N  NH2   . ARG B 1  219  ? 470.431 26.504  721.435 1.00 125.04 ? 219  ARG B NH2   1 
ATOM   3463  N  N     . GLU B 1  220  ? 470.516 22.581  719.691 1.00 116.50 ? 220  GLU B N     1 
ATOM   3464  C  CA    . GLU B 1  220  ? 470.424 22.065  721.048 1.00 119.84 ? 220  GLU B CA    1 
ATOM   3465  C  C     . GLU B 1  220  ? 470.786 20.593  721.142 1.00 113.17 ? 220  GLU B C     1 
ATOM   3466  O  O     . GLU B 1  220  ? 471.557 20.176  722.013 1.00 115.39 ? 220  GLU B O     1 
ATOM   3467  C  CB    . GLU B 1  220  ? 468.987 22.179  721.531 1.00 124.49 ? 220  GLU B CB    1 
ATOM   3468  C  CG    . GLU B 1  220  ? 468.841 21.729  722.957 1.00 131.48 ? 220  GLU B CG    1 
ATOM   3469  C  CD    . GLU B 1  220  ? 467.463 21.909  723.476 1.00 136.64 ? 220  GLU B CD    1 
ATOM   3470  O  OE1   . GLU B 1  220  ? 466.614 22.453  722.753 1.00 137.00 ? 220  GLU B OE1   1 
ATOM   3471  O  OE2   . GLU B 1  220  ? 467.254 21.570  724.664 1.00 139.63 ? 220  GLU B OE2   1 
ATOM   3472  N  N     . HIS B 1  221  ? 470.236 19.793  720.244 1.00 103.35 ? 221  HIS B N     1 
ATOM   3473  C  CA    . HIS B 1  221  ? 470.556 18.381  720.240 1.00 104.50 ? 221  HIS B CA    1 
ATOM   3474  C  C     . HIS B 1  221  ? 472.031 18.110  720.012 1.00 109.02 ? 221  HIS B C     1 
ATOM   3475  O  O     . HIS B 1  221  ? 472.545 17.102  720.503 1.00 113.73 ? 221  HIS B O     1 
ATOM   3476  C  CB    . HIS B 1  221  ? 469.731 17.713  719.168 1.00 104.26 ? 221  HIS B CB    1 
ATOM   3477  C  CG    . HIS B 1  221  ? 468.432 17.187  719.666 1.00 103.39 ? 221  HIS B CG    1 
ATOM   3478  N  ND1   . HIS B 1  221  ? 468.265 15.899  720.128 1.00 103.86 ? 221  HIS B ND1   1 
ATOM   3479  C  CD2   . HIS B 1  221  ? 467.226 17.791  719.772 1.00 102.56 ? 221  HIS B CD2   1 
ATOM   3480  C  CE1   . HIS B 1  221  ? 467.009 15.736  720.504 1.00 104.78 ? 221  HIS B CE1   1 
ATOM   3481  N  NE2   . HIS B 1  221  ? 466.360 16.869  720.299 1.00 104.41 ? 221  HIS B NE2   1 
ATOM   3482  N  N     . LEU B 1  222  ? 472.732 18.992  719.293 1.00 114.43 ? 222  LEU B N     1 
ATOM   3483  C  CA    . LEU B 1  222  ? 474.170 18.823  719.086 1.00 117.09 ? 222  LEU B CA    1 
ATOM   3484  C  C     . LEU B 1  222  ? 474.970 19.047  720.359 1.00 123.14 ? 222  LEU B C     1 
ATOM   3485  O  O     . LEU B 1  222  ? 476.058 18.476  720.517 1.00 124.11 ? 222  LEU B O     1 
ATOM   3486  C  CB    . LEU B 1  222  ? 474.644 19.751  717.977 1.00 119.56 ? 222  LEU B CB    1 
ATOM   3487  C  CG    . LEU B 1  222  ? 474.074 19.214  716.658 1.00 118.72 ? 222  LEU B CG    1 
ATOM   3488  C  CD1   . LEU B 1  222  ? 474.600 19.988  715.454 1.00 118.00 ? 222  LEU B CD1   1 
ATOM   3489  C  CD2   . LEU B 1  222  ? 474.298 17.699  716.517 1.00 119.02 ? 222  LEU B CD2   1 
ATOM   3490  N  N     . THR B 1  223  ? 474.467 19.892  721.258 1.00 120.07 ? 223  THR B N     1 
ATOM   3491  C  CA    . THR B 1  223  ? 475.131 20.113  722.534 1.00 117.86 ? 223  THR B CA    1 
ATOM   3492  C  C     . THR B 1  223  ? 475.143 18.855  723.387 1.00 109.45 ? 223  THR B C     1 
ATOM   3493  O  O     . THR B 1  223  ? 475.915 18.781  724.347 1.00 116.70 ? 223  THR B O     1 
ATOM   3494  C  CB    . THR B 1  223  ? 474.462 21.233  723.298 1.00 118.86 ? 223  THR B CB    1 
ATOM   3495  O  OG1   . THR B 1  223  ? 473.136 20.816  723.643 1.00 123.64 ? 223  THR B OG1   1 
ATOM   3496  C  CG2   . THR B 1  223  ? 474.382 22.471  722.446 1.00 108.87 ? 223  THR B CG2   1 
ATOM   3497  N  N     . TYR B 1  224  ? 474.319 17.864  723.049 1.00 105.08 ? 224  TYR B N     1 
ATOM   3498  C  CA    . TYR B 1  224  ? 474.203 16.660  723.865 1.00 105.17 ? 224  TYR B CA    1 
ATOM   3499  C  C     . TYR B 1  224  ? 475.434 15.796  723.827 1.00 113.56 ? 224  TYR B C     1 
ATOM   3500  O  O     . TYR B 1  224  ? 475.395 14.675  724.324 1.00 111.03 ? 224  TYR B O     1 
ATOM   3501  C  CB    . TYR B 1  224  ? 472.953 15.879  723.485 1.00 104.09 ? 224  TYR B CB    1 
ATOM   3502  C  CG    . TYR B 1  224  ? 471.704 16.685  723.814 1.00 108.26 ? 224  TYR B CG    1 
ATOM   3503  C  CD1   . TYR B 1  224  ? 471.776 17.757  724.708 1.00 111.00 ? 224  TYR B CD1   1 
ATOM   3504  C  CD2   . TYR B 1  224  ? 470.467 16.375  723.271 1.00 108.50 ? 224  TYR B CD2   1 
ATOM   3505  C  CE1   . TYR B 1  224  ? 470.666 18.494  725.040 1.00 113.86 ? 224  TYR B CE1   1 
ATOM   3506  C  CE2   . TYR B 1  224  ? 469.328 17.117  723.617 1.00 109.46 ? 224  TYR B CE2   1 
ATOM   3507  C  CZ    . TYR B 1  224  ? 469.442 18.174  724.495 1.00 110.40 ? 224  TYR B CZ    1 
ATOM   3508  O  OH    . TYR B 1  224  ? 468.324 18.908  724.823 1.00 109.38 ? 224  TYR B OH    1 
ATOM   3509  N  N     . PHE B 1  225  ? 476.404 16.218  723.036 1.00 121.12 ? 225  PHE B N     1 
ATOM   3510  C  CA    . PHE B 1  225  ? 477.722 15.612  722.881 1.00 127.84 ? 225  PHE B CA    1 
ATOM   3511  C  C     . PHE B 1  225  ? 478.750 16.279  723.818 1.00 142.39 ? 225  PHE B C     1 
ATOM   3512  O  O     . PHE B 1  225  ? 479.821 16.686  723.345 1.00 144.20 ? 225  PHE B O     1 
ATOM   3513  C  CB    . PHE B 1  225  ? 478.083 15.722  721.426 1.00 117.15 ? 225  PHE B CB    1 
ATOM   3514  C  CG    . PHE B 1  225  ? 477.179 14.870  720.584 1.00 108.75 ? 225  PHE B CG    1 
ATOM   3515  C  CD1   . PHE B 1  225  ? 477.301 13.500  720.555 1.00 105.38 ? 225  PHE B CD1   1 
ATOM   3516  C  CD2   . PHE B 1  225  ? 476.117 15.471  719.910 1.00 105.11 ? 225  PHE B CD2   1 
ATOM   3517  C  CE1   . PHE B 1  225  ? 476.427 12.735  719.799 1.00 101.65 ? 225  PHE B CE1   1 
ATOM   3518  C  CE2   . PHE B 1  225  ? 475.247 14.726  719.156 1.00 100.03 ? 225  PHE B CE2   1 
ATOM   3519  C  CZ    . PHE B 1  225  ? 475.389 13.356  719.098 1.00 98.06  ? 225  PHE B CZ    1 
ATOM   3520  N  N     . SER B 1  226  ? 478.484 16.413  725.136 1.00 156.63 ? 226  SER B N     1 
ATOM   3521  C  CA    . SER B 1  226  ? 479.352 17.135  726.089 1.00 163.49 ? 226  SER B CA    1 
ATOM   3522  C  C     . SER B 1  226  ? 480.011 16.290  727.179 1.00 165.46 ? 226  SER B C     1 
ATOM   3523  O  O     . SER B 1  226  ? 481.240 16.273  727.268 1.00 170.04 ? 226  SER B O     1 
ATOM   3524  C  CB    . SER B 1  226  ? 478.541 18.279  726.722 1.00 167.56 ? 226  SER B CB    1 
ATOM   3525  O  OG    . SER B 1  226  ? 477.357 17.794  727.321 1.00 169.56 ? 226  SER B OG    1 
ATOM   3526  N  N     . ASN B 1  227  ? 479.241 15.655  728.060 1.00 158.52 ? 227  ASN B N     1 
ATOM   3527  C  CA    . ASN B 1  227  ? 479.736 15.021  729.284 1.00 154.77 ? 227  ASN B CA    1 
ATOM   3528  C  C     . ASN B 1  227  ? 479.667 13.529  729.008 1.00 143.89 ? 227  ASN B C     1 
ATOM   3529  O  O     . ASN B 1  227  ? 478.577 12.995  728.749 1.00 135.89 ? 227  ASN B O     1 
ATOM   3530  C  CB    . ASN B 1  227  ? 478.909 15.392  730.521 1.00 158.35 ? 227  ASN B CB    1 
ATOM   3531  C  CG    . ASN B 1  227  ? 479.333 14.622  731.781 1.00 165.58 ? 227  ASN B CG    1 
ATOM   3532  O  OD1   . ASN B 1  227  ? 479.165 13.404  731.857 1.00 166.68 ? 227  ASN B OD1   1 
ATOM   3533  N  ND2   . ASN B 1  227  ? 479.863 15.337  732.782 1.00 170.76 ? 227  ASN B ND2   1 
ATOM   3534  N  N     . PRO B 1  228  ? 480.804 12.857  728.925 1.00 145.39 ? 228  PRO B N     1 
ATOM   3535  C  CA    . PRO B 1  228  ? 480.810 11.393  728.784 1.00 145.99 ? 228  PRO B CA    1 
ATOM   3536  C  C     . PRO B 1  228  ? 480.591 10.528  730.022 1.00 144.17 ? 228  PRO B C     1 
ATOM   3537  O  O     . PRO B 1  228  ? 480.008 10.947  731.029 1.00 140.70 ? 228  PRO B O     1 
ATOM   3538  C  CB    . PRO B 1  228  ? 482.217 11.143  728.216 1.00 147.43 ? 228  PRO B CB    1 
ATOM   3539  C  CG    . PRO B 1  228  ? 483.066 12.222  728.892 1.00 151.42 ? 228  PRO B CG    1 
ATOM   3540  C  CD    . PRO B 1  228  ? 482.155 13.410  729.135 1.00 149.57 ? 228  PRO B CD    1 
ATOM   3541  N  N     . GLN B 1  229  ? 480.995 9.262   729.871 1.00 145.31 ? 229  GLN B N     1 
ATOM   3542  C  CA    . GLN B 1  229  ? 481.020 8.230   730.914 1.00 145.54 ? 229  GLN B CA    1 
ATOM   3543  C  C     . GLN B 1  229  ? 481.614 6.956   730.302 1.00 137.32 ? 229  GLN B C     1 
ATOM   3544  O  O     . GLN B 1  229  ? 482.650 6.464   730.750 1.00 133.23 ? 229  GLN B O     1 
ATOM   3545  C  CB    . GLN B 1  229  ? 479.615 7.960   731.498 1.00 145.86 ? 229  GLN B CB    1 
ATOM   3546  C  CG    . GLN B 1  229  ? 479.537 6.865   732.621 1.00 149.60 ? 229  GLN B CG    1 
ATOM   3547  C  CD    . GLN B 1  229  ? 480.338 7.175   733.917 1.00 150.74 ? 229  GLN B CD    1 
ATOM   3548  O  OE1   . GLN B 1  229  ? 480.327 8.301   734.415 1.00 152.72 ? 229  GLN B OE1   1 
ATOM   3549  N  NE2   . GLN B 1  229  ? 481.015 6.155   734.463 1.00 146.70 ? 229  GLN B NE2   1 
ATOM   3550  N  N     . MET C 2  1    ? 491.699 -17.924 700.532 1.00 204.31 ? 1    MET C N     1 
ATOM   3551  C  CA    . MET C 2  1    ? 490.402 -18.361 701.034 1.00 203.26 ? 1    MET C CA    1 
ATOM   3552  C  C     . MET C 2  1    ? 490.030 -19.759 700.507 1.00 199.21 ? 1    MET C C     1 
ATOM   3553  O  O     . MET C 2  1    ? 490.600 -20.239 699.518 1.00 198.47 ? 1    MET C O     1 
ATOM   3554  C  CB    . MET C 2  1    ? 489.323 -17.342 700.656 1.00 203.11 ? 1    MET C CB    1 
ATOM   3555  C  CG    . MET C 2  1    ? 488.827 -17.435 699.214 1.00 202.13 ? 1    MET C CG    1 
ATOM   3556  S  SD    . MET C 2  1    ? 490.017 -16.974 697.931 1.00 202.45 ? 1    MET C SD    1 
ATOM   3557  C  CE    . MET C 2  1    ? 490.456 -15.322 698.468 1.00 205.34 ? 1    MET C CE    1 
ATOM   3558  N  N     . GLU C 2  2    ? 489.081 -20.408 701.182 1.00 187.71 ? 2    GLU C N     1 
ATOM   3559  C  CA    . GLU C 2  2    ? 488.629 -21.737 700.783 1.00 175.47 ? 2    GLU C CA    1 
ATOM   3560  C  C     . GLU C 2  2    ? 487.865 -21.671 699.462 1.00 161.64 ? 2    GLU C C     1 
ATOM   3561  O  O     . GLU C 2  2    ? 487.149 -20.710 699.173 1.00 157.73 ? 2    GLU C O     1 
ATOM   3562  C  CB    . GLU C 2  2    ? 487.769 -22.378 701.872 1.00 172.56 ? 2    GLU C CB    1 
ATOM   3563  C  CG    . GLU C 2  2    ? 487.432 -23.836 701.591 1.00 168.61 ? 2    GLU C CG    1 
ATOM   3564  C  CD    . GLU C 2  2    ? 487.674 -24.723 702.782 1.00 171.74 ? 2    GLU C CD    1 
ATOM   3565  O  OE1   . GLU C 2  2    ? 488.850 -25.037 703.052 1.00 173.66 ? 2    GLU C OE1   1 
ATOM   3566  O  OE2   . GLU C 2  2    ? 486.690 -25.105 703.447 1.00 172.94 ? 2    GLU C OE2   1 
ATOM   3567  N  N     . ILE C 2  3    ? 488.001 -22.727 698.669 1.00 153.81 ? 3    ILE C N     1 
ATOM   3568  C  CA    . ILE C 2  3    ? 487.274 -22.877 697.417 1.00 140.68 ? 3    ILE C CA    1 
ATOM   3569  C  C     . ILE C 2  3    ? 486.510 -24.193 697.492 1.00 139.44 ? 3    ILE C C     1 
ATOM   3570  O  O     . ILE C 2  3    ? 487.113 -25.272 697.533 1.00 142.55 ? 3    ILE C O     1 
ATOM   3571  C  CB    . ILE C 2  3    ? 488.222 -22.864 696.205 1.00 134.43 ? 3    ILE C CB    1 
ATOM   3572  C  CG1   . ILE C 2  3    ? 489.171 -21.651 696.224 1.00 132.53 ? 3    ILE C CG1   1 
ATOM   3573  C  CG2   . ILE C 2  3    ? 487.439 -22.893 694.916 1.00 127.54 ? 3    ILE C CG2   1 
ATOM   3574  C  CD1   . ILE C 2  3    ? 488.548 -20.326 695.815 1.00 126.02 ? 3    ILE C CD1   1 
ATOM   3575  N  N     . LYS C 2  4    ? 485.188 -24.103 697.521 1.00 133.85 ? 4    LYS C N     1 
ATOM   3576  C  CA    . LYS C 2  4    ? 484.304 -25.255 697.663 1.00 138.48 ? 4    LYS C CA    1 
ATOM   3577  C  C     . LYS C 2  4    ? 483.725 -25.616 696.309 1.00 131.96 ? 4    LYS C C     1 
ATOM   3578  O  O     . LYS C 2  4    ? 483.109 -24.771 695.654 1.00 126.63 ? 4    LYS C O     1 
ATOM   3579  C  CB    . LYS C 2  4    ? 483.162 -25.000 698.647 1.00 128.06 ? 4    LYS C CB    1 
ATOM   3580  C  CG    . LYS C 2  4    ? 482.331 -26.268 698.909 1.00 135.92 ? 4    LYS C CG    1 
ATOM   3581  C  CD    . LYS C 2  4    ? 481.287 -26.095 700.009 1.00 140.52 ? 4    LYS C CD    1 
ATOM   3582  C  CE    . LYS C 2  4    ? 480.622 -27.429 700.378 1.00 145.96 ? 4    LYS C CE    1 
ATOM   3583  N  NZ    . LYS C 2  4    ? 481.338 -28.616 699.809 1.00 149.26 ? 4    LYS C NZ    1 
ATOM   3584  N  N     . ARG C 2  5    ? 483.981 -26.838 695.855 1.00 138.27 ? 5    ARG C N     1 
ATOM   3585  C  CA    . ARG C 2  5    ? 483.480 -27.260 694.557 1.00 142.97 ? 5    ARG C CA    1 
ATOM   3586  C  C     . ARG C 2  5    ? 482.309 -28.220 694.714 1.00 146.58 ? 5    ARG C C     1 
ATOM   3587  O  O     . ARG C 2  5    ? 482.318 -29.105 695.576 1.00 155.25 ? 5    ARG C O     1 
ATOM   3588  C  CB    . ARG C 2  5    ? 484.560 -27.944 693.709 1.00 152.65 ? 5    ARG C CB    1 
ATOM   3589  C  CG    . ARG C 2  5    ? 485.193 -29.222 694.282 1.00 161.38 ? 5    ARG C CG    1 
ATOM   3590  C  CD    . ARG C 2  5    ? 486.199 -29.744 693.264 1.00 163.09 ? 5    ARG C CD    1 
ATOM   3591  N  NE    . ARG C 2  5    ? 485.553 -29.845 691.954 1.00 160.05 ? 5    ARG C NE    1 
ATOM   3592  C  CZ    . ARG C 2  5    ? 486.079 -29.381 690.828 1.00 154.66 ? 5    ARG C CZ    1 
ATOM   3593  N  NH1   . ARG C 2  5    ? 487.260 -28.786 690.855 1.00 153.47 ? 5    ARG C NH1   1 
ATOM   3594  N  NH2   . ARG C 2  5    ? 485.421 -29.502 689.683 1.00 151.42 ? 5    ARG C NH2   1 
ATOM   3595  N  N     . PHE C 2  6    ? 481.274 -27.983 693.921 1.00 140.16 ? 6    PHE C N     1 
ATOM   3596  C  CA    . PHE C 2  6    ? 480.078 -28.798 693.922 1.00 138.27 ? 6    PHE C CA    1 
ATOM   3597  C  C     . PHE C 2  6    ? 480.152 -29.798 692.774 1.00 134.15 ? 6    PHE C C     1 
ATOM   3598  O  O     . PHE C 2  6    ? 481.075 -29.796 691.949 1.00 134.35 ? 6    PHE C O     1 
ATOM   3599  C  CB    . PHE C 2  6    ? 478.797 -27.970 693.797 1.00 130.47 ? 6    PHE C CB    1 
ATOM   3600  C  CG    . PHE C 2  6    ? 478.607 -26.919 694.856 1.00 128.60 ? 6    PHE C CG    1 
ATOM   3601  C  CD1   . PHE C 2  6    ? 479.031 -25.618 694.652 1.00 114.69 ? 6    PHE C CD1   1 
ATOM   3602  C  CD2   . PHE C 2  6    ? 477.932 -27.212 696.023 1.00 132.88 ? 6    PHE C CD2   1 
ATOM   3603  C  CE1   . PHE C 2  6    ? 478.820 -24.638 695.608 1.00 116.23 ? 6    PHE C CE1   1 
ATOM   3604  C  CE2   . PHE C 2  6    ? 477.731 -26.235 696.985 1.00 122.42 ? 6    PHE C CE2   1 
ATOM   3605  C  CZ    . PHE C 2  6    ? 478.174 -24.950 696.773 1.00 120.08 ? 6    PHE C CZ    1 
ATOM   3606  N  N     . GLY C 2  7    ? 479.116 -30.623 692.703 1.00 137.31 ? 7    GLY C N     1 
ATOM   3607  C  CA    . GLY C 2  7    ? 478.879 -31.515 691.595 1.00 137.73 ? 7    GLY C CA    1 
ATOM   3608  C  C     . GLY C 2  7    ? 479.423 -32.903 691.810 1.00 140.14 ? 7    GLY C C     1 
ATOM   3609  O  O     . GLY C 2  7    ? 480.526 -33.082 692.331 1.00 142.83 ? 7    GLY C O     1 
ATOM   3610  N  N     . ARG C 2  8    ? 478.655 -33.889 691.349 1.00 143.84 ? 8    ARG C N     1 
ATOM   3611  C  CA    . ARG C 2  8    ? 478.968 -35.303 691.497 1.00 149.06 ? 8    ARG C CA    1 
ATOM   3612  C  C     . ARG C 2  8    ? 479.549 -35.931 690.239 1.00 142.07 ? 8    ARG C C     1 
ATOM   3613  O  O     . ARG C 2  8    ? 479.969 -37.096 690.267 1.00 139.43 ? 8    ARG C O     1 
ATOM   3614  C  CB    . ARG C 2  8    ? 477.692 -36.049 691.887 1.00 157.91 ? 8    ARG C CB    1 
ATOM   3615  C  CG    . ARG C 2  8    ? 476.541 -35.155 692.366 1.00 158.14 ? 8    ARG C CG    1 
ATOM   3616  C  CD    . ARG C 2  8    ? 475.517 -35.994 693.130 1.00 165.79 ? 8    ARG C CD    1 
ATOM   3617  N  NE    . ARG C 2  8    ? 475.200 -37.233 692.411 1.00 170.48 ? 8    ARG C NE    1 
ATOM   3618  C  CZ    . ARG C 2  8    ? 475.591 -38.461 692.769 1.00 174.38 ? 8    ARG C CZ    1 
ATOM   3619  N  NH1   . ARG C 2  8    ? 476.324 -38.651 693.861 1.00 176.25 ? 8    ARG C NH1   1 
ATOM   3620  N  NH2   . ARG C 2  8    ? 475.254 -39.508 692.017 1.00 174.93 ? 8    ARG C NH2   1 
ATOM   3621  N  N     . ILE C 2  9    ? 479.613 -35.171 689.157 1.00 140.20 ? 9    ILE C N     1 
ATOM   3622  C  CA    . ILE C 2  9    ? 480.064 -35.678 687.871 1.00 143.33 ? 9    ILE C CA    1 
ATOM   3623  C  C     . ILE C 2  9    ? 481.578 -35.817 687.894 1.00 145.62 ? 9    ILE C C     1 
ATOM   3624  O  O     . ILE C 2  9    ? 482.292 -34.865 688.220 1.00 145.20 ? 9    ILE C O     1 
ATOM   3625  C  CB    . ILE C 2  9    ? 479.609 -34.755 686.729 1.00 140.21 ? 9    ILE C CB    1 
ATOM   3626  C  CG1   . ILE C 2  9    ? 478.093 -34.849 686.527 1.00 140.18 ? 9    ILE C CG1   1 
ATOM   3627  C  CG2   . ILE C 2  9    ? 480.358 -35.059 685.440 1.00 137.64 ? 9    ILE C CG2   1 
ATOM   3628  C  CD1   . ILE C 2  9    ? 477.609 -34.194 685.247 1.00 136.38 ? 9    ILE C CD1   1 
ATOM   3629  N  N     . ARG C 2  10   ? 482.062 -37.022 687.627 1.00 152.22 ? 10   ARG C N     1 
ATOM   3630  C  CA    . ARG C 2  10   ? 483.488 -37.304 687.580 1.00 156.14 ? 10   ARG C CA    1 
ATOM   3631  C  C     . ARG C 2  10   ? 483.862 -37.275 686.105 1.00 161.23 ? 10   ARG C C     1 
ATOM   3632  O  O     . ARG C 2  10   ? 483.408 -38.130 685.339 1.00 166.30 ? 10   ARG C O     1 
ATOM   3633  C  CB    . ARG C 2  10   ? 483.769 -38.662 688.217 1.00 164.37 ? 10   ARG C CB    1 
ATOM   3634  C  CG    . ARG C 2  10   ? 485.194 -38.908 688.629 1.00 171.34 ? 10   ARG C CG    1 
ATOM   3635  C  CD    . ARG C 2  10   ? 485.876 -39.847 687.643 1.00 177.91 ? 10   ARG C CD    1 
ATOM   3636  N  NE    . ARG C 2  10   ? 485.200 -41.149 687.613 1.00 184.44 ? 10   ARG C NE    1 
ATOM   3637  C  CZ    . ARG C 2  10   ? 485.628 -42.216 686.938 1.00 188.28 ? 10   ARG C CZ    1 
ATOM   3638  N  NH1   . ARG C 2  10   ? 484.931 -43.348 686.977 1.00 190.84 ? 10   ARG C NH1   1 
ATOM   3639  N  NH2   . ARG C 2  10   ? 486.755 -42.160 686.231 1.00 187.92 ? 10   ARG C NH2   1 
ATOM   3640  N  N     . GLU C 2  11   ? 484.720 -36.336 685.705 1.00 154.73 ? 11   GLU C N     1 
ATOM   3641  C  CA    . GLU C 2  11   ? 485.107 -36.242 684.300 1.00 148.31 ? 11   GLU C CA    1 
ATOM   3642  C  C     . GLU C 2  11   ? 486.338 -37.082 684.044 1.00 151.15 ? 11   GLU C C     1 
ATOM   3643  O  O     . GLU C 2  11   ? 487.434 -36.743 684.500 1.00 156.99 ? 11   GLU C O     1 
ATOM   3644  C  CB    . GLU C 2  11   ? 485.381 -34.796 683.925 1.00 140.48 ? 11   GLU C CB    1 
ATOM   3645  C  CG    . GLU C 2  11   ? 484.204 -33.925 684.159 1.00 142.92 ? 11   GLU C CG    1 
ATOM   3646  C  CD    . GLU C 2  11   ? 484.541 -32.469 684.016 1.00 143.71 ? 11   GLU C CD    1 
ATOM   3647  O  OE1   . GLU C 2  11   ? 485.732 -32.160 683.772 1.00 144.10 ? 11   GLU C OE1   1 
ATOM   3648  O  OE2   . GLU C 2  11   ? 483.612 -31.646 684.158 1.00 141.14 ? 11   GLU C OE2   1 
ATOM   3649  N  N     . VAL C 2  12   ? 486.170 -38.133 683.242 1.00 151.02 ? 12   VAL C N     1 
ATOM   3650  C  CA    . VAL C 2  12   ? 487.264 -39.066 683.027 1.00 152.98 ? 12   VAL C CA    1 
ATOM   3651  C  C     . VAL C 2  12   ? 488.439 -38.455 682.286 1.00 145.65 ? 12   VAL C C     1 
ATOM   3652  O  O     . VAL C 2  12   ? 489.571 -38.920 682.458 1.00 152.49 ? 12   VAL C O     1 
ATOM   3653  C  CB    . VAL C 2  12   ? 486.757 -40.306 682.277 1.00 159.67 ? 12   VAL C CB    1 
ATOM   3654  C  CG1   . VAL C 2  12   ? 485.834 -41.115 683.168 1.00 167.88 ? 12   VAL C CG1   1 
ATOM   3655  C  CG2   . VAL C 2  12   ? 486.023 -39.861 681.029 1.00 155.42 ? 12   VAL C CG2   1 
ATOM   3656  N  N     . ILE C 2  13   ? 488.226 -37.393 681.518 1.00 130.78 ? 13   ILE C N     1 
ATOM   3657  C  CA    . ILE C 2  13   ? 489.329 -36.784 680.775 1.00 124.32 ? 13   ILE C CA    1 
ATOM   3658  C  C     . ILE C 2  13   ? 489.346 -35.273 680.913 1.00 116.82 ? 13   ILE C C     1 
ATOM   3659  O  O     . ILE C 2  13   ? 488.279 -34.650 680.987 1.00 115.42 ? 13   ILE C O     1 
ATOM   3660  C  CB    . ILE C 2  13   ? 489.287 -37.139 679.276 1.00 122.65 ? 13   ILE C CB    1 
ATOM   3661  C  CG1   . ILE C 2  13   ? 487.947 -36.771 678.648 1.00 118.37 ? 13   ILE C CG1   1 
ATOM   3662  C  CG2   . ILE C 2  13   ? 489.627 -38.596 679.030 1.00 129.00 ? 13   ILE C CG2   1 
ATOM   3663  C  CD1   . ILE C 2  13   ? 487.973 -36.901 677.148 1.00 115.40 ? 13   ILE C CD1   1 
ATOM   3664  N  N     . PRO C 2  14   ? 490.517 -34.647 680.920 1.00 114.21 ? 14   PRO C N     1 
ATOM   3665  C  CA    . PRO C 2  14   ? 490.563 -33.189 680.916 1.00 114.35 ? 14   PRO C CA    1 
ATOM   3666  C  C     . PRO C 2  14   ? 490.255 -32.696 679.517 1.00 113.23 ? 14   PRO C C     1 
ATOM   3667  O  O     . PRO C 2  14   ? 490.263 -33.448 678.539 1.00 117.52 ? 14   PRO C O     1 
ATOM   3668  C  CB    . PRO C 2  14   ? 492.004 -32.866 681.313 1.00 103.11 ? 14   PRO C CB    1 
ATOM   3669  C  CG    . PRO C 2  14   ? 492.758 -34.003 680.766 1.00 105.47 ? 14   PRO C CG    1 
ATOM   3670  C  CD    . PRO C 2  14   ? 491.870 -35.224 680.927 1.00 107.80 ? 14   PRO C CD    1 
ATOM   3671  N  N     . LEU C 2  15   ? 489.940 -31.418 679.457 1.00 111.61 ? 15   LEU C N     1 
ATOM   3672  C  CA    . LEU C 2  15   ? 489.759 -30.728 678.193 1.00 109.37 ? 15   LEU C CA    1 
ATOM   3673  C  C     . LEU C 2  15   ? 491.001 -30.883 677.306 1.00 116.80 ? 15   LEU C C     1 
ATOM   3674  O  O     . LEU C 2  15   ? 492.137 -30.877 677.813 1.00 120.06 ? 15   LEU C O     1 
ATOM   3675  C  CB    . LEU C 2  15   ? 489.518 -29.263 678.545 1.00 101.01 ? 15   LEU C CB    1 
ATOM   3676  C  CG    . LEU C 2  15   ? 488.171 -28.594 678.373 1.00 93.77  ? 15   LEU C CG    1 
ATOM   3677  C  CD1   . LEU C 2  15   ? 487.078 -29.518 678.801 1.00 94.17  ? 15   LEU C CD1   1 
ATOM   3678  C  CD2   . LEU C 2  15   ? 488.209 -27.469 679.375 1.00 90.70  ? 15   LEU C CD2   1 
ATOM   3679  N  N     . PRO C 2  16   ? 490.836 -31.078 675.992 1.00 117.49 ? 16   PRO C N     1 
ATOM   3680  C  CA    . PRO C 2  16   ? 492.014 -31.197 675.104 1.00 111.21 ? 16   PRO C CA    1 
ATOM   3681  C  C     . PRO C 2  16   ? 492.745 -29.867 675.061 1.00 105.96 ? 16   PRO C C     1 
ATOM   3682  O  O     . PRO C 2  16   ? 492.174 -28.839 675.463 1.00 104.29 ? 16   PRO C O     1 
ATOM   3683  C  CB    . PRO C 2  16   ? 491.412 -31.573 673.745 1.00 110.59 ? 16   PRO C CB    1 
ATOM   3684  C  CG    . PRO C 2  16   ? 490.028 -32.093 674.064 1.00 115.07 ? 16   PRO C CG    1 
ATOM   3685  C  CD    . PRO C 2  16   ? 489.575 -31.299 675.262 1.00 116.05 ? 16   PRO C CD    1 
ATOM   3686  N  N     . PRO C 2  17   ? 493.965 -29.815 674.532 1.00 100.69 ? 17   PRO C N     1 
ATOM   3687  C  CA    . PRO C 2  17   ? 494.609 -28.507 674.346 1.00 98.53  ? 17   PRO C CA    1 
ATOM   3688  C  C     . PRO C 2  17   ? 493.762 -27.609 673.470 1.00 99.07  ? 17   PRO C C     1 
ATOM   3689  O  O     . PRO C 2  17   ? 493.375 -27.968 672.361 1.00 104.24 ? 17   PRO C O     1 
ATOM   3690  C  CB    . PRO C 2  17   ? 495.944 -28.853 673.698 1.00 100.56 ? 17   PRO C CB    1 
ATOM   3691  C  CG    . PRO C 2  17   ? 496.170 -30.306 674.060 1.00 104.79 ? 17   PRO C CG    1 
ATOM   3692  C  CD    . PRO C 2  17   ? 494.824 -30.933 674.117 1.00 103.24 ? 17   PRO C CD    1 
ATOM   3693  N  N     . LEU C 2  18   ? 493.466 -26.428 673.993 1.00 96.99  ? 18   LEU C N     1 
ATOM   3694  C  CA    . LEU C 2  18   ? 492.408 -25.614 673.415 1.00 93.17  ? 18   LEU C CA    1 
ATOM   3695  C  C     . LEU C 2  18   ? 492.816 -24.984 672.099 1.00 88.64  ? 18   LEU C C     1 
ATOM   3696  O  O     . LEU C 2  18   ? 491.965 -24.822 671.227 1.00 87.72  ? 18   LEU C O     1 
ATOM   3697  C  CB    . LEU C 2  18   ? 491.965 -24.563 674.422 1.00 96.32  ? 18   LEU C CB    1 
ATOM   3698  C  CG    . LEU C 2  18   ? 491.232 -25.257 675.584 1.00 96.37  ? 18   LEU C CG    1 
ATOM   3699  C  CD1   . LEU C 2  18   ? 490.795 -24.234 676.597 1.00 94.19  ? 18   LEU C CD1   1 
ATOM   3700  C  CD2   . LEU C 2  18   ? 490.063 -26.141 675.125 1.00 95.92  ? 18   LEU C CD2   1 
ATOM   3701  N  N     . THR C 2  19   ? 494.101 -24.680 671.906 1.00 93.86  ? 19   THR C N     1 
ATOM   3702  C  CA    . THR C 2  19   ? 494.564 -24.136 670.635 1.00 96.55  ? 19   THR C CA    1 
ATOM   3703  C  C     . THR C 2  19   ? 495.059 -25.212 669.688 1.00 100.76 ? 19   THR C C     1 
ATOM   3704  O  O     . THR C 2  19   ? 495.571 -24.876 668.616 1.00 102.81 ? 19   THR C O     1 
ATOM   3705  C  CB    . THR C 2  19   ? 495.735 -23.148 670.849 1.00 99.48  ? 19   THR C CB    1 
ATOM   3706  O  OG1   . THR C 2  19   ? 496.770 -23.758 671.650 1.00 99.44  ? 19   THR C OG1   1 
ATOM   3707  C  CG2   . THR C 2  19   ? 495.265 -21.856 671.515 1.00 99.78  ? 19   THR C CG2   1 
ATOM   3708  N  N     . GLU C 2  20   ? 494.883 -26.491 670.037 1.00 102.74 ? 20   GLU C N     1 
ATOM   3709  C  CA    . GLU C 2  20   ? 495.390 -27.571 669.195 1.00 107.50 ? 20   GLU C CA    1 
ATOM   3710  C  C     . GLU C 2  20   ? 494.824 -27.503 667.792 1.00 100.55 ? 20   GLU C C     1 
ATOM   3711  O  O     . GLU C 2  20   ? 495.478 -27.941 666.831 1.00 97.87  ? 20   GLU C O     1 
ATOM   3712  C  CB    . GLU C 2  20   ? 495.072 -28.931 669.811 1.00 116.01 ? 20   GLU C CB    1 
ATOM   3713  C  CG    . GLU C 2  20   ? 493.699 -29.470 669.419 1.00 118.61 ? 20   GLU C CG    1 
ATOM   3714  C  CD    . GLU C 2  20   ? 493.467 -30.905 669.875 1.00 121.69 ? 20   GLU C CD    1 
ATOM   3715  O  OE1   . GLU C 2  20   ? 494.404 -31.733 669.806 1.00 119.30 ? 20   GLU C OE1   1 
ATOM   3716  O  OE2   . GLU C 2  20   ? 492.329 -31.197 670.310 1.00 124.15 ? 20   GLU C OE2   1 
ATOM   3717  N  N     . ILE C 2  21   ? 493.616 -26.950 667.652 1.00 98.54  ? 21   ILE C N     1 
ATOM   3718  C  CA    . ILE C 2  21   ? 493.035 -26.831 666.320 1.00 96.29  ? 21   ILE C CA    1 
ATOM   3719  C  C     . ILE C 2  21   ? 493.937 -25.986 665.426 1.00 90.98  ? 21   ILE C C     1 
ATOM   3720  O  O     . ILE C 2  21   ? 493.962 -26.166 664.205 1.00 90.38  ? 21   ILE C O     1 
ATOM   3721  C  CB    . ILE C 2  21   ? 491.599 -26.265 666.408 1.00 91.16  ? 21   ILE C CB    1 
ATOM   3722  C  CG1   . ILE C 2  21   ? 490.954 -26.267 665.035 1.00 90.48  ? 21   ILE C CG1   1 
ATOM   3723  C  CG2   . ILE C 2  21   ? 491.607 -24.810 666.861 1.00 86.96  ? 21   ILE C CG2   1 
ATOM   3724  C  CD1   . ILE C 2  21   ? 489.568 -25.726 665.023 1.00 87.27  ? 21   ILE C CD1   1 
ATOM   3725  N  N     . GLN C 2  22   ? 494.642 -25.019 666.001 1.00 88.47  ? 22   GLN C N     1 
ATOM   3726  C  CA    . GLN C 2  22   ? 495.589 -24.221 665.242 1.00 89.79  ? 22   GLN C CA    1 
ATOM   3727  C  C     . GLN C 2  22   ? 496.969 -24.878 665.166 1.00 97.44  ? 22   GLN C C     1 
ATOM   3728  O  O     . GLN C 2  22   ? 497.466 -25.205 664.080 1.00 100.06 ? 22   GLN C O     1 
ATOM   3729  C  CB    . GLN C 2  22   ? 495.708 -22.837 665.873 1.00 91.19  ? 22   GLN C CB    1 
ATOM   3730  C  CG    . GLN C 2  22   ? 494.480 -21.976 665.683 1.00 90.56  ? 22   GLN C CG    1 
ATOM   3731  C  CD    . GLN C 2  22   ? 494.399 -21.354 664.306 1.00 88.86  ? 22   GLN C CD    1 
ATOM   3732  O  OE1   . GLN C 2  22   ? 495.388 -20.833 663.762 1.00 85.05  ? 22   GLN C OE1   1 
ATOM   3733  N  NE2   . GLN C 2  22   ? 493.198 -21.355 663.753 1.00 89.18  ? 22   GLN C NE2   1 
ATOM   3734  N  N     . VAL C 2  23   ? 497.601 -25.044 666.331 1.00 93.89  ? 23   VAL C N     1 
ATOM   3735  C  CA    . VAL C 2  23   ? 498.959 -25.573 666.407 1.00 96.09  ? 23   VAL C CA    1 
ATOM   3736  C  C     . VAL C 2  23   ? 499.112 -26.880 665.644 1.00 99.75  ? 23   VAL C C     1 
ATOM   3737  O  O     . VAL C 2  23   ? 499.945 -26.990 664.739 1.00 96.36  ? 23   VAL C O     1 
ATOM   3738  C  CB    . VAL C 2  23   ? 499.393 -25.722 667.867 1.00 94.26  ? 23   VAL C CB    1 
ATOM   3739  C  CG1   . VAL C 2  23   ? 500.672 -26.556 667.933 1.00 100.12 ? 23   VAL C CG1   1 
ATOM   3740  C  CG2   . VAL C 2  23   ? 499.613 -24.353 668.439 1.00 93.75  ? 23   VAL C CG2   1 
ATOM   3741  N  N     . GLU C 2  24   ? 498.250 -27.857 665.929 1.00 111.39 ? 24   GLU C N     1 
ATOM   3742  C  CA    . GLU C 2  24   ? 498.394 -29.156 665.276 1.00 114.72 ? 24   GLU C CA    1 
ATOM   3743  C  C     . GLU C 2  24   ? 498.154 -29.091 663.783 1.00 115.43 ? 24   GLU C C     1 
ATOM   3744  O  O     . GLU C 2  24   ? 498.804 -29.824 663.027 1.00 120.16 ? 24   GLU C O     1 
ATOM   3745  C  CB    . GLU C 2  24   ? 497.443 -30.171 665.913 1.00 116.80 ? 24   GLU C CB    1 
ATOM   3746  C  CG    . GLU C 2  24   ? 498.019 -30.742 667.140 1.00 122.57 ? 24   GLU C CG    1 
ATOM   3747  C  CD    . GLU C 2  24   ? 499.441 -31.140 666.855 1.00 128.67 ? 24   GLU C CD    1 
ATOM   3748  O  OE1   . GLU C 2  24   ? 500.379 -30.650 667.526 1.00 132.21 ? 24   GLU C OE1   1 
ATOM   3749  O  OE2   . GLU C 2  24   ? 499.611 -31.940 665.912 1.00 132.79 ? 24   GLU C OE2   1 
ATOM   3750  N  N     . SER C 2  25   ? 497.235 -28.241 663.337 1.00 109.87 ? 25   SER C N     1 
ATOM   3751  C  CA    . SER C 2  25   ? 496.976 -28.126 661.909 1.00 102.39 ? 25   SER C CA    1 
ATOM   3752  C  C     . SER C 2  25   ? 498.215 -27.661 661.140 1.00 96.74  ? 25   SER C C     1 
ATOM   3753  O  O     . SER C 2  25   ? 498.629 -28.304 660.169 1.00 93.29  ? 25   SER C O     1 
ATOM   3754  C  CB    . SER C 2  25   ? 495.794 -27.179 661.697 1.00 102.68 ? 25   SER C CB    1 
ATOM   3755  O  OG    . SER C 2  25   ? 495.694 -26.750 660.362 1.00 105.01 ? 25   SER C OG    1 
ATOM   3756  N  N     . TYR C 2  26   ? 498.848 -26.569 661.587 1.00 91.87  ? 26   TYR C N     1 
ATOM   3757  C  CA    . TYR C 2  26   ? 500.004 -26.023 660.869 1.00 89.74  ? 26   TYR C CA    1 
ATOM   3758  C  C     . TYR C 2  26   ? 501.240 -26.903 661.005 1.00 94.01  ? 26   TYR C C     1 
ATOM   3759  O  O     . TYR C 2  26   ? 502.038 -27.010 660.075 1.00 95.46  ? 26   TYR C O     1 
ATOM   3760  C  CB    . TYR C 2  26   ? 500.335 -24.634 661.401 1.00 86.88  ? 26   TYR C CB    1 
ATOM   3761  C  CG    . TYR C 2  26   ? 500.922 -23.630 660.427 1.00 85.30  ? 26   TYR C CG    1 
ATOM   3762  C  CD1   . TYR C 2  26   ? 500.230 -23.214 659.302 1.00 85.85  ? 26   TYR C CD1   1 
ATOM   3763  C  CD2   . TYR C 2  26   ? 502.200 -23.138 660.620 1.00 90.72  ? 26   TYR C CD2   1 
ATOM   3764  C  CE1   . TYR C 2  26   ? 500.783 -22.288 658.429 1.00 85.10  ? 26   TYR C CE1   1 
ATOM   3765  C  CE2   . TYR C 2  26   ? 502.762 -22.231 659.757 1.00 89.82  ? 26   TYR C CE2   1 
ATOM   3766  C  CZ    . TYR C 2  26   ? 502.059 -21.810 658.667 1.00 87.37  ? 26   TYR C CZ    1 
ATOM   3767  O  OH    . TYR C 2  26   ? 502.647 -20.892 657.828 1.00 91.57  ? 26   TYR C OH    1 
ATOM   3768  N  N     . ARG C 2  27   ? 501.446 -27.487 662.179 1.00 108.01 ? 27   ARG C N     1 
ATOM   3769  C  CA    . ARG C 2  27   ? 502.578 -28.382 662.386 1.00 112.13 ? 27   ARG C CA    1 
ATOM   3770  C  C     . ARG C 2  27   ? 502.493 -29.502 661.360 1.00 110.76 ? 27   ARG C C     1 
ATOM   3771  O  O     . ARG C 2  27   ? 503.502 -29.883 660.761 1.00 115.85 ? 27   ARG C O     1 
ATOM   3772  C  CB    . ARG C 2  27   ? 502.652 -28.841 663.848 1.00 118.43 ? 27   ARG C CB    1 
ATOM   3773  C  CG    . ARG C 2  27   ? 504.064 -29.274 664.266 1.00 129.32 ? 27   ARG C CG    1 
ATOM   3774  C  CD    . ARG C 2  27   ? 504.160 -30.014 665.598 1.00 138.27 ? 27   ARG C CD    1 
ATOM   3775  N  NE    . ARG C 2  27   ? 503.197 -31.088 665.782 1.00 145.89 ? 27   ARG C NE    1 
ATOM   3776  C  CZ    . ARG C 2  27   ? 503.277 -32.267 665.170 1.00 153.18 ? 27   ARG C CZ    1 
ATOM   3777  N  NH1   . ARG C 2  27   ? 504.281 -32.520 664.337 1.00 158.54 ? 27   ARG C NH1   1 
ATOM   3778  N  NH2   . ARG C 2  27   ? 502.361 -33.197 665.395 1.00 155.45 ? 27   ARG C NH2   1 
ATOM   3779  N  N     . ARG C 2  28   ? 501.283 -30.046 661.162 1.00 105.85 ? 28   ARG C N     1 
ATOM   3780  C  CA    . ARG C 2  28   ? 501.067 -31.102 660.176 1.00 110.44 ? 28   ARG C CA    1 
ATOM   3781  C  C     . ARG C 2  28   ? 501.374 -30.629 658.752 1.00 108.18 ? 28   ARG C C     1 
ATOM   3782  O  O     . ARG C 2  28   ? 501.817 -31.420 657.912 1.00 110.10 ? 28   ARG C O     1 
ATOM   3783  C  CB    . ARG C 2  28   ? 499.589 -31.529 660.252 1.00 108.54 ? 28   ARG C CB    1 
ATOM   3784  C  CG    . ARG C 2  28   ? 499.079 -32.563 659.195 1.00 115.56 ? 28   ARG C CG    1 
ATOM   3785  C  CD    . ARG C 2  28   ? 498.155 -33.739 659.593 1.00 122.92 ? 28   ARG C CD    1 
ATOM   3786  N  NE    . ARG C 2  28   ? 498.595 -34.634 660.656 1.00 132.93 ? 28   ARG C NE    1 
ATOM   3787  C  CZ    . ARG C 2  28   ? 499.259 -35.770 660.430 1.00 143.23 ? 28   ARG C CZ    1 
ATOM   3788  N  NH1   . ARG C 2  28   ? 499.547 -36.145 659.185 1.00 147.04 ? 28   ARG C NH1   1 
ATOM   3789  N  NH2   . ARG C 2  28   ? 499.625 -36.551 661.441 1.00 148.17 ? 28   ARG C NH2   1 
ATOM   3790  N  N     . ALA C 2  29   ? 501.072 -29.377 658.428 1.00 108.86 ? 29   ALA C N     1 
ATOM   3791  C  CA    . ALA C 2  29   ? 501.369 -28.885 657.087 1.00 103.30 ? 29   ALA C CA    1 
ATOM   3792  C  C     . ALA C 2  29   ? 502.872 -28.740 656.834 1.00 108.78 ? 29   ALA C C     1 
ATOM   3793  O  O     . ALA C 2  29   ? 503.378 -29.159 655.783 1.00 116.61 ? 29   ALA C O     1 
ATOM   3794  C  CB    . ALA C 2  29   ? 500.654 -27.559 656.838 1.00 102.07 ? 29   ALA C CB    1 
ATOM   3795  N  N     . LEU C 2  30   ? 503.610 -28.156 657.796 1.00 103.34 ? 30   LEU C N     1 
ATOM   3796  C  CA    . LEU C 2  30   ? 505.036 -27.916 657.572 1.00 97.40  ? 30   LEU C CA    1 
ATOM   3797  C  C     . LEU C 2  30   ? 505.927 -29.118 657.814 1.00 93.80  ? 30   LEU C C     1 
ATOM   3798  O  O     . LEU C 2  30   ? 506.895 -29.307 657.082 1.00 98.42  ? 30   LEU C O     1 
ATOM   3799  C  CB    . LEU C 2  30   ? 505.519 -26.782 658.471 1.00 94.57  ? 30   LEU C CB    1 
ATOM   3800  C  CG    . LEU C 2  30   ? 504.804 -25.447 658.238 1.00 92.34  ? 30   LEU C CG    1 
ATOM   3801  C  CD1   . LEU C 2  30   ? 505.466 -24.284 658.989 1.00 86.08  ? 30   LEU C CD1   1 
ATOM   3802  C  CD2   . LEU C 2  30   ? 504.582 -25.135 656.752 1.00 96.30  ? 30   LEU C CD2   1 
ATOM   3803  N  N     . GLN C 2  31   ? 505.628 -29.950 658.795 1.00 95.41  ? 31   GLN C N     1 
ATOM   3804  C  CA    . GLN C 2  31   ? 506.507 -31.072 659.105 1.00 101.45 ? 31   GLN C CA    1 
ATOM   3805  C  C     . GLN C 2  31   ? 507.973 -30.629 659.202 1.00 108.12 ? 31   GLN C C     1 
ATOM   3806  O  O     . GLN C 2  31   ? 508.884 -31.358 658.800 1.00 109.02 ? 31   GLN C O     1 
ATOM   3807  C  CB    . GLN C 2  31   ? 506.350 -32.182 658.066 1.00 101.09 ? 31   GLN C CB    1 
ATOM   3808  C  CG    . GLN C 2  31   ? 504.922 -32.529 657.740 1.00 98.64  ? 31   GLN C CG    1 
ATOM   3809  C  CD    . GLN C 2  31   ? 504.814 -33.582 656.657 1.00 102.19 ? 31   GLN C CD    1 
ATOM   3810  O  OE1   . GLN C 2  31   ? 505.256 -34.727 656.829 1.00 104.35 ? 31   GLN C OE1   1 
ATOM   3811  N  NE2   . GLN C 2  31   ? 504.227 -33.197 655.522 1.00 99.41  ? 31   GLN C NE2   1 
ATOM   3812  N  N     . ALA C 2  32   ? 508.225 -29.465 659.814 1.00 114.60 ? 32   ALA C N     1 
ATOM   3813  C  CA    . ALA C 2  32   ? 509.588 -28.924 659.800 1.00 122.57 ? 32   ALA C CA    1 
ATOM   3814  C  C     . ALA C 2  32   ? 510.493 -29.776 660.669 1.00 131.56 ? 32   ALA C C     1 
ATOM   3815  O  O     . ALA C 2  32   ? 511.698 -29.890 660.414 1.00 127.72 ? 32   ALA C O     1 
ATOM   3816  C  CB    . ALA C 2  32   ? 509.615 -27.470 660.258 1.00 98.75  ? 32   ALA C CB    1 
ATOM   3817  N  N     . ASP C 2  33   ? 509.940 -30.292 661.749 1.00 148.04 ? 33   ASP C N     1 
ATOM   3818  C  CA    . ASP C 2  33   ? 510.633 -31.093 662.731 1.00 162.08 ? 33   ASP C CA    1 
ATOM   3819  C  C     . ASP C 2  33   ? 510.672 -32.566 662.338 1.00 166.33 ? 33   ASP C C     1 
ATOM   3820  O  O     . ASP C 2  33   ? 511.164 -33.380 663.115 1.00 175.36 ? 33   ASP C O     1 
ATOM   3821  C  CB    . ASP C 2  33   ? 509.949 -30.916 664.084 1.00 170.97 ? 33   ASP C CB    1 
ATOM   3822  C  CG    . ASP C 2  33   ? 510.354 -29.626 664.765 1.00 180.25 ? 33   ASP C CG    1 
ATOM   3823  O  OD1   . ASP C 2  33   ? 510.746 -28.682 664.037 1.00 181.69 ? 33   ASP C OD1   1 
ATOM   3824  O  OD2   . ASP C 2  33   ? 510.263 -29.549 666.012 1.00 183.13 ? 33   ASP C OD2   1 
ATOM   3825  N  N     . VAL C 2  34   ? 510.095 -32.935 661.195 1.00 146.87 ? 34   VAL C N     1 
ATOM   3826  C  CA    . VAL C 2  34   ? 510.195 -34.287 660.638 1.00 133.19 ? 34   VAL C CA    1 
ATOM   3827  C  C     . VAL C 2  34   ? 511.376 -34.370 659.673 1.00 132.74 ? 34   VAL C C     1 
ATOM   3828  O  O     . VAL C 2  34   ? 511.523 -33.478 658.823 1.00 134.25 ? 34   VAL C O     1 
ATOM   3829  C  CB    . VAL C 2  34   ? 508.909 -34.692 659.906 1.00 122.38 ? 34   VAL C CB    1 
ATOM   3830  C  CG1   . VAL C 2  34   ? 509.082 -36.055 659.270 1.00 124.68 ? 34   VAL C CG1   1 
ATOM   3831  C  CG2   . VAL C 2  34   ? 507.729 -34.677 660.830 1.00 122.85 ? 34   VAL C CG2   1 
ATOM   3832  N  N     . PRO C 2  35   ? 512.252 -35.374 659.758 1.00 131.00 ? 35   PRO C N     1 
ATOM   3833  C  CA    . PRO C 2  35   ? 513.283 -35.515 658.735 1.00 131.87 ? 35   PRO C CA    1 
ATOM   3834  C  C     . PRO C 2  35   ? 512.668 -35.838 657.387 1.00 135.52 ? 35   PRO C C     1 
ATOM   3835  O  O     . PRO C 2  35   ? 511.843 -36.757 657.279 1.00 141.01 ? 35   PRO C O     1 
ATOM   3836  C  CB    . PRO C 2  35   ? 514.121 -36.699 659.232 1.00 128.30 ? 35   PRO C CB    1 
ATOM   3837  C  CG    . PRO C 2  35   ? 513.258 -37.403 660.197 1.00 130.88 ? 35   PRO C CG    1 
ATOM   3838  C  CD    . PRO C 2  35   ? 512.424 -36.358 660.837 1.00 130.19 ? 35   PRO C CD    1 
ATOM   3839  N  N     . PRO C 2  36   ? 513.091 -35.125 656.337 1.00 136.53 ? 36   PRO C N     1 
ATOM   3840  C  CA    . PRO C 2  36   ? 512.415 -35.183 655.025 1.00 130.02 ? 36   PRO C CA    1 
ATOM   3841  C  C     . PRO C 2  36   ? 512.049 -36.556 654.488 1.00 130.95 ? 36   PRO C C     1 
ATOM   3842  O  O     . PRO C 2  36   ? 510.957 -36.699 653.924 1.00 128.49 ? 36   PRO C O     1 
ATOM   3843  C  CB    . PRO C 2  36   ? 513.406 -34.463 654.111 1.00 130.29 ? 36   PRO C CB    1 
ATOM   3844  C  CG    . PRO C 2  36   ? 513.980 -33.427 654.994 1.00 132.49 ? 36   PRO C CG    1 
ATOM   3845  C  CD    . PRO C 2  36   ? 514.020 -33.989 656.405 1.00 135.04 ? 36   PRO C CD    1 
ATOM   3846  N  N     . GLU C 2  37   ? 512.907 -37.571 654.634 1.00 136.60 ? 37   GLU C N     1 
ATOM   3847  C  CA    . GLU C 2  37   ? 512.547 -38.858 654.046 1.00 143.78 ? 37   GLU C CA    1 
ATOM   3848  C  C     . GLU C 2  37   ? 511.339 -39.483 654.731 1.00 145.55 ? 37   GLU C C     1 
ATOM   3849  O  O     . GLU C 2  37   ? 510.616 -40.257 654.095 1.00 149.98 ? 37   GLU C O     1 
ATOM   3850  C  CB    . GLU C 2  37   ? 513.711 -39.868 654.076 1.00 154.36 ? 37   GLU C CB    1 
ATOM   3851  C  CG    . GLU C 2  37   ? 514.280 -40.231 655.443 1.00 162.78 ? 37   GLU C CG    1 
ATOM   3852  C  CD    . GLU C 2  37   ? 515.313 -39.263 655.955 1.00 168.34 ? 37   GLU C CD    1 
ATOM   3853  O  OE1   . GLU C 2  37   ? 515.767 -38.406 655.161 1.00 168.29 ? 37   GLU C OE1   1 
ATOM   3854  O  OE2   . GLU C 2  37   ? 515.660 -39.365 657.159 1.00 171.65 ? 37   GLU C OE2   1 
ATOM   3855  N  N     . LYS C 2  38   ? 511.066 -39.123 655.978 1.00 138.83 ? 38   LYS C N     1 
ATOM   3856  C  CA    . LYS C 2  38   ? 509.980 -39.713 656.743 1.00 139.03 ? 38   LYS C CA    1 
ATOM   3857  C  C     . LYS C 2  38   ? 508.691 -38.897 656.678 1.00 135.23 ? 38   LYS C C     1 
ATOM   3858  O  O     . LYS C 2  38   ? 507.702 -39.264 657.327 1.00 133.50 ? 38   LYS C O     1 
ATOM   3859  C  CB    . LYS C 2  38   ? 510.417 -39.890 658.200 1.00 135.26 ? 38   LYS C CB    1 
ATOM   3860  C  CG    . LYS C 2  38   ? 511.279 -41.108 658.436 1.00 137.39 ? 38   LYS C CG    1 
ATOM   3861  C  CD    . LYS C 2  38   ? 512.245 -40.886 659.576 1.00 141.08 ? 38   LYS C CD    1 
ATOM   3862  C  CE    . LYS C 2  38   ? 511.539 -40.792 660.899 1.00 138.50 ? 38   LYS C CE    1 
ATOM   3863  N  NZ    . LYS C 2  38   ? 512.525 -40.490 661.971 1.00 141.23 ? 38   LYS C NZ    1 
ATOM   3864  N  N     . ARG C 2  39   ? 508.653 -37.847 655.862 1.00 132.93 ? 39   ARG C N     1 
ATOM   3865  C  CA    . ARG C 2  39   ? 507.462 -37.021 655.792 1.00 128.38 ? 39   ARG C CA    1 
ATOM   3866  C  C     . ARG C 2  39   ? 506.365 -37.790 655.069 1.00 132.92 ? 39   ARG C C     1 
ATOM   3867  O  O     . ARG C 2  39   ? 506.633 -38.487 654.083 1.00 133.56 ? 39   ARG C O     1 
ATOM   3868  C  CB    . ARG C 2  39   ? 507.781 -35.722 655.040 1.00 121.57 ? 39   ARG C CB    1 
ATOM   3869  C  CG    . ARG C 2  39   ? 508.709 -34.757 655.795 1.00 115.94 ? 39   ARG C CG    1 
ATOM   3870  C  CD    . ARG C 2  39   ? 508.672 -33.325 655.245 1.00 109.35 ? 39   ARG C CD    1 
ATOM   3871  N  NE    . ARG C 2  39   ? 509.536 -32.435 656.023 1.00 110.95 ? 39   ARG C NE    1 
ATOM   3872  C  CZ    . ARG C 2  39   ? 510.684 -31.923 655.576 1.00 117.05 ? 39   ARG C CZ    1 
ATOM   3873  N  NH1   . ARG C 2  39   ? 511.093 -32.214 654.352 1.00 126.53 ? 39   ARG C NH1   1 
ATOM   3874  N  NH2   . ARG C 2  39   ? 511.432 -31.131 656.341 1.00 113.57 ? 39   ARG C NH2   1 
ATOM   3875  N  N     . GLU C 2  40   ? 505.131 -37.689 655.594 1.00 133.44 ? 40   GLU C N     1 
ATOM   3876  C  CA    . GLU C 2  40   ? 503.932 -38.186 654.922 1.00 136.82 ? 40   GLU C CA    1 
ATOM   3877  C  C     . GLU C 2  40   ? 503.516 -37.212 653.834 1.00 135.06 ? 40   GLU C C     1 
ATOM   3878  O  O     . GLU C 2  40   ? 503.791 -36.014 653.909 1.00 133.36 ? 40   GLU C O     1 
ATOM   3879  C  CB    . GLU C 2  40   ? 502.774 -38.416 655.891 1.00 139.62 ? 40   GLU C CB    1 
ATOM   3880  C  CG    . GLU C 2  40   ? 503.045 -39.464 656.945 1.00 147.91 ? 40   GLU C CG    1 
ATOM   3881  C  CD    . GLU C 2  40   ? 503.831 -38.924 658.109 1.00 152.42 ? 40   GLU C CD    1 
ATOM   3882  O  OE1   . GLU C 2  40   ? 503.580 -37.755 658.495 1.00 150.36 ? 40   GLU C OE1   1 
ATOM   3883  O  OE2   . GLU C 2  40   ? 504.708 -39.663 658.617 1.00 157.27 ? 40   GLU C OE2   1 
ATOM   3884  N  N     . ASN C 2  41   ? 502.720 -37.705 652.889 1.00 143.20 ? 41   ASN C N     1 
ATOM   3885  C  CA    . ASN C 2  41   ? 502.322 -36.870 651.757 1.00 144.34 ? 41   ASN C CA    1 
ATOM   3886  C  C     . ASN C 2  41   ? 501.067 -36.078 652.112 1.00 143.48 ? 41   ASN C C     1 
ATOM   3887  O  O     . ASN C 2  41   ? 499.940 -36.501 651.859 1.00 148.20 ? 41   ASN C O     1 
ATOM   3888  C  CB    . ASN C 2  41   ? 502.112 -37.783 650.549 1.00 151.27 ? 41   ASN C CB    1 
ATOM   3889  C  CG    . ASN C 2  41   ? 501.755 -37.037 649.288 1.00 155.54 ? 41   ASN C CG    1 
ATOM   3890  O  OD1   . ASN C 2  41   ? 501.912 -35.832 649.212 1.00 152.36 ? 41   ASN C OD1   1 
ATOM   3891  N  ND2   . ASN C 2  41   ? 501.290 -37.765 648.273 1.00 160.95 ? 41   ASN C ND2   1 
ATOM   3892  N  N     . VAL C 2  42   ? 501.294 -34.854 652.598 1.00 131.94 ? 42   VAL C N     1 
ATOM   3893  C  CA    . VAL C 2  42   ? 500.254 -33.978 653.140 1.00 120.74 ? 42   VAL C CA    1 
ATOM   3894  C  C     . VAL C 2  42   ? 500.869 -32.591 653.163 1.00 118.85 ? 42   VAL C C     1 
ATOM   3895  O  O     . VAL C 2  42   ? 502.095 -32.441 653.154 1.00 123.32 ? 42   VAL C O     1 
ATOM   3896  C  CB    . VAL C 2  42   ? 499.754 -34.351 654.566 1.00 110.98 ? 42   VAL C CB    1 
ATOM   3897  C  CG1   . VAL C 2  42   ? 499.072 -35.709 654.641 1.00 111.04 ? 42   VAL C CG1   1 
ATOM   3898  C  CG2   . VAL C 2  42   ? 500.856 -34.229 655.578 1.00 112.31 ? 42   VAL C CG2   1 
ATOM   3899  N  N     . GLY C 2  43   ? 500.020 -31.573 653.235 1.00 115.09 ? 43   GLY C N     1 
ATOM   3900  C  CA    . GLY C 2  43   ? 500.523 -30.216 653.342 1.00 114.84 ? 43   GLY C CA    1 
ATOM   3901  C  C     . GLY C 2  43   ? 501.529 -29.846 652.277 1.00 112.49 ? 43   GLY C C     1 
ATOM   3902  O  O     . GLY C 2  43   ? 501.372 -30.161 651.094 1.00 113.82 ? 43   GLY C O     1 
ATOM   3903  N  N     . ILE C 2  44   ? 502.562 -29.122 652.707 1.00 116.99 ? 44   ILE C N     1 
ATOM   3904  C  CA    . ILE C 2  44   ? 503.641 -28.708 651.816 1.00 122.31 ? 44   ILE C CA    1 
ATOM   3905  C  C     . ILE C 2  44   ? 504.169 -29.876 650.994 1.00 130.36 ? 44   ILE C C     1 
ATOM   3906  O  O     . ILE C 2  44   ? 504.317 -29.775 649.769 1.00 133.74 ? 44   ILE C O     1 
ATOM   3907  C  CB    . ILE C 2  44   ? 504.769 -28.084 652.655 1.00 130.13 ? 44   ILE C CB    1 
ATOM   3908  C  CG1   . ILE C 2  44   ? 504.313 -26.749 653.206 1.00 129.21 ? 44   ILE C CG1   1 
ATOM   3909  C  CG2   . ILE C 2  44   ? 506.061 -27.988 651.869 1.00 139.04 ? 44   ILE C CG2   1 
ATOM   3910  C  CD1   . ILE C 2  44   ? 503.526 -26.005 652.211 1.00 127.82 ? 44   ILE C CD1   1 
ATOM   3911  N  N     . GLN C 2  45   ? 504.442 -31.009 651.650 1.00 128.66 ? 45   GLN C N     1 
ATOM   3912  C  CA    . GLN C 2  45   ? 504.932 -32.179 650.930 1.00 127.73 ? 45   GLN C CA    1 
ATOM   3913  C  C     . GLN C 2  45   ? 504.014 -32.543 649.776 1.00 128.39 ? 45   GLN C C     1 
ATOM   3914  O  O     . GLN C 2  45   ? 504.450 -32.654 648.628 1.00 129.71 ? 45   GLN C O     1 
ATOM   3915  C  CB    . GLN C 2  45   ? 505.088 -33.364 651.879 1.00 132.47 ? 45   GLN C CB    1 
ATOM   3916  C  CG    . GLN C 2  45   ? 506.540 -33.690 652.222 1.00 138.52 ? 45   GLN C CG    1 
ATOM   3917  C  CD    . GLN C 2  45   ? 507.329 -34.173 651.022 1.00 142.84 ? 45   GLN C CD    1 
ATOM   3918  O  OE1   . GLN C 2  45   ? 506.928 -35.126 650.358 1.00 146.41 ? 45   GLN C OE1   1 
ATOM   3919  N  NE2   . GLN C 2  45   ? 508.458 -33.518 650.736 1.00 142.90 ? 45   GLN C NE2   1 
ATOM   3920  N  N     . ALA C 2  46   ? 502.716 -32.636 650.055 1.00 125.00 ? 46   ALA C N     1 
ATOM   3921  C  CA    . ALA C 2  46   ? 501.752 -32.991 649.023 1.00 128.35 ? 46   ALA C CA    1 
ATOM   3922  C  C     . ALA C 2  46   ? 501.701 -31.981 647.888 1.00 116.44 ? 46   ALA C C     1 
ATOM   3923  O  O     . ALA C 2  46   ? 501.548 -32.368 646.727 1.00 100.65 ? 46   ALA C O     1 
ATOM   3924  C  CB    . ALA C 2  46   ? 500.372 -33.151 649.657 1.00 120.57 ? 46   ALA C CB    1 
ATOM   3925  N  N     . ALA C 2  47   ? 501.875 -30.693 648.194 1.00 115.20 ? 47   ALA C N     1 
ATOM   3926  C  CA    . ALA C 2  47   ? 501.887 -29.664 647.155 1.00 117.35 ? 47   ALA C CA    1 
ATOM   3927  C  C     . ALA C 2  47   ? 503.026 -29.874 646.175 1.00 125.46 ? 47   ALA C C     1 
ATOM   3928  O  O     . ALA C 2  47   ? 502.839 -29.798 644.953 1.00 128.42 ? 47   ALA C O     1 
ATOM   3929  C  CB    . ALA C 2  47   ? 501.993 -28.276 647.784 1.00 114.96 ? 47   ALA C CB    1 
ATOM   3930  N  N     . PHE C 2  48   ? 504.222 -30.123 646.697 1.00 130.30 ? 48   PHE C N     1 
ATOM   3931  C  CA    . PHE C 2  48   ? 505.361 -30.377 645.831 1.00 134.03 ? 48   PHE C CA    1 
ATOM   3932  C  C     . PHE C 2  48   ? 505.076 -31.609 644.969 1.00 138.72 ? 48   PHE C C     1 
ATOM   3933  O  O     . PHE C 2  48   ? 505.143 -31.551 643.737 1.00 144.96 ? 48   PHE C O     1 
ATOM   3934  C  CB    . PHE C 2  48   ? 506.607 -30.560 646.708 1.00 135.85 ? 48   PHE C CB    1 
ATOM   3935  C  CG    . PHE C 2  48   ? 507.305 -29.246 647.101 1.00 131.92 ? 48   PHE C CG    1 
ATOM   3936  C  CD1   . PHE C 2  48   ? 508.085 -28.523 646.201 1.00 128.78 ? 48   PHE C CD1   1 
ATOM   3937  C  CD2   . PHE C 2  48   ? 507.173 -28.752 648.413 1.00 125.09 ? 48   PHE C CD2   1 
ATOM   3938  C  CE1   . PHE C 2  48   ? 508.721 -27.336 646.594 1.00 124.96 ? 48   PHE C CE1   1 
ATOM   3939  C  CE2   . PHE C 2  48   ? 507.795 -27.569 648.807 1.00 120.08 ? 48   PHE C CE2   1 
ATOM   3940  C  CZ    . PHE C 2  48   ? 508.567 -26.860 647.892 1.00 122.77 ? 48   PHE C CZ    1 
ATOM   3941  N  N     . ARG C 2  49   ? 504.625 -32.695 645.603 1.00 136.27 ? 49   ARG C N     1 
ATOM   3942  C  CA    . ARG C 2  49   ? 504.317 -33.943 644.905 1.00 136.94 ? 49   ARG C CA    1 
ATOM   3943  C  C     . ARG C 2  49   ? 503.246 -33.779 643.830 1.00 130.96 ? 49   ARG C C     1 
ATOM   3944  O  O     . ARG C 2  49   ? 503.265 -34.492 642.823 1.00 133.10 ? 49   ARG C O     1 
ATOM   3945  C  CB    . ARG C 2  49   ? 503.847 -34.958 645.942 1.00 143.31 ? 49   ARG C CB    1 
ATOM   3946  C  CG    . ARG C 2  49   ? 504.896 -35.366 646.956 1.00 151.40 ? 49   ARG C CG    1 
ATOM   3947  C  CD    . ARG C 2  49   ? 505.838 -36.332 646.310 1.00 166.37 ? 49   ARG C CD    1 
ATOM   3948  N  NE    . ARG C 2  49   ? 505.083 -37.565 646.095 1.00 180.03 ? 49   ARG C NE    1 
ATOM   3949  C  CZ    . ARG C 2  49   ? 504.539 -37.941 644.937 1.00 191.29 ? 49   ARG C CZ    1 
ATOM   3950  N  NH1   . ARG C 2  49   ? 504.673 -37.189 643.845 1.00 193.71 ? 49   ARG C NH1   1 
ATOM   3951  N  NH2   . ARG C 2  49   ? 503.852 -39.074 644.877 1.00 197.01 ? 49   ARG C NH2   1 
ATOM   3952  N  N     . GLU C 2  50   ? 502.308 -32.858 644.015 1.00 126.04 ? 50   GLU C N     1 
ATOM   3953  C  CA    . GLU C 2  50   ? 501.309 -32.646 642.979 1.00 128.84 ? 50   GLU C CA    1 
ATOM   3954  C  C     . GLU C 2  50   ? 501.890 -31.880 641.802 1.00 132.53 ? 50   GLU C C     1 
ATOM   3955  O  O     . GLU C 2  50   ? 501.722 -32.286 640.645 1.00 139.38 ? 50   GLU C O     1 
ATOM   3956  C  CB    . GLU C 2  50   ? 500.103 -31.893 643.554 1.00 128.03 ? 50   GLU C CB    1 
ATOM   3957  C  CG    . GLU C 2  50   ? 498.724 -32.432 643.140 1.00 130.31 ? 50   GLU C CG    1 
ATOM   3958  C  CD    . GLU C 2  50   ? 497.590 -31.903 644.021 1.00 126.21 ? 50   GLU C CD    1 
ATOM   3959  O  OE1   . GLU C 2  50   ? 497.894 -31.293 645.074 1.00 120.49 ? 50   GLU C OE1   1 
ATOM   3960  O  OE2   . GLU C 2  50   ? 496.403 -32.067 643.638 1.00 127.80 ? 50   GLU C OE2   1 
ATOM   3961  N  N     . THR C 2  51   ? 502.646 -30.819 642.091 1.00 127.09 ? 51   THR C N     1 
ATOM   3962  C  CA    . THR C 2  51   ? 503.164 -29.962 641.031 1.00 123.85 ? 51   THR C CA    1 
ATOM   3963  C  C     . THR C 2  51   ? 504.267 -30.642 640.224 1.00 129.15 ? 51   THR C C     1 
ATOM   3964  O  O     . THR C 2  51   ? 504.384 -30.377 639.023 1.00 135.45 ? 51   THR C O     1 
ATOM   3965  C  CB    . THR C 2  51   ? 503.620 -28.616 641.602 1.00 117.79 ? 51   THR C CB    1 
ATOM   3966  O  OG1   . THR C 2  51   ? 502.583 -28.075 642.428 1.00 112.23 ? 51   THR C OG1   1 
ATOM   3967  C  CG2   . THR C 2  51   ? 503.897 -27.622 640.483 1.00 118.87 ? 51   THR C CG2   1 
ATOM   3968  N  N     . PHE C 2  52   ? 505.063 -31.557 640.836 1.00 125.62 ? 52   PHE C N     1 
ATOM   3969  C  CA    . PHE C 2  52   ? 506.180 -32.105 640.060 1.00 129.09 ? 52   PHE C CA    1 
ATOM   3970  C  C     . PHE C 2  52   ? 505.995 -33.576 639.725 1.00 132.27 ? 52   PHE C C     1 
ATOM   3971  O  O     . PHE C 2  52   ? 505.329 -34.318 640.465 1.00 128.47 ? 52   PHE C O     1 
ATOM   3972  C  CB    . PHE C 2  52   ? 507.535 -31.960 640.763 1.00 127.79 ? 52   PHE C CB    1 
ATOM   3973  C  CG    . PHE C 2  52   ? 508.016 -30.557 640.864 1.00 125.92 ? 52   PHE C CG    1 
ATOM   3974  C  CD1   . PHE C 2  52   ? 507.681 -29.751 641.924 1.00 115.63 ? 52   PHE C CD1   1 
ATOM   3975  C  CD2   . PHE C 2  52   ? 508.830 -30.040 639.860 1.00 132.87 ? 52   PHE C CD2   1 
ATOM   3976  C  CE1   . PHE C 2  52   ? 508.147 -28.447 641.997 1.00 111.81 ? 52   PHE C CE1   1 
ATOM   3977  C  CE2   . PHE C 2  52   ? 509.299 -28.737 639.928 1.00 130.89 ? 52   PHE C CE2   1 
ATOM   3978  C  CZ    . PHE C 2  52   ? 508.951 -27.938 641.012 1.00 119.14 ? 52   PHE C CZ    1 
ATOM   3979  N  N     . PRO C 2  53   ? 506.623 -34.036 638.606 1.00 131.87 ? 53   PRO C N     1 
ATOM   3980  C  CA    . PRO C 2  53   ? 507.525 -33.361 637.639 1.00 130.59 ? 53   PRO C CA    1 
ATOM   3981  C  C     . PRO C 2  53   ? 506.938 -32.379 636.594 1.00 133.24 ? 53   PRO C C     1 
ATOM   3982  O  O     . PRO C 2  53   ? 505.785 -32.553 636.189 1.00 131.04 ? 53   PRO C O     1 
ATOM   3983  C  CB    . PRO C 2  53   ? 508.162 -34.534 636.897 1.00 136.49 ? 53   PRO C CB    1 
ATOM   3984  C  CG    . PRO C 2  53   ? 507.177 -35.601 636.979 1.00 138.31 ? 53   PRO C CG    1 
ATOM   3985  C  CD    . PRO C 2  53   ? 506.505 -35.472 638.302 1.00 132.15 ? 53   PRO C CD    1 
ATOM   3986  N  N     . ILE C 2  54   ? 507.713 -31.344 636.235 1.00 137.45 ? 54   ILE C N     1 
ATOM   3987  C  CA    . ILE C 2  54   ? 507.334 -30.344 635.227 1.00 145.42 ? 54   ILE C CA    1 
ATOM   3988  C  C     . ILE C 2  54   ? 507.828 -30.718 633.819 1.00 157.37 ? 54   ILE C C     1 
ATOM   3989  O  O     . ILE C 2  54   ? 509.028 -30.640 633.528 1.00 160.37 ? 54   ILE C O     1 
ATOM   3990  C  CB    . ILE C 2  54   ? 507.896 -28.965 635.610 1.00 133.05 ? 54   ILE C CB    1 
ATOM   3991  C  CG1   . ILE C 2  54   ? 507.444 -28.532 636.994 1.00 117.04 ? 54   ILE C CG1   1 
ATOM   3992  C  CG2   . ILE C 2  54   ? 507.540 -27.912 634.570 1.00 129.71 ? 54   ILE C CG2   1 
ATOM   3993  C  CD1   . ILE C 2  54   ? 505.989 -28.160 637.050 1.00 128.70 ? 54   ILE C CD1   1 
ATOM   3994  N  N     . GLU C 2  55   ? 506.896 -31.112 632.940 1.00 171.98 ? 55   GLU C N     1 
ATOM   3995  C  CA    . GLU C 2  55   ? 507.168 -31.762 631.658 1.00 181.80 ? 55   GLU C CA    1 
ATOM   3996  C  C     . GLU C 2  55   ? 507.455 -30.707 630.575 1.00 184.42 ? 55   GLU C C     1 
ATOM   3997  O  O     . GLU C 2  55   ? 507.152 -29.524 630.746 1.00 187.08 ? 55   GLU C O     1 
ATOM   3998  C  CB    . GLU C 2  55   ? 506.012 -32.683 631.288 1.00 183.90 ? 55   GLU C CB    1 
ATOM   3999  C  CG    . GLU C 2  55   ? 505.823 -33.759 632.352 1.00 183.15 ? 55   GLU C CG    1 
ATOM   4000  C  CD    . GLU C 2  55   ? 506.263 -35.138 631.908 1.00 187.26 ? 55   GLU C CD    1 
ATOM   4001  O  OE1   . GLU C 2  55   ? 506.064 -36.077 632.716 1.00 184.45 ? 55   GLU C OE1   1 
ATOM   4002  O  OE2   . GLU C 2  55   ? 506.797 -35.282 630.773 1.00 190.59 ? 55   GLU C OE2   1 
ATOM   4003  N  N     . GLU C 2  56   ? 507.979 -31.137 629.421 1.00 176.67 ? 56   GLU C N     1 
ATOM   4004  C  CA    . GLU C 2  56   ? 508.411 -30.164 628.400 1.00 164.65 ? 56   GLU C CA    1 
ATOM   4005  C  C     . GLU C 2  56   ? 507.265 -29.797 627.456 1.00 150.83 ? 56   GLU C C     1 
ATOM   4006  O  O     . GLU C 2  56   ? 506.799 -28.655 627.449 1.00 141.81 ? 56   GLU C O     1 
ATOM   4007  C  CB    . GLU C 2  56   ? 509.648 -30.692 627.619 1.00 171.71 ? 56   GLU C CB    1 
ATOM   4008  C  CG    . GLU C 2  56   ? 509.658 -30.743 626.051 1.00 180.34 ? 56   GLU C CG    1 
ATOM   4009  C  CD    . GLU C 2  56   ? 508.885 -31.911 625.405 1.00 184.35 ? 56   GLU C CD    1 
ATOM   4010  O  OE1   . GLU C 2  56   ? 507.842 -32.323 625.964 1.00 185.73 ? 56   GLU C OE1   1 
ATOM   4011  O  OE2   . GLU C 2  56   ? 509.325 -32.409 624.327 1.00 183.69 ? 56   GLU C OE2   1 
ATOM   4012  N  N     . LEU C 2  64   ? 512.785 -32.474 628.080 1.00 194.68 ? 64   LEU C N     1 
ATOM   4013  C  CA    . LEU C 2  64   ? 513.078 -31.620 629.230 1.00 195.99 ? 64   LEU C CA    1 
ATOM   4014  C  C     . LEU C 2  64   ? 512.184 -31.969 630.450 1.00 200.24 ? 64   LEU C C     1 
ATOM   4015  O  O     . LEU C 2  64   ? 510.955 -31.958 630.337 1.00 207.06 ? 64   LEU C O     1 
ATOM   4016  C  CB    . LEU C 2  64   ? 512.864 -30.174 628.812 1.00 194.58 ? 64   LEU C CB    1 
ATOM   4017  C  CG    . LEU C 2  64   ? 513.985 -29.518 628.034 1.00 191.87 ? 64   LEU C CG    1 
ATOM   4018  C  CD1   . LEU C 2  64   ? 513.548 -28.126 627.658 1.00 191.30 ? 64   LEU C CD1   1 
ATOM   4019  C  CD2   . LEU C 2  64   ? 515.180 -29.475 628.947 1.00 185.74 ? 64   LEU C CD2   1 
ATOM   4020  N  N     . VAL C 2  65   ? 512.783 -32.212 631.623 1.00 195.02 ? 65   VAL C N     1 
ATOM   4021  C  CA    . VAL C 2  65   ? 512.042 -32.508 632.854 1.00 192.78 ? 65   VAL C CA    1 
ATOM   4022  C  C     . VAL C 2  65   ? 512.670 -31.868 634.090 1.00 166.42 ? 65   VAL C C     1 
ATOM   4023  O  O     . VAL C 2  65   ? 513.851 -32.089 634.368 1.00 158.21 ? 65   VAL C O     1 
ATOM   4024  C  CB    . VAL C 2  65   ? 511.934 -34.029 633.076 1.00 143.94 ? 65   VAL C CB    1 
ATOM   4025  C  CG1   . VAL C 2  65   ? 511.502 -34.343 634.503 1.00 140.69 ? 65   VAL C CG1   1 
ATOM   4026  C  CG2   . VAL C 2  65   ? 510.951 -34.632 632.095 1.00 145.96 ? 65   VAL C CG2   1 
ATOM   4027  N  N     . LEU C 2  66   ? 511.874 -31.115 634.856 1.00 149.07 ? 66   LEU C N     1 
ATOM   4028  C  CA    . LEU C 2  66   ? 512.303 -30.476 636.106 1.00 142.33 ? 66   LEU C CA    1 
ATOM   4029  C  C     . LEU C 2  66   ? 511.641 -31.297 637.207 1.00 144.21 ? 66   LEU C C     1 
ATOM   4030  O  O     . LEU C 2  66   ? 510.411 -31.352 637.294 1.00 148.93 ? 66   LEU C O     1 
ATOM   4031  C  CB    . LEU C 2  66   ? 511.909 -29.001 636.210 1.00 137.82 ? 66   LEU C CB    1 
ATOM   4032  C  CG    . LEU C 2  66   ? 512.437 -28.262 637.458 1.00 130.59 ? 66   LEU C CG    1 
ATOM   4033  C  CD1   . LEU C 2  66   ? 513.899 -28.600 637.683 1.00 132.14 ? 66   LEU C CD1   1 
ATOM   4034  C  CD2   . LEU C 2  66   ? 512.243 -26.742 637.389 1.00 126.95 ? 66   LEU C CD2   1 
ATOM   4035  N  N     . ASP C 2  67   ? 512.441 -31.861 638.089 1.00 146.74 ? 67   ASP C N     1 
ATOM   4036  C  CA    . ASP C 2  67   ? 511.938 -32.778 639.091 1.00 146.55 ? 67   ASP C CA    1 
ATOM   4037  C  C     . ASP C 2  67   ? 512.167 -32.283 640.509 1.00 126.01 ? 67   ASP C C     1 
ATOM   4038  O  O     . ASP C 2  67   ? 513.042 -31.458 640.769 1.00 125.70 ? 67   ASP C O     1 
ATOM   4039  C  CB    . ASP C 2  67   ? 512.652 -34.117 638.894 1.00 151.92 ? 67   ASP C CB    1 
ATOM   4040  C  CG    . ASP C 2  67   ? 511.844 -35.294 639.346 1.00 149.58 ? 67   ASP C CG    1 
ATOM   4041  O  OD1   . ASP C 2  67   ? 511.843 -36.277 638.567 1.00 167.24 ? 67   ASP C OD1   1 
ATOM   4042  O  OD2   . ASP C 2  67   ? 511.213 -35.240 640.430 1.00 143.03 ? 67   ASP C OD2   1 
ATOM   4043  N  N     . PHE C 2  68   ? 511.274 -32.685 641.401 1.00 128.18 ? 68   PHE C N     1 
ATOM   4044  C  CA    . PHE C 2  68   ? 511.312 -32.259 642.794 1.00 124.77 ? 68   PHE C CA    1 
ATOM   4045  C  C     . PHE C 2  68   ? 512.038 -33.264 643.671 1.00 127.89 ? 68   PHE C C     1 
ATOM   4046  O  O     . PHE C 2  68   ? 511.652 -34.434 643.713 1.00 130.92 ? 68   PHE C O     1 
ATOM   4047  C  CB    . PHE C 2  68   ? 509.902 -32.117 643.336 1.00 125.49 ? 68   PHE C CB    1 
ATOM   4048  C  CG    . PHE C 2  68   ? 509.849 -32.109 644.830 1.00 128.61 ? 68   PHE C CG    1 
ATOM   4049  C  CD1   . PHE C 2  68   ? 510.181 -30.973 645.548 1.00 126.17 ? 68   PHE C CD1   1 
ATOM   4050  C  CD2   . PHE C 2  68   ? 509.461 -33.252 645.517 1.00 132.28 ? 68   PHE C CD2   1 
ATOM   4051  C  CE1   . PHE C 2  68   ? 510.135 -30.969 646.911 1.00 125.62 ? 68   PHE C CE1   1 
ATOM   4052  C  CE2   . PHE C 2  68   ? 509.405 -33.255 646.884 1.00 133.94 ? 68   PHE C CE2   1 
ATOM   4053  C  CZ    . PHE C 2  68   ? 509.738 -32.111 647.587 1.00 131.41 ? 68   PHE C CZ    1 
ATOM   4054  N  N     . LEU C 2  69   ? 513.017 -32.801 644.450 1.00 126.88 ? 69   LEU C N     1 
ATOM   4055  C  CA    . LEU C 2  69   ? 513.708 -33.712 645.357 1.00 131.76 ? 69   LEU C CA    1 
ATOM   4056  C  C     . LEU C 2  69   ? 513.150 -33.697 646.779 1.00 135.48 ? 69   LEU C C     1 
ATOM   4057  O  O     . LEU C 2  69   ? 512.652 -34.714 647.271 1.00 143.70 ? 69   LEU C O     1 
ATOM   4058  C  CB    . LEU C 2  69   ? 515.207 -33.386 645.410 1.00 130.44 ? 69   LEU C CB    1 
ATOM   4059  C  CG    . LEU C 2  69   ? 516.120 -33.848 644.287 1.00 136.73 ? 69   LEU C CG    1 
ATOM   4060  C  CD1   . LEU C 2  69   ? 517.572 -33.739 644.756 1.00 139.12 ? 69   LEU C CD1   1 
ATOM   4061  C  CD2   . LEU C 2  69   ? 515.768 -35.263 643.897 1.00 135.98 ? 69   LEU C CD2   1 
ATOM   4062  N  N     . GLU C 2  70   ? 513.212 -32.543 647.443 1.00 130.29 ? 70   GLU C N     1 
ATOM   4063  C  CA    . GLU C 2  70   ? 512.850 -32.399 648.848 1.00 125.06 ? 70   GLU C CA    1 
ATOM   4064  C  C     . GLU C 2  70   ? 512.949 -30.921 649.194 1.00 119.91 ? 70   GLU C C     1 
ATOM   4065  O  O     . GLU C 2  70   ? 513.496 -30.123 648.427 1.00 115.13 ? 70   GLU C O     1 
ATOM   4066  C  CB    . GLU C 2  70   ? 513.736 -33.213 649.803 1.00 120.91 ? 70   GLU C CB    1 
ATOM   4067  C  CG    . GLU C 2  70   ? 515.227 -33.063 649.600 1.00 126.52 ? 70   GLU C CG    1 
ATOM   4068  C  CD    . GLU C 2  70   ? 516.019 -33.438 650.855 1.00 136.04 ? 70   GLU C CD    1 
ATOM   4069  O  OE1   . GLU C 2  70   ? 515.840 -32.714 651.867 1.00 134.91 ? 70   GLU C OE1   1 
ATOM   4070  O  OE2   . GLU C 2  70   ? 516.848 -34.398 650.827 1.00 137.84 ? 70   GLU C OE2   1 
ATOM   4071  N  N     . TYR C 2  71   ? 512.323 -30.548 650.294 1.00 114.89 ? 71   TYR C N     1 
ATOM   4072  C  CA    . TYR C 2  71   ? 512.382 -29.173 650.749 1.00 117.35 ? 71   TYR C CA    1 
ATOM   4073  C  C     . TYR C 2  71   ? 512.975 -29.188 652.146 1.00 114.65 ? 71   TYR C C     1 
ATOM   4074  O  O     . TYR C 2  71   ? 513.055 -30.235 652.791 1.00 122.55 ? 71   TYR C O     1 
ATOM   4075  C  CB    . TYR C 2  71   ? 510.997 -28.509 650.725 1.00 120.72 ? 71   TYR C CB    1 
ATOM   4076  C  CG    . TYR C 2  71   ? 510.076 -29.004 651.797 1.00 124.09 ? 71   TYR C CG    1 
ATOM   4077  C  CD1   . TYR C 2  71   ? 510.088 -28.457 653.072 1.00 125.39 ? 71   TYR C CD1   1 
ATOM   4078  C  CD2   . TYR C 2  71   ? 509.233 -30.074 651.547 1.00 127.35 ? 71   TYR C CD2   1 
ATOM   4079  C  CE1   . TYR C 2  71   ? 509.260 -28.950 654.060 1.00 124.21 ? 71   TYR C CE1   1 
ATOM   4080  C  CE2   . TYR C 2  71   ? 508.406 -30.567 652.524 1.00 127.93 ? 71   TYR C CE2   1 
ATOM   4081  C  CZ    . TYR C 2  71   ? 508.424 -30.005 653.777 1.00 123.92 ? 71   TYR C CZ    1 
ATOM   4082  O  OH    . TYR C 2  71   ? 507.595 -30.498 654.743 1.00 121.96 ? 71   TYR C OH    1 
ATOM   4083  N  N     . ARG C 2  72   ? 513.439 -28.024 652.584 1.00 112.93 ? 72   ARG C N     1 
ATOM   4084  C  CA    . ARG C 2  72   ? 513.838 -27.816 653.963 1.00 116.25 ? 72   ARG C CA    1 
ATOM   4085  C  C     . ARG C 2  72   ? 513.401 -26.420 654.354 1.00 116.61 ? 72   ARG C C     1 
ATOM   4086  O  O     . ARG C 2  72   ? 513.212 -25.557 653.496 1.00 119.62 ? 72   ARG C O     1 
ATOM   4087  C  CB    . ARG C 2  72   ? 515.343 -27.978 654.205 1.00 119.74 ? 72   ARG C CB    1 
ATOM   4088  C  CG    . ARG C 2  72   ? 516.212 -26.900 653.615 1.00 122.71 ? 72   ARG C CG    1 
ATOM   4089  C  CD    . ARG C 2  72   ? 517.601 -26.890 654.261 1.00 117.50 ? 72   ARG C CD    1 
ATOM   4090  N  NE    . ARG C 2  72   ? 518.457 -25.894 653.625 1.00 118.68 ? 72   ARG C NE    1 
ATOM   4091  C  CZ    . ARG C 2  72   ? 518.741 -24.701 654.142 1.00 117.95 ? 72   ARG C CZ    1 
ATOM   4092  N  NH1   . ARG C 2  72   ? 518.266 -24.341 655.333 1.00 116.07 ? 72   ARG C NH1   1 
ATOM   4093  N  NH2   . ARG C 2  72   ? 519.514 -23.864 653.466 1.00 120.47 ? 72   ARG C NH2   1 
ATOM   4094  N  N     . LEU C 2  73   ? 513.182 -26.228 655.645 1.00 118.70 ? 73   LEU C N     1 
ATOM   4095  C  CA    . LEU C 2  73   ? 512.852 -24.928 656.212 1.00 119.01 ? 73   LEU C CA    1 
ATOM   4096  C  C     . LEU C 2  73   ? 514.019 -24.460 657.058 1.00 124.48 ? 73   LEU C C     1 
ATOM   4097  O  O     . LEU C 2  73   ? 514.517 -25.219 657.895 1.00 127.47 ? 73   LEU C O     1 
ATOM   4098  C  CB    . LEU C 2  73   ? 511.581 -24.978 657.056 1.00 119.52 ? 73   LEU C CB    1 
ATOM   4099  C  CG    . LEU C 2  73   ? 510.289 -25.161 656.283 1.00 113.57 ? 73   LEU C CG    1 
ATOM   4100  C  CD1   . LEU C 2  73   ? 509.188 -25.609 657.214 1.00 109.03 ? 73   LEU C CD1   1 
ATOM   4101  C  CD2   . LEU C 2  73   ? 509.968 -23.823 655.690 1.00 114.72 ? 73   LEU C CD2   1 
ATOM   4102  N  N     . GLY C 2  74   ? 514.473 -23.232 656.823 1.00 124.44 ? 74   GLY C N     1 
ATOM   4103  C  CA    . GLY C 2  74   ? 515.560 -22.692 657.604 1.00 129.60 ? 74   GLY C CA    1 
ATOM   4104  C  C     . GLY C 2  74   ? 515.102 -22.204 658.961 1.00 123.12 ? 74   GLY C C     1 
ATOM   4105  O  O     . GLY C 2  74   ? 513.985 -22.461 659.411 1.00 121.61 ? 74   GLY C O     1 
ATOM   4106  N  N     . GLU C 2  75   ? 516.002 -21.510 659.631 1.00 128.64 ? 75   GLU C N     1 
ATOM   4107  C  CA    . GLU C 2  75   ? 515.606 -20.913 660.893 1.00 124.37 ? 75   GLU C CA    1 
ATOM   4108  C  C     . GLU C 2  75   ? 515.086 -19.504 660.640 1.00 116.54 ? 75   GLU C C     1 
ATOM   4109  O  O     . GLU C 2  75   ? 515.484 -18.863 659.665 1.00 120.83 ? 75   GLU C O     1 
ATOM   4110  C  CB    . GLU C 2  75   ? 516.792 -20.873 661.838 1.00 136.06 ? 75   GLU C CB    1 
ATOM   4111  C  CG    . GLU C 2  75   ? 517.257 -22.286 662.137 1.00 147.35 ? 75   GLU C CG    1 
ATOM   4112  C  CD    . GLU C 2  75   ? 516.437 -23.007 663.165 1.00 154.53 ? 75   GLU C CD    1 
ATOM   4113  O  OE1   . GLU C 2  75   ? 516.240 -24.226 662.953 1.00 157.42 ? 75   GLU C OE1   1 
ATOM   4114  O  OE2   . GLU C 2  75   ? 515.993 -22.384 664.158 1.00 157.08 ? 75   GLU C OE2   1 
ATOM   4115  N  N     . PRO C 2  76   ? 514.230 -18.947 661.483 1.00 105.59 ? 76   PRO C N     1 
ATOM   4116  C  CA    . PRO C 2  76   ? 513.749 -17.581 661.236 1.00 109.08 ? 76   PRO C CA    1 
ATOM   4117  C  C     . PRO C 2  76   ? 514.871 -16.572 661.369 1.00 112.46 ? 76   PRO C C     1 
ATOM   4118  O  O     . PRO C 2  76   ? 515.697 -16.651 662.287 1.00 105.80 ? 76   PRO C O     1 
ATOM   4119  C  CB    . PRO C 2  76   ? 512.649 -17.375 662.284 1.00 97.80  ? 76   PRO C CB    1 
ATOM   4120  C  CG    . PRO C 2  76   ? 512.352 -18.744 662.798 1.00 97.79  ? 76   PRO C CG    1 
ATOM   4121  C  CD    . PRO C 2  76   ? 513.588 -19.560 662.646 1.00 106.96 ? 76   PRO C CD    1 
ATOM   4122  N  N     . PRO C 2  77   ? 514.957 -15.649 660.411 1.00 117.28 ? 77   PRO C N     1 
ATOM   4123  C  CA    . PRO C 2  77   ? 515.989 -14.598 660.454 1.00 117.65 ? 77   PRO C CA    1 
ATOM   4124  C  C     . PRO C 2  77   ? 515.938 -13.740 661.693 1.00 116.36 ? 77   PRO C C     1 
ATOM   4125  O  O     . PRO C 2  77   ? 516.981 -13.214 662.109 1.00 112.68 ? 77   PRO C O     1 
ATOM   4126  C  CB    . PRO C 2  77   ? 515.700 -13.770 659.194 1.00 119.75 ? 77   PRO C CB    1 
ATOM   4127  C  CG    . PRO C 2  77   ? 514.885 -14.665 658.300 1.00 119.34 ? 77   PRO C CG    1 
ATOM   4128  C  CD    . PRO C 2  77   ? 514.091 -15.543 659.222 1.00 115.00 ? 77   PRO C CD    1 
ATOM   4129  N  N     . PHE C 2  78   ? 514.744 -13.525 662.257 1.00 119.40 ? 78   PHE C N     1 
ATOM   4130  C  CA    . PHE C 2  78   ? 514.578 -12.686 663.428 1.00 120.59 ? 78   PHE C CA    1 
ATOM   4131  C  C     . PHE C 2  78   ? 513.591 -13.354 664.372 1.00 119.22 ? 78   PHE C C     1 
ATOM   4132  O  O     . PHE C 2  78   ? 512.622 -13.977 663.902 1.00 114.75 ? 78   PHE C O     1 
ATOM   4133  C  CB    . PHE C 2  78   ? 514.081 -11.280 663.051 1.00 122.39 ? 78   PHE C CB    1 
ATOM   4134  C  CG    . PHE C 2  78   ? 514.931 -10.599 662.005 1.00 128.62 ? 78   PHE C CG    1 
ATOM   4135  C  CD1   . PHE C 2  78   ? 514.655 -10.761 660.654 1.00 128.37 ? 78   PHE C CD1   1 
ATOM   4136  C  CD2   . PHE C 2  78   ? 516.038 -9.851  662.367 1.00 129.94 ? 78   PHE C CD2   1 
ATOM   4137  C  CE1   . PHE C 2  78   ? 515.439 -10.152 659.691 1.00 127.67 ? 78   PHE C CE1   1 
ATOM   4138  C  CE2   . PHE C 2  78   ? 516.826 -9.249  661.401 1.00 130.61 ? 78   PHE C CE2   1 
ATOM   4139  C  CZ    . PHE C 2  78   ? 516.524 -9.399  660.067 1.00 128.72 ? 78   PHE C CZ    1 
ATOM   4140  N  N     . PRO C 2  79   ? 513.809 -13.218 665.739 1.00 117.62 ? 79   PRO C N     1 
ATOM   4141  C  CA    . PRO C 2  79   ? 512.884 -13.807 666.726 1.00 114.80 ? 79   PRO C CA    1 
ATOM   4142  C  C     . PRO C 2  79   ? 511.549 -13.088 666.822 1.00 112.18 ? 79   PRO C C     1 
ATOM   4143  O  O     . PRO C 2  79   ? 511.407 -11.985 666.289 1.00 113.26 ? 79   PRO C O     1 
ATOM   4144  C  CB    . PRO C 2  79   ? 513.653 -13.663 668.034 1.00 117.75 ? 79   PRO C CB    1 
ATOM   4145  C  CG    . PRO C 2  79   ? 514.538 -12.466 667.801 1.00 119.11 ? 79   PRO C CG    1 
ATOM   4146  C  CD    . PRO C 2  79   ? 514.929 -12.510 666.379 1.00 118.70 ? 79   PRO C CD    1 
ATOM   4147  N  N     . GLN C 2  80   ? 510.618 -13.610 667.624 1.00 110.79 ? 80   GLN C N     1 
ATOM   4148  C  CA    . GLN C 2  80   ? 509.262 -13.059 667.582 1.00 108.69 ? 80   GLN C CA    1 
ATOM   4149  C  C     . GLN C 2  80   ? 509.205 -11.618 668.071 1.00 111.65 ? 80   GLN C C     1 
ATOM   4150  O  O     . GLN C 2  80   ? 508.632 -10.749 667.402 1.00 107.62 ? 80   GLN C O     1 
ATOM   4151  C  CB    . GLN C 2  80   ? 508.269 -13.945 668.338 1.00 102.76 ? 80   GLN C CB    1 
ATOM   4152  C  CG    . GLN C 2  80   ? 508.263 -15.395 667.866 1.00 101.90 ? 80   GLN C CG    1 
ATOM   4153  C  CD    . GLN C 2  80   ? 507.397 -16.318 668.717 1.00 103.56 ? 80   GLN C CD    1 
ATOM   4154  O  OE1   . GLN C 2  80   ? 506.598 -15.866 669.549 1.00 104.43 ? 80   GLN C OE1   1 
ATOM   4155  N  NE2   . GLN C 2  80   ? 507.596 -17.626 668.551 1.00 103.70 ? 80   GLN C NE2   1 
ATOM   4156  N  N     . ASP C 2  81   ? 509.766 -11.351 669.246 1.00 124.03 ? 81   ASP C N     1 
ATOM   4157  C  CA    . ASP C 2  81   ? 509.759 -9.997  669.787 1.00 130.97 ? 81   ASP C CA    1 
ATOM   4158  C  C     . ASP C 2  81   ? 510.323 -9.003  668.779 1.00 132.77 ? 81   ASP C C     1 
ATOM   4159  O  O     . ASP C 2  81   ? 509.726 -7.954  668.505 1.00 129.99 ? 81   ASP C O     1 
ATOM   4160  C  CB    . ASP C 2  81   ? 510.578 -9.984  671.077 1.00 140.97 ? 81   ASP C CB    1 
ATOM   4161  C  CG    . ASP C 2  81   ? 511.480 -11.220 671.209 1.00 147.59 ? 81   ASP C CG    1 
ATOM   4162  O  OD1   . ASP C 2  81   ? 510.963 -12.354 671.071 1.00 146.69 ? 81   ASP C OD1   1 
ATOM   4163  O  OD2   . ASP C 2  81   ? 512.706 -11.062 671.443 1.00 151.03 ? 81   ASP C OD2   1 
ATOM   4164  N  N     . GLU C 2  82   ? 511.439 -9.370  668.157 1.00 135.58 ? 82   GLU C N     1 
ATOM   4165  C  CA    . GLU C 2  82   ? 512.079 -8.524  667.160 1.00 135.94 ? 82   GLU C CA    1 
ATOM   4166  C  C     . GLU C 2  82   ? 511.183 -8.256  665.953 1.00 130.80 ? 82   GLU C C     1 
ATOM   4167  O  O     . GLU C 2  82   ? 511.156 -7.134  665.436 1.00 132.81 ? 82   GLU C O     1 
ATOM   4168  C  CB    . GLU C 2  82   ? 513.387 -9.170  666.747 1.00 140.62 ? 82   GLU C CB    1 
ATOM   4169  C  CG    . GLU C 2  82   ? 514.106 -8.454  665.671 1.00 148.55 ? 82   GLU C CG    1 
ATOM   4170  C  CD    . GLU C 2  82   ? 515.570 -8.494  665.923 1.00 159.76 ? 82   GLU C CD    1 
ATOM   4171  O  OE1   . GLU C 2  82   ? 515.945 -9.094  666.957 1.00 163.29 ? 82   GLU C OE1   1 
ATOM   4172  O  OE2   . GLU C 2  82   ? 516.339 -7.967  665.088 1.00 164.98 ? 82   GLU C OE2   1 
ATOM   4173  N  N     . CYS C 2  83   ? 510.483 -9.277  665.453 1.00 121.88 ? 83   CYS C N     1 
ATOM   4174  C  CA    . CYS C 2  83   ? 509.589 -9.069  664.315 1.00 116.83 ? 83   CYS C CA    1 
ATOM   4175  C  C     . CYS C 2  83   ? 508.520 -8.026  664.620 1.00 116.14 ? 83   CYS C C     1 
ATOM   4176  O  O     . CYS C 2  83   ? 508.319 -7.085  663.841 1.00 113.85 ? 83   CYS C O     1 
ATOM   4177  C  CB    . CYS C 2  83   ? 508.912 -10.385 663.940 1.00 115.81 ? 83   CYS C CB    1 
ATOM   4178  S  SG    . CYS C 2  83   ? 509.961 -11.638 663.220 1.00 122.74 ? 83   CYS C SG    1 
ATOM   4179  N  N     . ARG C 2  84   ? 507.859 -8.158  665.781 1.00 119.26 ? 84   ARG C N     1 
ATOM   4180  C  CA    . ARG C 2  84   ? 506.821 -7.215  666.203 1.00 116.54 ? 84   ARG C CA    1 
ATOM   4181  C  C     . ARG C 2  84   ? 507.374 -5.812  666.326 1.00 118.60 ? 84   ARG C C     1 
ATOM   4182  O  O     . ARG C 2  84   ? 506.760 -4.838  665.860 1.00 118.12 ? 84   ARG C O     1 
ATOM   4183  C  CB    . ARG C 2  84   ? 506.263 -7.626  667.568 1.00 115.35 ? 84   ARG C CB    1 
ATOM   4184  C  CG    . ARG C 2  84   ? 505.491 -8.908  667.596 1.00 106.39 ? 84   ARG C CG    1 
ATOM   4185  C  CD    . ARG C 2  84   ? 504.933 -9.220  668.975 1.00 94.28  ? 84   ARG C CD    1 
ATOM   4186  N  NE    . ARG C 2  84   ? 504.215 -10.486 668.902 1.00 87.25  ? 84   ARG C NE    1 
ATOM   4187  C  CZ    . ARG C 2  84   ? 504.650 -11.622 669.454 1.00 90.11  ? 84   ARG C CZ    1 
ATOM   4188  N  NH1   . ARG C 2  84   ? 505.805 -11.661 670.132 1.00 93.73  ? 84   ARG C NH1   1 
ATOM   4189  N  NH2   . ARG C 2  84   ? 503.932 -12.734 669.323 1.00 93.21  ? 84   ARG C NH2   1 
ATOM   4190  N  N     . GLU C 2  85   ? 508.574 -5.715  666.896 1.00 114.89 ? 85   GLU C N     1 
ATOM   4191  C  CA    . GLU C 2  85   ? 509.266 -4.448  667.038 1.00 116.53 ? 85   GLU C CA    1 
ATOM   4192  C  C     . GLU C 2  85   ? 509.484 -3.776  665.697 1.00 118.75 ? 85   GLU C C     1 
ATOM   4193  O  O     . GLU C 2  85   ? 509.137 -2.602  665.521 1.00 117.61 ? 85   GLU C O     1 
ATOM   4194  C  CB    . GLU C 2  85   ? 510.604 -4.701  667.729 1.00 123.68 ? 85   GLU C CB    1 
ATOM   4195  C  CG    . GLU C 2  85   ? 511.652 -3.628  667.512 1.00 134.61 ? 85   GLU C CG    1 
ATOM   4196  C  CD    . GLU C 2  85   ? 511.503 -2.455  668.444 1.00 145.38 ? 85   GLU C CD    1 
ATOM   4197  O  OE1   . GLU C 2  85   ? 510.477 -2.392  669.147 1.00 147.20 ? 85   GLU C OE1   1 
ATOM   4198  O  OE2   . GLU C 2  85   ? 512.422 -1.607  668.488 1.00 152.95 ? 85   GLU C OE2   1 
ATOM   4199  N  N     . LYS C 2  86   ? 510.009 -4.517  664.723 1.00 121.89 ? 86   LYS C N     1 
ATOM   4200  C  CA    . LYS C 2  86   ? 510.485 -3.934  663.481 1.00 123.77 ? 86   LYS C CA    1 
ATOM   4201  C  C     . LYS C 2  86   ? 509.461 -3.969  662.354 1.00 126.16 ? 86   LYS C C     1 
ATOM   4202  O  O     . LYS C 2  86   ? 509.808 -3.658  661.211 1.00 130.64 ? 86   LYS C O     1 
ATOM   4203  C  CB    . LYS C 2  86   ? 511.769 -4.660  663.077 1.00 116.87 ? 86   LYS C CB    1 
ATOM   4204  C  CG    . LYS C 2  86   ? 512.891 -4.394  664.064 1.00 115.53 ? 86   LYS C CG    1 
ATOM   4205  C  CD    . LYS C 2  86   ? 514.225 -4.969  663.649 1.00 116.79 ? 86   LYS C CD    1 
ATOM   4206  C  CE    . LYS C 2  86   ? 515.272 -4.656  664.714 1.00 123.07 ? 86   LYS C CE    1 
ATOM   4207  N  NZ    . LYS C 2  86   ? 516.678 -5.016  664.348 1.00 126.34 ? 86   LYS C NZ    1 
ATOM   4208  N  N     . ASP C 2  87   ? 508.227 -4.380  662.636 1.00 132.43 ? 87   ASP C N     1 
ATOM   4209  C  CA    . ASP C 2  87   ? 507.179 -4.487  661.609 1.00 134.18 ? 87   ASP C CA    1 
ATOM   4210  C  C     . ASP C 2  87   ? 507.588 -5.498  660.529 1.00 127.18 ? 87   ASP C C     1 
ATOM   4211  O  O     . ASP C 2  87   ? 507.439 -5.260  659.325 1.00 126.02 ? 87   ASP C O     1 
ATOM   4212  C  CB    . ASP C 2  87   ? 506.779 -3.113  661.029 1.00 145.91 ? 87   ASP C CB    1 
ATOM   4213  C  CG    . ASP C 2  87   ? 505.893 -2.264  662.014 1.00 152.27 ? 87   ASP C CG    1 
ATOM   4214  O  OD1   . ASP C 2  87   ? 506.233 -1.083  662.275 1.00 156.07 ? 87   ASP C OD1   1 
ATOM   4215  O  OD2   . ASP C 2  87   ? 504.857 -2.772  662.523 1.00 149.50 ? 87   ASP C OD2   1 
ATOM   4216  N  N     . LEU C 2  88   ? 508.110 -6.637  660.991 1.00 116.74 ? 88   LEU C N     1 
ATOM   4217  C  CA    . LEU C 2  88   ? 508.598 -7.743  660.181 1.00 107.73 ? 88   LEU C CA    1 
ATOM   4218  C  C     . LEU C 2  88   ? 507.639 -8.916  660.315 1.00 103.32 ? 88   LEU C C     1 
ATOM   4219  O  O     . LEU C 2  88   ? 506.948 -9.055  661.324 1.00 106.50 ? 88   LEU C O     1 
ATOM   4220  C  CB    . LEU C 2  88   ? 509.972 -8.225  660.641 1.00 102.49 ? 88   LEU C CB    1 
ATOM   4221  C  CG    . LEU C 2  88   ? 511.138 -7.237  660.694 1.00 100.12 ? 88   LEU C CG    1 
ATOM   4222  C  CD1   . LEU C 2  88   ? 512.485 -7.964  660.895 1.00 100.16 ? 88   LEU C CD1   1 
ATOM   4223  C  CD2   . LEU C 2  88   ? 511.143 -6.202  659.579 1.00 98.59  ? 88   LEU C CD2   1 
ATOM   4224  N  N     . THR C 2  89   ? 507.581 -9.755  659.297 1.00 98.00  ? 89   THR C N     1 
ATOM   4225  C  CA    . THR C 2  89   ? 506.854 -11.009 659.409 1.00 94.61  ? 89   THR C CA    1 
ATOM   4226  C  C     . THR C 2  89   ? 507.689 -12.125 660.024 1.00 101.02 ? 89   THR C C     1 
ATOM   4227  O  O     . THR C 2  89   ? 508.845 -12.324 659.645 1.00 106.88 ? 89   THR C O     1 
ATOM   4228  C  CB    . THR C 2  89   ? 506.360 -11.451 658.051 1.00 91.50  ? 89   THR C CB    1 
ATOM   4229  O  OG1   . THR C 2  89   ? 505.351 -10.533 657.613 1.00 94.49  ? 89   THR C OG1   1 
ATOM   4230  C  CG2   . THR C 2  89   ? 505.826 -12.882 658.132 1.00 81.88  ? 89   THR C CG2   1 
ATOM   4231  N  N     . TYR C 2  90   ? 507.114 -12.828 661.005 1.00 107.39 ? 90   TYR C N     1 
ATOM   4232  C  CA    . TYR C 2  90   ? 507.800 -13.963 661.610 1.00 110.77 ? 90   TYR C CA    1 
ATOM   4233  C  C     . TYR C 2  90   ? 507.620 -15.156 660.671 1.00 109.13 ? 90   TYR C C     1 
ATOM   4234  O  O     . TYR C 2  90   ? 506.500 -15.664 660.518 1.00 108.51 ? 90   TYR C O     1 
ATOM   4235  C  CB    . TYR C 2  90   ? 507.217 -14.286 662.990 1.00 105.75 ? 90   TYR C CB    1 
ATOM   4236  C  CG    . TYR C 2  90   ? 507.893 -15.454 663.689 1.00 99.23  ? 90   TYR C CG    1 
ATOM   4237  C  CD1   . TYR C 2  90   ? 509.235 -15.391 664.068 1.00 97.79  ? 90   TYR C CD1   1 
ATOM   4238  C  CD2   . TYR C 2  90   ? 507.231 -16.668 663.834 1.00 95.42  ? 90   TYR C CD2   1 
ATOM   4239  C  CE1   . TYR C 2  90   ? 509.863 -16.482 664.663 1.00 97.43  ? 90   TYR C CE1   1 
ATOM   4240  C  CE2   . TYR C 2  90   ? 507.849 -17.758 664.421 1.00 94.54  ? 90   TYR C CE2   1 
ATOM   4241  C  CZ    . TYR C 2  90   ? 509.162 -17.665 664.829 1.00 95.49  ? 90   TYR C CZ    1 
ATOM   4242  O  OH    . TYR C 2  90   ? 509.747 -18.764 665.412 1.00 96.44  ? 90   TYR C OH    1 
ATOM   4243  N  N     . GLN C 2  91   ? 508.725 -15.641 660.107 1.00 106.32 ? 91   GLN C N     1 
ATOM   4244  C  CA    . GLN C 2  91   ? 508.696 -16.538 658.959 1.00 102.86 ? 91   GLN C CA    1 
ATOM   4245  C  C     . GLN C 2  91   ? 510.025 -17.274 658.869 1.00 105.21 ? 91   GLN C C     1 
ATOM   4246  O  O     . GLN C 2  91   ? 511.015 -16.866 659.486 1.00 110.81 ? 91   GLN C O     1 
ATOM   4247  C  CB    . GLN C 2  91   ? 508.407 -15.765 657.673 1.00 105.64 ? 91   GLN C CB    1 
ATOM   4248  C  CG    . GLN C 2  91   ? 509.345 -14.596 657.505 1.00 112.27 ? 91   GLN C CG    1 
ATOM   4249  C  CD    . GLN C 2  91   ? 509.030 -13.740 656.309 1.00 114.33 ? 91   GLN C CD    1 
ATOM   4250  O  OE1   . GLN C 2  91   ? 507.907 -13.734 655.797 1.00 116.19 ? 91   GLN C OE1   1 
ATOM   4251  N  NE2   . GLN C 2  91   ? 510.022 -12.979 655.870 1.00 117.09 ? 91   GLN C NE2   1 
ATOM   4252  N  N     . ALA C 2  92   ? 510.039 -18.370 658.091 1.00 98.78  ? 92   ALA C N     1 
ATOM   4253  C  CA    . ALA C 2  92   ? 511.266 -19.143 657.852 1.00 100.60 ? 92   ALA C CA    1 
ATOM   4254  C  C     . ALA C 2  92   ? 511.649 -19.184 656.375 1.00 102.71 ? 92   ALA C C     1 
ATOM   4255  O  O     . ALA C 2  92   ? 510.767 -19.208 655.508 1.00 99.82  ? 92   ALA C O     1 
ATOM   4256  C  CB    . ALA C 2  92   ? 511.120 -20.590 658.336 1.00 98.53  ? 92   ALA C CB    1 
ATOM   4257  N  N     . PRO C 2  93   ? 512.948 -19.173 656.051 1.00 106.10 ? 93   PRO C N     1 
ATOM   4258  C  CA    . PRO C 2  93   ? 513.355 -19.349 654.654 1.00 104.68 ? 93   PRO C CA    1 
ATOM   4259  C  C     . PRO C 2  93   ? 513.043 -20.768 654.196 1.00 103.51 ? 93   PRO C C     1 
ATOM   4260  O  O     . PRO C 2  93   ? 513.322 -21.734 654.911 1.00 100.52 ? 93   PRO C O     1 
ATOM   4261  C  CB    . PRO C 2  93   ? 514.866 -19.076 654.688 1.00 102.75 ? 93   PRO C CB    1 
ATOM   4262  C  CG    . PRO C 2  93   ? 515.267 -19.363 656.041 1.00 103.79 ? 93   PRO C CG    1 
ATOM   4263  C  CD    . PRO C 2  93   ? 514.116 -18.939 656.913 1.00 109.78 ? 93   PRO C CD    1 
ATOM   4264  N  N     . LEU C 2  94   ? 512.428 -20.881 653.014 1.00 98.29  ? 94   LEU C N     1 
ATOM   4265  C  CA    . LEU C 2  94   ? 512.114 -22.156 652.366 1.00 104.65 ? 94   LEU C CA    1 
ATOM   4266  C  C     . LEU C 2  94   ? 513.073 -22.389 651.207 1.00 111.61 ? 94   LEU C C     1 
ATOM   4267  O  O     . LEU C 2  94   ? 513.232 -21.520 650.346 1.00 121.71 ? 94   LEU C O     1 
ATOM   4268  C  CB    . LEU C 2  94   ? 510.666 -22.211 651.857 1.00 99.37  ? 94   LEU C CB    1 
ATOM   4269  C  CG    . LEU C 2  94   ? 510.255 -23.454 651.039 1.00 99.47  ? 94   LEU C CG    1 
ATOM   4270  C  CD1   . LEU C 2  94   ? 510.116 -24.710 651.898 1.00 99.96  ? 94   LEU C CD1   1 
ATOM   4271  C  CD2   . LEU C 2  94   ? 508.950 -23.200 650.271 1.00 94.36  ? 94   LEU C CD2   1 
ATOM   4272  N  N     . TYR C 2  95   ? 513.693 -23.563 651.171 1.00 110.70 ? 95   TYR C N     1 
ATOM   4273  C  CA    . TYR C 2  95   ? 514.549 -23.927 650.062 1.00 110.67 ? 95   TYR C CA    1 
ATOM   4274  C  C     . TYR C 2  95   ? 513.992 -25.211 649.469 1.00 111.71 ? 95   TYR C C     1 
ATOM   4275  O  O     . TYR C 2  95   ? 513.323 -25.983 650.159 1.00 110.38 ? 95   TYR C O     1 
ATOM   4276  C  CB    . TYR C 2  95   ? 515.998 -24.132 650.534 1.00 113.64 ? 95   TYR C CB    1 
ATOM   4277  C  CG    . TYR C 2  95   ? 516.599 -22.960 651.301 1.00 116.98 ? 95   TYR C CG    1 
ATOM   4278  C  CD1   . TYR C 2  95   ? 517.186 -21.879 650.651 1.00 120.41 ? 95   TYR C CD1   1 
ATOM   4279  C  CD2   . TYR C 2  95   ? 516.587 -22.951 652.684 1.00 118.85 ? 95   TYR C CD2   1 
ATOM   4280  C  CE1   . TYR C 2  95   ? 517.745 -20.819 651.367 1.00 124.85 ? 95   TYR C CE1   1 
ATOM   4281  C  CE2   . TYR C 2  95   ? 517.140 -21.909 653.406 1.00 122.96 ? 95   TYR C CE2   1 
ATOM   4282  C  CZ    . TYR C 2  95   ? 517.718 -20.846 652.753 1.00 127.55 ? 95   TYR C CZ    1 
ATOM   4283  O  OH    . TYR C 2  95   ? 518.257 -19.823 653.511 1.00 130.02 ? 95   TYR C OH    1 
ATOM   4284  N  N     . ALA C 2  96   ? 514.250 -25.432 648.183 1.00 115.46 ? 96   ALA C N     1 
ATOM   4285  C  CA    . ALA C 2  96   ? 513.859 -26.679 647.539 1.00 117.73 ? 96   ALA C CA    1 
ATOM   4286  C  C     . ALA C 2  96   ? 514.981 -27.206 646.671 1.00 121.51 ? 96   ALA C C     1 
ATOM   4287  O  O     . ALA C 2  96   ? 515.542 -26.463 645.863 1.00 124.75 ? 96   ALA C O     1 
ATOM   4288  C  CB    . ALA C 2  96   ? 512.591 -26.494 646.702 1.00 115.13 ? 96   ALA C CB    1 
ATOM   4289  N  N     . ARG C 2  97   ? 515.328 -28.471 646.871 1.00 128.40 ? 97   ARG C N     1 
ATOM   4290  C  CA    . ARG C 2  97   ? 516.284 -29.168 646.018 1.00 137.37 ? 97   ARG C CA    1 
ATOM   4291  C  C     . ARG C 2  97   ? 515.592 -29.682 644.762 1.00 136.42 ? 97   ARG C C     1 
ATOM   4292  O  O     . ARG C 2  97   ? 514.617 -30.437 644.846 1.00 131.00 ? 97   ARG C O     1 
ATOM   4293  C  CB    . ARG C 2  97   ? 516.963 -30.306 646.767 1.00 151.35 ? 97   ARG C CB    1 
ATOM   4294  C  CG    . ARG C 2  97   ? 518.460 -30.069 646.953 1.00 165.15 ? 97   ARG C CG    1 
ATOM   4295  C  CD    . ARG C 2  97   ? 519.102 -31.141 647.834 1.00 173.57 ? 97   ARG C CD    1 
ATOM   4296  N  NE    . ARG C 2  97   ? 519.007 -30.820 649.265 1.00 172.51 ? 97   ARG C NE    1 
ATOM   4297  C  CZ    . ARG C 2  97   ? 519.469 -31.607 650.235 1.00 172.63 ? 97   ARG C CZ    1 
ATOM   4298  N  NH1   . ARG C 2  97   ? 520.052 -32.755 649.919 1.00 176.72 ? 97   ARG C NH1   1 
ATOM   4299  N  NH2   . ARG C 2  97   ? 519.346 -31.254 651.513 1.00 168.08 ? 97   ARG C NH2   1 
ATOM   4300  N  N     . LEU C 2  98   ? 516.042 -29.204 643.602 1.00 135.93 ? 98   LEU C N     1 
ATOM   4301  C  CA    . LEU C 2  98   ? 515.467 -29.552 642.310 1.00 133.21 ? 98   LEU C CA    1 
ATOM   4302  C  C     . LEU C 2  98   ? 516.524 -30.152 641.383 1.00 141.12 ? 98   LEU C C     1 
ATOM   4303  O  O     . LEU C 2  98   ? 517.656 -29.665 641.312 1.00 145.35 ? 98   LEU C O     1 
ATOM   4304  C  CB    . LEU C 2  98   ? 514.828 -28.325 641.673 1.00 128.45 ? 98   LEU C CB    1 
ATOM   4305  C  CG    . LEU C 2  98   ? 513.756 -27.718 642.572 1.00 121.64 ? 98   LEU C CG    1 
ATOM   4306  C  CD1   . LEU C 2  98   ? 513.114 -26.479 641.953 1.00 118.57 ? 98   LEU C CD1   1 
ATOM   4307  C  CD2   . LEU C 2  98   ? 512.732 -28.796 642.833 1.00 119.91 ? 98   LEU C CD2   1 
ATOM   4308  N  N     . GLN C 2  99   ? 516.140 -31.168 640.614 1.00 143.89 ? 99   GLN C N     1 
ATOM   4309  C  CA    . GLN C 2  99   ? 517.019 -31.696 639.585 1.00 136.97 ? 99   GLN C CA    1 
ATOM   4310  C  C     . GLN C 2  99   ? 516.422 -31.480 638.201 1.00 137.41 ? 99   GLN C C     1 
ATOM   4311  O  O     . GLN C 2  99   ? 515.302 -31.910 637.912 1.00 136.23 ? 99   GLN C O     1 
ATOM   4312  C  CB    . GLN C 2  99   ? 517.328 -33.180 639.799 1.00 148.03 ? 99   GLN C CB    1 
ATOM   4313  C  CG    . GLN C 2  99   ? 516.170 -34.146 639.646 1.00 147.58 ? 99   GLN C CG    1 
ATOM   4314  C  CD    . GLN C 2  99   ? 516.623 -35.588 639.770 1.00 153.28 ? 99   GLN C CD    1 
ATOM   4315  O  OE1   . GLN C 2  99   ? 516.377 -36.404 638.880 1.00 157.61 ? 99   GLN C OE1   1 
ATOM   4316  N  NE2   . GLN C 2  99   ? 517.348 -35.892 640.842 1.00 153.67 ? 99   GLN C NE2   1 
ATOM   4317  N  N     . LEU C 2  100  ? 517.193 -30.801 637.358 1.00 141.37 ? 100  LEU C N     1 
ATOM   4318  C  CA    . LEU C 2  100  ? 516.913 -30.611 635.941 1.00 141.21 ? 100  LEU C CA    1 
ATOM   4319  C  C     . LEU C 2  100  ? 517.374 -31.809 635.125 1.00 146.03 ? 100  LEU C C     1 
ATOM   4320  O  O     . LEU C 2  100  ? 518.485 -32.300 635.317 1.00 155.51 ? 100  LEU C O     1 
ATOM   4321  C  CB    . LEU C 2  100  ? 517.632 -29.364 635.422 1.00 141.45 ? 100  LEU C CB    1 
ATOM   4322  C  CG    . LEU C 2  100  ? 517.387 -29.008 633.955 1.00 143.25 ? 100  LEU C CG    1 
ATOM   4323  C  CD1   . LEU C 2  100  ? 515.908 -28.885 633.713 1.00 140.20 ? 100  LEU C CD1   1 
ATOM   4324  C  CD2   . LEU C 2  100  ? 518.114 -27.742 633.542 1.00 143.81 ? 100  LEU C CD2   1 
ATOM   4325  N  N     . ILE C 2  101  ? 516.487 -32.341 634.296 1.00 153.35 ? 101  ILE C N     1 
ATOM   4326  C  CA    . ILE C 2  101  ? 516.770 -33.484 633.434 1.00 167.41 ? 101  ILE C CA    1 
ATOM   4327  C  C     . ILE C 2  101  ? 516.462 -33.031 632.011 1.00 179.04 ? 101  ILE C C     1 
ATOM   4328  O  O     . ILE C 2  101  ? 515.455 -32.354 631.766 1.00 179.30 ? 101  ILE C O     1 
ATOM   4329  C  CB    . ILE C 2  101  ? 516.026 -34.781 633.813 1.00 162.45 ? 101  ILE C CB    1 
ATOM   4330  C  CG1   . ILE C 2  101  ? 516.165 -35.054 635.311 1.00 159.58 ? 101  ILE C CG1   1 
ATOM   4331  C  CG2   . ILE C 2  101  ? 516.601 -35.960 633.033 1.00 164.51 ? 101  ILE C CG2   1 
ATOM   4332  C  CD1   . ILE C 2  101  ? 515.342 -36.226 635.806 1.00 162.27 ? 101  ILE C CD1   1 
ATOM   4333  N  N     . HIS C 2  102  ? 517.321 -33.401 631.071 1.00 194.92 ? 102  HIS C N     1 
ATOM   4334  C  CA    . HIS C 2  102  ? 517.028 -33.199 629.660 1.00 204.46 ? 102  HIS C CA    1 
ATOM   4335  C  C     . HIS C 2  102  ? 516.524 -34.513 629.077 1.00 208.71 ? 102  HIS C C     1 
ATOM   4336  O  O     . HIS C 2  102  ? 517.274 -35.492 628.984 1.00 205.72 ? 102  HIS C O     1 
ATOM   4337  C  CB    . HIS C 2  102  ? 518.289 -32.709 628.946 1.00 214.53 ? 102  HIS C CB    1 
ATOM   4338  C  CG    . HIS C 2  102  ? 518.029 -31.891 627.715 1.00 223.46 ? 102  HIS C CG    1 
ATOM   4339  N  ND1   . HIS C 2  102  ? 518.993 -31.088 627.142 1.00 227.28 ? 102  HIS C ND1   1 
ATOM   4340  C  CD2   . HIS C 2  102  ? 516.923 -31.754 626.943 1.00 225.21 ? 102  HIS C CD2   1 
ATOM   4341  C  CE1   . HIS C 2  102  ? 518.493 -30.492 626.073 1.00 228.22 ? 102  HIS C CE1   1 
ATOM   4342  N  NE2   . HIS C 2  102  ? 517.238 -30.879 625.930 1.00 226.61 ? 102  HIS C NE2   1 
ATOM   4343  N  N     . LYS C 2  103  ? 515.222 -34.540 628.733 1.00 212.70 ? 103  LYS C N     1 
ATOM   4344  C  CA    . LYS C 2  103  ? 514.630 -35.775 628.234 1.00 219.40 ? 103  LYS C CA    1 
ATOM   4345  C  C     . LYS C 2  103  ? 515.252 -36.155 626.902 1.00 233.34 ? 103  LYS C C     1 
ATOM   4346  O  O     . LYS C 2  103  ? 515.349 -37.344 626.576 1.00 238.84 ? 103  LYS C O     1 
ATOM   4347  C  CB    . LYS C 2  103  ? 513.103 -35.607 628.080 1.00 206.18 ? 103  LYS C CB    1 
ATOM   4348  C  CG    . LYS C 2  103  ? 512.554 -35.861 626.645 1.00 202.80 ? 103  LYS C CG    1 
ATOM   4349  C  CD    . LYS C 2  103  ? 511.313 -35.024 626.293 1.00 192.87 ? 103  LYS C CD    1 
ATOM   4350  C  CE    . LYS C 2  103  ? 510.966 -35.082 624.788 1.00 189.83 ? 103  LYS C CE    1 
ATOM   4351  N  NZ    . LYS C 2  103  ? 510.237 -36.307 624.363 1.00 188.93 ? 103  LYS C NZ    1 
ATOM   4352  N  N     . ASP C 2  104  ? 515.670 -35.153 626.126 1.00 245.22 ? 104  ASP C N     1 
ATOM   4353  C  CA    . ASP C 2  104  ? 516.386 -35.382 624.875 1.00 254.03 ? 104  ASP C CA    1 
ATOM   4354  C  C     . ASP C 2  104  ? 517.815 -35.905 625.101 1.00 253.11 ? 104  ASP C C     1 
ATOM   4355  O  O     . ASP C 2  104  ? 518.169 -36.992 624.632 1.00 258.34 ? 104  ASP C O     1 
ATOM   4356  C  CB    . ASP C 2  104  ? 516.343 -34.086 624.053 1.00 259.98 ? 104  ASP C CB    1 
ATOM   4357  C  CG    . ASP C 2  104  ? 514.913 -33.497 623.962 1.00 261.03 ? 104  ASP C CG    1 
ATOM   4358  O  OD1   . ASP C 2  104  ? 513.936 -34.281 624.010 1.00 262.43 ? 104  ASP C OD1   1 
ATOM   4359  O  OD2   . ASP C 2  104  ? 514.758 -32.258 623.860 1.00 259.78 ? 104  ASP C OD2   1 
ATOM   4360  N  N     . THR C 2  105  ? 518.650 -35.142 625.831 1.00 237.43 ? 105  THR C N     1 
ATOM   4361  C  CA    . THR C 2  105  ? 520.075 -35.436 626.068 1.00 232.33 ? 105  THR C CA    1 
ATOM   4362  C  C     . THR C 2  105  ? 520.354 -36.553 627.073 1.00 239.44 ? 105  THR C C     1 
ATOM   4363  O  O     . THR C 2  105  ? 520.461 -37.732 626.719 1.00 241.10 ? 105  THR C O     1 
ATOM   4364  C  CB    . THR C 2  105  ? 520.819 -34.175 626.559 1.00 206.29 ? 105  THR C CB    1 
ATOM   4365  O  OG1   . THR C 2  105  ? 520.617 -33.088 625.651 1.00 207.75 ? 105  THR C OG1   1 
ATOM   4366  C  CG2   . THR C 2  105  ? 522.321 -34.421 626.712 1.00 196.44 ? 105  THR C CG2   1 
ATOM   4367  N  N     . GLY C 2  106  ? 520.513 -36.147 628.332 1.00 251.21 ? 106  GLY C N     1 
ATOM   4368  C  CA    . GLY C 2  106  ? 520.933 -36.953 629.459 1.00 251.16 ? 106  GLY C CA    1 
ATOM   4369  C  C     . GLY C 2  106  ? 521.437 -36.030 630.557 1.00 248.26 ? 106  GLY C C     1 
ATOM   4370  O  O     . GLY C 2  106  ? 521.642 -36.456 631.698 1.00 248.06 ? 106  GLY C O     1 
ATOM   4371  N  N     . LEU C 2  107  ? 521.658 -34.760 630.193 1.00 238.30 ? 107  LEU C N     1 
ATOM   4372  C  CA    . LEU C 2  107  ? 522.177 -33.747 631.109 1.00 226.84 ? 107  LEU C CA    1 
ATOM   4373  C  C     . LEU C 2  107  ? 521.368 -33.682 632.402 1.00 211.81 ? 107  LEU C C     1 
ATOM   4374  O  O     . LEU C 2  107  ? 520.132 -33.708 632.376 1.00 202.15 ? 107  LEU C O     1 
ATOM   4375  C  CB    . LEU C 2  107  ? 522.144 -32.382 630.406 1.00 227.63 ? 107  LEU C CB    1 
ATOM   4376  C  CG    . LEU C 2  107  ? 522.296 -31.068 631.179 1.00 223.07 ? 107  LEU C CG    1 
ATOM   4377  C  CD1   . LEU C 2  107  ? 523.583 -30.361 630.776 1.00 225.88 ? 107  LEU C CD1   1 
ATOM   4378  C  CD2   . LEU C 2  107  ? 521.074 -30.160 630.964 1.00 216.05 ? 107  LEU C CD2   1 
ATOM   4379  N  N     . ILE C 2  108  ? 522.071 -33.591 633.539 1.00 202.01 ? 108  ILE C N     1 
ATOM   4380  C  CA    . ILE C 2  108  ? 521.440 -33.463 634.854 1.00 188.99 ? 108  ILE C CA    1 
ATOM   4381  C  C     . ILE C 2  108  ? 522.149 -32.331 635.609 1.00 181.61 ? 108  ILE C C     1 
ATOM   4382  O  O     . ILE C 2  108  ? 523.338 -32.454 635.924 1.00 187.64 ? 108  ILE C O     1 
ATOM   4383  C  CB    . ILE C 2  108  ? 521.543 -34.785 635.632 1.00 183.05 ? 108  ILE C CB    1 
ATOM   4384  C  CG1   . ILE C 2  108  ? 520.877 -35.916 634.827 1.00 181.62 ? 108  ILE C CG1   1 
ATOM   4385  C  CG2   . ILE C 2  108  ? 520.914 -34.636 637.039 1.00 175.43 ? 108  ILE C CG2   1 
ATOM   4386  C  CD1   . ILE C 2  108  ? 520.730 -37.229 635.554 1.00 181.90 ? 108  ILE C CD1   1 
ATOM   4387  N  N     . LYS C 2  109  ? 521.448 -31.228 635.883 1.00 175.04 ? 109  LYS C N     1 
ATOM   4388  C  CA    . LYS C 2  109  ? 521.920 -30.191 636.806 1.00 173.88 ? 109  LYS C CA    1 
ATOM   4389  C  C     . LYS C 2  109  ? 521.005 -30.087 638.027 1.00 175.55 ? 109  LYS C C     1 
ATOM   4390  O  O     . LYS C 2  109  ? 519.789 -29.938 637.870 1.00 178.12 ? 109  LYS C O     1 
ATOM   4391  C  CB    . LYS C 2  109  ? 522.063 -28.817 636.135 1.00 170.60 ? 109  LYS C CB    1 
ATOM   4392  C  CG    . LYS C 2  109  ? 522.371 -27.678 637.138 1.00 165.89 ? 109  LYS C CG    1 
ATOM   4393  C  CD    . LYS C 2  109  ? 523.687 -27.951 637.917 1.00 166.95 ? 109  LYS C CD    1 
ATOM   4394  C  CE    . LYS C 2  109  ? 524.127 -26.788 638.815 1.00 161.50 ? 109  LYS C CE    1 
ATOM   4395  N  NZ    . LYS C 2  109  ? 525.205 -27.199 639.770 1.00 160.52 ? 109  LYS C NZ    1 
ATOM   4396  N  N     . GLU C 2  110  ? 521.569 -30.157 639.238 1.00 171.81 ? 110  GLU C N     1 
ATOM   4397  C  CA    . GLU C 2  110  ? 520.773 -30.183 640.464 1.00 155.18 ? 110  GLU C CA    1 
ATOM   4398  C  C     . GLU C 2  110  ? 521.263 -29.089 641.404 1.00 148.81 ? 110  GLU C C     1 
ATOM   4399  O  O     . GLU C 2  110  ? 522.470 -28.903 641.584 1.00 154.88 ? 110  GLU C O     1 
ATOM   4400  C  CB    . GLU C 2  110  ? 520.890 -31.548 641.121 1.00 152.52 ? 110  GLU C CB    1 
ATOM   4401  C  CG    . GLU C 2  110  ? 520.308 -31.704 642.472 1.00 150.14 ? 110  GLU C CG    1 
ATOM   4402  C  CD    . GLU C 2  110  ? 520.567 -33.100 643.007 1.00 157.36 ? 110  GLU C CD    1 
ATOM   4403  O  OE1   . GLU C 2  110  ? 520.764 -33.235 644.237 1.00 162.95 ? 110  GLU C OE1   1 
ATOM   4404  O  OE2   . GLU C 2  110  ? 520.612 -34.054 642.196 1.00 156.96 ? 110  GLU C OE2   1 
ATOM   4405  N  N     . ASP C 2  111  ? 520.326 -28.360 641.996 1.00 146.53 ? 111  ASP C N     1 
ATOM   4406  C  CA    . ASP C 2  111  ? 520.657 -27.248 642.883 1.00 150.14 ? 111  ASP C CA    1 
ATOM   4407  C  C     . ASP C 2  111  ? 519.507 -27.030 643.870 1.00 141.52 ? 111  ASP C C     1 
ATOM   4408  O  O     . ASP C 2  111  ? 518.381 -27.496 643.674 1.00 133.72 ? 111  ASP C O     1 
ATOM   4409  C  CB    . ASP C 2  111  ? 521.018 -25.962 642.106 1.00 158.12 ? 111  ASP C CB    1 
ATOM   4410  C  CG    . ASP C 2  111  ? 521.602 -24.860 643.017 1.00 160.96 ? 111  ASP C CG    1 
ATOM   4411  O  OD1   . ASP C 2  111  ? 522.344 -25.197 643.972 1.00 161.73 ? 111  ASP C OD1   1 
ATOM   4412  O  OD2   . ASP C 2  111  ? 521.337 -23.661 642.766 1.00 160.15 ? 111  ASP C OD2   1 
ATOM   4413  N  N     . GLU C 2  112  ? 519.804 -26.371 644.963 1.00 139.07 ? 112  GLU C N     1 
ATOM   4414  C  CA    . GLU C 2  112  ? 518.781 -26.033 645.936 1.00 124.10 ? 112  GLU C CA    1 
ATOM   4415  C  C     . GLU C 2  112  ? 518.427 -24.569 645.704 1.00 126.47 ? 112  GLU C C     1 
ATOM   4416  O  O     . GLU C 2  112  ? 519.235 -23.675 645.966 1.00 131.05 ? 112  GLU C O     1 
ATOM   4417  C  CB    . GLU C 2  112  ? 519.301 -26.306 647.346 1.00 126.74 ? 112  GLU C CB    1 
ATOM   4418  C  CG    . GLU C 2  112  ? 518.346 -26.106 648.503 1.00 124.86 ? 112  GLU C CG    1 
ATOM   4419  C  CD    . GLU C 2  112  ? 519.081 -26.029 649.833 1.00 126.13 ? 112  GLU C CD    1 
ATOM   4420  O  OE1   . GLU C 2  112  ? 520.023 -25.212 649.947 1.00 126.82 ? 112  GLU C OE1   1 
ATOM   4421  O  OE2   . GLU C 2  112  ? 518.750 -26.826 650.742 1.00 121.73 ? 112  GLU C OE2   1 
ATOM   4422  N  N     . VAL C 2  113  ? 517.233 -24.331 645.186 1.00 118.67 ? 113  VAL C N     1 
ATOM   4423  C  CA    . VAL C 2  113  ? 516.777 -22.990 644.840 1.00 125.58 ? 113  VAL C CA    1 
ATOM   4424  C  C     . VAL C 2  113  ? 515.932 -22.434 645.976 1.00 123.87 ? 113  VAL C C     1 
ATOM   4425  O  O     . VAL C 2  113  ? 515.169 -23.161 646.629 1.00 120.40 ? 113  VAL C O     1 
ATOM   4426  C  CB    . VAL C 2  113  ? 515.975 -22.993 643.527 1.00 125.17 ? 113  VAL C CB    1 
ATOM   4427  C  CG1   . VAL C 2  113  ? 516.824 -23.523 642.425 1.00 128.89 ? 113  VAL C CG1   1 
ATOM   4428  C  CG2   . VAL C 2  113  ? 514.703 -23.807 643.661 1.00 121.84 ? 113  VAL C CG2   1 
ATOM   4429  N  N     . PHE C 2  114  ? 516.071 -21.134 646.206 1.00 123.73 ? 114  PHE C N     1 
ATOM   4430  C  CA    . PHE C 2  114  ? 515.366 -20.424 647.267 1.00 117.17 ? 114  PHE C CA    1 
ATOM   4431  C  C     . PHE C 2  114  ? 513.999 -19.964 646.777 1.00 112.96 ? 114  PHE C C     1 
ATOM   4432  O  O     . PHE C 2  114  ? 513.891 -19.221 645.791 1.00 107.79 ? 114  PHE C O     1 
ATOM   4433  C  CB    . PHE C 2  114  ? 516.205 -19.235 647.739 1.00 122.04 ? 114  PHE C CB    1 
ATOM   4434  C  CG    . PHE C 2  114  ? 515.537 -18.366 648.759 1.00 119.36 ? 114  PHE C CG    1 
ATOM   4435  C  CD1   . PHE C 2  114  ? 515.160 -18.863 649.982 1.00 118.49 ? 114  PHE C CD1   1 
ATOM   4436  C  CD2   . PHE C 2  114  ? 515.281 -17.036 648.477 1.00 120.39 ? 114  PHE C CD2   1 
ATOM   4437  C  CE1   . PHE C 2  114  ? 514.535 -18.044 650.909 1.00 115.64 ? 114  PHE C CE1   1 
ATOM   4438  C  CE2   . PHE C 2  114  ? 514.664 -16.214 649.400 1.00 118.42 ? 114  PHE C CE2   1 
ATOM   4439  C  CZ    . PHE C 2  114  ? 514.293 -16.716 650.618 1.00 114.49 ? 114  PHE C CZ    1 
ATOM   4440  N  N     . LEU C 2  115  ? 512.960 -20.440 647.448 1.00 116.81 ? 115  LEU C N     1 
ATOM   4441  C  CA    . LEU C 2  115  ? 511.587 -20.164 647.071 1.00 119.57 ? 115  LEU C CA    1 
ATOM   4442  C  C     . LEU C 2  115  ? 510.989 -19.022 647.870 1.00 125.58 ? 115  LEU C C     1 
ATOM   4443  O  O     . LEU C 2  115  ? 509.801 -18.748 647.719 1.00 130.83 ? 115  LEU C O     1 
ATOM   4444  C  CB    . LEU C 2  115  ? 510.709 -21.399 647.251 1.00 112.03 ? 115  LEU C CB    1 
ATOM   4445  C  CG    . LEU C 2  115  ? 511.109 -22.626 646.450 1.00 107.40 ? 115  LEU C CG    1 
ATOM   4446  C  CD1   . LEU C 2  115  ? 510.029 -23.699 646.549 1.00 100.26 ? 115  LEU C CD1   1 
ATOM   4447  C  CD2   . LEU C 2  115  ? 511.489 -22.266 645.037 1.00 114.31 ? 115  LEU C CD2   1 
ATOM   4448  N  N     . GLY C 2  116  ? 511.769 -18.333 648.693 1.00 133.85 ? 116  GLY C N     1 
ATOM   4449  C  CA    . GLY C 2  116  ? 511.209 -17.289 649.533 1.00 132.47 ? 116  GLY C CA    1 
ATOM   4450  C  C     . GLY C 2  116  ? 510.988 -17.761 650.958 1.00 134.62 ? 116  GLY C C     1 
ATOM   4451  O  O     . GLY C 2  116  ? 511.546 -18.766 651.403 1.00 138.73 ? 116  GLY C O     1 
ATOM   4452  N  N     . HIS C 2  117  ? 510.184 -16.999 651.698 1.00 126.55 ? 117  HIS C N     1 
ATOM   4453  C  CA    . HIS C 2  117  ? 509.938 -17.312 653.099 1.00 119.61 ? 117  HIS C CA    1 
ATOM   4454  C  C     . HIS C 2  117  ? 508.512 -17.813 653.339 1.00 117.54 ? 117  HIS C C     1 
ATOM   4455  O  O     . HIS C 2  117  ? 507.571 -17.441 652.624 1.00 118.64 ? 117  HIS C O     1 
ATOM   4456  C  CB    . HIS C 2  117  ? 510.116 -16.058 653.948 1.00 116.92 ? 117  HIS C CB    1 
ATOM   4457  C  CG    . HIS C 2  117  ? 511.507 -15.524 653.985 1.00 119.83 ? 117  HIS C CG    1 
ATOM   4458  N  ND1   . HIS C 2  117  ? 512.339 -15.680 655.073 1.00 123.04 ? 117  HIS C ND1   1 
ATOM   4459  C  CD2   . HIS C 2  117  ? 512.190 -14.771 653.090 1.00 121.50 ? 117  HIS C CD2   1 
ATOM   4460  C  CE1   . HIS C 2  117  ? 513.488 -15.074 654.834 1.00 126.04 ? 117  HIS C CE1   1 
ATOM   4461  N  NE2   . HIS C 2  117  ? 513.420 -14.510 653.640 1.00 125.25 ? 117  HIS C NE2   1 
ATOM   4462  N  N     . ILE C 2  118  ? 508.343 -18.622 654.385 1.00 108.97 ? 118  ILE C N     1 
ATOM   4463  C  CA    . ILE C 2  118  ? 507.003 -19.038 654.800 1.00 101.12 ? 118  ILE C CA    1 
ATOM   4464  C  C     . ILE C 2  118  ? 506.744 -18.651 656.250 1.00 107.60 ? 118  ILE C C     1 
ATOM   4465  O  O     . ILE C 2  118  ? 507.612 -18.855 657.120 1.00 114.32 ? 118  ILE C O     1 
ATOM   4466  C  CB    . ILE C 2  118  ? 506.792 -20.548 654.626 1.00 92.81  ? 118  ILE C CB    1 
ATOM   4467  C  CG1   . ILE C 2  118  ? 506.406 -20.857 653.204 1.00 100.69 ? 118  ILE C CG1   1 
ATOM   4468  C  CG2   . ILE C 2  118  ? 505.703 -21.063 655.512 1.00 87.89  ? 118  ILE C CG2   1 
ATOM   4469  C  CD1   . ILE C 2  118  ? 506.070 -22.297 653.039 1.00 105.22 ? 118  ILE C CD1   1 
ATOM   4470  N  N     . PRO C 2  119  ? 505.570 -18.098 656.557 1.00 101.56 ? 119  PRO C N     1 
ATOM   4471  C  CA    . PRO C 2  119  ? 505.305 -17.650 657.926 1.00 98.33  ? 119  PRO C CA    1 
ATOM   4472  C  C     . PRO C 2  119  ? 505.196 -18.805 658.920 1.00 98.29  ? 119  PRO C C     1 
ATOM   4473  O  O     . PRO C 2  119  ? 504.586 -19.842 658.640 1.00 94.80  ? 119  PRO C O     1 
ATOM   4474  C  CB    . PRO C 2  119  ? 503.978 -16.899 657.786 1.00 90.79  ? 119  PRO C CB    1 
ATOM   4475  C  CG    . PRO C 2  119  ? 503.966 -16.430 656.389 1.00 87.18  ? 119  PRO C CG    1 
ATOM   4476  C  CD    . PRO C 2  119  ? 504.584 -17.554 655.612 1.00 94.03  ? 119  PRO C CD    1 
ATOM   4477  N  N     . LEU C 2  120  ? 505.783 -18.613 660.095 1.00 103.74 ? 120  LEU C N     1 
ATOM   4478  C  CA    . LEU C 2  120  ? 505.726 -19.612 661.150 1.00 103.80 ? 120  LEU C CA    1 
ATOM   4479  C  C     . LEU C 2  120  ? 504.664 -19.213 662.156 1.00 101.08 ? 120  LEU C C     1 
ATOM   4480  O  O     . LEU C 2  120  ? 504.418 -18.017 662.361 1.00 97.29  ? 120  LEU C O     1 
ATOM   4481  C  CB    . LEU C 2  120  ? 507.073 -19.811 661.840 1.00 106.82 ? 120  LEU C CB    1 
ATOM   4482  C  CG    . LEU C 2  120  ? 508.147 -20.276 660.853 1.00 108.62 ? 120  LEU C CG    1 
ATOM   4483  C  CD1   . LEU C 2  120  ? 509.508 -20.401 661.521 1.00 112.10 ? 120  LEU C CD1   1 
ATOM   4484  C  CD2   . LEU C 2  120  ? 507.733 -21.587 660.223 1.00 107.89 ? 120  LEU C CD2   1 
ATOM   4485  N  N     . MET C 2  121  ? 503.955 -20.223 662.671 1.00 102.28 ? 121  MET C N     1 
ATOM   4486  C  CA    . MET C 2  121  ? 502.993 -20.063 663.761 1.00 99.41  ? 121  MET C CA    1 
ATOM   4487  C  C     . MET C 2  121  ? 503.715 -20.036 665.097 1.00 102.06 ? 121  MET C C     1 
ATOM   4488  O  O     . MET C 2  121  ? 504.587 -20.866 665.349 1.00 109.31 ? 121  MET C O     1 
ATOM   4489  C  CB    . MET C 2  121  ? 501.968 -21.195 663.750 1.00 97.48  ? 121  MET C CB    1 
ATOM   4490  C  CG    . MET C 2  121  ? 500.966 -21.137 664.874 1.00 96.48  ? 121  MET C CG    1 
ATOM   4491  S  SD    . MET C 2  121  ? 499.751 -22.470 664.814 1.00 94.84  ? 121  MET C SD    1 
ATOM   4492  C  CE    . MET C 2  121  ? 498.656 -21.893 663.505 1.00 93.61  ? 121  MET C CE    1 
ATOM   4493  N  N     . THR C 2  122  ? 503.312 -19.123 665.976 1.00 98.46  ? 122  THR C N     1 
ATOM   4494  C  CA    . THR C 2  122  ? 503.901 -19.079 667.304 1.00 103.33 ? 122  THR C CA    1 
ATOM   4495  C  C     . THR C 2  122  ? 503.389 -20.229 668.175 1.00 106.00 ? 122  THR C C     1 
ATOM   4496  O  O     . THR C 2  122  ? 502.612 -21.090 667.746 1.00 105.93 ? 122  THR C O     1 
ATOM   4497  C  CB    . THR C 2  122  ? 503.591 -17.750 667.972 1.00 101.65 ? 122  THR C CB    1 
ATOM   4498  O  OG1   . THR C 2  122  ? 502.166 -17.598 668.055 1.00 104.76 ? 122  THR C OG1   1 
ATOM   4499  C  CG2   . THR C 2  122  ? 504.181 -16.605 667.159 1.00 94.19  ? 122  THR C CG2   1 
ATOM   4500  N  N     . GLU C 2  123  ? 503.856 -20.243 669.425 1.00 111.01 ? 123  GLU C N     1 
ATOM   4501  C  CA    . GLU C 2  123  ? 503.501 -21.332 670.323 1.00 109.80 ? 123  GLU C CA    1 
ATOM   4502  C  C     . GLU C 2  123  ? 502.015 -21.343 670.661 1.00 102.52 ? 123  GLU C C     1 
ATOM   4503  O  O     . GLU C 2  123  ? 501.441 -22.420 670.851 1.00 102.81 ? 123  GLU C O     1 
ATOM   4504  C  CB    . GLU C 2  123  ? 504.342 -21.237 671.585 1.00 118.99 ? 123  GLU C CB    1 
ATOM   4505  C  CG    . GLU C 2  123  ? 504.573 -22.543 672.297 1.00 127.28 ? 123  GLU C CG    1 
ATOM   4506  C  CD    . GLU C 2  123  ? 505.392 -22.346 673.575 1.00 136.75 ? 123  GLU C CD    1 
ATOM   4507  O  OE1   . GLU C 2  123  ? 505.952 -23.339 674.094 1.00 142.29 ? 123  GLU C OE1   1 
ATOM   4508  O  OE2   . GLU C 2  123  ? 505.475 -21.193 674.067 1.00 137.09 ? 123  GLU C OE2   1 
ATOM   4509  N  N     . ASP C 2  124  ? 501.363 -20.180 670.689 1.00 95.22  ? 124  ASP C N     1 
ATOM   4510  C  CA    . ASP C 2  124  ? 499.971 -20.097 671.122 1.00 95.31  ? 124  ASP C CA    1 
ATOM   4511  C  C     . ASP C 2  124  ? 498.993 -20.201 669.966 1.00 99.19  ? 124  ASP C C     1 
ATOM   4512  O  O     . ASP C 2  124  ? 497.779 -20.072 670.180 1.00 95.99  ? 124  ASP C O     1 
ATOM   4513  C  CB    . ASP C 2  124  ? 499.705 -18.789 671.879 1.00 95.41  ? 124  ASP C CB    1 
ATOM   4514  C  CG    . ASP C 2  124  ? 499.930 -17.544 671.026 1.00 95.09  ? 124  ASP C CG    1 
ATOM   4515  O  OD1   . ASP C 2  124  ? 501.100 -17.156 670.816 1.00 95.26  ? 124  ASP C OD1   1 
ATOM   4516  O  OD2   . ASP C 2  124  ? 498.920 -16.923 670.612 1.00 92.65  ? 124  ASP C OD2   1 
ATOM   4517  N  N     . GLY C 2  125  ? 499.490 -20.444 668.757 1.00 96.52  ? 125  GLY C N     1 
ATOM   4518  C  CA    . GLY C 2  125  ? 498.625 -20.670 667.623 1.00 94.70  ? 125  GLY C CA    1 
ATOM   4519  C  C     . GLY C 2  125  ? 498.320 -19.459 666.777 1.00 91.23  ? 125  GLY C C     1 
ATOM   4520  O  O     . GLY C 2  125  ? 497.368 -19.493 665.998 1.00 94.51  ? 125  GLY C O     1 
ATOM   4521  N  N     . SER C 2  126  ? 499.076 -18.389 666.898 1.00 93.63  ? 126  SER C N     1 
ATOM   4522  C  CA    . SER C 2  126  ? 498.831 -17.197 666.097 1.00 94.11  ? 126  SER C CA    1 
ATOM   4523  C  C     . SER C 2  126  ? 500.036 -16.939 665.181 1.00 102.27 ? 126  SER C C     1 
ATOM   4524  O  O     . SER C 2  126  ? 500.998 -17.710 665.166 1.00 109.91 ? 126  SER C O     1 
ATOM   4525  C  CB    . SER C 2  126  ? 498.522 -16.018 667.013 1.00 93.35  ? 126  SER C CB    1 
ATOM   4526  O  OG    . SER C 2  126  ? 499.568 -15.843 667.946 1.00 96.57  ? 126  SER C OG    1 
ATOM   4527  N  N     . PHE C 2  127  ? 499.956 -15.885 664.358 1.00 99.28  ? 127  PHE C N     1 
ATOM   4528  C  CA    . PHE C 2  127  ? 501.028 -15.518 663.431 1.00 93.81  ? 127  PHE C CA    1 
ATOM   4529  C  C     . PHE C 2  127  ? 501.437 -14.069 663.672 1.00 93.99  ? 127  PHE C C     1 
ATOM   4530  O  O     . PHE C 2  127  ? 500.684 -13.285 664.258 1.00 92.32  ? 127  PHE C O     1 
ATOM   4531  C  CB    . PHE C 2  127  ? 500.621 -15.716 661.971 1.00 90.62  ? 127  PHE C CB    1 
ATOM   4532  C  CG    . PHE C 2  127  ? 500.444 -17.153 661.591 1.00 90.47  ? 127  PHE C CG    1 
ATOM   4533  C  CD1   . PHE C 2  127  ? 501.538 -17.955 661.339 1.00 98.30  ? 127  PHE C CD1   1 
ATOM   4534  C  CD2   . PHE C 2  127  ? 499.184 -17.707 661.490 1.00 85.50  ? 127  PHE C CD2   1 
ATOM   4535  C  CE1   . PHE C 2  127  ? 501.363 -19.289 660.981 1.00 99.77  ? 127  PHE C CE1   1 
ATOM   4536  C  CE2   . PHE C 2  127  ? 499.005 -19.033 661.141 1.00 86.61  ? 127  PHE C CE2   1 
ATOM   4537  C  CZ    . PHE C 2  127  ? 500.089 -19.827 660.894 1.00 93.14  ? 127  PHE C CZ    1 
ATOM   4538  N  N     . ILE C 2  128  ? 502.641 -13.712 663.217 1.00 92.22  ? 128  ILE C N     1 
ATOM   4539  C  CA    . ILE C 2  128  ? 503.101 -12.321 663.212 1.00 93.03  ? 128  ILE C CA    1 
ATOM   4540  C  C     . ILE C 2  128  ? 503.377 -11.903 661.781 1.00 94.83  ? 128  ILE C C     1 
ATOM   4541  O  O     . ILE C 2  128  ? 504.332 -12.387 661.165 1.00 102.24 ? 128  ILE C O     1 
ATOM   4542  C  CB    . ILE C 2  128  ? 504.357 -12.108 664.054 1.00 93.61  ? 128  ILE C CB    1 
ATOM   4543  C  CG1   . ILE C 2  128  ? 504.118 -12.558 665.490 1.00 81.12  ? 128  ILE C CG1   1 
ATOM   4544  C  CG2   . ILE C 2  128  ? 504.757 -10.619 663.992 1.00 82.28  ? 128  ILE C CG2   1 
ATOM   4545  C  CD1   . ILE C 2  128  ? 505.389 -12.674 666.309 1.00 84.09  ? 128  ILE C CD1   1 
ATOM   4546  N  N     . ILE C 2  129  ? 502.533 -11.027 661.253 1.00 93.04  ? 129  ILE C N     1 
ATOM   4547  C  CA    . ILE C 2  129  ? 502.545 -10.585 659.860 1.00 90.68  ? 129  ILE C CA    1 
ATOM   4548  C  C     . ILE C 2  129  ? 502.718 -9.072  659.842 1.00 104.43 ? 129  ILE C C     1 
ATOM   4549  O  O     . ILE C 2  129  ? 501.801 -8.340  660.227 1.00 115.55 ? 129  ILE C O     1 
ATOM   4550  C  CB    . ILE C 2  129  ? 501.253 -10.989 659.140 1.00 79.78  ? 129  ILE C CB    1 
ATOM   4551  C  CG1   . ILE C 2  129  ? 501.001 -12.490 659.273 1.00 74.91  ? 129  ILE C CG1   1 
ATOM   4552  C  CG2   . ILE C 2  129  ? 501.227 -10.497 657.738 1.00 82.41  ? 129  ILE C CG2   1 
ATOM   4553  C  CD1   . ILE C 2  129  ? 502.039 -13.331 658.667 1.00 76.22  ? 129  ILE C CD1   1 
ATOM   4554  N  N     . ASN C 2  130  ? 503.873 -8.596  659.386 1.00 107.03 ? 130  ASN C N     1 
ATOM   4555  C  CA    . ASN C 2  130  ? 504.210 -7.169  659.440 1.00 109.59 ? 130  ASN C CA    1 
ATOM   4556  C  C     . ASN C 2  130  ? 504.115 -6.574  660.847 1.00 110.04 ? 130  ASN C C     1 
ATOM   4557  O  O     . ASN C 2  130  ? 503.599 -5.466  661.034 1.00 112.49 ? 130  ASN C O     1 
ATOM   4558  C  CB    . ASN C 2  130  ? 503.325 -6.364  658.486 1.00 108.60 ? 130  ASN C CB    1 
ATOM   4559  C  CG    . ASN C 2  130  ? 503.659 -6.601  657.048 1.00 114.75 ? 130  ASN C CG    1 
ATOM   4560  O  OD1   . ASN C 2  130  ? 502.793 -6.981  656.254 1.00 112.91 ? 130  ASN C OD1   1 
ATOM   4561  N  ND2   . ASN C 2  130  ? 504.922 -6.385  656.692 1.00 123.47 ? 130  ASN C ND2   1 
ATOM   4562  N  N     . GLY C 2  131  ? 504.537 -7.319  661.868 1.00 109.33 ? 131  GLY C N     1 
ATOM   4563  C  CA    . GLY C 2  131  ? 504.579 -6.743  663.192 1.00 110.43 ? 131  GLY C CA    1 
ATOM   4564  C  C     . GLY C 2  131  ? 503.325 -6.929  663.998 1.00 113.34 ? 131  GLY C C     1 
ATOM   4565  O  O     . GLY C 2  131  ? 503.340 -6.654  665.205 1.00 119.01 ? 131  GLY C O     1 
ATOM   4566  N  N     . ALA C 2  132  ? 502.214 -7.278  663.343 1.00 104.08 ? 132  ALA C N     1 
ATOM   4567  C  CA    . ALA C 2  132  ? 500.918 -7.441  663.990 1.00 93.74  ? 132  ALA C CA    1 
ATOM   4568  C  C     . ALA C 2  132  ? 500.584 -8.919  664.133 1.00 84.42  ? 132  ALA C C     1 
ATOM   4569  O  O     . ALA C 2  132  ? 500.807 -9.712  663.223 1.00 84.72  ? 132  ALA C O     1 
ATOM   4570  C  CB    . ALA C 2  132  ? 499.823 -6.741  663.199 1.00 87.97  ? 132  ALA C CB    1 
ATOM   4571  N  N     . ASP C 2  133  ? 500.004 -9.267  665.262 1.00 81.87  ? 133  ASP C N     1 
ATOM   4572  C  CA    . ASP C 2  133  ? 499.608 -10.632 665.560 1.00 83.86  ? 133  ASP C CA    1 
ATOM   4573  C  C     . ASP C 2  133  ? 498.320 -10.977 664.825 1.00 82.52  ? 133  ASP C C     1 
ATOM   4574  O  O     . ASP C 2  133  ? 497.422 -10.140 664.728 1.00 87.94  ? 133  ASP C O     1 
ATOM   4575  C  CB    . ASP C 2  133  ? 499.418 -10.778 667.067 1.00 93.19  ? 133  ASP C CB    1 
ATOM   4576  C  CG    . ASP C 2  133  ? 500.681 -11.202 667.772 1.00 100.83 ? 133  ASP C CG    1 
ATOM   4577  O  OD1   . ASP C 2  133  ? 501.709 -10.499 667.608 1.00 101.37 ? 133  ASP C OD1   1 
ATOM   4578  O  OD2   . ASP C 2  133  ? 500.636 -12.212 668.510 1.00 104.06 ? 133  ASP C OD2   1 
ATOM   4579  N  N     . ARG C 2  134  ? 498.275 -12.131 664.175 1.00 81.81  ? 134  ARG C N     1 
ATOM   4580  C  CA    . ARG C 2  134  ? 497.079 -12.524 663.432 1.00 86.15  ? 134  ARG C CA    1 
ATOM   4581  C  C     . ARG C 2  134  ? 496.634 -13.943 663.763 1.00 90.04  ? 134  ARG C C     1 
ATOM   4582  O  O     . ARG C 2  134  ? 497.411 -14.780 664.233 1.00 94.66  ? 134  ARG C O     1 
ATOM   4583  C  CB    . ARG C 2  134  ? 497.278 -12.386 661.918 1.00 85.96  ? 134  ARG C CB    1 
ATOM   4584  C  CG    . ARG C 2  134  ? 497.504 -10.958 661.488 1.00 86.28  ? 134  ARG C CG    1 
ATOM   4585  C  CD    . ARG C 2  134  ? 497.426 -10.755 659.990 1.00 85.05  ? 134  ARG C CD    1 
ATOM   4586  N  NE    . ARG C 2  134  ? 496.872 -9.445  659.718 1.00 88.58  ? 134  ARG C NE    1 
ATOM   4587  C  CZ    . ARG C 2  134  ? 495.631 -9.281  659.285 1.00 94.81  ? 134  ARG C CZ    1 
ATOM   4588  N  NH1   . ARG C 2  134  ? 494.897 -10.353 659.058 1.00 94.03  ? 134  ARG C NH1   1 
ATOM   4589  N  NH2   . ARG C 2  134  ? 495.124 -8.070  659.071 1.00 100.68 ? 134  ARG C NH2   1 
ATOM   4590  N  N     . VAL C 2  135  ? 495.349 -14.194 663.534 1.00 89.93  ? 135  VAL C N     1 
ATOM   4591  C  CA    . VAL C 2  135  ? 494.758 -15.514 663.709 1.00 94.48  ? 135  VAL C CA    1 
ATOM   4592  C  C     . VAL C 2  135  ? 494.154 -15.922 662.365 1.00 94.48  ? 135  VAL C C     1 
ATOM   4593  O  O     . VAL C 2  135  ? 493.574 -15.078 661.669 1.00 94.56  ? 135  VAL C O     1 
ATOM   4594  C  CB    . VAL C 2  135  ? 493.707 -15.502 664.854 1.00 96.88  ? 135  VAL C CB    1 
ATOM   4595  C  CG1   . VAL C 2  135  ? 492.906 -16.798 664.927 1.00 96.49  ? 135  VAL C CG1   1 
ATOM   4596  C  CG2   . VAL C 2  135  ? 494.381 -15.268 666.191 1.00 99.06  ? 135  VAL C CG2   1 
ATOM   4597  N  N     . ILE C 2  136  ? 494.314 -17.199 661.984 1.00 91.22  ? 136  ILE C N     1 
ATOM   4598  C  CA    . ILE C 2  136  ? 493.615 -17.787 660.829 1.00 87.75  ? 136  ILE C CA    1 
ATOM   4599  C  C     . ILE C 2  136  ? 492.403 -18.570 661.326 1.00 80.76  ? 136  ILE C C     1 
ATOM   4600  O  O     . ILE C 2  136  ? 492.555 -19.641 661.927 1.00 76.59  ? 136  ILE C O     1 
ATOM   4601  C  CB    . ILE C 2  136  ? 494.529 -18.696 659.995 1.00 86.90  ? 136  ILE C CB    1 
ATOM   4602  C  CG1   . ILE C 2  136  ? 495.839 -18.015 659.607 1.00 81.88  ? 136  ILE C CG1   1 
ATOM   4603  C  CG2   . ILE C 2  136  ? 493.817 -19.224 658.785 1.00 88.54  ? 136  ILE C CG2   1 
ATOM   4604  C  CD1   . ILE C 2  136  ? 495.645 -16.777 658.793 1.00 76.12  ? 136  ILE C CD1   1 
ATOM   4605  N  N     . VAL C 2  137  ? 491.199 -18.079 660.991 1.00 80.12  ? 137  VAL C N     1 
ATOM   4606  C  CA    . VAL C 2  137  ? 489.947 -18.690 661.447 1.00 77.18  ? 137  VAL C CA    1 
ATOM   4607  C  C     . VAL C 2  137  ? 489.618 -19.918 660.609 1.00 74.78  ? 137  VAL C C     1 
ATOM   4608  O  O     . VAL C 2  137  ? 489.506 -19.818 659.380 1.00 74.14  ? 137  VAL C O     1 
ATOM   4609  C  CB    . VAL C 2  137  ? 488.798 -17.672 661.341 1.00 74.77  ? 137  VAL C CB    1 
ATOM   4610  C  CG1   . VAL C 2  137  ? 487.460 -18.346 661.598 1.00 76.19  ? 137  VAL C CG1   1 
ATOM   4611  C  CG2   . VAL C 2  137  ? 489.022 -16.448 662.223 1.00 74.18  ? 137  VAL C CG2   1 
ATOM   4612  N  N     . SER C 2  138  ? 489.331 -21.045 661.277 1.00 75.75  ? 138  SER C N     1 
ATOM   4613  C  CA    . SER C 2  138  ? 488.912 -22.260 660.572 1.00 78.23  ? 138  SER C CA    1 
ATOM   4614  C  C     . SER C 2  138  ? 487.640 -22.006 659.765 1.00 82.14  ? 138  SER C C     1 
ATOM   4615  O  O     . SER C 2  138  ? 486.822 -21.142 660.098 1.00 90.70  ? 138  SER C O     1 
ATOM   4616  C  CB    . SER C 2  138  ? 488.706 -23.447 661.523 1.00 78.66  ? 138  SER C CB    1 
ATOM   4617  O  OG    . SER C 2  138  ? 489.670 -23.492 662.547 1.00 78.51  ? 138  SER C OG    1 
ATOM   4618  N  N     . GLN C 2  139  ? 487.494 -22.727 658.662 1.00 84.27  ? 139  GLN C N     1 
ATOM   4619  C  CA    . GLN C 2  139  ? 486.350 -22.529 657.783 1.00 90.18  ? 139  GLN C CA    1 
ATOM   4620  C  C     . GLN C 2  139  ? 485.533 -23.807 657.622 1.00 92.37  ? 139  GLN C C     1 
ATOM   4621  O  O     . GLN C 2  139  ? 486.079 -24.871 657.289 1.00 89.91  ? 139  GLN C O     1 
ATOM   4622  C  CB    . GLN C 2  139  ? 486.771 -22.013 656.410 1.00 95.90  ? 139  GLN C CB    1 
ATOM   4623  C  CG    . GLN C 2  139  ? 485.612 -22.072 655.463 1.00 100.92 ? 139  GLN C CG    1 
ATOM   4624  C  CD    . GLN C 2  139  ? 485.959 -21.637 654.084 1.00 104.86 ? 139  GLN C CD    1 
ATOM   4625  O  OE1   . GLN C 2  139  ? 486.280 -22.465 653.212 1.00 109.13 ? 139  GLN C OE1   1 
ATOM   4626  N  NE2   . GLN C 2  139  ? 485.890 -20.329 653.855 1.00 103.85 ? 139  GLN C NE2   1 
ATOM   4627  N  N     . ILE C 2  140  ? 484.256 -23.724 657.992 1.00 89.75  ? 140  ILE C N     1 
ATOM   4628  C  CA    . ILE C 2  140  ? 483.336 -24.827 657.766 1.00 86.46  ? 140  ILE C CA    1 
ATOM   4629  C  C     . ILE C 2  140  ? 482.838 -24.791 656.315 1.00 86.96  ? 140  ILE C C     1 
ATOM   4630  O  O     . ILE C 2  140  ? 482.589 -23.714 655.743 1.00 86.47  ? 140  ILE C O     1 
ATOM   4631  C  CB    . ILE C 2  140  ? 482.191 -24.741 658.786 1.00 77.98  ? 140  ILE C CB    1 
ATOM   4632  C  CG1   . ILE C 2  140  ? 481.399 -26.043 658.775 1.00 76.78  ? 140  ILE C CG1   1 
ATOM   4633  C  CG2   . ILE C 2  140  ? 481.344 -23.505 658.517 1.00 77.69  ? 140  ILE C CG2   1 
ATOM   4634  C  CD1   . ILE C 2  140  ? 480.655 -26.261 660.002 1.00 74.76  ? 140  ILE C CD1   1 
ATOM   4635  N  N     . HIS C 2  141  ? 482.602 -25.973 655.733 1.00 82.77  ? 141  HIS C N     1 
ATOM   4636  C  CA    . HIS C 2  141  ? 482.044 -26.078 654.387 1.00 78.55  ? 141  HIS C CA    1 
ATOM   4637  C  C     . HIS C 2  141  ? 481.518 -27.488 654.168 1.00 82.21  ? 141  HIS C C     1 
ATOM   4638  O  O     . HIS C 2  141  ? 481.693 -28.371 655.015 1.00 87.79  ? 141  HIS C O     1 
ATOM   4639  C  CB    . HIS C 2  141  ? 483.123 -25.737 653.359 1.00 80.84  ? 141  HIS C CB    1 
ATOM   4640  C  CG    . HIS C 2  141  ? 484.181 -26.797 653.211 1.00 84.22  ? 141  HIS C CG    1 
ATOM   4641  N  ND1   . HIS C 2  141  ? 484.697 -27.173 651.993 1.00 86.33  ? 141  HIS C ND1   1 
ATOM   4642  C  CD2   . HIS C 2  141  ? 484.800 -27.578 654.130 1.00 84.95  ? 141  HIS C CD2   1 
ATOM   4643  C  CE1   . HIS C 2  141  ? 485.597 -28.126 652.169 1.00 85.30  ? 141  HIS C CE1   1 
ATOM   4644  N  NE2   . HIS C 2  141  ? 485.678 -28.392 653.457 1.00 83.03  ? 141  HIS C NE2   1 
ATOM   4645  N  N     . ARG C 2  142  ? 480.897 -27.702 653.001 1.00 90.56  ? 142  ARG C N     1 
ATOM   4646  C  CA    . ARG C 2  142  ? 480.397 -29.028 652.636 1.00 97.91  ? 142  ARG C CA    1 
ATOM   4647  C  C     . ARG C 2  142  ? 481.540 -29.969 652.312 1.00 98.69  ? 142  ARG C C     1 
ATOM   4648  O  O     . ARG C 2  142  ? 482.420 -29.640 651.517 1.00 99.60  ? 142  ARG C O     1 
ATOM   4649  C  CB    . ARG C 2  142  ? 479.420 -28.968 651.458 1.00 102.95 ? 142  ARG C CB    1 
ATOM   4650  C  CG    . ARG C 2  142  ? 478.183 -28.166 651.735 1.00 107.18 ? 142  ARG C CG    1 
ATOM   4651  C  CD    . ARG C 2  142  ? 477.115 -28.315 650.649 1.00 112.61 ? 142  ARG C CD    1 
ATOM   4652  N  NE    . ARG C 2  142  ? 476.601 -29.663 650.387 1.00 116.43 ? 142  ARG C NE    1 
ATOM   4653  C  CZ    . ARG C 2  142  ? 475.793 -29.950 649.355 1.00 114.61 ? 142  ARG C CZ    1 
ATOM   4654  N  NH1   . ARG C 2  142  ? 475.421 -28.994 648.508 1.00 109.92 ? 142  ARG C NH1   1 
ATOM   4655  N  NH2   . ARG C 2  142  ? 475.347 -31.184 649.154 1.00 115.58 ? 142  ARG C NH2   1 
ATOM   4656  N  N     . SER C 2  143  ? 481.529 -31.129 652.951 1.00 98.81  ? 143  SER C N     1 
ATOM   4657  C  CA    . SER C 2  143  ? 482.509 -32.157 652.665 1.00 98.48  ? 143  SER C CA    1 
ATOM   4658  C  C     . SER C 2  143  ? 482.309 -32.664 651.240 1.00 98.68  ? 143  SER C C     1 
ATOM   4659  O  O     . SER C 2  143  ? 481.174 -32.894 650.820 1.00 98.62  ? 143  SER C O     1 
ATOM   4660  C  CB    . SER C 2  143  ? 482.362 -33.307 653.662 1.00 98.85  ? 143  SER C CB    1 
ATOM   4661  O  OG    . SER C 2  143  ? 482.949 -34.501 653.186 1.00 101.15 ? 143  SER C OG    1 
ATOM   4662  N  N     . PRO C 2  144  ? 483.386 -32.887 650.493 1.00 98.97  ? 144  PRO C N     1 
ATOM   4663  C  CA    . PRO C 2  144  ? 483.270 -33.577 649.209 1.00 103.64 ? 144  PRO C CA    1 
ATOM   4664  C  C     . PRO C 2  144  ? 482.700 -34.984 649.354 1.00 109.34 ? 144  PRO C C     1 
ATOM   4665  O  O     . PRO C 2  144  ? 482.725 -35.586 650.429 1.00 111.09 ? 144  PRO C O     1 
ATOM   4666  C  CB    . PRO C 2  144  ? 484.717 -33.609 648.720 1.00 104.14 ? 144  PRO C CB    1 
ATOM   4667  C  CG    . PRO C 2  144  ? 485.306 -32.369 649.315 1.00 97.53  ? 144  PRO C CG    1 
ATOM   4668  C  CD    . PRO C 2  144  ? 484.703 -32.243 650.647 1.00 97.06  ? 144  PRO C CD    1 
ATOM   4669  N  N     . GLY C 2  145  ? 482.201 -35.512 648.240 1.00 110.10 ? 145  GLY C N     1 
ATOM   4670  C  CA    . GLY C 2  145  ? 481.552 -36.810 648.215 1.00 111.23 ? 145  GLY C CA    1 
ATOM   4671  C  C     . GLY C 2  145  ? 480.456 -36.836 647.162 1.00 114.47 ? 145  GLY C C     1 
ATOM   4672  O  O     . GLY C 2  145  ? 480.442 -36.017 646.242 1.00 115.84 ? 145  GLY C O     1 
ATOM   4673  N  N     . VAL C 2  146  ? 479.561 -37.817 647.295 1.00 114.59 ? 146  VAL C N     1 
ATOM   4674  C  CA    . VAL C 2  146  ? 478.410 -37.977 646.404 1.00 116.76 ? 146  VAL C CA    1 
ATOM   4675  C  C     . VAL C 2  146  ? 477.132 -37.915 647.234 1.00 120.94 ? 146  VAL C C     1 
ATOM   4676  O  O     . VAL C 2  146  ? 476.962 -38.696 648.180 1.00 119.87 ? 146  VAL C O     1 
ATOM   4677  C  CB    . VAL C 2  146  ? 478.469 -39.282 645.603 1.00 115.98 ? 146  VAL C CB    1 
ATOM   4678  C  CG1   . VAL C 2  146  ? 477.146 -39.528 644.924 1.00 117.13 ? 146  VAL C CG1   1 
ATOM   4679  C  CG2   . VAL C 2  146  ? 479.553 -39.208 644.594 1.00 118.23 ? 146  VAL C CG2   1 
ATOM   4680  N  N     . TYR C 2  147  ? 476.273 -36.942 646.930 1.00 123.55 ? 147  TYR C N     1 
ATOM   4681  C  CA    . TYR C 2  147  ? 475.059 -36.698 647.688 1.00 122.45 ? 147  TYR C CA    1 
ATOM   4682  C  C     . TYR C 2  147  ? 473.816 -36.909 646.831 1.00 118.06 ? 147  TYR C C     1 
ATOM   4683  O  O     . TYR C 2  147  ? 473.846 -36.746 645.611 1.00 117.14 ? 147  TYR C O     1 
ATOM   4684  C  CB    . TYR C 2  147  ? 475.089 -35.287 648.238 1.00 127.20 ? 147  TYR C CB    1 
ATOM   4685  C  CG    . TYR C 2  147  ? 476.267 -35.037 649.138 1.00 131.56 ? 147  TYR C CG    1 
ATOM   4686  C  CD1   . TYR C 2  147  ? 476.808 -36.060 649.895 1.00 136.10 ? 147  TYR C CD1   1 
ATOM   4687  C  CD2   . TYR C 2  147  ? 476.829 -33.777 649.244 1.00 133.39 ? 147  TYR C CD2   1 
ATOM   4688  C  CE1   . TYR C 2  147  ? 477.874 -35.833 650.739 1.00 139.62 ? 147  TYR C CE1   1 
ATOM   4689  C  CE2   . TYR C 2  147  ? 477.894 -33.534 650.086 1.00 135.81 ? 147  TYR C CE2   1 
ATOM   4690  C  CZ    . TYR C 2  147  ? 478.415 -34.567 650.832 1.00 139.80 ? 147  TYR C CZ    1 
ATOM   4691  O  OH    . TYR C 2  147  ? 479.482 -34.337 651.673 1.00 141.88 ? 147  TYR C OH    1 
ATOM   4692  N  N     . PHE C 2  148  ? 472.709 -37.245 647.489 1.00 120.29 ? 148  PHE C N     1 
ATOM   4693  C  CA    . PHE C 2  148  ? 471.420 -37.373 646.826 1.00 128.09 ? 148  PHE C CA    1 
ATOM   4694  C  C     . PHE C 2  148  ? 470.358 -36.548 647.540 1.00 131.58 ? 148  PHE C C     1 
ATOM   4695  O  O     . PHE C 2  148  ? 470.013 -36.840 648.688 1.00 131.49 ? 148  PHE C O     1 
ATOM   4696  C  CB    . PHE C 2  148  ? 471.017 -38.844 646.822 1.00 127.77 ? 148  PHE C CB    1 
ATOM   4697  C  CG    . PHE C 2  148  ? 472.035 -39.739 646.194 1.00 127.73 ? 148  PHE C CG    1 
ATOM   4698  C  CD1   . PHE C 2  148  ? 473.075 -40.241 646.956 1.00 124.99 ? 148  PHE C CD1   1 
ATOM   4699  C  CD2   . PHE C 2  148  ? 471.952 -40.092 644.852 1.00 133.71 ? 148  PHE C CD2   1 
ATOM   4700  C  CE1   . PHE C 2  148  ? 474.024 -41.069 646.397 1.00 127.42 ? 148  PHE C CE1   1 
ATOM   4701  C  CE2   . PHE C 2  148  ? 472.904 -40.934 644.270 1.00 134.69 ? 148  PHE C CE2   1 
ATOM   4702  C  CZ    . PHE C 2  148  ? 473.942 -41.422 645.045 1.00 131.91 ? 148  PHE C CZ    1 
ATOM   4703  N  N     . THR C 2  149  ? 469.833 -35.536 646.871 1.00 142.70 ? 149  THR C N     1 
ATOM   4704  C  CA    . THR C 2  149  ? 468.836 -34.689 647.501 1.00 147.33 ? 149  THR C CA    1 
ATOM   4705  C  C     . THR C 2  149  ? 467.519 -34.801 646.734 1.00 151.17 ? 149  THR C C     1 
ATOM   4706  O  O     . THR C 2  149  ? 467.528 -35.146 645.551 1.00 161.60 ? 149  THR C O     1 
ATOM   4707  C  CB    . THR C 2  149  ? 469.291 -33.227 647.564 1.00 147.36 ? 149  THR C CB    1 
ATOM   4708  O  OG1   . THR C 2  149  ? 468.502 -32.524 648.532 1.00 151.33 ? 149  THR C OG1   1 
ATOM   4709  C  CG2   . THR C 2  149  ? 469.164 -32.556 646.201 1.00 152.39 ? 149  THR C CG2   1 
ATOM   4710  N  N     . PRO C 2  150  ? 466.378 -34.600 647.385 1.00 141.98 ? 150  PRO C N     1 
ATOM   4711  C  CA    . PRO C 2  150  ? 465.101 -34.609 646.655 1.00 148.12 ? 150  PRO C CA    1 
ATOM   4712  C  C     . PRO C 2  150  ? 464.979 -33.413 645.722 1.00 148.94 ? 150  PRO C C     1 
ATOM   4713  O  O     . PRO C 2  150  ? 465.339 -32.290 646.082 1.00 142.12 ? 150  PRO C O     1 
ATOM   4714  C  CB    . PRO C 2  150  ? 464.059 -34.567 647.766 1.00 145.07 ? 150  PRO C CB    1 
ATOM   4715  C  CG    . PRO C 2  150  ? 464.769 -35.135 648.948 1.00 142.60 ? 150  PRO C CG    1 
ATOM   4716  C  CD    . PRO C 2  150  ? 466.179 -34.667 648.833 1.00 140.65 ? 150  PRO C CD    1 
ATOM   4717  N  N     . ASP C 2  151  ? 464.481 -33.668 644.500 1.00 162.91 ? 151  ASP C N     1 
ATOM   4718  C  CA    . ASP C 2  151  ? 464.251 -32.565 643.572 1.00 166.03 ? 151  ASP C CA    1 
ATOM   4719  C  C     . ASP C 2  151  ? 463.011 -31.779 643.970 1.00 163.15 ? 151  ASP C C     1 
ATOM   4720  O  O     . ASP C 2  151  ? 461.892 -32.309 643.941 1.00 164.57 ? 151  ASP C O     1 
ATOM   4721  C  CB    . ASP C 2  151  ? 464.121 -33.093 642.131 1.00 175.71 ? 151  ASP C CB    1 
ATOM   4722  C  CG    . ASP C 2  151  ? 463.877 -31.983 641.083 1.00 184.22 ? 151  ASP C CG    1 
ATOM   4723  O  OD1   . ASP C 2  151  ? 464.075 -30.789 641.387 1.00 183.72 ? 151  ASP C OD1   1 
ATOM   4724  O  OD2   . ASP C 2  151  ? 463.509 -32.317 639.931 1.00 189.35 ? 151  ASP C OD2   1 
ATOM   4725  N  N     . PRO C 2  152  ? 463.187 -30.521 644.379 1.00 159.02 ? 152  PRO C N     1 
ATOM   4726  C  CA    . PRO C 2  152  ? 462.045 -29.734 644.874 1.00 165.81 ? 152  PRO C CA    1 
ATOM   4727  C  C     . PRO C 2  152  ? 460.938 -29.575 643.842 1.00 171.91 ? 152  PRO C C     1 
ATOM   4728  O  O     . PRO C 2  152  ? 459.750 -29.625 644.185 1.00 174.48 ? 152  PRO C O     1 
ATOM   4729  C  CB    . PRO C 2  152  ? 462.690 -28.396 645.270 1.00 158.86 ? 152  PRO C CB    1 
ATOM   4730  C  CG    . PRO C 2  152  ? 463.996 -28.357 644.528 1.00 155.71 ? 152  PRO C CG    1 
ATOM   4731  C  CD    . PRO C 2  152  ? 464.455 -29.777 644.476 1.00 156.29 ? 152  PRO C CD    1 
ATOM   4732  N  N     . ALA C 2  153  ? 461.309 -29.452 642.566 1.00 180.64 ? 153  ALA C N     1 
ATOM   4733  C  CA    . ALA C 2  153  ? 460.327 -29.265 641.503 1.00 192.82 ? 153  ALA C CA    1 
ATOM   4734  C  C     . ALA C 2  153  ? 459.511 -30.527 641.287 1.00 203.61 ? 153  ALA C C     1 
ATOM   4735  O  O     . ALA C 2  153  ? 458.277 -30.497 641.349 1.00 207.68 ? 153  ALA C O     1 
ATOM   4736  C  CB    . ALA C 2  153  ? 461.030 -28.849 640.209 1.00 192.51 ? 153  ALA C CB    1 
ATOM   4737  N  N     . ARG C 2  154  ? 460.171 -31.649 641.048 1.00 213.41 ? 154  ARG C N     1 
ATOM   4738  C  CA    . ARG C 2  154  ? 459.428 -32.861 640.754 1.00 219.12 ? 154  ARG C CA    1 
ATOM   4739  C  C     . ARG C 2  154  ? 459.499 -33.746 641.991 1.00 214.03 ? 154  ARG C C     1 
ATOM   4740  O  O     . ARG C 2  154  ? 460.575 -34.274 642.315 1.00 214.79 ? 154  ARG C O     1 
ATOM   4741  C  CB    . ARG C 2  154  ? 460.013 -33.558 639.521 1.00 222.37 ? 154  ARG C CB    1 
ATOM   4742  C  CG    . ARG C 2  154  ? 460.112 -32.590 638.329 1.00 227.71 ? 154  ARG C CG    1 
ATOM   4743  C  CD    . ARG C 2  154  ? 461.405 -32.698 637.515 1.00 227.73 ? 154  ARG C CD    1 
ATOM   4744  N  NE    . ARG C 2  154  ? 461.700 -34.066 637.109 1.00 230.50 ? 154  ARG C NE    1 
ATOM   4745  C  CZ    . ARG C 2  154  ? 461.062 -34.690 636.123 1.00 236.56 ? 154  ARG C CZ    1 
ATOM   4746  N  NH1   . ARG C 2  154  ? 460.094 -34.069 635.464 1.00 239.54 ? 154  ARG C NH1   1 
ATOM   4747  N  NH2   . ARG C 2  154  ? 461.381 -35.934 635.799 1.00 239.14 ? 154  ARG C NH2   1 
ATOM   4748  N  N     . PRO C 2  155  ? 458.390 -33.896 642.726 1.00 194.85 ? 155  PRO C N     1 
ATOM   4749  C  CA    . PRO C 2  155  ? 458.449 -34.595 644.023 1.00 182.90 ? 155  PRO C CA    1 
ATOM   4750  C  C     . PRO C 2  155  ? 458.995 -36.009 643.941 1.00 174.62 ? 155  PRO C C     1 
ATOM   4751  O  O     . PRO C 2  155  ? 459.841 -36.387 644.758 1.00 169.84 ? 155  PRO C O     1 
ATOM   4752  C  CB    . PRO C 2  155  ? 456.989 -34.558 644.508 1.00 186.04 ? 155  PRO C CB    1 
ATOM   4753  C  CG    . PRO C 2  155  ? 456.173 -34.127 643.330 1.00 191.84 ? 155  PRO C CG    1 
ATOM   4754  C  CD    . PRO C 2  155  ? 457.073 -33.290 642.488 1.00 194.33 ? 155  PRO C CD    1 
ATOM   4755  N  N     . GLY C 2  156  ? 458.539 -36.808 642.985 1.00 177.23 ? 156  GLY C N     1 
ATOM   4756  C  CA    . GLY C 2  156  ? 459.016 -38.172 642.949 1.00 187.40 ? 156  GLY C CA    1 
ATOM   4757  C  C     . GLY C 2  156  ? 460.410 -38.395 642.393 1.00 190.23 ? 156  GLY C C     1 
ATOM   4758  O  O     . GLY C 2  156  ? 460.800 -39.550 642.197 1.00 194.88 ? 156  GLY C O     1 
ATOM   4759  N  N     . ARG C 2  157  ? 461.195 -37.342 642.157 1.00 193.34 ? 157  ARG C N     1 
ATOM   4760  C  CA    . ARG C 2  157  ? 462.510 -37.476 641.541 1.00 196.95 ? 157  ARG C CA    1 
ATOM   4761  C  C     . ARG C 2  157  ? 463.570 -36.871 642.456 1.00 196.55 ? 157  ARG C C     1 
ATOM   4762  O  O     . ARG C 2  157  ? 463.260 -36.123 643.393 1.00 195.84 ? 157  ARG C O     1 
ATOM   4763  C  CB    . ARG C 2  157  ? 462.565 -36.816 640.145 1.00 195.56 ? 157  ARG C CB    1 
ATOM   4764  C  CG    . ARG C 2  157  ? 461.684 -37.470 639.103 1.00 197.99 ? 157  ARG C CG    1 
ATOM   4765  C  CD    . ARG C 2  157  ? 461.936 -38.962 639.124 1.00 199.89 ? 157  ARG C CD    1 
ATOM   4766  N  NE    . ARG C 2  157  ? 460.939 -39.728 638.384 1.00 208.10 ? 157  ARG C NE    1 
ATOM   4767  C  CZ    . ARG C 2  157  ? 461.029 -40.020 637.088 1.00 214.25 ? 157  ARG C CZ    1 
ATOM   4768  N  NH1   . ARG C 2  157  ? 462.071 -39.605 636.372 1.00 213.03 ? 157  ARG C NH1   1 
ATOM   4769  N  NH2   . ARG C 2  157  ? 460.074 -40.732 636.505 1.00 220.14 ? 157  ARG C NH2   1 
ATOM   4770  N  N     . TYR C 2  158  ? 464.835 -37.220 642.182 1.00 197.73 ? 158  TYR C N     1 
ATOM   4771  C  CA    . TYR C 2  158  ? 465.959 -36.796 643.011 1.00 191.88 ? 158  TYR C CA    1 
ATOM   4772  C  C     . TYR C 2  158  ? 467.124 -36.367 642.126 1.00 186.57 ? 158  TYR C C     1 
ATOM   4773  O  O     . TYR C 2  158  ? 467.251 -36.794 640.976 1.00 192.30 ? 158  TYR C O     1 
ATOM   4774  C  CB    . TYR C 2  158  ? 466.382 -37.933 643.960 1.00 194.00 ? 158  TYR C CB    1 
ATOM   4775  C  CG    . TYR C 2  158  ? 465.236 -38.377 644.841 1.00 199.88 ? 158  TYR C CG    1 
ATOM   4776  C  CD1   . TYR C 2  158  ? 464.296 -39.290 644.376 1.00 205.71 ? 158  TYR C CD1   1 
ATOM   4777  C  CD2   . TYR C 2  158  ? 465.067 -37.860 646.115 1.00 197.45 ? 158  TYR C CD2   1 
ATOM   4778  C  CE1   . TYR C 2  158  ? 463.232 -39.681 645.156 1.00 208.17 ? 158  TYR C CE1   1 
ATOM   4779  C  CE2   . TYR C 2  158  ? 464.002 -38.243 646.907 1.00 199.53 ? 158  TYR C CE2   1 
ATOM   4780  C  CZ    . TYR C 2  158  ? 463.089 -39.159 646.423 1.00 204.51 ? 158  TYR C CZ    1 
ATOM   4781  O  OH    . TYR C 2  158  ? 462.024 -39.555 647.197 1.00 205.59 ? 158  TYR C OH    1 
ATOM   4782  N  N     . ILE C 2  159  ? 467.988 -35.525 642.684 1.00 162.13 ? 159  ILE C N     1 
ATOM   4783  C  CA    . ILE C 2  159  ? 469.226 -35.105 642.040 1.00 145.88 ? 159  ILE C CA    1 
ATOM   4784  C  C     . ILE C 2  159  ? 470.409 -35.676 642.801 1.00 133.86 ? 159  ILE C C     1 
ATOM   4785  O  O     . ILE C 2  159  ? 470.485 -35.551 644.031 1.00 130.56 ? 159  ILE C O     1 
ATOM   4786  C  CB    . ILE C 2  159  ? 469.345 -33.575 641.924 1.00 137.45 ? 159  ILE C CB    1 
ATOM   4787  C  CG1   . ILE C 2  159  ? 468.066 -32.961 641.349 1.00 136.02 ? 159  ILE C CG1   1 
ATOM   4788  C  CG2   . ILE C 2  159  ? 470.542 -33.213 641.063 1.00 136.51 ? 159  ILE C CG2   1 
ATOM   4789  C  CD1   . ILE C 2  159  ? 468.269 -31.597 640.688 1.00 133.07 ? 159  ILE C CD1   1 
ATOM   4790  N  N     . ALA C 2  160  ? 471.321 -36.313 642.067 1.00 133.33 ? 160  ALA C N     1 
ATOM   4791  C  CA    . ALA C 2  160  ? 472.581 -36.798 642.613 1.00 125.13 ? 160  ALA C CA    1 
ATOM   4792  C  C     . ALA C 2  160  ? 473.636 -35.751 642.280 1.00 127.14 ? 160  ALA C C     1 
ATOM   4793  O  O     . ALA C 2  160  ? 473.803 -35.382 641.111 1.00 131.91 ? 160  ALA C O     1 
ATOM   4794  C  CB    . ALA C 2  160  ? 472.954 -38.162 642.032 1.00 117.90 ? 160  ALA C CB    1 
ATOM   4795  N  N     . SER C 2  161  ? 474.302 -35.233 643.308 1.00 126.95 ? 161  SER C N     1 
ATOM   4796  C  CA    . SER C 2  161  ? 475.313 -34.192 643.146 1.00 129.54 ? 161  SER C CA    1 
ATOM   4797  C  C     . SER C 2  161  ? 476.701 -34.688 643.552 1.00 131.51 ? 161  SER C C     1 
ATOM   4798  O  O     . SER C 2  161  ? 476.879 -35.199 644.662 1.00 131.97 ? 161  SER C O     1 
ATOM   4799  C  CB    . SER C 2  161  ? 474.926 -32.928 643.919 1.00 130.36 ? 161  SER C CB    1 
ATOM   4800  O  OG    . SER C 2  161  ? 473.522 -32.705 643.908 1.00 134.87 ? 161  SER C OG    1 
ATOM   4801  N  N     . ILE C 2  162  ? 477.666 -34.596 642.633 1.00 134.88 ? 162  ILE C N     1 
ATOM   4802  C  CA    . ILE C 2  162  ? 479.063 -34.930 642.916 1.00 130.81 ? 162  ILE C CA    1 
ATOM   4803  C  C     . ILE C 2  162  ? 479.840 -33.642 643.125 1.00 128.59 ? 162  ILE C C     1 
ATOM   4804  O  O     . ILE C 2  162  ? 480.062 -32.884 642.174 1.00 131.96 ? 162  ILE C O     1 
ATOM   4805  C  CB    . ILE C 2  162  ? 479.699 -35.766 641.804 1.00 134.03 ? 162  ILE C CB    1 
ATOM   4806  C  CG1   . ILE C 2  162  ? 479.018 -37.126 641.724 1.00 136.97 ? 162  ILE C CG1   1 
ATOM   4807  C  CG2   . ILE C 2  162  ? 481.204 -35.887 642.027 1.00 134.05 ? 162  ILE C CG2   1 
ATOM   4808  C  CD1   . ILE C 2  162  ? 479.539 -38.015 640.655 1.00 138.55 ? 162  ILE C CD1   1 
ATOM   4809  N  N     . ILE C 2  163  ? 480.269 -33.401 644.358 1.00 119.02 ? 163  ILE C N     1 
ATOM   4810  C  CA    . ILE C 2  163  ? 480.920 -32.154 644.731 1.00 116.48 ? 163  ILE C CA    1 
ATOM   4811  C  C     . ILE C 2  163  ? 482.376 -32.416 645.120 1.00 112.20 ? 163  ILE C C     1 
ATOM   4812  O  O     . ILE C 2  163  ? 482.639 -33.223 646.019 1.00 108.48 ? 163  ILE C O     1 
ATOM   4813  C  CB    . ILE C 2  163  ? 480.155 -31.421 645.842 1.00 109.56 ? 163  ILE C CB    1 
ATOM   4814  C  CG1   . ILE C 2  163  ? 478.710 -31.196 645.419 1.00 106.22 ? 163  ILE C CG1   1 
ATOM   4815  C  CG2   . ILE C 2  163  ? 480.682 -30.044 645.990 1.00 109.84 ? 163  ILE C CG2   1 
ATOM   4816  C  CD1   . ILE C 2  163  ? 477.852 -30.755 646.596 1.00 104.77 ? 163  ILE C CD1   1 
ATOM   4817  N  N     . PRO C 2  164  ? 483.365 -31.768 644.444 1.00 118.28 ? 164  PRO C N     1 
ATOM   4818  C  CA    . PRO C 2  164  ? 484.781 -31.887 644.837 1.00 117.44 ? 164  PRO C CA    1 
ATOM   4819  C  C     . PRO C 2  164  ? 485.241 -30.808 645.800 1.00 115.48 ? 164  PRO C C     1 
ATOM   4820  O  O     . PRO C 2  164  ? 484.430 -29.955 646.170 1.00 118.09 ? 164  PRO C O     1 
ATOM   4821  C  CB    . PRO C 2  164  ? 485.493 -31.764 643.486 1.00 125.00 ? 164  PRO C CB    1 
ATOM   4822  C  CG    . PRO C 2  164  ? 484.639 -30.749 642.730 1.00 124.80 ? 164  PRO C CG    1 
ATOM   4823  C  CD    . PRO C 2  164  ? 483.203 -31.010 643.189 1.00 119.69 ? 164  PRO C CD    1 
ATOM   4824  N  N     . LEU C 2  165  ? 486.527 -30.794 646.173 1.00 112.44 ? 165  LEU C N     1 
ATOM   4825  C  CA    . LEU C 2  165  ? 487.036 -29.700 646.997 1.00 113.34 ? 165  LEU C CA    1 
ATOM   4826  C  C     . LEU C 2  165  ? 486.934 -28.377 646.245 1.00 118.33 ? 165  LEU C C     1 
ATOM   4827  O  O     . LEU C 2  165  ? 486.990 -28.349 645.012 1.00 125.96 ? 165  LEU C O     1 
ATOM   4828  C  CB    . LEU C 2  165  ? 488.473 -29.938 647.446 1.00 103.19 ? 165  LEU C CB    1 
ATOM   4829  C  CG    . LEU C 2  165  ? 488.712 -31.155 648.336 1.00 100.36 ? 165  LEU C CG    1 
ATOM   4830  C  CD1   . LEU C 2  165  ? 490.160 -31.530 648.277 1.00 102.20 ? 165  LEU C CD1   1 
ATOM   4831  C  CD2   . LEU C 2  165  ? 488.317 -30.861 649.764 1.00 95.68  ? 165  LEU C CD2   1 
ATOM   4832  N  N     . PRO C 2  166  ? 486.787 -27.268 646.968 1.00 121.49 ? 166  PRO C N     1 
ATOM   4833  C  CA    . PRO C 2  166  ? 486.703 -25.953 646.316 1.00 123.84 ? 166  PRO C CA    1 
ATOM   4834  C  C     . PRO C 2  166  ? 487.833 -25.641 645.350 1.00 128.13 ? 166  PRO C C     1 
ATOM   4835  O  O     . PRO C 2  166  ? 489.012 -25.896 645.633 1.00 128.91 ? 166  PRO C O     1 
ATOM   4836  C  CB    . PRO C 2  166  ? 486.715 -24.982 647.502 1.00 119.65 ? 166  PRO C CB    1 
ATOM   4837  C  CG    . PRO C 2  166  ? 486.095 -25.745 648.593 1.00 121.99 ? 166  PRO C CG    1 
ATOM   4838  C  CD    . PRO C 2  166  ? 486.520 -27.185 648.412 1.00 121.22 ? 166  PRO C CD    1 
ATOM   4839  N  N     . LYS C 2  167  ? 487.451 -25.111 644.177 1.00 126.01 ? 167  LYS C N     1 
ATOM   4840  C  CA    . LYS C 2  167  ? 488.373 -24.690 643.132 1.00 127.00 ? 167  LYS C CA    1 
ATOM   4841  C  C     . LYS C 2  167  ? 489.086 -25.895 642.516 1.00 131.85 ? 167  LYS C C     1 
ATOM   4842  O  O     . LYS C 2  167  ? 489.962 -25.727 641.637 1.00 138.97 ? 167  LYS C O     1 
ATOM   4843  C  CB    . LYS C 2  167  ? 489.333 -23.596 643.621 1.00 122.53 ? 167  LYS C CB    1 
ATOM   4844  C  CG    . LYS C 2  167  ? 488.628 -22.249 643.894 1.00 115.79 ? 167  LYS C CG    1 
ATOM   4845  C  CD    . LYS C 2  167  ? 489.315 -21.189 643.059 1.00 120.31 ? 167  LYS C CD    1 
ATOM   4846  C  CE    . LYS C 2  167  ? 488.401 -20.122 642.521 1.00 125.60 ? 167  LYS C CE    1 
ATOM   4847  N  NZ    . LYS C 2  167  ? 489.218 -19.054 641.849 1.00 130.33 ? 167  LYS C NZ    1 
ATOM   4848  N  N     . ARG C 2  168  ? 488.760 -27.104 642.980 1.00 124.72 ? 168  ARG C N     1 
ATOM   4849  C  CA    . ARG C 2  168  ? 489.327 -28.366 642.536 1.00 122.63 ? 168  ARG C CA    1 
ATOM   4850  C  C     . ARG C 2  168  ? 488.355 -29.136 641.657 1.00 121.82 ? 168  ARG C C     1 
ATOM   4851  O  O     . ARG C 2  168  ? 488.422 -30.366 641.606 1.00 122.21 ? 168  ARG C O     1 
ATOM   4852  C  CB    . ARG C 2  168  ? 489.738 -29.219 643.728 1.00 122.69 ? 168  ARG C CB    1 
ATOM   4853  C  CG    . ARG C 2  168  ? 490.632 -28.480 644.701 1.00 125.91 ? 168  ARG C CG    1 
ATOM   4854  C  CD    . ARG C 2  168  ? 492.107 -28.826 644.544 1.00 127.89 ? 168  ARG C CD    1 
ATOM   4855  N  NE    . ARG C 2  168  ? 492.608 -28.478 643.221 1.00 126.49 ? 168  ARG C NE    1 
ATOM   4856  C  CZ    . ARG C 2  168  ? 493.790 -28.854 642.761 1.00 125.31 ? 168  ARG C CZ    1 
ATOM   4857  N  NH1   . ARG C 2  168  ? 494.593 -29.591 643.513 1.00 123.07 ? 168  ARG C NH1   1 
ATOM   4858  N  NH2   . ARG C 2  168  ? 494.155 -28.502 641.545 1.00 128.22 ? 168  ARG C NH2   1 
ATOM   4859  N  N     . GLY C 2  169  ? 487.357 -28.461 641.092 1.00 119.03 ? 169  GLY C N     1 
ATOM   4860  C  CA    . GLY C 2  169  ? 486.516 -29.102 640.118 1.00 117.05 ? 169  GLY C CA    1 
ATOM   4861  C  C     . GLY C 2  169  ? 485.140 -28.500 640.013 1.00 118.59 ? 169  GLY C C     1 
ATOM   4862  O  O     . GLY C 2  169  ? 484.758 -27.591 640.746 1.00 124.19 ? 169  GLY C O     1 
ATOM   4863  N  N     . PRO C 2  170  ? 484.423 -28.919 638.994 1.00 118.63 ? 170  PRO C N     1 
ATOM   4864  C  CA    . PRO C 2  170  ? 483.057 -28.441 638.770 1.00 128.97 ? 170  PRO C CA    1 
ATOM   4865  C  C     . PRO C 2  170  ? 482.041 -29.187 639.646 1.00 132.82 ? 170  PRO C C     1 
ATOM   4866  O  O     . PRO C 2  170  ? 482.317 -30.267 640.179 1.00 131.26 ? 170  PRO C O     1 
ATOM   4867  C  CB    . PRO C 2  170  ? 482.862 -28.731 637.280 1.00 125.76 ? 170  PRO C CB    1 
ATOM   4868  C  CG    . PRO C 2  170  ? 483.578 -30.043 637.099 1.00 122.10 ? 170  PRO C CG    1 
ATOM   4869  C  CD    . PRO C 2  170  ? 484.782 -29.994 638.055 1.00 119.80 ? 170  PRO C CD    1 
ATOM   4870  N  N     . TRP C 2  171  ? 480.853 -28.581 639.832 1.00 143.12 ? 171  TRP C N     1 
ATOM   4871  C  CA    . TRP C 2  171  ? 479.787 -29.318 640.508 1.00 149.20 ? 171  TRP C CA    1 
ATOM   4872  C  C     . TRP C 2  171  ? 479.008 -30.072 639.436 1.00 148.09 ? 171  TRP C C     1 
ATOM   4873  O  O     . TRP C 2  171  ? 478.803 -29.558 638.334 1.00 152.06 ? 171  TRP C O     1 
ATOM   4874  C  CB    . TRP C 2  171  ? 478.832 -28.322 641.195 1.00 157.46 ? 171  TRP C CB    1 
ATOM   4875  C  CG    . TRP C 2  171  ? 479.290 -27.449 642.400 1.00 163.67 ? 171  TRP C CG    1 
ATOM   4876  C  CD1   . TRP C 2  171  ? 480.488 -27.495 643.069 1.00 162.95 ? 171  TRP C CD1   1 
ATOM   4877  C  CD2   . TRP C 2  171  ? 478.588 -26.293 642.932 1.00 165.53 ? 171  TRP C CD2   1 
ATOM   4878  N  NE1   . TRP C 2  171  ? 480.521 -26.522 644.050 1.00 162.05 ? 171  TRP C NE1   1 
ATOM   4879  C  CE2   . TRP C 2  171  ? 479.379 -25.762 643.974 1.00 164.00 ? 171  TRP C CE2   1 
ATOM   4880  C  CE3   . TRP C 2  171  ? 477.352 -25.682 642.647 1.00 166.17 ? 171  TRP C CE3   1 
ATOM   4881  C  CZ2   . TRP C 2  171  ? 478.974 -24.643 644.731 1.00 162.00 ? 171  TRP C CZ2   1 
ATOM   4882  C  CZ3   . TRP C 2  171  ? 476.950 -24.572 643.403 1.00 164.32 ? 171  TRP C CZ3   1 
ATOM   4883  C  CH2   . TRP C 2  171  ? 477.763 -24.066 644.427 1.00 161.98 ? 171  TRP C CH2   1 
ATOM   4884  N  N     . ILE C 2  172  ? 478.561 -31.289 639.768 1.00 143.78 ? 172  ILE C N     1 
ATOM   4885  C  CA    . ILE C 2  172  ? 477.678 -32.113 638.931 1.00 146.50 ? 172  ILE C CA    1 
ATOM   4886  C  C     . ILE C 2  172  ? 476.258 -32.305 639.475 1.00 149.93 ? 172  ILE C C     1 
ATOM   4887  O  O     . ILE C 2  172  ? 476.081 -32.614 640.657 1.00 154.97 ? 172  ILE C O     1 
ATOM   4888  C  CB    . ILE C 2  172  ? 478.335 -33.472 638.655 1.00 137.26 ? 172  ILE C CB    1 
ATOM   4889  C  CG1   . ILE C 2  172  ? 479.398 -33.311 637.565 1.00 127.58 ? 172  ILE C CG1   1 
ATOM   4890  C  CG2   . ILE C 2  172  ? 477.298 -34.489 638.303 1.00 140.25 ? 172  ILE C CG2   1 
ATOM   4891  C  CD1   . ILE C 2  172  ? 479.967 -34.611 637.062 1.00 124.31 ? 172  ILE C CD1   1 
ATOM   4892  N  N     . ASP C 2  173  ? 475.253 -32.165 638.604 1.00 154.13 ? 173  ASP C N     1 
ATOM   4893  C  CA    . ASP C 2  173  ? 473.846 -32.444 638.908 1.00 156.23 ? 173  ASP C CA    1 
ATOM   4894  C  C     . ASP C 2  173  ? 473.336 -33.544 637.978 1.00 159.27 ? 173  ASP C C     1 
ATOM   4895  O  O     . ASP C 2  173  ? 473.505 -33.441 636.757 1.00 165.90 ? 173  ASP C O     1 
ATOM   4896  C  CB    . ASP C 2  173  ? 472.947 -31.211 638.732 1.00 160.72 ? 173  ASP C CB    1 
ATOM   4897  C  CG    . ASP C 2  173  ? 472.869 -30.333 639.960 1.00 160.64 ? 173  ASP C CG    1 
ATOM   4898  O  OD1   . ASP C 2  173  ? 473.654 -30.535 640.916 1.00 157.11 ? 173  ASP C OD1   1 
ATOM   4899  O  OD2   . ASP C 2  173  ? 472.004 -29.420 639.942 1.00 162.39 ? 173  ASP C OD2   1 
ATOM   4900  N  N     . LEU C 2  174  ? 472.748 -34.605 638.523 1.00 152.90 ? 174  LEU C N     1 
ATOM   4901  C  CA    . LEU C 2  174  ? 472.131 -35.618 637.647 1.00 151.33 ? 174  LEU C CA    1 
ATOM   4902  C  C     . LEU C 2  174  ? 470.604 -35.526 637.566 1.00 156.99 ? 174  LEU C C     1 
ATOM   4903  O  O     . LEU C 2  174  ? 469.934 -36.530 637.835 1.00 162.43 ? 174  LEU C O     1 
ATOM   4904  C  CB    . LEU C 2  174  ? 472.555 -37.040 638.013 1.00 138.11 ? 174  LEU C CB    1 
ATOM   4905  C  CG    . LEU C 2  174  ? 473.778 -37.604 637.273 1.00 128.03 ? 174  LEU C CG    1 
ATOM   4906  C  CD1   . LEU C 2  174  ? 474.870 -36.598 637.140 1.00 124.80 ? 174  LEU C CD1   1 
ATOM   4907  C  CD2   . LEU C 2  174  ? 474.309 -38.912 637.853 1.00 123.38 ? 174  LEU C CD2   1 
ATOM   4908  N  N     . GLU C 2  175  ? 469.999 -34.379 637.229 1.00 159.73 ? 175  GLU C N     1 
ATOM   4909  C  CA    . GLU C 2  175  ? 468.545 -34.345 637.270 1.00 161.95 ? 175  GLU C CA    1 
ATOM   4910  C  C     . GLU C 2  175  ? 468.059 -35.341 636.217 1.00 171.68 ? 175  GLU C C     1 
ATOM   4911  O  O     . GLU C 2  175  ? 468.697 -35.537 635.181 1.00 174.31 ? 175  GLU C O     1 
ATOM   4912  C  CB    . GLU C 2  175  ? 468.013 -32.928 636.985 1.00 155.59 ? 175  GLU C CB    1 
ATOM   4913  C  CG    . GLU C 2  175  ? 466.481 -32.765 637.171 1.00 159.38 ? 175  GLU C CG    1 
ATOM   4914  C  CD    . GLU C 2  175  ? 465.988 -31.307 637.140 1.00 161.91 ? 175  GLU C CD    1 
ATOM   4915  O  OE1   . GLU C 2  175  ? 466.840 -30.392 637.145 1.00 161.59 ? 175  GLU C OE1   1 
ATOM   4916  O  OE2   . GLU C 2  175  ? 464.748 -31.081 637.135 1.00 163.30 ? 175  GLU C OE2   1 
ATOM   4917  N  N     . VAL C 2  176  ? 466.918 -35.965 636.460 1.00 182.85 ? 176  VAL C N     1 
ATOM   4918  C  CA    . VAL C 2  176  ? 466.256 -36.796 635.454 1.00 188.81 ? 176  VAL C CA    1 
ATOM   4919  C  C     . VAL C 2  176  ? 465.102 -35.987 634.889 1.00 197.96 ? 176  VAL C C     1 
ATOM   4920  O  O     . VAL C 2  176  ? 464.085 -35.762 635.556 1.00 203.45 ? 176  VAL C O     1 
ATOM   4921  C  CB    . VAL C 2  176  ? 465.800 -38.153 636.004 1.00 189.54 ? 176  VAL C CB    1 
ATOM   4922  C  CG1   . VAL C 2  176  ? 465.064 -38.924 634.925 1.00 193.34 ? 176  VAL C CG1   1 
ATOM   4923  C  CG2   . VAL C 2  176  ? 467.009 -38.956 636.451 1.00 188.79 ? 176  VAL C CG2   1 
ATOM   4924  N  N     . GLU C 2  177  ? 465.258 -35.582 633.640 1.00 193.46 ? 177  GLU C N     1 
ATOM   4925  C  CA    . GLU C 2  177  ? 464.335 -34.674 633.006 1.00 194.53 ? 177  GLU C CA    1 
ATOM   4926  C  C     . GLU C 2  177  ? 462.980 -35.359 632.819 1.00 192.52 ? 177  GLU C C     1 
ATOM   4927  O  O     . GLU C 2  177  ? 462.871 -36.584 632.928 1.00 193.54 ? 177  GLU C O     1 
ATOM   4928  C  CB    . GLU C 2  177  ? 464.908 -34.216 631.658 1.00 197.07 ? 177  GLU C CB    1 
ATOM   4929  C  CG    . GLU C 2  177  ? 465.045 -32.688 631.453 1.00 197.09 ? 177  GLU C CG    1 
ATOM   4930  C  CD    . GLU C 2  177  ? 465.756 -31.966 632.599 1.00 191.12 ? 177  GLU C CD    1 
ATOM   4931  O  OE1   . GLU C 2  177  ? 465.130 -31.082 633.233 1.00 191.76 ? 177  GLU C OE1   1 
ATOM   4932  O  OE2   . GLU C 2  177  ? 466.953 -32.250 632.832 1.00 184.83 ? 177  GLU C OE2   1 
ATOM   4933  N  N     . PRO C 2  178  ? 461.916 -34.566 632.654 1.00 192.80 ? 178  PRO C N     1 
ATOM   4934  C  CA    . PRO C 2  178  ? 460.571 -35.129 632.418 1.00 195.23 ? 178  PRO C CA    1 
ATOM   4935  C  C     . PRO C 2  178  ? 460.469 -36.123 631.249 1.00 197.87 ? 178  PRO C C     1 
ATOM   4936  O  O     . PRO C 2  178  ? 459.610 -37.016 631.291 1.00 199.36 ? 178  PRO C O     1 
ATOM   4937  C  CB    . PRO C 2  178  ? 459.705 -33.873 632.205 1.00 196.28 ? 178  PRO C CB    1 
ATOM   4938  C  CG    . PRO C 2  178  ? 460.674 -32.720 632.025 1.00 192.00 ? 178  PRO C CG    1 
ATOM   4939  C  CD    . PRO C 2  178  ? 461.864 -33.104 632.839 1.00 187.24 ? 178  PRO C CD    1 
ATOM   4940  N  N     . ASN C 2  179  ? 461.289 -35.993 630.204 1.00 195.70 ? 179  ASN C N     1 
ATOM   4941  C  CA    . ASN C 2  179  ? 461.254 -36.927 629.077 1.00 198.79 ? 179  ASN C CA    1 
ATOM   4942  C  C     . ASN C 2  179  ? 461.710 -38.354 629.409 1.00 197.35 ? 179  ASN C C     1 
ATOM   4943  O  O     . ASN C 2  179  ? 461.489 -39.251 628.584 1.00 199.29 ? 179  ASN C O     1 
ATOM   4944  C  CB    . ASN C 2  179  ? 462.090 -36.351 627.925 1.00 199.62 ? 179  ASN C CB    1 
ATOM   4945  C  CG    . ASN C 2  179  ? 463.548 -36.107 628.308 1.00 195.22 ? 179  ASN C CG    1 
ATOM   4946  O  OD1   . ASN C 2  179  ? 464.076 -36.708 629.244 1.00 191.25 ? 179  ASN C OD1   1 
ATOM   4947  N  ND2   . ASN C 2  179  ? 464.204 -35.212 627.573 1.00 195.65 ? 179  ASN C ND2   1 
ATOM   4948  N  N     . GLY C 2  180  ? 462.345 -38.601 630.558 1.00 192.48 ? 180  GLY C N     1 
ATOM   4949  C  CA    . GLY C 2  180  ? 462.727 -39.950 630.953 1.00 189.96 ? 180  GLY C CA    1 
ATOM   4950  C  C     . GLY C 2  180  ? 464.202 -40.268 630.856 1.00 184.89 ? 180  GLY C C     1 
ATOM   4951  O  O     . GLY C 2  180  ? 464.628 -41.308 631.377 1.00 181.86 ? 180  GLY C O     1 
ATOM   4952  N  N     . VAL C 2  181  ? 464.980 -39.426 630.192 1.00 180.19 ? 181  VAL C N     1 
ATOM   4953  C  CA    . VAL C 2  181  ? 466.418 -39.593 630.009 1.00 178.80 ? 181  VAL C CA    1 
ATOM   4954  C  C     . VAL C 2  181  ? 467.145 -38.961 631.190 1.00 175.47 ? 181  VAL C C     1 
ATOM   4955  O  O     . VAL C 2  181  ? 466.704 -37.941 631.743 1.00 175.11 ? 181  VAL C O     1 
ATOM   4956  C  CB    . VAL C 2  181  ? 466.895 -39.012 628.658 1.00 178.89 ? 181  VAL C CB    1 
ATOM   4957  C  CG1   . VAL C 2  181  ? 467.021 -37.495 628.706 1.00 177.44 ? 181  VAL C CG1   1 
ATOM   4958  C  CG2   . VAL C 2  181  ? 468.229 -39.651 628.232 1.00 175.10 ? 181  VAL C CG2   1 
ATOM   4959  N  N     . VAL C 2  182  ? 468.240 -39.592 631.610 1.00 176.05 ? 182  VAL C N     1 
ATOM   4960  C  CA    . VAL C 2  182  ? 468.993 -39.141 632.777 1.00 173.41 ? 182  VAL C CA    1 
ATOM   4961  C  C     . VAL C 2  182  ? 469.959 -38.058 632.310 1.00 172.66 ? 182  VAL C C     1 
ATOM   4962  O  O     . VAL C 2  182  ? 470.848 -38.305 631.487 1.00 174.70 ? 182  VAL C O     1 
ATOM   4963  C  CB    . VAL C 2  182  ? 469.735 -40.307 633.452 1.00 169.80 ? 182  VAL C CB    1 
ATOM   4964  C  CG1   . VAL C 2  182  ? 470.380 -41.232 632.420 1.00 172.29 ? 182  VAL C CG1   1 
ATOM   4965  C  CG2   . VAL C 2  182  ? 470.775 -39.778 634.415 1.00 163.69 ? 182  VAL C CG2   1 
ATOM   4966  N  N     . SER C 2  183  ? 469.787 -36.853 632.846 1.00 173.46 ? 183  SER C N     1 
ATOM   4967  C  CA    . SER C 2  183  ? 470.536 -35.686 632.409 1.00 172.70 ? 183  SER C CA    1 
ATOM   4968  C  C     . SER C 2  183  ? 471.657 -35.345 633.381 1.00 170.73 ? 183  SER C C     1 
ATOM   4969  O  O     . SER C 2  183  ? 471.538 -35.520 634.597 1.00 169.76 ? 183  SER C O     1 
ATOM   4970  C  CB    . SER C 2  183  ? 469.591 -34.487 632.232 1.00 174.22 ? 183  SER C CB    1 
ATOM   4971  O  OG    . SER C 2  183  ? 469.141 -33.955 633.465 1.00 171.57 ? 183  SER C OG    1 
ATOM   4972  N  N     . MET C 2  184  ? 472.755 -34.848 632.815 1.00 167.62 ? 184  MET C N     1 
ATOM   4973  C  CA    . MET C 2  184  ? 473.909 -34.375 633.568 1.00 160.35 ? 184  MET C CA    1 
ATOM   4974  C  C     . MET C 2  184  ? 474.104 -32.878 633.376 1.00 158.72 ? 184  MET C C     1 
ATOM   4975  O  O     . MET C 2  184  ? 474.120 -32.391 632.239 1.00 161.84 ? 184  MET C O     1 
ATOM   4976  C  CB    . MET C 2  184  ? 475.156 -35.123 633.116 1.00 156.34 ? 184  MET C CB    1 
ATOM   4977  C  CG    . MET C 2  184  ? 476.425 -34.542 633.634 1.00 147.55 ? 184  MET C CG    1 
ATOM   4978  S  SD    . MET C 2  184  ? 477.626 -35.853 633.549 1.00 143.92 ? 184  MET C SD    1 
ATOM   4979  C  CE    . MET C 2  184  ? 479.115 -34.928 633.255 1.00 138.06 ? 184  MET C CE    1 
ATOM   4980  N  N     . LYS C 2  185  ? 474.286 -32.165 634.489 1.00 148.37 ? 185  LYS C N     1 
ATOM   4981  C  CA    . LYS C 2  185  ? 474.441 -30.714 634.511 1.00 144.51 ? 185  LYS C CA    1 
ATOM   4982  C  C     . LYS C 2  185  ? 475.858 -30.381 634.976 1.00 140.47 ? 185  LYS C C     1 
ATOM   4983  O  O     . LYS C 2  185  ? 476.250 -30.764 636.085 1.00 134.71 ? 185  LYS C O     1 
ATOM   4984  C  CB    . LYS C 2  185  ? 473.382 -30.107 635.440 1.00 142.82 ? 185  LYS C CB    1 
ATOM   4985  C  CG    . LYS C 2  185  ? 473.156 -28.590 635.436 1.00 142.49 ? 185  LYS C CG    1 
ATOM   4986  C  CD    . LYS C 2  185  ? 472.184 -28.192 636.587 1.00 144.24 ? 185  LYS C CD    1 
ATOM   4987  C  CE    . LYS C 2  185  ? 470.924 -29.090 636.669 1.00 147.29 ? 185  LYS C CE    1 
ATOM   4988  N  NZ    . LYS C 2  185  ? 469.643 -28.416 636.323 1.00 149.46 ? 185  LYS C NZ    1 
ATOM   4989  N  N     . VAL C 2  186  ? 476.632 -29.708 634.113 1.00 146.02 ? 186  VAL C N     1 
ATOM   4990  C  CA    . VAL C 2  186  ? 478.026 -29.319 634.376 1.00 147.58 ? 186  VAL C CA    1 
ATOM   4991  C  C     . VAL C 2  186  ? 478.266 -27.911 633.843 1.00 153.12 ? 186  VAL C C     1 
ATOM   4992  O  O     . VAL C 2  186  ? 478.037 -27.646 632.657 1.00 158.60 ? 186  VAL C O     1 
ATOM   4993  C  CB    . VAL C 2  186  ? 479.048 -30.293 633.757 1.00 142.70 ? 186  VAL C CB    1 
ATOM   4994  C  CG1   . VAL C 2  186  ? 480.454 -29.812 634.022 1.00 134.77 ? 186  VAL C CG1   1 
ATOM   4995  C  CG2   . VAL C 2  186  ? 478.884 -31.664 634.353 1.00 145.16 ? 186  VAL C CG2   1 
ATOM   4996  N  N     . ASN C 2  187  ? 478.745 -27.013 634.711 1.00 158.77 ? 187  ASN C N     1 
ATOM   4997  C  CA    . ASN C 2  187  ? 479.006 -25.618 634.340 1.00 166.99 ? 187  ASN C CA    1 
ATOM   4998  C  C     . ASN C 2  187  ? 477.758 -24.973 633.737 1.00 176.27 ? 187  ASN C C     1 
ATOM   4999  O  O     . ASN C 2  187  ? 477.813 -24.342 632.674 1.00 183.22 ? 187  ASN C O     1 
ATOM   5000  C  CB    . ASN C 2  187  ? 480.194 -25.498 633.378 1.00 168.53 ? 187  ASN C CB    1 
ATOM   5001  C  CG    . ASN C 2  187  ? 481.511 -25.887 634.016 1.00 166.14 ? 187  ASN C CG    1 
ATOM   5002  O  OD1   . ASN C 2  187  ? 481.692 -27.026 634.429 1.00 167.04 ? 187  ASN C OD1   1 
ATOM   5003  N  ND2   . ASN C 2  187  ? 482.448 -24.944 634.080 1.00 164.86 ? 187  ASN C ND2   1 
ATOM   5004  N  N     . LYS C 2  188  ? 476.607 -25.215 634.386 1.00 179.77 ? 188  LYS C N     1 
ATOM   5005  C  CA    . LYS C 2  188  ? 475.306 -24.667 634.000 1.00 179.46 ? 188  LYS C CA    1 
ATOM   5006  C  C     . LYS C 2  188  ? 474.778 -25.277 632.703 1.00 184.96 ? 188  LYS C C     1 
ATOM   5007  O  O     . LYS C 2  188  ? 473.630 -25.004 632.334 1.00 189.52 ? 188  LYS C O     1 
ATOM   5008  C  CB    . LYS C 2  188  ? 475.347 -23.134 633.861 1.00 182.00 ? 188  LYS C CB    1 
ATOM   5009  C  CG    . LYS C 2  188  ? 475.854 -22.358 635.070 1.00 179.52 ? 188  LYS C CG    1 
ATOM   5010  C  CD    . LYS C 2  188  ? 475.640 -20.844 634.897 1.00 180.66 ? 188  LYS C CD    1 
ATOM   5011  C  CE    . LYS C 2  188  ? 476.430 -20.042 635.941 1.00 178.15 ? 188  LYS C CE    1 
ATOM   5012  N  NZ    . LYS C 2  188  ? 477.166 -18.863 635.385 1.00 178.10 ? 188  LYS C NZ    1 
ATOM   5013  N  N     . ARG C 2  189  ? 475.559 -26.126 632.021 1.00 179.84 ? 189  ARG C N     1 
ATOM   5014  C  CA    . ARG C 2  189  ? 475.076 -26.792 630.817 1.00 177.98 ? 189  ARG C CA    1 
ATOM   5015  C  C     . ARG C 2  189  ? 474.586 -28.200 631.131 1.00 169.54 ? 189  ARG C C     1 
ATOM   5016  O  O     . ARG C 2  189  ? 475.247 -28.950 631.854 1.00 164.92 ? 189  ARG C O     1 
ATOM   5017  C  CB    . ARG C 2  189  ? 476.238 -26.906 629.833 1.00 182.71 ? 189  ARG C CB    1 
ATOM   5018  C  CG    . ARG C 2  189  ? 476.740 -25.595 629.270 1.00 187.68 ? 189  ARG C CG    1 
ATOM   5019  C  CD    . ARG C 2  189  ? 477.839 -25.848 628.251 1.00 193.44 ? 189  ARG C CD    1 
ATOM   5020  N  NE    . ARG C 2  189  ? 478.643 -24.656 627.993 1.00 196.42 ? 189  ARG C NE    1 
ATOM   5021  C  CZ    . ARG C 2  189  ? 479.215 -24.372 626.827 1.00 202.08 ? 189  ARG C CZ    1 
ATOM   5022  N  NH1   . ARG C 2  189  ? 479.070 -25.196 625.798 1.00 206.84 ? 189  ARG C NH1   1 
ATOM   5023  N  NH2   . ARG C 2  189  ? 479.946 -23.269 626.692 1.00 202.16 ? 189  ARG C NH2   1 
ATOM   5024  N  N     . LYS C 2  190  ? 473.474 -28.590 630.509 1.00 166.20 ? 190  LYS C N     1 
ATOM   5025  C  CA    . LYS C 2  190  ? 472.934 -29.934 630.656 1.00 164.01 ? 190  LYS C CA    1 
ATOM   5026  C  C     . LYS C 2  190  ? 473.005 -30.673 629.327 1.00 168.68 ? 190  LYS C C     1 
ATOM   5027  O  O     . LYS C 2  190  ? 472.886 -30.071 628.255 1.00 172.19 ? 190  LYS C O     1 
ATOM   5028  C  CB    . LYS C 2  190  ? 471.482 -29.920 631.194 1.00 160.40 ? 190  LYS C CB    1 
ATOM   5029  C  CG    . LYS C 2  190  ? 471.288 -29.033 632.440 1.00 154.83 ? 190  LYS C CG    1 
ATOM   5030  C  CD    . LYS C 2  190  ? 469.865 -28.960 633.042 1.00 153.68 ? 190  LYS C CD    1 
ATOM   5031  C  CE    . LYS C 2  190  ? 469.438 -30.284 633.677 1.00 152.87 ? 190  LYS C CE    1 
ATOM   5032  N  NZ    . LYS C 2  190  ? 468.266 -30.127 634.598 1.00 151.14 ? 190  LYS C NZ    1 
ATOM   5033  N  N     . PHE C 2  191  ? 473.188 -31.983 629.403 1.00 170.40 ? 191  PHE C N     1 
ATOM   5034  C  CA    . PHE C 2  191  ? 473.101 -32.843 628.232 1.00 175.86 ? 191  PHE C CA    1 
ATOM   5035  C  C     . PHE C 2  191  ? 472.655 -34.206 628.724 1.00 176.56 ? 191  PHE C C     1 
ATOM   5036  O  O     . PHE C 2  191  ? 472.639 -34.460 629.936 1.00 173.28 ? 191  PHE C O     1 
ATOM   5037  C  CB    . PHE C 2  191  ? 474.448 -32.959 627.511 1.00 173.44 ? 191  PHE C CB    1 
ATOM   5038  C  CG    . PHE C 2  191  ? 475.535 -33.531 628.370 1.00 166.98 ? 191  PHE C CG    1 
ATOM   5039  C  CD1   . PHE C 2  191  ? 476.206 -32.750 629.296 1.00 160.70 ? 191  PHE C CD1   1 
ATOM   5040  C  CD2   . PHE C 2  191  ? 475.875 -34.867 628.253 1.00 167.10 ? 191  PHE C CD2   1 
ATOM   5041  C  CE1   . PHE C 2  191  ? 477.195 -33.296 630.081 1.00 157.08 ? 191  PHE C CE1   1 
ATOM   5042  C  CE2   . PHE C 2  191  ? 476.858 -35.419 629.034 1.00 163.18 ? 191  PHE C CE2   1 
ATOM   5043  C  CZ    . PHE C 2  191  ? 477.522 -34.633 629.949 1.00 158.82 ? 191  PHE C CZ    1 
ATOM   5044  N  N     . PRO C 2  192  ? 472.363 -35.138 627.816 1.00 182.29 ? 192  PRO C N     1 
ATOM   5045  C  CA    . PRO C 2  192  ? 472.037 -36.487 628.288 1.00 180.52 ? 192  PRO C CA    1 
ATOM   5046  C  C     . PRO C 2  192  ? 473.282 -37.195 628.809 1.00 175.68 ? 192  PRO C C     1 
ATOM   5047  O  O     . PRO C 2  192  ? 474.303 -37.287 628.122 1.00 170.59 ? 192  PRO C O     1 
ATOM   5048  C  CB    . PRO C 2  192  ? 471.468 -37.169 627.039 1.00 188.84 ? 192  PRO C CB    1 
ATOM   5049  C  CG    . PRO C 2  192  ? 470.965 -36.049 626.194 1.00 190.41 ? 192  PRO C CG    1 
ATOM   5050  C  CD    . PRO C 2  192  ? 471.941 -34.934 626.417 1.00 185.10 ? 192  PRO C CD    1 
ATOM   5051  N  N     . LEU C 2  193  ? 473.143 -37.782 630.002 1.00 172.71 ? 193  LEU C N     1 
ATOM   5052  C  CA    . LEU C 2  193  ? 474.231 -38.488 630.671 1.00 170.10 ? 193  LEU C CA    1 
ATOM   5053  C  C     . LEU C 2  193  ? 474.682 -39.703 629.876 1.00 176.63 ? 193  LEU C C     1 
ATOM   5054  O  O     . LEU C 2  193  ? 475.836 -40.131 629.995 1.00 177.58 ? 193  LEU C O     1 
ATOM   5055  C  CB    . LEU C 2  193  ? 473.789 -38.890 632.079 1.00 159.26 ? 193  LEU C CB    1 
ATOM   5056  C  CG    . LEU C 2  193  ? 474.779 -39.731 632.870 1.00 151.82 ? 193  LEU C CG    1 
ATOM   5057  C  CD1   . LEU C 2  193  ? 476.033 -38.930 633.065 1.00 147.35 ? 193  LEU C CD1   1 
ATOM   5058  C  CD2   . LEU C 2  193  ? 474.197 -40.147 634.202 1.00 147.90 ? 193  LEU C CD2   1 
ATOM   5059  N  N     . VAL C 2  194  ? 473.792 -40.233 629.042 1.00 185.43 ? 194  VAL C N     1 
ATOM   5060  C  CA    . VAL C 2  194  ? 474.074 -41.420 628.246 1.00 193.81 ? 194  VAL C CA    1 
ATOM   5061  C  C     . VAL C 2  194  ? 475.311 -41.208 627.387 1.00 195.73 ? 194  VAL C C     1 
ATOM   5062  O  O     . VAL C 2  194  ? 476.154 -42.103 627.267 1.00 197.71 ? 194  VAL C O     1 
ATOM   5063  C  CB    . VAL C 2  194  ? 472.838 -41.786 627.400 1.00 202.80 ? 194  VAL C CB    1 
ATOM   5064  C  CG1   . VAL C 2  194  ? 472.104 -40.533 626.961 1.00 203.69 ? 194  VAL C CG1   1 
ATOM   5065  C  CG2   . VAL C 2  194  ? 473.223 -42.634 626.191 1.00 208.31 ? 194  VAL C CG2   1 
ATOM   5066  N  N     . LEU C 2  195  ? 475.484 -40.001 626.849 1.00 197.60 ? 195  LEU C N     1 
ATOM   5067  C  CA    . LEU C 2  195  ? 476.629 -39.715 625.984 1.00 200.68 ? 195  LEU C CA    1 
ATOM   5068  C  C     . LEU C 2  195  ? 477.945 -39.953 626.712 1.00 194.84 ? 195  LEU C C     1 
ATOM   5069  O  O     . LEU C 2  195  ? 478.876 -40.552 626.160 1.00 199.66 ? 195  LEU C O     1 
ATOM   5070  C  CB    . LEU C 2  195  ? 476.544 -38.278 625.465 1.00 202.50 ? 195  LEU C CB    1 
ATOM   5071  C  CG    . LEU C 2  195  ? 477.710 -37.754 624.627 1.00 202.97 ? 195  LEU C CG    1 
ATOM   5072  C  CD1   . LEU C 2  195  ? 477.933 -38.658 623.428 1.00 210.61 ? 195  LEU C CD1   1 
ATOM   5073  C  CD2   . LEU C 2  195  ? 477.409 -36.341 624.162 1.00 200.26 ? 195  LEU C CD2   1 
ATOM   5074  N  N     . LEU C 2  196  ? 478.052 -39.459 627.936 1.00 182.95 ? 196  LEU C N     1 
ATOM   5075  C  CA    . LEU C 2  196  ? 479.260 -39.671 628.724 1.00 176.81 ? 196  LEU C CA    1 
ATOM   5076  C  C     . LEU C 2  196  ? 479.505 -41.150 629.028 1.00 176.16 ? 196  LEU C C     1 
ATOM   5077  O  O     . LEU C 2  196  ? 480.653 -41.611 629.007 1.00 177.39 ? 196  LEU C O     1 
ATOM   5078  C  CB    . LEU C 2  196  ? 479.167 -38.867 630.016 1.00 173.31 ? 196  LEU C CB    1 
ATOM   5079  C  CG    . LEU C 2  196  ? 480.420 -38.812 630.894 1.00 172.14 ? 196  LEU C CG    1 
ATOM   5080  C  CD1   . LEU C 2  196  ? 480.427 -39.876 632.007 1.00 170.39 ? 196  LEU C CD1   1 
ATOM   5081  C  CD2   . LEU C 2  196  ? 481.675 -38.907 630.013 1.00 175.74 ? 196  LEU C CD2   1 
ATOM   5082  N  N     . LEU C 2  197  ? 478.442 -41.912 629.288 1.00 178.88 ? 197  LEU C N     1 
ATOM   5083  C  CA    . LEU C 2  197  ? 478.574 -43.352 629.514 1.00 184.69 ? 197  LEU C CA    1 
ATOM   5084  C  C     . LEU C 2  197  ? 479.229 -44.075 628.333 1.00 194.89 ? 197  LEU C C     1 
ATOM   5085  O  O     . LEU C 2  197  ? 480.079 -44.955 628.529 1.00 199.47 ? 197  LEU C O     1 
ATOM   5086  C  CB    . LEU C 2  197  ? 477.185 -43.925 629.785 1.00 180.99 ? 197  LEU C CB    1 
ATOM   5087  C  CG    . LEU C 2  197  ? 476.605 -43.511 631.136 1.00 174.88 ? 197  LEU C CG    1 
ATOM   5088  C  CD1   . LEU C 2  197  ? 475.193 -44.017 631.298 1.00 177.79 ? 197  LEU C CD1   1 
ATOM   5089  C  CD2   . LEU C 2  197  ? 477.473 -44.036 632.250 1.00 172.19 ? 197  LEU C CD2   1 
ATOM   5090  N  N     . ARG C 2  198  ? 478.890 -43.684 627.103 1.00 201.50 ? 198  ARG C N     1 
ATOM   5091  C  CA    . ARG C 2  198  ? 479.478 -44.304 625.920 1.00 201.80 ? 198  ARG C CA    1 
ATOM   5092  C  C     . ARG C 2  198  ? 480.973 -44.022 625.862 1.00 197.57 ? 198  ARG C C     1 
ATOM   5093  O  O     . ARG C 2  198  ? 481.771 -44.902 625.523 1.00 202.40 ? 198  ARG C O     1 
ATOM   5094  C  CB    . ARG C 2  198  ? 478.766 -43.777 624.670 1.00 205.22 ? 198  ARG C CB    1 
ATOM   5095  C  CG    . ARG C 2  198  ? 479.115 -44.419 623.336 1.00 215.39 ? 198  ARG C CG    1 
ATOM   5096  C  CD    . ARG C 2  198  ? 478.888 -45.920 623.293 1.00 221.47 ? 198  ARG C CD    1 
ATOM   5097  N  NE    . ARG C 2  198  ? 479.256 -46.463 621.982 1.00 228.92 ? 198  ARG C NE    1 
ATOM   5098  C  CZ    . ARG C 2  198  ? 479.580 -47.733 621.755 1.00 234.60 ? 198  ARG C CZ    1 
ATOM   5099  N  NH1   . ARG C 2  198  ? 479.901 -48.137 620.529 1.00 239.75 ? 198  ARG C NH1   1 
ATOM   5100  N  NH2   . ARG C 2  198  ? 479.575 -48.602 622.755 1.00 234.22 ? 198  ARG C NH2   1 
ATOM   5101  N  N     . VAL C 2  199  ? 481.366 -42.812 626.264 1.00 185.51 ? 199  VAL C N     1 
ATOM   5102  C  CA    . VAL C 2  199  ? 482.765 -42.401 626.363 1.00 179.27 ? 199  VAL C CA    1 
ATOM   5103  C  C     . VAL C 2  199  ? 483.557 -43.268 627.338 1.00 176.02 ? 199  VAL C C     1 
ATOM   5104  O  O     . VAL C 2  199  ? 484.757 -43.511 627.139 1.00 179.00 ? 199  VAL C O     1 
ATOM   5105  C  CB    . VAL C 2  199  ? 482.818 -40.917 626.768 1.00 164.12 ? 199  VAL C CB    1 
ATOM   5106  C  CG1   . VAL C 2  199  ? 484.259 -40.439 626.862 1.00 159.66 ? 199  VAL C CG1   1 
ATOM   5107  C  CG2   . VAL C 2  199  ? 482.004 -40.075 625.795 1.00 161.35 ? 199  VAL C CG2   1 
ATOM   5108  N  N     . LEU C 2  200  ? 482.904 -43.775 628.377 1.00 179.61 ? 200  LEU C N     1 
ATOM   5109  C  CA    . LEU C 2  200  ? 483.556 -44.617 629.373 1.00 181.42 ? 200  LEU C CA    1 
ATOM   5110  C  C     . LEU C 2  200  ? 483.855 -46.011 628.857 1.00 189.46 ? 200  LEU C C     1 
ATOM   5111  O  O     . LEU C 2  200  ? 484.512 -46.787 629.561 1.00 191.13 ? 200  LEU C O     1 
ATOM   5112  C  CB    . LEU C 2  200  ? 482.662 -44.735 630.593 1.00 182.20 ? 200  LEU C CB    1 
ATOM   5113  C  CG    . LEU C 2  200  ? 482.500 -43.388 631.274 1.00 179.40 ? 200  LEU C CG    1 
ATOM   5114  C  CD1   . LEU C 2  200  ? 481.341 -43.435 632.260 1.00 178.96 ? 200  LEU C CD1   1 
ATOM   5115  C  CD2   . LEU C 2  200  ? 483.803 -43.011 631.948 1.00 175.98 ? 200  LEU C CD2   1 
ATOM   5116  N  N     . GLY C 2  201  ? 483.348 -46.349 627.681 1.00 194.48 ? 201  GLY C N     1 
ATOM   5117  C  CA    . GLY C 2  201  ? 483.614 -47.614 627.044 1.00 198.90 ? 201  GLY C CA    1 
ATOM   5118  C  C     . GLY C 2  201  ? 482.503 -48.583 627.327 1.00 201.66 ? 201  GLY C C     1 
ATOM   5119  O  O     . GLY C 2  201  ? 482.671 -49.790 627.120 1.00 206.57 ? 201  GLY C O     1 
ATOM   5120  N  N     . TYR C 2  202  ? 481.366 -48.068 627.775 1.00 196.33 ? 202  TYR C N     1 
ATOM   5121  C  CA    . TYR C 2  202  ? 480.180 -48.844 628.075 1.00 194.60 ? 202  TYR C CA    1 
ATOM   5122  C  C     . TYR C 2  202  ? 479.429 -49.231 626.813 1.00 196.32 ? 202  TYR C C     1 
ATOM   5123  O  O     . TYR C 2  202  ? 479.336 -48.457 625.855 1.00 195.03 ? 202  TYR C O     1 
ATOM   5124  C  CB    . TYR C 2  202  ? 479.262 -48.034 628.980 1.00 192.39 ? 202  TYR C CB    1 
ATOM   5125  C  CG    . TYR C 2  202  ? 479.714 -47.993 630.410 1.00 186.85 ? 202  TYR C CG    1 
ATOM   5126  C  CD1   . TYR C 2  202  ? 480.708 -48.847 630.867 1.00 188.17 ? 202  TYR C CD1   1 
ATOM   5127  C  CD2   . TYR C 2  202  ? 479.168 -47.083 631.293 1.00 179.95 ? 202  TYR C CD2   1 
ATOM   5128  C  CE1   . TYR C 2  202  ? 481.129 -48.806 632.168 1.00 184.05 ? 202  TYR C CE1   1 
ATOM   5129  C  CE2   . TYR C 2  202  ? 479.577 -47.038 632.593 1.00 177.38 ? 202  TYR C CE2   1 
ATOM   5130  C  CZ    . TYR C 2  202  ? 480.559 -47.900 633.032 1.00 178.49 ? 202  TYR C CZ    1 
ATOM   5131  O  OH    . TYR C 2  202  ? 480.976 -47.853 634.344 1.00 174.38 ? 202  TYR C OH    1 
ATOM   5132  N  N     . ASP C 2  203  ? 478.870 -50.430 626.835 1.00 195.55 ? 203  ASP C N     1 
ATOM   5133  C  CA    . ASP C 2  203  ? 478.053 -50.934 625.751 1.00 201.86 ? 203  ASP C CA    1 
ATOM   5134  C  C     . ASP C 2  203  ? 476.653 -51.186 626.290 1.00 204.85 ? 203  ASP C C     1 
ATOM   5135  O  O     . ASP C 2  203  ? 476.441 -51.290 627.501 1.00 203.21 ? 203  ASP C O     1 
ATOM   5136  C  CB    . ASP C 2  203  ? 478.651 -52.224 625.173 1.00 202.94 ? 203  ASP C CB    1 
ATOM   5137  C  CG    . ASP C 2  203  ? 478.186 -52.510 623.756 1.00 207.31 ? 203  ASP C CG    1 
ATOM   5138  O  OD1   . ASP C 2  203  ? 478.679 -51.857 622.809 1.00 208.03 ? 203  ASP C OD1   1 
ATOM   5139  O  OD2   . ASP C 2  203  ? 477.337 -53.411 623.587 1.00 211.77 ? 203  ASP C OD2   1 
ATOM   5140  N  N     . GLN C 2  204  ? 475.690 -51.232 625.367 1.00 215.40 ? 204  GLN C N     1 
ATOM   5141  C  CA    . GLN C 2  204  ? 474.284 -51.396 625.728 1.00 223.82 ? 204  GLN C CA    1 
ATOM   5142  C  C     . GLN C 2  204  ? 474.083 -52.599 626.648 1.00 227.55 ? 204  GLN C C     1 
ATOM   5143  O  O     . GLN C 2  204  ? 473.232 -52.580 627.545 1.00 225.98 ? 204  GLN C O     1 
ATOM   5144  C  CB    . GLN C 2  204  ? 473.480 -51.562 624.441 1.00 231.31 ? 204  GLN C CB    1 
ATOM   5145  C  CG    . GLN C 2  204  ? 471.987 -51.556 624.556 1.00 234.50 ? 204  GLN C CG    1 
ATOM   5146  C  CD    . GLN C 2  204  ? 471.342 -51.409 623.189 1.00 240.76 ? 204  GLN C CD    1 
ATOM   5147  O  OE1   . GLN C 2  204  ? 472.034 -51.261 622.178 1.00 241.31 ? 204  GLN C OE1   1 
ATOM   5148  N  NE2   . GLN C 2  204  ? 470.020 -51.477 623.148 1.00 244.61 ? 204  GLN C NE2   1 
ATOM   5149  N  N     . GLU C 2  205  ? 474.867 -53.656 626.422 1.00 238.83 ? 205  GLU C N     1 
ATOM   5150  C  CA    . GLU C 2  205  ? 474.819 -54.871 627.234 1.00 242.47 ? 205  GLU C CA    1 
ATOM   5151  C  C     . GLU C 2  205  ? 475.205 -54.599 628.684 1.00 229.57 ? 205  GLU C C     1 
ATOM   5152  O  O     . GLU C 2  205  ? 474.515 -55.031 629.613 1.00 227.20 ? 205  GLU C O     1 
ATOM   5153  C  CB    . GLU C 2  205  ? 475.728 -55.953 626.628 1.00 254.35 ? 205  GLU C CB    1 
ATOM   5154  C  CG    . GLU C 2  205  ? 477.224 -55.580 626.517 1.00 258.94 ? 205  GLU C CG    1 
ATOM   5155  C  CD    . GLU C 2  205  ? 478.075 -56.151 627.657 1.00 261.27 ? 205  GLU C CD    1 
ATOM   5156  O  OE1   . GLU C 2  205  ? 477.509 -56.487 628.723 1.00 261.10 ? 205  GLU C OE1   1 
ATOM   5157  O  OE2   . GLU C 2  205  ? 479.313 -56.245 627.493 1.00 261.65 ? 205  GLU C OE2   1 
ATOM   5158  N  N     . THR C 2  206  ? 476.340 -53.922 628.888 1.00 211.69 ? 206  THR C N     1 
ATOM   5159  C  CA    . THR C 2  206  ? 476.856 -53.671 630.230 1.00 199.96 ? 206  THR C CA    1 
ATOM   5160  C  C     . THR C 2  206  ? 475.881 -52.862 631.084 1.00 191.53 ? 206  THR C C     1 
ATOM   5161  O  O     . THR C 2  206  ? 475.644 -53.202 632.250 1.00 190.01 ? 206  THR C O     1 
ATOM   5162  C  CB    . THR C 2  206  ? 478.214 -52.956 630.123 1.00 189.82 ? 206  THR C CB    1 
ATOM   5163  O  OG1   . THR C 2  206  ? 478.965 -53.481 629.017 1.00 188.22 ? 206  THR C OG1   1 
ATOM   5164  C  CG2   . THR C 2  206  ? 479.027 -53.133 631.400 1.00 186.87 ? 206  THR C CG2   1 
ATOM   5165  N  N     . LEU C 2  207  ? 475.320 -51.778 630.539 1.00 192.20 ? 207  LEU C N     1 
ATOM   5166  C  CA    . LEU C 2  207  ? 474.365 -50.986 631.318 1.00 189.99 ? 207  LEU C CA    1 
ATOM   5167  C  C     . LEU C 2  207  ? 473.075 -51.759 631.591 1.00 197.94 ? 207  LEU C C     1 
ATOM   5168  O  O     . LEU C 2  207  ? 472.478 -51.620 632.665 1.00 194.34 ? 207  LEU C O     1 
ATOM   5169  C  CB    . LEU C 2  207  ? 474.070 -49.656 630.620 1.00 186.12 ? 207  LEU C CB    1 
ATOM   5170  C  CG    . LEU C 2  207  ? 475.310 -48.768 630.400 1.00 180.30 ? 207  LEU C CG    1 
ATOM   5171  C  CD1   . LEU C 2  207  ? 474.947 -47.373 629.910 1.00 176.78 ? 207  LEU C CD1   1 
ATOM   5172  C  CD2   . LEU C 2  207  ? 476.199 -48.688 631.624 1.00 174.83 ? 207  LEU C CD2   1 
ATOM   5173  N  N     . ALA C 2  208  ? 472.608 -52.534 630.609 1.00 211.12 ? 208  ALA C N     1 
ATOM   5174  C  CA    . ALA C 2  208  ? 471.404 -53.348 630.781 1.00 222.28 ? 208  ALA C CA    1 
ATOM   5175  C  C     . ALA C 2  208  ? 471.569 -54.425 631.852 1.00 228.29 ? 208  ALA C C     1 
ATOM   5176  O  O     . ALA C 2  208  ? 470.727 -54.556 632.748 1.00 229.16 ? 208  ALA C O     1 
ATOM   5177  C  CB    . ALA C 2  208  ? 471.015 -53.989 629.449 1.00 226.72 ? 208  ALA C CB    1 
ATOM   5178  N  N     . ARG C 2  209  ? 472.651 -55.207 631.781 1.00 240.03 ? 209  ARG C N     1 
ATOM   5179  C  CA    . ARG C 2  209  ? 472.843 -56.267 632.770 1.00 243.42 ? 209  ARG C CA    1 
ATOM   5180  C  C     . ARG C 2  209  ? 473.105 -55.719 634.170 1.00 231.77 ? 209  ARG C C     1 
ATOM   5181  O  O     . ARG C 2  209  ? 472.674 -56.316 635.161 1.00 232.22 ? 209  ARG C O     1 
ATOM   5182  C  CB    . ARG C 2  209  ? 473.982 -57.212 632.336 1.00 251.64 ? 209  ARG C CB    1 
ATOM   5183  C  CG    . ARG C 2  209  ? 475.409 -56.819 632.738 1.00 252.98 ? 209  ARG C CG    1 
ATOM   5184  C  CD    . ARG C 2  209  ? 476.375 -57.975 632.470 1.00 259.90 ? 209  ARG C CD    1 
ATOM   5185  N  NE    . ARG C 2  209  ? 477.550 -57.941 633.340 1.00 259.74 ? 209  ARG C NE    1 
ATOM   5186  C  CZ    . ARG C 2  209  ? 478.695 -57.341 633.034 1.00 259.15 ? 209  ARG C CZ    1 
ATOM   5187  N  NH1   . ARG C 2  209  ? 478.829 -56.720 631.870 1.00 260.19 ? 209  ARG C NH1   1 
ATOM   5188  N  NH2   . ARG C 2  209  ? 479.707 -57.363 633.891 1.00 256.87 ? 209  ARG C NH2   1 
ATOM   5189  N  N     . GLU C 2  210  ? 473.835 -54.610 634.279 1.00 212.61 ? 210  GLU C N     1 
ATOM   5190  C  CA    . GLU C 2  210  ? 474.187 -54.081 635.590 1.00 200.96 ? 210  GLU C CA    1 
ATOM   5191  C  C     . GLU C 2  210  ? 472.979 -53.444 636.304 1.00 195.34 ? 210  GLU C C     1 
ATOM   5192  O  O     . GLU C 2  210  ? 472.641 -53.818 637.433 1.00 194.84 ? 210  GLU C O     1 
ATOM   5193  C  CB    . GLU C 2  210  ? 475.322 -53.065 635.425 1.00 193.18 ? 210  GLU C CB    1 
ATOM   5194  C  CG    . GLU C 2  210  ? 476.302 -52.992 636.587 1.00 187.36 ? 210  GLU C CG    1 
ATOM   5195  C  CD    . GLU C 2  210  ? 477.062 -54.309 636.776 1.00 188.29 ? 210  GLU C CD    1 
ATOM   5196  O  OE1   . GLU C 2  210  ? 477.450 -54.930 635.754 1.00 188.89 ? 210  GLU C OE1   1 
ATOM   5197  O  OE2   . GLU C 2  210  ? 477.270 -54.718 637.944 1.00 186.36 ? 210  GLU C OE2   1 
ATOM   5198  N  N     . LEU C 2  211  ? 472.314 -52.496 635.638 1.00 188.84 ? 211  LEU C N     1 
ATOM   5199  C  CA    . LEU C 2  211  ? 471.257 -51.604 636.131 1.00 180.99 ? 211  LEU C CA    1 
ATOM   5200  C  C     . LEU C 2  211  ? 469.806 -51.974 635.840 1.00 181.05 ? 211  LEU C C     1 
ATOM   5201  O  O     . LEU C 2  211  ? 468.904 -51.271 636.312 1.00 182.53 ? 211  LEU C O     1 
ATOM   5202  C  CB    . LEU C 2  211  ? 471.465 -50.182 635.620 1.00 171.64 ? 211  LEU C CB    1 
ATOM   5203  C  CG    . LEU C 2  211  ? 472.682 -49.369 636.030 1.00 162.28 ? 211  LEU C CG    1 
ATOM   5204  C  CD1   . LEU C 2  211  ? 473.843 -49.668 635.116 1.00 161.68 ? 211  LEU C CD1   1 
ATOM   5205  C  CD2   . LEU C 2  211  ? 472.268 -47.924 635.950 1.00 156.83 ? 211  LEU C CD2   1 
ATOM   5206  N  N     . GLY C 2  212  ? 469.524 -53.095 635.196 1.00 193.44 ? 212  GLY C N     1 
ATOM   5207  C  CA    . GLY C 2  212  ? 468.177 -53.442 634.701 1.00 204.20 ? 212  GLY C CA    1 
ATOM   5208  C  C     . GLY C 2  212  ? 466.942 -53.409 635.581 1.00 210.36 ? 212  GLY C C     1 
ATOM   5209  O  O     . GLY C 2  212  ? 465.831 -53.159 635.051 1.00 206.45 ? 212  GLY C O     1 
ATOM   5210  N  N     . ALA C 2  213  ? 467.071 -53.615 636.859 1.00 217.58 ? 213  ALA C N     1 
ATOM   5211  C  CA    . ALA C 2  213  ? 465.950 -53.737 637.793 1.00 224.60 ? 213  ALA C CA    1 
ATOM   5212  C  C     . ALA C 2  213  ? 464.886 -52.640 637.769 1.00 223.64 ? 213  ALA C C     1 
ATOM   5213  O  O     . ALA C 2  213  ? 463.755 -52.896 638.165 1.00 231.64 ? 213  ALA C O     1 
ATOM   5214  C  CB    . ALA C 2  213  ? 466.507 -53.818 639.220 1.00 220.21 ? 213  ALA C CB    1 
ATOM   5215  N  N     . TYR C 2  214  ? 465.179 -51.428 637.312 1.00 219.85 ? 214  TYR C N     1 
ATOM   5216  C  CA    . TYR C 2  214  ? 464.186 -50.360 637.302 1.00 220.74 ? 214  TYR C CA    1 
ATOM   5217  C  C     . TYR C 2  214  ? 463.555 -50.173 635.938 1.00 228.12 ? 214  TYR C C     1 
ATOM   5218  O  O     . TYR C 2  214  ? 464.192 -49.667 635.009 1.00 229.10 ? 214  TYR C O     1 
ATOM   5219  C  CB    . TYR C 2  214  ? 464.858 -49.079 637.745 1.00 211.51 ? 214  TYR C CB    1 
ATOM   5220  C  CG    . TYR C 2  214  ? 465.928 -49.450 638.710 1.00 206.99 ? 214  TYR C CG    1 
ATOM   5221  C  CD1   . TYR C 2  214  ? 465.629 -49.682 640.043 1.00 204.30 ? 214  TYR C CD1   1 
ATOM   5222  C  CD2   . TYR C 2  214  ? 467.231 -49.651 638.276 1.00 205.38 ? 214  TYR C CD2   1 
ATOM   5223  C  CE1   . TYR C 2  214  ? 466.607 -50.083 640.920 1.00 200.89 ? 214  TYR C CE1   1 
ATOM   5224  C  CE2   . TYR C 2  214  ? 468.216 -50.056 639.142 1.00 201.87 ? 214  TYR C CE2   1 
ATOM   5225  C  CZ    . TYR C 2  214  ? 467.904 -50.266 640.470 1.00 198.59 ? 214  TYR C CZ    1 
ATOM   5226  O  OH    . TYR C 2  214  ? 468.876 -50.662 641.367 1.00 192.94 ? 214  TYR C OH    1 
ATOM   5227  N  N     . GLY C 2  215  ? 462.279 -50.565 635.833 1.00 239.59 ? 215  GLY C N     1 
ATOM   5228  C  CA    . GLY C 2  215  ? 461.702 -50.944 634.566 1.00 250.58 ? 215  GLY C CA    1 
ATOM   5229  C  C     . GLY C 2  215  ? 461.773 -49.729 633.683 1.00 254.30 ? 215  GLY C C     1 
ATOM   5230  O  O     . GLY C 2  215  ? 462.358 -49.807 632.597 1.00 258.36 ? 215  GLY C O     1 
ATOM   5231  N  N     . GLU C 2  216  ? 461.181 -48.608 634.090 1.00 253.58 ? 216  GLU C N     1 
ATOM   5232  C  CA    . GLU C 2  216  ? 461.067 -47.570 633.086 1.00 250.83 ? 216  GLU C CA    1 
ATOM   5233  C  C     . GLU C 2  216  ? 462.308 -46.695 633.088 1.00 241.94 ? 216  GLU C C     1 
ATOM   5234  O  O     . GLU C 2  216  ? 462.531 -45.950 632.127 1.00 245.72 ? 216  GLU C O     1 
ATOM   5235  C  CB    . GLU C 2  216  ? 459.827 -46.687 633.332 1.00 251.80 ? 216  GLU C CB    1 
ATOM   5236  C  CG    . GLU C 2  216  ? 458.487 -47.419 633.352 1.00 256.83 ? 216  GLU C CG    1 
ATOM   5237  C  CD    . GLU C 2  216  ? 457.291 -46.479 633.233 1.00 256.05 ? 216  GLU C CD    1 
ATOM   5238  O  OE1   . GLU C 2  216  ? 457.442 -45.267 633.496 1.00 250.91 ? 216  GLU C OE1   1 
ATOM   5239  O  OE2   . GLU C 2  216  ? 456.195 -46.956 632.870 1.00 260.92 ? 216  GLU C OE2   1 
ATOM   5240  N  N     . LEU C 2  217  ? 463.123 -46.763 634.150 1.00 222.19 ? 217  LEU C N     1 
ATOM   5241  C  CA    . LEU C 2  217  ? 464.222 -45.814 634.187 1.00 205.04 ? 217  LEU C CA    1 
ATOM   5242  C  C     . LEU C 2  217  ? 465.444 -46.281 633.393 1.00 203.46 ? 217  LEU C C     1 
ATOM   5243  O  O     . LEU C 2  217  ? 466.059 -45.472 632.690 1.00 206.83 ? 217  LEU C O     1 
ATOM   5244  C  CB    . LEU C 2  217  ? 464.579 -45.532 635.642 1.00 189.07 ? 217  LEU C CB    1 
ATOM   5245  C  CG    . LEU C 2  217  ? 463.315 -45.356 636.485 1.00 179.63 ? 217  LEU C CG    1 
ATOM   5246  C  CD1   . LEU C 2  217  ? 463.637 -45.593 637.942 1.00 173.19 ? 217  LEU C CD1   1 
ATOM   5247  C  CD2   . LEU C 2  217  ? 462.679 -43.990 636.265 1.00 175.17 ? 217  LEU C CD2   1 
ATOM   5248  N  N     . VAL C 2  218  ? 465.839 -47.564 633.515 1.00 205.10 ? 218  VAL C N     1 
ATOM   5249  C  CA    . VAL C 2  218  ? 467.059 -48.020 632.832 1.00 203.05 ? 218  VAL C CA    1 
ATOM   5250  C  C     . VAL C 2  218  ? 466.930 -47.911 631.319 1.00 201.86 ? 218  VAL C C     1 
ATOM   5251  O  O     . VAL C 2  218  ? 467.899 -47.599 630.617 1.00 200.95 ? 218  VAL C O     1 
ATOM   5252  C  CB    . VAL C 2  218  ? 467.446 -49.449 633.257 1.00 202.23 ? 218  VAL C CB    1 
ATOM   5253  C  CG1   . VAL C 2  218  ? 468.956 -49.629 633.136 1.00 197.44 ? 218  VAL C CG1   1 
ATOM   5254  C  CG2   . VAL C 2  218  ? 467.036 -49.688 634.683 1.00 201.11 ? 218  VAL C CG2   1 
ATOM   5255  N  N     . GLN C 2  219  ? 465.730 -48.185 630.799 1.00 208.16 ? 219  GLN C N     1 
ATOM   5256  C  CA    . GLN C 2  219  ? 465.442 -48.035 629.374 1.00 212.98 ? 219  GLN C CA    1 
ATOM   5257  C  C     . GLN C 2  219  ? 465.432 -46.576 628.946 1.00 213.66 ? 219  GLN C C     1 
ATOM   5258  O  O     . GLN C 2  219  ? 465.771 -46.265 627.795 1.00 218.18 ? 219  GLN C O     1 
ATOM   5259  C  CB    . GLN C 2  219  ? 464.154 -48.773 628.988 1.00 219.14 ? 219  GLN C CB    1 
ATOM   5260  C  CG    . GLN C 2  219  ? 464.468 -50.202 628.495 1.00 221.21 ? 219  GLN C CG    1 
ATOM   5261  C  CD    . GLN C 2  219  ? 463.302 -50.919 627.834 1.00 224.84 ? 219  GLN C CD    1 
ATOM   5262  O  OE1   . GLN C 2  219  ? 462.865 -50.553 626.743 1.00 225.13 ? 219  GLN C OE1   1 
ATOM   5263  N  NE2   . GLN C 2  219  ? 462.821 -51.975 628.478 1.00 228.36 ? 219  GLN C NE2   1 
ATOM   5264  N  N     . GLY C 2  220  ? 465.066 -45.675 629.860 1.00 206.17 ? 220  GLY C N     1 
ATOM   5265  C  CA    . GLY C 2  220  ? 465.118 -44.255 629.581 1.00 200.33 ? 220  GLY C CA    1 
ATOM   5266  C  C     . GLY C 2  220  ? 466.521 -43.707 629.431 1.00 194.15 ? 220  GLY C C     1 
ATOM   5267  O  O     . GLY C 2  220  ? 466.694 -42.656 628.807 1.00 194.64 ? 220  GLY C O     1 
ATOM   5268  N  N     . LEU C 2  221  ? 467.529 -44.380 629.986 1.00 191.08 ? 221  LEU C N     1 
ATOM   5269  C  CA    . LEU C 2  221  ? 468.892 -43.923 629.747 1.00 186.60 ? 221  LEU C CA    1 
ATOM   5270  C  C     . LEU C 2  221  ? 469.403 -44.319 628.364 1.00 193.89 ? 221  LEU C C     1 
ATOM   5271  O  O     . LEU C 2  221  ? 470.305 -43.652 627.854 1.00 195.52 ? 221  LEU C O     1 
ATOM   5272  C  CB    . LEU C 2  221  ? 469.826 -44.437 630.849 1.00 178.12 ? 221  LEU C CB    1 
ATOM   5273  C  CG    . LEU C 2  221  ? 470.599 -45.744 630.719 1.00 176.17 ? 221  LEU C CG    1 
ATOM   5274  C  CD1   . LEU C 2  221  ? 471.998 -45.391 630.359 1.00 172.90 ? 221  LEU C CD1   1 
ATOM   5275  C  CD2   . LEU C 2  221  ? 470.587 -46.533 632.015 1.00 175.30 ? 221  LEU C CD2   1 
ATOM   5276  N  N     . MET C 2  222  ? 468.840 -45.371 627.748 1.00 203.13 ? 222  MET C N     1 
ATOM   5277  C  CA    . MET C 2  222  ? 469.325 -45.934 626.480 1.00 210.30 ? 222  MET C CA    1 
ATOM   5278  C  C     . MET C 2  222  ? 468.901 -45.064 625.296 1.00 215.21 ? 222  MET C C     1 
ATOM   5279  O  O     . MET C 2  222  ? 467.702 -44.878 625.054 1.00 218.93 ? 222  MET C O     1 
ATOM   5280  C  CB    . MET C 2  222  ? 468.835 -47.369 626.294 1.00 209.43 ? 222  MET C CB    1 
ATOM   5281  C  CG    . MET C 2  222  ? 469.378 -48.320 627.341 1.00 204.69 ? 222  MET C CG    1 
ATOM   5282  S  SD    . MET C 2  222  ? 469.844 -49.916 626.660 1.00 208.26 ? 222  MET C SD    1 
ATOM   5283  C  CE    . MET C 2  222  ? 470.423 -50.746 628.135 1.00 205.31 ? 222  MET C CE    1 
ATOM   5284  N  N     . ASP C 2  223  ? 469.882 -44.569 624.535 1.00 221.64 ? 223  ASP C N     1 
ATOM   5285  C  CA    . ASP C 2  223  ? 469.635 -43.818 623.305 1.00 229.70 ? 223  ASP C CA    1 
ATOM   5286  C  C     . ASP C 2  223  ? 470.525 -44.326 622.170 1.00 237.67 ? 223  ASP C C     1 
ATOM   5287  O  O     . ASP C 2  223  ? 471.755 -44.244 622.253 1.00 236.11 ? 223  ASP C O     1 
ATOM   5288  C  CB    . ASP C 2  223  ? 469.830 -42.317 623.554 1.00 229.47 ? 223  ASP C CB    1 
ATOM   5289  C  CG    . ASP C 2  223  ? 469.515 -41.476 622.339 1.00 236.36 ? 223  ASP C CG    1 
ATOM   5290  O  OD1   . ASP C 2  223  ? 470.428 -41.255 621.516 1.00 237.96 ? 223  ASP C OD1   1 
ATOM   5291  O  OD2   . ASP C 2  223  ? 468.340 -41.063 622.195 1.00 239.45 ? 223  ASP C OD2   1 
ATOM   5292  N  N     . GLU C 2  224  ? 469.878 -44.850 621.115 1.00 242.86 ? 224  GLU C N     1 
ATOM   5293  C  CA    . GLU C 2  224  ? 470.529 -45.547 619.993 1.00 243.72 ? 224  GLU C CA    1 
ATOM   5294  C  C     . GLU C 2  224  ? 471.519 -44.669 619.223 1.00 237.54 ? 224  GLU C C     1 
ATOM   5295  O  O     . GLU C 2  224  ? 472.618 -45.124 618.886 1.00 234.73 ? 224  GLU C O     1 
ATOM   5296  C  CB    . GLU C 2  224  ? 469.475 -46.130 619.044 1.00 249.65 ? 224  GLU C CB    1 
ATOM   5297  C  CG    . GLU C 2  224  ? 468.338 -45.191 618.657 1.00 251.19 ? 224  GLU C CG    1 
ATOM   5298  C  CD    . GLU C 2  224  ? 467.224 -45.171 619.701 1.00 250.28 ? 224  GLU C CD    1 
ATOM   5299  O  OE1   . GLU C 2  224  ? 466.960 -46.236 620.299 1.00 251.28 ? 224  GLU C OE1   1 
ATOM   5300  O  OE2   . GLU C 2  224  ? 466.620 -44.099 619.933 1.00 248.65 ? 224  GLU C OE2   1 
ATOM   5301  N  N     . SER C 2  225  ? 471.141 -43.425 618.902 1.00 234.59 ? 225  SER C N     1 
ATOM   5302  C  CA    . SER C 2  225  ? 472.010 -42.556 618.102 1.00 235.02 ? 225  SER C CA    1 
ATOM   5303  C  C     . SER C 2  225  ? 473.381 -42.425 618.759 1.00 231.15 ? 225  SER C C     1 
ATOM   5304  O  O     . SER C 2  225  ? 474.407 -42.347 618.070 1.00 235.68 ? 225  SER C O     1 
ATOM   5305  C  CB    . SER C 2  225  ? 471.366 -41.181 617.892 1.00 228.53 ? 225  SER C CB    1 
ATOM   5306  O  OG    . SER C 2  225  ? 471.037 -40.547 619.117 1.00 221.63 ? 225  SER C OG    1 
ATOM   5307  N  N     . VAL C 2  226  ? 473.410 -42.373 620.092 1.00 229.06 ? 226  VAL C N     1 
ATOM   5308  C  CA    . VAL C 2  226  ? 474.655 -42.248 620.848 1.00 222.49 ? 226  VAL C CA    1 
ATOM   5309  C  C     . VAL C 2  226  ? 475.490 -43.519 620.688 1.00 225.44 ? 226  VAL C C     1 
ATOM   5310  O  O     . VAL C 2  226  ? 476.719 -43.456 620.577 1.00 226.86 ? 226  VAL C O     1 
ATOM   5311  C  CB    . VAL C 2  226  ? 474.373 -41.932 622.329 1.00 213.34 ? 226  VAL C CB    1 
ATOM   5312  C  CG1   . VAL C 2  226  ? 475.662 -42.013 623.141 1.00 207.83 ? 226  VAL C CG1   1 
ATOM   5313  C  CG2   . VAL C 2  226  ? 473.730 -40.563 622.464 1.00 210.88 ? 226  VAL C CG2   1 
ATOM   5314  N  N     . PHE C 2  227  ? 474.846 -44.692 620.710 1.00 224.51 ? 227  PHE C N     1 
ATOM   5315  C  CA    . PHE C 2  227  ? 475.576 -45.947 620.524 1.00 226.67 ? 227  PHE C CA    1 
ATOM   5316  C  C     . PHE C 2  227  ? 476.161 -46.080 619.122 1.00 239.60 ? 227  PHE C C     1 
ATOM   5317  O  O     . PHE C 2  227  ? 477.169 -46.776 618.944 1.00 244.67 ? 227  PHE C O     1 
ATOM   5318  C  CB    . PHE C 2  227  ? 474.669 -47.154 620.767 1.00 215.73 ? 227  PHE C CB    1 
ATOM   5319  C  CG    . PHE C 2  227  ? 474.312 -47.389 622.199 1.00 202.59 ? 227  PHE C CG    1 
ATOM   5320  C  CD1   . PHE C 2  227  ? 475.287 -47.751 623.116 1.00 195.47 ? 227  PHE C CD1   1 
ATOM   5321  C  CD2   . PHE C 2  227  ? 472.995 -47.305 622.623 1.00 199.66 ? 227  PHE C CD2   1 
ATOM   5322  C  CE1   . PHE C 2  227  ? 474.957 -47.996 624.441 1.00 189.40 ? 227  PHE C CE1   1 
ATOM   5323  C  CE2   . PHE C 2  227  ? 472.654 -47.545 623.953 1.00 192.88 ? 227  PHE C CE2   1 
ATOM   5324  C  CZ    . PHE C 2  227  ? 473.636 -47.892 624.862 1.00 187.62 ? 227  PHE C CZ    1 
ATOM   5325  N  N     . ALA C 2  228  ? 475.559 -45.445 618.115 1.00 253.17 ? 228  ALA C N     1 
ATOM   5326  C  CA    . ALA C 2  228  ? 476.077 -45.530 616.750 1.00 261.49 ? 228  ALA C CA    1 
ATOM   5327  C  C     . ALA C 2  228  ? 477.472 -44.927 616.584 1.00 260.25 ? 228  ALA C C     1 
ATOM   5328  O  O     . ALA C 2  228  ? 477.771 -44.329 615.544 1.00 263.79 ? 228  ALA C O     1 
ATOM   5329  C  CB    . ALA C 2  228  ? 475.110 -44.847 615.779 1.00 265.67 ? 228  ALA C CB    1 
ATOM   5330  N  N     . MET C 2  229  ? 478.339 -45.099 617.581 1.00 255.34 ? 229  MET C N     1 
ATOM   5331  C  CA    . MET C 2  229  ? 479.675 -44.528 617.519 1.00 250.38 ? 229  MET C CA    1 
ATOM   5332  C  C     . MET C 2  229  ? 480.534 -45.114 618.633 1.00 242.19 ? 229  MET C C     1 
ATOM   5333  O  O     . MET C 2  229  ? 480.072 -45.270 619.768 1.00 237.37 ? 229  MET C O     1 
ATOM   5334  C  CB    . MET C 2  229  ? 479.599 -42.999 617.647 1.00 248.13 ? 229  MET C CB    1 
ATOM   5335  C  CG    . MET C 2  229  ? 479.049 -42.537 618.989 1.00 243.32 ? 229  MET C CG    1 
ATOM   5336  S  SD    . MET C 2  229  ? 478.561 -40.806 619.103 1.00 240.55 ? 229  MET C SD    1 
ATOM   5337  C  CE    . MET C 2  229  ? 477.428 -40.702 617.718 1.00 246.75 ? 229  MET C CE    1 
ATOM   5338  N  N     . ARG C 2  230  ? 481.778 -45.445 618.288 1.00 235.87 ? 230  ARG C N     1 
ATOM   5339  C  CA    . ARG C 2  230  ? 482.735 -45.992 619.239 1.00 224.59 ? 230  ARG C CA    1 
ATOM   5340  C  C     . ARG C 2  230  ? 483.119 -44.937 620.278 1.00 210.78 ? 230  ARG C C     1 
ATOM   5341  O  O     . ARG C 2  230  ? 482.846 -43.749 620.094 1.00 204.24 ? 230  ARG C O     1 
ATOM   5342  C  CB    . ARG C 2  230  ? 483.950 -46.576 618.516 1.00 226.51 ? 230  ARG C CB    1 
ATOM   5343  C  CG    . ARG C 2  230  ? 484.457 -45.849 617.314 1.00 226.80 ? 230  ARG C CG    1 
ATOM   5344  C  CD    . ARG C 2  230  ? 485.770 -46.482 616.923 1.00 228.57 ? 230  ARG C CD    1 
ATOM   5345  N  NE    . ARG C 2  230  ? 485.929 -46.573 615.475 1.00 235.30 ? 230  ARG C NE    1 
ATOM   5346  C  CZ    . ARG C 2  230  ? 486.369 -45.592 614.694 1.00 235.96 ? 230  ARG C CZ    1 
ATOM   5347  N  NH1   . ARG C 2  230  ? 486.474 -45.788 613.380 1.00 241.81 ? 230  ARG C NH1   1 
ATOM   5348  N  NH2   . ARG C 2  230  ? 486.701 -44.419 615.225 1.00 230.02 ? 230  ARG C NH2   1 
ATOM   5349  N  N     . PRO C 2  231  ? 483.714 -45.356 621.413 1.00 201.42 ? 231  PRO C N     1 
ATOM   5350  C  CA    . PRO C 2  231  ? 484.041 -44.391 622.476 1.00 197.90 ? 231  PRO C CA    1 
ATOM   5351  C  C     . PRO C 2  231  ? 484.803 -43.158 621.998 1.00 195.00 ? 231  PRO C C     1 
ATOM   5352  O  O     . PRO C 2  231  ? 484.782 -42.122 622.670 1.00 191.39 ? 231  PRO C O     1 
ATOM   5353  C  CB    . PRO C 2  231  ? 484.895 -45.227 623.434 1.00 192.97 ? 231  PRO C CB    1 
ATOM   5354  C  CG    . PRO C 2  231  ? 484.329 -46.596 623.303 1.00 196.36 ? 231  PRO C CG    1 
ATOM   5355  C  CD    . PRO C 2  231  ? 483.922 -46.747 621.860 1.00 203.13 ? 231  PRO C CD    1 
ATOM   5356  N  N     . GLU C 2  232  ? 485.528 -43.264 620.884 1.00 201.40 ? 232  GLU C N     1 
ATOM   5357  C  CA    . GLU C 2  232  ? 486.293 -42.120 620.395 1.00 202.13 ? 232  GLU C CA    1 
ATOM   5358  C  C     . GLU C 2  232  ? 485.372 -41.063 619.791 1.00 203.13 ? 232  GLU C C     1 
ATOM   5359  O  O     . GLU C 2  232  ? 485.510 -39.867 620.069 1.00 195.84 ? 232  GLU C O     1 
ATOM   5360  C  CB    . GLU C 2  232  ? 487.329 -42.576 619.367 1.00 212.88 ? 232  GLU C CB    1 
ATOM   5361  C  CG    . GLU C 2  232  ? 488.235 -41.462 618.856 1.00 215.95 ? 232  GLU C CG    1 
ATOM   5362  C  CD    . GLU C 2  232  ? 489.216 -41.957 617.809 1.00 225.29 ? 232  GLU C CD    1 
ATOM   5363  O  OE1   . GLU C 2  232  ? 489.166 -43.163 617.482 1.00 230.86 ? 232  GLU C OE1   1 
ATOM   5364  O  OE2   . GLU C 2  232  ? 490.030 -41.148 617.309 1.00 227.55 ? 232  GLU C OE2   1 
ATOM   5365  N  N     . GLU C 2  233  ? 484.445 -41.498 618.931 1.00 209.37 ? 233  GLU C N     1 
ATOM   5366  C  CA    . GLU C 2  233  ? 483.467 -40.609 618.306 1.00 214.71 ? 233  GLU C CA    1 
ATOM   5367  C  C     . GLU C 2  233  ? 482.530 -39.942 619.317 1.00 213.06 ? 233  GLU C C     1 
ATOM   5368  O  O     . GLU C 2  233  ? 482.147 -38.781 619.133 1.00 212.20 ? 233  GLU C O     1 
ATOM   5369  C  CB    . GLU C 2  233  ? 482.652 -41.400 617.281 1.00 218.31 ? 233  GLU C CB    1 
ATOM   5370  C  CG    . GLU C 2  233  ? 483.479 -42.347 616.406 1.00 224.59 ? 233  GLU C CG    1 
ATOM   5371  C  CD    . GLU C 2  233  ? 484.030 -41.695 615.140 1.00 228.41 ? 233  GLU C CD    1 
ATOM   5372  O  OE1   . GLU C 2  233  ? 483.583 -40.582 614.783 1.00 227.93 ? 233  GLU C OE1   1 
ATOM   5373  O  OE2   . GLU C 2  233  ? 484.921 -42.298 614.503 1.00 230.29 ? 233  GLU C OE2   1 
ATOM   5374  N  N     . ALA C 2  234  ? 482.169 -40.648 620.393 1.00 218.20 ? 234  ALA C N     1 
ATOM   5375  C  CA    . ALA C 2  234  ? 481.275 -40.109 621.421 1.00 214.24 ? 234  ALA C CA    1 
ATOM   5376  C  C     . ALA C 2  234  ? 481.935 -39.004 622.239 1.00 206.34 ? 234  ALA C C     1 
ATOM   5377  O  O     . ALA C 2  234  ? 481.258 -38.073 622.698 1.00 204.11 ? 234  ALA C O     1 
ATOM   5378  C  CB    . ALA C 2  234  ? 480.796 -41.237 622.332 1.00 216.01 ? 234  ALA C CB    1 
ATOM   5379  N  N     . LEU C 2  235  ? 483.249 -39.083 622.415 1.00 193.40 ? 235  LEU C N     1 
ATOM   5380  C  CA    . LEU C 2  235  ? 483.985 -38.071 623.161 1.00 179.64 ? 235  LEU C CA    1 
ATOM   5381  C  C     . LEU C 2  235  ? 484.029 -36.759 622.395 1.00 173.70 ? 235  LEU C C     1 
ATOM   5382  O  O     . LEU C 2  235  ? 483.807 -35.688 622.969 1.00 171.32 ? 235  LEU C O     1 
ATOM   5383  C  CB    . LEU C 2  235  ? 485.401 -38.579 623.421 1.00 172.66 ? 235  LEU C CB    1 
ATOM   5384  C  CG    . LEU C 2  235  ? 486.433 -37.632 624.026 1.00 164.10 ? 235  LEU C CG    1 
ATOM   5385  C  CD1   . LEU C 2  235  ? 485.945 -37.064 625.335 1.00 160.14 ? 235  LEU C CD1   1 
ATOM   5386  C  CD2   . LEU C 2  235  ? 487.745 -38.360 624.213 1.00 162.22 ? 235  LEU C CD2   1 
ATOM   5387  N  N     . ILE C 2  236  ? 484.266 -36.831 621.089 1.00 176.85 ? 236  ILE C N     1 
ATOM   5388  C  CA    . ILE C 2  236  ? 484.266 -35.639 620.244 1.00 174.45 ? 236  ILE C CA    1 
ATOM   5389  C  C     . ILE C 2  236  ? 482.881 -34.986 620.225 1.00 175.22 ? 236  ILE C C     1 
ATOM   5390  O  O     . ILE C 2  236  ? 482.753 -33.768 620.422 1.00 171.35 ? 236  ILE C O     1 
ATOM   5391  C  CB    . ILE C 2  236  ? 484.762 -36.008 618.817 1.00 171.56 ? 236  ILE C CB    1 
ATOM   5392  C  CG1   . ILE C 2  236  ? 486.268 -36.355 618.836 1.00 166.41 ? 236  ILE C CG1   1 
ATOM   5393  C  CG2   . ILE C 2  236  ? 484.435 -34.909 617.783 1.00 169.31 ? 236  ILE C CG2   1 
ATOM   5394  C  CD1   . ILE C 2  236  ? 486.868 -36.748 617.513 1.00 169.32 ? 236  ILE C CD1   1 
ATOM   5395  N  N     . ARG C 2  237  ? 481.825 -35.798 620.147 1.00 179.68 ? 237  ARG C N     1 
ATOM   5396  C  CA    . ARG C 2  237  ? 480.466 -35.266 620.133 1.00 180.84 ? 237  ARG C CA    1 
ATOM   5397  C  C     . ARG C 2  237  ? 480.164 -34.447 621.384 1.00 174.43 ? 237  ARG C C     1 
ATOM   5398  O  O     . ARG C 2  237  ? 479.636 -33.336 621.289 1.00 170.90 ? 237  ARG C O     1 
ATOM   5399  C  CB    . ARG C 2  237  ? 479.487 -36.435 619.954 1.00 188.65 ? 237  ARG C CB    1 
ATOM   5400  C  CG    . ARG C 2  237  ? 478.026 -36.239 620.355 1.00 191.01 ? 237  ARG C CG    1 
ATOM   5401  C  CD    . ARG C 2  237  ? 477.159 -37.094 619.402 1.00 198.20 ? 237  ARG C CD    1 
ATOM   5402  N  NE    . ARG C 2  237  ? 475.720 -37.063 619.668 1.00 199.48 ? 237  ARG C NE    1 
ATOM   5403  C  CZ    . ARG C 2  237  ? 474.809 -37.689 618.920 1.00 204.26 ? 237  ARG C CZ    1 
ATOM   5404  N  NH1   . ARG C 2  237  ? 473.521 -37.606 619.233 1.00 206.13 ? 237  ARG C NH1   1 
ATOM   5405  N  NH2   . ARG C 2  237  ? 475.180 -38.393 617.853 1.00 205.93 ? 237  ARG C NH2   1 
ATOM   5406  N  N     . LEU C 2  238  ? 480.500 -34.966 622.562 1.00 173.84 ? 238  LEU C N     1 
ATOM   5407  C  CA    . LEU C 2  238  ? 480.289 -34.212 623.801 1.00 173.34 ? 238  LEU C CA    1 
ATOM   5408  C  C     . LEU C 2  238  ? 481.061 -32.891 623.834 1.00 171.91 ? 238  LEU C C     1 
ATOM   5409  O  O     . LEU C 2  238  ? 480.539 -31.863 624.289 1.00 168.42 ? 238  LEU C O     1 
ATOM   5410  C  CB    . LEU C 2  238  ? 480.665 -35.053 625.015 1.00 166.70 ? 238  LEU C CB    1 
ATOM   5411  C  CG    . LEU C 2  238  ? 480.379 -34.249 626.285 1.00 159.05 ? 238  LEU C CG    1 
ATOM   5412  C  CD1   . LEU C 2  238  ? 478.910 -33.844 626.323 1.00 161.87 ? 238  LEU C CD1   1 
ATOM   5413  C  CD2   . LEU C 2  238  ? 480.777 -35.015 627.538 1.00 153.30 ? 238  LEU C CD2   1 
ATOM   5414  N  N     . PHE C 2  239  ? 482.314 -32.910 623.382 1.00 177.27 ? 239  PHE C N     1 
ATOM   5415  C  CA    . PHE C 2  239  ? 483.136 -31.703 623.364 1.00 176.78 ? 239  PHE C CA    1 
ATOM   5416  C  C     . PHE C 2  239  ? 482.524 -30.607 622.495 1.00 180.30 ? 239  PHE C C     1 
ATOM   5417  O  O     . PHE C 2  239  ? 482.543 -29.431 622.881 1.00 179.26 ? 239  PHE C O     1 
ATOM   5418  C  CB    . PHE C 2  239  ? 484.562 -32.035 622.905 1.00 180.91 ? 239  PHE C CB    1 
ATOM   5419  C  CG    . PHE C 2  239  ? 485.488 -30.841 622.892 1.00 178.90 ? 239  PHE C CG    1 
ATOM   5420  C  CD1   . PHE C 2  239  ? 486.301 -30.589 623.985 1.00 172.83 ? 239  PHE C CD1   1 
ATOM   5421  C  CD2   . PHE C 2  239  ? 485.539 -29.967 621.821 1.00 183.12 ? 239  PHE C CD2   1 
ATOM   5422  C  CE1   . PHE C 2  239  ? 487.149 -29.500 624.010 1.00 170.67 ? 239  PHE C CE1   1 
ATOM   5423  C  CE2   . PHE C 2  239  ? 486.387 -28.867 621.848 1.00 181.05 ? 239  PHE C CE2   1 
ATOM   5424  C  CZ    . PHE C 2  239  ? 487.191 -28.638 622.941 1.00 173.93 ? 239  PHE C CZ    1 
ATOM   5425  N  N     . THR C 2  240  ? 481.895 -30.969 621.370 1.00 181.83 ? 240  THR C N     1 
ATOM   5426  C  CA    . THR C 2  240  ? 481.273 -29.935 620.545 1.00 181.78 ? 240  THR C CA    1 
ATOM   5427  C  C     . THR C 2  240  ? 480.114 -29.272 621.275 1.00 180.03 ? 240  THR C C     1 
ATOM   5428  O  O     . THR C 2  240  ? 479.837 -28.087 621.053 1.00 176.79 ? 240  THR C O     1 
ATOM   5429  C  CB    . THR C 2  240  ? 480.731 -30.532 619.237 1.00 187.82 ? 240  THR C CB    1 
ATOM   5430  O  OG1   . THR C 2  240  ? 479.751 -31.536 619.532 1.00 186.88 ? 240  THR C OG1   1 
ATOM   5431  C  CG2   . THR C 2  240  ? 481.828 -31.172 618.415 1.00 192.22 ? 240  THR C CG2   1 
ATOM   5432  N  N     . LEU C 2  241  ? 479.478 -29.999 622.193 1.00 178.65 ? 241  LEU C N     1 
ATOM   5433  C  CA    . LEU C 2  241  ? 478.427 -29.430 623.028 1.00 178.49 ? 241  LEU C CA    1 
ATOM   5434  C  C     . LEU C 2  241  ? 478.999 -28.471 624.062 1.00 181.67 ? 241  LEU C C     1 
ATOM   5435  O  O     . LEU C 2  241  ? 478.433 -27.401 624.305 1.00 182.99 ? 241  LEU C O     1 
ATOM   5436  C  CB    . LEU C 2  241  ? 477.653 -30.545 623.726 1.00 163.89 ? 241  LEU C CB    1 
ATOM   5437  C  CG    . LEU C 2  241  ? 476.641 -31.308 622.883 1.00 160.79 ? 241  LEU C CG    1 
ATOM   5438  C  CD1   . LEU C 2  241  ? 475.877 -32.294 623.741 1.00 157.48 ? 241  LEU C CD1   1 
ATOM   5439  C  CD2   . LEU C 2  241  ? 475.692 -30.324 622.223 1.00 161.87 ? 241  LEU C CD2   1 
ATOM   5440  N  N     . LEU C 2  242  ? 480.122 -28.837 624.677 1.00 190.24 ? 242  LEU C N     1 
ATOM   5441  C  CA    . LEU C 2  242  ? 480.702 -28.039 625.752 1.00 194.89 ? 242  LEU C CA    1 
ATOM   5442  C  C     . LEU C 2  242  ? 481.510 -26.825 625.296 1.00 201.63 ? 242  LEU C C     1 
ATOM   5443  O  O     . LEU C 2  242  ? 481.550 -25.824 626.018 1.00 203.49 ? 242  LEU C O     1 
ATOM   5444  C  CB    . LEU C 2  242  ? 481.579 -28.938 626.615 1.00 191.42 ? 242  LEU C CB    1 
ATOM   5445  C  CG    . LEU C 2  242  ? 480.796 -30.136 627.145 1.00 190.20 ? 242  LEU C CG    1 
ATOM   5446  C  CD1   . LEU C 2  242  ? 481.671 -30.954 628.058 1.00 187.22 ? 242  LEU C CD1   1 
ATOM   5447  C  CD2   . LEU C 2  242  ? 479.554 -29.659 627.873 1.00 187.58 ? 242  LEU C CD2   1 
ATOM   5448  N  N     . ARG C 2  243  ? 482.207 -26.876 624.175 1.00 212.46 ? 243  ARG C N     1 
ATOM   5449  C  CA    . ARG C 2  243  ? 483.002 -25.732 623.728 1.00 216.82 ? 243  ARG C CA    1 
ATOM   5450  C  C     . ARG C 2  243  ? 482.676 -25.385 622.283 1.00 220.09 ? 243  ARG C C     1 
ATOM   5451  O  O     . ARG C 2  243  ? 483.466 -25.681 621.376 1.00 227.58 ? 243  ARG C O     1 
ATOM   5452  C  CB    . ARG C 2  243  ? 484.493 -25.977 623.940 1.00 219.31 ? 243  ARG C CB    1 
ATOM   5453  C  CG    . ARG C 2  243  ? 484.891 -25.679 625.377 1.00 222.70 ? 243  ARG C CG    1 
ATOM   5454  C  CD    . ARG C 2  243  ? 486.393 -25.663 625.577 1.00 227.72 ? 243  ARG C CD    1 
ATOM   5455  N  NE    . ARG C 2  243  ? 486.978 -24.364 625.250 1.00 232.45 ? 243  ARG C NE    1 
ATOM   5456  C  CZ    . ARG C 2  243  ? 486.827 -23.267 625.990 1.00 231.69 ? 243  ARG C CZ    1 
ATOM   5457  N  NH1   . ARG C 2  243  ? 486.102 -23.300 627.105 1.00 228.43 ? 243  ARG C NH1   1 
ATOM   5458  N  NH2   . ARG C 2  243  ? 487.398 -22.133 625.607 1.00 233.05 ? 243  ARG C NH2   1 
ATOM   5459  N  N     . PRO C 2  244  ? 481.525 -24.758 622.027 1.00 204.09 ? 244  PRO C N     1 
ATOM   5460  C  CA    . PRO C 2  244  ? 481.179 -24.427 620.641 1.00 213.22 ? 244  PRO C CA    1 
ATOM   5461  C  C     . PRO C 2  244  ? 482.238 -23.530 620.022 1.00 224.76 ? 244  PRO C C     1 
ATOM   5462  O  O     . PRO C 2  244  ? 482.784 -22.634 620.668 1.00 217.63 ? 244  PRO C O     1 
ATOM   5463  C  CB    . PRO C 2  244  ? 479.840 -23.696 620.777 1.00 195.17 ? 244  PRO C CB    1 
ATOM   5464  C  CG    . PRO C 2  244  ? 479.283 -24.168 622.061 1.00 185.27 ? 244  PRO C CG    1 
ATOM   5465  C  CD    . PRO C 2  244  ? 480.465 -24.355 622.963 1.00 190.00 ? 244  PRO C CD    1 
ATOM   5466  N  N     . GLY C 2  245  ? 482.487 -23.763 618.735 1.00 247.60 ? 245  GLY C N     1 
ATOM   5467  C  CA    . GLY C 2  245  ? 483.427 -23.000 617.953 1.00 249.95 ? 245  GLY C CA    1 
ATOM   5468  C  C     . GLY C 2  245  ? 484.867 -23.473 618.041 1.00 248.21 ? 245  GLY C C     1 
ATOM   5469  O  O     . GLY C 2  245  ? 485.669 -23.116 617.171 1.00 257.86 ? 245  GLY C O     1 
ATOM   5470  N  N     . ASP C 2  246  ? 485.226 -24.267 619.060 1.00 234.31 ? 246  ASP C N     1 
ATOM   5471  C  CA    . ASP C 2  246  ? 486.568 -24.848 619.137 1.00 227.68 ? 246  ASP C CA    1 
ATOM   5472  C  C     . ASP C 2  246  ? 486.606 -26.146 618.337 1.00 230.31 ? 246  ASP C C     1 
ATOM   5473  O  O     . ASP C 2  246  ? 485.833 -27.067 618.635 1.00 232.19 ? 246  ASP C O     1 
ATOM   5474  C  CB    . ASP C 2  246  ? 486.976 -25.101 620.582 1.00 211.53 ? 246  ASP C CB    1 
ATOM   5475  C  CG    . ASP C 2  246  ? 488.449 -25.471 620.718 1.00 203.32 ? 246  ASP C CG    1 
ATOM   5476  O  OD1   . ASP C 2  246  ? 488.804 -26.652 620.511 1.00 203.12 ? 246  ASP C OD1   1 
ATOM   5477  O  OD2   . ASP C 2  246  ? 489.258 -24.567 621.012 1.00 198.67 ? 246  ASP C OD2   1 
ATOM   5478  N  N     . PRO C 2  247  ? 487.453 -26.255 617.317 1.00 238.94 ? 247  PRO C N     1 
ATOM   5479  C  CA    . PRO C 2  247  ? 487.509 -27.483 616.510 1.00 242.21 ? 247  PRO C CA    1 
ATOM   5480  C  C     . PRO C 2  247  ? 487.794 -28.713 617.354 1.00 232.29 ? 247  PRO C C     1 
ATOM   5481  O  O     . PRO C 2  247  ? 488.716 -28.717 618.186 1.00 225.75 ? 247  PRO C O     1 
ATOM   5482  C  CB    . PRO C 2  247  ? 488.647 -27.207 615.506 1.00 247.56 ? 247  PRO C CB    1 
ATOM   5483  C  CG    . PRO C 2  247  ? 489.401 -26.045 616.070 1.00 247.27 ? 247  PRO C CG    1 
ATOM   5484  C  CD    . PRO C 2  247  ? 488.383 -25.231 616.817 1.00 242.47 ? 247  PRO C CD    1 
ATOM   5485  N  N     . PRO C 2  248  ? 486.972 -29.757 617.211 1.00 215.03 ? 248  PRO C N     1 
ATOM   5486  C  CA    . PRO C 2  248  ? 487.001 -30.926 618.107 1.00 205.18 ? 248  PRO C CA    1 
ATOM   5487  C  C     . PRO C 2  248  ? 488.111 -31.904 617.724 1.00 200.81 ? 248  PRO C C     1 
ATOM   5488  O  O     . PRO C 2  248  ? 487.876 -33.101 617.501 1.00 205.66 ? 248  PRO C O     1 
ATOM   5489  C  CB    . PRO C 2  248  ? 485.599 -31.526 617.908 1.00 200.98 ? 248  PRO C CB    1 
ATOM   5490  C  CG    . PRO C 2  248  ? 484.828 -30.536 617.081 1.00 204.28 ? 248  PRO C CG    1 
ATOM   5491  C  CD    . PRO C 2  248  ? 485.830 -29.807 616.290 1.00 213.65 ? 248  PRO C CD    1 
ATOM   5492  N  N     . LYS C 2  249  ? 489.345 -31.396 617.664 1.00 199.61 ? 249  LYS C N     1 
ATOM   5493  C  CA    . LYS C 2  249  ? 490.515 -32.245 617.454 1.00 201.35 ? 249  LYS C CA    1 
ATOM   5494  C  C     . LYS C 2  249  ? 490.628 -33.252 618.596 1.00 205.45 ? 249  LYS C C     1 
ATOM   5495  O  O     . LYS C 2  249  ? 490.444 -32.905 619.768 1.00 200.07 ? 249  LYS C O     1 
ATOM   5496  C  CB    . LYS C 2  249  ? 491.787 -31.391 617.337 1.00 193.22 ? 249  LYS C CB    1 
ATOM   5497  C  CG    . LYS C 2  249  ? 492.945 -32.059 616.590 1.00 188.94 ? 249  LYS C CG    1 
ATOM   5498  C  CD    . LYS C 2  249  ? 494.047 -31.056 616.236 1.00 181.74 ? 249  LYS C CD    1 
ATOM   5499  C  CE    . LYS C 2  249  ? 495.241 -31.733 615.573 1.00 176.94 ? 249  LYS C CE    1 
ATOM   5500  N  NZ    . LYS C 2  249  ? 496.384 -30.806 615.476 1.00 172.62 ? 249  LYS C NZ    1 
ATOM   5501  N  N     . ARG C 2  250  ? 490.932 -34.512 618.246 1.00 214.52 ? 250  ARG C N     1 
ATOM   5502  C  CA    . ARG C 2  250  ? 490.886 -35.596 619.229 1.00 212.93 ? 250  ARG C CA    1 
ATOM   5503  C  C     . ARG C 2  250  ? 491.852 -35.381 620.393 1.00 210.49 ? 250  ARG C C     1 
ATOM   5504  O  O     . ARG C 2  250  ? 491.521 -35.722 621.532 1.00 208.97 ? 250  ARG C O     1 
ATOM   5505  C  CB    . ARG C 2  250  ? 491.157 -36.930 618.534 1.00 213.27 ? 250  ARG C CB    1 
ATOM   5506  C  CG    . ARG C 2  250  ? 490.964 -38.180 619.381 1.00 207.01 ? 250  ARG C CG    1 
ATOM   5507  C  CD    . ARG C 2  250  ? 492.345 -38.792 619.595 1.00 206.29 ? 250  ARG C CD    1 
ATOM   5508  N  NE    . ARG C 2  250  ? 492.376 -39.992 620.422 1.00 204.42 ? 250  ARG C NE    1 
ATOM   5509  C  CZ    . ARG C 2  250  ? 493.495 -40.513 620.918 1.00 204.49 ? 250  ARG C CZ    1 
ATOM   5510  N  NH1   . ARG C 2  250  ? 494.662 -39.937 620.669 1.00 204.74 ? 250  ARG C NH1   1 
ATOM   5511  N  NH2   . ARG C 2  250  ? 493.451 -41.615 621.651 1.00 204.84 ? 250  ARG C NH2   1 
ATOM   5512  N  N     . ASP C 2  251  ? 493.079 -34.918 620.139 1.00 215.28 ? 251  ASP C N     1 
ATOM   5513  C  CA    . ASP C 2  251  ? 493.948 -34.638 621.281 1.00 214.74 ? 251  ASP C CA    1 
ATOM   5514  C  C     . ASP C 2  251  ? 493.409 -33.474 622.127 1.00 209.57 ? 251  ASP C C     1 
ATOM   5515  O  O     . ASP C 2  251  ? 493.540 -33.478 623.359 1.00 206.80 ? 251  ASP C O     1 
ATOM   5516  C  CB    . ASP C 2  251  ? 495.400 -34.377 620.851 1.00 221.98 ? 251  ASP C CB    1 
ATOM   5517  C  CG    . ASP C 2  251  ? 495.519 -33.574 619.576 1.00 229.49 ? 251  ASP C CG    1 
ATOM   5518  O  OD1   . ASP C 2  251  ? 494.559 -32.863 619.212 1.00 229.99 ? 251  ASP C OD1   1 
ATOM   5519  O  OD2   . ASP C 2  251  ? 496.599 -33.640 618.947 1.00 233.75 ? 251  ASP C OD2   1 
ATOM   5520  N  N     . LYS C 2  252  ? 492.833 -32.449 621.477 1.00 207.06 ? 252  LYS C N     1 
ATOM   5521  C  CA    . LYS C 2  252  ? 492.203 -31.337 622.200 1.00 198.47 ? 252  LYS C CA    1 
ATOM   5522  C  C     . LYS C 2  252  ? 491.015 -31.740 623.075 1.00 186.43 ? 252  LYS C C     1 
ATOM   5523  O  O     . LYS C 2  252  ? 490.899 -31.263 624.207 1.00 183.21 ? 252  LYS C O     1 
ATOM   5524  C  CB    . LYS C 2  252  ? 491.750 -30.260 621.209 1.00 206.90 ? 252  LYS C CB    1 
ATOM   5525  C  CG    . LYS C 2  252  ? 492.747 -29.134 621.003 1.00 212.63 ? 252  LYS C CG    1 
ATOM   5526  C  CD    . LYS C 2  252  ? 492.049 -27.831 620.646 1.00 215.31 ? 252  LYS C CD    1 
ATOM   5527  C  CE    . LYS C 2  252  ? 493.025 -26.665 620.715 1.00 216.59 ? 252  LYS C CE    1 
ATOM   5528  N  NZ    . LYS C 2  252  ? 492.335 -25.348 620.709 1.00 216.48 ? 252  LYS C NZ    1 
ATOM   5529  N  N     . ALA C 2  253  ? 490.124 -32.611 622.582 1.00 180.78 ? 253  ALA C N     1 
ATOM   5530  C  CA    . ALA C 2  253  ? 488.964 -33.042 623.376 1.00 170.79 ? 253  ALA C CA    1 
ATOM   5531  C  C     . ALA C 2  253  ? 489.364 -33.838 624.613 1.00 168.29 ? 253  ALA C C     1 
ATOM   5532  O  O     . ALA C 2  253  ? 488.871 -33.579 625.722 1.00 162.93 ? 253  ALA C O     1 
ATOM   5533  C  CB    . ALA C 2  253  ? 487.991 -33.853 622.524 1.00 167.00 ? 253  ALA C CB    1 
ATOM   5534  N  N     . VAL C 2  254  ? 490.236 -34.832 624.432 1.00 173.10 ? 254  VAL C N     1 
ATOM   5535  C  CA    . VAL C 2  254  ? 490.754 -35.612 625.556 1.00 175.60 ? 254  VAL C CA    1 
ATOM   5536  C  C     . VAL C 2  254  ? 491.337 -34.699 626.625 1.00 179.12 ? 254  VAL C C     1 
ATOM   5537  O  O     . VAL C 2  254  ? 490.963 -34.778 627.800 1.00 171.05 ? 254  VAL C O     1 
ATOM   5538  C  CB    . VAL C 2  254  ? 491.797 -36.633 625.069 1.00 166.95 ? 254  VAL C CB    1 
ATOM   5539  C  CG1   . VAL C 2  254  ? 492.458 -37.335 626.261 1.00 159.62 ? 254  VAL C CG1   1 
ATOM   5540  C  CG2   . VAL C 2  254  ? 491.155 -37.642 624.119 1.00 167.69 ? 254  VAL C CG2   1 
ATOM   5541  N  N     . ALA C 2  255  ? 492.212 -33.775 626.215 1.00 194.76 ? 255  ALA C N     1 
ATOM   5542  C  CA    . ALA C 2  255  ? 492.839 -32.862 627.166 1.00 193.56 ? 255  ALA C CA    1 
ATOM   5543  C  C     . ALA C 2  255  ? 491.790 -32.100 627.964 1.00 188.18 ? 255  ALA C C     1 
ATOM   5544  O  O     . ALA C 2  255  ? 491.882 -32.017 629.192 1.00 186.52 ? 255  ALA C O     1 
ATOM   5545  C  CB    . ALA C 2  255  ? 493.782 -31.906 626.432 1.00 194.99 ? 255  ALA C CB    1 
ATOM   5546  N  N     . TYR C 2  256  ? 490.798 -31.512 627.293 1.00 174.91 ? 256  TYR C N     1 
ATOM   5547  C  CA    . TYR C 2  256  ? 489.800 -30.744 628.029 1.00 162.97 ? 256  TYR C CA    1 
ATOM   5548  C  C     . TYR C 2  256  ? 489.019 -31.639 628.981 1.00 159.10 ? 256  TYR C C     1 
ATOM   5549  O  O     . TYR C 2  256  ? 488.879 -31.329 630.171 1.00 155.63 ? 256  TYR C O     1 
ATOM   5550  C  CB    . TYR C 2  256  ? 488.831 -30.061 627.068 1.00 160.99 ? 256  TYR C CB    1 
ATOM   5551  C  CG    . TYR C 2  256  ? 487.770 -29.201 627.748 1.00 154.03 ? 256  TYR C CG    1 
ATOM   5552  C  CD1   . TYR C 2  256  ? 486.497 -29.710 628.037 1.00 146.90 ? 256  TYR C CD1   1 
ATOM   5553  C  CD2   . TYR C 2  256  ? 488.036 -27.881 628.091 1.00 151.48 ? 256  TYR C CD2   1 
ATOM   5554  C  CE1   . TYR C 2  256  ? 485.531 -28.917 628.646 1.00 142.04 ? 256  TYR C CE1   1 
ATOM   5555  C  CE2   . TYR C 2  256  ? 487.079 -27.087 628.700 1.00 145.96 ? 256  TYR C CE2   1 
ATOM   5556  C  CZ    . TYR C 2  256  ? 485.835 -27.602 628.973 1.00 141.69 ? 256  TYR C CZ    1 
ATOM   5557  O  OH    . TYR C 2  256  ? 484.919 -26.773 629.579 1.00 138.53 ? 256  TYR C OH    1 
ATOM   5558  N  N     . VAL C 2  257  ? 488.462 -32.736 628.463 1.00 154.70 ? 257  VAL C N     1 
ATOM   5559  C  CA    . VAL C 2  257  ? 487.688 -33.634 629.314 1.00 148.35 ? 257  VAL C CA    1 
ATOM   5560  C  C     . VAL C 2  257  ? 488.544 -34.283 630.406 1.00 150.72 ? 257  VAL C C     1 
ATOM   5561  O  O     . VAL C 2  257  ? 488.125 -34.368 631.567 1.00 146.57 ? 257  VAL C O     1 
ATOM   5562  C  CB    . VAL C 2  257  ? 487.000 -34.689 628.434 1.00 141.31 ? 257  VAL C CB    1 
ATOM   5563  C  CG1   . VAL C 2  257  ? 486.633 -35.902 629.254 1.00 137.90 ? 257  VAL C CG1   1 
ATOM   5564  C  CG2   . VAL C 2  257  ? 485.777 -34.085 627.792 1.00 136.98 ? 257  VAL C CG2   1 
ATOM   5565  N  N     . TYR C 2  258  ? 489.759 -34.737 630.065 1.00 161.35 ? 258  TYR C N     1 
ATOM   5566  C  CA    . TYR C 2  258  ? 490.671 -35.266 631.084 1.00 164.04 ? 258  TYR C CA    1 
ATOM   5567  C  C     . TYR C 2  258  ? 490.997 -34.248 632.167 1.00 170.26 ? 258  TYR C C     1 
ATOM   5568  O  O     . TYR C 2  258  ? 490.863 -34.534 633.363 1.00 168.98 ? 258  TYR C O     1 
ATOM   5569  C  CB    . TYR C 2  258  ? 491.975 -35.748 630.444 1.00 159.02 ? 258  TYR C CB    1 
ATOM   5570  C  CG    . TYR C 2  258  ? 493.003 -36.250 631.445 1.00 150.20 ? 258  TYR C CG    1 
ATOM   5571  C  CD1   . TYR C 2  258  ? 494.128 -35.489 631.761 1.00 142.94 ? 258  TYR C CD1   1 
ATOM   5572  C  CD2   . TYR C 2  258  ? 492.878 -37.503 632.031 1.00 149.87 ? 258  TYR C CD2   1 
ATOM   5573  C  CE1   . TYR C 2  258  ? 495.074 -35.946 632.661 1.00 139.82 ? 258  TYR C CE1   1 
ATOM   5574  C  CE2   . TYR C 2  258  ? 493.826 -37.971 632.932 1.00 148.32 ? 258  TYR C CE2   1 
ATOM   5575  C  CZ    . TYR C 2  258  ? 494.922 -37.188 633.240 1.00 143.65 ? 258  TYR C CZ    1 
ATOM   5576  O  OH    . TYR C 2  258  ? 495.862 -37.651 634.132 1.00 143.64 ? 258  TYR C OH    1 
ATOM   5577  N  N     . GLY C 2  259  ? 491.385 -33.034 631.760 1.00 183.50 ? 259  GLY C N     1 
ATOM   5578  C  CA    . GLY C 2  259  ? 491.751 -32.018 632.732 1.00 184.99 ? 259  GLY C CA    1 
ATOM   5579  C  C     . GLY C 2  259  ? 490.610 -31.601 633.626 1.00 185.46 ? 259  GLY C C     1 
ATOM   5580  O  O     . GLY C 2  259  ? 490.813 -31.296 634.802 1.00 183.49 ? 259  GLY C O     1 
ATOM   5581  N  N     . LEU C 2  260  ? 489.395 -31.634 633.103 1.00 187.97 ? 260  LEU C N     1 
ATOM   5582  C  CA    . LEU C 2  260  ? 488.246 -31.234 633.893 1.00 187.27 ? 260  LEU C CA    1 
ATOM   5583  C  C     . LEU C 2  260  ? 487.786 -32.349 634.828 1.00 180.51 ? 260  LEU C C     1 
ATOM   5584  O  O     . LEU C 2  260  ? 487.226 -32.052 635.887 1.00 178.88 ? 260  LEU C O     1 
ATOM   5585  C  CB    . LEU C 2  260  ? 487.134 -30.710 632.981 1.00 191.77 ? 260  LEU C CB    1 
ATOM   5586  C  CG    . LEU C 2  260  ? 487.294 -29.183 632.791 1.00 195.01 ? 260  LEU C CG    1 
ATOM   5587  C  CD1   . LEU C 2  260  ? 488.506 -28.789 631.922 1.00 196.89 ? 260  LEU C CD1   1 
ATOM   5588  C  CD2   . LEU C 2  260  ? 486.026 -28.535 632.258 1.00 196.49 ? 260  LEU C CD2   1 
ATOM   5589  N  N     . ILE C 2  261  ? 487.967 -33.625 634.456 1.00 160.89 ? 261  ILE C N     1 
ATOM   5590  C  CA    . ILE C 2  261  ? 487.328 -34.728 635.182 1.00 143.51 ? 261  ILE C CA    1 
ATOM   5591  C  C     . ILE C 2  261  ? 488.354 -35.721 635.726 1.00 143.31 ? 261  ILE C C     1 
ATOM   5592  O  O     . ILE C 2  261  ? 488.316 -36.069 636.909 1.00 148.34 ? 261  ILE C O     1 
ATOM   5593  C  CB    . ILE C 2  261  ? 486.292 -35.459 634.320 1.00 126.73 ? 261  ILE C CB    1 
ATOM   5594  C  CG1   . ILE C 2  261  ? 484.936 -34.987 634.760 1.00 122.56 ? 261  ILE C CG1   1 
ATOM   5595  C  CG2   . ILE C 2  261  ? 486.290 -36.960 634.608 1.00 119.83 ? 261  ILE C CG2   1 
ATOM   5596  C  CD1   . ILE C 2  261  ? 484.769 -33.513 634.530 1.00 120.85 ? 261  ILE C CD1   1 
ATOM   5597  N  N     . ALA C 2  262  ? 489.183 -36.292 634.857 1.00 146.18 ? 262  ALA C N     1 
ATOM   5598  C  CA    . ALA C 2  262  ? 490.072 -37.372 635.261 1.00 142.67 ? 262  ALA C CA    1 
ATOM   5599  C  C     . ALA C 2  262  ? 491.467 -36.922 635.694 1.00 140.02 ? 262  ALA C C     1 
ATOM   5600  O  O     . ALA C 2  262  ? 492.224 -37.759 636.196 1.00 139.52 ? 262  ALA C O     1 
ATOM   5601  C  CB    . ALA C 2  262  ? 490.216 -38.386 634.122 1.00 146.92 ? 262  ALA C CB    1 
ATOM   5602  N  N     . ASP C 2  263  ? 491.848 -35.643 635.492 1.00 137.13 ? 263  ASP C N     1 
ATOM   5603  C  CA    . ASP C 2  263  ? 493.225 -35.237 635.795 1.00 136.22 ? 263  ASP C CA    1 
ATOM   5604  C  C     . ASP C 2  263  ? 493.472 -35.059 637.289 1.00 128.83 ? 263  ASP C C     1 
ATOM   5605  O  O     . ASP C 2  263  ? 492.955 -34.105 637.885 1.00 124.09 ? 263  ASP C O     1 
ATOM   5606  C  CB    . ASP C 2  263  ? 493.540 -33.913 635.066 1.00 136.63 ? 263  ASP C CB    1 
ATOM   5607  C  CG    . ASP C 2  263  ? 495.058 -33.575 634.988 1.00 133.68 ? 263  ASP C CG    1 
ATOM   5608  O  OD1   . ASP C 2  263  ? 495.890 -34.203 635.671 1.00 133.16 ? 263  ASP C OD1   1 
ATOM   5609  O  OD2   . ASP C 2  263  ? 495.414 -32.642 634.231 1.00 129.96 ? 263  ASP C OD2   1 
ATOM   5610  N  N     . PRO C 2  264  ? 494.309 -35.913 637.923 1.00 130.35 ? 264  PRO C N     1 
ATOM   5611  C  CA    . PRO C 2  264  ? 494.578 -35.748 639.357 1.00 131.97 ? 264  PRO C CA    1 
ATOM   5612  C  C     . PRO C 2  264  ? 495.405 -34.507 639.639 1.00 134.47 ? 264  PRO C C     1 
ATOM   5613  O  O     . PRO C 2  264  ? 496.329 -34.545 640.455 1.00 139.77 ? 264  PRO C O     1 
ATOM   5614  C  CB    . PRO C 2  264  ? 495.313 -37.042 639.735 1.00 129.06 ? 264  PRO C CB    1 
ATOM   5615  C  CG    . PRO C 2  264  ? 495.927 -37.493 638.513 1.00 131.23 ? 264  PRO C CG    1 
ATOM   5616  C  CD    . PRO C 2  264  ? 494.971 -37.119 637.397 1.00 132.50 ? 264  PRO C CD    1 
ATOM   5617  N  N     . ARG C 2  265  ? 495.107 -33.413 638.943 1.00 136.35 ? 265  ARG C N     1 
ATOM   5618  C  CA    . ARG C 2  265  ? 495.780 -32.149 639.202 1.00 134.77 ? 265  ARG C CA    1 
ATOM   5619  C  C     . ARG C 2  265  ? 494.749 -31.028 639.149 1.00 130.50 ? 265  ARG C C     1 
ATOM   5620  O  O     . ARG C 2  265  ? 494.706 -30.165 640.032 1.00 128.25 ? 265  ARG C O     1 
ATOM   5621  C  CB    . ARG C 2  265  ? 496.907 -31.902 638.191 1.00 143.44 ? 265  ARG C CB    1 
ATOM   5622  C  CG    . ARG C 2  265  ? 498.264 -32.587 638.494 1.00 151.10 ? 265  ARG C CG    1 
ATOM   5623  C  CD    . ARG C 2  265  ? 499.426 -31.916 637.706 1.00 155.60 ? 265  ARG C CD    1 
ATOM   5624  N  NE    . ARG C 2  265  ? 500.549 -32.806 637.381 1.00 160.17 ? 265  ARG C NE    1 
ATOM   5625  C  CZ    . ARG C 2  265  ? 501.698 -32.400 636.832 1.00 163.44 ? 265  ARG C CZ    1 
ATOM   5626  N  NH1   . ARG C 2  265  ? 501.885 -31.118 636.547 1.00 163.12 ? 265  ARG C NH1   1 
ATOM   5627  N  NH2   . ARG C 2  265  ? 502.666 -33.270 636.559 1.00 166.96 ? 265  ARG C NH2   1 
ATOM   5628  N  N     . ARG C 2  266  ? 493.858 -31.082 638.167 1.00 125.81 ? 266  ARG C N     1 
ATOM   5629  C  CA    . ARG C 2  266  ? 492.831 -30.062 638.031 1.00 122.35 ? 266  ARG C CA    1 
ATOM   5630  C  C     . ARG C 2  266  ? 491.535 -30.457 638.737 1.00 120.71 ? 266  ARG C C     1 
ATOM   5631  O  O     . ARG C 2  266  ? 490.678 -29.593 638.975 1.00 117.29 ? 266  ARG C O     1 
ATOM   5632  C  CB    . ARG C 2  266  ? 492.582 -29.757 636.544 1.00 113.80 ? 266  ARG C CB    1 
ATOM   5633  N  N     . TYR C 2  267  ? 491.389 -31.735 639.097 1.00 127.56 ? 267  TYR C N     1 
ATOM   5634  C  CA    . TYR C 2  267  ? 490.211 -32.251 639.790 1.00 127.35 ? 267  TYR C CA    1 
ATOM   5635  C  C     . TYR C 2  267  ? 490.681 -33.040 641.004 1.00 132.84 ? 267  TYR C C     1 
ATOM   5636  O  O     . TYR C 2  267  ? 491.339 -34.081 640.868 1.00 134.83 ? 267  TYR C O     1 
ATOM   5637  C  CB    . TYR C 2  267  ? 489.345 -33.120 638.890 1.00 126.80 ? 267  TYR C CB    1 
ATOM   5638  C  CG    . TYR C 2  267  ? 487.993 -33.403 639.496 1.00 124.85 ? 267  TYR C CG    1 
ATOM   5639  C  CD1   . TYR C 2  267  ? 487.791 -34.522 640.295 1.00 124.83 ? 267  TYR C CD1   1 
ATOM   5640  C  CD2   . TYR C 2  267  ? 486.921 -32.546 639.280 1.00 124.31 ? 267  TYR C CD2   1 
ATOM   5641  C  CE1   . TYR C 2  267  ? 486.562 -34.783 640.855 1.00 125.66 ? 267  TYR C CE1   1 
ATOM   5642  C  CE2   . TYR C 2  267  ? 485.687 -32.800 639.835 1.00 125.51 ? 267  TYR C CE2   1 
ATOM   5643  C  CZ    . TYR C 2  267  ? 485.506 -33.925 640.621 1.00 126.28 ? 267  TYR C CZ    1 
ATOM   5644  O  OH    . TYR C 2  267  ? 484.265 -34.181 641.179 1.00 126.22 ? 267  TYR C OH    1 
ATOM   5645  N  N     . ASP C 2  268  ? 490.335 -32.537 642.190 1.00 132.41 ? 268  ASP C N     1 
ATOM   5646  C  CA    . ASP C 2  268  ? 490.698 -33.176 643.443 1.00 131.45 ? 268  ASP C CA    1 
ATOM   5647  C  C     . ASP C 2  268  ? 489.490 -33.380 644.336 1.00 136.65 ? 268  ASP C C     1 
ATOM   5648  O  O     . ASP C 2  268  ? 488.915 -32.411 644.839 1.00 138.70 ? 268  ASP C O     1 
ATOM   5649  C  CB    . ASP C 2  268  ? 491.722 -32.329 644.180 1.00 126.96 ? 268  ASP C CB    1 
ATOM   5650  C  CG    . ASP C 2  268  ? 492.627 -33.149 645.027 1.00 124.49 ? 268  ASP C CG    1 
ATOM   5651  O  OD1   . ASP C 2  268  ? 492.311 -34.340 645.249 1.00 123.43 ? 268  ASP C OD1   1 
ATOM   5652  O  OD2   . ASP C 2  268  ? 493.642 -32.589 645.479 1.00 123.38 ? 268  ASP C OD2   1 
ATOM   5653  N  N     . LEU C 2  269  ? 489.098 -34.633 644.520 1.00 139.35 ? 269  LEU C N     1 
ATOM   5654  C  CA    . LEU C 2  269  ? 488.190 -34.970 645.603 1.00 134.77 ? 269  LEU C CA    1 
ATOM   5655  C  C     . LEU C 2  269  ? 488.983 -34.898 646.900 1.00 134.14 ? 269  LEU C C     1 
ATOM   5656  O  O     . LEU C 2  269  ? 490.215 -34.943 646.885 1.00 139.27 ? 269  LEU C O     1 
ATOM   5657  C  CB    . LEU C 2  269  ? 487.621 -36.363 645.398 1.00 129.52 ? 269  LEU C CB    1 
ATOM   5658  C  CG    . LEU C 2  269  ? 486.135 -36.438 645.603 1.00 122.31 ? 269  LEU C CG    1 
ATOM   5659  C  CD1   . LEU C 2  269  ? 485.535 -35.335 644.776 1.00 121.38 ? 269  LEU C CD1   1 
ATOM   5660  C  CD2   . LEU C 2  269  ? 485.679 -37.756 645.089 1.00 121.35 ? 269  LEU C CD2   1 
ATOM   5661  N  N     . GLY C 2  270  ? 488.309 -34.765 648.028 1.00 132.96 ? 270  GLY C N     1 
ATOM   5662  C  CA    . GLY C 2  270  ? 489.087 -34.786 649.250 1.00 134.40 ? 270  GLY C CA    1 
ATOM   5663  C  C     . GLY C 2  270  ? 489.668 -36.166 649.554 1.00 134.64 ? 270  GLY C C     1 
ATOM   5664  O  O     . GLY C 2  270  ? 489.360 -37.173 648.909 1.00 133.61 ? 270  GLY C O     1 
ATOM   5665  N  N     . GLU C 2  271  ? 490.542 -36.207 650.569 1.00 132.52 ? 271  GLU C N     1 
ATOM   5666  C  CA    . GLU C 2  271  ? 490.813 -37.486 651.207 1.00 133.15 ? 271  GLU C CA    1 
ATOM   5667  C  C     . GLU C 2  271  ? 489.582 -37.930 651.961 1.00 134.92 ? 271  GLU C C     1 
ATOM   5668  O  O     . GLU C 2  271  ? 489.256 -39.124 652.007 1.00 136.91 ? 271  GLU C O     1 
ATOM   5669  C  CB    . GLU C 2  271  ? 491.998 -37.375 652.157 1.00 136.23 ? 271  GLU C CB    1 
ATOM   5670  C  CG    . GLU C 2  271  ? 492.494 -38.714 652.648 1.00 145.90 ? 271  GLU C CG    1 
ATOM   5671  C  CD    . GLU C 2  271  ? 493.125 -39.527 651.551 1.00 157.96 ? 271  GLU C CD    1 
ATOM   5672  O  OE1   . GLU C 2  271  ? 493.754 -38.924 650.656 1.00 161.65 ? 271  GLU C OE1   1 
ATOM   5673  O  OE2   . GLU C 2  271  ? 492.995 -40.771 651.578 1.00 164.50 ? 271  GLU C OE2   1 
ATOM   5674  N  N     . ALA C 2  272  ? 488.893 -36.957 652.561 1.00 129.30 ? 272  ALA C N     1 
ATOM   5675  C  CA    . ALA C 2  272  ? 487.618 -37.210 653.204 1.00 126.99 ? 272  ALA C CA    1 
ATOM   5676  C  C     . ALA C 2  272  ? 486.535 -37.483 652.175 1.00 124.44 ? 272  ALA C C     1 
ATOM   5677  O  O     . ALA C 2  272  ? 485.703 -38.377 652.364 1.00 127.78 ? 272  ALA C O     1 
ATOM   5678  C  CB    . ALA C 2  272  ? 487.253 -36.009 654.067 1.00 121.58 ? 272  ALA C CB    1 
ATOM   5679  N  N     . GLY C 2  273  ? 486.610 -36.795 651.032 1.00 129.18 ? 273  GLY C N     1 
ATOM   5680  C  CA    . GLY C 2  273  ? 485.687 -37.045 649.934 1.00 135.22 ? 273  GLY C CA    1 
ATOM   5681  C  C     . GLY C 2  273  ? 485.760 -38.469 649.423 1.00 144.95 ? 273  GLY C C     1 
ATOM   5682  O  O     . GLY C 2  273  ? 484.738 -39.136 649.249 1.00 147.63 ? 273  GLY C O     1 
ATOM   5683  N  N     . ARG C 2  274  ? 486.974 -38.946 649.160 1.00 150.27 ? 274  ARG C N     1 
ATOM   5684  C  CA    . ARG C 2  274  ? 487.170 -40.328 648.737 1.00 156.10 ? 274  ARG C CA    1 
ATOM   5685  C  C     . ARG C 2  274  ? 486.568 -41.327 649.729 1.00 159.36 ? 274  ARG C C     1 
ATOM   5686  O  O     . ARG C 2  274  ? 485.853 -42.249 649.323 1.00 161.93 ? 274  ARG C O     1 
ATOM   5687  C  CB    . ARG C 2  274  ? 488.667 -40.560 648.528 1.00 160.55 ? 274  ARG C CB    1 
ATOM   5688  C  CG    . ARG C 2  274  ? 489.134 -41.976 648.254 1.00 165.68 ? 274  ARG C CG    1 
ATOM   5689  C  CD    . ARG C 2  274  ? 490.587 -42.063 648.715 1.00 167.55 ? 274  ARG C CD    1 
ATOM   5690  N  NE    . ARG C 2  274  ? 491.318 -43.210 648.195 1.00 171.97 ? 274  ARG C NE    1 
ATOM   5691  C  CZ    . ARG C 2  274  ? 491.565 -44.306 648.903 1.00 176.20 ? 274  ARG C CZ    1 
ATOM   5692  N  NH1   . ARG C 2  274  ? 491.138 -44.392 650.161 1.00 173.94 ? 274  ARG C NH1   1 
ATOM   5693  N  NH2   . ARG C 2  274  ? 492.245 -45.311 648.357 1.00 181.15 ? 274  ARG C NH2   1 
ATOM   5694  N  N     . TYR C 2  275  ? 486.851 -41.182 651.030 1.00 157.23 ? 275  TYR C N     1 
ATOM   5695  C  CA    . TYR C 2  275  ? 486.279 -42.122 651.998 1.00 160.06 ? 275  TYR C CA    1 
ATOM   5696  C  C     . TYR C 2  275  ? 484.747 -42.089 652.022 1.00 159.53 ? 275  TYR C C     1 
ATOM   5697  O  O     . TYR C 2  275  ? 484.103 -43.145 652.034 1.00 168.76 ? 275  TYR C O     1 
ATOM   5698  C  CB    . TYR C 2  275  ? 486.818 -41.875 653.411 1.00 165.04 ? 275  TYR C CB    1 
ATOM   5699  C  CG    . TYR C 2  275  ? 486.160 -42.792 654.448 1.00 172.99 ? 275  TYR C CG    1 
ATOM   5700  C  CD1   . TYR C 2  275  ? 486.554 -44.128 654.575 1.00 179.54 ? 275  TYR C CD1   1 
ATOM   5701  C  CD2   . TYR C 2  275  ? 485.131 -42.336 655.279 1.00 172.82 ? 275  TYR C CD2   1 
ATOM   5702  C  CE1   . TYR C 2  275  ? 485.951 -44.978 655.503 1.00 182.55 ? 275  TYR C CE1   1 
ATOM   5703  C  CE2   . TYR C 2  275  ? 484.523 -43.181 656.211 1.00 176.36 ? 275  TYR C CE2   1 
ATOM   5704  C  CZ    . TYR C 2  275  ? 484.939 -44.498 656.315 1.00 181.27 ? 275  TYR C CZ    1 
ATOM   5705  O  OH    . TYR C 2  275  ? 484.345 -45.335 657.232 1.00 184.95 ? 275  TYR C OH    1 
ATOM   5706  N  N     . LYS C 2  276  ? 484.142 -40.892 651.989 1.00 146.85 ? 276  LYS C N     1 
ATOM   5707  C  CA    . LYS C 2  276  ? 482.678 -40.778 652.027 1.00 137.34 ? 276  LYS C CA    1 
ATOM   5708  C  C     . LYS C 2  276  ? 482.020 -41.389 650.802 1.00 133.61 ? 276  LYS C C     1 
ATOM   5709  O  O     . LYS C 2  276  ? 480.937 -41.980 650.903 1.00 130.32 ? 276  LYS C O     1 
ATOM   5710  C  CB    . LYS C 2  276  ? 482.257 -39.319 652.162 1.00 132.28 ? 276  LYS C CB    1 
ATOM   5711  C  CG    . LYS C 2  276  ? 482.480 -38.737 653.531 1.00 131.33 ? 276  LYS C CG    1 
ATOM   5712  C  CD    . LYS C 2  276  ? 481.447 -39.280 654.490 1.00 136.42 ? 276  LYS C CD    1 
ATOM   5713  C  CE    . LYS C 2  276  ? 480.071 -38.867 654.022 1.00 136.97 ? 276  LYS C CE    1 
ATOM   5714  N  NZ    . LYS C 2  276  ? 480.029 -37.405 653.770 1.00 133.93 ? 276  LYS C NZ    1 
ATOM   5715  N  N     . ALA C 2  277  ? 482.644 -41.224 649.634 1.00 131.30 ? 277  ALA C N     1 
ATOM   5716  C  CA    . ALA C 2  277  ? 482.149 -41.831 648.402 1.00 132.38 ? 277  ALA C CA    1 
ATOM   5717  C  C     . ALA C 2  277  ? 482.198 -43.343 648.512 1.00 134.11 ? 277  ALA C C     1 
ATOM   5718  O  O     . ALA C 2  277  ? 481.232 -44.039 648.177 1.00 131.84 ? 277  ALA C O     1 
ATOM   5719  C  CB    . ALA C 2  277  ? 482.966 -41.349 647.208 1.00 124.26 ? 277  ALA C CB    1 
ATOM   5720  N  N     . GLU C 2  278  ? 483.351 -43.867 648.928 1.00 146.23 ? 278  GLU C N     1 
ATOM   5721  C  CA    . GLU C 2  278  ? 483.502 -45.302 649.117 1.00 154.84 ? 278  GLU C CA    1 
ATOM   5722  C  C     . GLU C 2  278  ? 482.428 -45.819 650.058 1.00 160.13 ? 278  GLU C C     1 
ATOM   5723  O  O     . GLU C 2  278  ? 481.877 -46.908 649.856 1.00 166.13 ? 278  GLU C O     1 
ATOM   5724  C  CB    . GLU C 2  278  ? 484.880 -45.594 649.720 1.00 155.75 ? 278  GLU C CB    1 
ATOM   5725  C  CG    . GLU C 2  278  ? 486.067 -45.402 648.795 1.00 156.97 ? 278  GLU C CG    1 
ATOM   5726  C  CD    . GLU C 2  278  ? 487.387 -45.639 649.505 1.00 155.53 ? 278  GLU C CD    1 
ATOM   5727  O  OE1   . GLU C 2  278  ? 487.386 -45.817 650.744 1.00 155.33 ? 278  GLU C OE1   1 
ATOM   5728  O  OE2   . GLU C 2  278  ? 488.429 -45.609 648.831 1.00 154.04 ? 278  GLU C OE2   1 
ATOM   5729  N  N     . GLU C 2  279  ? 482.117 -45.040 651.098 1.00 155.95 ? 279  GLU C N     1 
ATOM   5730  C  CA    . GLU C 2  279  ? 481.160 -45.476 652.102 1.00 151.16 ? 279  GLU C CA    1 
ATOM   5731  C  C     . GLU C 2  279  ? 479.722 -45.393 651.607 1.00 147.41 ? 279  GLU C C     1 
ATOM   5732  O  O     . GLU C 2  279  ? 478.932 -46.304 651.867 1.00 150.08 ? 279  GLU C O     1 
ATOM   5733  C  CB    . GLU C 2  279  ? 481.327 -44.651 653.371 1.00 150.08 ? 279  GLU C CB    1 
ATOM   5734  C  CG    . GLU C 2  279  ? 480.546 -45.246 654.487 1.00 158.93 ? 279  GLU C CG    1 
ATOM   5735  C  CD    . GLU C 2  279  ? 480.941 -46.696 654.693 1.00 168.26 ? 279  GLU C CD    1 
ATOM   5736  O  OE1   . GLU C 2  279  ? 480.038 -47.538 654.880 1.00 173.18 ? 279  GLU C OE1   1 
ATOM   5737  O  OE2   . GLU C 2  279  ? 482.157 -46.997 654.654 1.00 169.84 ? 279  GLU C OE2   1 
ATOM   5738  N  N     . LYS C 2  280  ? 479.376 -44.340 650.858 1.00 142.16 ? 280  LYS C N     1 
ATOM   5739  C  CA    . LYS C 2  280  ? 477.996 -44.178 650.396 1.00 142.35 ? 280  LYS C CA    1 
ATOM   5740  C  C     . LYS C 2  280  ? 477.646 -45.162 649.285 1.00 142.20 ? 280  LYS C C     1 
ATOM   5741  O  O     . LYS C 2  280  ? 476.596 -45.815 649.328 1.00 144.93 ? 280  LYS C O     1 
ATOM   5742  C  CB    . LYS C 2  280  ? 477.769 -42.744 649.917 1.00 138.93 ? 280  LYS C CB    1 
ATOM   5743  C  CG    . LYS C 2  280  ? 476.343 -42.450 649.431 1.00 140.13 ? 280  LYS C CG    1 
ATOM   5744  C  CD    . LYS C 2  280  ? 475.326 -42.561 650.546 1.00 143.69 ? 280  LYS C CD    1 
ATOM   5745  C  CE    . LYS C 2  280  ? 473.968 -42.023 650.133 1.00 145.44 ? 280  LYS C CE    1 
ATOM   5746  N  NZ    . LYS C 2  280  ? 472.991 -42.102 651.266 1.00 145.51 ? 280  LYS C NZ    1 
ATOM   5747  N  N     . LEU C 2  281  ? 478.498 -45.269 648.274 1.00 139.51 ? 281  LEU C N     1 
ATOM   5748  C  CA    . LEU C 2  281  ? 478.186 -46.102 647.123 1.00 143.93 ? 281  LEU C CA    1 
ATOM   5749  C  C     . LEU C 2  281  ? 478.684 -47.518 647.316 1.00 150.44 ? 281  LEU C C     1 
ATOM   5750  O  O     . LEU C 2  281  ? 478.416 -48.377 646.467 1.00 155.63 ? 281  LEU C O     1 
ATOM   5751  C  CB    . LEU C 2  281  ? 478.716 -45.508 645.805 1.00 146.94 ? 281  LEU C CB    1 
ATOM   5752  C  CG    . LEU C 2  281  ? 478.520 -44.029 645.449 1.00 143.55 ? 281  LEU C CG    1 
ATOM   5753  C  CD1   . LEU C 2  281  ? 479.451 -43.604 644.335 1.00 143.44 ? 281  LEU C CD1   1 
ATOM   5754  C  CD2   . LEU C 2  281  ? 477.084 -43.831 644.981 1.00 143.06 ? 281  LEU C CD2   1 
ATOM   5755  N  N     . GLY C 2  282  ? 479.432 -47.764 648.387 1.00 152.14 ? 282  GLY C N     1 
ATOM   5756  C  CA    . GLY C 2  282  ? 479.973 -49.080 648.630 1.00 161.26 ? 282  GLY C CA    1 
ATOM   5757  C  C     . GLY C 2  282  ? 480.972 -49.572 647.607 1.00 158.66 ? 282  GLY C C     1 
ATOM   5758  O  O     . GLY C 2  282  ? 480.814 -50.661 647.041 1.00 163.82 ? 282  GLY C O     1 
ATOM   5759  N  N     . ILE C 2  283  ? 481.975 -48.750 647.309 1.00 159.18 ? 283  ILE C N     1 
ATOM   5760  C  CA    . ILE C 2  283  ? 483.028 -49.101 646.370 1.00 165.86 ? 283  ILE C CA    1 
ATOM   5761  C  C     . ILE C 2  283  ? 484.351 -48.671 646.997 1.00 168.69 ? 283  ILE C C     1 
ATOM   5762  O  O     . ILE C 2  283  ? 484.379 -48.129 648.105 1.00 166.85 ? 283  ILE C O     1 
ATOM   5763  C  CB    . ILE C 2  283  ? 482.807 -48.456 644.985 1.00 164.76 ? 283  ILE C CB    1 
ATOM   5764  C  CG1   . ILE C 2  283  ? 483.069 -46.955 645.042 1.00 162.16 ? 283  ILE C CG1   1 
ATOM   5765  C  CG2   . ILE C 2  283  ? 481.385 -48.706 644.484 1.00 164.94 ? 283  ILE C CG2   1 
ATOM   5766  C  CD1   . ILE C 2  283  ? 482.895 -46.276 643.704 1.00 162.57 ? 283  ILE C CD1   1 
ATOM   5767  N  N     . ARG C 2  284  ? 485.459 -48.909 646.296 1.00 175.33 ? 284  ARG C N     1 
ATOM   5768  C  CA    . ARG C 2  284  ? 486.754 -48.448 646.781 1.00 176.31 ? 284  ARG C CA    1 
ATOM   5769  C  C     . ARG C 2  284  ? 487.403 -47.664 645.645 1.00 173.53 ? 284  ARG C C     1 
ATOM   5770  O  O     . ARG C 2  284  ? 487.490 -48.160 644.518 1.00 170.92 ? 284  ARG C O     1 
ATOM   5771  C  CB    . ARG C 2  284  ? 487.598 -49.636 647.273 1.00 184.52 ? 284  ARG C CB    1 
ATOM   5772  C  CG    . ARG C 2  284  ? 487.478 -49.820 648.822 1.00 188.01 ? 284  ARG C CG    1 
ATOM   5773  C  CD    . ARG C 2  284  ? 488.701 -50.251 649.641 1.00 193.51 ? 284  ARG C CD    1 
ATOM   5774  N  NE    . ARG C 2  284  ? 489.822 -49.320 649.640 1.00 194.44 ? 284  ARG C NE    1 
ATOM   5775  C  CZ    . ARG C 2  284  ? 490.014 -48.417 650.599 1.00 192.74 ? 284  ARG C CZ    1 
ATOM   5776  N  NH1   . ARG C 2  284  ? 491.055 -47.596 650.546 1.00 192.74 ? 284  ARG C NH1   1 
ATOM   5777  N  NH2   . ARG C 2  284  ? 489.162 -48.341 651.618 1.00 189.59 ? 284  ARG C NH2   1 
ATOM   5778  N  N     . LEU C 2  285  ? 487.855 -46.448 645.937 1.00 172.37 ? 285  LEU C N     1 
ATOM   5779  C  CA    . LEU C 2  285  ? 488.476 -45.581 644.941 1.00 171.30 ? 285  LEU C CA    1 
ATOM   5780  C  C     . LEU C 2  285  ? 489.998 -45.740 644.890 1.00 172.14 ? 285  LEU C C     1 
ATOM   5781  O  O     . LEU C 2  285  ? 490.672 -45.707 645.926 1.00 173.92 ? 285  LEU C O     1 
ATOM   5782  C  CB    . LEU C 2  285  ? 488.100 -44.129 645.252 1.00 164.21 ? 285  LEU C CB    1 
ATOM   5783  C  CG    . LEU C 2  285  ? 486.916 -43.545 644.480 1.00 158.87 ? 285  LEU C CG    1 
ATOM   5784  C  CD1   . LEU C 2  285  ? 487.285 -43.297 643.035 1.00 162.94 ? 285  LEU C CD1   1 
ATOM   5785  C  CD2   . LEU C 2  285  ? 485.729 -44.463 644.557 1.00 157.14 ? 285  LEU C CD2   1 
ATOM   5786  N  N     . SER C 2  286  ? 490.540 -45.878 643.672 1.00 172.90 ? 286  SER C N     1 
ATOM   5787  C  CA    . SER C 2  286  ? 491.991 -45.946 643.492 1.00 172.49 ? 286  SER C CA    1 
ATOM   5788  C  C     . SER C 2  286  ? 492.655 -44.585 643.666 1.00 169.71 ? 286  SER C C     1 
ATOM   5789  O  O     . SER C 2  286  ? 493.880 -44.520 643.830 1.00 169.38 ? 286  SER C O     1 
ATOM   5790  C  CB    . SER C 2  286  ? 492.351 -46.538 642.122 1.00 175.19 ? 286  SER C CB    1 
ATOM   5791  O  OG    . SER C 2  286  ? 491.945 -45.699 641.054 1.00 173.05 ? 286  SER C OG    1 
ATOM   5792  N  N     . GLY C 2  287  ? 491.883 -43.508 643.609 1.00 161.21 ? 287  GLY C N     1 
ATOM   5793  C  CA    . GLY C 2  287  ? 492.455 -42.190 643.755 1.00 152.21 ? 287  GLY C CA    1 
ATOM   5794  C  C     . GLY C 2  287  ? 491.377 -41.164 644.011 1.00 142.45 ? 287  GLY C C     1 
ATOM   5795  O  O     . GLY C 2  287  ? 490.212 -41.496 644.216 1.00 140.80 ? 287  GLY C O     1 
ATOM   5796  N  N     . ARG C 2  288  ? 491.768 -39.905 643.907 1.00 134.11 ? 288  ARG C N     1 
ATOM   5797  C  CA    . ARG C 2  288  ? 490.882 -38.797 644.209 1.00 127.47 ? 288  ARG C CA    1 
ATOM   5798  C  C     . ARG C 2  288  ? 490.176 -38.236 642.991 1.00 126.88 ? 288  ARG C C     1 
ATOM   5799  O  O     . ARG C 2  288  ? 489.673 -37.109 643.043 1.00 122.98 ? 288  ARG C O     1 
ATOM   5800  C  CB    . ARG C 2  288  ? 491.639 -37.741 645.004 1.00 120.56 ? 288  ARG C CB    1 
ATOM   5801  C  CG    . ARG C 2  288  ? 492.029 -38.360 646.338 1.00 122.09 ? 288  ARG C CG    1 
ATOM   5802  C  CD    . ARG C 2  288  ? 492.391 -37.323 647.368 1.00 128.64 ? 288  ARG C CD    1 
ATOM   5803  N  NE    . ARG C 2  288  ? 493.556 -36.494 647.076 1.00 133.99 ? 288  ARG C NE    1 
ATOM   5804  C  CZ    . ARG C 2  288  ? 494.788 -36.777 647.496 1.00 140.58 ? 288  ARG C CZ    1 
ATOM   5805  N  NH1   . ARG C 2  288  ? 495.015 -37.862 648.232 1.00 142.36 ? 288  ARG C NH1   1 
ATOM   5806  N  NH2   . ARG C 2  288  ? 495.794 -35.963 647.200 1.00 144.17 ? 288  ARG C NH2   1 
ATOM   5807  N  N     . THR C 2  289  ? 490.224 -38.937 641.868 1.00 137.75 ? 289  THR C N     1 
ATOM   5808  C  CA    . THR C 2  289  ? 489.583 -38.447 640.663 1.00 145.96 ? 289  THR C CA    1 
ATOM   5809  C  C     . THR C 2  289  ? 488.380 -39.324 640.339 1.00 150.33 ? 289  THR C C     1 
ATOM   5810  O  O     . THR C 2  289  ? 488.276 -40.476 640.777 1.00 149.48 ? 289  THR C O     1 
ATOM   5811  C  CB    . THR C 2  289  ? 490.541 -38.428 639.464 1.00 150.24 ? 289  THR C CB    1 
ATOM   5812  O  OG1   . THR C 2  289  ? 491.345 -39.615 639.453 1.00 154.25 ? 289  THR C OG1   1 
ATOM   5813  C  CG2   . THR C 2  289  ? 491.440 -37.207 639.548 1.00 148.30 ? 289  THR C CG2   1 
ATOM   5814  N  N     . LEU C 2  290  ? 487.447 -38.730 639.590 1.00 158.78 ? 290  LEU C N     1 
ATOM   5815  C  CA    . LEU C 2  290  ? 486.220 -39.424 639.221 1.00 159.44 ? 290  LEU C CA    1 
ATOM   5816  C  C     . LEU C 2  290  ? 486.458 -40.503 638.172 1.00 158.69 ? 290  LEU C C     1 
ATOM   5817  O  O     . LEU C 2  290  ? 485.702 -41.481 638.126 1.00 160.62 ? 290  LEU C O     1 
ATOM   5818  C  CB    . LEU C 2  290  ? 485.191 -38.430 638.691 1.00 159.87 ? 290  LEU C CB    1 
ATOM   5819  C  CG    . LEU C 2  290  ? 484.805 -37.285 639.616 1.00 155.17 ? 290  LEU C CG    1 
ATOM   5820  C  CD1   . LEU C 2  290  ? 483.685 -36.481 639.004 1.00 155.55 ? 290  LEU C CD1   1 
ATOM   5821  C  CD2   . LEU C 2  290  ? 484.438 -37.794 640.988 1.00 156.69 ? 290  LEU C CD2   1 
ATOM   5822  N  N     . ALA C 2  291  ? 487.502 -40.369 637.348 1.00 157.83 ? 291  ALA C N     1 
ATOM   5823  C  CA    . ALA C 2  291  ? 487.844 -41.429 636.413 1.00 158.50 ? 291  ALA C CA    1 
ATOM   5824  C  C     . ALA C 2  291  ? 489.344 -41.436 636.156 1.00 159.78 ? 291  ALA C C     1 
ATOM   5825  O  O     . ALA C 2  291  ? 490.095 -40.617 636.695 1.00 159.52 ? 291  ALA C O     1 
ATOM   5826  C  CB    . ALA C 2  291  ? 487.061 -41.267 635.111 1.00 148.98 ? 291  ALA C CB    1 
ATOM   5827  N  N     . ARG C 2  292  ? 489.764 -42.371 635.298 1.00 167.66 ? 292  ARG C N     1 
ATOM   5828  C  CA    . ARG C 2  292  ? 491.155 -42.579 634.910 1.00 172.56 ? 292  ARG C CA    1 
ATOM   5829  C  C     . ARG C 2  292  ? 491.356 -42.594 633.394 1.00 173.56 ? 292  ARG C C     1 
ATOM   5830  O  O     . ARG C 2  292  ? 490.443 -42.889 632.613 1.00 175.95 ? 292  ARG C O     1 
ATOM   5831  C  CB    . ARG C 2  292  ? 491.697 -43.892 635.476 1.00 176.05 ? 292  ARG C CB    1 
ATOM   5832  C  CG    . ARG C 2  292  ? 491.905 -43.909 636.968 1.00 175.34 ? 292  ARG C CG    1 
ATOM   5833  C  CD    . ARG C 2  292  ? 492.270 -45.307 637.337 1.00 178.54 ? 292  ARG C CD    1 
ATOM   5834  N  NE    . ARG C 2  292  ? 491.263 -46.207 636.800 1.00 182.05 ? 292  ARG C NE    1 
ATOM   5835  C  CZ    . ARG C 2  292  ? 491.323 -47.528 636.880 1.00 187.70 ? 292  ARG C CZ    1 
ATOM   5836  N  NH1   . ARG C 2  292  ? 492.355 -48.107 637.472 1.00 189.92 ? 292  ARG C NH1   1 
ATOM   5837  N  NH2   . ARG C 2  292  ? 490.352 -48.266 636.366 1.00 191.08 ? 292  ARG C NH2   1 
ATOM   5838  N  N     . PHE C 2  293  ? 492.601 -42.300 633.001 1.00 171.97 ? 293  PHE C N     1 
ATOM   5839  C  CA    . PHE C 2  293  ? 493.100 -42.526 631.648 1.00 168.11 ? 293  PHE C CA    1 
ATOM   5840  C  C     . PHE C 2  293  ? 494.101 -43.664 631.806 1.00 169.38 ? 293  PHE C C     1 
ATOM   5841  O  O     . PHE C 2  293  ? 495.178 -43.476 632.387 1.00 166.29 ? 293  PHE C O     1 
ATOM   5842  C  CB    . PHE C 2  293  ? 493.755 -41.267 631.073 1.00 163.79 ? 293  PHE C CB    1 
ATOM   5843  C  CG    . PHE C 2  293  ? 494.033 -41.331 629.584 1.00 167.30 ? 293  PHE C CG    1 
ATOM   5844  C  CD1   . PHE C 2  293  ? 493.042 -41.029 628.663 1.00 165.58 ? 293  PHE C CD1   1 
ATOM   5845  C  CD2   . PHE C 2  293  ? 495.295 -41.683 629.110 1.00 170.75 ? 293  PHE C CD2   1 
ATOM   5846  C  CE1   . PHE C 2  293  ? 493.301 -41.083 627.309 1.00 169.00 ? 293  PHE C CE1   1 
ATOM   5847  C  CE2   . PHE C 2  293  ? 495.558 -41.746 627.750 1.00 172.68 ? 293  PHE C CE2   1 
ATOM   5848  C  CZ    . PHE C 2  293  ? 494.565 -41.445 626.851 1.00 172.93 ? 293  PHE C CZ    1 
ATOM   5849  N  N     . GLU C 2  294  ? 493.711 -44.855 631.343 1.00 174.94 ? 294  GLU C N     1 
ATOM   5850  C  CA    . GLU C 2  294  ? 494.461 -46.089 631.548 1.00 179.38 ? 294  GLU C CA    1 
ATOM   5851  C  C     . GLU C 2  294  ? 494.430 -46.929 630.283 1.00 183.46 ? 294  GLU C C     1 
ATOM   5852  O  O     . GLU C 2  294  ? 493.360 -47.148 629.704 1.00 184.20 ? 294  GLU C O     1 
ATOM   5853  C  CB    . GLU C 2  294  ? 493.898 -46.894 632.720 1.00 178.45 ? 294  GLU C CB    1 
ATOM   5854  C  CG    . GLU C 2  294  ? 494.527 -48.260 632.916 1.00 182.41 ? 294  GLU C CG    1 
ATOM   5855  C  CD    . GLU C 2  294  ? 493.957 -48.981 634.129 1.00 184.77 ? 294  GLU C CD    1 
ATOM   5856  O  OE1   . GLU C 2  294  ? 493.900 -48.381 635.229 1.00 179.98 ? 294  GLU C OE1   1 
ATOM   5857  O  OE2   . GLU C 2  294  ? 493.547 -50.150 633.978 1.00 189.40 ? 294  GLU C OE2   1 
ATOM   5858  N  N     . ASP C 2  295  ? 495.606 -47.374 629.850 1.00 189.53 ? 295  ASP C N     1 
ATOM   5859  C  CA    . ASP C 2  295  ? 495.761 -48.183 628.643 1.00 195.45 ? 295  ASP C CA    1 
ATOM   5860  C  C     . ASP C 2  295  ? 495.176 -47.472 627.426 1.00 198.72 ? 295  ASP C C     1 
ATOM   5861  O  O     . ASP C 2  295  ? 494.627 -48.109 626.521 1.00 203.25 ? 295  ASP C O     1 
ATOM   5862  C  CB    . ASP C 2  295  ? 495.113 -49.565 628.816 1.00 202.88 ? 295  ASP C CB    1 
ATOM   5863  C  CG    . ASP C 2  295  ? 495.672 -50.331 630.008 1.00 205.69 ? 295  ASP C CG    1 
ATOM   5864  O  OD1   . ASP C 2  295  ? 494.916 -51.114 630.624 1.00 206.49 ? 295  ASP C OD1   1 
ATOM   5865  O  OD2   . ASP C 2  295  ? 496.862 -50.150 630.333 1.00 205.45 ? 295  ASP C OD2   1 
ATOM   5866  N  N     . GLY C 2  296  ? 495.297 -46.141 627.416 1.00 189.14 ? 296  GLY C N     1 
ATOM   5867  C  CA    . GLY C 2  296  ? 494.925 -45.308 626.295 1.00 188.35 ? 296  GLY C CA    1 
ATOM   5868  C  C     . GLY C 2  296  ? 493.490 -44.818 626.278 1.00 177.63 ? 296  GLY C C     1 
ATOM   5869  O  O     . GLY C 2  296  ? 493.196 -43.840 625.583 1.00 179.32 ? 296  GLY C O     1 
ATOM   5870  N  N     . GLU C 2  297  ? 492.597 -45.442 627.028 1.00 178.47 ? 297  GLU C N     1 
ATOM   5871  C  CA    . GLU C 2  297  ? 491.191 -45.056 627.044 1.00 180.48 ? 297  GLU C CA    1 
ATOM   5872  C  C     . GLU C 2  297  ? 490.804 -44.592 628.449 1.00 181.43 ? 297  GLU C C     1 
ATOM   5873  O  O     . GLU C 2  297  ? 491.621 -44.593 629.375 1.00 180.82 ? 297  GLU C O     1 
ATOM   5874  C  CB    . GLU C 2  297  ? 490.301 -46.181 626.502 1.00 185.95 ? 297  GLU C CB    1 
ATOM   5875  C  CG    . GLU C 2  297  ? 490.325 -47.499 627.234 1.00 190.08 ? 297  GLU C CG    1 
ATOM   5876  C  CD    . GLU C 2  297  ? 489.345 -48.494 626.619 1.00 195.42 ? 297  GLU C CD    1 
ATOM   5877  O  OE1   . GLU C 2  297  ? 489.720 -49.674 626.438 1.00 199.02 ? 297  GLU C OE1   1 
ATOM   5878  O  OE2   . GLU C 2  297  ? 488.205 -48.089 626.296 1.00 195.46 ? 297  GLU C OE2   1 
ATOM   5879  N  N     . PHE C 2  298  ? 489.545 -44.187 628.604 1.00 180.94 ? 298  PHE C N     1 
ATOM   5880  C  CA    . PHE C 2  298  ? 489.017 -43.757 629.893 1.00 173.73 ? 298  PHE C CA    1 
ATOM   5881  C  C     . PHE C 2  298  ? 488.319 -44.928 630.563 1.00 176.90 ? 298  PHE C C     1 
ATOM   5882  O  O     . PHE C 2  298  ? 487.558 -45.661 629.918 1.00 181.80 ? 298  PHE C O     1 
ATOM   5883  C  CB    . PHE C 2  298  ? 488.004 -42.615 629.741 1.00 168.57 ? 298  PHE C CB    1 
ATOM   5884  C  CG    . PHE C 2  298  ? 488.611 -41.257 629.491 1.00 163.77 ? 298  PHE C CG    1 
ATOM   5885  C  CD1   . PHE C 2  298  ? 489.706 -40.816 630.221 1.00 162.15 ? 298  PHE C CD1   1 
ATOM   5886  C  CD2   . PHE C 2  298  ? 488.053 -40.402 628.546 1.00 160.95 ? 298  PHE C CD2   1 
ATOM   5887  C  CE1   . PHE C 2  298  ? 490.249 -39.549 629.992 1.00 159.64 ? 298  PHE C CE1   1 
ATOM   5888  C  CE2   . PHE C 2  298  ? 488.587 -39.139 628.317 1.00 158.46 ? 298  PHE C CE2   1 
ATOM   5889  C  CZ    . PHE C 2  298  ? 489.686 -38.713 629.037 1.00 157.74 ? 298  PHE C CZ    1 
ATOM   5890  N  N     . LYS C 2  299  ? 488.585 -45.095 631.860 1.00 168.84 ? 299  LYS C N     1 
ATOM   5891  C  CA    . LYS C 2  299  ? 487.963 -46.144 632.659 1.00 168.67 ? 299  LYS C CA    1 
ATOM   5892  C  C     . LYS C 2  299  ? 487.225 -45.531 633.843 1.00 167.15 ? 299  LYS C C     1 
ATOM   5893  O  O     . LYS C 2  299  ? 487.824 -44.856 634.691 1.00 166.17 ? 299  LYS C O     1 
ATOM   5894  C  CB    . LYS C 2  299  ? 489.007 -47.165 633.123 1.00 161.23 ? 299  LYS C CB    1 
ATOM   5895  C  CG    . LYS C 2  299  ? 489.507 -48.063 631.987 1.00 159.63 ? 299  LYS C CG    1 
ATOM   5896  C  CD    . LYS C 2  299  ? 490.659 -48.935 632.416 1.00 155.66 ? 299  LYS C CD    1 
ATOM   5897  C  CE    . LYS C 2  299  ? 491.015 -49.912 631.326 1.00 159.03 ? 299  LYS C CE    1 
ATOM   5898  N  NZ    . LYS C 2  299  ? 492.135 -50.805 631.731 1.00 162.21 ? 299  LYS C NZ    1 
ATOM   5899  N  N     . ASP C 2  300  ? 485.937 -45.835 633.926 1.00 172.96 ? 300  ASP C N     1 
ATOM   5900  C  CA    . ASP C 2  300  ? 485.046 -45.292 634.940 1.00 171.52 ? 300  ASP C CA    1 
ATOM   5901  C  C     . ASP C 2  300  ? 485.377 -45.768 636.350 1.00 175.95 ? 300  ASP C C     1 
ATOM   5902  O  O     . ASP C 2  300  ? 485.893 -46.867 636.559 1.00 182.32 ? 300  ASP C O     1 
ATOM   5903  C  CB    . ASP C 2  300  ? 483.606 -45.679 634.593 1.00 171.64 ? 300  ASP C CB    1 
ATOM   5904  C  CG    . ASP C 2  300  ? 482.595 -45.061 635.509 1.00 163.41 ? 300  ASP C CG    1 
ATOM   5905  O  OD1   . ASP C 2  300  ? 482.739 -43.878 635.855 1.00 159.88 ? 300  ASP C OD1   1 
ATOM   5906  O  OD2   . ASP C 2  300  ? 481.633 -45.766 635.862 1.00 163.94 ? 300  ASP C OD2   1 
ATOM   5907  N  N     . GLU C 2  301  ? 485.097 -44.897 637.322 1.00 173.25 ? 301  GLU C N     1 
ATOM   5908  C  CA    . GLU C 2  301  ? 485.280 -45.177 638.744 1.00 167.45 ? 301  GLU C CA    1 
ATOM   5909  C  C     . GLU C 2  301  ? 483.999 -44.861 639.496 1.00 161.91 ? 301  GLU C C     1 
ATOM   5910  O  O     . GLU C 2  301  ? 483.409 -45.734 640.137 1.00 164.15 ? 301  GLU C O     1 
ATOM   5911  C  CB    . GLU C 2  301  ? 486.432 -44.379 639.364 1.00 167.96 ? 301  GLU C CB    1 
ATOM   5912  C  CG    . GLU C 2  301  ? 487.828 -44.888 639.056 1.00 174.80 ? 301  GLU C CG    1 
ATOM   5913  C  CD    . GLU C 2  301  ? 488.770 -44.709 640.240 1.00 174.75 ? 301  GLU C CD    1 
ATOM   5914  O  OE1   . GLU C 2  301  ? 489.122 -45.722 640.883 1.00 177.60 ? 301  GLU C OE1   1 
ATOM   5915  O  OE2   . GLU C 2  301  ? 489.145 -43.553 640.538 1.00 171.54 ? 301  GLU C OE2   1 
ATOM   5916  N  N     . VAL C 2  302  ? 483.577 -43.603 639.414 1.00 151.39 ? 302  VAL C N     1 
ATOM   5917  C  CA    . VAL C 2  302  ? 482.467 -43.077 640.203 1.00 143.17 ? 302  VAL C CA    1 
ATOM   5918  C  C     . VAL C 2  302  ? 481.125 -43.217 639.492 1.00 138.99 ? 302  VAL C C     1 
ATOM   5919  O  O     . VAL C 2  302  ? 480.167 -43.740 640.063 1.00 139.05 ? 302  VAL C O     1 
ATOM   5920  C  CB    . VAL C 2  302  ? 482.759 -41.609 640.570 1.00 132.07 ? 302  VAL C CB    1 
ATOM   5921  C  CG1   . VAL C 2  302  ? 481.598 -41.014 641.348 1.00 126.23 ? 302  VAL C CG1   1 
ATOM   5922  C  CG2   . VAL C 2  302  ? 484.044 -41.525 641.368 1.00 127.64 ? 302  VAL C CG2   1 
ATOM   5923  N  N     . PHE C 2  303  ? 481.029 -42.701 638.268 1.00 139.67 ? 303  PHE C N     1 
ATOM   5924  C  CA    . PHE C 2  303  ? 479.751 -42.551 637.566 1.00 145.26 ? 303  PHE C CA    1 
ATOM   5925  C  C     . PHE C 2  303  ? 478.827 -43.767 637.636 1.00 155.91 ? 303  PHE C C     1 
ATOM   5926  O  O     . PHE C 2  303  ? 477.626 -43.614 637.878 1.00 160.68 ? 303  PHE C O     1 
ATOM   5927  C  CB    . PHE C 2  303  ? 480.043 -42.147 636.125 1.00 145.03 ? 303  PHE C CB    1 
ATOM   5928  C  CG    . PHE C 2  303  ? 480.634 -40.780 636.018 1.00 142.88 ? 303  PHE C CG    1 
ATOM   5929  C  CD1   . PHE C 2  303  ? 482.006 -40.596 635.994 1.00 144.40 ? 303  PHE C CD1   1 
ATOM   5930  C  CD2   . PHE C 2  303  ? 479.811 -39.679 635.850 1.00 140.28 ? 303  PHE C CD2   1 
ATOM   5931  C  CE1   . PHE C 2  303  ? 482.546 -39.324 635.903 1.00 141.11 ? 303  PHE C CE1   1 
ATOM   5932  C  CE2   . PHE C 2  303  ? 480.341 -38.409 635.732 1.00 138.32 ? 303  PHE C CE2   1 
ATOM   5933  C  CZ    . PHE C 2  303  ? 481.711 -38.230 635.761 1.00 138.28 ? 303  PHE C CZ    1 
ATOM   5934  N  N     . LEU C 2  304  ? 479.330 -44.969 637.388 1.00 166.62 ? 304  LEU C N     1 
ATOM   5935  C  CA    . LEU C 2  304  ? 478.361 -46.070 637.424 1.00 171.48 ? 304  LEU C CA    1 
ATOM   5936  C  C     . LEU C 2  304  ? 477.789 -46.336 638.824 1.00 169.32 ? 304  LEU C C     1 
ATOM   5937  O  O     . LEU C 2  304  ? 476.568 -46.500 638.956 1.00 171.50 ? 304  LEU C O     1 
ATOM   5938  C  CB    . LEU C 2  304  ? 478.938 -47.356 636.828 1.00 178.94 ? 304  LEU C CB    1 
ATOM   5939  C  CG    . LEU C 2  304  ? 477.831 -48.408 636.722 1.00 183.92 ? 304  LEU C CG    1 
ATOM   5940  C  CD1   . LEU C 2  304  ? 476.748 -47.897 635.784 1.00 182.79 ? 304  LEU C CD1   1 
ATOM   5941  C  CD2   . LEU C 2  304  ? 478.359 -49.751 636.260 1.00 190.26 ? 304  LEU C CD2   1 
ATOM   5942  N  N     . PRO C 2  305  ? 478.602 -46.370 639.890 1.00 156.68 ? 305  PRO C N     1 
ATOM   5943  C  CA    . PRO C 2  305  ? 478.004 -46.476 641.236 1.00 154.45 ? 305  PRO C CA    1 
ATOM   5944  C  C     . PRO C 2  305  ? 477.073 -45.326 641.563 1.00 145.89 ? 305  PRO C C     1 
ATOM   5945  O  O     . PRO C 2  305  ? 476.081 -45.520 642.277 1.00 148.16 ? 305  PRO C O     1 
ATOM   5946  C  CB    . PRO C 2  305  ? 479.227 -46.499 642.158 1.00 152.36 ? 305  PRO C CB    1 
ATOM   5947  C  CG    . PRO C 2  305  ? 480.259 -47.149 641.338 1.00 155.18 ? 305  PRO C CG    1 
ATOM   5948  C  CD    . PRO C 2  305  ? 480.044 -46.674 639.929 1.00 155.97 ? 305  PRO C CD    1 
ATOM   5949  N  N     . THR C 2  306  ? 477.387 -44.120 641.091 1.00 139.36 ? 306  THR C N     1 
ATOM   5950  C  CA    . THR C 2  306  ? 476.518 -42.983 641.360 1.00 131.86 ? 306  THR C CA    1 
ATOM   5951  C  C     . THR C 2  306  ? 475.215 -43.094 640.579 1.00 136.72 ? 306  THR C C     1 
ATOM   5952  O  O     . THR C 2  306  ? 474.142 -42.796 641.114 1.00 139.98 ? 306  THR C O     1 
ATOM   5953  C  CB    . THR C 2  306  ? 477.243 -41.691 640.983 1.00 126.20 ? 306  THR C CB    1 
ATOM   5954  O  OG1   . THR C 2  306  ? 478.423 -41.541 641.784 1.00 122.62 ? 306  THR C OG1   1 
ATOM   5955  C  CG2   . THR C 2  306  ? 476.332 -40.489 641.149 1.00 123.77 ? 306  THR C CG2   1 
ATOM   5956  N  N     . LEU C 2  307  ? 475.283 -43.533 639.318 1.00 136.27 ? 307  LEU C N     1 
ATOM   5957  C  CA    . LEU C 2  307  ? 474.064 -43.746 638.540 1.00 140.06 ? 307  LEU C CA    1 
ATOM   5958  C  C     . LEU C 2  307  ? 473.235 -44.868 639.152 1.00 139.01 ? 307  LEU C C     1 
ATOM   5959  O  O     . LEU C 2  307  ? 472.005 -44.778 639.232 1.00 140.89 ? 307  LEU C O     1 
ATOM   5960  C  CB    . LEU C 2  307  ? 474.396 -44.040 637.069 1.00 142.62 ? 307  LEU C CB    1 
ATOM   5961  C  CG    . LEU C 2  307  ? 473.200 -44.406 636.162 1.00 147.79 ? 307  LEU C CG    1 
ATOM   5962  C  CD1   . LEU C 2  307  ? 472.178 -43.255 636.108 1.00 147.05 ? 307  LEU C CD1   1 
ATOM   5963  C  CD2   . LEU C 2  307  ? 473.604 -44.861 634.737 1.00 149.50 ? 307  LEU C CD2   1 
ATOM   5964  N  N     . ARG C 2  308  ? 473.908 -45.944 639.562 1.00 142.57 ? 308  ARG C N     1 
ATOM   5965  C  CA    . ARG C 2  308  ? 473.267 -47.088 640.204 1.00 151.57 ? 308  ARG C CA    1 
ATOM   5966  C  C     . ARG C 2  308  ? 472.548 -46.711 641.504 1.00 157.12 ? 308  ARG C C     1 
ATOM   5967  O  O     . ARG C 2  308  ? 471.401 -47.125 641.734 1.00 161.91 ? 308  ARG C O     1 
ATOM   5968  C  CB    . ARG C 2  308  ? 474.347 -48.150 640.448 1.00 153.91 ? 308  ARG C CB    1 
ATOM   5969  C  CG    . ARG C 2  308  ? 473.929 -49.579 640.753 1.00 159.85 ? 308  ARG C CG    1 
ATOM   5970  C  CD    . ARG C 2  308  ? 473.759 -49.637 642.264 1.00 162.36 ? 308  ARG C CD    1 
ATOM   5971  N  NE    . ARG C 2  308  ? 474.872 -48.913 642.888 1.00 160.78 ? 308  ARG C NE    1 
ATOM   5972  C  CZ    . ARG C 2  308  ? 474.862 -48.410 644.120 1.00 156.32 ? 308  ARG C CZ    1 
ATOM   5973  N  NH1   . ARG C 2  308  ? 473.785 -48.549 644.880 1.00 157.55 ? 308  ARG C NH1   1 
ATOM   5974  N  NH2   . ARG C 2  308  ? 475.924 -47.755 644.584 1.00 150.83 ? 308  ARG C NH2   1 
ATOM   5975  N  N     . TYR C 2  309  ? 473.187 -45.910 642.358 1.00 154.08 ? 309  TYR C N     1 
ATOM   5976  C  CA    . TYR C 2  309  ? 472.534 -45.539 643.604 1.00 151.04 ? 309  TYR C CA    1 
ATOM   5977  C  C     . TYR C 2  309  ? 471.293 -44.686 643.355 1.00 148.49 ? 309  TYR C C     1 
ATOM   5978  O  O     . TYR C 2  309  ? 470.239 -44.945 643.938 1.00 149.45 ? 309  TYR C O     1 
ATOM   5979  C  CB    . TYR C 2  309  ? 473.533 -44.792 644.496 1.00 153.97 ? 309  TYR C CB    1 
ATOM   5980  C  CG    . TYR C 2  309  ? 473.147 -44.694 645.971 1.00 160.69 ? 309  TYR C CG    1 
ATOM   5981  C  CD1   . TYR C 2  309  ? 473.828 -45.444 646.928 1.00 163.49 ? 309  TYR C CD1   1 
ATOM   5982  C  CD2   . TYR C 2  309  ? 472.097 -43.887 646.406 1.00 163.13 ? 309  TYR C CD2   1 
ATOM   5983  C  CE1   . TYR C 2  309  ? 473.495 -45.383 648.272 1.00 165.04 ? 309  TYR C CE1   1 
ATOM   5984  C  CE2   . TYR C 2  309  ? 471.752 -43.822 647.757 1.00 165.14 ? 309  TYR C CE2   1 
ATOM   5985  C  CZ    . TYR C 2  309  ? 472.454 -44.579 648.684 1.00 166.86 ? 309  TYR C CZ    1 
ATOM   5986  O  OH    . TYR C 2  309  ? 472.124 -44.529 650.027 1.00 167.65 ? 309  TYR C OH    1 
ATOM   5987  N  N     . LEU C 2  310  ? 471.365 -43.743 642.416 1.00 144.88 ? 310  LEU C N     1 
ATOM   5988  C  CA    . LEU C 2  310  ? 470.216 -42.894 642.094 1.00 149.42 ? 310  LEU C CA    1 
ATOM   5989  C  C     . LEU C 2  310  ? 468.990 -43.682 641.622 1.00 154.77 ? 310  LEU C C     1 
ATOM   5990  O  O     . LEU C 2  310  ? 467.874 -43.428 642.090 1.00 153.90 ? 310  LEU C O     1 
ATOM   5991  C  CB    . LEU C 2  310  ? 470.610 -41.832 641.068 1.00 146.07 ? 310  LEU C CB    1 
ATOM   5992  C  CG    . LEU C 2  310  ? 469.451 -41.049 640.430 1.00 146.94 ? 310  LEU C CG    1 
ATOM   5993  C  CD1   . LEU C 2  310  ? 468.578 -40.377 641.489 1.00 145.08 ? 310  LEU C CD1   1 
ATOM   5994  C  CD2   . LEU C 2  310  ? 469.958 -40.015 639.407 1.00 146.16 ? 310  LEU C CD2   1 
ATOM   5995  N  N     . PHE C 2  311  ? 469.158 -44.606 640.669 1.00 169.78 ? 311  PHE C N     1 
ATOM   5996  C  CA    . PHE C 2  311  ? 468.002 -45.386 640.215 1.00 187.18 ? 311  PHE C CA    1 
ATOM   5997  C  C     . PHE C 2  311  ? 467.383 -46.208 641.340 1.00 194.82 ? 311  PHE C C     1 
ATOM   5998  O  O     . PHE C 2  311  ? 466.153 -46.243 641.482 1.00 201.39 ? 311  PHE C O     1 
ATOM   5999  C  CB    . PHE C 2  311  ? 468.365 -46.306 639.042 1.00 193.42 ? 311  PHE C CB    1 
ATOM   6000  C  CG    . PHE C 2  311  ? 468.370 -45.629 637.689 1.00 197.71 ? 311  PHE C CG    1 
ATOM   6001  C  CD1   . PHE C 2  311  ? 467.909 -44.329 637.540 1.00 197.26 ? 311  PHE C CD1   1 
ATOM   6002  C  CD2   . PHE C 2  311  ? 468.784 -46.323 636.553 1.00 200.00 ? 311  PHE C CD2   1 
ATOM   6003  C  CE1   . PHE C 2  311  ? 467.899 -43.719 636.290 1.00 198.32 ? 311  PHE C CE1   1 
ATOM   6004  C  CE2   . PHE C 2  311  ? 468.776 -45.721 635.304 1.00 199.79 ? 311  PHE C CE2   1 
ATOM   6005  C  CZ    . PHE C 2  311  ? 468.335 -44.420 635.171 1.00 199.29 ? 311  PHE C CZ    1 
ATOM   6006  N  N     . ALA C 2  312  ? 468.206 -46.877 642.145 1.00 199.64 ? 312  ALA C N     1 
ATOM   6007  C  CA    . ALA C 2  312  ? 467.668 -47.675 643.244 1.00 204.25 ? 312  ALA C CA    1 
ATOM   6008  C  C     . ALA C 2  312  ? 466.869 -46.834 644.244 1.00 205.32 ? 312  ALA C C     1 
ATOM   6009  O  O     . ALA C 2  312  ? 465.865 -47.303 644.788 1.00 205.89 ? 312  ALA C O     1 
ATOM   6010  C  CB    . ALA C 2  312  ? 468.800 -48.424 643.935 1.00 206.38 ? 312  ALA C CB    1 
ATOM   6011  N  N     . LEU C 2  313  ? 467.246 -45.574 644.445 1.00 201.27 ? 313  LEU C N     1 
ATOM   6012  C  CA    . LEU C 2  313  ? 466.509 -44.721 645.374 1.00 196.01 ? 313  LEU C CA    1 
ATOM   6013  C  C     . LEU C 2  313  ? 465.153 -44.310 644.813 1.00 194.61 ? 313  LEU C C     1 
ATOM   6014  O  O     . LEU C 2  313  ? 464.138 -44.402 645.513 1.00 200.83 ? 313  LEU C O     1 
ATOM   6015  C  CB    . LEU C 2  313  ? 467.329 -43.484 645.738 1.00 189.87 ? 313  LEU C CB    1 
ATOM   6016  C  CG    . LEU C 2  313  ? 466.627 -42.557 646.735 1.00 187.22 ? 313  LEU C CG    1 
ATOM   6017  C  CD1   . LEU C 2  313  ? 466.293 -43.278 648.032 1.00 189.21 ? 313  LEU C CD1   1 
ATOM   6018  C  CD2   . LEU C 2  313  ? 467.454 -41.311 646.996 1.00 181.55 ? 313  LEU C CD2   1 
ATOM   6019  N  N     . THR C 2  314  ? 465.103 -43.881 643.550 1.00 182.87 ? 314  THR C N     1 
ATOM   6020  C  CA    . THR C 2  314  ? 463.822 -43.484 642.967 1.00 178.67 ? 314  THR C CA    1 
ATOM   6021  C  C     . THR C 2  314  ? 462.828 -44.638 643.035 1.00 179.95 ? 314  THR C C     1 
ATOM   6022  O  O     . THR C 2  314  ? 461.632 -44.434 643.288 1.00 185.69 ? 314  THR C O     1 
ATOM   6023  C  CB    . THR C 2  314  ? 464.027 -43.019 641.525 1.00 166.46 ? 314  THR C CB    1 
ATOM   6024  O  OG1   . THR C 2  314  ? 464.940 -41.911 641.507 1.00 153.99 ? 314  THR C OG1   1 
ATOM   6025  C  CG2   . THR C 2  314  ? 462.688 -42.577 640.915 1.00 167.77 ? 314  THR C CG2   1 
ATOM   6026  N  N     . ALA C 2  315  ? 463.312 -45.858 642.816 1.00 181.40 ? 315  ALA C N     1 
ATOM   6027  C  CA    . ALA C 2  315  ? 462.500 -47.063 642.873 1.00 185.36 ? 315  ALA C CA    1 
ATOM   6028  C  C     . ALA C 2  315  ? 462.105 -47.440 644.296 1.00 189.90 ? 315  ALA C C     1 
ATOM   6029  O  O     . ALA C 2  315  ? 461.222 -48.286 644.469 1.00 193.41 ? 315  ALA C O     1 
ATOM   6030  C  CB    . ALA C 2  315  ? 463.254 -48.227 642.232 1.00 189.41 ? 315  ALA C CB    1 
ATOM   6031  N  N     . GLY C 2  316  ? 462.706 -46.824 645.311 1.00 189.32 ? 316  GLY C N     1 
ATOM   6032  C  CA    . GLY C 2  316  ? 462.343 -47.137 646.680 1.00 198.70 ? 316  GLY C CA    1 
ATOM   6033  C  C     . GLY C 2  316  ? 463.026 -48.387 647.181 1.00 201.20 ? 316  GLY C C     1 
ATOM   6034  O  O     . GLY C 2  316  ? 462.478 -49.100 648.029 1.00 204.01 ? 316  GLY C O     1 
ATOM   6035  N  N     . VAL C 2  317  ? 464.210 -48.668 646.656 1.00 206.67 ? 317  VAL C N     1 
ATOM   6036  C  CA    . VAL C 2  317  ? 465.041 -49.819 647.032 1.00 208.48 ? 317  VAL C CA    1 
ATOM   6037  C  C     . VAL C 2  317  ? 465.573 -49.654 648.453 1.00 203.24 ? 317  VAL C C     1 
ATOM   6038  O  O     . VAL C 2  317  ? 466.033 -48.558 648.823 1.00 200.62 ? 317  VAL C O     1 
ATOM   6039  C  CB    . VAL C 2  317  ? 466.185 -49.999 646.031 1.00 209.58 ? 317  VAL C CB    1 
ATOM   6040  C  CG1   . VAL C 2  317  ? 467.146 -51.074 646.498 1.00 211.65 ? 317  VAL C CG1   1 
ATOM   6041  C  CG2   . VAL C 2  317  ? 465.617 -50.370 644.665 1.00 213.61 ? 317  VAL C CG2   1 
ATOM   6042  N  N     . PRO C 2  318  ? 465.446 -50.681 649.292 1.00 191.71 ? 318  PRO C N     1 
ATOM   6043  C  CA    . PRO C 2  318  ? 465.974 -50.623 650.662 1.00 185.15 ? 318  PRO C CA    1 
ATOM   6044  C  C     . PRO C 2  318  ? 467.467 -50.318 650.692 1.00 182.21 ? 318  PRO C C     1 
ATOM   6045  O  O     . PRO C 2  318  ? 468.241 -50.839 649.886 1.00 179.02 ? 318  PRO C O     1 
ATOM   6046  C  CB    . PRO C 2  318  ? 465.704 -52.032 651.192 1.00 186.87 ? 318  PRO C CB    1 
ATOM   6047  C  CG    . PRO C 2  318  ? 464.541 -52.493 650.412 1.00 191.49 ? 318  PRO C CG    1 
ATOM   6048  C  CD    . PRO C 2  318  ? 464.697 -51.923 649.044 1.00 194.78 ? 318  PRO C CD    1 
ATOM   6049  N  N     . GLY C 2  319  ? 467.871 -49.477 651.640 1.00 183.41 ? 319  GLY C N     1 
ATOM   6050  C  CA    . GLY C 2  319  ? 469.263 -49.116 651.798 1.00 190.62 ? 319  GLY C CA    1 
ATOM   6051  C  C     . GLY C 2  319  ? 469.651 -47.820 651.132 1.00 188.20 ? 319  GLY C C     1 
ATOM   6052  O  O     . GLY C 2  319  ? 470.842 -47.483 651.121 1.00 179.17 ? 319  GLY C O     1 
ATOM   6053  N  N     . HIS C 2  320  ? 468.692 -47.091 650.562 1.00 203.56 ? 320  HIS C N     1 
ATOM   6054  C  CA    . HIS C 2  320  ? 468.980 -45.840 649.886 1.00 206.12 ? 320  HIS C CA    1 
ATOM   6055  C  C     . HIS C 2  320  ? 468.221 -44.713 650.564 1.00 199.02 ? 320  HIS C C     1 
ATOM   6056  O  O     . HIS C 2  320  ? 466.998 -44.785 650.726 1.00 201.21 ? 320  HIS C O     1 
ATOM   6057  C  CB    . HIS C 2  320  ? 468.563 -45.941 648.415 1.00 211.12 ? 320  HIS C CB    1 
ATOM   6058  C  CG    . HIS C 2  320  ? 469.318 -46.987 647.655 1.00 216.14 ? 320  HIS C CG    1 
ATOM   6059  N  ND1   . HIS C 2  320  ? 469.257 -48.326 647.978 1.00 220.11 ? 320  HIS C ND1   1 
ATOM   6060  C  CD2   . HIS C 2  320  ? 470.186 -46.889 646.623 1.00 215.81 ? 320  HIS C CD2   1 
ATOM   6061  C  CE1   . HIS C 2  320  ? 470.039 -49.010 647.164 1.00 221.22 ? 320  HIS C CE1   1 
ATOM   6062  N  NE2   . HIS C 2  320  ? 470.622 -48.161 646.339 1.00 219.05 ? 320  HIS C NE2   1 
ATOM   6063  N  N     . GLU C 2  321  ? 468.960 -43.687 650.962 1.00 181.04 ? 321  GLU C N     1 
ATOM   6064  C  CA    . GLU C 2  321  ? 468.450 -42.564 651.723 1.00 167.65 ? 321  GLU C CA    1 
ATOM   6065  C  C     . GLU C 2  321  ? 468.885 -41.270 651.054 1.00 151.02 ? 321  GLU C C     1 
ATOM   6066  O  O     . GLU C 2  321  ? 469.862 -41.240 650.305 1.00 148.17 ? 321  GLU C O     1 
ATOM   6067  C  CB    . GLU C 2  321  ? 468.968 -42.629 653.134 1.00 168.17 ? 321  GLU C CB    1 
ATOM   6068  C  CG    . GLU C 2  321  ? 470.451 -42.503 653.118 1.00 169.48 ? 321  GLU C CG    1 
ATOM   6069  C  CD    . GLU C 2  321  ? 471.060 -42.669 654.463 1.00 170.73 ? 321  GLU C CD    1 
ATOM   6070  O  OE1   . GLU C 2  321  ? 470.343 -42.471 655.469 1.00 168.44 ? 321  GLU C OE1   1 
ATOM   6071  O  OE2   . GLU C 2  321  ? 472.274 -42.954 654.501 1.00 173.26 ? 321  GLU C OE2   1 
ATOM   6072  N  N     . VAL C 2  322  ? 468.170 -40.195 651.334 1.00 140.01 ? 322  VAL C N     1 
ATOM   6073  C  CA    . VAL C 2  322  ? 468.690 -38.883 650.988 1.00 129.15 ? 322  VAL C CA    1 
ATOM   6074  C  C     . VAL C 2  322  ? 469.695 -38.454 652.050 1.00 121.41 ? 322  VAL C C     1 
ATOM   6075  O  O     . VAL C 2  322  ? 469.744 -39.006 653.144 1.00 128.05 ? 322  VAL C O     1 
ATOM   6076  C  CB    . VAL C 2  322  ? 467.542 -37.864 650.845 1.00 124.13 ? 322  VAL C CB    1 
ATOM   6077  C  CG1   . VAL C 2  322  ? 468.017 -36.424 651.055 1.00 116.63 ? 322  VAL C CG1   1 
ATOM   6078  C  CG2   . VAL C 2  322  ? 466.895 -37.998 649.475 1.00 129.83 ? 322  VAL C CG2   1 
ATOM   6079  N  N     . ASP C 2  323  ? 470.604 -37.568 651.685 1.00 117.73 ? 323  ASP C N     1 
ATOM   6080  C  CA    . ASP C 2  323  ? 471.608 -37.110 652.626 1.00 120.28 ? 323  ASP C CA    1 
ATOM   6081  C  C     . ASP C 2  323  ? 471.208 -35.731 653.129 1.00 119.62 ? 323  ASP C C     1 
ATOM   6082  O  O     . ASP C 2  323  ? 470.799 -34.870 652.344 1.00 122.01 ? 323  ASP C O     1 
ATOM   6083  C  CB    . ASP C 2  323  ? 473.003 -37.127 652.028 1.00 126.48 ? 323  ASP C CB    1 
ATOM   6084  C  CG    . ASP C 2  323  ? 473.427 -38.521 651.682 1.00 135.52 ? 323  ASP C CG    1 
ATOM   6085  O  OD1   . ASP C 2  323  ? 473.662 -39.296 652.635 1.00 139.82 ? 323  ASP C OD1   1 
ATOM   6086  O  OD2   . ASP C 2  323  ? 473.513 -38.849 650.484 1.00 137.47 ? 323  ASP C OD2   1 
ATOM   6087  N  N     . ASP C 2  324  ? 471.305 -35.542 654.438 1.00 116.92 ? 324  ASP C N     1 
ATOM   6088  C  CA    . ASP C 2  324  ? 471.070 -34.251 655.070 1.00 116.28 ? 324  ASP C CA    1 
ATOM   6089  C  C     . ASP C 2  324  ? 472.352 -33.428 654.987 1.00 111.51 ? 324  ASP C C     1 
ATOM   6090  O  O     . ASP C 2  324  ? 473.378 -33.806 655.560 1.00 110.91 ? 324  ASP C O     1 
ATOM   6091  C  CB    . ASP C 2  324  ? 470.617 -34.489 656.514 1.00 117.63 ? 324  ASP C CB    1 
ATOM   6092  C  CG    . ASP C 2  324  ? 470.189 -33.222 657.235 1.00 114.41 ? 324  ASP C CG    1 
ATOM   6093  O  OD1   . ASP C 2  324  ? 470.985 -32.715 658.052 1.00 112.06 ? 324  ASP C OD1   1 
ATOM   6094  O  OD2   . ASP C 2  324  ? 469.052 -32.751 657.006 1.00 114.12 ? 324  ASP C OD2   1 
ATOM   6095  N  N     . ILE C 2  325  ? 472.301 -32.309 654.259 1.00 114.03 ? 325  ILE C N     1 
ATOM   6096  C  CA    . ILE C 2  325  ? 473.523 -31.577 653.928 1.00 114.40 ? 325  ILE C CA    1 
ATOM   6097  C  C     . ILE C 2  325  ? 474.004 -30.643 655.019 1.00 115.19 ? 325  ILE C C     1 
ATOM   6098  O  O     . ILE C 2  325  ? 475.119 -30.120 654.915 1.00 117.34 ? 325  ILE C O     1 
ATOM   6099  C  CB    . ILE C 2  325  ? 473.384 -30.690 652.680 1.00 118.20 ? 325  ILE C CB    1 
ATOM   6100  C  CG1   . ILE C 2  325  ? 472.594 -29.430 653.010 1.00 122.02 ? 325  ILE C CG1   1 
ATOM   6101  C  CG2   . ILE C 2  325  ? 472.663 -31.450 651.600 1.00 121.82 ? 325  ILE C CG2   1 
ATOM   6102  C  CD1   . ILE C 2  325  ? 472.670 -28.375 651.933 1.00 122.72 ? 325  ILE C CD1   1 
ATOM   6103  N  N     . ASP C 2  326  ? 473.196 -30.385 656.039 1.00 113.62 ? 326  ASP C N     1 
ATOM   6104  C  CA    . ASP C 2  326  ? 473.646 -29.579 657.161 1.00 114.08 ? 326  ASP C CA    1 
ATOM   6105  C  C     . ASP C 2  326  ? 474.100 -30.447 658.325 1.00 106.45 ? 326  ASP C C     1 
ATOM   6106  O  O     . ASP C 2  326  ? 474.608 -29.918 659.328 1.00 102.81 ? 326  ASP C O     1 
ATOM   6107  C  CB    . ASP C 2  326  ? 472.517 -28.631 657.628 1.00 123.38 ? 326  ASP C CB    1 
ATOM   6108  C  CG    . ASP C 2  326  ? 472.104 -27.601 656.561 1.00 129.50 ? 326  ASP C CG    1 
ATOM   6109  O  OD1   . ASP C 2  326  ? 472.921 -26.717 656.214 1.00 130.14 ? 326  ASP C OD1   1 
ATOM   6110  O  OD2   . ASP C 2  326  ? 470.941 -27.657 656.096 1.00 131.65 ? 326  ASP C OD2   1 
ATOM   6111  N  N     . HIS C 2  327  ? 473.980 -31.767 658.175 1.00 100.45 ? 327  HIS C N     1 
ATOM   6112  C  CA    . HIS C 2  327  ? 474.505 -32.721 659.141 1.00 99.90  ? 327  HIS C CA    1 
ATOM   6113  C  C     . HIS C 2  327  ? 476.004 -32.552 659.305 1.00 98.54  ? 327  HIS C C     1 
ATOM   6114  O  O     . HIS C 2  327  ? 476.721 -32.358 658.327 1.00 101.02 ? 327  HIS C O     1 
ATOM   6115  C  CB    . HIS C 2  327  ? 474.181 -34.124 658.650 1.00 102.70 ? 327  HIS C CB    1 
ATOM   6116  C  CG    . HIS C 2  327  ? 474.360 -35.195 659.673 1.00 108.61 ? 327  HIS C CG    1 
ATOM   6117  N  ND1   . HIS C 2  327  ? 475.592 -35.723 659.995 1.00 110.38 ? 327  HIS C ND1   1 
ATOM   6118  C  CD2   . HIS C 2  327  ? 473.452 -35.865 660.422 1.00 111.79 ? 327  HIS C CD2   1 
ATOM   6119  C  CE1   . HIS C 2  327  ? 475.435 -36.667 660.908 1.00 112.85 ? 327  HIS C CE1   1 
ATOM   6120  N  NE2   . HIS C 2  327  ? 474.147 -36.774 661.182 1.00 112.63 ? 327  HIS C NE2   1 
ATOM   6121  N  N     . LEU C 2  328  ? 476.490 -32.630 660.545 1.00 94.88  ? 328  LEU C N     1 
ATOM   6122  C  CA    . LEU C 2  328  ? 477.897 -32.310 660.757 1.00 95.01  ? 328  LEU C CA    1 
ATOM   6123  C  C     . LEU C 2  328  ? 478.839 -33.458 660.369 1.00 95.37  ? 328  LEU C C     1 
ATOM   6124  O  O     . LEU C 2  328  ? 480.062 -33.335 660.540 1.00 81.70  ? 328  LEU C O     1 
ATOM   6125  C  CB    . LEU C 2  328  ? 478.149 -31.914 662.217 1.00 88.06  ? 328  LEU C CB    1 
ATOM   6126  C  CG    . LEU C 2  328  ? 477.849 -30.460 662.618 1.00 79.00  ? 328  LEU C CG    1 
ATOM   6127  C  CD1   . LEU C 2  328  ? 478.358 -30.102 664.018 1.00 78.99  ? 328  LEU C CD1   1 
ATOM   6128  C  CD2   . LEU C 2  328  ? 478.193 -29.426 661.592 1.00 85.84  ? 328  LEU C CD2   1 
ATOM   6129  N  N     . GLY C 2  329  ? 478.295 -34.577 659.881 1.00 97.49  ? 329  GLY C N     1 
ATOM   6130  C  CA    . GLY C 2  329  ? 479.105 -35.597 659.231 1.00 102.28 ? 329  GLY C CA    1 
ATOM   6131  C  C     . GLY C 2  329  ? 479.449 -35.273 657.791 1.00 102.06 ? 329  GLY C C     1 
ATOM   6132  O  O     . GLY C 2  329  ? 480.499 -35.692 657.287 1.00 100.83 ? 329  GLY C O     1 
ATOM   6133  N  N     . ASN C 2  330  ? 478.561 -34.537 657.121 1.00 95.97  ? 330  ASN C N     1 
ATOM   6134  C  CA    . ASN C 2  330  ? 478.653 -34.090 655.739 1.00 91.88  ? 330  ASN C CA    1 
ATOM   6135  C  C     . ASN C 2  330  ? 479.151 -32.650 655.605 1.00 85.13  ? 330  ASN C C     1 
ATOM   6136  O  O     . ASN C 2  330  ? 479.066 -32.077 654.521 1.00 87.63  ? 330  ASN C O     1 
ATOM   6137  C  CB    . ASN C 2  330  ? 477.306 -34.287 655.037 1.00 91.61  ? 330  ASN C CB    1 
ATOM   6138  C  CG    . ASN C 2  330  ? 476.780 -35.712 655.198 1.00 96.78  ? 330  ASN C CG    1 
ATOM   6139  O  OD1   . ASN C 2  330  ? 477.550 -36.665 655.130 1.00 98.76  ? 330  ASN C OD1   1 
ATOM   6140  N  ND2   . ASN C 2  330  ? 475.469 -35.862 655.395 1.00 101.43 ? 330  ASN C ND2   1 
ATOM   6141  N  N     . ARG C 2  331  ? 479.519 -32.009 656.705 1.00 86.35  ? 331  ARG C N     1 
ATOM   6142  C  CA    . ARG C 2  331  ? 480.044 -30.652 656.724 1.00 85.87  ? 331  ARG C CA    1 
ATOM   6143  C  C     . ARG C 2  331  ? 481.399 -30.755 657.415 1.00 83.72  ? 331  ARG C C     1 
ATOM   6144  O  O     . ARG C 2  331  ? 481.507 -31.395 658.466 1.00 98.61  ? 331  ARG C O     1 
ATOM   6145  C  CB    . ARG C 2  331  ? 479.125 -29.668 657.462 1.00 84.42  ? 331  ARG C CB    1 
ATOM   6146  C  CG    . ARG C 2  331  ? 478.789 -28.497 656.588 1.00 83.79  ? 331  ARG C CG    1 
ATOM   6147  C  CD    . ARG C 2  331  ? 477.494 -27.822 656.882 1.00 81.20  ? 331  ARG C CD    1 
ATOM   6148  N  NE    . ARG C 2  331  ? 477.763 -26.768 657.852 1.00 88.44  ? 331  ARG C NE    1 
ATOM   6149  C  CZ    . ARG C 2  331  ? 477.041 -25.653 657.971 1.00 98.62  ? 331  ARG C CZ    1 
ATOM   6150  N  NH1   . ARG C 2  331  ? 477.340 -24.732 658.895 1.00 100.26 ? 331  ARG C NH1   1 
ATOM   6151  N  NH2   . ARG C 2  331  ? 475.994 -25.476 657.177 1.00 100.67 ? 331  ARG C NH2   1 
ATOM   6152  N  N     . ARG C 2  332  ? 482.447 -30.208 656.819 1.00 74.93  ? 332  ARG C N     1 
ATOM   6153  C  CA    . ARG C 2  332  ? 483.779 -30.426 657.378 1.00 82.09  ? 332  ARG C CA    1 
ATOM   6154  C  C     . ARG C 2  332  ? 484.502 -29.102 657.571 1.00 79.38  ? 332  ARG C C     1 
ATOM   6155  O  O     . ARG C 2  332  ? 484.061 -28.045 657.111 1.00 77.44  ? 332  ARG C O     1 
ATOM   6156  C  CB    . ARG C 2  332  ? 484.628 -31.380 656.530 1.00 80.82  ? 332  ARG C CB    1 
ATOM   6157  C  CG    . ARG C 2  332  ? 485.020 -30.794 655.204 1.00 82.54  ? 332  ARG C CG    1 
ATOM   6158  C  CD    . ARG C 2  332  ? 485.831 -31.729 654.388 1.00 77.25  ? 332  ARG C CD    1 
ATOM   6159  N  NE    . ARG C 2  332  ? 487.139 -31.908 655.006 1.00 87.95  ? 332  ARG C NE    1 
ATOM   6160  C  CZ    . ARG C 2  332  ? 488.203 -31.162 654.733 1.00 85.33  ? 332  ARG C CZ    1 
ATOM   6161  N  NH1   . ARG C 2  332  ? 488.109 -30.173 653.854 1.00 81.46  ? 332  ARG C NH1   1 
ATOM   6162  N  NH2   . ARG C 2  332  ? 489.361 -31.406 655.339 1.00 85.14  ? 332  ARG C NH2   1 
ATOM   6163  N  N     . ILE C 2  333  ? 485.535 -29.164 658.400 1.00 85.14  ? 333  ILE C N     1 
ATOM   6164  C  CA    . ILE C 2  333  ? 486.351 -28.014 658.758 1.00 90.03  ? 333  ILE C CA    1 
ATOM   6165  C  C     . ILE C 2  333  ? 487.639 -27.992 657.967 1.00 97.34  ? 333  ILE C C     1 
ATOM   6166  O  O     . ILE C 2  333  ? 488.361 -28.999 657.906 1.00 101.46 ? 333  ILE C O     1 
ATOM   6167  C  CB    . ILE C 2  333  ? 486.664 -28.002 660.255 1.00 94.04  ? 333  ILE C CB    1 
ATOM   6168  C  CG1   . ILE C 2  333  ? 485.366 -28.175 661.025 1.00 98.40  ? 333  ILE C CG1   1 
ATOM   6169  C  CG2   . ILE C 2  333  ? 487.342 -26.688 660.609 1.00 93.01  ? 333  ILE C CG2   1 
ATOM   6170  C  CD1   . ILE C 2  333  ? 484.392 -27.065 660.734 1.00 100.31 ? 333  ILE C CD1   1 
ATOM   6171  N  N     . ARG C 2  334  ? 487.955 -26.820 657.417 1.00 103.91 ? 334  ARG C N     1 
ATOM   6172  C  CA    . ARG C 2  334  ? 489.237 -26.557 656.774 1.00 104.15 ? 334  ARG C CA    1 
ATOM   6173  C  C     . ARG C 2  334  ? 490.104 -25.746 657.731 1.00 100.61 ? 334  ARG C C     1 
ATOM   6174  O  O     . ARG C 2  334  ? 489.898 -24.542 657.888 1.00 103.54 ? 334  ARG C O     1 
ATOM   6175  C  CB    . ARG C 2  334  ? 489.037 -25.772 655.481 1.00 110.17 ? 334  ARG C CB    1 
ATOM   6176  C  CG    . ARG C 2  334  ? 488.121 -26.377 654.435 1.00 117.19 ? 334  ARG C CG    1 
ATOM   6177  C  CD    . ARG C 2  334  ? 488.860 -26.224 653.130 1.00 122.34 ? 334  ARG C CD    1 
ATOM   6178  N  NE    . ARG C 2  334  ? 488.820 -24.850 652.649 1.00 124.70 ? 334  ARG C NE    1 
ATOM   6179  C  CZ    . ARG C 2  334  ? 489.015 -24.511 651.383 1.00 128.81 ? 334  ARG C CZ    1 
ATOM   6180  N  NH1   . ARG C 2  334  ? 489.255 -25.457 650.485 1.00 131.38 ? 334  ARG C NH1   1 
ATOM   6181  N  NH2   . ARG C 2  334  ? 488.966 -23.234 651.016 1.00 129.45 ? 334  ARG C NH2   1 
ATOM   6182  N  N     . THR C 2  335  ? 491.123 -26.376 658.306 1.00 90.56  ? 335  THR C N     1 
ATOM   6183  C  CA    . THR C 2  335  ? 491.911 -25.692 659.314 1.00 87.93  ? 335  THR C CA    1 
ATOM   6184  C  C     . THR C 2  335  ? 493.039 -24.889 658.679 1.00 87.61  ? 335  THR C C     1 
ATOM   6185  O  O     . THR C 2  335  ? 493.176 -24.845 657.464 1.00 97.49  ? 335  THR C O     1 
ATOM   6186  C  CB    . THR C 2  335  ? 492.475 -26.726 660.278 1.00 90.14  ? 335  THR C CB    1 
ATOM   6187  O  OG1   . THR C 2  335  ? 492.951 -27.856 659.529 1.00 89.76  ? 335  THR C OG1   1 
ATOM   6188  C  CG2   . THR C 2  335  ? 491.400 -27.181 661.225 1.00 92.58  ? 335  THR C CG2   1 
ATOM   6189  N  N     . VAL C 2  336  ? 493.820 -24.191 659.506 1.00 86.09  ? 336  VAL C N     1 
ATOM   6190  C  CA    . VAL C 2  336  ? 494.882 -23.314 659.000 1.00 91.21  ? 336  VAL C CA    1 
ATOM   6191  C  C     . VAL C 2  336  ? 495.771 -24.017 657.981 1.00 101.29 ? 336  VAL C C     1 
ATOM   6192  O  O     . VAL C 2  336  ? 495.998 -23.516 656.873 1.00 109.33 ? 336  VAL C O     1 
ATOM   6193  C  CB    . VAL C 2  336  ? 495.755 -22.816 660.155 1.00 96.04  ? 336  VAL C CB    1 
ATOM   6194  C  CG1   . VAL C 2  336  ? 496.363 -21.491 659.789 1.00 90.97  ? 336  VAL C CG1   1 
ATOM   6195  C  CG2   . VAL C 2  336  ? 494.968 -22.797 661.435 1.00 102.45 ? 336  VAL C CG2   1 
ATOM   6196  N  N     . GLY C 2  337  ? 496.284 -25.202 658.348 1.00 101.11 ? 337  GLY C N     1 
ATOM   6197  C  CA    . GLY C 2  337  ? 497.185 -25.926 657.461 1.00 97.55  ? 337  GLY C CA    1 
ATOM   6198  C  C     . GLY C 2  337  ? 496.551 -26.165 656.110 1.00 95.01  ? 337  GLY C C     1 
ATOM   6199  O  O     . GLY C 2  337  ? 497.143 -25.884 655.065 1.00 94.68  ? 337  GLY C O     1 
ATOM   6200  N  N     . GLU C 2  338  ? 495.313 -26.644 656.117 1.00 84.67  ? 338  GLU C N     1 
ATOM   6201  C  CA    . GLU C 2  338  ? 494.657 -26.931 654.864 1.00 77.76  ? 338  GLU C CA    1 
ATOM   6202  C  C     . GLU C 2  338  ? 494.464 -25.658 654.076 1.00 77.56  ? 338  GLU C C     1 
ATOM   6203  O  O     . GLU C 2  338  ? 494.794 -25.607 652.888 1.00 87.64  ? 338  GLU C O     1 
ATOM   6204  C  CB    . GLU C 2  338  ? 493.332 -27.610 655.120 1.00 80.05  ? 338  GLU C CB    1 
ATOM   6205  C  CG    . GLU C 2  338  ? 492.622 -27.892 653.864 1.00 93.45  ? 338  GLU C CG    1 
ATOM   6206  C  CD    . GLU C 2  338  ? 491.477 -28.820 654.065 1.00 104.58 ? 338  GLU C CD    1 
ATOM   6207  O  OE1   . GLU C 2  338  ? 491.427 -29.461 655.144 1.00 106.45 ? 338  GLU C OE1   1 
ATOM   6208  O  OE2   . GLU C 2  338  ? 490.609 -28.862 653.162 1.00 109.17 ? 338  GLU C OE2   1 
ATOM   6209  N  N     . LEU C 2  339  ? 494.039 -24.591 654.747 1.00 73.18  ? 339  LEU C N     1 
ATOM   6210  C  CA    . LEU C 2  339  ? 493.799 -23.317 654.072 1.00 79.05  ? 339  LEU C CA    1 
ATOM   6211  C  C     . LEU C 2  339  ? 495.090 -22.779 653.496 1.00 82.47  ? 339  LEU C C     1 
ATOM   6212  O  O     . LEU C 2  339  ? 495.123 -22.327 652.347 1.00 89.41  ? 339  LEU C O     1 
ATOM   6213  C  CB    . LEU C 2  339  ? 493.174 -22.294 655.023 1.00 79.79  ? 339  LEU C CB    1 
ATOM   6214  C  CG    . LEU C 2  339  ? 491.870 -22.649 655.751 1.00 75.75  ? 339  LEU C CG    1 
ATOM   6215  C  CD1   . LEU C 2  339  ? 491.610 -21.611 656.790 1.00 73.94  ? 339  LEU C CD1   1 
ATOM   6216  C  CD2   . LEU C 2  339  ? 490.680 -22.740 654.789 1.00 73.02  ? 339  LEU C CD2   1 
ATOM   6217  N  N     . MET C 2  340  ? 496.118 -22.678 654.335 1.00 86.10  ? 340  MET C N     1 
ATOM   6218  C  CA    . MET C 2  340  ? 497.442 -22.250 653.882 1.00 95.64  ? 340  MET C CA    1 
ATOM   6219  C  C     . MET C 2  340  ? 497.965 -23.127 652.738 1.00 94.54  ? 340  MET C C     1 
ATOM   6220  O  O     . MET C 2  340  ? 498.582 -22.635 651.782 1.00 87.76  ? 340  MET C O     1 
ATOM   6221  C  CB    . MET C 2  340  ? 498.420 -22.289 655.053 1.00 100.19 ? 340  MET C CB    1 
ATOM   6222  C  CG    . MET C 2  340  ? 499.822 -21.887 654.651 1.00 100.73 ? 340  MET C CG    1 
ATOM   6223  S  SD    . MET C 2  340  ? 500.763 -23.296 653.968 1.00 96.71  ? 340  MET C SD    1 
ATOM   6224  C  CE    . MET C 2  340  ? 502.105 -22.348 653.300 1.00 107.01 ? 340  MET C CE    1 
ATOM   6225  N  N     . THR C 2  341  ? 497.832 -24.444 652.891 1.00 95.63  ? 341  THR C N     1 
ATOM   6226  C  CA    . THR C 2  341  ? 498.293 -25.367 651.868 1.00 92.08  ? 341  THR C CA    1 
ATOM   6227  C  C     . THR C 2  341  ? 497.571 -25.133 650.554 1.00 90.90  ? 341  THR C C     1 
ATOM   6228  O  O     . THR C 2  341  ? 498.175 -25.238 649.486 1.00 96.60  ? 341  THR C O     1 
ATOM   6229  C  CB    . THR C 2  341  ? 498.100 -26.798 652.349 1.00 91.10  ? 341  THR C CB    1 
ATOM   6230  O  OG1   . THR C 2  341  ? 498.956 -27.022 653.476 1.00 85.94  ? 341  THR C OG1   1 
ATOM   6231  C  CG2   . THR C 2  341  ? 498.425 -27.787 651.248 1.00 94.94  ? 341  THR C CG2   1 
ATOM   6232  N  N     . ASP C 2  342  ? 496.290 -24.788 650.605 1.00 89.76  ? 342  ASP C N     1 
ATOM   6233  C  CA    . ASP C 2  342  ? 495.604 -24.460 649.365 1.00 95.27  ? 342  ASP C CA    1 
ATOM   6234  C  C     . ASP C 2  342  ? 496.280 -23.288 648.654 1.00 92.14  ? 342  ASP C C     1 
ATOM   6235  O  O     . ASP C 2  342  ? 496.504 -23.352 647.443 1.00 97.42  ? 342  ASP C O     1 
ATOM   6236  C  CB    . ASP C 2  342  ? 494.127 -24.212 649.643 1.00 108.68 ? 342  ASP C CB    1 
ATOM   6237  C  CG    . ASP C 2  342  ? 493.267 -25.272 648.993 1.00 120.12 ? 342  ASP C CG    1 
ATOM   6238  O  OD1   . ASP C 2  342  ? 493.613 -26.464 649.199 1.00 126.75 ? 342  ASP C OD1   1 
ATOM   6239  O  OD2   . ASP C 2  342  ? 492.277 -24.938 648.303 1.00 121.71 ? 342  ASP C OD2   1 
ATOM   6240  N  N     . GLN C 2  343  ? 496.550 -22.180 649.355 1.00 84.41  ? 343  GLN C N     1 
ATOM   6241  C  CA    . GLN C 2  343  ? 497.243 -21.065 648.695 1.00 87.74  ? 343  GLN C CA    1 
ATOM   6242  C  C     . GLN C 2  343  ? 498.655 -21.434 648.287 1.00 92.67  ? 343  GLN C C     1 
ATOM   6243  O  O     . GLN C 2  343  ? 499.183 -20.911 647.301 1.00 94.31  ? 343  GLN C O     1 
ATOM   6244  C  CB    . GLN C 2  343  ? 497.289 -19.831 649.582 1.00 88.03  ? 343  GLN C CB    1 
ATOM   6245  C  CG    . GLN C 2  343  ? 496.023 -19.093 649.695 1.00 90.31  ? 343  GLN C CG    1 
ATOM   6246  C  CD    . GLN C 2  343  ? 495.395 -18.986 648.358 1.00 92.43  ? 343  GLN C CD    1 
ATOM   6247  O  OE1   . GLN C 2  343  ? 494.574 -19.814 647.960 1.00 98.82  ? 343  GLN C OE1   1 
ATOM   6248  N  NE2   . GLN C 2  343  ? 495.816 -17.960 647.612 1.00 88.69  ? 343  GLN C NE2   1 
ATOM   6249  N  N     . PHE C 2  344  ? 499.321 -22.244 649.094 1.00 101.77 ? 344  PHE C N     1 
ATOM   6250  C  CA    . PHE C 2  344  ? 500.643 -22.718 648.719 1.00 103.18 ? 344  PHE C CA    1 
ATOM   6251  C  C     . PHE C 2  344  ? 500.594 -23.507 647.424 1.00 108.47 ? 344  PHE C C     1 
ATOM   6252  O  O     . PHE C 2  344  ? 501.388 -23.271 646.512 1.00 116.72 ? 344  PHE C O     1 
ATOM   6253  C  CB    . PHE C 2  344  ? 501.241 -23.538 649.858 1.00 105.66 ? 344  PHE C CB    1 
ATOM   6254  C  CG    . PHE C 2  344  ? 502.691 -23.876 649.674 1.00 109.83 ? 344  PHE C CG    1 
ATOM   6255  C  CD1   . PHE C 2  344  ? 503.066 -25.066 649.060 1.00 113.76 ? 344  PHE C CD1   1 
ATOM   6256  C  CD2   . PHE C 2  344  ? 503.678 -22.985 650.053 1.00 113.06 ? 344  PHE C CD2   1 
ATOM   6257  C  CE1   . PHE C 2  344  ? 504.394 -25.391 648.886 1.00 117.45 ? 344  PHE C CE1   1 
ATOM   6258  C  CE2   . PHE C 2  344  ? 505.014 -23.299 649.865 1.00 118.81 ? 344  PHE C CE2   1 
ATOM   6259  C  CZ    . PHE C 2  344  ? 505.371 -24.506 649.277 1.00 120.08 ? 344  PHE C CZ    1 
ATOM   6260  N  N     . ARG C 2  345  ? 499.621 -24.409 647.301 1.00 99.55  ? 345  ARG C N     1 
ATOM   6261  C  CA    . ARG C 2  345  ? 499.504 -25.222 646.096 1.00 98.13  ? 345  ARG C CA    1 
ATOM   6262  C  C     . ARG C 2  345  ? 499.267 -24.351 644.864 1.00 100.03 ? 345  ARG C C     1 
ATOM   6263  O  O     . ARG C 2  345  ? 499.837 -24.603 643.793 1.00 104.85 ? 345  ARG C O     1 
ATOM   6264  C  CB    . ARG C 2  345  ? 498.394 -26.249 646.303 1.00 98.55  ? 345  ARG C CB    1 
ATOM   6265  C  CG    . ARG C 2  345  ? 498.017 -27.069 645.109 1.00 106.00 ? 345  ARG C CG    1 
ATOM   6266  C  CD    . ARG C 2  345  ? 497.079 -28.206 645.529 1.00 115.48 ? 345  ARG C CD    1 
ATOM   6267  N  NE    . ARG C 2  345  ? 497.668 -29.136 646.511 1.00 124.04 ? 345  ARG C NE    1 
ATOM   6268  C  CZ    . ARG C 2  345  ? 497.354 -29.178 647.814 1.00 129.14 ? 345  ARG C CZ    1 
ATOM   6269  N  NH1   . ARG C 2  345  ? 496.442 -28.347 648.329 1.00 131.53 ? 345  ARG C NH1   1 
ATOM   6270  N  NH2   . ARG C 2  345  ? 497.942 -30.065 648.614 1.00 129.02 ? 345  ARG C NH2   1 
ATOM   6271  N  N     . VAL C 2  346  ? 498.438 -23.319 645.004 1.00 94.02  ? 346  VAL C N     1 
ATOM   6272  C  CA    . VAL C 2  346  ? 498.199 -22.363 643.924 1.00 92.24  ? 346  VAL C CA    1 
ATOM   6273  C  C     . VAL C 2  346  ? 499.488 -21.636 643.521 1.00 95.10  ? 346  VAL C C     1 
ATOM   6274  O  O     . VAL C 2  346  ? 499.829 -21.547 642.335 1.00 101.73 ? 346  VAL C O     1 
ATOM   6275  C  CB    . VAL C 2  346  ? 497.105 -21.375 644.340 1.00 87.16  ? 346  VAL C CB    1 
ATOM   6276  C  CG1   . VAL C 2  346  ? 497.126 -20.174 643.423 1.00 87.19  ? 346  VAL C CG1   1 
ATOM   6277  C  CG2   . VAL C 2  346  ? 495.772 -22.074 644.354 1.00 90.39  ? 346  VAL C CG2   1 
ATOM   6278  N  N     . GLY C 2  347  ? 500.189 -21.052 644.494 1.00 91.37  ? 347  GLY C N     1 
ATOM   6279  C  CA    . GLY C 2  347  ? 501.450 -20.378 644.212 1.00 91.37  ? 347  GLY C CA    1 
ATOM   6280  C  C     . GLY C 2  347  ? 502.482 -21.261 643.531 1.00 97.49  ? 347  GLY C C     1 
ATOM   6281  O  O     . GLY C 2  347  ? 503.365 -20.753 642.833 1.00 104.13 ? 347  GLY C O     1 
ATOM   6282  N  N     . LEU C 2  348  ? 502.486 -22.563 643.843 1.00 95.11  ? 348  LEU C N     1 
ATOM   6283  C  CA    . LEU C 2  348  ? 503.432 -23.478 643.212 1.00 94.49  ? 348  LEU C CA    1 
ATOM   6284  C  C     . LEU C 2  348  ? 503.106 -23.685 641.727 1.00 97.26  ? 348  LEU C C     1 
ATOM   6285  O  O     . LEU C 2  348  ? 503.998 -23.648 640.869 1.00 95.19  ? 348  LEU C O     1 
ATOM   6286  C  CB    . LEU C 2  348  ? 503.377 -24.829 643.919 1.00 91.68  ? 348  LEU C CB    1 
ATOM   6287  C  CG    . LEU C 2  348  ? 504.715 -25.464 644.246 1.00 98.95  ? 348  LEU C CG    1 
ATOM   6288  C  CD1   . LEU C 2  348  ? 505.563 -24.414 644.938 1.00 101.59 ? 348  LEU C CD1   1 
ATOM   6289  C  CD2   . LEU C 2  348  ? 504.584 -26.736 645.073 1.00 102.84 ? 348  LEU C CD2   1 
ATOM   6290  N  N     . ALA C 2  349  ? 501.820 -23.870 641.413 1.00 97.56  ? 349  ALA C N     1 
ATOM   6291  C  CA    . ALA C 2  349  ? 501.357 -24.008 640.034 1.00 97.59  ? 349  ALA C CA    1 
ATOM   6292  C  C     . ALA C 2  349  ? 501.648 -22.772 639.183 1.00 99.72  ? 349  ALA C C     1 
ATOM   6293  O  O     . ALA C 2  349  ? 501.860 -22.897 637.977 1.00 109.70 ? 349  ALA C O     1 
ATOM   6294  C  CB    . ALA C 2  349  ? 499.880 -24.362 640.009 1.00 96.53  ? 349  ALA C CB    1 
ATOM   6295  N  N     . ARG C 2  350  ? 501.503 -21.570 639.741 1.00 101.16 ? 350  ARG C N     1 
ATOM   6296  C  CA    . ARG C 2  350  ? 501.847 -20.357 638.991 1.00 113.22 ? 350  ARG C CA    1 
ATOM   6297  C  C     . ARG C 2  350  ? 503.334 -20.313 638.648 1.00 120.75 ? 350  ARG C C     1 
ATOM   6298  O  O     . ARG C 2  350  ? 503.720 -19.971 637.521 1.00 120.58 ? 350  ARG C O     1 
ATOM   6299  C  CB    . ARG C 2  350  ? 501.467 -19.116 639.788 1.00 124.00 ? 350  ARG C CB    1 
ATOM   6300  C  CG    . ARG C 2  350  ? 499.996 -18.993 640.077 1.00 131.82 ? 350  ARG C CG    1 
ATOM   6301  C  CD    . ARG C 2  350  ? 499.517 -17.598 639.720 1.00 137.61 ? 350  ARG C CD    1 
ATOM   6302  N  NE    . ARG C 2  350  ? 498.088 -17.432 639.954 1.00 138.97 ? 350  ARG C NE    1 
ATOM   6303  C  CZ    . ARG C 2  350  ? 497.562 -17.171 641.143 1.00 137.23 ? 350  ARG C CZ    1 
ATOM   6304  N  NH1   . ARG C 2  350  ? 498.354 -17.059 642.205 1.00 134.97 ? 350  ARG C NH1   1 
ATOM   6305  N  NH2   . ARG C 2  350  ? 496.249 -17.027 641.265 1.00 138.05 ? 350  ARG C NH2   1 
ATOM   6306  N  N     . LEU C 2  351  ? 504.185 -20.617 639.634 1.00 123.13 ? 351  LEU C N     1 
ATOM   6307  C  CA    . LEU C 2  351  ? 505.629 -20.734 639.416 1.00 123.65 ? 351  LEU C CA    1 
ATOM   6308  C  C     . LEU C 2  351  ? 505.935 -21.705 638.280 1.00 118.03 ? 351  LEU C C     1 
ATOM   6309  O  O     . LEU C 2  351  ? 506.890 -21.506 637.522 1.00 117.19 ? 351  LEU C O     1 
ATOM   6310  C  CB    . LEU C 2  351  ? 506.331 -21.127 640.733 1.00 121.25 ? 351  LEU C CB    1 
ATOM   6311  C  CG    . LEU C 2  351  ? 507.838 -21.404 640.887 1.00 117.23 ? 351  LEU C CG    1 
ATOM   6312  C  CD1   . LEU C 2  351  ? 508.332 -20.863 642.209 1.00 110.38 ? 351  LEU C CD1   1 
ATOM   6313  C  CD2   . LEU C 2  351  ? 508.104 -22.878 640.855 1.00 120.82 ? 351  LEU C CD2   1 
ATOM   6314  N  N     . ALA C 2  352  ? 505.151 -22.781 638.181 1.00 116.31 ? 352  ALA C N     1 
ATOM   6315  C  CA    . ALA C 2  352  ? 505.308 -23.762 637.113 1.00 121.59 ? 352  ALA C CA    1 
ATOM   6316  C  C     . ALA C 2  352  ? 505.029 -23.156 635.734 1.00 125.99 ? 352  ALA C C     1 
ATOM   6317  O  O     . ALA C 2  352  ? 505.727 -23.482 634.770 1.00 128.27 ? 352  ALA C O     1 
ATOM   6318  C  CB    . ALA C 2  352  ? 504.422 -24.975 637.383 1.00 102.58 ? 352  ALA C CB    1 
ATOM   6319  N  N     . ARG C 2  353  ? 504.022 -22.281 635.610 1.00 126.90 ? 353  ARG C N     1 
ATOM   6320  C  CA    . ARG C 2  353  ? 503.815 -21.581 634.338 1.00 141.09 ? 353  ARG C CA    1 
ATOM   6321  C  C     . ARG C 2  353  ? 505.093 -20.874 633.897 1.00 155.53 ? 353  ARG C C     1 
ATOM   6322  O  O     . ARG C 2  353  ? 505.462 -20.912 632.718 1.00 162.39 ? 353  ARG C O     1 
ATOM   6323  C  CB    . ARG C 2  353  ? 502.688 -20.541 634.442 1.00 143.08 ? 353  ARG C CB    1 
ATOM   6324  C  CG    . ARG C 2  353  ? 502.393 -19.848 633.080 1.00 150.65 ? 353  ARG C CG    1 
ATOM   6325  C  CD    . ARG C 2  353  ? 502.471 -18.282 633.082 1.00 152.20 ? 353  ARG C CD    1 
ATOM   6326  N  NE    . ARG C 2  353  ? 502.540 -17.752 631.705 1.00 156.87 ? 353  ARG C NE    1 
ATOM   6327  C  CZ    . ARG C 2  353  ? 502.495 -16.464 631.353 1.00 157.13 ? 353  ARG C CZ    1 
ATOM   6328  N  NH1   . ARG C 2  353  ? 502.375 -15.509 632.269 1.00 152.52 ? 353  ARG C NH1   1 
ATOM   6329  N  NH2   . ARG C 2  353  ? 502.570 -16.133 630.063 1.00 161.23 ? 353  ARG C NH2   1 
ATOM   6330  N  N     . GLY C 2  354  ? 505.743 -20.161 634.821 1.00 167.07 ? 354  GLY C N     1 
ATOM   6331  C  CA    . GLY C 2  354  ? 507.014 -19.530 634.499 1.00 168.30 ? 354  GLY C CA    1 
ATOM   6332  C  C     . GLY C 2  354  ? 508.083 -20.518 634.064 1.00 168.52 ? 354  GLY C C     1 
ATOM   6333  O  O     . GLY C 2  354  ? 508.890 -20.223 633.182 1.00 171.46 ? 354  GLY C O     1 
ATOM   6334  N  N     . VAL C 2  355  ? 508.155 -21.669 634.733 1.00 148.03 ? 355  VAL C N     1 
ATOM   6335  C  CA    . VAL C 2  355  ? 509.103 -22.709 634.342 1.00 140.47 ? 355  VAL C CA    1 
ATOM   6336  C  C     . VAL C 2  355  ? 508.849 -23.226 632.928 1.00 145.51 ? 355  VAL C C     1 
ATOM   6337  O  O     . VAL C 2  355  ? 509.757 -23.252 632.090 1.00 157.35 ? 355  VAL C O     1 
ATOM   6338  C  CB    . VAL C 2  355  ? 509.061 -23.858 635.355 1.00 131.95 ? 355  VAL C CB    1 
ATOM   6339  C  CG1   . VAL C 2  355  ? 509.668 -25.091 634.748 1.00 132.17 ? 355  VAL C CG1   1 
ATOM   6340  C  CG2   . VAL C 2  355  ? 509.824 -23.459 636.581 1.00 134.12 ? 355  VAL C CG2   1 
ATOM   6341  N  N     . ARG C 2  356  ? 507.617 -23.650 632.636 1.00 145.82 ? 356  ARG C N     1 
ATOM   6342  C  CA    . ARG C 2  356  ? 507.311 -24.149 631.294 1.00 149.03 ? 356  ARG C CA    1 
ATOM   6343  C  C     . ARG C 2  356  ? 507.586 -23.113 630.219 1.00 157.71 ? 356  ARG C C     1 
ATOM   6344  O  O     . ARG C 2  356  ? 508.120 -23.448 629.155 1.00 161.22 ? 356  ARG C O     1 
ATOM   6345  C  CB    . ARG C 2  356  ? 505.844 -24.571 631.214 1.00 147.19 ? 356  ARG C CB    1 
ATOM   6346  C  CG    . ARG C 2  356  ? 505.396 -25.459 632.346 1.00 147.35 ? 356  ARG C CG    1 
ATOM   6347  C  CD    . ARG C 2  356  ? 503.940 -25.898 632.233 1.00 147.95 ? 356  ARG C CD    1 
ATOM   6348  N  NE    . ARG C 2  356  ? 503.557 -26.607 633.455 1.00 149.99 ? 356  ARG C NE    1 
ATOM   6349  C  CZ    . ARG C 2  356  ? 502.920 -26.045 634.487 1.00 147.51 ? 356  ARG C CZ    1 
ATOM   6350  N  NH1   . ARG C 2  356  ? 502.574 -24.756 634.449 1.00 144.83 ? 356  ARG C NH1   1 
ATOM   6351  N  NH2   . ARG C 2  356  ? 502.629 -26.774 635.567 1.00 146.05 ? 356  ARG C NH2   1 
ATOM   6352  N  N     . GLU C 2  357  ? 507.253 -21.845 630.478 1.00 170.70 ? 357  GLU C N     1 
ATOM   6353  C  CA    . GLU C 2  357  ? 507.539 -20.845 629.461 1.00 178.63 ? 357  GLU C CA    1 
ATOM   6354  C  C     . GLU C 2  357  ? 509.034 -20.606 629.330 1.00 179.68 ? 357  GLU C C     1 
ATOM   6355  O  O     . GLU C 2  357  ? 509.511 -20.291 628.233 1.00 189.77 ? 357  GLU C O     1 
ATOM   6356  C  CB    . GLU C 2  357  ? 506.764 -19.541 629.707 1.00 184.03 ? 357  GLU C CB    1 
ATOM   6357  C  CG    . GLU C 2  357  ? 506.802 -18.641 628.436 1.00 195.90 ? 357  GLU C CG    1 
ATOM   6358  C  CD    . GLU C 2  357  ? 506.241 -17.232 628.591 1.00 199.56 ? 357  GLU C CD    1 
ATOM   6359  O  OE1   . GLU C 2  357  ? 505.482 -16.980 629.558 1.00 196.94 ? 357  GLU C OE1   1 
ATOM   6360  O  OE2   . GLU C 2  357  ? 506.540 -16.392 627.701 1.00 203.60 ? 357  GLU C OE2   1 
ATOM   6361  N  N     . ARG C 2  358  ? 509.788 -20.716 630.424 1.00 163.35 ? 358  ARG C N     1 
ATOM   6362  C  CA    . ARG C 2  358  ? 511.231 -20.540 630.308 1.00 156.74 ? 358  ARG C CA    1 
ATOM   6363  C  C     . ARG C 2  358  ? 511.959 -21.749 629.711 1.00 149.64 ? 358  ARG C C     1 
ATOM   6364  O  O     . ARG C 2  358  ? 513.113 -21.596 629.291 1.00 152.58 ? 358  ARG C O     1 
ATOM   6365  C  CB    . ARG C 2  358  ? 511.803 -20.193 631.672 1.00 148.93 ? 358  ARG C CB    1 
ATOM   6366  C  CG    . ARG C 2  358  ? 512.588 -18.894 631.718 1.00 148.47 ? 358  ARG C CG    1 
ATOM   6367  C  CD    . ARG C 2  358  ? 512.838 -18.529 633.178 1.00 142.94 ? 358  ARG C CD    1 
ATOM   6368  N  NE    . ARG C 2  358  ? 511.605 -18.122 633.834 1.00 135.18 ? 358  ARG C NE    1 
ATOM   6369  C  CZ    . ARG C 2  358  ? 511.503 -17.033 634.579 1.00 128.62 ? 358  ARG C CZ    1 
ATOM   6370  N  NH1   . ARG C 2  358  ? 512.572 -16.259 634.755 1.00 130.95 ? 358  ARG C NH1   1 
ATOM   6371  N  NH2   . ARG C 2  358  ? 510.338 -16.716 635.137 1.00 115.34 ? 358  ARG C NH2   1 
ATOM   6372  N  N     . MET C 2  359  ? 511.315 -22.932 629.654 1.00 147.60 ? 359  MET C N     1 
ATOM   6373  C  CA    . MET C 2  359  ? 511.912 -24.158 629.112 1.00 154.36 ? 359  MET C CA    1 
ATOM   6374  C  C     . MET C 2  359  ? 511.769 -24.231 627.597 1.00 168.07 ? 359  MET C C     1 
ATOM   6375  O  O     . MET C 2  359  ? 512.161 -25.234 626.984 1.00 178.69 ? 359  MET C O     1 
ATOM   6376  C  CB    . MET C 2  359  ? 511.288 -25.437 629.688 1.00 151.18 ? 359  MET C CB    1 
ATOM   6377  C  CG    . MET C 2  359  ? 511.630 -25.744 631.113 1.00 152.46 ? 359  MET C CG    1 
ATOM   6378  S  SD    . MET C 2  359  ? 511.216 -27.471 631.449 1.00 158.20 ? 359  MET C SD    1 
ATOM   6379  C  CE    . MET C 2  359  ? 509.506 -27.498 630.938 1.00 161.84 ? 359  MET C CE    1 
ATOM   6380  N  N     . LEU C 2  360  ? 511.230 -23.178 627.013 1.00 166.51 ? 360  LEU C N     1 
ATOM   6381  C  CA    . LEU C 2  360  ? 511.028 -22.990 625.603 1.00 168.73 ? 360  LEU C CA    1 
ATOM   6382  C  C     . LEU C 2  360  ? 512.002 -21.935 625.109 1.00 175.83 ? 360  LEU C C     1 
ATOM   6383  O  O     . LEU C 2  360  ? 512.863 -22.249 624.277 1.00 186.87 ? 360  LEU C O     1 
ATOM   6384  C  CB    . LEU C 2  360  ? 509.552 -22.624 625.376 1.00 160.64 ? 360  LEU C CB    1 
ATOM   6385  C  CG    . LEU C 2  360  ? 508.655 -23.882 625.223 1.00 156.61 ? 360  LEU C CG    1 
ATOM   6386  C  CD1   . LEU C 2  360  ? 508.761 -24.900 626.379 1.00 151.59 ? 360  LEU C CD1   1 
ATOM   6387  C  CD2   . LEU C 2  360  ? 507.167 -23.561 625.005 1.00 154.71 ? 360  LEU C CD2   1 
ATOM   6388  N  N     . MET C 2  361  ? 511.936 -20.715 625.656 1.00 175.82 ? 361  MET C N     1 
ATOM   6389  C  CA    . MET C 2  361  ? 512.823 -19.625 625.265 1.00 183.61 ? 361  MET C CA    1 
ATOM   6390  C  C     . MET C 2  361  ? 514.261 -19.937 625.741 1.00 183.94 ? 361  MET C C     1 
ATOM   6391  O  O     . MET C 2  361  ? 514.540 -21.004 626.306 1.00 183.62 ? 361  MET C O     1 
ATOM   6392  C  CB    . MET C 2  361  ? 512.317 -18.313 625.868 1.00 186.78 ? 361  MET C CB    1 
ATOM   6393  C  CG    . MET C 2  361  ? 510.824 -18.285 626.151 1.00 187.72 ? 361  MET C CG    1 
ATOM   6394  S  SD    . MET C 2  361  ? 509.825 -18.553 624.667 1.00 192.50 ? 361  MET C SD    1 
ATOM   6395  C  CE    . MET C 2  361  ? 510.303 -17.150 623.675 1.00 195.04 ? 361  MET C CE    1 
ATOM   6396  N  N     . GLY C 2  362  ? 515.187 -18.995 625.495 1.00 181.06 ? 362  GLY C N     1 
ATOM   6397  C  CA    . GLY C 2  362  ? 516.614 -19.054 625.843 1.00 181.50 ? 362  GLY C CA    1 
ATOM   6398  C  C     . GLY C 2  362  ? 517.342 -20.377 626.045 1.00 176.72 ? 362  GLY C C     1 
ATOM   6399  O  O     . GLY C 2  362  ? 517.321 -20.927 627.147 1.00 171.38 ? 362  GLY C O     1 
ATOM   6400  N  N     . SER C 2  363  ? 518.112 -20.788 625.023 1.00 193.22 ? 363  SER C N     1 
ATOM   6401  C  CA    . SER C 2  363  ? 518.969 -21.974 624.871 1.00 203.91 ? 363  SER C CA    1 
ATOM   6402  C  C     . SER C 2  363  ? 518.445 -23.159 625.673 1.00 218.49 ? 363  SER C C     1 
ATOM   6403  O  O     . SER C 2  363  ? 518.407 -23.115 626.907 1.00 215.28 ? 363  SER C O     1 
ATOM   6404  C  CB    . SER C 2  363  ? 520.414 -21.669 625.312 1.00 194.60 ? 363  SER C CB    1 
ATOM   6405  O  OG    . SER C 2  363  ? 520.477 -21.093 626.615 1.00 184.01 ? 363  SER C OG    1 
ATOM   6406  N  N     . GLU C 2  364  ? 518.183 -24.280 624.990 1.00 240.18 ? 364  GLU C N     1 
ATOM   6407  C  CA    . GLU C 2  364  ? 517.667 -25.463 625.675 1.00 244.52 ? 364  GLU C CA    1 
ATOM   6408  C  C     . GLU C 2  364  ? 518.709 -26.225 626.483 1.00 250.15 ? 364  GLU C C     1 
ATOM   6409  O  O     . GLU C 2  364  ? 518.341 -27.144 627.220 1.00 252.62 ? 364  GLU C O     1 
ATOM   6410  C  CB    . GLU C 2  364  ? 516.988 -26.407 624.677 1.00 247.16 ? 364  GLU C CB    1 
ATOM   6411  C  CG    . GLU C 2  364  ? 515.591 -26.859 625.131 1.00 242.54 ? 364  GLU C CG    1 
ATOM   6412  C  CD    . GLU C 2  364  ? 514.963 -27.872 624.198 1.00 243.69 ? 364  GLU C CD    1 
ATOM   6413  O  OE1   . GLU C 2  364  ? 514.083 -28.641 624.645 1.00 239.72 ? 364  GLU C OE1   1 
ATOM   6414  O  OE2   . GLU C 2  364  ? 515.362 -27.902 623.018 1.00 248.46 ? 364  GLU C OE2   1 
ATOM   6415  N  N     . ASP C 2  365  ? 519.985 -25.876 626.358 1.00 243.79 ? 365  ASP C N     1 
ATOM   6416  C  CA    . ASP C 2  365  ? 521.088 -26.553 627.030 1.00 234.88 ? 365  ASP C CA    1 
ATOM   6417  C  C     . ASP C 2  365  ? 521.586 -25.796 628.252 1.00 224.07 ? 365  ASP C C     1 
ATOM   6418  O  O     . ASP C 2  365  ? 521.624 -26.341 629.363 1.00 224.03 ? 365  ASP C O     1 
ATOM   6419  C  CB    . ASP C 2  365  ? 522.258 -26.872 626.106 1.00 236.91 ? 365  ASP C CB    1 
ATOM   6420  C  CG    . ASP C 2  365  ? 523.177 -27.901 626.732 1.00 236.74 ? 365  ASP C CG    1 
ATOM   6421  O  OD1   . ASP C 2  365  ? 522.959 -29.107 626.493 1.00 236.29 ? 365  ASP C OD1   1 
ATOM   6422  O  OD2   . ASP C 2  365  ? 524.061 -27.517 627.523 1.00 236.81 ? 365  ASP C OD2   1 
ATOM   6423  N  N     . SER C 2  366  ? 521.999 -24.545 628.057 1.00 210.51 ? 366  SER C N     1 
ATOM   6424  C  CA    . SER C 2  366  ? 522.613 -23.777 629.127 1.00 198.71 ? 366  SER C CA    1 
ATOM   6425  C  C     . SER C 2  366  ? 521.557 -23.059 629.952 1.00 186.68 ? 366  SER C C     1 
ATOM   6426  O  O     . SER C 2  366  ? 521.283 -21.867 629.806 1.00 185.74 ? 366  SER C O     1 
ATOM   6427  C  CB    . SER C 2  366  ? 523.566 -22.769 628.500 1.00 198.65 ? 366  SER C CB    1 
ATOM   6428  O  OG    . SER C 2  366  ? 523.907 -21.760 629.419 1.00 197.37 ? 366  SER C OG    1 
ATOM   6429  N  N     . LEU C 2  367  ? 520.956 -23.857 630.842 1.00 177.29 ? 367  LEU C N     1 
ATOM   6430  C  CA    . LEU C 2  367  ? 519.980 -23.466 631.853 1.00 169.51 ? 367  LEU C CA    1 
ATOM   6431  C  C     . LEU C 2  367  ? 520.142 -24.403 633.044 1.00 166.77 ? 367  LEU C C     1 
ATOM   6432  O  O     . LEU C 2  367  ? 520.307 -25.612 632.837 1.00 175.57 ? 367  LEU C O     1 
ATOM   6433  C  CB    . LEU C 2  367  ? 518.520 -23.480 631.362 1.00 162.84 ? 367  LEU C CB    1 
ATOM   6434  C  CG    . LEU C 2  367  ? 517.996 -22.429 630.376 1.00 159.36 ? 367  LEU C CG    1 
ATOM   6435  C  CD1   . LEU C 2  367  ? 516.550 -22.724 629.966 1.00 151.79 ? 367  LEU C CD1   1 
ATOM   6436  C  CD2   . LEU C 2  367  ? 518.111 -21.041 630.973 1.00 156.44 ? 367  LEU C CD2   1 
ATOM   6437  N  N     . THR C 2  368  ? 520.163 -23.839 634.266 1.00 161.21 ? 368  THR C N     1 
ATOM   6438  C  CA    . THR C 2  368  ? 520.131 -24.546 635.546 1.00 153.13 ? 368  THR C CA    1 
ATOM   6439  C  C     . THR C 2  368  ? 518.741 -24.436 636.148 1.00 147.07 ? 368  THR C C     1 
ATOM   6440  O  O     . THR C 2  368  ? 517.888 -23.720 635.616 1.00 137.89 ? 368  THR C O     1 
ATOM   6441  C  CB    . THR C 2  368  ? 521.165 -23.961 636.521 1.00 147.52 ? 368  THR C CB    1 
ATOM   6442  O  OG1   . THR C 2  368  ? 520.982 -22.543 636.641 1.00 145.45 ? 368  THR C OG1   1 
ATOM   6443  C  CG2   . THR C 2  368  ? 522.583 -24.279 636.095 1.00 153.65 ? 368  THR C CG2   1 
ATOM   6444  N  N     . PRO C 2  369  ? 518.467 -25.113 637.281 1.00 148.14 ? 369  PRO C N     1 
ATOM   6445  C  CA    . PRO C 2  369  ? 517.205 -24.834 637.981 1.00 141.77 ? 369  PRO C CA    1 
ATOM   6446  C  C     . PRO C 2  369  ? 517.173 -23.471 638.622 1.00 139.42 ? 369  PRO C C     1 
ATOM   6447  O  O     . PRO C 2  369  ? 516.089 -22.888 638.719 1.00 126.53 ? 369  PRO C O     1 
ATOM   6448  C  CB    . PRO C 2  369  ? 517.139 -25.931 639.052 1.00 132.25 ? 369  PRO C CB    1 
ATOM   6449  C  CG    . PRO C 2  369  ? 517.891 -27.026 638.513 1.00 138.87 ? 369  PRO C CG    1 
ATOM   6450  C  CD    . PRO C 2  369  ? 519.048 -26.380 637.765 1.00 149.48 ? 369  PRO C CD    1 
ATOM   6451  N  N     . ALA C 2  370  ? 518.321 -22.923 639.040 1.00 146.57 ? 370  ALA C N     1 
ATOM   6452  C  CA    . ALA C 2  370  ? 518.270 -21.608 639.669 1.00 150.70 ? 370  ALA C CA    1 
ATOM   6453  C  C     . ALA C 2  370  ? 517.848 -20.512 638.694 1.00 152.74 ? 370  ALA C C     1 
ATOM   6454  O  O     . ALA C 2  370  ? 517.087 -19.607 639.070 1.00 149.20 ? 370  ALA C O     1 
ATOM   6455  C  CB    . ALA C 2  370  ? 519.636 -21.287 640.284 1.00 157.80 ? 370  ALA C CB    1 
ATOM   6456  N  N     . LYS C 2  371  ? 518.235 -20.626 637.425 1.00 154.14 ? 371  LYS C N     1 
ATOM   6457  C  CA    . LYS C 2  371  ? 517.826 -19.613 636.460 1.00 152.76 ? 371  LYS C CA    1 
ATOM   6458  C  C     . LYS C 2  371  ? 516.397 -19.888 636.002 1.00 152.90 ? 371  LYS C C     1 
ATOM   6459  O  O     . LYS C 2  371  ? 515.652 -18.960 635.657 1.00 152.35 ? 371  LYS C O     1 
ATOM   6460  C  CB    . LYS C 2  371  ? 518.850 -19.398 635.336 1.00 151.64 ? 371  LYS C CB    1 
ATOM   6461  C  CG    . LYS C 2  371  ? 519.608 -20.500 634.627 1.00 152.37 ? 371  LYS C CG    1 
ATOM   6462  C  CD    . LYS C 2  371  ? 520.352 -19.722 633.484 1.00 155.77 ? 371  LYS C CD    1 
ATOM   6463  C  CE    . LYS C 2  371  ? 521.300 -20.474 632.537 1.00 156.76 ? 371  LYS C CE    1 
ATOM   6464  N  NZ    . LYS C 2  371  ? 522.569 -21.064 633.058 1.00 158.74 ? 371  LYS C NZ    1 
ATOM   6465  N  N     . LEU C 2  372  ? 515.994 -21.155 636.076 1.00 149.67 ? 372  LEU C N     1 
ATOM   6466  C  CA    . LEU C 2  372  ? 514.713 -21.638 635.585 1.00 143.29 ? 372  LEU C CA    1 
ATOM   6467  C  C     . LEU C 2  372  ? 513.553 -21.279 636.512 1.00 135.36 ? 372  LEU C C     1 
ATOM   6468  O  O     . LEU C 2  372  ? 512.411 -21.217 636.039 1.00 127.09 ? 372  LEU C O     1 
ATOM   6469  C  CB    . LEU C 2  372  ? 514.801 -23.156 635.413 1.00 144.94 ? 372  LEU C CB    1 
ATOM   6470  C  CG    . LEU C 2  372  ? 513.871 -23.916 634.475 1.00 144.18 ? 372  LEU C CG    1 
ATOM   6471  C  CD1   . LEU C 2  372  ? 513.674 -23.130 633.205 1.00 146.91 ? 372  LEU C CD1   1 
ATOM   6472  C  CD2   . LEU C 2  372  ? 514.452 -25.291 634.166 1.00 144.20 ? 372  LEU C CD2   1 
ATOM   6473  N  N     . VAL C 2  373  ? 513.798 -21.097 637.819 1.00 133.90 ? 373  VAL C N     1 
ATOM   6474  C  CA    . VAL C 2  373  ? 512.742 -20.903 638.825 1.00 129.09 ? 373  VAL C CA    1 
ATOM   6475  C  C     . VAL C 2  373  ? 512.692 -19.424 639.198 1.00 129.73 ? 373  VAL C C     1 
ATOM   6476  O  O     . VAL C 2  373  ? 513.717 -18.831 639.558 1.00 138.54 ? 373  VAL C O     1 
ATOM   6477  C  CB    . VAL C 2  373  ? 512.956 -21.765 640.081 1.00 119.24 ? 373  VAL C CB    1 
ATOM   6478  C  CG1   . VAL C 2  373  ? 512.154 -21.195 641.189 1.00 110.82 ? 373  VAL C CG1   1 
ATOM   6479  C  CG2   . VAL C 2  373  ? 512.497 -23.182 639.849 1.00 114.96 ? 373  VAL C CG2   1 
ATOM   6480  N  N     . ASN C 2  374  ? 511.510 -18.823 639.088 1.00 126.27 ? 374  ASN C N     1 
ATOM   6481  C  CA    . ASN C 2  374  ? 511.240 -17.492 639.617 1.00 128.26 ? 374  ASN C CA    1 
ATOM   6482  C  C     . ASN C 2  374  ? 510.253 -17.682 640.749 1.00 129.67 ? 374  ASN C C     1 
ATOM   6483  O  O     . ASN C 2  374  ? 509.151 -18.185 640.525 1.00 129.12 ? 374  ASN C O     1 
ATOM   6484  C  CB    . ASN C 2  374  ? 510.623 -16.544 638.591 1.00 125.89 ? 374  ASN C CB    1 
ATOM   6485  C  CG    . ASN C 2  374  ? 510.456 -15.132 639.144 1.00 123.23 ? 374  ASN C CG    1 
ATOM   6486  O  OD1   . ASN C 2  374  ? 510.961 -14.824 640.214 1.00 124.19 ? 374  ASN C OD1   1 
ATOM   6487  N  ND2   . ASN C 2  374  ? 509.645 -14.321 638.488 1.00 121.83 ? 374  ASN C ND2   1 
ATOM   6488  N  N     . SER C 2  375  ? 510.637 -17.281 641.956 1.00 137.54 ? 375  SER C N     1 
ATOM   6489  C  CA    . SER C 2  375  ? 509.818 -17.579 643.123 1.00 137.56 ? 375  SER C CA    1 
ATOM   6490  C  C     . SER C 2  375  ? 508.759 -16.523 643.407 1.00 132.54 ? 375  SER C C     1 
ATOM   6491  O  O     . SER C 2  375  ? 507.889 -16.766 644.249 1.00 124.20 ? 375  SER C O     1 
ATOM   6492  C  CB    . SER C 2  375  ? 510.723 -17.750 644.354 1.00 142.58 ? 375  SER C CB    1 
ATOM   6493  O  OG    . SER C 2  375  ? 511.312 -16.518 644.749 1.00 145.73 ? 375  SER C OG    1 
ATOM   6494  N  N     . ARG C 2  376  ? 508.778 -15.399 642.682 1.00 136.07 ? 376  ARG C N     1 
ATOM   6495  C  CA    . ARG C 2  376  ? 507.806 -14.323 642.891 1.00 129.93 ? 376  ARG C CA    1 
ATOM   6496  C  C     . ARG C 2  376  ? 506.361 -14.794 642.949 1.00 118.68 ? 376  ARG C C     1 
ATOM   6497  O  O     . ARG C 2  376  ? 505.662 -14.424 643.905 1.00 114.89 ? 376  ARG C O     1 
ATOM   6498  C  CB    . ARG C 2  376  ? 507.960 -13.274 641.779 1.00 137.53 ? 376  ARG C CB    1 
ATOM   6499  C  CG    . ARG C 2  376  ? 509.308 -12.586 641.734 1.00 144.12 ? 376  ARG C CG    1 
ATOM   6500  C  CD    . ARG C 2  376  ? 509.695 -12.141 643.142 1.00 140.67 ? 376  ARG C CD    1 
ATOM   6501  N  NE    . ARG C 2  376  ? 510.904 -11.328 643.180 1.00 142.52 ? 376  ARG C NE    1 
ATOM   6502  C  CZ    . ARG C 2  376  ? 511.524 -10.990 644.302 1.00 142.24 ? 376  ARG C CZ    1 
ATOM   6503  N  NH1   . ARG C 2  376  ? 511.047 -11.408 645.461 1.00 141.62 ? 376  ARG C NH1   1 
ATOM   6504  N  NH2   . ARG C 2  376  ? 512.613 -10.237 644.272 1.00 144.09 ? 376  ARG C NH2   1 
ATOM   6505  N  N     . PRO C 2  377  ? 505.867 -15.621 642.018 1.00 110.59 ? 377  PRO C N     1 
ATOM   6506  C  CA    . PRO C 2  377  ? 504.488 -16.120 642.145 1.00 107.10 ? 377  PRO C CA    1 
ATOM   6507  C  C     . PRO C 2  377  ? 504.221 -16.864 643.437 1.00 101.13 ? 377  PRO C C     1 
ATOM   6508  O  O     . PRO C 2  377  ? 503.096 -16.804 643.951 1.00 103.20 ? 377  PRO C O     1 
ATOM   6509  C  CB    . PRO C 2  377  ? 504.332 -17.026 640.912 1.00 106.30 ? 377  PRO C CB    1 
ATOM   6510  C  CG    . PRO C 2  377  ? 505.666 -17.368 640.547 1.00 109.48 ? 377  PRO C CG    1 
ATOM   6511  C  CD    . PRO C 2  377  ? 506.496 -16.162 640.808 1.00 113.88 ? 377  PRO C CD    1 
ATOM   6512  N  N     . LEU C 2  378  ? 505.174 -17.659 643.913 1.00 99.81  ? 378  LEU C N     1 
ATOM   6513  C  CA    . LEU C 2  378  ? 504.939 -18.372 645.159 1.00 104.59 ? 378  LEU C CA    1 
ATOM   6514  C  C     . LEU C 2  378  ? 504.906 -17.403 646.351 1.00 99.51  ? 378  LEU C C     1 
ATOM   6515  O  O     . LEU C 2  378  ? 504.010 -17.475 647.194 1.00 100.66 ? 378  LEU C O     1 
ATOM   6516  C  CB    . LEU C 2  378  ? 505.965 -19.480 645.346 1.00 106.54 ? 378  LEU C CB    1 
ATOM   6517  C  CG    . LEU C 2  378  ? 505.676 -20.279 646.619 1.00 104.64 ? 378  LEU C CG    1 
ATOM   6518  C  CD1   . LEU C 2  378  ? 504.302 -20.805 646.503 1.00 105.56 ? 378  LEU C CD1   1 
ATOM   6519  C  CD2   . LEU C 2  378  ? 506.579 -21.458 646.722 1.00 109.19 ? 378  LEU C CD2   1 
ATOM   6520  N  N     . GLU C 2  379  ? 505.913 -16.529 646.469 1.00 107.13 ? 379  GLU C N     1 
ATOM   6521  C  CA    . GLU C 2  379  ? 505.941 -15.548 647.556 1.00 110.47 ? 379  GLU C CA    1 
ATOM   6522  C  C     . GLU C 2  379  ? 504.689 -14.687 647.596 1.00 112.02 ? 379  GLU C C     1 
ATOM   6523  O  O     . GLU C 2  379  ? 504.148 -14.420 648.681 1.00 113.36 ? 379  GLU C O     1 
ATOM   6524  C  CB    . GLU C 2  379  ? 507.132 -14.604 647.419 1.00 120.11 ? 379  GLU C CB    1 
ATOM   6525  C  CG    . GLU C 2  379  ? 508.496 -15.208 647.415 1.00 131.94 ? 379  GLU C CG    1 
ATOM   6526  C  CD    . GLU C 2  379  ? 509.548 -14.142 647.201 1.00 141.47 ? 379  GLU C CD    1 
ATOM   6527  O  OE1   . GLU C 2  379  ? 510.102 -14.056 646.078 1.00 146.93 ? 379  GLU C OE1   1 
ATOM   6528  O  OE2   . GLU C 2  379  ? 509.794 -13.373 648.155 1.00 144.17 ? 379  GLU C OE2   1 
ATOM   6529  N  N     . ALA C 2  380  ? 504.205 -14.252 646.427 1.00 110.75 ? 380  ALA C N     1 
ATOM   6530  C  CA    . ALA C 2  380  ? 503.031 -13.381 646.389 1.00 112.98 ? 380  ALA C CA    1 
ATOM   6531  C  C     . ALA C 2  380  ? 501.779 -14.112 646.842 1.00 111.79 ? 380  ALA C C     1 
ATOM   6532  O  O     . ALA C 2  380  ? 500.989 -13.569 647.621 1.00 111.50 ? 380  ALA C O     1 
ATOM   6533  C  CB    . ALA C 2  380  ? 502.820 -12.809 644.993 1.00 109.40 ? 380  ALA C CB    1 
ATOM   6534  N  N     . ALA C 2  381  ? 501.604 -15.355 646.391 1.00 113.23 ? 381  ALA C N     1 
ATOM   6535  C  CA    . ALA C 2  381  ? 500.448 -16.150 646.796 1.00 105.91 ? 381  ALA C CA    1 
ATOM   6536  C  C     . ALA C 2  381  ? 500.389 -16.342 648.300 1.00 102.93 ? 381  ALA C C     1 
ATOM   6537  O  O     . ALA C 2  381  ? 499.303 -16.295 648.888 1.00 105.57 ? 381  ALA C O     1 
ATOM   6538  C  CB    . ALA C 2  381  ? 500.481 -17.511 646.107 1.00 111.35 ? 381  ALA C CB    1 
ATOM   6539  N  N     . ILE C 2  382  ? 501.526 -16.606 648.939 1.00 100.35 ? 382  ILE C N     1 
ATOM   6540  C  CA    . ILE C 2  382  ? 501.500 -16.785 650.383 1.00 102.88 ? 382  ILE C CA    1 
ATOM   6541  C  C     . ILE C 2  382  ? 501.244 -15.447 651.075 1.00 106.69 ? 382  ILE C C     1 
ATOM   6542  O  O     . ILE C 2  382  ? 500.487 -15.366 652.051 1.00 105.03 ? 382  ILE C O     1 
ATOM   6543  C  CB    . ILE C 2  382  ? 502.798 -17.441 650.856 1.00 103.21 ? 382  ILE C CB    1 
ATOM   6544  C  CG1   . ILE C 2  382  ? 502.952 -18.826 650.232 1.00 105.28 ? 382  ILE C CG1   1 
ATOM   6545  C  CG2   . ILE C 2  382  ? 502.671 -17.700 652.320 1.00 100.63 ? 382  ILE C CG2   1 
ATOM   6546  C  CD1   . ILE C 2  382  ? 501.870 -19.784 650.594 1.00 105.07 ? 382  ILE C CD1   1 
ATOM   6547  N  N     . ARG C 2  383  ? 501.926 -14.388 650.623 1.00 112.96 ? 383  ARG C N     1 
ATOM   6548  C  CA    . ARG C 2  383  ? 501.730 -13.047 651.183 1.00 117.21 ? 383  ARG C CA    1 
ATOM   6549  C  C     . ARG C 2  383  ? 500.308 -12.574 650.993 1.00 114.92 ? 383  ARG C C     1 
ATOM   6550  O  O     . ARG C 2  383  ? 499.766 -11.846 651.819 1.00 108.11 ? 383  ARG C O     1 
ATOM   6551  C  CB    . ARG C 2  383  ? 502.703 -12.056 650.559 1.00 124.65 ? 383  ARG C CB    1 
ATOM   6552  C  CG    . ARG C 2  383  ? 502.642 -10.647 651.155 1.00 128.31 ? 383  ARG C CG    1 
ATOM   6553  C  CD    . ARG C 2  383  ? 503.790 -9.793  650.643 1.00 135.52 ? 383  ARG C CD    1 
ATOM   6554  N  NE    . ARG C 2  383  ? 503.941 -9.878  649.195 1.00 144.77 ? 383  ARG C NE    1 
ATOM   6555  C  CZ    . ARG C 2  383  ? 504.977 -10.478 648.601 1.00 150.55 ? 383  ARG C CZ    1 
ATOM   6556  N  NH1   . ARG C 2  383  ? 505.948 -11.027 649.337 1.00 148.88 ? 383  ARG C NH1   1 
ATOM   6557  N  NH2   . ARG C 2  383  ? 505.054 -10.526 647.273 1.00 152.69 ? 383  ARG C NH2   1 
ATOM   6558  N  N     . GLU C 2  384  ? 499.703 -12.976 649.895 1.00 126.33 ? 384  GLU C N     1 
ATOM   6559  C  CA    . GLU C 2  384  ? 498.325 -12.624 649.609 1.00 129.42 ? 384  GLU C CA    1 
ATOM   6560  C  C     . GLU C 2  384  ? 497.397 -13.287 650.624 1.00 116.95 ? 384  GLU C C     1 
ATOM   6561  O  O     . GLU C 2  384  ? 496.490 -12.641 651.171 1.00 114.91 ? 384  GLU C O     1 
ATOM   6562  C  CB    . GLU C 2  384  ? 498.016 -13.068 648.175 1.00 142.00 ? 384  GLU C CB    1 
ATOM   6563  C  CG    . GLU C 2  384  ? 496.709 -12.640 647.592 1.00 152.23 ? 384  GLU C CG    1 
ATOM   6564  C  CD    . GLU C 2  384  ? 496.804 -11.202 647.133 1.00 162.25 ? 384  GLU C CD    1 
ATOM   6565  O  OE1   . GLU C 2  384  ? 497.073 -10.325 647.979 1.00 165.09 ? 384  GLU C OE1   1 
ATOM   6566  O  OE2   . GLU C 2  384  ? 496.664 -10.951 645.915 1.00 168.21 ? 384  GLU C OE2   1 
ATOM   6567  N  N     . PHE C 2  385  ? 497.624 -14.580 650.888 1.00 100.40 ? 385  PHE C N     1 
ATOM   6568  C  CA    . PHE C 2  385  ? 496.836 -15.257 651.897 1.00 92.70  ? 385  PHE C CA    1 
ATOM   6569  C  C     . PHE C 2  385  ? 496.979 -14.566 653.239 1.00 88.93  ? 385  PHE C C     1 
ATOM   6570  O  O     . PHE C 2  385  ? 495.985 -14.391 653.960 1.00 93.53  ? 385  PHE C O     1 
ATOM   6571  C  CB    . PHE C 2  385  ? 497.273 -16.744 651.949 1.00 88.71  ? 385  PHE C CB    1 
ATOM   6572  C  CG    . PHE C 2  385  ? 496.668 -17.563 653.024 1.00 83.27  ? 385  PHE C CG    1 
ATOM   6573  C  CD1   . PHE C 2  385  ? 495.363 -18.031 652.866 1.00 83.84  ? 385  PHE C CD1   1 
ATOM   6574  C  CD2   . PHE C 2  385  ? 497.384 -17.991 654.097 1.00 83.48  ? 385  PHE C CD2   1 
ATOM   6575  C  CE1   . PHE C 2  385  ? 494.767 -18.866 653.809 1.00 80.55  ? 385  PHE C CE1   1 
ATOM   6576  C  CE2   . PHE C 2  385  ? 496.798 -18.855 655.042 1.00 83.47  ? 385  PHE C CE2   1 
ATOM   6577  C  CZ    . PHE C 2  385  ? 495.472 -19.286 654.885 1.00 80.26  ? 385  PHE C CZ    1 
ATOM   6578  N  N     . PHE C 2  386  ? 498.192 -14.331 653.667 1.00 87.41  ? 386  PHE C N     1 
ATOM   6579  C  CA    . PHE C 2  386  ? 498.387 -13.749 654.985 1.00 90.41  ? 386  PHE C CA    1 
ATOM   6580  C  C     . PHE C 2  386  ? 498.031 -12.283 655.124 1.00 100.95 ? 386  PHE C C     1 
ATOM   6581  O  O     . PHE C 2  386  ? 497.383 -11.925 656.106 1.00 108.25 ? 386  PHE C O     1 
ATOM   6582  C  CB    . PHE C 2  386  ? 499.798 -13.957 655.436 1.00 94.17  ? 386  PHE C CB    1 
ATOM   6583  C  CG    . PHE C 2  386  ? 499.971 -15.310 656.001 1.00 95.40  ? 386  PHE C CG    1 
ATOM   6584  C  CD1   . PHE C 2  386  ? 500.388 -16.342 655.163 1.00 98.58  ? 386  PHE C CD1   1 
ATOM   6585  C  CD2   . PHE C 2  386  ? 499.690 -15.582 657.322 1.00 92.59  ? 386  PHE C CD2   1 
ATOM   6586  C  CE1   . PHE C 2  386  ? 500.510 -17.604 655.631 1.00 95.83  ? 386  PHE C CE1   1 
ATOM   6587  C  CE2   . PHE C 2  386  ? 499.805 -16.831 657.812 1.00 91.47  ? 386  PHE C CE2   1 
ATOM   6588  C  CZ    . PHE C 2  386  ? 500.219 -17.865 656.974 1.00 89.89  ? 386  PHE C CZ    1 
ATOM   6589  N  N     . SER C 2  387  ? 498.351 -11.401 654.155 1.00 115.13 ? 387  SER C N     1 
ATOM   6590  C  CA    . SER C 2  387  ? 498.006 -9.988  654.339 1.00 123.09 ? 387  SER C CA    1 
ATOM   6591  C  C     . SER C 2  387  ? 496.545 -9.688  654.047 1.00 115.35 ? 387  SER C C     1 
ATOM   6592  O  O     . SER C 2  387  ? 495.915 -8.970  654.814 1.00 112.34 ? 387  SER C O     1 
ATOM   6593  C  CB    . SER C 2  387  ? 498.914 -9.113  653.460 1.00 134.55 ? 387  SER C CB    1 
ATOM   6594  O  OG    . SER C 2  387  ? 498.410 -7.772  653.300 1.00 140.68 ? 387  SER C OG    1 
ATOM   6595  N  N     . ARG C 2  388  ? 496.050 -10.057 652.879 1.00 107.44 ? 388  ARG C N     1 
ATOM   6596  C  CA    . ARG C 2  388  ? 494.715 -9.630  652.476 1.00 106.12 ? 388  ARG C CA    1 
ATOM   6597  C  C     . ARG C 2  388  ? 493.632 -10.693 652.581 1.00 98.52  ? 388  ARG C C     1 
ATOM   6598  O  O     . ARG C 2  388  ? 492.458 -10.351 652.399 1.00 93.04  ? 388  ARG C O     1 
ATOM   6599  C  CB    . ARG C 2  388  ? 494.726 -8.925  651.101 1.00 115.89 ? 388  ARG C CB    1 
ATOM   6600  C  CG    . ARG C 2  388  ? 495.184 -7.467  651.279 1.00 122.65 ? 388  ARG C CG    1 
ATOM   6601  C  CD    . ARG C 2  388  ? 495.625 -6.787  650.038 1.00 133.37 ? 388  ARG C CD    1 
ATOM   6602  N  NE    . ARG C 2  388  ? 496.863 -7.362  649.554 1.00 143.74 ? 388  ARG C NE    1 
ATOM   6603  C  CZ    . ARG C 2  388  ? 498.048 -7.046  650.072 1.00 151.33 ? 388  ARG C CZ    1 
ATOM   6604  N  NH1   . ARG C 2  388  ? 498.115 -6.176  651.082 1.00 151.59 ? 388  ARG C NH1   1 
ATOM   6605  N  NH2   . ARG C 2  388  ? 499.161 -7.593  649.585 1.00 155.31 ? 388  ARG C NH2   1 
ATOM   6606  N  N     . SER C 2  389  ? 493.935 -11.927 652.989 1.00 98.31  ? 389  SER C N     1 
ATOM   6607  C  CA    . SER C 2  389  ? 492.802 -12.856 653.036 1.00 104.20 ? 389  SER C CA    1 
ATOM   6608  C  C     . SER C 2  389  ? 491.832 -12.417 654.110 1.00 113.39 ? 389  SER C C     1 
ATOM   6609  O  O     . SER C 2  389  ? 492.190 -11.729 655.070 1.00 121.73 ? 389  SER C O     1 
ATOM   6610  C  CB    . SER C 2  389  ? 493.219 -14.293 653.387 1.00 89.80  ? 389  SER C CB    1 
ATOM   6611  O  OG    . SER C 2  389  ? 492.102 -15.160 653.601 1.00 74.78  ? 389  SER C OG    1 
ATOM   6612  N  N     . GLN C 2  390  ? 490.588 -12.827 653.972 1.00 122.06 ? 390  GLN C N     1 
ATOM   6613  C  CA    . GLN C 2  390  ? 489.681 -12.424 655.004 1.00 129.90 ? 390  GLN C CA    1 
ATOM   6614  C  C     . GLN C 2  390  ? 489.238 -13.680 655.742 1.00 129.97 ? 390  GLN C C     1 
ATOM   6615  O  O     . GLN C 2  390  ? 488.127 -14.177 655.603 1.00 137.01 ? 390  GLN C O     1 
ATOM   6616  C  CB    . GLN C 2  390  ? 488.528 -11.544 654.480 1.00 141.65 ? 390  GLN C CB    1 
ATOM   6617  C  CG    . GLN C 2  390  ? 487.582 -11.135 655.621 1.00 156.58 ? 390  GLN C CG    1 
ATOM   6618  C  CD    . GLN C 2  390  ? 486.444 -10.184 655.221 1.00 166.42 ? 390  GLN C CD    1 
ATOM   6619  O  OE1   . GLN C 2  390  ? 486.337 -9.751  654.062 1.00 170.78 ? 390  GLN C OE1   1 
ATOM   6620  N  NE2   . GLN C 2  390  ? 485.643 -9.781  656.218 1.00 165.19 ? 390  GLN C NE2   1 
ATOM   6621  N  N     . LEU C 2  391  ? 490.207 -14.228 656.462 1.00 107.98 ? 391  LEU C N     1 
ATOM   6622  C  CA    . LEU C 2  391  ? 490.209 -15.394 657.339 1.00 90.32  ? 391  LEU C CA    1 
ATOM   6623  C  C     . LEU C 2  391  ? 491.530 -15.240 658.070 1.00 87.87  ? 391  LEU C C     1 
ATOM   6624  O  O     . LEU C 2  391  ? 491.810 -15.921 659.075 1.00 83.09  ? 391  LEU C O     1 
ATOM   6625  C  CB    . LEU C 2  391  ? 490.113 -16.779 656.713 1.00 80.40  ? 391  LEU C CB    1 
ATOM   6626  C  CG    . LEU C 2  391  ? 488.837 -17.349 656.144 1.00 77.44  ? 391  LEU C CG    1 
ATOM   6627  C  CD1   . LEU C 2  391  ? 489.140 -18.733 655.589 1.00 74.30  ? 391  LEU C CD1   1 
ATOM   6628  C  CD2   . LEU C 2  391  ? 487.758 -17.401 657.210 1.00 79.14  ? 391  LEU C CD2   1 
ATOM   6629  N  N     . SER C 2  392  ? 492.373 -14.356 657.526 1.00 86.22  ? 392  SER C N     1 
ATOM   6630  C  CA    . SER C 2  392  ? 493.585 -13.966 658.210 1.00 82.86  ? 392  SER C CA    1 
ATOM   6631  C  C     . SER C 2  392  ? 493.128 -12.700 658.889 1.00 77.11  ? 392  SER C C     1 
ATOM   6632  O  O     . SER C 2  392  ? 492.954 -11.680 658.208 1.00 70.85  ? 392  SER C O     1 
ATOM   6633  C  CB    . SER C 2  392  ? 494.761 -13.701 657.276 1.00 84.57  ? 392  SER C CB    1 
ATOM   6634  O  OG    . SER C 2  392  ? 495.910 -13.357 658.046 1.00 84.37  ? 392  SER C OG    1 
ATOM   6635  N  N     . GLN C 2  393  ? 492.955 -12.750 660.214 1.00 75.67  ? 393  GLN C N     1 
ATOM   6636  C  CA    . GLN C 2  393  ? 492.376 -11.627 660.934 1.00 74.12  ? 393  GLN C CA    1 
ATOM   6637  C  C     . GLN C 2  393  ? 493.335 -11.067 661.987 1.00 76.30  ? 393  GLN C C     1 
ATOM   6638  O  O     . GLN C 2  393  ? 494.083 -11.809 662.649 1.00 78.50  ? 393  GLN C O     1 
ATOM   6639  C  CB    . GLN C 2  393  ? 491.040 -11.960 661.618 1.00 78.37  ? 393  GLN C CB    1 
ATOM   6640  C  CG    . GLN C 2  393  ? 489.851 -12.453 660.780 1.00 80.56  ? 393  GLN C CG    1 
ATOM   6641  C  CD    . GLN C 2  393  ? 488.714 -12.962 661.675 1.00 82.61  ? 393  GLN C CD    1 
ATOM   6642  O  OE1   . GLN C 2  393  ? 488.691 -12.670 662.865 1.00 95.04  ? 393  GLN C OE1   1 
ATOM   6643  N  NE2   . GLN C 2  393  ? 487.788 -13.713 661.123 1.00 76.10  ? 393  GLN C NE2   1 
ATOM   6644  N  N     . PHE C 2  394  ? 493.231 -9.751  662.180 1.00 72.82  ? 394  PHE C N     1 
ATOM   6645  C  CA    . PHE C 2  394  ? 493.912 -9.058  663.262 1.00 76.32  ? 394  PHE C CA    1 
ATOM   6646  C  C     . PHE C 2  394  ? 493.524 -9.744  664.571 1.00 73.55  ? 394  PHE C C     1 
ATOM   6647  O  O     . PHE C 2  394  ? 492.332 -9.904  664.871 1.00 69.52  ? 394  PHE C O     1 
ATOM   6648  C  CB    . PHE C 2  394  ? 493.453 -7.603  663.232 1.00 86.08  ? 394  PHE C CB    1 
ATOM   6649  C  CG    . PHE C 2  394  ? 494.379 -6.609  663.865 1.00 94.52  ? 394  PHE C CG    1 
ATOM   6650  C  CD1   . PHE C 2  394  ? 495.670 -6.446  663.438 1.00 97.24  ? 394  PHE C CD1   1 
ATOM   6651  C  CD2   . PHE C 2  394  ? 493.880 -5.753  664.858 1.00 101.12 ? 394  PHE C CD2   1 
ATOM   6652  C  CE1   . PHE C 2  394  ? 496.482 -5.480  664.025 1.00 102.76 ? 394  PHE C CE1   1 
ATOM   6653  C  CE2   . PHE C 2  394  ? 494.671 -4.785  665.441 1.00 103.73 ? 394  PHE C CE2   1 
ATOM   6654  C  CZ    . PHE C 2  394  ? 495.978 -4.647  665.030 1.00 105.24 ? 394  PHE C CZ    1 
ATOM   6655  N  N     . LYS C 2  395  ? 494.528 -10.162 665.347 1.00 73.74  ? 395  LYS C N     1 
ATOM   6656  C  CA    . LYS C 2  395  ? 494.261 -10.966 666.541 1.00 75.92  ? 395  LYS C CA    1 
ATOM   6657  C  C     . LYS C 2  395  ? 493.429 -10.210 667.569 1.00 82.33  ? 395  LYS C C     1 
ATOM   6658  O  O     . LYS C 2  395  ? 493.607 -9.009  667.798 1.00 87.75  ? 395  LYS C O     1 
ATOM   6659  C  CB    . LYS C 2  395  ? 495.580 -11.418 667.183 1.00 68.71  ? 395  LYS C CB    1 
ATOM   6660  C  CG    . LYS C 2  395  ? 495.513 -12.683 668.035 1.00 64.34  ? 395  LYS C CG    1 
ATOM   6661  C  CD    . LYS C 2  395  ? 496.332 -12.535 669.292 1.00 71.02  ? 395  LYS C CD    1 
ATOM   6662  C  CE    . LYS C 2  395  ? 497.594 -13.392 669.320 1.00 81.49  ? 395  LYS C CE    1 
ATOM   6663  N  NZ    . LYS C 2  395  ? 498.130 -13.565 670.733 1.00 94.40  ? 395  LYS C NZ    1 
ATOM   6664  N  N     . ASP C 2  396  ? 492.516 -10.928 668.214 1.00 81.80  ? 396  ASP C N     1 
ATOM   6665  C  CA    . ASP C 2  396  ? 491.763 -10.337 669.302 1.00 83.67  ? 396  ASP C CA    1 
ATOM   6666  C  C     . ASP C 2  396  ? 492.546 -10.651 670.564 1.00 87.26  ? 396  ASP C C     1 
ATOM   6667  O  O     . ASP C 2  396  ? 492.484 -11.768 671.081 1.00 86.88  ? 396  ASP C O     1 
ATOM   6668  C  CB    . ASP C 2  396  ? 490.383 -10.978 669.369 1.00 85.03  ? 396  ASP C CB    1 
ATOM   6669  C  CG    . ASP C 2  396  ? 489.492 -10.347 670.407 1.00 90.71  ? 396  ASP C CG    1 
ATOM   6670  O  OD1   . ASP C 2  396  ? 489.983 -9.455  671.128 1.00 94.01  ? 396  ASP C OD1   1 
ATOM   6671  O  OD2   . ASP C 2  396  ? 488.320 -10.785 670.541 1.00 92.81  ? 396  ASP C OD2   1 
ATOM   6672  N  N     . GLU C 2  397  ? 493.230 -9.656  671.107 1.00 92.08  ? 397  GLU C N     1 
ATOM   6673  C  CA    . GLU C 2  397  ? 493.971 -9.942  672.319 1.00 98.87  ? 397  GLU C CA    1 
ATOM   6674  C  C     . GLU C 2  397  ? 493.632 -8.900  673.376 1.00 107.47 ? 397  GLU C C     1 
ATOM   6675  O  O     . GLU C 2  397  ? 494.485 -8.453  674.151 1.00 112.47 ? 397  GLU C O     1 
ATOM   6676  C  CB    . GLU C 2  397  ? 495.478 -10.096 672.055 1.00 100.44 ? 397  GLU C CB    1 
ATOM   6677  C  CG    . GLU C 2  397  ? 496.161 -9.148  671.068 1.00 104.10 ? 397  GLU C CG    1 
ATOM   6678  C  CD    . GLU C 2  397  ? 497.704 -9.210  671.137 1.00 108.71 ? 397  GLU C CD    1 
ATOM   6679  O  OE1   . GLU C 2  397  ? 498.268 -10.142 671.774 1.00 110.33 ? 397  GLU C OE1   1 
ATOM   6680  O  OE2   . GLU C 2  397  ? 498.357 -8.343  670.517 1.00 108.30 ? 397  GLU C OE2   1 
ATOM   6681  N  N     . THR C 2  398  ? 492.341 -8.566  673.474 1.00 103.47 ? 398  THR C N     1 
ATOM   6682  C  CA    . THR C 2  398  ? 491.927 -7.603  674.479 1.00 97.43  ? 398  THR C CA    1 
ATOM   6683  C  C     . THR C 2  398  ? 492.294 -8.149  675.827 1.00 99.94  ? 398  THR C C     1 
ATOM   6684  O  O     . THR C 2  398  ? 492.829 -7.438  676.683 1.00 105.46 ? 398  THR C O     1 
ATOM   6685  C  CB    . THR C 2  398  ? 490.430 -7.340  674.398 1.00 89.70  ? 398  THR C CB    1 
ATOM   6686  O  OG1   . THR C 2  398  ? 490.055 -7.048  673.045 1.00 89.34  ? 398  THR C OG1   1 
ATOM   6687  C  CG2   . THR C 2  398  ? 490.065 -6.197  675.270 1.00 90.55  ? 398  THR C CG2   1 
ATOM   6688  N  N     . ASN C 2  399  ? 492.053 -9.436  675.995 1.00 100.33 ? 399  ASN C N     1 
ATOM   6689  C  CA    . ASN C 2  399  ? 492.401 -10.190 677.187 1.00 102.09 ? 399  ASN C CA    1 
ATOM   6690  C  C     . ASN C 2  399  ? 492.741 -11.588 676.703 1.00 93.74  ? 399  ASN C C     1 
ATOM   6691  O  O     . ASN C 2  399  ? 492.526 -11.912 675.528 1.00 78.66  ? 399  ASN C O     1 
ATOM   6692  C  CB    . ASN C 2  399  ? 491.267 -10.205 678.231 1.00 93.33  ? 399  ASN C CB    1 
ATOM   6693  C  CG    . ASN C 2  399  ? 490.048 -10.946 677.755 1.00 86.43  ? 399  ASN C CG    1 
ATOM   6694  O  OD1   . ASN C 2  399  ? 490.112 -12.140 677.444 1.00 82.64  ? 399  ASN C OD1   1 
ATOM   6695  N  ND2   . ASN C 2  399  ? 488.916 -10.251 677.708 1.00 85.74  ? 399  ASN C ND2   1 
ATOM   6696  N  N     . PRO C 2  400  ? 493.372 -12.402 677.547 1.00 99.10  ? 400  PRO C N     1 
ATOM   6697  C  CA    . PRO C 2  400  ? 493.826 -13.712 677.068 1.00 98.63  ? 400  PRO C CA    1 
ATOM   6698  C  C     . PRO C 2  400  ? 492.713 -14.551 676.465 1.00 97.39  ? 400  PRO C C     1 
ATOM   6699  O  O     . PRO C 2  400  ? 492.959 -15.291 675.501 1.00 96.70  ? 400  PRO C O     1 
ATOM   6700  C  CB    . PRO C 2  400  ? 494.354 -14.362 678.351 1.00 105.19 ? 400  PRO C CB    1 
ATOM   6701  C  CG    . PRO C 2  400  ? 494.807 -13.215 679.202 1.00 103.87 ? 400  PRO C CG    1 
ATOM   6702  C  CD    . PRO C 2  400  ? 493.832 -12.120 678.923 1.00 100.59 ? 400  PRO C CD    1 
ATOM   6703  N  N     . LEU C 2  401  ? 491.511 -14.512 677.069 1.00 91.67  ? 401  LEU C N     1 
ATOM   6704  C  CA    . LEU C 2  401  ? 490.366 -15.272 676.564 1.00 88.25  ? 401  LEU C CA    1 
ATOM   6705  C  C     . LEU C 2  401  ? 489.935 -14.835 675.167 1.00 88.94  ? 401  LEU C C     1 
ATOM   6706  O  O     . LEU C 2  401  ? 489.597 -15.681 674.325 1.00 90.16  ? 401  LEU C O     1 
ATOM   6707  C  CB    . LEU C 2  401  ? 489.167 -15.107 677.485 1.00 81.94  ? 401  LEU C CB    1 
ATOM   6708  C  CG    . LEU C 2  401  ? 487.923 -15.839 676.964 1.00 76.70  ? 401  LEU C CG    1 
ATOM   6709  C  CD1   . LEU C 2  401  ? 488.262 -17.343 676.873 1.00 77.61  ? 401  LEU C CD1   1 
ATOM   6710  C  CD2   . LEU C 2  401  ? 486.618 -15.574 677.697 1.00 73.96  ? 401  LEU C CD2   1 
ATOM   6711  N  N     . SER C 2  402  ? 490.075 -13.543 674.867 1.00 92.02  ? 402  SER C N     1 
ATOM   6712  C  CA    . SER C 2  402  ? 489.729 -13.009 673.552 1.00 90.62  ? 402  SER C CA    1 
ATOM   6713  C  C     . SER C 2  402  ? 490.396 -13.807 672.436 1.00 91.53  ? 402  SER C C     1 
ATOM   6714  O  O     . SER C 2  402  ? 489.731 -14.282 671.505 1.00 85.93  ? 402  SER C O     1 
ATOM   6715  C  CB    . SER C 2  402  ? 490.153 -11.544 673.489 1.00 93.23  ? 402  SER C CB    1 
ATOM   6716  O  OG    . SER C 2  402  ? 489.876 -10.887 674.713 1.00 95.71  ? 402  SER C OG    1 
ATOM   6717  N  N     . SER C 2  403  ? 491.719 -13.963 672.523 1.00 90.51  ? 403  SER C N     1 
ATOM   6718  C  CA    . SER C 2  403  ? 492.451 -14.671 671.489 1.00 85.89  ? 403  SER C CA    1 
ATOM   6719  C  C     . SER C 2  403  ? 492.146 -16.162 671.519 1.00 90.01  ? 403  SER C C     1 
ATOM   6720  O  O     . SER C 2  403  ? 491.961 -16.771 670.459 1.00 92.76  ? 403  SER C O     1 
ATOM   6721  C  CB    . SER C 2  403  ? 493.950 -14.424 671.667 1.00 85.13  ? 403  SER C CB    1 
ATOM   6722  O  OG    . SER C 2  403  ? 494.493 -15.237 672.701 1.00 88.44  ? 403  SER C OG    1 
ATOM   6723  N  N     . LEU C 2  404  ? 492.044 -16.767 672.715 1.00 92.32  ? 404  LEU C N     1 
ATOM   6724  C  CA    . LEU C 2  404  ? 491.670 -18.183 672.776 1.00 93.23  ? 404  LEU C CA    1 
ATOM   6725  C  C     . LEU C 2  404  ? 490.362 -18.412 672.022 1.00 90.91  ? 404  LEU C C     1 
ATOM   6726  O  O     . LEU C 2  404  ? 490.254 -19.340 671.209 1.00 92.42  ? 404  LEU C O     1 
ATOM   6727  C  CB    . LEU C 2  404  ? 491.537 -18.692 674.209 1.00 94.11  ? 404  LEU C CB    1 
ATOM   6728  C  CG    . LEU C 2  404  ? 491.061 -20.155 674.158 1.00 92.30  ? 404  LEU C CG    1 
ATOM   6729  C  CD1   . LEU C 2  404  ? 492.117 -21.030 673.480 1.00 93.05  ? 404  LEU C CD1   1 
ATOM   6730  C  CD2   . LEU C 2  404  ? 490.734 -20.710 675.494 1.00 96.31  ? 404  LEU C CD2   1 
ATOM   6731  N  N     . ARG C 2  405  ? 489.380 -17.528 672.215 1.00 84.10  ? 405  ARG C N     1 
ATOM   6732  C  CA    . ARG C 2  405  ? 488.139 -17.706 671.477 1.00 83.23  ? 405  ARG C CA    1 
ATOM   6733  C  C     . ARG C 2  405  ? 488.350 -17.480 670.007 1.00 91.14  ? 405  ARG C C     1 
ATOM   6734  O  O     . ARG C 2  405  ? 487.761 -18.181 669.172 1.00 92.43  ? 405  ARG C O     1 
ATOM   6735  C  CB    . ARG C 2  405  ? 487.064 -16.756 671.958 1.00 78.58  ? 405  ARG C CB    1 
ATOM   6736  C  CG    . ARG C 2  405  ? 485.818 -17.011 671.180 1.00 75.91  ? 405  ARG C CG    1 
ATOM   6737  C  CD    . ARG C 2  405  ? 484.921 -15.847 671.280 1.00 72.75  ? 405  ARG C CD    1 
ATOM   6738  N  NE    . ARG C 2  405  ? 485.221 -14.748 670.398 1.00 70.88  ? 405  ARG C NE    1 
ATOM   6739  C  CZ    . ARG C 2  405  ? 484.293 -13.865 670.061 1.00 75.68  ? 405  ARG C CZ    1 
ATOM   6740  N  NH1   . ARG C 2  405  ? 483.063 -14.019 670.524 1.00 72.96  ? 405  ARG C NH1   1 
ATOM   6741  N  NH2   . ARG C 2  405  ? 484.578 -12.829 669.281 1.00 80.36  ? 405  ARG C NH2   1 
ATOM   6742  N  N     . HIS C 2  406  ? 489.139 -16.468 669.679 1.00 91.58  ? 406  HIS C N     1 
ATOM   6743  C  CA    . HIS C 2  406  ? 489.383 -16.157 668.285 1.00 84.60  ? 406  HIS C CA    1 
ATOM   6744  C  C     . HIS C 2  406  ? 489.930 -17.368 667.539 1.00 83.37  ? 406  HIS C C     1 
ATOM   6745  O  O     . HIS C 2  406  ? 489.498 -17.676 666.420 1.00 59.06  ? 406  HIS C O     1 
ATOM   6746  C  CB    . HIS C 2  406  ? 490.355 -14.989 668.201 1.00 79.67  ? 406  HIS C CB    1 
ATOM   6747  C  CG    . HIS C 2  406  ? 490.368 -14.344 666.861 1.00 75.89  ? 406  HIS C CG    1 
ATOM   6748  N  ND1   . HIS C 2  406  ? 491.076 -13.195 666.593 1.00 75.25  ? 406  HIS C ND1   1 
ATOM   6749  C  CD2   . HIS C 2  406  ? 489.728 -14.677 665.717 1.00 74.35  ? 406  HIS C CD2   1 
ATOM   6750  C  CE1   . HIS C 2  406  ? 490.862 -12.841 665.340 1.00 75.06  ? 406  HIS C CE1   1 
ATOM   6751  N  NE2   . HIS C 2  406  ? 490.048 -13.723 664.789 1.00 74.64  ? 406  HIS C NE2   1 
ATOM   6752  N  N     . LYS C 2  407  ? 490.900 -18.054 668.147 1.00 77.85  ? 407  LYS C N     1 
ATOM   6753  C  CA    . LYS C 2  407  ? 491.503 -19.205 667.489 1.00 83.55  ? 407  LYS C CA    1 
ATOM   6754  C  C     . LYS C 2  407  ? 490.513 -20.352 667.340 1.00 85.81  ? 407  LYS C C     1 
ATOM   6755  O  O     . LYS C 2  407  ? 490.678 -21.196 666.435 1.00 86.56  ? 407  LYS C O     1 
ATOM   6756  C  CB    . LYS C 2  407  ? 492.765 -19.642 668.245 1.00 88.16  ? 407  LYS C CB    1 
ATOM   6757  C  CG    . LYS C 2  407  ? 493.903 -18.598 668.219 1.00 87.96  ? 407  LYS C CG    1 
ATOM   6758  C  CD    . LYS C 2  407  ? 494.748 -18.590 669.504 1.00 90.44  ? 407  LYS C CD    1 
ATOM   6759  C  CE    . LYS C 2  407  ? 495.742 -17.420 669.514 1.00 91.33  ? 407  LYS C CE    1 
ATOM   6760  N  NZ    . LYS C 2  407  ? 496.325 -17.168 670.864 1.00 99.59  ? 407  LYS C NZ    1 
ATOM   6761  N  N     . ARG C 2  408  ? 489.496 -20.408 668.210 1.00 72.90  ? 408  ARG C N     1 
ATOM   6762  C  CA    . ARG C 2  408  ? 488.520 -21.483 668.149 1.00 72.09  ? 408  ARG C CA    1 
ATOM   6763  C  C     . ARG C 2  408  ? 487.242 -21.137 667.376 1.00 72.74  ? 408  ARG C C     1 
ATOM   6764  O  O     . ARG C 2  408  ? 486.268 -21.886 667.474 1.00 78.29  ? 408  ARG C O     1 
ATOM   6765  C  CB    . ARG C 2  408  ? 488.206 -21.997 669.535 1.00 68.45  ? 408  ARG C CB    1 
ATOM   6766  C  CG    . ARG C 2  408  ? 489.440 -22.159 670.393 1.00 73.64  ? 408  ARG C CG    1 
ATOM   6767  C  CD    . ARG C 2  408  ? 489.061 -22.763 671.744 1.00 79.72  ? 408  ARG C CD    1 
ATOM   6768  N  NE    . ARG C 2  408  ? 489.065 -24.225 671.689 1.00 84.39  ? 408  ARG C NE    1 
ATOM   6769  C  CZ    . ARG C 2  408  ? 487.975 -24.971 671.841 1.00 85.23  ? 408  ARG C CZ    1 
ATOM   6770  N  NH1   . ARG C 2  408  ? 486.796 -24.373 672.061 1.00 80.23  ? 408  ARG C NH1   1 
ATOM   6771  N  NH2   . ARG C 2  408  ? 488.066 -26.308 671.777 1.00 87.31  ? 408  ARG C NH2   1 
ATOM   6772  N  N     . ARG C 2  409  ? 487.165 -19.985 666.709 1.00 73.32  ? 409  ARG C N     1 
ATOM   6773  C  CA    . ARG C 2  409  ? 485.958 -19.684 665.935 1.00 71.75  ? 409  ARG C CA    1 
ATOM   6774  C  C     . ARG C 2  409  ? 485.908 -20.416 664.599 1.00 68.96  ? 409  ARG C C     1 
ATOM   6775  O  O     . ARG C 2  409  ? 486.934 -20.832 664.040 1.00 74.71  ? 409  ARG C O     1 
ATOM   6776  C  CB    . ARG C 2  409  ? 485.729 -18.203 665.674 1.00 75.87  ? 409  ARG C CB    1 
ATOM   6777  C  CG    . ARG C 2  409  ? 484.918 -17.741 666.842 1.00 93.06  ? 409  ARG C CG    1 
ATOM   6778  C  CD    . ARG C 2  409  ? 483.903 -16.683 666.581 1.00 96.17  ? 409  ARG C CD    1 
ATOM   6779  N  NE    . ARG C 2  409  ? 484.435 -15.400 666.190 1.00 94.21  ? 409  ARG C NE    1 
ATOM   6780  C  CZ    . ARG C 2  409  ? 483.688 -14.313 666.247 1.00 94.63  ? 409  ARG C CZ    1 
ATOM   6781  N  NH1   . ARG C 2  409  ? 484.180 -13.139 665.895 1.00 91.39  ? 409  ARG C NH1   1 
ATOM   6782  N  NH2   . ARG C 2  409  ? 482.464 -14.410 666.755 1.00 98.08  ? 409  ARG C NH2   1 
ATOM   6783  N  N     . ILE C 2  410  ? 484.684 -20.672 664.152 1.00 66.39  ? 410  ILE C N     1 
ATOM   6784  C  CA    . ILE C 2  410  ? 484.399 -21.392 662.912 1.00 72.72  ? 410  ILE C CA    1 
ATOM   6785  C  C     . ILE C 2  410  ? 483.528 -20.502 662.025 1.00 80.49  ? 410  ILE C C     1 
ATOM   6786  O  O     . ILE C 2  410  ? 482.391 -20.170 662.398 1.00 83.34  ? 410  ILE C O     1 
ATOM   6787  C  CB    . ILE C 2  410  ? 483.712 -22.731 663.175 1.00 71.88  ? 410  ILE C CB    1 
ATOM   6788  C  CG1   . ILE C 2  410  ? 484.628 -23.594 664.018 1.00 76.56  ? 410  ILE C CG1   1 
ATOM   6789  C  CG2   . ILE C 2  410  ? 483.370 -23.403 661.853 1.00 70.14  ? 410  ILE C CG2   1 
ATOM   6790  C  CD1   . ILE C 2  410  ? 484.004 -24.906 664.387 1.00 85.44  ? 410  ILE C CD1   1 
ATOM   6791  N  N     . SER C 2  411  ? 484.010 -20.191 660.819 1.00 81.55  ? 411  SER C N     1 
ATOM   6792  C  CA    . SER C 2  411  ? 483.274 -19.307 659.925 1.00 85.47  ? 411  SER C CA    1 
ATOM   6793  C  C     . SER C 2  411  ? 482.755 -20.016 658.689 1.00 93.93  ? 411  SER C C     1 
ATOM   6794  O  O     . SER C 2  411  ? 483.431 -20.885 658.118 1.00 90.68  ? 411  SER C O     1 
ATOM   6795  C  CB    . SER C 2  411  ? 484.141 -18.136 659.454 1.00 84.95  ? 411  SER C CB    1 
ATOM   6796  O  OG    . SER C 2  411  ? 483.433 -17.323 658.515 1.00 84.23  ? 411  SER C OG    1 
ATOM   6797  N  N     . ALA C 2  412  ? 481.508 -19.683 658.339 1.00 96.24  ? 412  ALA C N     1 
ATOM   6798  C  CA    . ALA C 2  412  ? 480.899 -20.154 657.113 1.00 103.81 ? 412  ALA C CA    1 
ATOM   6799  C  C     . ALA C 2  412  ? 481.052 -19.144 655.990 1.00 116.30 ? 412  ALA C C     1 
ATOM   6800  O  O     . ALA C 2  412  ? 480.579 -19.406 654.888 1.00 122.37 ? 412  ALA C O     1 
ATOM   6801  C  CB    . ALA C 2  412  ? 479.423 -20.476 657.332 1.00 97.85  ? 412  ALA C CB    1 
ATOM   6802  N  N     . LEU C 2  413  ? 481.628 -17.969 656.255 1.00 128.93 ? 413  LEU C N     1 
ATOM   6803  C  CA    . LEU C 2  413  ? 481.868 -16.972 655.217 1.00 147.19 ? 413  LEU C CA    1 
ATOM   6804  C  C     . LEU C 2  413  ? 483.257 -17.229 654.618 1.00 169.70 ? 413  LEU C C     1 
ATOM   6805  O  O     . LEU C 2  413  ? 483.876 -18.270 654.859 1.00 171.37 ? 413  LEU C O     1 
ATOM   6806  C  CB    . LEU C 2  413  ? 481.743 -15.535 655.733 1.00 137.02 ? 413  LEU C CB    1 
ATOM   6807  C  CG    . LEU C 2  413  ? 480.566 -14.885 656.457 1.00 128.30 ? 413  LEU C CG    1 
ATOM   6808  C  CD1   . LEU C 2  413  ? 480.261 -15.621 657.728 1.00 129.06 ? 413  LEU C CD1   1 
ATOM   6809  C  CD2   . LEU C 2  413  ? 480.957 -13.470 656.810 1.00 124.90 ? 413  LEU C CD2   1 
ATOM   6810  N  N     . GLY C 2  414  ? 483.767 -16.285 653.824 1.00 191.75 ? 414  GLY C N     1 
ATOM   6811  C  CA    . GLY C 2  414  ? 485.072 -16.439 653.221 1.00 196.78 ? 414  GLY C CA    1 
ATOM   6812  C  C     . GLY C 2  414  ? 485.023 -17.177 651.897 1.00 203.89 ? 414  GLY C C     1 
ATOM   6813  O  O     . GLY C 2  414  ? 483.958 -17.622 651.455 1.00 208.09 ? 414  GLY C O     1 
ATOM   6814  N  N     . PRO C 2  415  ? 486.187 -17.290 651.206 1.00 187.55 ? 415  PRO C N     1 
ATOM   6815  C  CA    . PRO C 2  415  ? 486.222 -17.995 649.912 1.00 185.57 ? 415  PRO C CA    1 
ATOM   6816  C  C     . PRO C 2  415  ? 485.842 -19.471 650.014 1.00 185.79 ? 415  PRO C C     1 
ATOM   6817  O  O     . PRO C 2  415  ? 486.744 -20.312 650.106 1.00 181.65 ? 415  PRO C O     1 
ATOM   6818  C  CB    . PRO C 2  415  ? 487.684 -17.832 649.480 1.00 174.06 ? 415  PRO C CB    1 
ATOM   6819  C  CG    . PRO C 2  415  ? 488.447 -17.702 650.777 1.00 168.48 ? 415  PRO C CG    1 
ATOM   6820  C  CD    . PRO C 2  415  ? 487.537 -16.879 651.643 1.00 176.41 ? 415  PRO C CD    1 
ATOM   6821  N  N     . GLY C 2  416  ? 484.547 -19.820 649.966 1.00 194.80 ? 416  GLY C N     1 
ATOM   6822  C  CA    . GLY C 2  416  ? 484.197 -21.230 650.088 1.00 190.28 ? 416  GLY C CA    1 
ATOM   6823  C  C     . GLY C 2  416  ? 483.093 -21.578 651.079 1.00 182.42 ? 416  GLY C C     1 
ATOM   6824  O  O     . GLY C 2  416  ? 482.997 -22.732 651.506 1.00 183.98 ? 416  GLY C O     1 
ATOM   6825  N  N     . GLY C 2  417  ? 482.213 -20.630 651.390 1.00 169.02 ? 417  GLY C N     1 
ATOM   6826  C  CA    . GLY C 2  417  ? 481.184 -20.773 652.408 1.00 160.41 ? 417  GLY C CA    1 
ATOM   6827  C  C     . GLY C 2  417  ? 480.011 -19.909 651.993 1.00 155.50 ? 417  GLY C C     1 
ATOM   6828  O  O     . GLY C 2  417  ? 480.105 -19.360 650.898 1.00 162.38 ? 417  GLY C O     1 
ATOM   6829  N  N     . LEU C 2  418  ? 478.940 -19.751 652.798 1.00 164.62 ? 418  LEU C N     1 
ATOM   6830  C  CA    . LEU C 2  418  ? 477.723 -19.049 652.369 1.00 169.39 ? 418  LEU C CA    1 
ATOM   6831  C  C     . LEU C 2  418  ? 477.946 -17.638 651.825 1.00 185.84 ? 418  LEU C C     1 
ATOM   6832  O  O     . LEU C 2  418  ? 478.674 -17.503 650.846 1.00 198.98 ? 418  LEU C O     1 
ATOM   6833  C  CB    . LEU C 2  418  ? 476.712 -18.999 653.517 1.00 148.47 ? 418  LEU C CB    1 
ATOM   6834  N  N     . THR C 2  419  ? 477.257 -16.607 652.333 1.00 188.53 ? 419  THR C N     1 
ATOM   6835  C  CA    . THR C 2  419  ? 477.599 -15.177 652.191 1.00 188.88 ? 419  THR C CA    1 
ATOM   6836  C  C     . THR C 2  419  ? 476.304 -14.367 652.321 1.00 179.36 ? 419  THR C C     1 
ATOM   6837  O  O     . THR C 2  419  ? 475.791 -14.168 653.428 1.00 175.22 ? 419  THR C O     1 
ATOM   6838  C  CB    . THR C 2  419  ? 478.269 -14.759 650.841 1.00 195.98 ? 419  THR C CB    1 
ATOM   6839  O  OG1   . THR C 2  419  ? 479.139 -15.764 650.312 1.00 196.37 ? 419  THR C OG1   1 
ATOM   6840  C  CG2   . THR C 2  419  ? 479.156 -13.597 651.045 1.00 196.02 ? 419  THR C CG2   1 
ATOM   6841  N  N     . ARG C 2  420  ? 475.777 -13.897 651.184 1.00 174.15 ? 420  ARG C N     1 
ATOM   6842  C  CA    . ARG C 2  420  ? 474.625 -12.996 651.131 1.00 161.53 ? 420  ARG C CA    1 
ATOM   6843  C  C     . ARG C 2  420  ? 473.313 -13.750 651.360 1.00 151.74 ? 420  ARG C C     1 
ATOM   6844  O  O     . ARG C 2  420  ? 472.878 -13.953 652.498 1.00 145.84 ? 420  ARG C O     1 
ATOM   6845  C  CB    . ARG C 2  420  ? 474.584 -12.259 649.786 1.00 157.40 ? 420  ARG C CB    1 
ATOM   6846  N  N     . PHE C 2  425  ? 468.521 -19.923 655.716 1.00 157.46 ? 425  PHE C N     1 
ATOM   6847  C  CA    . PHE C 2  425  ? 468.284 -20.384 657.080 1.00 156.74 ? 425  PHE C CA    1 
ATOM   6848  C  C     . PHE C 2  425  ? 469.009 -21.658 657.436 1.00 146.40 ? 425  PHE C C     1 
ATOM   6849  O  O     . PHE C 2  425  ? 469.623 -21.754 658.484 1.00 149.51 ? 425  PHE C O     1 
ATOM   6850  C  CB    . PHE C 2  425  ? 466.787 -20.693 657.308 1.00 163.09 ? 425  PHE C CB    1 
ATOM   6851  C  CG    . PHE C 2  425  ? 465.887 -19.490 657.460 1.00 167.81 ? 425  PHE C CG    1 
ATOM   6852  C  CD1   . PHE C 2  425  ? 465.338 -19.190 658.704 1.00 165.67 ? 425  PHE C CD1   1 
ATOM   6853  C  CD2   . PHE C 2  425  ? 465.549 -18.697 656.373 1.00 169.82 ? 425  PHE C CD2   1 
ATOM   6854  C  CE1   . PHE C 2  425  ? 464.490 -18.116 658.871 1.00 164.71 ? 425  PHE C CE1   1 
ATOM   6855  C  CE2   . PHE C 2  425  ? 464.699 -17.615 656.533 1.00 168.97 ? 425  PHE C CE2   1 
ATOM   6856  C  CZ    . PHE C 2  425  ? 464.171 -17.325 657.787 1.00 166.87 ? 425  PHE C CZ    1 
ATOM   6857  N  N     . ASP C 2  426  ? 469.043 -22.571 656.475 1.00 128.73 ? 426  ASP C N     1 
ATOM   6858  C  CA    . ASP C 2  426  ? 469.561 -23.913 656.707 1.00 120.53 ? 426  ASP C CA    1 
ATOM   6859  C  C     . ASP C 2  426  ? 470.943 -23.909 657.328 1.00 108.11 ? 426  ASP C C     1 
ATOM   6860  O  O     . ASP C 2  426  ? 471.243 -24.752 658.178 1.00 107.83 ? 426  ASP C O     1 
ATOM   6861  C  CB    . ASP C 2  426  ? 469.540 -24.738 655.420 1.00 123.65 ? 426  ASP C CB    1 
ATOM   6862  C  CG    . ASP C 2  426  ? 468.125 -25.164 655.019 1.00 129.93 ? 426  ASP C CG    1 
ATOM   6863  O  OD1   . ASP C 2  426  ? 467.151 -24.470 655.405 1.00 133.48 ? 426  ASP C OD1   1 
ATOM   6864  O  OD2   . ASP C 2  426  ? 467.987 -26.213 654.340 1.00 131.52 ? 426  ASP C OD2   1 
ATOM   6865  N  N     . VAL C 2  427  ? 471.809 -22.996 656.890 1.00 108.59 ? 427  VAL C N     1 
ATOM   6866  C  CA    . VAL C 2  427  ? 473.205 -22.969 657.334 1.00 105.78 ? 427  VAL C CA    1 
ATOM   6867  C  C     . VAL C 2  427  ? 473.354 -22.355 658.716 1.00 98.38  ? 427  VAL C C     1 
ATOM   6868  O  O     . VAL C 2  427  ? 474.286 -22.702 659.459 1.00 96.62  ? 427  VAL C O     1 
ATOM   6869  C  CB    . VAL C 2  427  ? 474.048 -22.176 656.318 1.00 109.94 ? 427  VAL C CB    1 
ATOM   6870  C  CG1   . VAL C 2  427  ? 475.189 -22.980 655.843 1.00 112.78 ? 427  VAL C CG1   1 
ATOM   6871  C  CG2   . VAL C 2  427  ? 473.186 -21.659 655.137 1.00 113.30 ? 427  VAL C CG2   1 
ATOM   6872  N  N     . ARG C 2  428  ? 472.537 -21.352 659.029 1.00 94.51  ? 428  ARG C N     1 
ATOM   6873  C  CA    . ARG C 2  428  ? 472.658 -20.664 660.305 1.00 86.85  ? 428  ARG C CA    1 
ATOM   6874  C  C     . ARG C 2  428  ? 472.022 -21.412 661.471 1.00 84.40  ? 428  ARG C C     1 
ATOM   6875  O  O     . ARG C 2  428  ? 472.385 -21.156 662.622 1.00 82.33  ? 428  ARG C O     1 
ATOM   6876  C  CB    . ARG C 2  428  ? 471.961 -19.339 660.159 1.00 71.20  ? 428  ARG C CB    1 
ATOM   6877  C  CG    . ARG C 2  428  ? 472.407 -18.623 658.962 1.00 64.39  ? 428  ARG C CG    1 
ATOM   6878  C  CD    . ARG C 2  428  ? 471.479 -17.526 658.839 1.00 63.89  ? 428  ARG C CD    1 
ATOM   6879  N  NE    . ARG C 2  428  ? 472.199 -16.303 659.032 1.00 67.36  ? 428  ARG C NE    1 
ATOM   6880  C  CZ    . ARG C 2  428  ? 472.432 -15.430 658.080 1.00 83.29  ? 428  ARG C CZ    1 
ATOM   6881  N  NH1   . ARG C 2  428  ? 471.987 -15.648 656.849 1.00 88.89  ? 428  ARG C NH1   1 
ATOM   6882  N  NH2   . ARG C 2  428  ? 473.098 -14.334 658.379 1.00 77.62  ? 428  ARG C NH2   1 
ATOM   6883  N  N     . ASP C 2  429  ? 471.181 -22.400 661.194 1.00 89.89  ? 429  ASP C N     1 
ATOM   6884  C  CA    . ASP C 2  429  ? 470.483 -23.127 662.239 1.00 92.28  ? 429  ASP C CA    1 
ATOM   6885  C  C     . ASP C 2  429  ? 471.441 -23.883 663.130 1.00 94.69  ? 429  ASP C C     1 
ATOM   6886  O  O     . ASP C 2  429  ? 472.596 -24.157 662.765 1.00 90.96  ? 429  ASP C O     1 
ATOM   6887  C  CB    . ASP C 2  429  ? 469.491 -24.121 661.653 1.00 102.66 ? 429  ASP C CB    1 
ATOM   6888  C  CG    . ASP C 2  429  ? 468.089 -23.631 661.739 1.00 110.27 ? 429  ASP C CG    1 
ATOM   6889  O  OD1   . ASP C 2  429  ? 467.795 -22.954 662.745 1.00 113.15 ? 429  ASP C OD1   1 
ATOM   6890  O  OD2   . ASP C 2  429  ? 467.290 -23.920 660.823 1.00 115.79 ? 429  ASP C OD2   1 
ATOM   6891  N  N     . VAL C 2  430  ? 470.962 -24.187 664.336 1.00 93.24  ? 430  VAL C N     1 
ATOM   6892  C  CA    . VAL C 2  430  ? 471.681 -25.108 665.201 1.00 88.48  ? 430  VAL C CA    1 
ATOM   6893  C  C     . VAL C 2  430  ? 471.124 -26.498 664.914 1.00 88.82  ? 430  VAL C C     1 
ATOM   6894  O  O     . VAL C 2  430  ? 469.991 -26.801 665.298 1.00 92.14  ? 430  VAL C O     1 
ATOM   6895  C  CB    . VAL C 2  430  ? 471.508 -24.757 666.674 1.00 80.08  ? 430  VAL C CB    1 
ATOM   6896  C  CG1   . VAL C 2  430  ? 471.929 -25.962 667.516 1.00 80.89  ? 430  VAL C CG1   1 
ATOM   6897  C  CG2   . VAL C 2  430  ? 472.262 -23.512 667.006 1.00 74.91  ? 430  VAL C CG2   1 
ATOM   6898  N  N     . HIS C 2  431  ? 471.944 -27.342 664.275 1.00 80.71  ? 431  HIS C N     1 
ATOM   6899  C  CA    . HIS C 2  431  ? 471.659 -28.732 663.916 1.00 79.93  ? 431  HIS C CA    1 
ATOM   6900  C  C     . HIS C 2  431  ? 471.819 -29.691 665.089 1.00 85.11  ? 431  HIS C C     1 
ATOM   6901  O  O     . HIS C 2  431  ? 472.589 -29.449 666.025 1.00 90.66  ? 431  HIS C O     1 
ATOM   6902  C  CB    . HIS C 2  431  ? 472.576 -29.130 662.749 1.00 80.86  ? 431  HIS C CB    1 
ATOM   6903  C  CG    . HIS C 2  431  ? 472.157 -30.350 661.969 1.00 81.12  ? 431  HIS C CG    1 
ATOM   6904  N  ND1   . HIS C 2  431  ? 472.407 -31.632 662.420 1.00 80.87  ? 431  HIS C ND1   1 
ATOM   6905  C  CD2   . HIS C 2  431  ? 471.481 -30.496 660.805 1.00 79.49  ? 431  HIS C CD2   1 
ATOM   6906  C  CE1   . HIS C 2  431  ? 471.961 -32.512 661.541 1.00 79.40  ? 431  HIS C CE1   1 
ATOM   6907  N  NE2   . HIS C 2  431  ? 471.383 -31.850 660.556 1.00 79.45  ? 431  HIS C NE2   1 
ATOM   6908  N  N     . ARG C 2  432  ? 471.045 -30.778 665.049 1.00 83.65  ? 432  ARG C N     1 
ATOM   6909  C  CA    . ARG C 2  432  ? 471.159 -31.768 666.109 1.00 84.94  ? 432  ARG C CA    1 
ATOM   6910  C  C     . ARG C 2  432  ? 472.573 -32.318 666.232 1.00 81.37  ? 432  ARG C C     1 
ATOM   6911  O  O     . ARG C 2  432  ? 472.953 -32.786 667.306 1.00 87.56  ? 432  ARG C O     1 
ATOM   6912  C  CB    . ARG C 2  432  ? 470.211 -32.931 665.888 1.00 86.71  ? 432  ARG C CB    1 
ATOM   6913  C  CG    . ARG C 2  432  ? 470.405 -33.685 664.655 1.00 82.33  ? 432  ARG C CG    1 
ATOM   6914  C  CD    . ARG C 2  432  ? 469.488 -34.822 664.770 1.00 79.59  ? 432  ARG C CD    1 
ATOM   6915  N  NE    . ARG C 2  432  ? 469.601 -35.723 663.649 1.00 89.50  ? 432  ARG C NE    1 
ATOM   6916  C  CZ    . ARG C 2  432  ? 470.507 -36.690 663.611 1.00 90.95  ? 432  ARG C CZ    1 
ATOM   6917  N  NH1   . ARG C 2  432  ? 471.357 -36.837 664.628 1.00 90.16  ? 432  ARG C NH1   1 
ATOM   6918  N  NH2   . ARG C 2  432  ? 470.560 -37.505 662.574 1.00 89.06  ? 432  ARG C NH2   1 
ATOM   6919  N  N     . THR C 2  433  ? 473.309 -32.408 665.132 1.00 83.13  ? 433  THR C N     1 
ATOM   6920  C  CA    . THR C 2  433  ? 474.663 -32.938 665.218 1.00 93.38  ? 433  THR C CA    1 
ATOM   6921  C  C     . THR C 2  433  ? 475.658 -31.931 665.809 1.00 92.44  ? 433  THR C C     1 
ATOM   6922  O  O     . THR C 2  433  ? 476.821 -32.308 666.042 1.00 93.09  ? 433  THR C O     1 
ATOM   6923  C  CB    . THR C 2  433  ? 475.156 -33.491 663.858 1.00 98.61  ? 433  THR C CB    1 
ATOM   6924  O  OG1   . THR C 2  433  ? 475.168 -32.475 662.848 1.00 99.19  ? 433  THR C OG1   1 
ATOM   6925  C  CG2   . THR C 2  433  ? 474.269 -34.626 663.414 1.00 102.93 ? 433  THR C CG2   1 
ATOM   6926  N  N     . HIS C 2  434  ? 475.240 -30.676 666.064 1.00 84.45  ? 434  HIS C N     1 
ATOM   6927  C  CA    . HIS C 2  434  ? 476.136 -29.727 666.720 1.00 88.18  ? 434  HIS C CA    1 
ATOM   6928  C  C     . HIS C 2  434  ? 476.435 -30.125 668.162 1.00 93.99  ? 434  HIS C C     1 
ATOM   6929  O  O     . HIS C 2  434  ? 477.440 -29.673 668.731 1.00 95.53  ? 434  HIS C O     1 
ATOM   6930  C  CB    . HIS C 2  434  ? 475.527 -28.328 666.731 1.00 88.57  ? 434  HIS C CB    1 
ATOM   6931  C  CG    . HIS C 2  434  ? 475.574 -27.619 665.414 1.00 86.73  ? 434  HIS C CG    1 
ATOM   6932  N  ND1   . HIS C 2  434  ? 475.757 -28.279 664.220 1.00 86.77  ? 434  HIS C ND1   1 
ATOM   6933  C  CD2   . HIS C 2  434  ? 475.394 -26.311 665.102 1.00 84.74  ? 434  HIS C CD2   1 
ATOM   6934  C  CE1   . HIS C 2  434  ? 475.718 -27.406 663.229 1.00 87.02  ? 434  HIS C CE1   1 
ATOM   6935  N  NE2   . HIS C 2  434  ? 475.493 -26.206 663.739 1.00 84.98  ? 434  HIS C NE2   1 
ATOM   6936  N  N     . TYR C 2  435  ? 475.642 -31.039 668.715 1.00 98.01  ? 435  TYR C N     1 
ATOM   6937  C  CA    . TYR C 2  435  ? 475.800 -31.500 670.085 1.00 98.74  ? 435  TYR C CA    1 
ATOM   6938  C  C     . TYR C 2  435  ? 477.198 -32.012 670.332 1.00 101.47 ? 435  TYR C C     1 
ATOM   6939  O  O     . TYR C 2  435  ? 477.604 -33.034 669.775 1.00 104.36 ? 435  TYR C O     1 
ATOM   6940  C  CB    . TYR C 2  435  ? 474.764 -32.605 670.319 1.00 98.49  ? 435  TYR C CB    1 
ATOM   6941  C  CG    . TYR C 2  435  ? 474.593 -33.051 671.737 1.00 100.95 ? 435  TYR C CG    1 
ATOM   6942  C  CD1   . TYR C 2  435  ? 473.524 -32.653 672.537 1.00 97.00  ? 435  TYR C CD1   1 
ATOM   6943  C  CD2   . TYR C 2  435  ? 475.457 -34.012 672.235 1.00 106.49 ? 435  TYR C CD2   1 
ATOM   6944  C  CE1   . TYR C 2  435  ? 473.401 -33.140 673.847 1.00 96.64  ? 435  TYR C CE1   1 
ATOM   6945  C  CE2   . TYR C 2  435  ? 475.343 -34.495 673.518 1.00 107.18 ? 435  TYR C CE2   1 
ATOM   6946  C  CZ    . TYR C 2  435  ? 474.325 -34.078 674.316 1.00 101.79 ? 435  TYR C CZ    1 
ATOM   6947  O  OH    . TYR C 2  435  ? 474.296 -34.624 675.583 1.00 104.80 ? 435  TYR C OH    1 
ATOM   6948  N  N     . GLY C 2  436  ? 477.864 -31.391 671.304 1.00 110.38 ? 436  GLY C N     1 
ATOM   6949  C  CA    . GLY C 2  436  ? 479.217 -31.764 671.669 1.00 115.93 ? 436  GLY C CA    1 
ATOM   6950  C  C     . GLY C 2  436  ? 480.287 -31.286 670.706 1.00 116.39 ? 436  GLY C C     1 
ATOM   6951  O  O     . GLY C 2  436  ? 481.484 -31.493 670.982 1.00 121.58 ? 436  GLY C O     1 
ATOM   6952  N  N     . ARG C 2  437  ? 479.888 -30.639 669.601 1.00 106.79 ? 437  ARG C N     1 
ATOM   6953  C  CA    . ARG C 2  437  ? 480.801 -30.238 668.543 1.00 96.39  ? 437  ARG C CA    1 
ATOM   6954  C  C     . ARG C 2  437  ? 480.840 -28.735 668.347 1.00 91.47  ? 437  ARG C C     1 
ATOM   6955  O  O     . ARG C 2  437  ? 481.905 -28.128 668.479 1.00 94.89  ? 437  ARG C O     1 
ATOM   6956  C  CB    . ARG C 2  437  ? 480.471 -30.916 667.216 1.00 89.07  ? 437  ARG C CB    1 
ATOM   6957  C  CG    . ARG C 2  437  ? 480.707 -32.377 667.252 1.00 89.44  ? 437  ARG C CG    1 
ATOM   6958  C  CD    . ARG C 2  437  ? 480.220 -32.982 665.978 1.00 91.21  ? 437  ARG C CD    1 
ATOM   6959  N  NE    . ARG C 2  437  ? 480.262 -34.439 665.994 1.00 95.26  ? 437  ARG C NE    1 
ATOM   6960  C  CZ    . ARG C 2  437  ? 479.305 -35.197 666.516 1.00 93.16  ? 437  ARG C CZ    1 
ATOM   6961  N  NH1   . ARG C 2  437  ? 478.228 -34.626 667.050 1.00 87.93  ? 437  ARG C NH1   1 
ATOM   6962  N  NH2   . ARG C 2  437  ? 479.422 -36.520 666.488 1.00 94.70  ? 437  ARG C NH2   1 
ATOM   6963  N  N     . ILE C 2  438  ? 479.718 -28.120 668.012 1.00 87.17  ? 438  ILE C N     1 
ATOM   6964  C  CA    . ILE C 2  438  ? 479.658 -26.677 667.836 1.00 91.07  ? 438  ILE C CA    1 
ATOM   6965  C  C     . ILE C 2  438  ? 478.756 -26.082 668.900 1.00 96.38  ? 438  ILE C C     1 
ATOM   6966  O  O     . ILE C 2  438  ? 477.651 -26.575 669.158 1.00 103.72 ? 438  ILE C O     1 
ATOM   6967  C  CB    . ILE C 2  438  ? 479.148 -26.314 666.434 1.00 92.52  ? 438  ILE C CB    1 
ATOM   6968  C  CG1   . ILE C 2  438  ? 480.077 -26.913 665.386 1.00 88.50  ? 438  ILE C CG1   1 
ATOM   6969  C  CG2   . ILE C 2  438  ? 479.049 -24.828 666.263 1.00 94.03  ? 438  ILE C CG2   1 
ATOM   6970  C  CD1   . ILE C 2  438  ? 479.653 -26.658 663.989 1.00 80.65  ? 438  ILE C CD1   1 
ATOM   6971  N  N     . CYS C 2  439  ? 479.242 -25.058 669.555 1.00 95.44  ? 439  CYS C N     1 
ATOM   6972  C  CA    . CYS C 2  439  ? 478.466 -24.453 670.605 1.00 89.69  ? 439  CYS C CA    1 
ATOM   6973  C  C     . CYS C 2  439  ? 477.175 -23.825 670.124 1.00 82.62  ? 439  CYS C C     1 
ATOM   6974  O  O     . CYS C 2  439  ? 477.183 -23.067 669.148 1.00 82.21  ? 439  CYS C O     1 
ATOM   6975  C  CB    . CYS C 2  439  ? 479.263 -23.370 671.283 1.00 90.81  ? 439  CYS C CB    1 
ATOM   6976  S  SG    . CYS C 2  439  ? 478.457 -22.522 672.710 1.00 87.76  ? 439  CYS C SG    1 
ATOM   6977  N  N     . PRO C 2  440  ? 476.044 -24.185 670.739 1.00 71.32  ? 440  PRO C N     1 
ATOM   6978  C  CA    . PRO C 2  440  ? 474.745 -23.598 670.391 1.00 69.29  ? 440  PRO C CA    1 
ATOM   6979  C  C     . PRO C 2  440  ? 474.550 -22.211 670.848 1.00 68.69  ? 440  PRO C C     1 
ATOM   6980  O  O     . PRO C 2  440  ? 473.587 -21.558 670.415 1.00 68.19  ? 440  PRO C O     1 
ATOM   6981  C  CB    . PRO C 2  440  ? 473.722 -24.583 671.043 1.00 62.36  ? 440  PRO C CB    1 
ATOM   6982  C  CG    . PRO C 2  440  ? 474.411 -25.112 672.126 1.00 69.92  ? 440  PRO C CG    1 
ATOM   6983  C  CD    . PRO C 2  440  ? 475.856 -25.231 671.755 1.00 75.33  ? 440  PRO C CD    1 
ATOM   6984  N  N     . VAL C 2  441  ? 475.390 -21.758 671.756 1.00 76.11  ? 441  VAL C N     1 
ATOM   6985  C  CA    . VAL C 2  441  ? 475.221 -20.446 672.364 1.00 81.52  ? 441  VAL C CA    1 
ATOM   6986  C  C     . VAL C 2  441  ? 476.045 -19.395 671.605 1.00 73.81  ? 441  VAL C C     1 
ATOM   6987  O  O     . VAL C 2  441  ? 475.511 -18.340 671.213 1.00 61.45  ? 441  VAL C O     1 
ATOM   6988  C  CB    . VAL C 2  441  ? 475.570 -20.486 673.875 1.00 75.00  ? 441  VAL C CB    1 
ATOM   6989  C  CG1   . VAL C 2  441  ? 475.598 -19.071 674.530 1.00 73.94  ? 441  VAL C CG1   1 
ATOM   6990  C  CG2   . VAL C 2  441  ? 474.636 -21.409 674.613 1.00 67.37  ? 441  VAL C CG2   1 
ATOM   6991  N  N     . GLU C 2  442  ? 477.365 -19.641 671.456 1.00 81.99  ? 442  GLU C N     1 
ATOM   6992  C  CA    . GLU C 2  442  ? 478.312 -18.588 671.077 1.00 82.51  ? 442  GLU C CA    1 
ATOM   6993  C  C     . GLU C 2  442  ? 478.333 -18.480 669.558 1.00 70.60  ? 442  GLU C C     1 
ATOM   6994  O  O     . GLU C 2  442  ? 478.768 -19.402 668.864 1.00 67.45  ? 442  GLU C O     1 
ATOM   6995  C  CB    . GLU C 2  442  ? 479.698 -18.885 671.645 1.00 90.07  ? 442  GLU C CB    1 
ATOM   6996  C  CG    . GLU C 2  442  ? 480.683 -17.729 671.481 1.00 94.83  ? 442  GLU C CG    1 
ATOM   6997  C  CD    . GLU C 2  442  ? 482.129 -18.189 671.405 1.00 102.03 ? 442  GLU C CD    1 
ATOM   6998  O  OE1   . GLU C 2  442  ? 482.793 -17.882 670.372 1.00 108.72 ? 442  GLU C OE1   1 
ATOM   6999  O  OE2   . GLU C 2  442  ? 482.597 -18.865 672.355 1.00 102.32 ? 442  GLU C OE2   1 
ATOM   7000  N  N     . THR C 2  443  ? 477.660 -17.432 669.084 1.00 62.87  ? 443  THR C N     1 
ATOM   7001  C  CA    . THR C 2  443  ? 477.484 -16.963 667.721 1.00 65.18  ? 443  THR C CA    1 
ATOM   7002  C  C     . THR C 2  443  ? 477.249 -15.466 667.767 1.00 64.52  ? 443  THR C C     1 
ATOM   7003  O  O     . THR C 2  443  ? 476.853 -14.938 668.805 1.00 68.24  ? 443  THR C O     1 
ATOM   7004  C  CB    . THR C 2  443  ? 476.280 -17.610 667.044 1.00 73.07  ? 443  THR C CB    1 
ATOM   7005  O  OG1   . THR C 2  443  ? 476.239 -17.213 665.662 1.00 82.97  ? 443  THR C OG1   1 
ATOM   7006  C  CG2   . THR C 2  443  ? 475.010 -17.183 667.742 1.00 72.86  ? 443  THR C CG2   1 
ATOM   7007  N  N     . PRO C 2  444  ? 477.545 -14.741 666.694 1.00 69.26  ? 444  PRO C N     1 
ATOM   7008  C  CA    . PRO C 2  444  ? 477.271 -13.301 666.729 1.00 69.17  ? 444  PRO C CA    1 
ATOM   7009  C  C     . PRO C 2  444  ? 475.773 -13.070 666.677 1.00 62.95  ? 444  PRO C C     1 
ATOM   7010  O  O     . PRO C 2  444  ? 475.045 -13.794 666.001 1.00 58.94  ? 444  PRO C O     1 
ATOM   7011  C  CB    . PRO C 2  444  ? 477.951 -12.767 665.461 1.00 72.98  ? 444  PRO C CB    1 
ATOM   7012  C  CG    . PRO C 2  444  ? 478.968 -13.811 665.102 1.00 72.37  ? 444  PRO C CG    1 
ATOM   7013  C  CD    . PRO C 2  444  ? 478.354 -15.115 665.519 1.00 69.84  ? 444  PRO C CD    1 
ATOM   7014  N  N     . GLU C 2  445  ? 475.307 -12.074 667.402 1.00 74.69  ? 445  GLU C N     1 
ATOM   7015  C  CA    . GLU C 2  445  ? 473.929 -11.629 667.251 1.00 84.20  ? 445  GLU C CA    1 
ATOM   7016  C  C     . GLU C 2  445  ? 473.863 -10.721 666.029 1.00 80.76  ? 445  GLU C C     1 
ATOM   7017  O  O     . GLU C 2  445  ? 474.700 -9.827  665.858 1.00 77.17  ? 445  GLU C O     1 
ATOM   7018  C  CB    . GLU C 2  445  ? 473.414 -10.994 668.552 1.00 99.78  ? 445  GLU C CB    1 
ATOM   7019  C  CG    . GLU C 2  445  ? 473.388 -9.495  668.694 1.00 108.83 ? 445  GLU C CG    1 
ATOM   7020  C  CD    . GLU C 2  445  ? 472.798 -9.087  670.039 1.00 115.32 ? 445  GLU C CD    1 
ATOM   7021  O  OE1   . GLU C 2  445  ? 473.587 -8.915  670.995 1.00 118.02 ? 445  GLU C OE1   1 
ATOM   7022  O  OE2   . GLU C 2  445  ? 471.560 -8.965  670.153 1.00 119.40 ? 445  GLU C OE2   1 
ATOM   7023  N  N     . GLY C 2  446  ? 472.788 -10.831 665.273 1.00 84.95  ? 446  GLY C N     1 
ATOM   7024  C  CA    . GLY C 2  446  ? 472.634 -10.044 664.053 1.00 89.88  ? 446  GLY C CA    1 
ATOM   7025  C  C     . GLY C 2  446  ? 472.910 -10.814 662.768 1.00 88.94  ? 446  GLY C C     1 
ATOM   7026  O  O     . GLY C 2  446  ? 472.826 -12.049 662.704 1.00 88.02  ? 446  GLY C O     1 
ATOM   7027  N  N     . ALA C 2  447  ? 473.249 -10.048 661.718 1.00 85.56  ? 447  ALA C N     1 
ATOM   7028  C  CA    . ALA C 2  447  ? 473.331 -10.594 660.361 1.00 66.13  ? 447  ALA C CA    1 
ATOM   7029  C  C     . ALA C 2  447  ? 474.196 -11.837 660.235 1.00 61.30  ? 447  ALA C C     1 
ATOM   7030  O  O     . ALA C 2  447  ? 473.848 -12.750 659.497 1.00 55.56  ? 447  ALA C O     1 
ATOM   7031  C  CB    . ALA C 2  447  ? 473.871 -9.522  659.445 1.00 58.89  ? 447  ALA C CB    1 
ATOM   7032  N  N     . ASN C 2  448  ? 475.218 -11.968 661.047 1.00 62.49  ? 448  ASN C N     1 
ATOM   7033  C  CA    . ASN C 2  448  ? 476.137 -13.093 660.975 1.00 74.24  ? 448  ASN C CA    1 
ATOM   7034  C  C     . ASN C 2  448  ? 475.680 -14.307 661.791 1.00 71.72  ? 448  ASN C C     1 
ATOM   7035  O  O     . ASN C 2  448  ? 476.424 -15.298 661.886 1.00 71.57  ? 448  ASN C O     1 
ATOM   7036  C  CB    . ASN C 2  448  ? 477.532 -12.635 661.390 1.00 83.90  ? 448  ASN C CB    1 
ATOM   7037  C  CG    . ASN C 2  448  ? 478.226 -11.819 660.296 1.00 92.91  ? 448  ASN C CG    1 
ATOM   7038  O  OD1   . ASN C 2  448  ? 478.108 -12.116 659.094 1.00 94.97  ? 448  ASN C OD1   1 
ATOM   7039  N  ND2   . ASN C 2  448  ? 478.920 -10.764 660.703 1.00 97.91  ? 448  ASN C ND2   1 
ATOM   7040  N  N     . ILE C 2  449  ? 474.472 -14.252 662.356 1.00 63.75  ? 449  ILE C N     1 
ATOM   7041  C  CA    . ILE C 2  449  ? 473.965 -15.303 663.224 1.00 67.72  ? 449  ILE C CA    1 
ATOM   7042  C  C     . ILE C 2  449  ? 473.982 -16.685 662.599 1.00 65.53  ? 449  ILE C C     1 
ATOM   7043  O  O     . ILE C 2  449  ? 473.467 -16.902 661.495 1.00 70.78  ? 449  ILE C O     1 
ATOM   7044  C  CB    . ILE C 2  449  ? 472.530 -14.947 663.601 1.00 79.17  ? 449  ILE C CB    1 
ATOM   7045  C  CG1   . ILE C 2  449  ? 472.014 -15.868 664.736 1.00 87.97  ? 449  ILE C CG1   1 
ATOM   7046  C  CG2   . ILE C 2  449  ? 471.686 -14.762 662.313 1.00 72.98  ? 449  ILE C CG2   1 
ATOM   7047  C  CD1   . ILE C 2  449  ? 472.289 -15.359 666.135 1.00 90.98  ? 449  ILE C CD1   1 
ATOM   7048  N  N     . GLY C 2  450  ? 474.591 -17.637 663.315 1.00 66.44  ? 450  GLY C N     1 
ATOM   7049  C  CA    . GLY C 2  450  ? 474.687 -19.012 662.861 1.00 68.91  ? 450  GLY C CA    1 
ATOM   7050  C  C     . GLY C 2  450  ? 475.791 -19.338 661.888 1.00 77.23  ? 450  GLY C C     1 
ATOM   7051  O  O     . GLY C 2  450  ? 476.142 -20.518 661.761 1.00 83.99  ? 450  GLY C O     1 
ATOM   7052  N  N     . LEU C 2  451  ? 476.378 -18.326 661.227 1.00 77.55  ? 451  LEU C N     1 
ATOM   7053  C  CA    . LEU C 2  451  ? 477.490 -18.500 660.285 1.00 79.26  ? 451  LEU C CA    1 
ATOM   7054  C  C     . LEU C 2  451  ? 478.850 -18.597 660.969 1.00 83.97  ? 451  LEU C C     1 
ATOM   7055  O  O     . LEU C 2  451  ? 479.725 -19.375 660.545 1.00 78.92  ? 451  LEU C O     1 
ATOM   7056  C  CB    . LEU C 2  451  ? 477.479 -17.340 659.291 1.00 73.93  ? 451  LEU C CB    1 
ATOM   7057  C  CG    . LEU C 2  451  ? 476.193 -17.032 658.509 1.00 70.25  ? 451  LEU C CG    1 
ATOM   7058  C  CD1   . LEU C 2  451  ? 476.461 -15.942 657.506 1.00 68.99  ? 451  LEU C CD1   1 
ATOM   7059  C  CD2   . LEU C 2  451  ? 475.718 -18.261 657.755 1.00 71.72  ? 451  LEU C CD2   1 
ATOM   7060  N  N     . ILE C 2  452  ? 479.065 -17.760 661.969 1.00 86.34  ? 452  ILE C N     1 
ATOM   7061  C  CA    . ILE C 2  452  ? 480.258 -17.789 662.805 1.00 77.77  ? 452  ILE C CA    1 
ATOM   7062  C  C     . ILE C 2  452  ? 479.880 -18.429 664.135 1.00 76.95  ? 452  ILE C C     1 
ATOM   7063  O  O     . ILE C 2  452  ? 478.910 -18.017 664.776 1.00 74.12  ? 452  ILE C O     1 
ATOM   7064  C  CB    . ILE C 2  452  ? 480.831 -16.382 662.977 1.00 65.11  ? 452  ILE C CB    1 
ATOM   7065  C  CG1   . ILE C 2  452  ? 480.777 -15.683 661.624 1.00 61.42  ? 452  ILE C CG1   1 
ATOM   7066  C  CG2   . ILE C 2  452  ? 482.175 -16.432 663.557 1.00 62.31  ? 452  ILE C CG2   1 
ATOM   7067  C  CD1   . ILE C 2  452  ? 481.014 -14.249 661.712 1.00 58.58  ? 452  ILE C CD1   1 
ATOM   7068  N  N     . THR C 2  453  ? 480.582 -19.495 664.492 1.00 82.25  ? 453  THR C N     1 
ATOM   7069  C  CA    . THR C 2  453  ? 480.323 -20.298 665.674 1.00 85.64  ? 453  THR C CA    1 
ATOM   7070  C  C     . THR C 2  453  ? 481.648 -20.555 666.368 1.00 86.89  ? 453  THR C C     1 
ATOM   7071  O  O     . THR C 2  453  ? 482.657 -19.933 666.055 1.00 91.68  ? 453  THR C O     1 
ATOM   7072  C  CB    . THR C 2  453  ? 479.590 -21.608 665.349 1.00 89.58  ? 453  THR C CB    1 
ATOM   7073  O  OG1   . THR C 2  453  ? 480.088 -22.196 664.134 1.00 88.51  ? 453  THR C OG1   1 
ATOM   7074  C  CG2   . THR C 2  453  ? 478.087 -21.334 665.226 1.00 90.57  ? 453  THR C CG2   1 
ATOM   7075  N  N     . SER C 2  454  ? 481.618 -21.354 667.417 1.00 86.52  ? 454  SER C N     1 
ATOM   7076  C  CA    . SER C 2  454  ? 482.808 -21.607 668.209 1.00 84.21  ? 454  SER C CA    1 
ATOM   7077  C  C     . SER C 2  454  ? 482.906 -23.096 668.466 1.00 90.27  ? 454  SER C C     1 
ATOM   7078  O  O     . SER C 2  454  ? 481.902 -23.778 668.682 1.00 95.95  ? 454  SER C O     1 
ATOM   7079  C  CB    . SER C 2  454  ? 482.836 -20.860 669.537 1.00 81.95  ? 454  SER C CB    1 
ATOM   7080  O  OG    . SER C 2  454  ? 484.173 -20.514 669.871 1.00 79.87  ? 454  SER C OG    1 
ATOM   7081  N  N     . LEU C 2  455  ? 484.126 -23.588 668.415 1.00 89.61  ? 455  LEU C N     1 
ATOM   7082  C  CA    . LEU C 2  455  ? 484.391 -24.990 668.662 1.00 89.54  ? 455  LEU C CA    1 
ATOM   7083  C  C     . LEU C 2  455  ? 483.998 -25.367 670.083 1.00 88.52  ? 455  LEU C C     1 
ATOM   7084  O  O     . LEU C 2  455  ? 484.206 -24.582 671.018 1.00 88.93  ? 455  LEU C O     1 
ATOM   7085  C  CB    . LEU C 2  455  ? 485.878 -25.252 668.441 1.00 86.90  ? 455  LEU C CB    1 
ATOM   7086  C  CG    . LEU C 2  455  ? 486.180 -26.733 668.370 1.00 90.50  ? 455  LEU C CG    1 
ATOM   7087  C  CD1   . LEU C 2  455  ? 485.455 -27.357 667.200 1.00 88.77  ? 455  LEU C CD1   1 
ATOM   7088  C  CD2   . LEU C 2  455  ? 487.674 -26.952 668.308 1.00 93.69  ? 455  LEU C CD2   1 
ATOM   7089  N  N     . ALA C 2  456  ? 483.337 -26.527 670.231 1.00 90.01  ? 456  ALA C N     1 
ATOM   7090  C  CA    . ALA C 2  456  ? 482.975 -26.983 671.569 1.00 96.80  ? 456  ALA C CA    1 
ATOM   7091  C  C     . ALA C 2  456  ? 484.220 -27.368 672.369 1.00 98.59  ? 456  ALA C C     1 
ATOM   7092  O  O     . ALA C 2  456  ? 485.241 -27.786 671.815 1.00 100.64 ? 456  ALA C O     1 
ATOM   7093  C  CB    . ALA C 2  456  ? 482.041 -28.187 671.503 1.00 99.66  ? 456  ALA C CB    1 
ATOM   7094  N  N     . ALA C 2  457  ? 484.069 -27.354 673.697 1.00 97.75  ? 457  ALA C N     1 
ATOM   7095  C  CA    . ALA C 2  457  ? 485.233 -27.488 674.570 1.00 100.38 ? 457  ALA C CA    1 
ATOM   7096  C  C     . ALA C 2  457  ? 485.927 -28.830 674.426 1.00 104.20 ? 457  ALA C C     1 
ATOM   7097  O  O     . ALA C 2  457  ? 487.152 -28.883 674.255 1.00 106.22 ? 457  ALA C O     1 
ATOM   7098  C  CB    . ALA C 2  457  ? 484.829 -27.262 676.017 1.00 107.85 ? 457  ALA C CB    1 
ATOM   7099  N  N     . TYR C 2  458  ? 485.171 -29.916 674.367 1.00 103.14 ? 458  TYR C N     1 
ATOM   7100  C  CA    . TYR C 2  458  ? 485.853 -31.196 674.284 1.00 110.30 ? 458  TYR C CA    1 
ATOM   7101  C  C     . TYR C 2  458  ? 486.035 -31.655 672.878 1.00 110.27 ? 458  TYR C C     1 
ATOM   7102  O  O     . TYR C 2  458  ? 486.525 -32.772 672.676 1.00 113.25 ? 458  TYR C O     1 
ATOM   7103  C  CB    . TYR C 2  458  ? 485.126 -32.294 675.039 1.00 114.57 ? 458  TYR C CB    1 
ATOM   7104  C  CG    . TYR C 2  458  ? 485.503 -32.407 676.493 1.00 116.30 ? 458  TYR C CG    1 
ATOM   7105  C  CD1   . TYR C 2  458  ? 486.750 -32.909 676.857 1.00 119.44 ? 458  TYR C CD1   1 
ATOM   7106  C  CD2   . TYR C 2  458  ? 484.617 -32.069 677.501 1.00 111.39 ? 458  TYR C CD2   1 
ATOM   7107  C  CE1   . TYR C 2  458  ? 487.118 -33.040 678.187 1.00 117.96 ? 458  TYR C CE1   1 
ATOM   7108  C  CE2   . TYR C 2  458  ? 484.977 -32.207 678.833 1.00 113.66 ? 458  TYR C CE2   1 
ATOM   7109  C  CZ    . TYR C 2  458  ? 486.227 -32.690 679.165 1.00 114.07 ? 458  TYR C CZ    1 
ATOM   7110  O  OH    . TYR C 2  458  ? 486.584 -32.821 680.478 1.00 114.21 ? 458  TYR C OH    1 
ATOM   7111  N  N     . ALA C 2  459  ? 485.634 -30.832 671.914 1.00 112.23 ? 459  ALA C N     1 
ATOM   7112  C  CA    . ALA C 2  459  ? 485.705 -31.239 670.526 1.00 106.14 ? 459  ALA C CA    1 
ATOM   7113  C  C     . ALA C 2  459  ? 487.133 -31.106 670.032 1.00 100.63 ? 459  ALA C C     1 
ATOM   7114  O  O     . ALA C 2  459  ? 487.860 -30.165 670.372 1.00 97.02  ? 459  ALA C O     1 
ATOM   7115  C  CB    . ALA C 2  459  ? 484.780 -30.388 669.653 1.00 105.18 ? 459  ALA C CB    1 
ATOM   7116  N  N     . ARG C 2  460  ? 487.495 -32.014 669.153 1.00 97.93  ? 460  ARG C N     1 
ATOM   7117  C  CA    . ARG C 2  460  ? 488.711 -31.885 668.389 1.00 97.76  ? 460  ARG C CA    1 
ATOM   7118  C  C     . ARG C 2  460  ? 488.390 -32.298 666.964 1.00 96.45  ? 460  ARG C C     1 
ATOM   7119  O  O     . ARG C 2  460  ? 487.569 -33.196 666.730 1.00 94.13  ? 460  ARG C O     1 
ATOM   7120  C  CB    . ARG C 2  460  ? 489.858 -32.725 668.943 1.00 108.11 ? 460  ARG C CB    1 
ATOM   7121  C  CG    . ARG C 2  460  ? 489.486 -33.997 669.682 1.00 117.90 ? 460  ARG C CG    1 
ATOM   7122  C  CD    . ARG C 2  460  ? 490.663 -35.022 669.622 1.00 127.52 ? 460  ARG C CD    1 
ATOM   7123  N  NE    . ARG C 2  460  ? 491.950 -34.453 670.003 1.00 128.60 ? 460  ARG C NE    1 
ATOM   7124  C  CZ    . ARG C 2  460  ? 492.419 -34.427 671.240 1.00 133.35 ? 460  ARG C CZ    1 
ATOM   7125  N  NH1   . ARG C 2  460  ? 491.702 -34.936 672.234 1.00 136.14 ? 460  ARG C NH1   1 
ATOM   7126  N  NH2   . ARG C 2  460  ? 493.600 -33.877 671.479 1.00 135.18 ? 460  ARG C NH2   1 
ATOM   7127  N  N     . VAL C 2  461  ? 489.064 -31.635 666.021 1.00 90.98  ? 461  VAL C N     1 
ATOM   7128  C  CA    . VAL C 2  461  ? 488.907 -31.893 664.598 1.00 87.55  ? 461  VAL C CA    1 
ATOM   7129  C  C     . VAL C 2  461  ? 489.844 -33.015 664.173 1.00 95.49  ? 461  VAL C C     1 
ATOM   7130  O  O     . VAL C 2  461  ? 491.057 -32.929 664.397 1.00 103.45 ? 461  VAL C O     1 
ATOM   7131  C  CB    . VAL C 2  461  ? 489.187 -30.623 663.800 1.00 82.33  ? 461  VAL C CB    1 
ATOM   7132  C  CG1   . VAL C 2  461  ? 488.931 -30.904 662.315 1.00 83.00  ? 461  VAL C CG1   1 
ATOM   7133  C  CG2   . VAL C 2  461  ? 488.377 -29.447 664.360 1.00 72.86  ? 461  VAL C CG2   1 
ATOM   7134  N  N     . ASP C 2  462  ? 489.282 -34.093 663.615 1.00 97.81  ? 462  ASP C N     1 
ATOM   7135  C  CA    . ASP C 2  462  ? 490.100 -35.212 663.155 1.00 108.99 ? 462  ASP C CA    1 
ATOM   7136  C  C     . ASP C 2  462  ? 490.841 -34.868 661.845 1.00 117.87 ? 462  ASP C C     1 
ATOM   7137  O  O     . ASP C 2  462  ? 490.747 -33.759 661.292 1.00 115.85 ? 462  ASP C O     1 
ATOM   7138  C  CB    . ASP C 2  462  ? 489.282 -36.511 663.060 1.00 113.69 ? 462  ASP C CB    1 
ATOM   7139  C  CG    . ASP C 2  462  ? 488.192 -36.485 661.983 1.00 119.94 ? 462  ASP C CG    1 
ATOM   7140  O  OD1   . ASP C 2  462  ? 488.246 -35.689 661.015 1.00 121.93 ? 462  ASP C OD1   1 
ATOM   7141  O  OD2   . ASP C 2  462  ? 487.296 -37.349 662.070 1.00 123.35 ? 462  ASP C OD2   1 
ATOM   7142  N  N     . GLU C 2  463  ? 491.588 -35.869 661.352 1.00 120.16 ? 463  GLU C N     1 
ATOM   7143  C  CA    . GLU C 2  463  ? 492.470 -35.719 660.199 1.00 114.35 ? 463  GLU C CA    1 
ATOM   7144  C  C     . GLU C 2  463  ? 491.700 -35.455 658.914 1.00 112.89 ? 463  GLU C C     1 
ATOM   7145  O  O     . GLU C 2  463  ? 492.216 -34.808 657.994 1.00 109.46 ? 463  GLU C O     1 
ATOM   7146  C  CB    . GLU C 2  463  ? 493.213 -37.027 660.025 1.00 119.41 ? 463  GLU C CB    1 
ATOM   7147  C  CG    . GLU C 2  463  ? 493.988 -37.469 661.221 1.00 129.26 ? 463  GLU C CG    1 
ATOM   7148  C  CD    . GLU C 2  463  ? 494.438 -38.917 661.063 1.00 143.50 ? 463  GLU C CD    1 
ATOM   7149  O  OE1   . GLU C 2  463  ? 494.115 -39.510 660.008 1.00 147.68 ? 463  GLU C OE1   1 
ATOM   7150  O  OE2   . GLU C 2  463  ? 495.075 -39.477 661.988 1.00 148.70 ? 463  GLU C OE2   1 
ATOM   7151  N  N     . LEU C 2  464  ? 490.469 -35.948 658.835 1.00 109.92 ? 464  LEU C N     1 
ATOM   7152  C  CA    . LEU C 2  464  ? 489.635 -35.727 657.666 1.00 107.90 ? 464  LEU C CA    1 
ATOM   7153  C  C     . LEU C 2  464  ? 488.948 -34.383 657.689 1.00 110.12 ? 464  LEU C C     1 
ATOM   7154  O  O     . LEU C 2  464  ? 488.446 -33.944 656.652 1.00 114.33 ? 464  LEU C O     1 
ATOM   7155  C  CB    . LEU C 2  464  ? 488.626 -36.859 657.517 1.00 102.73 ? 464  LEU C CB    1 
ATOM   7156  C  CG    . LEU C 2  464  ? 489.374 -38.169 657.208 1.00 102.80 ? 464  LEU C CG    1 
ATOM   7157  C  CD1   . LEU C 2  464  ? 488.488 -39.193 656.505 1.00 100.76 ? 464  LEU C CD1   1 
ATOM   7158  C  CD2   . LEU C 2  464  ? 490.652 -37.926 656.402 1.00 103.08 ? 464  LEU C CD2   1 
ATOM   7159  N  N     . GLY C 2  465  ? 488.883 -33.739 658.842 1.00 110.13 ? 465  GLY C N     1 
ATOM   7160  C  CA    . GLY C 2  465  ? 488.288 -32.429 658.937 1.00 112.94 ? 465  GLY C CA    1 
ATOM   7161  C  C     . GLY C 2  465  ? 486.904 -32.431 659.512 1.00 112.66 ? 465  GLY C C     1 
ATOM   7162  O  O     . GLY C 2  465  ? 486.219 -31.403 659.426 1.00 112.61 ? 465  GLY C O     1 
ATOM   7163  N  N     . PHE C 2  466  ? 486.450 -33.575 660.033 1.00 120.34 ? 466  PHE C N     1 
ATOM   7164  C  CA    . PHE C 2  466  ? 485.154 -33.699 660.682 1.00 122.99 ? 466  PHE C CA    1 
ATOM   7165  C  C     . PHE C 2  466  ? 485.345 -33.509 662.181 1.00 121.34 ? 466  PHE C C     1 
ATOM   7166  O  O     . PHE C 2  466  ? 486.331 -33.994 662.746 1.00 121.97 ? 466  PHE C O     1 
ATOM   7167  C  CB    . PHE C 2  466  ? 484.556 -35.085 660.440 1.00 132.88 ? 466  PHE C CB    1 
ATOM   7168  C  CG    . PHE C 2  466  ? 484.380 -35.440 658.996 1.00 139.51 ? 466  PHE C CG    1 
ATOM   7169  C  CD1   . PHE C 2  466  ? 484.340 -34.463 658.015 1.00 138.91 ? 466  PHE C CD1   1 
ATOM   7170  C  CD2   . PHE C 2  466  ? 484.276 -36.769 658.622 1.00 143.91 ? 466  PHE C CD2   1 
ATOM   7171  C  CE1   . PHE C 2  466  ? 484.192 -34.809 656.690 1.00 139.87 ? 466  PHE C CE1   1 
ATOM   7172  C  CE2   . PHE C 2  466  ? 484.119 -37.119 657.307 1.00 145.58 ? 466  PHE C CE2   1 
ATOM   7173  C  CZ    . PHE C 2  466  ? 484.076 -36.137 656.337 1.00 143.45 ? 466  PHE C CZ    1 
ATOM   7174  N  N     . ILE C 2  467  ? 484.419 -32.785 662.821 1.00 116.43 ? 467  ILE C N     1 
ATOM   7175  C  CA    . ILE C 2  467  ? 484.514 -32.534 664.258 1.00 108.26 ? 467  ILE C CA    1 
ATOM   7176  C  C     . ILE C 2  467  ? 484.035 -33.738 665.056 1.00 103.50 ? 467  ILE C C     1 
ATOM   7177  O  O     . ILE C 2  467  ? 482.930 -34.252 664.821 1.00 102.10 ? 467  ILE C O     1 
ATOM   7178  C  CB    . ILE C 2  467  ? 483.734 -31.287 664.673 1.00 100.87 ? 467  ILE C CB    1 
ATOM   7179  C  CG1   . ILE C 2  467  ? 484.037 -30.094 663.785 1.00 93.67  ? 467  ILE C CG1   1 
ATOM   7180  C  CG2   . ILE C 2  467  ? 484.018 -30.978 666.127 1.00 106.10 ? 467  ILE C CG2   1 
ATOM   7181  C  CD1   . ILE C 2  467  ? 483.155 -28.898 664.157 1.00 89.72  ? 467  ILE C CD1   1 
ATOM   7182  N  N     . ARG C 2  468  ? 484.864 -34.194 665.999 1.00 105.60 ? 468  ARG C N     1 
ATOM   7183  C  CA    . ARG C 2  468  ? 484.513 -35.322 666.853 1.00 108.23 ? 468  ARG C CA    1 
ATOM   7184  C  C     . ARG C 2  468  ? 484.346 -34.864 668.301 1.00 105.92 ? 468  ARG C C     1 
ATOM   7185  O  O     . ARG C 2  468  ? 484.983 -33.902 668.751 1.00 104.08 ? 468  ARG C O     1 
ATOM   7186  C  CB    . ARG C 2  468  ? 485.539 -36.458 666.764 1.00 113.51 ? 468  ARG C CB    1 
ATOM   7187  C  CG    . ARG C 2  468  ? 485.723 -36.934 665.348 1.00 118.46 ? 468  ARG C CG    1 
ATOM   7188  C  CD    . ARG C 2  468  ? 486.846 -37.934 665.175 1.00 125.10 ? 468  ARG C CD    1 
ATOM   7189  N  NE    . ARG C 2  468  ? 486.348 -39.308 665.133 1.00 129.24 ? 468  ARG C NE    1 
ATOM   7190  C  CZ    . ARG C 2  468  ? 487.047 -40.329 664.650 1.00 134.05 ? 468  ARG C CZ    1 
ATOM   7191  N  NH1   . ARG C 2  468  ? 488.269 -40.118 664.181 1.00 136.86 ? 468  ARG C NH1   1 
ATOM   7192  N  NH2   . ARG C 2  468  ? 486.532 -41.554 664.637 1.00 137.31 ? 468  ARG C NH2   1 
ATOM   7193  N  N     . THR C 2  469  ? 483.479 -35.578 669.026 1.00 106.54 ? 469  THR C N     1 
ATOM   7194  C  CA    . THR C 2  469  ? 483.197 -35.299 670.422 1.00 103.34 ? 469  THR C CA    1 
ATOM   7195  C  C     . THR C 2  469  ? 483.291 -36.605 671.205 1.00 103.16 ? 469  THR C C     1 
ATOM   7196  O  O     . THR C 2  469  ? 483.008 -37.682 670.659 1.00 106.63 ? 469  THR C O     1 
ATOM   7197  C  CB    . THR C 2  469  ? 481.821 -34.623 670.585 1.00 94.66  ? 469  THR C CB    1 
ATOM   7198  O  OG1   . THR C 2  469  ? 481.596 -34.308 671.955 1.00 94.04  ? 469  THR C OG1   1 
ATOM   7199  C  CG2   . THR C 2  469  ? 480.712 -35.534 670.123 1.00 86.22  ? 469  THR C CG2   1 
ATOM   7200  N  N     . PRO C 2  470  ? 483.816 -36.557 672.433 1.00 104.90 ? 470  PRO C N     1 
ATOM   7201  C  CA    . PRO C 2  470  ? 484.040 -37.789 673.210 1.00 107.03 ? 470  PRO C CA    1 
ATOM   7202  C  C     . PRO C 2  470  ? 482.773 -38.361 673.839 1.00 105.57 ? 470  PRO C C     1 
ATOM   7203  O  O     . PRO C 2  470  ? 481.858 -37.621 674.208 1.00 94.15  ? 470  PRO C O     1 
ATOM   7204  C  CB    . PRO C 2  470  ? 485.028 -37.327 674.285 1.00 103.48 ? 470  PRO C CB    1 
ATOM   7205  C  CG    . PRO C 2  470  ? 484.674 -35.880 674.494 1.00 98.28  ? 470  PRO C CG    1 
ATOM   7206  C  CD    . PRO C 2  470  ? 484.305 -35.356 673.142 1.00 96.48  ? 470  PRO C CD    1 
ATOM   7207  N  N     . TYR C 2  471  ? 482.694 -39.702 673.894 1.00 115.66 ? 471  TYR C N     1 
ATOM   7208  C  CA    . TYR C 2  471  ? 481.642 -40.388 674.645 1.00 119.75 ? 471  TYR C CA    1 
ATOM   7209  C  C     . TYR C 2  471  ? 482.229 -41.601 675.359 1.00 130.60 ? 471  TYR C C     1 
ATOM   7210  O  O     . TYR C 2  471  ? 483.157 -42.233 674.845 1.00 134.96 ? 471  TYR C O     1 
ATOM   7211  C  CB    . TYR C 2  471  ? 480.520 -40.868 673.725 1.00 117.14 ? 471  TYR C CB    1 
ATOM   7212  C  CG    . TYR C 2  471  ? 479.753 -39.758 673.040 1.00 115.22 ? 471  TYR C CG    1 
ATOM   7213  C  CD1   . TYR C 2  471  ? 478.969 -38.859 673.749 1.00 112.94 ? 471  TYR C CD1   1 
ATOM   7214  C  CD2   . TYR C 2  471  ? 479.823 -39.616 671.657 1.00 117.32 ? 471  TYR C CD2   1 
ATOM   7215  C  CE1   . TYR C 2  471  ? 478.272 -37.848 673.094 1.00 111.71 ? 471  TYR C CE1   1 
ATOM   7216  C  CE2   . TYR C 2  471  ? 479.138 -38.619 670.996 1.00 115.03 ? 471  TYR C CE2   1 
ATOM   7217  C  CZ    . TYR C 2  471  ? 478.363 -37.736 671.710 1.00 115.62 ? 471  TYR C CZ    1 
ATOM   7218  O  OH    . TYR C 2  471  ? 477.686 -36.745 671.020 1.00 116.91 ? 471  TYR C OH    1 
ATOM   7219  N  N     . ARG C 2  472  ? 481.675 -41.948 676.537 1.00 140.37 ? 472  ARG C N     1 
ATOM   7220  C  CA    . ARG C 2  472  ? 482.107 -43.153 677.256 1.00 145.44 ? 472  ARG C CA    1 
ATOM   7221  C  C     . ARG C 2  472  ? 481.321 -44.391 676.837 1.00 140.84 ? 472  ARG C C     1 
ATOM   7222  O  O     . ARG C 2  472  ? 480.088 -44.368 676.782 1.00 133.47 ? 472  ARG C O     1 
ATOM   7223  C  CB    . ARG C 2  472  ? 482.006 -43.030 678.777 1.00 156.02 ? 472  ARG C CB    1 
ATOM   7224  C  CG    . ARG C 2  472  ? 483.009 -42.105 679.434 1.00 163.45 ? 472  ARG C CG    1 
ATOM   7225  C  CD    . ARG C 2  472  ? 483.382 -42.679 680.816 1.00 172.06 ? 472  ARG C CD    1 
ATOM   7226  N  NE    . ARG C 2  472  ? 482.596 -42.277 681.983 1.00 173.40 ? 472  ARG C NE    1 
ATOM   7227  C  CZ    . ARG C 2  472  ? 482.721 -42.853 683.183 1.00 175.35 ? 472  ARG C CZ    1 
ATOM   7228  N  NH1   . ARG C 2  472  ? 483.574 -43.858 683.359 1.00 177.35 ? 472  ARG C NH1   1 
ATOM   7229  N  NH2   . ARG C 2  472  ? 481.979 -42.443 684.205 1.00 174.60 ? 472  ARG C NH2   1 
ATOM   7230  N  N     . ARG C 2  473  ? 482.037 -45.493 676.618 1.00 146.28 ? 473  ARG C N     1 
ATOM   7231  C  CA    . ARG C 2  473  ? 481.378 -46.750 676.294 1.00 152.06 ? 473  ARG C CA    1 
ATOM   7232  C  C     . ARG C 2  473  ? 480.631 -47.281 677.504 1.00 156.52 ? 473  ARG C C     1 
ATOM   7233  O  O     . ARG C 2  473  ? 481.113 -47.199 678.638 1.00 160.23 ? 473  ARG C O     1 
ATOM   7234  C  CB    . ARG C 2  473  ? 482.370 -47.798 675.806 1.00 152.27 ? 473  ARG C CB    1 
ATOM   7235  C  CG    . ARG C 2  473  ? 481.699 -49.127 675.460 1.00 154.85 ? 473  ARG C CG    1 
ATOM   7236  C  CD    . ARG C 2  473  ? 482.660 -50.104 674.808 1.00 160.77 ? 473  ARG C CD    1 
ATOM   7237  N  NE    . ARG C 2  473  ? 483.297 -49.530 673.629 1.00 160.96 ? 473  ARG C NE    1 
ATOM   7238  C  CZ    . ARG C 2  473  ? 482.752 -49.516 672.418 1.00 162.06 ? 473  ARG C CZ    1 
ATOM   7239  N  NH1   . ARG C 2  473  ? 481.554 -50.051 672.230 1.00 162.26 ? 473  ARG C NH1   1 
ATOM   7240  N  NH2   . ARG C 2  473  ? 483.406 -48.969 671.397 1.00 162.63 ? 473  ARG C NH2   1 
ATOM   7241  N  N     . VAL C 2  474  ? 479.453 -47.844 677.253 1.00 160.88 ? 474  VAL C N     1 
ATOM   7242  C  CA    . VAL C 2  474  ? 478.646 -48.502 678.272 1.00 161.91 ? 474  VAL C CA    1 
ATOM   7243  C  C     . VAL C 2  474  ? 478.372 -49.919 677.790 1.00 166.60 ? 474  VAL C C     1 
ATOM   7244  O  O     . VAL C 2  474  ? 477.694 -50.112 676.775 1.00 170.95 ? 474  VAL C O     1 
ATOM   7245  C  CB    . VAL C 2  474  ? 477.324 -47.758 678.519 1.00 159.04 ? 474  VAL C CB    1 
ATOM   7246  C  CG1   . VAL C 2  474  ? 476.437 -48.549 679.479 1.00 161.70 ? 474  VAL C CG1   1 
ATOM   7247  C  CG2   . VAL C 2  474  ? 477.578 -46.347 679.002 1.00 156.29 ? 474  VAL C CG2   1 
ATOM   7248  N  N     . VAL C 2  475  ? 478.894 -50.911 678.501 1.00 165.86 ? 475  VAL C N     1 
ATOM   7249  C  CA    . VAL C 2  475  ? 478.673 -52.300 678.129 1.00 170.53 ? 475  VAL C CA    1 
ATOM   7250  C  C     . VAL C 2  475  ? 477.807 -52.940 679.204 1.00 173.40 ? 475  VAL C C     1 
ATOM   7251  O  O     . VAL C 2  475  ? 478.141 -52.886 680.392 1.00 172.56 ? 475  VAL C O     1 
ATOM   7252  C  CB    . VAL C 2  475  ? 480.011 -53.046 677.973 1.00 178.16 ? 475  VAL C CB    1 
ATOM   7253  C  CG1   . VAL C 2  475  ? 479.788 -54.468 677.456 1.00 183.89 ? 475  VAL C CG1   1 
ATOM   7254  C  CG2   . VAL C 2  475  ? 480.945 -52.267 677.061 1.00 177.05 ? 475  VAL C CG2   1 
ATOM   7255  N  N     . GLY C 2  476  ? 476.719 -53.576 678.784 1.00 176.29 ? 476  GLY C N     1 
ATOM   7256  C  CA    . GLY C 2  476  ? 475.743 -54.042 679.753 1.00 181.02 ? 476  GLY C CA    1 
ATOM   7257  C  C     . GLY C 2  476  ? 475.174 -52.803 680.404 1.00 176.25 ? 476  GLY C C     1 
ATOM   7258  O  O     . GLY C 2  476  ? 474.652 -51.900 679.734 1.00 175.29 ? 476  GLY C O     1 
ATOM   7259  N  N     . GLY C 2  477  ? 475.280 -52.748 681.732 1.00 179.91 ? 477  GLY C N     1 
ATOM   7260  C  CA    . GLY C 2  477  ? 474.968 -51.550 682.487 1.00 173.36 ? 477  GLY C CA    1 
ATOM   7261  C  C     . GLY C 2  477  ? 476.171 -50.855 683.084 1.00 168.93 ? 477  GLY C C     1 
ATOM   7262  O  O     . GLY C 2  477  ? 475.997 -49.898 683.850 1.00 165.20 ? 477  GLY C O     1 
ATOM   7263  N  N     . VAL C 2  478  ? 477.383 -51.277 682.754 1.00 163.92 ? 478  VAL C N     1 
ATOM   7264  C  CA    . VAL C 2  478  ? 478.595 -50.766 683.374 1.00 161.81 ? 478  VAL C CA    1 
ATOM   7265  C  C     . VAL C 2  478  ? 479.186 -49.705 682.461 1.00 160.01 ? 478  VAL C C     1 
ATOM   7266  O  O     . VAL C 2  478  ? 479.286 -49.903 681.243 1.00 166.77 ? 478  VAL C O     1 
ATOM   7267  C  CB    . VAL C 2  478  ? 479.604 -51.889 683.683 1.00 162.23 ? 478  VAL C CB    1 
ATOM   7268  C  CG1   . VAL C 2  478  ? 480.287 -52.431 682.426 1.00 162.46 ? 478  VAL C CG1   1 
ATOM   7269  C  CG2   . VAL C 2  478  ? 480.634 -51.389 684.679 1.00 162.11 ? 478  VAL C CG2   1 
ATOM   7270  N  N     . VAL C 2  479  ? 479.502 -48.549 683.025 1.00 156.49 ? 479  VAL C N     1 
ATOM   7271  C  CA    . VAL C 2  479  ? 480.109 -47.472 682.255 1.00 153.42 ? 479  VAL C CA    1 
ATOM   7272  C  C     . VAL C 2  479  ? 481.625 -47.613 682.332 1.00 156.22 ? 479  VAL C C     1 
ATOM   7273  O  O     . VAL C 2  479  ? 482.219 -47.440 683.401 1.00 155.09 ? 479  VAL C O     1 
ATOM   7274  C  CB    . VAL C 2  479  ? 479.667 -46.105 682.794 1.00 152.18 ? 479  VAL C CB    1 
ATOM   7275  C  CG1   . VAL C 2  479  ? 480.223 -45.003 681.921 1.00 152.66 ? 479  VAL C CG1   1 
ATOM   7276  C  CG2   . VAL C 2  479  ? 478.146 -46.028 682.885 1.00 149.82 ? 479  VAL C CG2   1 
ATOM   7277  N  N     . THR C 2  480  ? 482.262 -47.882 681.193 1.00 153.66 ? 480  THR C N     1 
ATOM   7278  C  CA    . THR C 2  480  ? 483.709 -48.025 681.187 1.00 157.80 ? 480  THR C CA    1 
ATOM   7279  C  C     . THR C 2  480  ? 484.360 -46.638 681.301 1.00 159.65 ? 480  THR C C     1 
ATOM   7280  O  O     . THR C 2  480  ? 483.690 -45.604 681.244 1.00 155.70 ? 480  THR C O     1 
ATOM   7281  C  CB    . THR C 2  480  ? 484.146 -48.811 679.950 1.00 153.09 ? 480  THR C CB    1 
ATOM   7282  O  OG1   . THR C 2  480  ? 483.552 -48.236 678.781 1.00 152.71 ? 480  THR C OG1   1 
ATOM   7283  C  CG2   . THR C 2  480  ? 483.680 -50.257 680.056 1.00 152.91 ? 480  THR C CG2   1 
ATOM   7284  N  N     . ASP C 2  481  ? 485.691 -46.612 681.410 1.00 172.61 ? 481  ASP C N     1 
ATOM   7285  C  CA    . ASP C 2  481  ? 486.479 -45.381 681.355 1.00 170.83 ? 481  ASP C CA    1 
ATOM   7286  C  C     . ASP C 2  481  ? 487.079 -45.119 679.987 1.00 165.61 ? 481  ASP C C     1 
ATOM   7287  O  O     . ASP C 2  481  ? 487.791 -44.124 679.808 1.00 165.48 ? 481  ASP C O     1 
ATOM   7288  C  CB    . ASP C 2  481  ? 487.595 -45.403 682.403 1.00 177.71 ? 481  ASP C CB    1 
ATOM   7289  C  CG    . ASP C 2  481  ? 487.080 -45.168 683.797 1.00 183.50 ? 481  ASP C CG    1 
ATOM   7290  O  OD1   . ASP C 2  481  ? 487.706 -44.381 684.539 1.00 183.65 ? 481  ASP C OD1   1 
ATOM   7291  O  OD2   . ASP C 2  481  ? 486.024 -45.738 684.136 1.00 186.01 ? 481  ASP C OD2   1 
ATOM   7292  N  N     . GLU C 2  482  ? 486.792 -45.974 679.021 1.00 163.11 ? 482  GLU C N     1 
ATOM   7293  C  CA    . GLU C 2  482  ? 487.314 -45.822 677.679 1.00 155.34 ? 482  GLU C CA    1 
ATOM   7294  C  C     . GLU C 2  482  ? 486.488 -44.770 676.954 1.00 144.50 ? 482  GLU C C     1 
ATOM   7295  O  O     . GLU C 2  482  ? 485.252 -44.824 676.952 1.00 145.90 ? 482  GLU C O     1 
ATOM   7296  C  CB    . GLU C 2  482  ? 487.248 -47.149 676.926 1.00 160.84 ? 482  GLU C CB    1 
ATOM   7297  C  CG    . GLU C 2  482  ? 487.024 -46.963 675.426 1.00 163.32 ? 482  GLU C CG    1 
ATOM   7298  C  CD    . GLU C 2  482  ? 486.457 -48.196 674.743 1.00 167.00 ? 482  GLU C CD    1 
ATOM   7299  O  OE1   . GLU C 2  482  ? 486.913 -48.527 673.612 1.00 167.59 ? 482  GLU C OE1   1 
ATOM   7300  O  OE2   . GLU C 2  482  ? 485.557 -48.827 675.344 1.00 167.45 ? 482  GLU C OE2   1 
ATOM   7301  N  N     . VAL C 2  483  ? 487.160 -43.769 676.407 1.00 136.33 ? 483  VAL C N     1 
ATOM   7302  C  CA    . VAL C 2  483  ? 486.478 -42.677 675.744 1.00 127.37 ? 483  VAL C CA    1 
ATOM   7303  C  C     . VAL C 2  483  ? 486.702 -42.849 674.257 1.00 128.74 ? 483  VAL C C     1 
ATOM   7304  O  O     . VAL C 2  483  ? 487.819 -43.124 673.813 1.00 131.27 ? 483  VAL C O     1 
ATOM   7305  C  CB    . VAL C 2  483  ? 487.007 -41.321 676.234 1.00 123.12 ? 483  VAL C CB    1 
ATOM   7306  C  CG1   . VAL C 2  483  ? 486.316 -40.188 675.504 1.00 112.21 ? 483  VAL C CG1   1 
ATOM   7307  C  CG2   . VAL C 2  483  ? 486.789 -41.217 677.732 1.00 122.23 ? 483  VAL C CG2   1 
ATOM   7308  N  N     . VAL C 2  484  ? 485.637 -42.673 673.488 1.00 126.69 ? 484  VAL C N     1 
ATOM   7309  C  CA    . VAL C 2  484  ? 485.682 -42.769 672.037 1.00 127.85 ? 484  VAL C CA    1 
ATOM   7310  C  C     . VAL C 2  484  ? 485.292 -41.426 671.448 1.00 128.94 ? 484  VAL C C     1 
ATOM   7311  O  O     . VAL C 2  484  ? 484.202 -40.907 671.730 1.00 127.80 ? 484  VAL C O     1 
ATOM   7312  C  CB    . VAL C 2  484  ? 484.756 -43.872 671.513 1.00 132.10 ? 484  VAL C CB    1 
ATOM   7313  C  CG1   . VAL C 2  484  ? 484.779 -43.886 670.000 1.00 131.83 ? 484  VAL C CG1   1 
ATOM   7314  C  CG2   . VAL C 2  484  ? 485.154 -45.223 672.088 1.00 139.48 ? 484  VAL C CG2   1 
ATOM   7315  N  N     . TYR C 2  485  ? 486.172 -40.861 670.642 1.00 126.44 ? 485  TYR C N     1 
ATOM   7316  C  CA    . TYR C 2  485  ? 485.817 -39.660 669.910 1.00 125.58 ? 485  TYR C CA    1 
ATOM   7317  C  C     . TYR C 2  485  ? 485.042 -40.067 668.661 1.00 132.34 ? 485  TYR C C     1 
ATOM   7318  O  O     . TYR C 2  485  ? 485.558 -40.825 667.828 1.00 138.95 ? 485  TYR C O     1 
ATOM   7319  C  CB    . TYR C 2  485  ? 487.060 -38.863 669.573 1.00 115.85 ? 485  TYR C CB    1 
ATOM   7320  C  CG    . TYR C 2  485  ? 487.474 -37.919 670.656 1.00 105.02 ? 485  TYR C CG    1 
ATOM   7321  C  CD1   . TYR C 2  485  ? 486.929 -36.646 670.694 1.00 100.70 ? 485  TYR C CD1   1 
ATOM   7322  C  CD2   . TYR C 2  485  ? 488.413 -38.267 671.608 1.00 106.23 ? 485  TYR C CD2   1 
ATOM   7323  C  CE1   . TYR C 2  485  ? 487.292 -35.745 671.644 1.00 100.39 ? 485  TYR C CE1   1 
ATOM   7324  C  CE2   . TYR C 2  485  ? 488.787 -37.359 672.582 1.00 107.94 ? 485  TYR C CE2   1 
ATOM   7325  C  CZ    . TYR C 2  485  ? 488.212 -36.093 672.588 1.00 105.35 ? 485  TYR C CZ    1 
ATOM   7326  O  OH    . TYR C 2  485  ? 488.538 -35.144 673.523 1.00 106.24 ? 485  TYR C OH    1 
ATOM   7327  N  N     . MET C 2  486  ? 483.811 -39.563 668.516 1.00 130.29 ? 486  MET C N     1 
ATOM   7328  C  CA    . MET C 2  486  ? 482.950 -39.971 667.413 1.00 127.60 ? 486  MET C CA    1 
ATOM   7329  C  C     . MET C 2  486  ? 482.648 -38.829 666.466 1.00 123.26 ? 486  MET C C     1 
ATOM   7330  O  O     . MET C 2  486  ? 482.497 -37.676 666.885 1.00 121.11 ? 486  MET C O     1 
ATOM   7331  C  CB    . MET C 2  486  ? 481.614 -40.514 667.912 1.00 127.01 ? 486  MET C CB    1 
ATOM   7332  C  CG    . MET C 2  486  ? 481.707 -41.791 668.667 1.00 132.60 ? 486  MET C CG    1 
ATOM   7333  S  SD    . MET C 2  486  ? 480.074 -42.371 669.087 1.00 135.50 ? 486  MET C SD    1 
ATOM   7334  C  CE    . MET C 2  486  ? 480.508 -44.031 669.553 1.00 143.58 ? 486  MET C CE    1 
ATOM   7335  N  N     . THR C 2  487  ? 482.552 -39.173 665.184 1.00 125.45 ? 487  THR C N     1 
ATOM   7336  C  CA    . THR C 2  487  ? 482.037 -38.257 664.186 1.00 119.23 ? 487  THR C CA    1 
ATOM   7337  C  C     . THR C 2  487  ? 480.517 -38.212 664.233 1.00 116.13 ? 487  THR C C     1 
ATOM   7338  O  O     . THR C 2  487  ? 479.867 -39.050 664.856 1.00 119.62 ? 487  THR C O     1 
ATOM   7339  C  CB    . THR C 2  487  ? 482.438 -38.753 662.815 1.00 119.24 ? 487  THR C CB    1 
ATOM   7340  O  OG1   . THR C 2  487  ? 481.788 -40.013 662.614 1.00 120.67 ? 487  THR C OG1   1 
ATOM   7341  C  CG2   . THR C 2  487  ? 483.931 -38.978 662.760 1.00 123.71 ? 487  THR C CG2   1 
ATOM   7342  N  N     . ALA C 2  488  ? 479.938 -37.273 663.491 1.00 109.87 ? 488  ALA C N     1 
ATOM   7343  C  CA    . ALA C 2  488  ? 478.486 -37.155 663.523 1.00 110.62 ? 488  ALA C CA    1 
ATOM   7344  C  C     . ALA C 2  488  ? 477.817 -38.363 662.876 1.00 110.00 ? 488  ALA C C     1 
ATOM   7345  O  O     . ALA C 2  488  ? 476.826 -38.886 663.393 1.00 110.19 ? 488  ALA C O     1 
ATOM   7346  C  CB    . ALA C 2  488  ? 478.045 -35.860 662.846 1.00 110.43 ? 488  ALA C CB    1 
ATOM   7347  N  N     . THR C 2  489  ? 478.371 -38.837 661.762 1.00 110.95 ? 489  THR C N     1 
ATOM   7348  C  CA    . THR C 2  489  ? 477.785 -39.965 661.045 1.00 117.88 ? 489  THR C CA    1 
ATOM   7349  C  C     . THR C 2  489  ? 477.775 -41.210 661.916 1.00 117.89 ? 489  THR C C     1 
ATOM   7350  O  O     . THR C 2  489  ? 476.761 -41.902 662.040 1.00 118.81 ? 489  THR C O     1 
ATOM   7351  C  CB    . THR C 2  489  ? 478.577 -40.262 659.741 1.00 121.94 ? 489  THR C CB    1 
ATOM   7352  O  OG1   . THR C 2  489  ? 478.740 -39.091 658.923 1.00 122.05 ? 489  THR C OG1   1 
ATOM   7353  C  CG2   . THR C 2  489  ? 477.934 -41.382 658.909 1.00 120.97 ? 489  THR C CG2   1 
ATOM   7354  N  N     . GLU C 2  490  ? 478.897 -41.468 662.573 1.00 124.65 ? 490  GLU C N     1 
ATOM   7355  C  CA    . GLU C 2  490  ? 479.048 -42.626 663.437 1.00 134.93 ? 490  GLU C CA    1 
ATOM   7356  C  C     . GLU C 2  490  ? 478.272 -42.510 664.740 1.00 137.08 ? 490  GLU C C     1 
ATOM   7357  O  O     . GLU C 2  490  ? 477.832 -43.531 665.277 1.00 138.39 ? 490  GLU C O     1 
ATOM   7358  C  CB    . GLU C 2  490  ? 480.543 -42.830 663.649 1.00 147.29 ? 490  GLU C CB    1 
ATOM   7359  C  CG    . GLU C 2  490  ? 480.975 -44.137 664.236 1.00 158.45 ? 490  GLU C CG    1 
ATOM   7360  C  CD    . GLU C 2  490  ? 482.363 -44.025 664.818 1.00 163.84 ? 490  GLU C CD    1 
ATOM   7361  O  OE1   . GLU C 2  490  ? 483.088 -43.071 664.432 1.00 161.54 ? 490  GLU C OE1   1 
ATOM   7362  O  OE2   . GLU C 2  490  ? 482.748 -44.916 665.604 1.00 169.40 ? 490  GLU C OE2   1 
ATOM   7363  N  N     . GLU C 2  491  ? 478.090 -41.296 665.264 1.00 136.07 ? 491  GLU C N     1 
ATOM   7364  C  CA    . GLU C 2  491  ? 477.309 -41.131 666.491 1.00 132.06 ? 491  GLU C CA    1 
ATOM   7365  C  C     . GLU C 2  491  ? 475.867 -41.594 666.334 1.00 129.57 ? 491  GLU C C     1 
ATOM   7366  O  O     . GLU C 2  491  ? 475.304 -42.206 667.249 1.00 129.16 ? 491  GLU C O     1 
ATOM   7367  C  CB    . GLU C 2  491  ? 477.300 -39.661 666.907 1.00 128.57 ? 491  GLU C CB    1 
ATOM   7368  C  CG    . GLU C 2  491  ? 476.373 -39.415 668.067 1.00 128.53 ? 491  GLU C CG    1 
ATOM   7369  C  CD    . GLU C 2  491  ? 476.119 -37.950 668.354 1.00 125.58 ? 491  GLU C CD    1 
ATOM   7370  O  OE1   . GLU C 2  491  ? 474.934 -37.584 668.557 1.00 125.59 ? 491  GLU C OE1   1 
ATOM   7371  O  OE2   . GLU C 2  491  ? 477.095 -37.175 668.410 1.00 123.61 ? 491  GLU C OE2   1 
ATOM   7372  N  N     . ASP C 2  492  ? 475.280 -41.382 665.158 1.00 127.34 ? 492  ASP C N     1 
ATOM   7373  C  CA    . ASP C 2  492  ? 473.890 -41.749 664.924 1.00 131.78 ? 492  ASP C CA    1 
ATOM   7374  C  C     . ASP C 2  492  ? 473.613 -43.242 665.046 1.00 140.75 ? 492  ASP C C     1 
ATOM   7375  O  O     . ASP C 2  492  ? 472.443 -43.635 665.084 1.00 148.20 ? 492  ASP C O     1 
ATOM   7376  C  CB    . ASP C 2  492  ? 473.456 -41.212 663.571 1.00 124.27 ? 492  ASP C CB    1 
ATOM   7377  C  CG    . ASP C 2  492  ? 473.122 -39.742 663.633 1.00 118.25 ? 492  ASP C CG    1 
ATOM   7378  O  OD1   . ASP C 2  492  ? 473.307 -39.143 664.717 1.00 116.15 ? 492  ASP C OD1   1 
ATOM   7379  O  OD2   . ASP C 2  492  ? 472.679 -39.189 662.610 1.00 117.40 ? 492  ASP C OD2   1 
ATOM   7380  N  N     . ARG C 2  493  ? 474.633 -44.086 665.104 1.00 146.50 ? 493  ARG C N     1 
ATOM   7381  C  CA    . ARG C 2  493  ? 474.352 -45.510 665.166 1.00 152.73 ? 493  ARG C CA    1 
ATOM   7382  C  C     . ARG C 2  493  ? 473.926 -45.928 666.568 1.00 153.20 ? 493  ARG C C     1 
ATOM   7383  O  O     . ARG C 2  493  ? 473.102 -46.836 666.710 1.00 158.02 ? 493  ARG C O     1 
ATOM   7384  C  CB    . ARG C 2  493  ? 475.553 -46.345 664.701 1.00 165.62 ? 493  ARG C CB    1 
ATOM   7385  C  CG    . ARG C 2  493  ? 475.480 -46.753 663.222 1.00 174.18 ? 493  ARG C CG    1 
ATOM   7386  C  CD    . ARG C 2  493  ? 476.650 -47.623 662.740 1.00 182.94 ? 493  ARG C CD    1 
ATOM   7387  N  NE    . ARG C 2  493  ? 476.519 -49.026 663.148 1.00 192.70 ? 493  ARG C NE    1 
ATOM   7388  C  CZ    . ARG C 2  493  ? 477.407 -49.682 663.892 1.00 198.93 ? 493  ARG C CZ    1 
ATOM   7389  N  NH1   . ARG C 2  493  ? 478.505 -49.063 664.311 1.00 199.79 ? 493  ARG C NH1   1 
ATOM   7390  N  NH2   . ARG C 2  493  ? 477.203 -50.958 664.214 1.00 202.09 ? 493  ARG C NH2   1 
ATOM   7391  N  N     . TYR C 2  494  ? 474.445 -45.273 667.605 1.00 147.56 ? 494  TYR C N     1 
ATOM   7392  C  CA    . TYR C 2  494  ? 474.320 -45.763 668.967 1.00 146.63 ? 494  TYR C CA    1 
ATOM   7393  C  C     . TYR C 2  494  ? 473.259 -44.994 669.771 1.00 141.97 ? 494  TYR C C     1 
ATOM   7394  O  O     . TYR C 2  494  ? 472.652 -44.022 669.306 1.00 136.56 ? 494  TYR C O     1 
ATOM   7395  C  CB    . TYR C 2  494  ? 475.696 -45.692 669.631 1.00 148.06 ? 494  TYR C CB    1 
ATOM   7396  C  CG    . TYR C 2  494  ? 476.779 -46.185 668.701 1.00 153.25 ? 494  TYR C CG    1 
ATOM   7397  C  CD1   . TYR C 2  494  ? 476.910 -47.534 668.389 1.00 159.75 ? 494  TYR C CD1   1 
ATOM   7398  C  CD2   . TYR C 2  494  ? 477.653 -45.288 668.100 1.00 154.17 ? 494  TYR C CD2   1 
ATOM   7399  C  CE1   . TYR C 2  494  ? 477.905 -47.981 667.503 1.00 164.75 ? 494  TYR C CE1   1 
ATOM   7400  C  CE2   . TYR C 2  494  ? 478.649 -45.717 667.223 1.00 158.44 ? 494  TYR C CE2   1 
ATOM   7401  C  CZ    . TYR C 2  494  ? 478.774 -47.063 666.924 1.00 164.21 ? 494  TYR C CZ    1 
ATOM   7402  O  OH    . TYR C 2  494  ? 479.767 -47.477 666.046 1.00 165.89 ? 494  TYR C OH    1 
ATOM   7403  N  N     . THR C 2  495  ? 473.047 -45.467 671.011 1.00 140.85 ? 495  THR C N     1 
ATOM   7404  C  CA    . THR C 2  495  ? 472.153 -44.888 672.016 1.00 137.04 ? 495  THR C CA    1 
ATOM   7405  C  C     . THR C 2  495  ? 472.994 -44.268 673.136 1.00 133.72 ? 495  THR C C     1 
ATOM   7406  O  O     . THR C 2  495  ? 473.663 -44.989 673.887 1.00 135.64 ? 495  THR C O     1 
ATOM   7407  C  CB    . THR C 2  495  ? 471.243 -45.983 672.587 1.00 138.43 ? 495  THR C CB    1 
ATOM   7408  O  OG1   . THR C 2  495  ? 470.441 -46.569 671.553 1.00 138.18 ? 495  THR C OG1   1 
ATOM   7409  C  CG2   . THR C 2  495  ? 470.334 -45.415 673.666 1.00 138.09 ? 495  THR C CG2   1 
ATOM   7410  N  N     . ILE C 2  496  ? 472.969 -42.940 673.256 1.00 131.53 ? 496  ILE C N     1 
ATOM   7411  C  CA    . ILE C 2  496  ? 473.905 -42.228 674.124 1.00 130.42 ? 496  ILE C CA    1 
ATOM   7412  C  C     . ILE C 2  496  ? 473.206 -41.596 675.319 1.00 124.54 ? 496  ILE C C     1 
ATOM   7413  O  O     . ILE C 2  496  ? 472.453 -40.625 675.167 1.00 116.61 ? 496  ILE C O     1 
ATOM   7414  C  CB    . ILE C 2  496  ? 474.647 -41.142 673.347 1.00 132.19 ? 496  ILE C CB    1 
ATOM   7415  C  CG1   . ILE C 2  496  ? 475.212 -41.718 672.069 1.00 134.63 ? 496  ILE C CG1   1 
ATOM   7416  C  CG2   . ILE C 2  496  ? 475.740 -40.541 674.200 1.00 134.96 ? 496  ILE C CG2   1 
ATOM   7417  C  CD1   . ILE C 2  496  ? 475.932 -40.684 671.310 1.00 135.00 ? 496  ILE C CD1   1 
ATOM   7418  N  N     . ALA C 2  497  ? 473.558 -42.076 676.508 1.00 124.91 ? 497  ALA C N     1 
ATOM   7419  C  CA    . ALA C 2  497  ? 472.967 -41.637 677.762 1.00 124.94 ? 497  ALA C CA    1 
ATOM   7420  C  C     . ALA C 2  497  ? 473.527 -40.281 678.166 1.00 123.99 ? 497  ALA C C     1 
ATOM   7421  O  O     . ALA C 2  497  ? 474.655 -39.922 677.810 1.00 123.87 ? 497  ALA C O     1 
ATOM   7422  C  CB    . ALA C 2  497  ? 473.223 -42.646 678.872 1.00 127.97 ? 497  ALA C CB    1 
ATOM   7423  N  N     . GLN C 2  498  ? 472.727 -39.535 678.924 1.00 121.75 ? 498  GLN C N     1 
ATOM   7424  C  CA    . GLN C 2  498  ? 473.131 -38.229 679.427 1.00 119.57 ? 498  GLN C CA    1 
ATOM   7425  C  C     . GLN C 2  498  ? 474.216 -38.345 680.495 1.00 121.66 ? 498  GLN C C     1 
ATOM   7426  O  O     . GLN C 2  498  ? 474.406 -39.398 681.109 1.00 126.35 ? 498  GLN C O     1 
ATOM   7427  C  CB    . GLN C 2  498  ? 471.934 -37.506 680.015 1.00 116.91 ? 498  GLN C CB    1 
ATOM   7428  C  CG    . GLN C 2  498  ? 471.009 -36.938 678.999 1.00 117.71 ? 498  GLN C CG    1 
ATOM   7429  C  CD    . GLN C 2  498  ? 471.653 -35.777 678.280 1.00 121.92 ? 498  GLN C CD    1 
ATOM   7430  O  OE1   . GLN C 2  498  ? 472.285 -34.921 678.906 1.00 123.81 ? 498  GLN C OE1   1 
ATOM   7431  N  NE2   . GLN C 2  498  ? 471.472 -35.720 676.963 1.00 123.21 ? 498  GLN C NE2   1 
ATOM   7432  N  N     . ALA C 2  499  ? 475.015 -37.278 680.629 1.00 123.74 ? 499  ALA C N     1 
ATOM   7433  C  CA    . ALA C 2  499  ? 476.157 -37.330 681.540 1.00 126.63 ? 499  ALA C CA    1 
ATOM   7434  C  C     . ALA C 2  499  ? 475.776 -37.303 683.021 1.00 127.57 ? 499  ALA C C     1 
ATOM   7435  O  O     . ALA C 2  499  ? 476.539 -37.807 683.852 1.00 132.10 ? 499  ALA C O     1 
ATOM   7436  C  CB    . ALA C 2  499  ? 477.103 -36.163 681.255 1.00 127.02 ? 499  ALA C CB    1 
ATOM   7437  N  N     . ASN C 2  500  ? 474.605 -36.787 683.376 1.00 118.56 ? 500  ASN C N     1 
ATOM   7438  C  CA    . ASN C 2  500  ? 474.248 -36.711 684.787 1.00 112.59 ? 500  ASN C CA    1 
ATOM   7439  C  C     . ASN C 2  500  ? 473.478 -37.931 685.243 1.00 115.16 ? 500  ASN C C     1 
ATOM   7440  O  O     . ASN C 2  500  ? 473.004 -37.961 686.385 1.00 117.67 ? 500  ASN C O     1 
ATOM   7441  C  CB    . ASN C 2  500  ? 473.421 -35.462 685.091 1.00 104.17 ? 500  ASN C CB    1 
ATOM   7442  C  CG    . ASN C 2  500  ? 471.996 -35.546 684.560 1.00 99.01  ? 500  ASN C CG    1 
ATOM   7443  O  OD1   . ASN C 2  500  ? 471.590 -36.535 683.928 1.00 99.51  ? 500  ASN C OD1   1 
ATOM   7444  N  ND2   . ASN C 2  500  ? 471.228 -34.487 684.802 1.00 94.43  ? 500  ASN C ND2   1 
ATOM   7445  N  N     . THR C 2  501  ? 473.318 -38.912 684.372 1.00 112.84 ? 501  THR C N     1 
ATOM   7446  C  CA    . THR C 2  501  ? 472.582 -40.112 684.729 1.00 114.19 ? 501  THR C CA    1 
ATOM   7447  C  C     . THR C 2  501  ? 473.202 -40.844 685.920 1.00 112.54 ? 501  THR C C     1 
ATOM   7448  O  O     . THR C 2  501  ? 474.427 -41.080 685.949 1.00 106.73 ? 501  THR C O     1 
ATOM   7449  C  CB    . THR C 2  501  ? 472.437 -41.031 683.529 1.00 114.69 ? 501  THR C CB    1 
ATOM   7450  O  OG1   . THR C 2  501  ? 473.718 -41.193 682.922 1.00 116.60 ? 501  THR C OG1   1 
ATOM   7451  C  CG2   . THR C 2  501  ? 471.420 -40.442 682.547 1.00 106.64 ? 501  THR C CG2   1 
ATOM   7452  N  N     . PRO C 2  502  ? 472.380 -41.192 686.915 1.00 119.17 ? 502  PRO C N     1 
ATOM   7453  C  CA    . PRO C 2  502  ? 472.846 -41.738 688.194 1.00 132.55 ? 502  PRO C CA    1 
ATOM   7454  C  C     . PRO C 2  502  ? 473.743 -42.955 688.071 1.00 140.26 ? 502  PRO C C     1 
ATOM   7455  O  O     . PRO C 2  502  ? 473.518 -43.860 687.263 1.00 144.98 ? 502  PRO C O     1 
ATOM   7456  C  CB    . PRO C 2  502  ? 471.541 -42.100 688.906 1.00 127.94 ? 502  PRO C CB    1 
ATOM   7457  C  CG    . PRO C 2  502  ? 470.528 -41.197 688.298 1.00 124.24 ? 502  PRO C CG    1 
ATOM   7458  C  CD    . PRO C 2  502  ? 470.916 -41.066 686.870 1.00 105.45 ? 502  PRO C CD    1 
ATOM   7459  N  N     . LEU C 2  503  ? 474.762 -42.970 688.919 1.00 152.58 ? 503  LEU C N     1 
ATOM   7460  C  CA    . LEU C 2  503  ? 475.734 -44.043 688.968 1.00 157.74 ? 503  LEU C CA    1 
ATOM   7461  C  C     . LEU C 2  503  ? 475.933 -44.433 690.419 1.00 158.99 ? 503  LEU C C     1 
ATOM   7462  O  O     . LEU C 2  503  ? 476.021 -43.575 691.301 1.00 158.11 ? 503  LEU C O     1 
ATOM   7463  C  CB    . LEU C 2  503  ? 477.067 -43.568 688.396 1.00 157.84 ? 503  LEU C CB    1 
ATOM   7464  C  CG    . LEU C 2  503  ? 477.020 -43.046 686.966 1.00 155.19 ? 503  LEU C CG    1 
ATOM   7465  C  CD1   . LEU C 2  503  ? 478.386 -42.529 686.556 1.00 153.16 ? 503  LEU C CD1   1 
ATOM   7466  C  CD2   . LEU C 2  503  ? 476.560 -44.170 686.060 1.00 158.28 ? 503  LEU C CD2   1 
ATOM   7467  N  N     . GLU C 2  504  ? 476.013 -45.725 690.661 1.00 159.48 ? 504  GLU C N     1 
ATOM   7468  C  CA    . GLU C 2  504  ? 476.562 -46.234 691.901 1.00 163.39 ? 504  GLU C CA    1 
ATOM   7469  C  C     . GLU C 2  504  ? 477.855 -46.953 691.545 1.00 167.83 ? 504  GLU C C     1 
ATOM   7470  O  O     . GLU C 2  504  ? 477.827 -48.011 690.907 1.00 169.79 ? 504  GLU C O     1 
ATOM   7471  C  CB    . GLU C 2  504  ? 475.567 -47.182 692.573 1.00 167.11 ? 504  GLU C CB    1 
ATOM   7472  C  CG    . GLU C 2  504  ? 474.913 -48.161 691.583 1.00 168.54 ? 504  GLU C CG    1 
ATOM   7473  C  CD    . GLU C 2  504  ? 474.000 -49.196 692.227 1.00 170.66 ? 504  GLU C CD    1 
ATOM   7474  O  OE1   . GLU C 2  504  ? 473.167 -48.828 693.084 1.00 168.74 ? 504  GLU C OE1   1 
ATOM   7475  O  OE2   . GLU C 2  504  ? 474.134 -50.392 691.866 1.00 173.53 ? 504  GLU C OE2   1 
ATOM   7476  N  N     . GLY C 2  505  ? 478.990 -46.367 691.901 1.00 165.19 ? 505  GLY C N     1 
ATOM   7477  C  CA    . GLY C 2  505  ? 480.200 -46.953 691.371 1.00 168.00 ? 505  GLY C CA    1 
ATOM   7478  C  C     . GLY C 2  505  ? 480.204 -46.731 689.885 1.00 158.35 ? 505  GLY C C     1 
ATOM   7479  O  O     . GLY C 2  505  ? 479.868 -45.655 689.384 1.00 155.65 ? 505  GLY C O     1 
ATOM   7480  N  N     . ASN C 2  506  ? 480.536 -47.799 689.174 1.00 166.37 ? 506  ASN C N     1 
ATOM   7481  C  CA    . ASN C 2  506  ? 480.551 -47.837 687.725 1.00 173.09 ? 506  ASN C CA    1 
ATOM   7482  C  C     . ASN C 2  506  ? 479.234 -48.327 687.124 1.00 172.84 ? 506  ASN C C     1 
ATOM   7483  O  O     . ASN C 2  506  ? 479.156 -48.508 685.907 1.00 175.34 ? 506  ASN C O     1 
ATOM   7484  C  CB    . ASN C 2  506  ? 481.708 -48.712 687.245 1.00 184.46 ? 506  ASN C CB    1 
ATOM   7485  C  CG    . ASN C 2  506  ? 482.582 -48.002 686.229 1.00 192.20 ? 506  ASN C CG    1 
ATOM   7486  O  OD1   . ASN C 2  506  ? 482.486 -46.779 686.055 1.00 191.17 ? 506  ASN C OD1   1 
ATOM   7487  N  ND2   . ASN C 2  506  ? 483.435 -48.760 685.545 1.00 196.52 ? 506  ASN C ND2   1 
ATOM   7488  N  N     . ARG C 2  507  ? 478.208 -48.549 687.940 1.00 173.68 ? 507  ARG C N     1 
ATOM   7489  C  CA    . ARG C 2  507  ? 476.929 -49.086 687.483 1.00 172.97 ? 507  ARG C CA    1 
ATOM   7490  C  C     . ARG C 2  507  ? 475.892 -48.003 687.238 1.00 164.54 ? 507  ARG C C     1 
ATOM   7491  O  O     . ARG C 2  507  ? 475.822 -47.010 687.968 1.00 160.29 ? 507  ARG C O     1 
ATOM   7492  C  CB    . ARG C 2  507  ? 476.334 -50.086 688.486 1.00 182.10 ? 507  ARG C CB    1 
ATOM   7493  C  CG    . ARG C 2  507  ? 474.892 -50.515 688.115 1.00 184.51 ? 507  ARG C CG    1 
ATOM   7494  C  CD    . ARG C 2  507  ? 474.346 -51.772 688.793 1.00 191.97 ? 507  ARG C CD    1 
ATOM   7495  N  NE    . ARG C 2  507  ? 475.119 -52.983 688.535 1.00 199.64 ? 507  ARG C NE    1 
ATOM   7496  C  CZ    . ARG C 2  507  ? 475.052 -53.671 687.395 1.00 201.92 ? 507  ARG C CZ    1 
ATOM   7497  N  NH1   . ARG C 2  507  ? 474.254 -53.259 686.412 1.00 199.31 ? 507  ARG C NH1   1 
ATOM   7498  N  NH2   . ARG C 2  507  ? 475.774 -54.774 687.235 1.00 205.46 ? 507  ARG C NH2   1 
ATOM   7499  N  N     . ILE C 2  508  ? 475.110 -48.190 686.178 1.00 159.68 ? 508  ILE C N     1 
ATOM   7500  C  CA    . ILE C 2  508  ? 474.027 -47.269 685.887 1.00 156.87 ? 508  ILE C CA    1 
ATOM   7501  C  C     . ILE C 2  508  ? 472.989 -47.500 686.966 1.00 159.63 ? 508  ILE C C     1 
ATOM   7502  O  O     . ILE C 2  508  ? 472.490 -48.620 687.122 1.00 165.65 ? 508  ILE C O     1 
ATOM   7503  C  CB    . ILE C 2  508  ? 473.435 -47.554 684.505 1.00 152.96 ? 508  ILE C CB    1 
ATOM   7504  C  CG1   . ILE C 2  508  ? 474.462 -47.270 683.409 1.00 152.37 ? 508  ILE C CG1   1 
ATOM   7505  C  CG2   . ILE C 2  508  ? 472.130 -46.793 684.317 1.00 147.75 ? 508  ILE C CG2   1 
ATOM   7506  C  CD1   . ILE C 2  508  ? 473.951 -47.544 682.017 1.00 151.98 ? 508  ILE C CD1   1 
ATOM   7507  N  N     . ALA C 2  509  ? 472.668 -46.453 687.722 1.00 162.72 ? 509  ALA C N     1 
ATOM   7508  C  CA    . ALA C 2  509  ? 471.829 -46.640 688.896 1.00 163.65 ? 509  ALA C CA    1 
ATOM   7509  C  C     . ALA C 2  509  ? 470.354 -46.343 688.668 1.00 162.02 ? 509  ALA C C     1 
ATOM   7510  O  O     . ALA C 2  509  ? 469.575 -46.472 689.609 1.00 167.31 ? 509  ALA C O     1 
ATOM   7511  C  CB    . ALA C 2  509  ? 472.353 -45.781 690.051 1.00 161.71 ? 509  ALA C CB    1 
ATOM   7512  N  N     . ALA C 2  510  ? 469.939 -45.967 687.465 1.00 162.97 ? 510  ALA C N     1 
ATOM   7513  C  CA    . ALA C 2  510  ? 468.543 -45.645 687.210 1.00 162.76 ? 510  ALA C CA    1 
ATOM   7514  C  C     . ALA C 2  510  ? 467.882 -46.754 686.401 1.00 172.69 ? 510  ALA C C     1 
ATOM   7515  O  O     . ALA C 2  510  ? 468.515 -47.390 685.555 1.00 173.15 ? 510  ALA C O     1 
ATOM   7516  C  CB    . ALA C 2  510  ? 468.396 -44.311 686.481 1.00 141.44 ? 510  ALA C CB    1 
ATOM   7517  N  N     . GLU C 2  511  ? 466.596 -46.983 686.664 1.00 188.46 ? 511  GLU C N     1 
ATOM   7518  C  CA    . GLU C 2  511  ? 465.860 -47.989 685.906 1.00 195.86 ? 511  GLU C CA    1 
ATOM   7519  C  C     . GLU C 2  511  ? 465.525 -47.422 684.542 1.00 189.74 ? 511  GLU C C     1 
ATOM   7520  O  O     . GLU C 2  511  ? 465.341 -48.166 683.572 1.00 193.67 ? 511  GLU C O     1 
ATOM   7521  C  CB    . GLU C 2  511  ? 464.601 -48.465 686.635 1.00 200.61 ? 511  GLU C CB    1 
ATOM   7522  C  CG    . GLU C 2  511  ? 463.953 -49.662 685.924 1.00 207.57 ? 511  GLU C CG    1 
ATOM   7523  C  CD    . GLU C 2  511  ? 463.260 -50.621 686.869 1.00 212.36 ? 511  GLU C CD    1 
ATOM   7524  O  OE1   . GLU C 2  511  ? 462.919 -50.199 687.993 1.00 212.67 ? 511  GLU C OE1   1 
ATOM   7525  O  OE2   . GLU C 2  511  ? 463.062 -51.797 686.486 1.00 215.62 ? 511  GLU C OE2   1 
ATOM   7526  N  N     . ARG C 2  512  ? 465.395 -46.106 684.482 1.00 178.11 ? 512  ARG C N     1 
ATOM   7527  C  CA    . ARG C 2  512  ? 465.152 -45.399 683.245 1.00 168.55 ? 512  ARG C CA    1 
ATOM   7528  C  C     . ARG C 2  512  ? 466.187 -44.281 683.173 1.00 159.59 ? 512  ARG C C     1 
ATOM   7529  O  O     . ARG C 2  512  ? 466.380 -43.545 684.151 1.00 159.29 ? 512  ARG C O     1 
ATOM   7530  C  CB    . ARG C 2  512  ? 463.722 -44.861 683.225 1.00 164.51 ? 512  ARG C CB    1 
ATOM   7531  C  CG    . ARG C 2  512  ? 463.426 -43.862 684.326 1.00 165.24 ? 512  ARG C CG    1 
ATOM   7532  C  CD    . ARG C 2  512  ? 462.246 -43.017 683.938 1.00 167.22 ? 512  ARG C CD    1 
ATOM   7533  N  NE    . ARG C 2  512  ? 461.210 -43.861 683.350 1.00 174.13 ? 512  ARG C NE    1 
ATOM   7534  C  CZ    . ARG C 2  512  ? 460.245 -43.421 682.549 1.00 177.22 ? 512  ARG C CZ    1 
ATOM   7535  N  NH1   . ARG C 2  512  ? 460.178 -42.131 682.226 1.00 174.53 ? 512  ARG C NH1   1 
ATOM   7536  N  NH2   . ARG C 2  512  ? 459.346 -44.275 682.070 1.00 181.03 ? 512  ARG C NH2   1 
ATOM   7537  N  N     . VAL C 2  513  ? 466.892 -44.194 682.029 1.00 147.08 ? 513  VAL C N     1 
ATOM   7538  C  CA    . VAL C 2  513  ? 467.965 -43.224 681.815 1.00 130.43 ? 513  VAL C CA    1 
ATOM   7539  C  C     . VAL C 2  513  ? 467.538 -42.263 680.717 1.00 118.59 ? 513  VAL C C     1 
ATOM   7540  O  O     . VAL C 2  513  ? 466.742 -42.598 679.830 1.00 113.47 ? 513  VAL C O     1 
ATOM   7541  C  CB    . VAL C 2  513  ? 469.315 -43.866 681.427 1.00 126.80 ? 513  VAL C CB    1 
ATOM   7542  C  CG1   . VAL C 2  513  ? 469.554 -45.175 682.189 1.00 129.27 ? 513  VAL C CG1   1 
ATOM   7543  C  CG2   . VAL C 2  513  ? 469.427 -44.018 679.924 1.00 125.30 ? 513  VAL C CG2   1 
ATOM   7544  N  N     . VAL C 2  514  ? 468.108 -41.072 680.754 1.00 112.96 ? 514  VAL C N     1 
ATOM   7545  C  CA    . VAL C 2  514  ? 467.823 -40.083 679.736 1.00 109.20 ? 514  VAL C CA    1 
ATOM   7546  C  C     . VAL C 2  514  ? 468.905 -40.234 678.685 1.00 114.96 ? 514  VAL C C     1 
ATOM   7547  O  O     . VAL C 2  514  ? 470.096 -40.066 678.974 1.00 114.64 ? 514  VAL C O     1 
ATOM   7548  C  CB    . VAL C 2  514  ? 467.830 -38.674 680.331 1.00 100.25 ? 514  VAL C CB    1 
ATOM   7549  C  CG1   . VAL C 2  514  ? 467.331 -37.683 679.310 1.00 104.53 ? 514  VAL C CG1   1 
ATOM   7550  C  CG2   . VAL C 2  514  ? 467.033 -38.639 681.619 1.00 92.59  ? 514  VAL C CG2   1 
ATOM   7551  N  N     . ALA C 2  515  ? 468.494 -40.564 677.463 1.00 117.19 ? 515  ALA C N     1 
ATOM   7552  C  CA    . ALA C 2  515  ? 469.442 -40.817 676.391 1.00 119.74 ? 515  ALA C CA    1 
ATOM   7553  C  C     . ALA C 2  515  ? 468.968 -40.165 675.101 1.00 119.94 ? 515  ALA C C     1 
ATOM   7554  O  O     . ALA C 2  515  ? 467.861 -39.621 675.018 1.00 117.82 ? 515  ALA C O     1 
ATOM   7555  C  CB    . ALA C 2  515  ? 469.661 -42.323 676.185 1.00 120.15 ? 515  ALA C CB    1 
ATOM   7556  N  N     . ARG C 2  516  ? 469.836 -40.253 674.085 1.00 122.39 ? 516  ARG C N     1 
ATOM   7557  C  CA    . ARG C 2  516  ? 469.596 -39.772 672.732 1.00 120.11 ? 516  ARG C CA    1 
ATOM   7558  C  C     . ARG C 2  516  ? 469.805 -40.880 671.699 1.00 123.77 ? 516  ARG C C     1 
ATOM   7559  O  O     . ARG C 2  516  ? 470.758 -41.663 671.802 1.00 126.99 ? 516  ARG C O     1 
ATOM   7560  C  CB    . ARG C 2  516  ? 470.534 -38.619 672.411 1.00 118.01 ? 516  ARG C CB    1 
ATOM   7561  C  CG    . ARG C 2  516  ? 470.311 -37.359 673.218 1.00 115.20 ? 516  ARG C CG    1 
ATOM   7562  C  CD    . ARG C 2  516  ? 471.387 -36.366 672.836 1.00 113.91 ? 516  ARG C CD    1 
ATOM   7563  N  NE    . ARG C 2  516  ? 472.716 -36.911 673.121 1.00 116.14 ? 516  ARG C NE    1 
ATOM   7564  C  CZ    . ARG C 2  516  ? 473.726 -36.922 672.252 1.00 114.02 ? 516  ARG C CZ    1 
ATOM   7565  N  NH1   . ARG C 2  516  ? 473.579 -36.423 671.030 1.00 109.94 ? 516  ARG C NH1   1 
ATOM   7566  N  NH2   . ARG C 2  516  ? 474.890 -37.440 672.610 1.00 117.19 ? 516  ARG C NH2   1 
ATOM   7567  N  N     . ARG C 2  517  ? 468.905 -40.947 670.713 1.00 122.77 ? 517  ARG C N     1 
ATOM   7568  C  CA    . ARG C 2  517  ? 469.071 -41.755 669.496 1.00 120.50 ? 517  ARG C CA    1 
ATOM   7569  C  C     . ARG C 2  517  ? 468.870 -40.869 668.277 1.00 112.31 ? 517  ARG C C     1 
ATOM   7570  O  O     . ARG C 2  517  ? 467.783 -40.315 668.069 1.00 105.92 ? 517  ARG C O     1 
ATOM   7571  C  CB    . ARG C 2  517  ? 468.165 -42.986 669.444 1.00 123.32 ? 517  ARG C CB    1 
ATOM   7572  C  CG    . ARG C 2  517  ? 468.618 -44.109 670.337 1.00 126.55 ? 517  ARG C CG    1 
ATOM   7573  C  CD    . ARG C 2  517  ? 467.572 -45.181 670.450 1.00 132.96 ? 517  ARG C CD    1 
ATOM   7574  N  NE    . ARG C 2  517  ? 468.034 -46.259 671.316 1.00 141.91 ? 517  ARG C NE    1 
ATOM   7575  C  CZ    . ARG C 2  517  ? 467.243 -47.109 671.957 1.00 149.14 ? 517  ARG C CZ    1 
ATOM   7576  N  NH1   . ARG C 2  517  ? 465.923 -47.007 671.849 1.00 150.39 ? 517  ARG C NH1   1 
ATOM   7577  N  NH2   . ARG C 2  517  ? 467.783 -48.072 672.695 1.00 153.44 ? 517  ARG C NH2   1 
ATOM   7578  N  N     . LYS C 2  518  ? 469.948 -40.705 667.515 1.00 113.02 ? 518  LYS C N     1 
ATOM   7579  C  CA    . LYS C 2  518  ? 469.995 -39.777 666.392 1.00 114.89 ? 518  LYS C CA    1 
ATOM   7580  C  C     . LYS C 2  518  ? 469.520 -38.409 666.857 1.00 115.05 ? 518  LYS C C     1 
ATOM   7581  O  O     . LYS C 2  518  ? 468.683 -37.757 666.222 1.00 112.30 ? 518  LYS C O     1 
ATOM   7582  C  CB    . LYS C 2  518  ? 469.152 -40.279 665.217 1.00 110.27 ? 518  LYS C CB    1 
ATOM   7583  C  CG    . LYS C 2  518  ? 469.655 -41.559 664.558 1.00 109.86 ? 518  LYS C CG    1 
ATOM   7584  C  CD    . LYS C 2  518  ? 469.015 -41.742 663.173 1.00 110.16 ? 518  LYS C CD    1 
ATOM   7585  C  CE    . LYS C 2  518  ? 469.457 -43.011 662.412 1.00 113.70 ? 518  LYS C CE    1 
ATOM   7586  N  NZ    . LYS C 2  518  ? 469.082 -44.290 663.063 1.00 115.02 ? 518  LYS C NZ    1 
ATOM   7587  N  N     . GLY C 2  519  ? 469.969 -38.033 668.052 1.00 118.28 ? 519  GLY C N     1 
ATOM   7588  C  CA    . GLY C 2  519  ? 469.696 -36.732 668.591 1.00 121.67 ? 519  GLY C CA    1 
ATOM   7589  C  C     . GLY C 2  519  ? 468.321 -36.628 669.195 1.00 125.60 ? 519  GLY C C     1 
ATOM   7590  O  O     . GLY C 2  519  ? 468.075 -35.730 670.022 1.00 121.61 ? 519  GLY C O     1 
ATOM   7591  N  N     . GLU C 2  520  ? 467.420 -37.538 668.813 1.00 130.84 ? 520  GLU C N     1 
ATOM   7592  C  CA    . GLU C 2  520  ? 466.060 -37.509 669.308 1.00 130.24 ? 520  GLU C CA    1 
ATOM   7593  C  C     . GLU C 2  520  ? 466.068 -38.030 670.739 1.00 124.38 ? 520  GLU C C     1 
ATOM   7594  O  O     . GLU C 2  520  ? 466.523 -39.158 670.975 1.00 120.28 ? 520  GLU C O     1 
ATOM   7595  C  CB    . GLU C 2  520  ? 465.163 -38.352 668.395 1.00 138.38 ? 520  GLU C CB    1 
ATOM   7596  C  CG    . GLU C 2  520  ? 463.667 -38.056 668.498 1.00 143.42 ? 520  GLU C CG    1 
ATOM   7597  C  CD    . GLU C 2  520  ? 463.306 -36.696 667.854 1.00 146.03 ? 520  GLU C CD    1 
ATOM   7598  O  OE1   . GLU C 2  520  ? 462.340 -36.037 668.304 1.00 147.39 ? 520  GLU C OE1   1 
ATOM   7599  O  OE2   . GLU C 2  520  ? 463.991 -36.284 666.891 1.00 147.15 ? 520  GLU C OE2   1 
ATOM   7600  N  N     . PRO C 2  521  ? 465.588 -37.257 671.712 1.00 120.42 ? 521  PRO C N     1 
ATOM   7601  C  CA    . PRO C 2  521  ? 465.570 -37.741 673.097 1.00 119.65 ? 521  PRO C CA    1 
ATOM   7602  C  C     . PRO C 2  521  ? 464.526 -38.819 673.348 1.00 118.52 ? 521  PRO C C     1 
ATOM   7603  O  O     . PRO C 2  521  ? 463.354 -38.673 672.993 1.00 119.03 ? 521  PRO C O     1 
ATOM   7604  C  CB    . PRO C 2  521  ? 465.258 -36.477 673.901 1.00 113.79 ? 521  PRO C CB    1 
ATOM   7605  C  CG    . PRO C 2  521  ? 464.538 -35.576 672.939 1.00 112.38 ? 521  PRO C CG    1 
ATOM   7606  C  CD    . PRO C 2  521  ? 465.094 -35.872 671.583 1.00 115.86 ? 521  PRO C CD    1 
ATOM   7607  N  N     . VAL C 2  522  ? 464.937 -39.849 674.087 1.00 119.37 ? 522  VAL C N     1 
ATOM   7608  C  CA    . VAL C 2  522  ? 464.123 -41.037 674.311 1.00 120.59 ? 522  VAL C CA    1 
ATOM   7609  C  C     . VAL C 2  522  ? 464.553 -41.590 675.652 1.00 125.34 ? 522  VAL C C     1 
ATOM   7610  O  O     . VAL C 2  522  ? 465.744 -41.606 675.977 1.00 127.56 ? 522  VAL C O     1 
ATOM   7611  C  CB    . VAL C 2  522  ? 464.326 -42.124 673.226 1.00 128.90 ? 522  VAL C CB    1 
ATOM   7612  C  CG1   . VAL C 2  522  ? 463.422 -43.314 673.479 1.00 133.93 ? 522  VAL C CG1   1 
ATOM   7613  C  CG2   . VAL C 2  522  ? 464.109 -41.578 671.824 1.00 131.25 ? 522  VAL C CG2   1 
ATOM   7614  N  N     . ILE C 2  523  ? 463.588 -42.140 676.382 1.00 122.92 ? 523  ILE C N     1 
ATOM   7615  C  CA    . ILE C 2  523  ? 463.831 -42.793 677.664 1.00 122.87 ? 523  ILE C CA    1 
ATOM   7616  C  C     . ILE C 2  523  ? 464.011 -44.292 677.491 1.00 123.82 ? 523  ILE C C     1 
ATOM   7617  O  O     . ILE C 2  523  ? 463.206 -44.952 676.825 1.00 125.38 ? 523  ILE C O     1 
ATOM   7618  C  CB    . ILE C 2  523  ? 462.691 -42.495 678.650 1.00 115.25 ? 523  ILE C CB    1 
ATOM   7619  C  CG1   . ILE C 2  523  ? 462.563 -40.984 678.870 1.00 107.10 ? 523  ILE C CG1   1 
ATOM   7620  C  CG2   . ILE C 2  523  ? 462.944 -43.199 679.956 1.00 115.39 ? 523  ILE C CG2   1 
ATOM   7621  C  CD1   . ILE C 2  523  ? 463.850 -40.328 679.290 1.00 106.09 ? 523  ILE C CD1   1 
ATOM   7622  N  N     . VAL C 2  524  ? 465.040 -44.842 678.132 1.00 127.82 ? 524  VAL C N     1 
ATOM   7623  C  CA    . VAL C 2  524  ? 465.512 -46.182 677.813 1.00 137.53 ? 524  VAL C CA    1 
ATOM   7624  C  C     . VAL C 2  524  ? 465.992 -46.804 679.122 1.00 144.02 ? 524  VAL C C     1 
ATOM   7625  O  O     . VAL C 2  524  ? 466.434 -46.107 680.044 1.00 142.34 ? 524  VAL C O     1 
ATOM   7626  C  CB    . VAL C 2  524  ? 466.582 -46.170 676.674 1.00 135.25 ? 524  VAL C CB    1 
ATOM   7627  C  CG1   . VAL C 2  524  ? 467.058 -44.748 676.358 1.00 132.09 ? 524  VAL C CG1   1 
ATOM   7628  C  CG2   . VAL C 2  524  ? 467.766 -47.062 676.972 1.00 135.56 ? 524  VAL C CG2   1 
ATOM   7629  N  N     . SER C 2  525  ? 465.876 -48.129 679.203 1.00 151.76 ? 525  SER C N     1 
ATOM   7630  C  CA    . SER C 2  525  ? 466.328 -48.957 680.306 1.00 156.45 ? 525  SER C CA    1 
ATOM   7631  C  C     . SER C 2  525  ? 467.833 -49.199 680.208 1.00 157.25 ? 525  SER C C     1 
ATOM   7632  O  O     . SER C 2  525  ? 468.389 -49.282 679.109 1.00 153.51 ? 525  SER C O     1 
ATOM   7633  C  CB    . SER C 2  525  ? 465.562 -50.285 680.341 1.00 165.48 ? 525  SER C CB    1 
ATOM   7634  O  OG    . SER C 2  525  ? 466.281 -51.358 679.750 1.00 172.07 ? 525  SER C OG    1 
ATOM   7635  N  N     . PRO C 2  526  ? 468.509 -49.305 681.355 1.00 161.89 ? 526  PRO C N     1 
ATOM   7636  C  CA    . PRO C 2  526  ? 469.968 -49.497 681.379 1.00 166.84 ? 526  PRO C CA    1 
ATOM   7637  C  C     . PRO C 2  526  ? 470.500 -50.637 680.506 1.00 171.35 ? 526  PRO C C     1 
ATOM   7638  O  O     . PRO C 2  526  ? 471.690 -50.629 680.164 1.00 168.54 ? 526  PRO C O     1 
ATOM   7639  C  CB    . PRO C 2  526  ? 470.251 -49.766 682.867 1.00 166.67 ? 526  PRO C CB    1 
ATOM   7640  C  CG    . PRO C 2  526  ? 468.946 -50.291 683.418 1.00 167.43 ? 526  PRO C CG    1 
ATOM   7641  C  CD    . PRO C 2  526  ? 467.920 -49.471 682.695 1.00 164.43 ? 526  PRO C CD    1 
ATOM   7642  N  N     . GLU C 2  527  ? 469.660 -51.613 680.123 1.00 182.10 ? 527  GLU C N     1 
ATOM   7643  C  CA    . GLU C 2  527  ? 470.162 -52.669 679.245 1.00 185.35 ? 527  GLU C CA    1 
ATOM   7644  C  C     . GLU C 2  527  ? 470.429 -52.150 677.833 1.00 183.48 ? 527  GLU C C     1 
ATOM   7645  O  O     . GLU C 2  527  ? 471.318 -52.663 677.144 1.00 186.43 ? 527  GLU C O     1 
ATOM   7646  C  CB    . GLU C 2  527  ? 469.130 -53.811 679.112 1.00 190.63 ? 527  GLU C CB    1 
ATOM   7647  C  CG    . GLU C 2  527  ? 468.849 -54.754 680.298 1.00 197.05 ? 527  GLU C CG    1 
ATOM   7648  C  CD    . GLU C 2  527  ? 467.972 -54.130 681.390 1.00 197.42 ? 527  GLU C CD    1 
ATOM   7649  O  OE1   . GLU C 2  527  ? 467.161 -53.231 681.073 1.00 193.38 ? 527  GLU C OE1   1 
ATOM   7650  O  OE2   . GLU C 2  527  ? 468.062 -54.565 682.560 1.00 201.25 ? 527  GLU C OE2   1 
ATOM   7651  N  N     . GLU C 2  528  ? 469.706 -51.122 677.401 1.00 174.70 ? 528  GLU C N     1 
ATOM   7652  C  CA    . GLU C 2  528  ? 469.790 -50.564 676.054 1.00 170.27 ? 528  GLU C CA    1 
ATOM   7653  C  C     . GLU C 2  528  ? 470.845 -49.461 675.869 1.00 162.43 ? 528  GLU C C     1 
ATOM   7654  O  O     . GLU C 2  528  ? 470.905 -48.873 674.781 1.00 162.12 ? 528  GLU C O     1 
ATOM   7655  C  CB    . GLU C 2  528  ? 468.415 -50.055 675.614 1.00 165.40 ? 528  GLU C CB    1 
ATOM   7656  C  CG    . GLU C 2  528  ? 467.275 -51.032 675.850 1.00 168.99 ? 528  GLU C CG    1 
ATOM   7657  C  CD    . GLU C 2  528  ? 465.945 -50.479 675.386 1.00 168.28 ? 528  GLU C CD    1 
ATOM   7658  O  OE1   . GLU C 2  528  ? 465.151 -50.036 676.241 1.00 167.69 ? 528  GLU C OE1   1 
ATOM   7659  O  OE2   . GLU C 2  528  ? 465.686 -50.509 674.164 1.00 168.84 ? 528  GLU C OE2   1 
ATOM   7660  N  N     . VAL C 2  529  ? 471.637 -49.128 676.891 1.00 162.07 ? 529  VAL C N     1 
ATOM   7661  C  CA    . VAL C 2  529  ? 472.563 -47.988 676.846 1.00 156.75 ? 529  VAL C CA    1 
ATOM   7662  C  C     . VAL C 2  529  ? 473.936 -48.395 676.319 1.00 159.27 ? 529  VAL C C     1 
ATOM   7663  O  O     . VAL C 2  529  ? 474.672 -49.128 676.987 1.00 164.74 ? 529  VAL C O     1 
ATOM   7664  C  CB    . VAL C 2  529  ? 472.700 -47.336 678.226 1.00 158.98 ? 529  VAL C CB    1 
ATOM   7665  C  CG1   . VAL C 2  529  ? 473.767 -46.249 678.194 1.00 156.55 ? 529  VAL C CG1   1 
ATOM   7666  C  CG2   . VAL C 2  529  ? 471.365 -46.755 678.658 1.00 158.18 ? 529  VAL C CG2   1 
ATOM   7667  N  N     . GLU C 2  530  ? 474.266 -47.919 675.099 1.00 151.81 ? 530  GLU C N     1 
ATOM   7668  C  CA    . GLU C 2  530  ? 475.528 -48.151 674.387 1.00 143.28 ? 530  GLU C CA    1 
ATOM   7669  C  C     . GLU C 2  530  ? 476.657 -47.183 674.751 1.00 133.50 ? 530  GLU C C     1 
ATOM   7670  O  O     . GLU C 2  530  ? 477.813 -47.606 674.856 1.00 135.09 ? 530  GLU C O     1 
ATOM   7671  C  CB    . GLU C 2  530  ? 475.275 -48.065 672.880 1.00 133.13 ? 530  GLU C CB    1 
ATOM   7672  C  CG    . GLU C 2  530  ? 474.107 -48.898 672.416 1.00 132.29 ? 530  GLU C CG    1 
ATOM   7673  C  CD    . GLU C 2  530  ? 473.857 -48.768 670.940 1.00 132.49 ? 530  GLU C CD    1 
ATOM   7674  O  OE1   . GLU C 2  530  ? 472.766 -48.285 670.560 1.00 131.26 ? 530  GLU C OE1   1 
ATOM   7675  O  OE2   . GLU C 2  530  ? 474.754 -49.125 670.158 1.00 135.18 ? 530  GLU C OE2   1 
ATOM   7676  N  N     . PHE C 2  531  ? 476.379 -45.888 674.912 1.00 128.38 ? 531  PHE C N     1 
ATOM   7677  C  CA    . PHE C 2  531  ? 477.424 -44.941 675.284 1.00 131.38 ? 531  PHE C CA    1 
ATOM   7678  C  C     . PHE C 2  531  ? 476.867 -43.942 676.287 1.00 131.69 ? 531  PHE C C     1 
ATOM   7679  O  O     . PHE C 2  531  ? 475.672 -43.951 676.593 1.00 134.19 ? 531  PHE C O     1 
ATOM   7680  C  CB    . PHE C 2  531  ? 477.996 -44.231 674.045 1.00 134.93 ? 531  PHE C CB    1 
ATOM   7681  C  CG    . PHE C 2  531  ? 478.866 -45.117 673.183 1.00 142.89 ? 531  PHE C CG    1 
ATOM   7682  C  CD1   . PHE C 2  531  ? 480.214 -45.277 673.470 1.00 144.51 ? 531  PHE C CD1   1 
ATOM   7683  C  CD2   . PHE C 2  531  ? 478.337 -45.793 672.091 1.00 145.65 ? 531  PHE C CD2   1 
ATOM   7684  C  CE1   . PHE C 2  531  ? 481.019 -46.097 672.696 1.00 146.74 ? 531  PHE C CE1   1 
ATOM   7685  C  CE2   . PHE C 2  531  ? 479.136 -46.614 671.312 1.00 147.96 ? 531  PHE C CE2   1 
ATOM   7686  C  CZ    . PHE C 2  531  ? 480.480 -46.765 671.619 1.00 148.95 ? 531  PHE C CZ    1 
ATOM   7687  N  N     . MET C 2  532  ? 477.733 -43.041 676.768 1.00 127.59 ? 532  MET C N     1 
ATOM   7688  C  CA    . MET C 2  532  ? 477.306 -42.001 677.699 1.00 121.49 ? 532  MET C CA    1 
ATOM   7689  C  C     . MET C 2  532  ? 478.177 -40.761 677.546 1.00 113.58 ? 532  MET C C     1 
ATOM   7690  O  O     . MET C 2  532  ? 479.407 -40.876 677.490 1.00 109.65 ? 532  MET C O     1 
ATOM   7691  C  CB    . MET C 2  532  ? 477.402 -42.479 679.143 1.00 130.54 ? 532  MET C CB    1 
ATOM   7692  C  CG    . MET C 2  532  ? 477.040 -41.401 680.146 1.00 132.81 ? 532  MET C CG    1 
ATOM   7693  S  SD    . MET C 2  532  ? 476.998 -41.985 681.842 1.00 135.60 ? 532  MET C SD    1 
ATOM   7694  C  CE    . MET C 2  532  ? 477.649 -40.518 682.642 1.00 132.69 ? 532  MET C CE    1 
ATOM   7695  N  N     . ASP C 2  533  ? 477.541 -39.586 677.683 1.00 108.84 ? 533  ASP C N     1 
ATOM   7696  C  CA    . ASP C 2  533  ? 478.234 -38.304 677.576 1.00 106.77 ? 533  ASP C CA    1 
ATOM   7697  C  C     . ASP C 2  533  ? 479.372 -38.209 678.589 1.00 110.78 ? 533  ASP C C     1 
ATOM   7698  O  O     . ASP C 2  533  ? 479.289 -38.743 679.700 1.00 120.01 ? 533  ASP C O     1 
ATOM   7699  C  CB    . ASP C 2  533  ? 477.261 -37.145 677.837 1.00 102.08 ? 533  ASP C CB    1 
ATOM   7700  C  CG    . ASP C 2  533  ? 476.220 -36.945 676.736 1.00 102.46 ? 533  ASP C CG    1 
ATOM   7701  O  OD1   . ASP C 2  533  ? 475.862 -37.907 676.018 1.00 103.84 ? 533  ASP C OD1   1 
ATOM   7702  O  OD2   . ASP C 2  533  ? 475.715 -35.802 676.639 1.00 98.95  ? 533  ASP C OD2   1 
ATOM   7703  N  N     . VAL C 2  534  ? 480.470 -37.578 678.176 1.00 108.13 ? 534  VAL C N     1 
ATOM   7704  C  CA    . VAL C 2  534  ? 481.602 -37.369 679.079 1.00 108.19 ? 534  VAL C CA    1 
ATOM   7705  C  C     . VAL C 2  534  ? 481.300 -36.304 680.122 1.00 101.10 ? 534  VAL C C     1 
ATOM   7706  O  O     . VAL C 2  534  ? 481.715 -36.425 681.280 1.00 99.23  ? 534  VAL C O     1 
ATOM   7707  C  CB    . VAL C 2  534  ? 482.889 -37.050 678.301 1.00 113.59 ? 534  VAL C CB    1 
ATOM   7708  C  CG1   . VAL C 2  534  ? 483.969 -36.537 679.246 1.00 114.04 ? 534  VAL C CG1   1 
ATOM   7709  C  CG2   . VAL C 2  534  ? 483.395 -38.322 677.637 1.00 120.26 ? 534  VAL C CG2   1 
ATOM   7710  N  N     . SER C 2  535  ? 480.552 -35.272 679.755 1.00 97.40  ? 535  SER C N     1 
ATOM   7711  C  CA    . SER C 2  535  ? 480.391 -34.120 680.633 1.00 99.13  ? 535  SER C CA    1 
ATOM   7712  C  C     . SER C 2  535  ? 479.383 -33.152 680.017 1.00 100.00 ? 535  SER C C     1 
ATOM   7713  O  O     . SER C 2  535  ? 479.109 -33.217 678.811 1.00 100.75 ? 535  SER C O     1 
ATOM   7714  C  CB    . SER C 2  535  ? 481.744 -33.401 680.834 1.00 96.00  ? 535  SER C CB    1 
ATOM   7715  O  OG    . SER C 2  535  ? 481.649 -32.138 681.476 1.00 91.98  ? 535  SER C OG    1 
ATOM   7716  N  N     . PRO C 2  536  ? 478.758 -32.308 680.848 1.00 100.45 ? 536  PRO C N     1 
ATOM   7717  C  CA    . PRO C 2  536  ? 477.934 -31.226 680.291 1.00 94.00  ? 536  PRO C CA    1 
ATOM   7718  C  C     . PRO C 2  536  ? 478.777 -30.211 679.559 1.00 92.52  ? 536  PRO C C     1 
ATOM   7719  O  O     . PRO C 2  536  ? 478.295 -29.584 678.607 1.00 89.28  ? 536  PRO C O     1 
ATOM   7720  C  CB    . PRO C 2  536  ? 477.300 -30.586 681.529 1.00 94.03  ? 536  PRO C CB    1 
ATOM   7721  C  CG    . PRO C 2  536  ? 477.356 -31.641 682.571 1.00 103.00 ? 536  PRO C CG    1 
ATOM   7722  C  CD    . PRO C 2  536  ? 478.613 -32.421 682.311 1.00 104.00 ? 536  PRO C CD    1 
ATOM   7723  N  N     . LYS C 2  537  ? 480.014 -29.999 680.025 1.00 91.90  ? 537  LYS C N     1 
ATOM   7724  C  CA    . LYS C 2  537  ? 480.924 -29.047 679.397 1.00 89.51  ? 537  LYS C CA    1 
ATOM   7725  C  C     . LYS C 2  537  ? 481.111 -29.296 677.902 1.00 91.35  ? 537  LYS C C     1 
ATOM   7726  O  O     . LYS C 2  537  ? 481.260 -28.333 677.133 1.00 87.07  ? 537  LYS C O     1 
ATOM   7727  C  CB    . LYS C 2  537  ? 482.253 -29.024 680.161 1.00 88.02  ? 537  LYS C CB    1 
ATOM   7728  C  CG    . LYS C 2  537  ? 482.026 -28.809 681.634 1.00 99.70  ? 537  LYS C CG    1 
ATOM   7729  C  CD    . LYS C 2  537  ? 483.283 -28.685 682.500 1.00 108.74 ? 537  LYS C CD    1 
ATOM   7730  C  CE    . LYS C 2  537  ? 482.912 -28.874 683.993 1.00 114.25 ? 537  LYS C CE    1 
ATOM   7731  N  NZ    . LYS C 2  537  ? 481.995 -27.791 684.518 1.00 113.66 ? 537  LYS C NZ    1 
ATOM   7732  N  N     . GLN C 2  538  ? 480.961 -30.551 677.448 1.00 96.36  ? 538  GLN C N     1 
ATOM   7733  C  CA    . GLN C 2  538  ? 481.269 -30.872 676.056 1.00 99.28  ? 538  GLN C CA    1 
ATOM   7734  C  C     . GLN C 2  538  ? 480.275 -30.287 675.065 1.00 101.45 ? 538  GLN C C     1 
ATOM   7735  O  O     . GLN C 2  538  ? 480.586 -30.215 673.873 1.00 109.29 ? 538  GLN C O     1 
ATOM   7736  C  CB    . GLN C 2  538  ? 481.375 -32.386 675.864 1.00 99.08  ? 538  GLN C CB    1 
ATOM   7737  C  CG    . GLN C 2  538  ? 480.064 -33.128 675.760 1.00 99.00  ? 538  GLN C CG    1 
ATOM   7738  C  CD    . GLN C 2  538  ? 480.270 -34.621 675.520 1.00 103.98 ? 538  GLN C CD    1 
ATOM   7739  O  OE1   . GLN C 2  538  ? 479.995 -35.454 676.387 1.00 108.80 ? 538  GLN C OE1   1 
ATOM   7740  N  NE2   . GLN C 2  538  ? 480.679 -34.964 674.312 1.00 104.75 ? 538  GLN C NE2   1 
ATOM   7741  N  N     . VAL C 2  539  ? 479.107 -29.854 675.527 1.00 96.09  ? 539  VAL C N     1 
ATOM   7742  C  CA    . VAL C 2  539  ? 478.085 -29.292 674.654 1.00 91.51  ? 539  VAL C CA    1 
ATOM   7743  C  C     . VAL C 2  539  ? 478.350 -27.825 674.306 1.00 89.06  ? 539  VAL C C     1 
ATOM   7744  O  O     . VAL C 2  539  ? 477.818 -27.335 673.301 1.00 90.64  ? 539  VAL C O     1 
ATOM   7745  C  CB    . VAL C 2  539  ? 476.711 -29.507 675.323 1.00 91.97  ? 539  VAL C CB    1 
ATOM   7746  C  CG1   . VAL C 2  539  ? 475.597 -28.895 674.530 1.00 90.12  ? 539  VAL C CG1   1 
ATOM   7747  C  CG2   . VAL C 2  539  ? 476.435 -31.003 675.464 1.00 93.17  ? 539  VAL C CG2   1 
ATOM   7748  N  N     . PHE C 2  540  ? 479.174 -27.112 675.079 1.00 85.67  ? 540  PHE C N     1 
ATOM   7749  C  CA    . PHE C 2  540  ? 479.308 -25.666 674.936 1.00 87.48  ? 540  PHE C CA    1 
ATOM   7750  C  C     . PHE C 2  540  ? 480.746 -25.212 674.674 1.00 88.60  ? 540  PHE C C     1 
ATOM   7751  O  O     . PHE C 2  540  ? 481.718 -25.957 674.870 1.00 89.88  ? 540  PHE C O     1 
ATOM   7752  C  CB    . PHE C 2  540  ? 478.817 -24.955 676.195 1.00 87.02  ? 540  PHE C CB    1 
ATOM   7753  C  CG    . PHE C 2  540  ? 477.436 -25.353 676.616 1.00 90.39  ? 540  PHE C CG    1 
ATOM   7754  C  CD1   . PHE C 2  540  ? 476.347 -24.555 676.345 1.00 88.19  ? 540  PHE C CD1   1 
ATOM   7755  C  CD2   . PHE C 2  540  ? 477.233 -26.540 677.314 1.00 94.27  ? 540  PHE C CD2   1 
ATOM   7756  C  CE1   . PHE C 2  540  ? 475.083 -24.929 676.765 1.00 88.40  ? 540  PHE C CE1   1 
ATOM   7757  C  CE2   . PHE C 2  540  ? 475.973 -26.929 677.722 1.00 90.76  ? 540  PHE C CE2   1 
ATOM   7758  C  CZ    . PHE C 2  540  ? 474.899 -26.122 677.453 1.00 89.06  ? 540  PHE C CZ    1 
ATOM   7759  N  N     . SER C 2  541  ? 480.855 -23.971 674.189 1.00 84.91  ? 541  SER C N     1 
ATOM   7760  C  CA    . SER C 2  541  ? 482.134 -23.352 673.875 1.00 81.49  ? 541  SER C CA    1 
ATOM   7761  C  C     . SER C 2  541  ? 482.881 -23.002 675.150 1.00 84.53  ? 541  SER C C     1 
ATOM   7762  O  O     . SER C 2  541  ? 482.400 -23.196 676.266 1.00 90.25  ? 541  SER C O     1 
ATOM   7763  C  CB    . SER C 2  541  ? 481.936 -22.045 673.128 1.00 84.20  ? 541  SER C CB    1 
ATOM   7764  O  OG    . SER C 2  541  ? 481.350 -21.101 674.016 1.00 83.14  ? 541  SER C OG    1 
ATOM   7765  N  N     . VAL C 2  542  ? 484.071 -22.446 674.981 1.00 79.22  ? 542  VAL C N     1 
ATOM   7766  C  CA    . VAL C 2  542  ? 484.843 -22.066 676.148 1.00 80.49  ? 542  VAL C CA    1 
ATOM   7767  C  C     . VAL C 2  542  ? 484.217 -20.862 676.853 1.00 81.33  ? 542  VAL C C     1 
ATOM   7768  O  O     . VAL C 2  542  ? 484.094 -20.846 678.080 1.00 85.93  ? 542  VAL C O     1 
ATOM   7769  C  CB    . VAL C 2  542  ? 486.309 -21.852 675.757 1.00 80.10  ? 542  VAL C CB    1 
ATOM   7770  C  CG1   . VAL C 2  542  ? 487.048 -21.068 676.825 1.00 81.82  ? 542  VAL C CG1   1 
ATOM   7771  C  CG2   . VAL C 2  542  ? 486.961 -23.223 675.562 1.00 82.54  ? 542  VAL C CG2   1 
ATOM   7772  N  N     . ASN C 2  543  ? 483.734 -19.876 676.106 1.00 84.07  ? 543  ASN C N     1 
ATOM   7773  C  CA    . ASN C 2  543  ? 483.108 -18.723 676.760 1.00 88.49  ? 543  ASN C CA    1 
ATOM   7774  C  C     . ASN C 2  543  ? 481.847 -19.125 677.515 1.00 84.88  ? 543  ASN C C     1 
ATOM   7775  O  O     . ASN C 2  543  ? 481.605 -18.661 678.633 1.00 88.17  ? 543  ASN C O     1 
ATOM   7776  C  CB    . ASN C 2  543  ? 482.818 -17.633 675.740 1.00 94.67  ? 543  ASN C CB    1 
ATOM   7777  C  CG    . ASN C 2  543  ? 484.095 -17.081 675.156 1.00 101.88 ? 543  ASN C CG    1 
ATOM   7778  O  OD1   . ASN C 2  543  ? 484.886 -17.837 674.562 1.00 103.22 ? 543  ASN C OD1   1 
ATOM   7779  N  ND2   . ASN C 2  543  ? 484.348 -15.785 675.372 1.00 100.80 ? 543  ASN C ND2   1 
ATOM   7780  N  N     . THR C 2  544  ? 481.000 -19.932 676.889 1.00 82.42  ? 544  THR C N     1 
ATOM   7781  C  CA    . THR C 2  544  ? 479.794 -20.407 677.550 1.00 82.07  ? 544  THR C CA    1 
ATOM   7782  C  C     . THR C 2  544  ? 480.099 -21.228 678.796 1.00 90.47  ? 544  THR C C     1 
ATOM   7783  O  O     . THR C 2  544  ? 479.376 -21.122 679.796 1.00 96.16  ? 544  THR C O     1 
ATOM   7784  C  CB    . THR C 2  544  ? 478.985 -21.232 676.568 1.00 82.62  ? 544  THR C CB    1 
ATOM   7785  O  OG1   . THR C 2  544  ? 478.784 -20.465 675.364 1.00 87.09  ? 544  THR C OG1   1 
ATOM   7786  C  CG2   . THR C 2  544  ? 477.681 -21.643 677.191 1.00 77.18  ? 544  THR C CG2   1 
ATOM   7787  N  N     . ASN C 2  545  ? 481.185 -22.005 678.792 1.00 89.29  ? 545  ASN C N     1 
ATOM   7788  C  CA    . ASN C 2  545  ? 481.510 -22.814 679.969 1.00 89.40  ? 545  ASN C CA    1 
ATOM   7789  C  C     . ASN C 2  545  ? 481.963 -21.991 681.157 1.00 88.22  ? 545  ASN C C     1 
ATOM   7790  O  O     . ASN C 2  545  ? 482.149 -22.555 682.237 1.00 91.93  ? 545  ASN C O     1 
ATOM   7791  C  CB    . ASN C 2  545  ? 482.569 -23.852 679.648 1.00 92.50  ? 545  ASN C CB    1 
ATOM   7792  C  CG    . ASN C 2  545  ? 481.987 -25.217 679.441 1.00 92.69  ? 545  ASN C CG    1 
ATOM   7793  O  OD1   . ASN C 2  545  ? 481.474 -25.810 680.394 1.00 91.15  ? 545  ASN C OD1   1 
ATOM   7794  N  ND2   . ASN C 2  545  ? 482.016 -25.714 678.204 1.00 91.96  ? 545  ASN C ND2   1 
ATOM   7795  N  N     . LEU C 2  546  ? 482.159 -20.695 680.981 1.00 87.95  ? 546  LEU C N     1 
ATOM   7796  C  CA    . LEU C 2  546  ? 482.596 -19.834 682.058 1.00 88.04  ? 546  LEU C CA    1 
ATOM   7797  C  C     . LEU C 2  546  ? 481.427 -19.166 682.761 1.00 91.69  ? 546  LEU C C     1 
ATOM   7798  O  O     . LEU C 2  546  ? 481.649 -18.441 683.745 1.00 94.86  ? 546  LEU C O     1 
ATOM   7799  C  CB    . LEU C 2  546  ? 483.493 -18.726 681.506 1.00 81.44  ? 546  LEU C CB    1 
ATOM   7800  C  CG    . LEU C 2  546  ? 484.888 -19.044 681.011 1.00 83.19  ? 546  LEU C CG    1 
ATOM   7801  C  CD1   . LEU C 2  546  ? 485.450 -17.782 680.388 1.00 83.54  ? 546  LEU C CD1   1 
ATOM   7802  C  CD2   . LEU C 2  546  ? 485.830 -19.661 682.045 1.00 88.19  ? 546  LEU C CD2   1 
ATOM   7803  N  N     . ILE C 2  547  ? 480.193 -19.489 682.367 1.00 84.57  ? 547  ILE C N     1 
ATOM   7804  C  CA    . ILE C 2  547  ? 479.008 -18.852 682.924 1.00 84.31  ? 547  ILE C CA    1 
ATOM   7805  C  C     . ILE C 2  547  ? 478.388 -19.770 684.013 1.00 91.28  ? 547  ILE C C     1 
ATOM   7806  O  O     . ILE C 2  547  ? 477.827 -20.815 683.672 1.00 94.57  ? 547  ILE C O     1 
ATOM   7807  C  CB    . ILE C 2  547  ? 477.962 -18.527 681.852 1.00 73.32  ? 547  ILE C CB    1 
ATOM   7808  C  CG1   . ILE C 2  547  ? 478.536 -17.685 680.744 1.00 72.95  ? 547  ILE C CG1   1 
ATOM   7809  C  CG2   . ILE C 2  547  ? 476.851 -17.724 682.431 1.00 69.87  ? 547  ILE C CG2   1 
ATOM   7810  C  CD1   . ILE C 2  547  ? 477.503 -17.486 679.661 1.00 70.43  ? 547  ILE C CD1   1 
ATOM   7811  N  N     . PRO C 2  548  ? 478.549 -19.421 685.281 1.00 85.76  ? 548  PRO C N     1 
ATOM   7812  C  CA    . PRO C 2  548  ? 477.984 -20.261 686.346 1.00 87.24  ? 548  PRO C CA    1 
ATOM   7813  C  C     . PRO C 2  548  ? 476.465 -20.147 686.343 1.00 86.73  ? 548  PRO C C     1 
ATOM   7814  O  O     . PRO C 2  548  ? 475.900 -19.168 685.838 1.00 77.71  ? 548  PRO C O     1 
ATOM   7815  C  CB    . PRO C 2  548  ? 478.589 -19.659 687.622 1.00 85.38  ? 548  PRO C CB    1 
ATOM   7816  C  CG    . PRO C 2  548  ? 478.837 -18.211 687.245 1.00 80.15  ? 548  PRO C CG    1 
ATOM   7817  C  CD    . PRO C 2  548  ? 479.223 -18.226 685.807 1.00 82.66  ? 548  PRO C CD    1 
ATOM   7818  N  N     . PHE C 2  549  ? 475.802 -21.219 686.803 1.00 92.16  ? 549  PHE C N     1 
ATOM   7819  C  CA    . PHE C 2  549  ? 474.341 -21.267 686.849 1.00 87.29  ? 549  PHE C CA    1 
ATOM   7820  C  C     . PHE C 2  549  ? 473.747 -21.068 685.470 1.00 87.16  ? 549  PHE C C     1 
ATOM   7821  O  O     . PHE C 2  549  ? 472.677 -20.476 685.325 1.00 90.25  ? 549  PHE C O     1 
ATOM   7822  C  CB    . PHE C 2  549  ? 473.759 -20.223 687.799 1.00 88.61  ? 549  PHE C CB    1 
ATOM   7823  C  CG    . PHE C 2  549  ? 474.256 -20.332 689.195 1.00 90.88  ? 549  PHE C CG    1 
ATOM   7824  C  CD1   . PHE C 2  549  ? 473.917 -21.427 689.980 1.00 95.36  ? 549  PHE C CD1   1 
ATOM   7825  C  CD2   . PHE C 2  549  ? 474.993 -19.297 689.758 1.00 87.72  ? 549  PHE C CD2   1 
ATOM   7826  C  CE1   . PHE C 2  549  ? 474.363 -21.526 691.286 1.00 95.15  ? 549  PHE C CE1   1 
ATOM   7827  C  CE2   . PHE C 2  549  ? 475.435 -19.379 691.053 1.00 89.31  ? 549  PHE C CE2   1 
ATOM   7828  C  CZ    . PHE C 2  549  ? 475.122 -20.499 691.826 1.00 93.05  ? 549  PHE C CZ    1 
ATOM   7829  N  N     . LEU C 2  550  ? 474.480 -21.508 684.454 1.00 88.74  ? 550  LEU C N     1 
ATOM   7830  C  CA    . LEU C 2  550  ? 474.035 -21.372 683.070 1.00 88.33  ? 550  LEU C CA    1 
ATOM   7831  C  C     . LEU C 2  550  ? 472.681 -22.023 682.836 1.00 90.04  ? 550  LEU C C     1 
ATOM   7832  O  O     . LEU C 2  550  ? 471.855 -21.462 682.097 1.00 82.49  ? 550  LEU C O     1 
ATOM   7833  C  CB    . LEU C 2  550  ? 475.091 -21.993 682.151 1.00 88.29  ? 550  LEU C CB    1 
ATOM   7834  C  CG    . LEU C 2  550  ? 474.939 -22.276 680.664 1.00 83.23  ? 550  LEU C CG    1 
ATOM   7835  C  CD1   . LEU C 2  550  ? 474.871 -20.970 679.863 1.00 77.62  ? 550  LEU C CD1   1 
ATOM   7836  C  CD2   . LEU C 2  550  ? 476.089 -23.192 680.217 1.00 84.48  ? 550  LEU C CD2   1 
ATOM   7837  N  N     . GLU C 2  551  ? 472.387 -23.118 683.568 1.00 91.92  ? 551  GLU C N     1 
ATOM   7838  C  CA    . GLU C 2  551  ? 471.110 -23.815 683.441 1.00 89.31  ? 551  GLU C CA    1 
ATOM   7839  C  C     . GLU C 2  551  ? 469.938 -22.918 683.805 1.00 77.95  ? 551  GLU C C     1 
ATOM   7840  O  O     . GLU C 2  551  ? 468.799 -23.277 683.507 1.00 68.12  ? 551  GLU C O     1 
ATOM   7841  C  CB    . GLU C 2  551  ? 471.072 -25.114 684.260 1.00 99.02  ? 551  GLU C CB    1 
ATOM   7842  C  CG    . GLU C 2  551  ? 471.240 -25.034 685.802 1.00 110.26 ? 551  GLU C CG    1 
ATOM   7843  C  CD    . GLU C 2  551  ? 472.685 -25.158 686.283 1.00 117.84 ? 551  GLU C CD    1 
ATOM   7844  O  OE1   . GLU C 2  551  ? 472.903 -25.517 687.483 1.00 121.30 ? 551  GLU C OE1   1 
ATOM   7845  O  OE2   . GLU C 2  551  ? 473.591 -24.888 685.454 1.00 117.59 ? 551  GLU C OE2   1 
ATOM   7846  N  N     . HIS C 2  552  ? 470.181 -21.827 684.528 1.00 84.18  ? 552  HIS C N     1 
ATOM   7847  C  CA    . HIS C 2  552  ? 469.145 -20.891 684.931 1.00 87.50  ? 552  HIS C CA    1 
ATOM   7848  C  C     . HIS C 2  552  ? 468.999 -19.674 683.996 1.00 96.55  ? 552  HIS C C     1 
ATOM   7849  O  O     . HIS C 2  552  ? 468.150 -18.819 684.264 1.00 104.52 ? 552  HIS C O     1 
ATOM   7850  C  CB    . HIS C 2  552  ? 469.413 -20.389 686.353 1.00 86.17  ? 552  HIS C CB    1 
ATOM   7851  C  CG    . HIS C 2  552  ? 469.549 -21.487 687.368 1.00 93.68  ? 552  HIS C CG    1 
ATOM   7852  N  ND1   . HIS C 2  552  ? 468.468 -22.167 687.890 1.00 97.20  ? 552  HIS C ND1   1 
ATOM   7853  C  CD2   . HIS C 2  552  ? 470.634 -21.952 688.032 1.00 96.88  ? 552  HIS C CD2   1 
ATOM   7854  C  CE1   . HIS C 2  552  ? 468.891 -23.050 688.779 1.00 98.62  ? 552  HIS C CE1   1 
ATOM   7855  N  NE2   . HIS C 2  552  ? 470.201 -22.934 688.891 1.00 97.27  ? 552  HIS C NE2   1 
ATOM   7856  N  N     . ASP C 2  553  ? 469.809 -19.545 682.938 1.00 94.23  ? 553  ASP C N     1 
ATOM   7857  C  CA    . ASP C 2  553  ? 469.781 -18.394 682.025 1.00 89.87  ? 553  ASP C CA    1 
ATOM   7858  C  C     . ASP C 2  553  ? 469.164 -18.638 680.653 1.00 91.52  ? 553  ASP C C     1 
ATOM   7859  O  O     . ASP C 2  553  ? 469.560 -19.586 679.964 1.00 94.69  ? 553  ASP C O     1 
ATOM   7860  C  CB    . ASP C 2  553  ? 471.197 -17.857 681.796 1.00 85.21  ? 553  ASP C CB    1 
ATOM   7861  C  CG    . ASP C 2  553  ? 471.739 -17.099 682.982 1.00 79.06  ? 553  ASP C CG    1 
ATOM   7862  O  OD1   . ASP C 2  553  ? 470.930 -16.359 683.581 1.00 82.85  ? 553  ASP C OD1   1 
ATOM   7863  O  OD2   . ASP C 2  553  ? 472.957 -17.190 683.273 1.00 67.44  ? 553  ASP C OD2   1 
ATOM   7864  N  N     . ASP C 2  554  ? 468.227 -17.763 680.236 1.00 89.38  ? 554  ASP C N     1 
ATOM   7865  C  CA    . ASP C 2  554  ? 467.732 -17.825 678.854 1.00 83.08  ? 554  ASP C CA    1 
ATOM   7866  C  C     . ASP C 2  554  ? 468.875 -17.658 677.854 1.00 84.21  ? 554  ASP C C     1 
ATOM   7867  O  O     . ASP C 2  554  ? 469.743 -16.784 677.997 1.00 82.06  ? 554  ASP C O     1 
ATOM   7868  C  CB    . ASP C 2  554  ? 466.648 -16.769 678.599 1.00 78.65  ? 554  ASP C CB    1 
ATOM   7869  C  CG    . ASP C 2  554  ? 466.196 -16.726 677.115 1.00 82.35  ? 554  ASP C CG    1 
ATOM   7870  O  OD1   . ASP C 2  554  ? 465.386 -17.564 676.636 1.00 83.91  ? 554  ASP C OD1   1 
ATOM   7871  O  OD2   . ASP C 2  554  ? 466.603 -15.752 676.437 1.00 80.91  ? 554  ASP C OD2   1 
ATOM   7872  N  N     . ALA C 2  555  ? 468.847 -18.505 676.818 1.00 81.23  ? 555  ALA C N     1 
ATOM   7873  C  CA    . ALA C 2  555  ? 469.958 -18.580 675.867 1.00 71.46  ? 555  ALA C CA    1 
ATOM   7874  C  C     . ALA C 2  555  ? 470.312 -17.247 675.202 1.00 63.44  ? 555  ALA C C     1 
ATOM   7875  O  O     . ALA C 2  555  ? 471.492 -16.904 675.124 1.00 66.18  ? 555  ALA C O     1 
ATOM   7876  C  CB    . ALA C 2  555  ? 469.658 -19.647 674.818 1.00 67.00  ? 555  ALA C CB    1 
ATOM   7877  N  N     . ASN C 2  556  ? 469.327 -16.437 674.805 1.00 61.35  ? 556  ASN C N     1 
ATOM   7878  C  CA    . ASN C 2  556  ? 469.672 -15.176 674.133 1.00 64.17  ? 556  ASN C CA    1 
ATOM   7879  C  C     . ASN C 2  556  ? 470.528 -14.304 675.032 1.00 71.14  ? 556  ASN C C     1 
ATOM   7880  O  O     . ASN C 2  556  ? 471.310 -13.486 674.544 1.00 80.28  ? 556  ASN C O     1 
ATOM   7881  C  CB    . ASN C 2  556  ? 468.443 -14.392 673.686 1.00 65.54  ? 556  ASN C CB    1 
ATOM   7882  C  CG    . ASN C 2  556  ? 467.576 -15.170 672.746 1.00 77.85  ? 556  ASN C CG    1 
ATOM   7883  O  OD1   . ASN C 2  556  ? 466.556 -15.696 673.174 1.00 87.17  ? 556  ASN C OD1   1 
ATOM   7884  N  ND2   . ASN C 2  556  ? 467.969 -15.286 671.477 1.00 83.67  ? 556  ASN C ND2   1 
ATOM   7885  N  N     . ARG C 2  557  ? 470.309 -14.381 676.337 1.00 66.87  ? 557  ARG C N     1 
ATOM   7886  C  CA    . ARG C 2  557  ? 471.131 -13.627 677.262 1.00 67.06  ? 557  ARG C CA    1 
ATOM   7887  C  C     . ARG C 2  557  ? 472.431 -14.372 677.522 1.00 67.96  ? 557  ARG C C     1 
ATOM   7888  O  O     . ARG C 2  557  ? 473.475 -13.740 677.709 1.00 70.08  ? 557  ARG C O     1 
ATOM   7889  C  CB    . ARG C 2  557  ? 470.364 -13.371 678.554 1.00 68.58  ? 557  ARG C CB    1 
ATOM   7890  C  CG    . ARG C 2  557  ? 470.371 -11.911 679.021 1.00 62.25  ? 557  ARG C CG    1 
ATOM   7891  C  CD    . ARG C 2  557  ? 469.760 -11.012 677.926 1.00 59.29  ? 557  ARG C CD    1 
ATOM   7892  N  NE    . ARG C 2  557  ? 470.144 -9.607  678.079 1.00 53.39  ? 557  ARG C NE    1 
ATOM   7893  C  CZ    . ARG C 2  557  ? 469.603 -8.592  677.398 1.00 54.58  ? 557  ARG C CZ    1 
ATOM   7894  N  NH1   . ARG C 2  557  ? 468.619 -8.813  676.491 1.00 50.09  ? 557  ARG C NH1   1 
ATOM   7895  N  NH2   . ARG C 2  557  ? 470.044 -7.346  677.644 1.00 51.88  ? 557  ARG C NH2   1 
ATOM   7896  N  N     . ALA C 2  558  ? 472.362 -15.710 677.619 1.00 67.06  ? 558  ALA C N     1 
ATOM   7897  C  CA    . ALA C 2  558  ? 473.573 -16.522 677.775 1.00 73.43  ? 558  ALA C CA    1 
ATOM   7898  C  C     . ALA C 2  558  ? 474.572 -16.231 676.658 1.00 77.33  ? 558  ALA C C     1 
ATOM   7899  O  O     . ALA C 2  558  ? 475.793 -16.261 676.865 1.00 79.68  ? 558  ALA C O     1 
ATOM   7900  C  CB    . ALA C 2  558  ? 473.226 -18.012 677.784 1.00 72.47  ? 558  ALA C CB    1 
ATOM   7901  N  N     . LEU C 2  559  ? 474.067 -16.038 675.444 1.00 79.68  ? 559  LEU C N     1 
ATOM   7902  C  CA    . LEU C 2  559  ? 474.909 -15.613 674.337 1.00 77.84  ? 559  LEU C CA    1 
ATOM   7903  C  C     . LEU C 2  559  ? 475.734 -14.382 674.685 1.00 75.49  ? 559  LEU C C     1 
ATOM   7904  O  O     . LEU C 2  559  ? 476.966 -14.455 674.766 1.00 80.70  ? 559  LEU C O     1 
ATOM   7905  C  CB    . LEU C 2  559  ? 474.020 -15.354 673.122 1.00 76.00  ? 559  LEU C CB    1 
ATOM   7906  C  CG    . LEU C 2  559  ? 474.632 -14.824 671.844 1.00 73.03  ? 559  LEU C CG    1 
ATOM   7907  C  CD1   . LEU C 2  559  ? 473.870 -15.355 670.673 1.00 74.35  ? 559  LEU C CD1   1 
ATOM   7908  C  CD2   . LEU C 2  559  ? 474.453 -13.317 671.886 1.00 72.26  ? 559  LEU C CD2   1 
ATOM   7909  N  N     . MET C 2  560  ? 475.062 -13.330 675.138 1.00 63.48  ? 560  MET C N     1 
ATOM   7910  C  CA    . MET C 2  560  ? 475.759 -12.098 675.495 1.00 66.54  ? 560  MET C CA    1 
ATOM   7911  C  C     . MET C 2  560  ? 476.796 -12.339 676.591 1.00 69.87  ? 560  MET C C     1 
ATOM   7912  O  O     . MET C 2  560  ? 477.829 -11.655 676.657 1.00 67.86  ? 560  MET C O     1 
ATOM   7913  C  CB    . MET C 2  560  ? 474.734 -11.058 675.906 1.00 64.35  ? 560  MET C CB    1 
ATOM   7914  C  CG    . MET C 2  560  ? 473.640 -10.944 674.886 1.00 61.85  ? 560  MET C CG    1 
ATOM   7915  S  SD    . MET C 2  560  ? 472.520 -9.583  675.236 1.00 57.30  ? 560  MET C SD    1 
ATOM   7916  C  CE    . MET C 2  560  ? 471.347 -9.788  673.909 1.00 60.64  ? 560  MET C CE    1 
ATOM   7917  N  N     . GLY C 2  561  ? 476.492 -13.224 677.527 1.00 75.50  ? 561  GLY C N     1 
ATOM   7918  C  CA    . GLY C 2  561  ? 477.480 -13.535 678.535 1.00 76.65  ? 561  GLY C CA    1 
ATOM   7919  C  C     . GLY C 2  561  ? 478.757 -14.058 677.912 1.00 76.38  ? 561  GLY C C     1 
ATOM   7920  O  O     . GLY C 2  561  ? 479.848 -13.606 678.264 1.00 77.53  ? 561  GLY C O     1 
ATOM   7921  N  N     . SER C 2  562  ? 478.644 -15.088 677.059 1.00 75.54  ? 562  SER C N     1 
ATOM   7922  C  CA    . SER C 2  562  ? 479.805 -15.572 676.304 1.00 78.20  ? 562  SER C CA    1 
ATOM   7923  C  C     . SER C 2  562  ? 480.552 -14.444 675.596 1.00 78.88  ? 562  SER C C     1 
ATOM   7924  O  O     . SER C 2  562  ? 481.740 -14.196 675.857 1.00 80.07  ? 562  SER C O     1 
ATOM   7925  C  CB    . SER C 2  562  ? 479.437 -16.661 675.293 1.00 72.94  ? 562  SER C CB    1 
ATOM   7926  O  OG    . SER C 2  562  ? 479.168 -17.905 675.895 1.00 69.74  ? 562  SER C OG    1 
ATOM   7927  N  N     . ASN C 2  563  ? 479.871 -13.791 674.647 1.00 70.94  ? 563  ASN C N     1 
ATOM   7928  C  CA    . ASN C 2  563  ? 480.516 -12.772 673.832 1.00 74.67  ? 563  ASN C CA    1 
ATOM   7929  C  C     . ASN C 2  563  ? 481.126 -11.632 674.638 1.00 71.12  ? 563  ASN C C     1 
ATOM   7930  O  O     . ASN C 2  563  ? 482.175 -11.107 674.257 1.00 82.32  ? 563  ASN C O     1 
ATOM   7931  C  CB    . ASN C 2  563  ? 479.538 -12.197 672.809 1.00 81.93  ? 563  ASN C CB    1 
ATOM   7932  C  CG    . ASN C 2  563  ? 479.106 -13.212 671.756 1.00 89.19  ? 563  ASN C CG    1 
ATOM   7933  O  OD1   . ASN C 2  563  ? 479.885 -14.072 671.327 1.00 93.15  ? 563  ASN C OD1   1 
ATOM   7934  N  ND2   . ASN C 2  563  ? 477.881 -13.045 671.260 1.00 91.05  ? 563  ASN C ND2   1 
ATOM   7935  N  N     . MET C 2  564  ? 480.532 -11.232 675.742 1.00 68.46  ? 564  MET C N     1 
ATOM   7936  C  CA    . MET C 2  564  ? 481.093 -10.035 676.353 1.00 71.24  ? 564  MET C CA    1 
ATOM   7937  C  C     . MET C 2  564  ? 482.358 -10.312 677.134 1.00 76.24  ? 564  MET C C     1 
ATOM   7938  O  O     . MET C 2  564  ? 483.222 -9.432  677.215 1.00 80.50  ? 564  MET C O     1 
ATOM   7939  C  CB    . MET C 2  564  ? 480.049 -9.330  677.209 1.00 73.08  ? 564  MET C CB    1 
ATOM   7940  C  CG    . MET C 2  564  ? 479.121 -8.618  676.288 1.00 75.65  ? 564  MET C CG    1 
ATOM   7941  S  SD    . MET C 2  564  ? 477.912 -7.589  677.056 1.00 79.45  ? 564  MET C SD    1 
ATOM   7942  C  CE    . MET C 2  564  ? 477.094 -8.849  678.034 1.00 83.48  ? 564  MET C CE    1 
ATOM   7943  N  N     . GLN C 2  565  ? 482.506 -11.518 677.680 1.00 75.39  ? 565  GLN C N     1 
ATOM   7944  C  CA    . GLN C 2  565  ? 483.771 -11.877 678.301 1.00 78.07  ? 565  GLN C CA    1 
ATOM   7945  C  C     . GLN C 2  565  ? 484.920 -11.684 677.329 1.00 83.52  ? 565  GLN C C     1 
ATOM   7946  O  O     . GLN C 2  565  ? 486.025 -11.290 677.727 1.00 88.11  ? 565  GLN C O     1 
ATOM   7947  C  CB    . GLN C 2  565  ? 483.713 -13.306 678.809 1.00 74.56  ? 565  GLN C CB    1 
ATOM   7948  C  CG    . GLN C 2  565  ? 482.628 -13.550 679.794 1.00 72.85  ? 565  GLN C CG    1 
ATOM   7949  C  CD    . GLN C 2  565  ? 482.773 -14.901 680.424 1.00 76.00  ? 565  GLN C CD    1 
ATOM   7950  O  OE1   . GLN C 2  565  ? 482.261 -15.901 679.902 1.00 75.32  ? 565  GLN C OE1   1 
ATOM   7951  N  NE2   . GLN C 2  565  ? 483.501 -14.956 681.549 1.00 78.07  ? 565  GLN C NE2   1 
ATOM   7952  N  N     . THR C 2  566  ? 484.646 -11.852 676.041 1.00 81.42  ? 566  THR C N     1 
ATOM   7953  C  CA    . THR C 2  566  ? 485.654 -11.558 675.040 1.00 79.08  ? 566  THR C CA    1 
ATOM   7954  C  C     . THR C 2  566  ? 486.098 -10.110 675.149 1.00 75.26  ? 566  THR C C     1 
ATOM   7955  O  O     . THR C 2  566  ? 487.244 -9.780  674.825 1.00 77.48  ? 566  THR C O     1 
ATOM   7956  C  CB    . THR C 2  566  ? 485.077 -11.864 673.667 1.00 80.78  ? 566  THR C CB    1 
ATOM   7957  O  OG1   . THR C 2  566  ? 485.170 -13.275 673.438 1.00 80.44  ? 566  THR C OG1   1 
ATOM   7958  C  CG2   . THR C 2  566  ? 485.785 -11.089 672.561 1.00 87.52  ? 566  THR C CG2   1 
ATOM   7959  N  N     . GLN C 2  567  ? 485.208 -9.242  675.614 1.00 68.40  ? 567  GLN C N     1 
ATOM   7960  C  CA    . GLN C 2  567  ? 485.439 -7.809  675.639 1.00 69.21  ? 567  GLN C CA    1 
ATOM   7961  C  C     . GLN C 2  567  ? 485.944 -7.284  676.976 1.00 72.21  ? 567  GLN C C     1 
ATOM   7962  O  O     . GLN C 2  567  ? 486.099 -6.058  677.128 1.00 74.05  ? 567  GLN C O     1 
ATOM   7963  C  CB    . GLN C 2  567  ? 484.194 -7.071  675.172 1.00 66.54  ? 567  GLN C CB    1 
ATOM   7964  C  CG    . GLN C 2  567  ? 483.731 -7.710  673.883 1.00 72.58  ? 567  GLN C CG    1 
ATOM   7965  C  CD    . GLN C 2  567  ? 482.381 -7.259  673.412 1.00 75.05  ? 567  GLN C CD    1 
ATOM   7966  O  OE1   . GLN C 2  567  ? 481.860 -6.231  673.859 1.00 74.96  ? 567  GLN C OE1   1 
ATOM   7967  N  NE2   . GLN C 2  567  ? 481.797 -8.028  672.484 1.00 75.54  ? 567  GLN C NE2   1 
ATOM   7968  N  N     . ALA C 2  568  ? 486.172 -8.160  677.956 1.00 71.18  ? 568  ALA C N     1 
ATOM   7969  C  CA    . ALA C 2  568  ? 486.600 -7.678  679.261 1.00 73.06  ? 568  ALA C CA    1 
ATOM   7970  C  C     . ALA C 2  568  ? 488.006 -7.102  679.176 1.00 75.39  ? 568  ALA C C     1 
ATOM   7971  O  O     . ALA C 2  568  ? 488.936 -7.754  678.691 1.00 78.45  ? 568  ALA C O     1 
ATOM   7972  C  CB    . ALA C 2  568  ? 486.566 -8.812  680.287 1.00 74.95  ? 568  ALA C CB    1 
ATOM   7973  N  N     . VAL C 2  569  ? 488.181 -5.928  679.763 1.00 74.44  ? 569  VAL C N     1 
ATOM   7974  C  CA    . VAL C 2  569  ? 489.462 -5.236  679.737 1.00 77.36  ? 569  VAL C CA    1 
ATOM   7975  C  C     . VAL C 2  569  ? 490.251 -5.692  680.949 1.00 88.44  ? 569  VAL C C     1 
ATOM   7976  O  O     . VAL C 2  569  ? 489.721 -5.689  682.073 1.00 101.32 ? 569  VAL C O     1 
ATOM   7977  C  CB    . VAL C 2  569  ? 489.257 -3.719  679.790 1.00 68.03  ? 569  VAL C CB    1 
ATOM   7978  C  CG1   . VAL C 2  569  ? 490.535 -3.029  680.128 1.00 64.33  ? 569  VAL C CG1   1 
ATOM   7979  C  CG2   . VAL C 2  569  ? 488.650 -3.229  678.487 1.00 63.66  ? 569  VAL C CG2   1 
ATOM   7980  N  N     . PRO C 2  570  ? 491.523 -6.028  680.785 1.00 94.14  ? 570  PRO C N     1 
ATOM   7981  C  CA    . PRO C 2  570  ? 492.333 -6.386  681.953 1.00 96.12  ? 570  PRO C CA    1 
ATOM   7982  C  C     . PRO C 2  570  ? 492.465 -5.221  682.916 1.00 99.21  ? 570  PRO C C     1 
ATOM   7983  O  O     . PRO C 2  570  ? 492.925 -4.131  682.557 1.00 100.26 ? 570  PRO C O     1 
ATOM   7984  C  CB    . PRO C 2  570  ? 493.681 -6.780  681.339 1.00 95.78  ? 570  PRO C CB    1 
ATOM   7985  C  CG    . PRO C 2  570  ? 493.342 -7.175  679.926 1.00 92.85  ? 570  PRO C CG    1 
ATOM   7986  C  CD    . PRO C 2  570  ? 492.230 -6.264  679.519 1.00 90.92  ? 570  PRO C CD    1 
ATOM   7987  N  N     . LEU C 2  571  ? 492.110 -5.481  684.164 1.00 96.30  ? 571  LEU C N     1 
ATOM   7988  C  CA    . LEU C 2  571  ? 492.094 -4.435  685.166 1.00 91.81  ? 571  LEU C CA    1 
ATOM   7989  C  C     . LEU C 2  571  ? 493.334 -4.644  686.025 1.00 94.28  ? 571  LEU C C     1 
ATOM   7990  O  O     . LEU C 2  571  ? 493.771 -5.777  686.247 1.00 92.77  ? 571  LEU C O     1 
ATOM   7991  C  CB    . LEU C 2  571  ? 490.822 -4.509  685.998 1.00 90.44  ? 571  LEU C CB    1 
ATOM   7992  C  CG    . LEU C 2  571  ? 489.468 -4.500  685.277 1.00 86.82  ? 571  LEU C CG    1 
ATOM   7993  C  CD1   . LEU C 2  571  ? 488.347 -4.842  686.272 1.00 82.88  ? 571  LEU C CD1   1 
ATOM   7994  C  CD2   . LEU C 2  571  ? 489.185 -3.167  684.599 1.00 89.37  ? 571  LEU C CD2   1 
ATOM   7995  N  N     . ILE C 2  572  ? 493.880 -3.547  686.541 1.00 93.53  ? 572  ILE C N     1 
ATOM   7996  C  CA    . ILE C 2  572  ? 495.080 -3.641  687.366 1.00 94.88  ? 572  ILE C CA    1 
ATOM   7997  C  C     . ILE C 2  572  ? 494.821 -4.443  688.631 1.00 100.64 ? 572  ILE C C     1 
ATOM   7998  O  O     . ILE C 2  572  ? 495.719 -5.145  689.121 1.00 103.12 ? 572  ILE C O     1 
ATOM   7999  C  CB    . ILE C 2  572  ? 495.640 -2.240  687.650 1.00 90.18  ? 572  ILE C CB    1 
ATOM   8000  C  CG1   . ILE C 2  572  ? 494.815 -1.508  688.677 1.00 91.37  ? 572  ILE C CG1   1 
ATOM   8001  C  CG2   . ILE C 2  572  ? 495.551 -1.405  686.415 1.00 91.80  ? 572  ILE C CG2   1 
ATOM   8002  C  CD1   . ILE C 2  572  ? 495.261 -0.091  688.828 1.00 95.04  ? 572  ILE C CD1   1 
ATOM   8003  N  N     . ARG C 2  573  ? 493.608 -4.355  689.186 1.00 102.75 ? 573  ARG C N     1 
ATOM   8004  C  CA    . ARG C 2  573  ? 493.228 -5.125  690.361 1.00 100.37 ? 573  ARG C CA    1 
ATOM   8005  C  C     . ARG C 2  573  ? 492.436 -6.374  690.038 1.00 100.28 ? 573  ARG C C     1 
ATOM   8006  O  O     . ARG C 2  573  ? 491.864 -6.960  690.954 1.00 102.68 ? 573  ARG C O     1 
ATOM   8007  C  CB    . ARG C 2  573  ? 492.410 -4.288  691.331 1.00 102.91 ? 573  ARG C CB    1 
ATOM   8008  C  CG    . ARG C 2  573  ? 493.024 -3.017  691.800 1.00 111.00 ? 573  ARG C CG    1 
ATOM   8009  C  CD    . ARG C 2  573  ? 494.149 -3.326  692.779 1.00 120.33 ? 573  ARG C CD    1 
ATOM   8010  N  NE    . ARG C 2  573  ? 493.901 -4.482  693.652 1.00 118.52 ? 573  ARG C NE    1 
ATOM   8011  C  CZ    . ARG C 2  573  ? 493.454 -4.387  694.897 1.00 110.64 ? 573  ARG C CZ    1 
ATOM   8012  N  NH1   . ARG C 2  573  ? 493.210 -3.189  695.409 1.00 103.64 ? 573  ARG C NH1   1 
ATOM   8013  N  NH2   . ARG C 2  573  ? 493.269 -5.482  695.627 1.00 110.90 ? 573  ARG C NH2   1 
ATOM   8014  N  N     . ALA C 2  574  ? 492.407 -6.806  688.777 1.00 100.00 ? 574  ALA C N     1 
ATOM   8015  C  CA    . ALA C 2  574  ? 491.496 -7.866  688.342 1.00 97.87  ? 574  ALA C CA    1 
ATOM   8016  C  C     . ALA C 2  574  ? 491.511 -9.075  689.285 1.00 97.24  ? 574  ALA C C     1 
ATOM   8017  O  O     . ALA C 2  574  ? 492.559 -9.481  689.802 1.00 98.63  ? 574  ALA C O     1 
ATOM   8018  C  CB    . ALA C 2  574  ? 491.856 -8.311  686.911 1.00 93.37  ? 574  ALA C CB    1 
ATOM   8019  N  N     . GLN C 2  575  ? 490.328 -9.635  689.532 1.00 91.44  ? 575  GLN C N     1 
ATOM   8020  C  CA    . GLN C 2  575  ? 490.199 -10.781 690.408 1.00 93.73  ? 575  GLN C CA    1 
ATOM   8021  C  C     . GLN C 2  575  ? 489.380 -11.838 689.701 1.00 91.53  ? 575  GLN C C     1 
ATOM   8022  O  O     . GLN C 2  575  ? 488.509 -11.531 688.885 1.00 93.95  ? 575  GLN C O     1 
ATOM   8023  C  CB    . GLN C 2  575  ? 489.511 -10.412 691.712 1.00 100.91 ? 575  GLN C CB    1 
ATOM   8024  C  CG    . GLN C 2  575  ? 488.982 -8.986  691.735 1.00 103.96 ? 575  GLN C CG    1 
ATOM   8025  C  CD    . GLN C 2  575  ? 488.278 -8.656  693.036 1.00 108.40 ? 575  GLN C CD    1 
ATOM   8026  O  OE1   . GLN C 2  575  ? 487.412 -7.785  693.080 1.00 106.42 ? 575  GLN C OE1   1 
ATOM   8027  N  NE2   . GLN C 2  575  ? 488.689 -9.325  694.117 1.00 112.33 ? 575  GLN C NE2   1 
ATOM   8028  N  N     . ALA C 2  576  ? 489.609 -13.081 690.067 1.00 94.61  ? 576  ALA C N     1 
ATOM   8029  C  CA    . ALA C 2  576  ? 488.756 -14.129 689.555 1.00 100.15 ? 576  ALA C CA    1 
ATOM   8030  C  C     . ALA C 2  576  ? 487.399 -14.069 690.259 1.00 105.09 ? 576  ALA C C     1 
ATOM   8031  O  O     . ALA C 2  576  ? 487.297 -13.556 691.384 1.00 104.24 ? 576  ALA C O     1 
ATOM   8032  C  CB    . ALA C 2  576  ? 489.400 -15.493 689.760 1.00 103.92 ? 576  ALA C CB    1 
ATOM   8033  N  N     . PRO C 2  577  ? 486.329 -14.527 689.593 1.00 104.41 ? 577  PRO C N     1 
ATOM   8034  C  CA    . PRO C 2  577  ? 484.997 -14.445 690.205 1.00 104.84 ? 577  PRO C CA    1 
ATOM   8035  C  C     . PRO C 2  577  ? 484.869 -15.310 691.458 1.00 104.27 ? 577  PRO C C     1 
ATOM   8036  O  O     . PRO C 2  577  ? 485.489 -16.369 691.567 1.00 107.78 ? 577  PRO C O     1 
ATOM   8037  C  CB    . PRO C 2  577  ? 484.071 -14.947 689.081 1.00 98.63  ? 577  PRO C CB    1 
ATOM   8038  C  CG    . PRO C 2  577  ? 484.936 -15.732 688.176 1.00 93.74  ? 577  PRO C CG    1 
ATOM   8039  C  CD    . PRO C 2  577  ? 486.269 -15.066 688.225 1.00 96.57  ? 577  PRO C CD    1 
ATOM   8040  N  N     . VAL C 2  578  ? 484.016 -14.866 692.397 1.00 98.87  ? 578  VAL C N     1 
ATOM   8041  C  CA    . VAL C 2  578  ? 483.811 -15.655 693.616 1.00 103.26 ? 578  VAL C CA    1 
ATOM   8042  C  C     . VAL C 2  578  ? 483.023 -16.912 693.315 1.00 98.72  ? 578  VAL C C     1 
ATOM   8043  O  O     . VAL C 2  578  ? 483.107 -17.893 694.066 1.00 98.38  ? 578  VAL C O     1 
ATOM   8044  C  CB    . VAL C 2  578  ? 483.159 -14.869 694.775 1.00 109.08 ? 578  VAL C CB    1 
ATOM   8045  C  CG1   . VAL C 2  578  ? 483.736 -13.491 694.919 1.00 110.54 ? 578  VAL C CG1   1 
ATOM   8046  C  CG2   . VAL C 2  578  ? 481.651 -14.791 694.604 1.00 111.78 ? 578  VAL C CG2   1 
ATOM   8047  N  N     . VAL C 2  579  ? 482.212 -16.903 692.263 1.00 89.74  ? 579  VAL C N     1 
ATOM   8048  C  CA    . VAL C 2  579  ? 481.575 -18.122 691.787 1.00 89.19  ? 579  VAL C CA    1 
ATOM   8049  C  C     . VAL C 2  579  ? 482.171 -18.502 690.442 1.00 90.86  ? 579  VAL C C     1 
ATOM   8050  O  O     . VAL C 2  579  ? 481.888 -17.860 689.419 1.00 88.10  ? 579  VAL C O     1 
ATOM   8051  C  CB    . VAL C 2  579  ? 480.066 -17.953 691.650 1.00 82.44  ? 579  VAL C CB    1 
ATOM   8052  C  CG1   . VAL C 2  579  ? 479.480 -19.281 691.176 1.00 84.11  ? 579  VAL C CG1   1 
ATOM   8053  C  CG2   . VAL C 2  579  ? 479.478 -17.463 692.937 1.00 80.64  ? 579  VAL C CG2   1 
ATOM   8054  N  N     . MET C 2  580  ? 482.958 -19.574 690.428 1.00 94.08  ? 580  MET C N     1 
ATOM   8055  C  CA    . MET C 2  580  ? 483.534 -20.054 689.188 1.00 95.11  ? 580  MET C CA    1 
ATOM   8056  C  C     . MET C 2  580  ? 482.845 -21.345 688.747 1.00 94.70  ? 580  MET C C     1 
ATOM   8057  O  O     . MET C 2  580  ? 482.084 -21.964 689.498 1.00 96.17  ? 580  MET C O     1 
ATOM   8058  C  CB    . MET C 2  580  ? 485.033 -20.285 689.363 1.00 103.01 ? 580  MET C CB    1 
ATOM   8059  C  CG    . MET C 2  580  ? 485.830 -19.038 689.695 1.00 105.89 ? 580  MET C CG    1 
ATOM   8060  S  SD    . MET C 2  580  ? 487.508 -19.520 690.206 1.00 110.74 ? 580  MET C SD    1 
ATOM   8061  C  CE    . MET C 2  580  ? 487.221 -20.392 691.743 1.00 117.84 ? 580  MET C CE    1 
ATOM   8062  N  N     . THR C 2  581  ? 483.158 -21.770 687.515 1.00 92.28  ? 581  THR C N     1 
ATOM   8063  C  CA    . THR C 2  581  ? 482.675 -23.023 686.942 1.00 90.63  ? 581  THR C CA    1 
ATOM   8064  C  C     . THR C 2  581  ? 483.722 -24.134 686.939 1.00 95.25  ? 581  THR C C     1 
ATOM   8065  O  O     . THR C 2  581  ? 483.382 -25.278 686.607 1.00 94.83  ? 581  THR C O     1 
ATOM   8066  C  CB    . THR C 2  581  ? 482.194 -22.788 685.498 1.00 90.14  ? 581  THR C CB    1 
ATOM   8067  O  OG1   . THR C 2  581  ? 483.317 -22.518 684.647 1.00 90.22  ? 581  THR C OG1   1 
ATOM   8068  C  CG2   . THR C 2  581  ? 481.259 -21.608 685.410 1.00 90.19  ? 581  THR C CG2   1 
ATOM   8069  N  N     . GLY C 2  582  ? 484.970 -23.830 687.329 1.00 96.59  ? 582  GLY C N     1 
ATOM   8070  C  CA    . GLY C 2  582  ? 486.079 -24.763 687.326 1.00 101.03 ? 582  GLY C CA    1 
ATOM   8071  C  C     . GLY C 2  582  ? 486.896 -24.812 686.046 1.00 104.53 ? 582  GLY C C     1 
ATOM   8072  O  O     . GLY C 2  582  ? 487.812 -25.637 685.946 1.00 109.62 ? 582  GLY C O     1 
ATOM   8073  N  N     . LEU C 2  583  ? 486.585 -23.991 685.047 1.00 106.35 ? 583  LEU C N     1 
ATOM   8074  C  CA    . LEU C 2  583  ? 487.395 -23.940 683.838 1.00 103.82 ? 583  LEU C CA    1 
ATOM   8075  C  C     . LEU C 2  583  ? 488.385 -22.789 683.819 1.00 102.49 ? 583  LEU C C     1 
ATOM   8076  O  O     . LEU C 2  583  ? 489.222 -22.733 682.917 1.00 99.25  ? 583  LEU C O     1 
ATOM   8077  C  CB    . LEU C 2  583  ? 486.472 -23.772 682.632 1.00 100.24 ? 583  LEU C CB    1 
ATOM   8078  C  CG    . LEU C 2  583  ? 486.525 -24.816 681.541 1.00 100.82 ? 583  LEU C CG    1 
ATOM   8079  C  CD1   . LEU C 2  583  ? 485.785 -26.031 682.044 1.00 103.43 ? 583  LEU C CD1   1 
ATOM   8080  C  CD2   . LEU C 2  583  ? 485.866 -24.267 680.311 1.00 97.69  ? 583  LEU C CD2   1 
ATOM   8081  N  N     . GLU C 2  584  ? 488.318 -21.893 684.806 1.00 105.60 ? 584  GLU C N     1 
ATOM   8082  C  CA    . GLU C 2  584  ? 489.016 -20.615 684.727 1.00 103.10 ? 584  GLU C CA    1 
ATOM   8083  C  C     . GLU C 2  584  ? 490.513 -20.756 684.940 1.00 106.45 ? 584  GLU C C     1 
ATOM   8084  O  O     . GLU C 2  584  ? 491.264 -19.874 684.517 1.00 103.43 ? 584  GLU C O     1 
ATOM   8085  C  CB    . GLU C 2  584  ? 488.441 -19.618 685.738 1.00 94.70  ? 584  GLU C CB    1 
ATOM   8086  C  CG    . GLU C 2  584  ? 487.563 -20.235 686.825 1.00 91.95  ? 584  GLU C CG    1 
ATOM   8087  C  CD    . GLU C 2  584  ? 486.105 -20.505 686.455 1.00 88.40  ? 584  GLU C CD    1 
ATOM   8088  O  OE1   . GLU C 2  584  ? 485.284 -19.563 686.215 1.00 83.58  ? 584  GLU C OE1   1 
ATOM   8089  O  OE2   . GLU C 2  584  ? 485.773 -21.705 686.498 1.00 88.41  ? 584  GLU C OE2   1 
ATOM   8090  N  N     . GLU C 2  585  ? 490.939 -21.824 685.624 1.00 116.11 ? 585  GLU C N     1 
ATOM   8091  C  CA    . GLU C 2  585  ? 492.347 -22.213 685.692 1.00 126.17 ? 585  GLU C CA    1 
ATOM   8092  C  C     . GLU C 2  585  ? 492.885 -22.708 684.361 1.00 126.80 ? 585  GLU C C     1 
ATOM   8093  O  O     . GLU C 2  585  ? 493.989 -22.329 683.949 1.00 128.06 ? 585  GLU C O     1 
ATOM   8094  C  CB    . GLU C 2  585  ? 492.518 -23.306 686.747 1.00 141.21 ? 585  GLU C CB    1 
ATOM   8095  C  CG    . GLU C 2  585  ? 493.162 -22.874 688.059 1.00 151.08 ? 585  GLU C CG    1 
ATOM   8096  C  CD    . GLU C 2  585  ? 493.005 -23.915 689.188 1.00 157.12 ? 585  GLU C CD    1 
ATOM   8097  O  OE1   . GLU C 2  585  ? 492.059 -24.733 689.138 1.00 158.45 ? 585  GLU C OE1   1 
ATOM   8098  O  OE2   . GLU C 2  585  ? 493.841 -23.923 690.123 1.00 160.90 ? 585  GLU C OE2   1 
ATOM   8099  N  N     . ARG C 2  586  ? 492.132 -23.570 683.681 1.00 119.86 ? 586  ARG C N     1 
ATOM   8100  C  CA    . ARG C 2  586  ? 492.621 -24.142 682.428 1.00 116.57 ? 586  ARG C CA    1 
ATOM   8101  C  C     . ARG C 2  586  ? 492.777 -23.075 681.353 1.00 97.29  ? 586  ARG C C     1 
ATOM   8102  O  O     . ARG C 2  586  ? 493.787 -23.052 680.653 1.00 85.68  ? 586  ARG C O     1 
ATOM   8103  C  CB    . ARG C 2  586  ? 491.664 -25.238 681.963 1.00 111.79 ? 586  ARG C CB    1 
ATOM   8104  C  CG    . ARG C 2  586  ? 492.271 -26.618 681.939 1.00 113.28 ? 586  ARG C CG    1 
ATOM   8105  C  CD    . ARG C 2  586  ? 493.683 -26.631 681.415 1.00 114.28 ? 586  ARG C CD    1 
ATOM   8106  N  NE    . ARG C 2  586  ? 493.715 -27.071 680.026 1.00 116.86 ? 586  ARG C NE    1 
ATOM   8107  C  CZ    . ARG C 2  586  ? 493.282 -28.256 679.599 1.00 119.69 ? 586  ARG C CZ    1 
ATOM   8108  N  NH1   . ARG C 2  586  ? 492.786 -29.146 680.457 1.00 123.26 ? 586  ARG C NH1   1 
ATOM   8109  N  NH2   . ARG C 2  586  ? 493.349 -28.555 678.306 1.00 117.66 ? 586  ARG C NH2   1 
ATOM   8110  N  N     . VAL C 2  587  ? 491.841 -22.119 681.296 1.00 102.18 ? 587  VAL C N     1 
ATOM   8111  C  CA    . VAL C 2  587  ? 491.845 -21.064 680.280 1.00 87.38  ? 587  VAL C CA    1 
ATOM   8112  C  C     . VAL C 2  587  ? 493.086 -20.209 680.392 1.00 90.07  ? 587  VAL C C     1 
ATOM   8113  O  O     . VAL C 2  587  ? 493.645 -19.793 679.381 1.00 94.84  ? 587  VAL C O     1 
ATOM   8114  C  CB    . VAL C 2  587  ? 490.601 -20.174 680.415 1.00 76.25  ? 587  VAL C CB    1 
ATOM   8115  C  CG1   . VAL C 2  587  ? 490.797 -18.918 679.621 1.00 74.31  ? 587  VAL C CG1   1 
ATOM   8116  C  CG2   . VAL C 2  587  ? 489.352 -20.904 679.974 1.00 81.33  ? 587  VAL C CG2   1 
ATOM   8117  N  N     . VAL C 2  588  ? 493.477 -19.839 681.610 1.00 97.20  ? 588  VAL C N     1 
ATOM   8118  C  CA    . VAL C 2  588  ? 494.674 -19.019 681.761 1.00 96.81  ? 588  VAL C CA    1 
ATOM   8119  C  C     . VAL C 2  588  ? 495.893 -19.794 681.308 1.00 108.12 ? 588  VAL C C     1 
ATOM   8120  O  O     . VAL C 2  588  ? 496.790 -19.250 680.645 1.00 111.26 ? 588  VAL C O     1 
ATOM   8121  C  CB    . VAL C 2  588  ? 494.830 -18.530 683.210 1.00 94.99  ? 588  VAL C CB    1 
ATOM   8122  C  CG1   . VAL C 2  588  ? 496.153 -17.836 683.369 1.00 98.21  ? 588  VAL C CG1   1 
ATOM   8123  C  CG2   . VAL C 2  588  ? 493.748 -17.542 683.526 1.00 95.23  ? 588  VAL C CG2   1 
ATOM   8124  N  N     . ARG C 2  589  ? 495.945 -21.079 681.657 1.00 107.39 ? 589  ARG C N     1 
ATOM   8125  C  CA    . ARG C 2  589  ? 497.106 -21.882 681.300 1.00 109.87 ? 589  ARG C CA    1 
ATOM   8126  C  C     . ARG C 2  589  ? 497.255 -22.069 679.788 1.00 116.51 ? 589  ARG C C     1 
ATOM   8127  O  O     . ARG C 2  589  ? 498.322 -21.806 679.226 1.00 125.73 ? 589  ARG C O     1 
ATOM   8128  C  CB    . ARG C 2  589  ? 496.972 -23.231 681.996 1.00 108.12 ? 589  ARG C CB    1 
ATOM   8129  C  CG    . ARG C 2  589  ? 497.558 -24.386 681.254 1.00 107.95 ? 589  ARG C CG    1 
ATOM   8130  C  CD    . ARG C 2  589  ? 497.761 -25.519 682.199 1.00 109.43 ? 589  ARG C CD    1 
ATOM   8131  N  NE    . ARG C 2  589  ? 498.610 -25.094 683.298 1.00 112.43 ? 589  ARG C NE    1 
ATOM   8132  C  CZ    . ARG C 2  589  ? 499.277 -25.939 684.068 1.00 122.89 ? 589  ARG C CZ    1 
ATOM   8133  N  NH1   . ARG C 2  589  ? 499.184 -27.247 683.838 1.00 127.67 ? 589  ARG C NH1   1 
ATOM   8134  N  NH2   . ARG C 2  589  ? 500.041 -25.484 685.053 1.00 127.04 ? 589  ARG C NH2   1 
ATOM   8135  N  N     . ASP C 2  590  ? 496.174 -22.419 679.098 1.00 110.49 ? 590  ASP C N     1 
ATOM   8136  C  CA    . ASP C 2  590  ? 496.236 -22.583 677.656 1.00 107.21 ? 590  ASP C CA    1 
ATOM   8137  C  C     . ASP C 2  590  ? 496.376 -21.249 676.955 1.00 112.25 ? 590  ASP C C     1 
ATOM   8138  O  O     . ASP C 2  590  ? 496.882 -21.185 675.835 1.00 119.42 ? 590  ASP C O     1 
ATOM   8139  C  CB    . ASP C 2  590  ? 495.011 -23.371 677.211 1.00 101.03 ? 590  ASP C CB    1 
ATOM   8140  C  CG    . ASP C 2  590  ? 495.092 -24.851 677.605 1.00 104.35 ? 590  ASP C CG    1 
ATOM   8141  O  OD1   . ASP C 2  590  ? 495.750 -25.192 678.613 1.00 108.33 ? 590  ASP C OD1   1 
ATOM   8142  O  OD2   . ASP C 2  590  ? 494.404 -25.675 676.969 1.00 106.74 ? 590  ASP C OD2   1 
ATOM   8143  N  N     . SER C 2  591  ? 495.888 -20.185 677.576 1.00 123.02 ? 591  SER C N     1 
ATOM   8144  C  CA    . SER C 2  591  ? 496.002 -18.854 676.990 1.00 123.57 ? 591  SER C CA    1 
ATOM   8145  C  C     . SER C 2  591  ? 497.456 -18.416 676.854 1.00 117.60 ? 591  SER C C     1 
ATOM   8146  O  O     . SER C 2  591  ? 497.801 -17.717 675.894 1.00 117.72 ? 591  SER C O     1 
ATOM   8147  C  CB    . SER C 2  591  ? 495.195 -17.833 677.795 1.00 127.85 ? 591  SER C CB    1 
ATOM   8148  O  OG    . SER C 2  591  ? 496.030 -17.078 678.659 1.00 136.11 ? 591  SER C OG    1 
ATOM   8149  N  N     . LEU C 2  592  ? 498.311 -18.777 677.814 1.00 114.42 ? 592  LEU C N     1 
ATOM   8150  C  CA    . LEU C 2  592  ? 499.745 -18.496 677.790 1.00 118.75 ? 592  LEU C CA    1 
ATOM   8151  C  C     . LEU C 2  592  ? 500.042 -17.140 678.414 1.00 127.59 ? 592  LEU C C     1 
ATOM   8152  O  O     . LEU C 2  592  ? 501.191 -16.736 678.427 1.00 137.30 ? 592  LEU C O     1 
ATOM   8153  C  CB    . LEU C 2  592  ? 500.419 -18.588 676.408 1.00 106.92 ? 592  LEU C CB    1 
ATOM   8154  C  CG    . LEU C 2  592  ? 500.969 -19.973 676.051 1.00 100.12 ? 592  LEU C CG    1 
ATOM   8155  C  CD1   . LEU C 2  592  ? 499.901 -21.024 675.916 1.00 96.35  ? 592  LEU C CD1   1 
ATOM   8156  C  CD2   . LEU C 2  592  ? 501.823 -19.906 674.800 1.00 100.67 ? 592  LEU C CD2   1 
ATOM   8157  N  N     . ALA C 2  593  ? 499.037 -16.394 678.856 1.00 138.78 ? 593  ALA C N     1 
ATOM   8158  C  CA    . ALA C 2  593  ? 499.293 -15.238 679.718 1.00 147.74 ? 593  ALA C CA    1 
ATOM   8159  C  C     . ALA C 2  593  ? 500.078 -15.585 680.989 1.00 152.10 ? 593  ALA C C     1 
ATOM   8160  O  O     . ALA C 2  593  ? 501.058 -14.901 681.314 1.00 156.06 ? 593  ALA C O     1 
ATOM   8161  C  CB    . ALA C 2  593  ? 497.965 -14.582 680.109 1.00 145.51 ? 593  ALA C CB    1 
ATOM   8162  N  N     . ALA C 2  594  ? 499.687 -16.639 681.713 1.00 146.88 ? 594  ALA C N     1 
ATOM   8163  C  CA    . ALA C 2  594  ? 500.439 -17.036 682.903 1.00 142.93 ? 594  ALA C CA    1 
ATOM   8164  C  C     . ALA C 2  594  ? 501.700 -17.841 682.578 1.00 142.25 ? 594  ALA C C     1 
ATOM   8165  O  O     . ALA C 2  594  ? 501.814 -18.484 681.535 1.00 147.67 ? 594  ALA C O     1 
ATOM   8166  C  CB    . ALA C 2  594  ? 499.560 -17.855 683.836 1.00 140.80 ? 594  ALA C CB    1 
ATOM   8167  N  N     . LEU C 2  595  ? 502.657 -17.788 683.505 1.00 135.72 ? 595  LEU C N     1 
ATOM   8168  C  CA    . LEU C 2  595  ? 503.978 -18.398 683.372 1.00 132.53 ? 595  LEU C CA    1 
ATOM   8169  C  C     . LEU C 2  595  ? 504.124 -19.565 684.356 1.00 136.48 ? 595  LEU C C     1 
ATOM   8170  O  O     . LEU C 2  595  ? 503.853 -19.395 685.551 1.00 142.35 ? 595  LEU C O     1 
ATOM   8171  C  CB    . LEU C 2  595  ? 505.037 -17.333 683.629 1.00 127.13 ? 595  LEU C CB    1 
ATOM   8172  C  CG    . LEU C 2  595  ? 506.414 -17.686 683.158 1.00 127.55 ? 595  LEU C CG    1 
ATOM   8173  C  CD1   . LEU C 2  595  ? 506.261 -17.699 681.674 1.00 126.99 ? 595  LEU C CD1   1 
ATOM   8174  C  CD2   . LEU C 2  595  ? 507.363 -16.616 683.596 1.00 128.76 ? 595  LEU C CD2   1 
ATOM   8175  N  N     . TYR C 2  596  ? 504.617 -20.725 683.888 1.00 132.89 ? 596  TYR C N     1 
ATOM   8176  C  CA    . TYR C 2  596  ? 504.748 -21.916 684.740 1.00 129.90 ? 596  TYR C CA    1 
ATOM   8177  C  C     . TYR C 2  596  ? 506.153 -22.499 684.767 1.00 132.31 ? 596  TYR C C     1 
ATOM   8178  O  O     . TYR C 2  596  ? 506.993 -22.189 683.923 1.00 131.38 ? 596  TYR C O     1 
ATOM   8179  C  CB    . TYR C 2  596  ? 503.766 -22.999 684.289 1.00 124.69 ? 596  TYR C CB    1 
ATOM   8180  C  CG    . TYR C 2  596  ? 502.337 -22.490 684.283 1.00 120.19 ? 596  TYR C CG    1 
ATOM   8181  C  CD1   . TYR C 2  596  ? 501.809 -21.867 683.171 1.00 117.13 ? 596  TYR C CD1   1 
ATOM   8182  C  CD2   . TYR C 2  596  ? 501.499 -22.686 685.372 1.00 117.43 ? 596  TYR C CD2   1 
ATOM   8183  C  CE1   . TYR C 2  596  ? 500.518 -21.412 683.160 1.00 110.41 ? 596  TYR C CE1   1 
ATOM   8184  C  CE2   . TYR C 2  596  ? 500.208 -22.245 685.350 1.00 109.74 ? 596  TYR C CE2   1 
ATOM   8185  C  CZ    . TYR C 2  596  ? 499.730 -21.611 684.241 1.00 107.06 ? 596  TYR C CZ    1 
ATOM   8186  O  OH    . TYR C 2  596  ? 498.447 -21.148 684.199 1.00 110.08 ? 596  TYR C OH    1 
ATOM   8187  N  N     . ALA C 2  597  ? 506.404 -23.332 685.786 1.00 135.66 ? 597  ALA C N     1 
ATOM   8188  C  CA    . ALA C 2  597  ? 507.707 -23.964 685.961 1.00 142.29 ? 597  ALA C CA    1 
ATOM   8189  C  C     . ALA C 2  597  ? 507.858 -25.232 685.123 1.00 151.38 ? 597  ALA C C     1 
ATOM   8190  O  O     . ALA C 2  597  ? 507.015 -26.135 685.194 1.00 153.95 ? 597  ALA C O     1 
ATOM   8191  C  CB    . ALA C 2  597  ? 507.914 -24.300 687.430 1.00 136.92 ? 597  ALA C CB    1 
ATOM   8192  N  N     . GLU C 2  598  ? 508.976 -25.320 684.385 1.00 159.91 ? 598  GLU C N     1 
ATOM   8193  C  CA    . GLU C 2  598  ? 509.246 -26.456 683.496 1.00 166.20 ? 598  GLU C CA    1 
ATOM   8194  C  C     . GLU C 2  598  ? 509.409 -27.767 684.252 1.00 168.05 ? 598  GLU C C     1 
ATOM   8195  O  O     . GLU C 2  598  ? 508.733 -28.756 683.949 1.00 166.88 ? 598  GLU C O     1 
ATOM   8196  C  CB    . GLU C 2  598  ? 510.452 -26.170 682.598 1.00 175.39 ? 598  GLU C CB    1 
ATOM   8197  C  CG    . GLU C 2  598  ? 510.143 -25.082 681.575 1.00 178.89 ? 598  GLU C CG    1 
ATOM   8198  C  CD    . GLU C 2  598  ? 511.272 -24.841 680.605 1.00 184.86 ? 598  GLU C CD    1 
ATOM   8199  O  OE1   . GLU C 2  598  ? 511.980 -25.820 680.277 1.00 188.68 ? 598  GLU C OE1   1 
ATOM   8200  O  OE2   . GLU C 2  598  ? 511.394 -23.693 680.117 1.00 184.43 ? 598  GLU C OE2   1 
ATOM   8201  N  N     . GLU C 2  599  ? 510.347 -27.820 685.193 1.00 172.55 ? 599  GLU C N     1 
ATOM   8202  C  CA    . GLU C 2  599  ? 510.536 -29.028 685.977 1.00 176.23 ? 599  GLU C CA    1 
ATOM   8203  C  C     . GLU C 2  599  ? 510.464 -28.623 687.445 1.00 174.14 ? 599  GLU C C     1 
ATOM   8204  O  O     . GLU C 2  599  ? 510.258 -27.450 687.767 1.00 171.24 ? 599  GLU C O     1 
ATOM   8205  C  CB    . GLU C 2  599  ? 511.889 -29.678 685.636 1.00 183.88 ? 599  GLU C CB    1 
ATOM   8206  C  CG    . GLU C 2  599  ? 511.878 -31.192 685.481 1.00 188.63 ? 599  GLU C CG    1 
ATOM   8207  C  CD    . GLU C 2  599  ? 511.281 -31.618 684.129 1.00 188.33 ? 599  GLU C CD    1 
ATOM   8208  O  OE1   . GLU C 2  599  ? 511.460 -30.880 683.128 1.00 185.99 ? 599  GLU C OE1   1 
ATOM   8209  O  OE2   . GLU C 2  599  ? 510.628 -32.683 684.065 1.00 189.63 ? 599  GLU C OE2   1 
ATOM   8210  N  N     . ASP C 2  600  ? 510.644 -29.581 688.350 1.00 174.51 ? 600  ASP C N     1 
ATOM   8211  C  CA    . ASP C 2  600  ? 510.724 -29.247 689.769 1.00 171.33 ? 600  ASP C CA    1 
ATOM   8212  C  C     . ASP C 2  600  ? 511.979 -28.412 690.023 1.00 167.84 ? 600  ASP C C     1 
ATOM   8213  O  O     . ASP C 2  600  ? 512.970 -28.525 689.302 1.00 173.93 ? 600  ASP C O     1 
ATOM   8214  C  CB    . ASP C 2  600  ? 510.726 -30.519 690.619 1.00 178.01 ? 600  ASP C CB    1 
ATOM   8215  C  CG    . ASP C 2  600  ? 509.454 -31.340 690.448 1.00 176.84 ? 600  ASP C CG    1 
ATOM   8216  O  OD1   . ASP C 2  600  ? 508.587 -31.298 691.350 1.00 174.24 ? 600  ASP C OD1   1 
ATOM   8217  O  OD2   . ASP C 2  600  ? 509.330 -32.031 689.410 1.00 177.11 ? 600  ASP C OD2   1 
ATOM   8218  N  N     . GLY C 2  601  ? 511.948 -27.564 691.045 1.00 159.75 ? 601  GLY C N     1 
ATOM   8219  C  CA    . GLY C 2  601  ? 513.116 -26.733 691.283 1.00 159.49 ? 601  GLY C CA    1 
ATOM   8220  C  C     . GLY C 2  601  ? 512.918 -25.743 692.408 1.00 150.92 ? 601  GLY C C     1 
ATOM   8221  O  O     . GLY C 2  601  ? 511.945 -25.810 693.159 1.00 160.32 ? 601  GLY C O     1 
ATOM   8222  N  N     . GLU C 2  602  ? 513.878 -24.825 692.522 1.00 152.29 ? 602  GLU C N     1 
ATOM   8223  C  CA    . GLU C 2  602  ? 513.862 -23.781 693.534 1.00 152.21 ? 602  GLU C CA    1 
ATOM   8224  C  C     . GLU C 2  602  ? 514.052 -22.415 692.894 1.00 149.29 ? 602  GLU C C     1 
ATOM   8225  O  O     . GLU C 2  602  ? 514.870 -22.258 691.990 1.00 149.91 ? 602  GLU C O     1 
ATOM   8226  C  CB    . GLU C 2  602  ? 514.967 -24.013 694.559 1.00 166.37 ? 602  GLU C CB    1 
ATOM   8227  C  CG    . GLU C 2  602  ? 514.950 -23.015 695.707 1.00 168.30 ? 602  GLU C CG    1 
ATOM   8228  C  CD    . GLU C 2  602  ? 516.085 -23.221 696.693 1.00 177.58 ? 602  GLU C CD    1 
ATOM   8229  O  OE1   . GLU C 2  602  ? 516.436 -24.387 696.990 1.00 183.66 ? 602  GLU C OE1   1 
ATOM   8230  O  OE2   . GLU C 2  602  ? 516.634 -22.204 697.165 1.00 181.36 ? 602  GLU C OE2   1 
ATOM   8231  N  N     . VAL C 2  603  ? 513.333 -21.418 693.401 1.00 146.42 ? 603  VAL C N     1 
ATOM   8232  C  CA    . VAL C 2  603  ? 513.380 -20.074 692.830 1.00 146.75 ? 603  VAL C CA    1 
ATOM   8233  C  C     . VAL C 2  603  ? 514.626 -19.344 693.307 1.00 148.42 ? 603  VAL C C     1 
ATOM   8234  O  O     . VAL C 2  603  ? 514.782 -19.084 694.502 1.00 153.06 ? 603  VAL C O     1 
ATOM   8235  C  CB    . VAL C 2  603  ? 512.122 -19.270 693.189 1.00 146.66 ? 603  VAL C CB    1 
ATOM   8236  C  CG1   . VAL C 2  603  ? 512.262 -17.854 692.664 1.00 145.44 ? 603  VAL C CG1   1 
ATOM   8237  C  CG2   . VAL C 2  603  ? 510.855 -19.923 692.600 1.00 144.48 ? 603  VAL C CG2   1 
ATOM   8238  N  N     . ALA C 2  604  ? 515.504 -18.985 692.371 1.00 147.55 ? 604  ALA C N     1 
ATOM   8239  C  CA    . ALA C 2  604  ? 516.707 -18.270 692.767 1.00 151.03 ? 604  ALA C CA    1 
ATOM   8240  C  C     . ALA C 2  604  ? 516.462 -16.776 692.936 1.00 157.30 ? 604  ALA C C     1 
ATOM   8241  O  O     . ALA C 2  604  ? 516.906 -16.171 693.915 1.00 161.60 ? 604  ALA C O     1 
ATOM   8242  C  CB    . ALA C 2  604  ? 517.788 -18.496 691.719 1.00 152.93 ? 604  ALA C CB    1 
ATOM   8243  N  N     . LYS C 2  605  ? 515.775 -16.162 691.984 1.00 152.14 ? 605  LYS C N     1 
ATOM   8244  C  CA    . LYS C 2  605  ? 515.559 -14.720 691.958 1.00 150.87 ? 605  LYS C CA    1 
ATOM   8245  C  C     . LYS C 2  605  ? 514.165 -14.364 691.460 1.00 144.08 ? 605  LYS C C     1 
ATOM   8246  O  O     . LYS C 2  605  ? 513.597 -15.073 690.630 1.00 148.61 ? 605  LYS C O     1 
ATOM   8247  C  CB    . LYS C 2  605  ? 516.663 -13.996 691.182 1.00 160.10 ? 605  LYS C CB    1 
ATOM   8248  C  CG    . LYS C 2  605  ? 517.970 -14.038 691.945 1.00 172.38 ? 605  LYS C CG    1 
ATOM   8249  C  CD    . LYS C 2  605  ? 519.103 -13.271 691.309 1.00 181.29 ? 605  LYS C CD    1 
ATOM   8250  C  CE    . LYS C 2  605  ? 520.329 -13.357 692.238 1.00 194.08 ? 605  LYS C CE    1 
ATOM   8251  N  NZ    . LYS C 2  605  ? 521.527 -12.594 691.770 1.00 200.09 ? 605  LYS C NZ    1 
ATOM   8252  N  N     . VAL C 2  606  ? 513.587 -13.309 692.024 1.00 137.64 ? 606  VAL C N     1 
ATOM   8253  C  CA    . VAL C 2  606  ? 512.298 -12.775 691.579 1.00 137.16 ? 606  VAL C CA    1 
ATOM   8254  C  C     . VAL C 2  606  ? 512.395 -11.258 691.488 1.00 136.20 ? 606  VAL C C     1 
ATOM   8255  O  O     . VAL C 2  606  ? 512.740 -10.594 692.469 1.00 142.61 ? 606  VAL C O     1 
ATOM   8256  C  CB    . VAL C 2  606  ? 511.108 -13.178 692.457 1.00 135.83 ? 606  VAL C CB    1 
ATOM   8257  C  CG1   . VAL C 2  606  ? 509.890 -12.348 692.061 1.00 126.67 ? 606  VAL C CG1   1 
ATOM   8258  C  CG2   . VAL C 2  606  ? 510.804 -14.640 692.262 1.00 136.48 ? 606  VAL C CG2   1 
ATOM   8259  N  N     . ASP C 2  607  ? 512.090 -10.713 690.319 1.00 135.52 ? 607  ASP C N     1 
ATOM   8260  C  CA    . ASP C 2  607  ? 512.218 -9.300  690.008 1.00 136.98 ? 607  ASP C CA    1 
ATOM   8261  C  C     . ASP C 2  607  ? 510.939 -8.817  689.353 1.00 130.84 ? 607  ASP C C     1 
ATOM   8262  O  O     . ASP C 2  607  ? 510.071 -9.609  688.984 1.00 130.72 ? 607  ASP C O     1 
ATOM   8263  C  CB    . ASP C 2  607  ? 513.380 -9.108  689.011 1.00 147.09 ? 607  ASP C CB    1 
ATOM   8264  C  CG    . ASP C 2  607  ? 514.113 -7.816  689.183 1.00 155.94 ? 607  ASP C CG    1 
ATOM   8265  O  OD1   . ASP C 2  607  ? 514.000 -7.219  690.265 1.00 159.41 ? 607  ASP C OD1   1 
ATOM   8266  O  OD2   . ASP C 2  607  ? 514.833 -7.424  688.231 1.00 155.86 ? 607  ASP C OD2   1 
ATOM   8267  N  N     . GLY C 2  608  ? 510.805 -7.497  689.234 1.00 126.41 ? 608  GLY C N     1 
ATOM   8268  C  CA    . GLY C 2  608  ? 509.719 -6.973  688.427 1.00 130.54 ? 608  GLY C CA    1 
ATOM   8269  C  C     . GLY C 2  608  ? 509.924 -7.346  686.969 1.00 129.28 ? 608  GLY C C     1 
ATOM   8270  O  O     . GLY C 2  608  ? 508.968 -7.602  686.226 1.00 108.85 ? 608  GLY C O     1 
ATOM   8271  N  N     . ASN C 2  609  ? 511.183 -7.334  686.536 1.00 135.85 ? 609  ASN C N     1 
ATOM   8272  C  CA    . ASN C 2  609  ? 511.545 -7.621  685.168 1.00 129.97 ? 609  ASN C CA    1 
ATOM   8273  C  C     . ASN C 2  609  ? 511.829 -9.098  684.913 1.00 128.86 ? 609  ASN C C     1 
ATOM   8274  O  O     . ASN C 2  609  ? 511.724 -9.533  683.760 1.00 129.61 ? 609  ASN C O     1 
ATOM   8275  C  CB    . ASN C 2  609  ? 512.762 -6.761  684.775 1.00 116.88 ? 609  ASN C CB    1 
ATOM   8276  C  CG    . ASN C 2  609  ? 512.613 -5.281  685.167 1.00 116.39 ? 609  ASN C CG    1 
ATOM   8277  O  OD1   . ASN C 2  609  ? 511.535 -4.728  685.107 1.00 113.18 ? 609  ASN C OD1   1 
ATOM   8278  N  ND2   . ASN C 2  609  ? 513.699 -4.649  685.538 1.00 119.72 ? 609  ASN C ND2   1 
ATOM   8279  N  N     . ARG C 2  610  ? 512.137 -9.899  685.934 1.00 121.24 ? 610  ARG C N     1 
ATOM   8280  C  CA    . ARG C 2  610  ? 512.531 -11.268 685.613 1.00 125.65 ? 610  ARG C CA    1 
ATOM   8281  C  C     . ARG C 2  610  ? 512.421 -12.195 686.815 1.00 130.91 ? 610  ARG C C     1 
ATOM   8282  O  O     . ARG C 2  610  ? 512.392 -11.752 687.962 1.00 132.33 ? 610  ARG C O     1 
ATOM   8283  C  CB    . ARG C 2  610  ? 513.956 -11.317 685.067 1.00 130.78 ? 610  ARG C CB    1 
ATOM   8284  C  CG    . ARG C 2  610  ? 515.008 -10.671 685.939 1.00 137.26 ? 610  ARG C CG    1 
ATOM   8285  C  CD    . ARG C 2  610  ? 515.787 -11.781 686.578 1.00 144.95 ? 610  ARG C CD    1 
ATOM   8286  N  NE    . ARG C 2  610  ? 516.826 -11.338 687.493 1.00 155.24 ? 610  ARG C NE    1 
ATOM   8287  C  CZ    . ARG C 2  610  ? 516.698 -11.319 688.811 1.00 164.25 ? 610  ARG C CZ    1 
ATOM   8288  N  NH1   . ARG C 2  610  ? 515.568 -11.729 689.372 1.00 166.16 ? 610  ARG C NH1   1 
ATOM   8289  N  NH2   . ARG C 2  610  ? 517.714 -10.920 689.564 1.00 170.20 ? 610  ARG C NH2   1 
ATOM   8290  N  N     . ILE C 2  611  ? 512.369 -13.501 686.524 1.00 131.37 ? 611  ILE C N     1 
ATOM   8291  C  CA    . ILE C 2  611  ? 512.359 -14.569 687.527 1.00 133.46 ? 611  ILE C CA    1 
ATOM   8292  C  C     . ILE C 2  611  ? 513.398 -15.602 687.074 1.00 128.55 ? 611  ILE C C     1 
ATOM   8293  O  O     . ILE C 2  611  ? 513.307 -16.111 685.951 1.00 127.27 ? 611  ILE C O     1 
ATOM   8294  C  CB    . ILE C 2  611  ? 510.963 -15.221 687.651 1.00 127.63 ? 611  ILE C CB    1 
ATOM   8295  C  CG1   . ILE C 2  611  ? 509.905 -14.228 688.125 1.00 123.26 ? 611  ILE C CG1   1 
ATOM   8296  C  CG2   . ILE C 2  611  ? 510.964 -16.357 688.675 1.00 124.85 ? 611  ILE C CG2   1 
ATOM   8297  C  CD1   . ILE C 2  611  ? 508.499 -14.799 688.089 1.00 115.64 ? 611  ILE C CD1   1 
ATOM   8298  N  N     . VAL C 2  612  ? 514.393 -15.892 687.921 1.00 138.20 ? 612  VAL C N     1 
ATOM   8299  C  CA    . VAL C 2  612  ? 515.426 -16.902 687.647 1.00 141.06 ? 612  VAL C CA    1 
ATOM   8300  C  C     . VAL C 2  612  ? 515.166 -18.134 688.507 1.00 141.41 ? 612  VAL C C     1 
ATOM   8301  O  O     . VAL C 2  612  ? 515.088 -18.030 689.737 1.00 142.63 ? 612  VAL C O     1 
ATOM   8302  C  CB    . VAL C 2  612  ? 516.849 -16.363 687.876 1.00 140.94 ? 612  VAL C CB    1 
ATOM   8303  C  CG1   . VAL C 2  612  ? 517.857 -17.429 687.513 1.00 144.84 ? 612  VAL C CG1   1 
ATOM   8304  C  CG2   . VAL C 2  612  ? 517.090 -15.133 687.028 1.00 139.03 ? 612  VAL C CG2   1 
ATOM   8305  N  N     . VAL C 2  613  ? 515.080 -19.303 687.871 1.00 141.08 ? 613  VAL C N     1 
ATOM   8306  C  CA    . VAL C 2  613  ? 514.759 -20.557 688.545 1.00 143.54 ? 613  VAL C CA    1 
ATOM   8307  C  C     . VAL C 2  613  ? 515.891 -21.569 688.386 1.00 149.05 ? 613  VAL C C     1 
ATOM   8308  O  O     . VAL C 2  613  ? 516.421 -21.749 687.286 1.00 150.62 ? 613  VAL C O     1 
ATOM   8309  C  CB    . VAL C 2  613  ? 513.451 -21.152 688.012 1.00 137.37 ? 613  VAL C CB    1 
ATOM   8310  C  CG1   . VAL C 2  613  ? 513.188 -22.488 688.669 1.00 139.72 ? 613  VAL C CG1   1 
ATOM   8311  C  CG2   . VAL C 2  613  ? 512.349 -20.193 688.263 1.00 133.14 ? 613  VAL C CG2   1 
ATOM   8312  N  N     . ARG C 2  614  ? 516.290 -22.189 689.495 1.00 153.68 ? 614  ARG C N     1 
ATOM   8313  C  CA    . ARG C 2  614  ? 517.249 -23.291 689.500 1.00 162.82 ? 614  ARG C CA    1 
ATOM   8314  C  C     . ARG C 2  614  ? 516.491 -24.615 689.586 1.00 167.02 ? 614  ARG C C     1 
ATOM   8315  O  O     . ARG C 2  614  ? 515.844 -24.891 690.601 1.00 172.63 ? 614  ARG C O     1 
ATOM   8316  C  CB    . ARG C 2  614  ? 518.199 -23.155 690.690 1.00 167.63 ? 614  ARG C CB    1 
ATOM   8317  C  CG    . ARG C 2  614  ? 519.063 -24.385 690.990 1.00 173.02 ? 614  ARG C CG    1 
ATOM   8318  C  CD    . ARG C 2  614  ? 519.987 -24.741 689.845 1.00 174.22 ? 614  ARG C CD    1 
ATOM   8319  N  NE    . ARG C 2  614  ? 521.059 -23.768 689.722 1.00 173.50 ? 614  ARG C NE    1 
ATOM   8320  C  CZ    . ARG C 2  614  ? 522.138 -23.772 690.489 1.00 176.11 ? 614  ARG C CZ    1 
ATOM   8321  N  NH1   . ARG C 2  614  ? 523.069 -22.850 690.315 1.00 178.63 ? 614  ARG C NH1   1 
ATOM   8322  N  NH2   . ARG C 2  614  ? 522.282 -24.704 691.421 1.00 177.39 ? 614  ARG C NH2   1 
ATOM   8323  N  N     . TYR C 2  615  ? 516.538 -25.426 688.526 1.00 172.13 ? 615  TYR C N     1 
ATOM   8324  C  CA    . TYR C 2  615  ? 515.770 -26.666 688.550 1.00 177.87 ? 615  TYR C CA    1 
ATOM   8325  C  C     . TYR C 2  615  ? 516.570 -27.804 689.183 1.00 191.18 ? 615  TYR C C     1 
ATOM   8326  O  O     . TYR C 2  615  ? 517.682 -27.624 689.684 1.00 197.15 ? 615  TYR C O     1 
ATOM   8327  C  CB    . TYR C 2  615  ? 515.303 -27.093 687.151 1.00 175.46 ? 615  TYR C CB    1 
ATOM   8328  C  CG    . TYR C 2  615  ? 514.190 -26.269 686.551 1.00 170.98 ? 615  TYR C CG    1 
ATOM   8329  C  CD1   . TYR C 2  615  ? 513.167 -25.765 687.360 1.00 168.51 ? 615  TYR C CD1   1 
ATOM   8330  C  CD2   . TYR C 2  615  ? 514.109 -26.051 685.179 1.00 168.42 ? 615  TYR C CD2   1 
ATOM   8331  C  CE1   . TYR C 2  615  ? 512.116 -25.033 686.831 1.00 160.49 ? 615  TYR C CE1   1 
ATOM   8332  C  CE2   . TYR C 2  615  ? 513.050 -25.305 684.635 1.00 163.26 ? 615  TYR C CE2   1 
ATOM   8333  C  CZ    . TYR C 2  615  ? 512.059 -24.801 685.478 1.00 156.11 ? 615  TYR C CZ    1 
ATOM   8334  O  OH    . TYR C 2  615  ? 511.004 -24.071 684.992 1.00 148.27 ? 615  TYR C OH    1 
ATOM   8335  N  N     . GLU C 2  616  ? 515.949 -28.990 689.203 1.00 197.66 ? 616  GLU C N     1 
ATOM   8336  C  CA    . GLU C 2  616  ? 516.607 -30.200 689.694 1.00 207.80 ? 616  GLU C CA    1 
ATOM   8337  C  C     . GLU C 2  616  ? 517.792 -30.544 688.798 1.00 213.09 ? 616  GLU C C     1 
ATOM   8338  O  O     . GLU C 2  616  ? 518.826 -31.043 689.265 1.00 217.97 ? 616  GLU C O     1 
ATOM   8339  C  CB    . GLU C 2  616  ? 515.615 -31.364 689.806 1.00 205.87 ? 616  GLU C CB    1 
ATOM   8340  C  CG    . GLU C 2  616  ? 514.965 -31.798 688.510 1.00 202.50 ? 616  GLU C CG    1 
ATOM   8341  C  CD    . GLU C 2  616  ? 514.391 -33.192 688.600 1.00 203.08 ? 616  GLU C CD    1 
ATOM   8342  O  OE1   . GLU C 2  616  ? 513.931 -33.576 689.699 1.00 202.66 ? 616  GLU C OE1   1 
ATOM   8343  O  OE2   . GLU C 2  616  ? 514.429 -33.912 687.580 1.00 203.34 ? 616  GLU C OE2   1 
ATOM   8344  N  N     . ASP C 2  617  ? 517.638 -30.284 687.492 1.00 213.15 ? 617  ASP C N     1 
ATOM   8345  C  CA    . ASP C 2  617  ? 518.650 -30.567 686.485 1.00 214.20 ? 617  ASP C CA    1 
ATOM   8346  C  C     . ASP C 2  617  ? 519.957 -29.833 686.770 1.00 214.37 ? 617  ASP C C     1 
ATOM   8347  O  O     . ASP C 2  617  ? 521.009 -30.232 686.260 1.00 217.81 ? 617  ASP C O     1 
ATOM   8348  C  CB    . ASP C 2  617  ? 518.150 -30.109 685.096 1.00 213.43 ? 617  ASP C CB    1 
ATOM   8349  C  CG    . ASP C 2  617  ? 516.609 -30.095 684.964 1.00 209.80 ? 617  ASP C CG    1 
ATOM   8350  O  OD1   . ASP C 2  617  ? 515.899 -30.695 685.795 1.00 209.73 ? 617  ASP C OD1   1 
ATOM   8351  O  OD2   . ASP C 2  617  ? 516.103 -29.456 684.015 1.00 204.12 ? 617  ASP C OD2   1 
ATOM   8352  N  N     . GLY C 2  618  ? 519.907 -28.771 687.573 1.00 207.52 ? 618  GLY C N     1 
ATOM   8353  C  CA    . GLY C 2  618  ? 521.041 -27.931 687.883 1.00 203.19 ? 618  GLY C CA    1 
ATOM   8354  C  C     . GLY C 2  618  ? 521.138 -26.716 686.988 1.00 193.43 ? 618  GLY C C     1 
ATOM   8355  O  O     . GLY C 2  618  ? 521.818 -25.743 687.337 1.00 192.98 ? 618  GLY C O     1 
ATOM   8356  N  N     . ARG C 2  619  ? 520.480 -26.768 685.838 1.00 181.60 ? 619  ARG C N     1 
ATOM   8357  C  CA    . ARG C 2  619  ? 520.478 -25.676 684.884 1.00 173.06 ? 619  ARG C CA    1 
ATOM   8358  C  C     . ARG C 2  619  ? 519.739 -24.468 685.447 1.00 168.27 ? 619  ARG C C     1 
ATOM   8359  O  O     . ARG C 2  619  ? 518.735 -24.606 686.152 1.00 162.81 ? 619  ARG C O     1 
ATOM   8360  C  CB    . ARG C 2  619  ? 519.861 -26.179 683.571 1.00 168.64 ? 619  ARG C CB    1 
ATOM   8361  C  CG    . ARG C 2  619  ? 518.459 -26.768 683.720 1.00 163.97 ? 619  ARG C CG    1 
ATOM   8362  C  CD    . ARG C 2  619  ? 517.998 -27.460 682.445 1.00 163.21 ? 619  ARG C CD    1 
ATOM   8363  N  NE    . ARG C 2  619  ? 516.591 -27.845 682.502 1.00 166.87 ? 619  ARG C NE    1 
ATOM   8364  C  CZ    . ARG C 2  619  ? 515.598 -27.160 681.942 1.00 168.93 ? 619  ARG C CZ    1 
ATOM   8365  N  NH1   . ARG C 2  619  ? 514.336 -27.583 682.050 1.00 166.81 ? 619  ARG C NH1   1 
ATOM   8366  N  NH2   . ARG C 2  619  ? 515.872 -26.082 681.215 1.00 169.84 ? 619  ARG C NH2   1 
ATOM   8367  N  N     . LEU C 2  620  ? 520.290 -23.282 685.205 1.00 166.61 ? 620  LEU C N     1 
ATOM   8368  C  CA    . LEU C 2  620  ? 519.743 -22.032 685.721 1.00 162.69 ? 620  LEU C CA    1 
ATOM   8369  C  C     . LEU C 2  620  ? 518.993 -21.390 684.556 1.00 154.31 ? 620  LEU C C     1 
ATOM   8370  O  O     . LEU C 2  620  ? 519.612 -20.905 683.601 1.00 149.46 ? 620  LEU C O     1 
ATOM   8371  C  CB    . LEU C 2  620  ? 520.838 -21.117 686.268 1.00 162.93 ? 620  LEU C CB    1 
ATOM   8372  C  CG    . LEU C 2  620  ? 520.408 -20.110 687.332 1.00 156.44 ? 620  LEU C CG    1 
ATOM   8373  C  CD1   . LEU C 2  620  ? 519.988 -20.849 688.564 1.00 158.14 ? 620  LEU C CD1   1 
ATOM   8374  C  CD2   . LEU C 2  620  ? 521.520 -19.128 687.659 1.00 160.64 ? 620  LEU C CD2   1 
ATOM   8375  N  N     . VAL C 2  621  ? 517.664 -21.372 684.646 1.00 147.84 ? 621  VAL C N     1 
ATOM   8376  C  CA    . VAL C 2  621  ? 516.789 -20.866 683.589 1.00 142.12 ? 621  VAL C CA    1 
ATOM   8377  C  C     . VAL C 2  621  ? 516.276 -19.498 684.006 1.00 141.68 ? 621  VAL C C     1 
ATOM   8378  O  O     . VAL C 2  621  ? 515.792 -19.327 685.132 1.00 143.54 ? 621  VAL C O     1 
ATOM   8379  C  CB    . VAL C 2  621  ? 515.608 -21.826 683.354 1.00 138.10 ? 621  VAL C CB    1 
ATOM   8380  C  CG1   . VAL C 2  621  ? 514.722 -21.349 682.213 1.00 133.28 ? 621  VAL C CG1   1 
ATOM   8381  C  CG2   . VAL C 2  621  ? 516.113 -23.234 683.115 1.00 145.43 ? 621  VAL C CG2   1 
ATOM   8382  N  N     . GLU C 2  622  ? 516.375 -18.521 683.109 1.00 135.41 ? 622  GLU C N     1 
ATOM   8383  C  CA    . GLU C 2  622  ? 515.900 -17.174 683.396 1.00 138.42 ? 622  GLU C CA    1 
ATOM   8384  C  C     . GLU C 2  622  ? 514.668 -16.897 682.539 1.00 137.71 ? 622  GLU C C     1 
ATOM   8385  O  O     . GLU C 2  622  ? 514.718 -17.006 681.306 1.00 137.33 ? 622  GLU C O     1 
ATOM   8386  C  CB    . GLU C 2  622  ? 516.993 -16.123 683.191 1.00 137.06 ? 622  GLU C CB    1 
ATOM   8387  C  CG    . GLU C 2  622  ? 516.492 -14.687 683.264 1.00 131.54 ? 622  GLU C CG    1 
ATOM   8388  C  CD    . GLU C 2  622  ? 517.587 -13.690 683.613 1.00 135.74 ? 622  GLU C CD    1 
ATOM   8389  O  OE1   . GLU C 2  622  ? 518.573 -14.076 684.280 1.00 140.95 ? 622  GLU C OE1   1 
ATOM   8390  O  OE2   . GLU C 2  622  ? 517.469 -12.515 683.215 1.00 134.28 ? 622  GLU C OE2   1 
ATOM   8391  N  N     . TYR C 2  623  ? 513.568 -16.539 683.193 1.00 131.64 ? 623  TYR C N     1 
ATOM   8392  C  CA    . TYR C 2  623  ? 512.352 -16.216 682.473 1.00 123.51 ? 623  TYR C CA    1 
ATOM   8393  C  C     . TYR C 2  623  ? 512.164 -14.718 682.553 1.00 120.74 ? 623  TYR C C     1 
ATOM   8394  O  O     . TYR C 2  623  ? 511.876 -14.188 683.633 1.00 120.25 ? 623  TYR C O     1 
ATOM   8395  C  CB    . TYR C 2  623  ? 511.139 -16.911 683.071 1.00 120.53 ? 623  TYR C CB    1 
ATOM   8396  C  CG    . TYR C 2  623  ? 511.199 -18.400 683.169 1.00 127.38 ? 623  TYR C CG    1 
ATOM   8397  C  CD1   . TYR C 2  623  ? 511.775 -19.011 684.259 1.00 134.30 ? 623  TYR C CD1   1 
ATOM   8398  C  CD2   . TYR C 2  623  ? 510.618 -19.199 682.200 1.00 131.17 ? 623  TYR C CD2   1 
ATOM   8399  C  CE1   . TYR C 2  623  ? 511.803 -20.377 684.373 1.00 137.12 ? 623  TYR C CE1   1 
ATOM   8400  C  CE2   . TYR C 2  623  ? 510.640 -20.570 682.303 1.00 136.16 ? 623  TYR C CE2   1 
ATOM   8401  C  CZ    . TYR C 2  623  ? 511.233 -21.151 683.396 1.00 141.54 ? 623  TYR C CZ    1 
ATOM   8402  O  OH    . TYR C 2  623  ? 511.267 -22.517 683.522 1.00 145.04 ? 623  TYR C OH    1 
ATOM   8403  N  N     . PRO C 2  624  ? 512.359 -14.001 681.467 1.00 125.12 ? 624  PRO C N     1 
ATOM   8404  C  CA    . PRO C 2  624  ? 512.062 -12.572 681.457 1.00 124.67 ? 624  PRO C CA    1 
ATOM   8405  C  C     . PRO C 2  624  ? 510.564 -12.382 681.388 1.00 125.11 ? 624  PRO C C     1 
ATOM   8406  O  O     . PRO C 2  624  ? 509.829 -13.215 680.854 1.00 123.30 ? 624  PRO C O     1 
ATOM   8407  C  CB    . PRO C 2  624  ? 512.744 -12.081 680.182 1.00 128.23 ? 624  PRO C CB    1 
ATOM   8408  C  CG    . PRO C 2  624  ? 512.667 -13.283 679.275 1.00 127.74 ? 624  PRO C CG    1 
ATOM   8409  C  CD    . PRO C 2  624  ? 512.844 -14.484 680.164 1.00 126.06 ? 624  PRO C CD    1 
ATOM   8410  N  N     . LEU C 2  625  ? 510.105 -11.291 681.968 1.00 124.56 ? 625  LEU C N     1 
ATOM   8411  C  CA    . LEU C 2  625  ? 508.680 -11.036 682.045 1.00 123.63 ? 625  LEU C CA    1 
ATOM   8412  C  C     . LEU C 2  625  ? 508.303 -9.882  681.136 1.00 121.74 ? 625  LEU C C     1 
ATOM   8413  O  O     . LEU C 2  625  ? 509.004 -8.869  681.063 1.00 124.94 ? 625  LEU C O     1 
ATOM   8414  C  CB    . LEU C 2  625  ? 508.271 -10.673 683.486 1.00 122.27 ? 625  LEU C CB    1 
ATOM   8415  C  CG    . LEU C 2  625  ? 508.515 -11.614 684.673 1.00 122.34 ? 625  LEU C CG    1 
ATOM   8416  C  CD1   . LEU C 2  625  ? 508.138 -10.959 685.967 1.00 121.72 ? 625  LEU C CD1   1 
ATOM   8417  C  CD2   . LEU C 2  625  ? 507.643 -12.840 684.490 1.00 118.47 ? 625  LEU C CD2   1 
ATOM   8418  N  N     . ARG C 2  626  ? 507.183 -10.046 680.458 1.00 121.49 ? 626  ARG C N     1 
ATOM   8419  C  CA    . ARG C 2  626  ? 506.676 -9.013  679.578 1.00 125.45 ? 626  ARG C CA    1 
ATOM   8420  C  C     . ARG C 2  626  ? 506.013 -7.983  680.467 1.00 131.03 ? 626  ARG C C     1 
ATOM   8421  O  O     . ARG C 2  626  ? 505.057 -8.306  681.183 1.00 131.45 ? 626  ARG C O     1 
ATOM   8422  C  CB    . ARG C 2  626  ? 505.651 -9.569  678.601 1.00 130.25 ? 626  ARG C CB    1 
ATOM   8423  C  CG    . ARG C 2  626  ? 505.160 -8.542  677.607 1.00 133.46 ? 626  ARG C CG    1 
ATOM   8424  C  CD    . ARG C 2  626  ? 504.342 -9.201  676.542 1.00 138.39 ? 626  ARG C CD    1 
ATOM   8425  N  NE    . ARG C 2  626  ? 505.158 -10.096 675.731 1.00 150.22 ? 626  ARG C NE    1 
ATOM   8426  C  CZ    . ARG C 2  626  ? 505.064 -11.421 675.747 1.00 156.26 ? 626  ARG C CZ    1 
ATOM   8427  N  NH1   . ARG C 2  626  ? 504.165 -12.012 676.532 1.00 155.16 ? 626  ARG C NH1   1 
ATOM   8428  N  NH2   . ARG C 2  626  ? 505.855 -12.148 674.958 1.00 158.89 ? 626  ARG C NH2   1 
ATOM   8429  N  N     . ARG C 2  627  ? 506.481 -6.745  680.414 1.00 130.84 ? 627  ARG C N     1 
ATOM   8430  C  CA    . ARG C 2  627  ? 505.982 -5.719  681.318 1.00 126.08 ? 627  ARG C CA    1 
ATOM   8431  C  C     . ARG C 2  627  ? 505.401 -4.586  680.489 1.00 117.28 ? 627  ARG C C     1 
ATOM   8432  O  O     . ARG C 2  627  ? 506.092 -3.997  679.651 1.00 113.80 ? 627  ARG C O     1 
ATOM   8433  C  CB    . ARG C 2  627  ? 507.096 -5.216  682.249 1.00 127.99 ? 627  ARG C CB    1 
ATOM   8434  C  CG    . ARG C 2  627  ? 507.404 -6.081  683.486 1.00 128.34 ? 627  ARG C CG    1 
ATOM   8435  C  CD    . ARG C 2  627  ? 506.142 -6.644  684.094 1.00 123.17 ? 627  ARG C CD    1 
ATOM   8436  N  NE    . ARG C 2  627  ? 506.243 -6.855  685.540 1.00 126.04 ? 627  ARG C NE    1 
ATOM   8437  C  CZ    . ARG C 2  627  ? 505.330 -6.444  686.425 1.00 123.56 ? 627  ARG C CZ    1 
ATOM   8438  N  NH1   . ARG C 2  627  ? 504.250 -5.797  686.005 1.00 113.48 ? 627  ARG C NH1   1 
ATOM   8439  N  NH2   . ARG C 2  627  ? 505.489 -6.676  687.734 1.00 128.47 ? 627  ARG C NH2   1 
ATOM   8440  N  N     . PHE C 2  628  ? 504.125 -4.304  680.732 1.00 115.90 ? 628  PHE C N     1 
ATOM   8441  C  CA    . PHE C 2  628  ? 503.367 -3.228  680.096 1.00 118.34 ? 628  PHE C CA    1 
ATOM   8442  C  C     . PHE C 2  628  ? 503.481 -3.226  678.562 1.00 120.28 ? 628  PHE C C     1 
ATOM   8443  O  O     . PHE C 2  628  ? 503.666 -2.178  677.942 1.00 122.26 ? 628  PHE C O     1 
ATOM   8444  C  CB    . PHE C 2  628  ? 503.802 -1.875  680.675 1.00 112.93 ? 628  PHE C CB    1 
ATOM   8445  C  CG    . PHE C 2  628  ? 503.726 -1.787  682.182 1.00 111.52 ? 628  PHE C CG    1 
ATOM   8446  C  CD1   . PHE C 2  628  ? 502.552 -1.406  682.812 1.00 105.19 ? 628  PHE C CD1   1 
ATOM   8447  C  CD2   . PHE C 2  628  ? 504.845 -2.017  682.964 1.00 119.38 ? 628  PHE C CD2   1 
ATOM   8448  C  CE1   . PHE C 2  628  ? 502.486 -1.303  684.178 1.00 107.60 ? 628  PHE C CE1   1 
ATOM   8449  C  CE2   . PHE C 2  628  ? 504.782 -1.910  684.354 1.00 118.79 ? 628  PHE C CE2   1 
ATOM   8450  C  CZ    . PHE C 2  628  ? 503.605 -1.551  684.956 1.00 112.07 ? 628  PHE C CZ    1 
ATOM   8451  N  N     . TYR C 2  629  ? 503.224 -4.368  677.921 1.00 122.67 ? 629  TYR C N     1 
ATOM   8452  C  CA    . TYR C 2  629  ? 503.286 -4.382  676.465 1.00 124.64 ? 629  TYR C CA    1 
ATOM   8453  C  C     . TYR C 2  629  ? 501.892 -4.113  675.924 1.00 110.73 ? 629  TYR C C     1 
ATOM   8454  O  O     . TYR C 2  629  ? 500.899 -4.526  676.520 1.00 105.42 ? 629  TYR C O     1 
ATOM   8455  C  CB    . TYR C 2  629  ? 503.858 -5.707  675.915 1.00 143.14 ? 629  TYR C CB    1 
ATOM   8456  C  CG    . TYR C 2  629  ? 503.690 -5.962  674.388 1.00 153.43 ? 629  TYR C CG    1 
ATOM   8457  C  CD1   . TYR C 2  629  ? 504.517 -5.311  673.458 1.00 154.03 ? 629  TYR C CD1   1 
ATOM   8458  C  CD2   . TYR C 2  629  ? 502.747 -6.874  673.888 1.00 154.27 ? 629  TYR C CD2   1 
ATOM   8459  C  CE1   . TYR C 2  629  ? 504.381 -5.539  672.095 1.00 153.90 ? 629  TYR C CE1   1 
ATOM   8460  C  CE2   . TYR C 2  629  ? 502.611 -7.104  672.510 1.00 151.03 ? 629  TYR C CE2   1 
ATOM   8461  C  CZ    . TYR C 2  629  ? 503.427 -6.434  671.628 1.00 153.08 ? 629  TYR C CZ    1 
ATOM   8462  O  OH    . TYR C 2  629  ? 503.288 -6.660  670.274 1.00 155.72 ? 629  TYR C OH    1 
ATOM   8463  N  N     . ARG C 2  630  ? 501.835 -3.389  674.805 1.00 101.81 ? 630  ARG C N     1 
ATOM   8464  C  CA    . ARG C 2  630  ? 500.589 -2.957  674.186 1.00 95.59  ? 630  ARG C CA    1 
ATOM   8465  C  C     . ARG C 2  630  ? 500.087 -3.958  673.139 1.00 97.68  ? 630  ARG C C     1 
ATOM   8466  O  O     . ARG C 2  630  ? 500.744 -4.182  672.109 1.00 100.67 ? 630  ARG C O     1 
ATOM   8467  C  CB    . ARG C 2  630  ? 500.817 -1.593  673.538 1.00 91.25  ? 630  ARG C CB    1 
ATOM   8468  C  CG    . ARG C 2  630  ? 499.618 -1.105  672.812 1.00 91.42  ? 630  ARG C CG    1 
ATOM   8469  C  CD    . ARG C 2  630  ? 499.918 0.040   671.877 1.00 94.60  ? 630  ARG C CD    1 
ATOM   8470  N  NE    . ARG C 2  630  ? 498.653 0.458   671.300 1.00 95.84  ? 630  ARG C NE    1 
ATOM   8471  C  CZ    . ARG C 2  630  ? 498.117 -0.106  670.225 1.00 91.65  ? 630  ARG C CZ    1 
ATOM   8472  N  NH1   . ARG C 2  630  ? 498.766 -1.102  669.619 1.00 87.05  ? 630  ARG C NH1   1 
ATOM   8473  N  NH2   . ARG C 2  630  ? 496.929 0.311   669.778 1.00 91.18  ? 630  ARG C NH2   1 
ATOM   8474  N  N     . SER C 2  631  ? 498.894 -4.517  673.391 1.00 91.04  ? 631  SER C N     1 
ATOM   8475  C  CA    . SER C 2  631  ? 498.222 -5.458  672.507 1.00 89.68  ? 631  SER C CA    1 
ATOM   8476  C  C     . SER C 2  631  ? 497.564 -4.717  671.353 1.00 90.61  ? 631  SER C C     1 
ATOM   8477  O  O     . SER C 2  631  ? 497.459 -3.487  671.360 1.00 91.96  ? 631  SER C O     1 
ATOM   8478  C  CB    . SER C 2  631  ? 497.183 -6.257  673.274 1.00 90.49  ? 631  SER C CB    1 
ATOM   8479  O  OG    . SER C 2  631  ? 496.022 -5.459  673.450 1.00 92.17  ? 631  SER C OG    1 
ATOM   8480  N  N     . ASN C 2  632  ? 496.992 -5.494  670.420 1.00 89.03  ? 632  ASN C N     1 
ATOM   8481  C  CA    . ASN C 2  632  ? 496.340 -4.929  669.237 1.00 94.89  ? 632  ASN C CA    1 
ATOM   8482  C  C     . ASN C 2  632  ? 495.257 -3.918  669.584 1.00 98.26  ? 632  ASN C C     1 
ATOM   8483  O  O     . ASN C 2  632  ? 495.089 -2.900  668.899 1.00 101.19 ? 632  ASN C O     1 
ATOM   8484  C  CB    . ASN C 2  632  ? 495.722 -6.045  668.402 1.00 100.76 ? 632  ASN C CB    1 
ATOM   8485  C  CG    . ASN C 2  632  ? 496.724 -6.727  667.511 1.00 107.64 ? 632  ASN C CG    1 
ATOM   8486  O  OD1   . ASN C 2  632  ? 497.799 -6.187  667.265 1.00 115.02 ? 632  ASN C OD1   1 
ATOM   8487  N  ND2   . ASN C 2  632  ? 496.357 -7.895  666.973 1.00 104.30 ? 632  ASN C ND2   1 
ATOM   8488  N  N     . GLN C 2  633  ? 494.525 -4.172  670.650 1.00 99.23  ? 633  GLN C N     1 
ATOM   8489  C  CA    . GLN C 2  633  ? 493.425 -3.325  671.053 1.00 95.47  ? 633  GLN C CA    1 
ATOM   8490  C  C     . GLN C 2  633  ? 493.846 -2.309  672.103 1.00 97.86  ? 633  GLN C C     1 
ATOM   8491  O  O     . GLN C 2  633  ? 492.997 -1.588  672.640 1.00 104.18 ? 633  GLN C O     1 
ATOM   8492  C  CB    . GLN C 2  633  ? 492.281 -4.220  671.557 1.00 91.81  ? 633  GLN C CB    1 
ATOM   8493  C  CG    . GLN C 2  633  ? 491.710 -5.203  670.475 1.00 93.88  ? 633  GLN C CG    1 
ATOM   8494  C  CD    . GLN C 2  633  ? 492.601 -6.422  670.121 1.00 93.91  ? 633  GLN C CD    1 
ATOM   8495  O  OE1   . GLN C 2  633  ? 493.647 -6.644  670.720 1.00 99.81  ? 633  GLN C OE1   1 
ATOM   8496  N  NE2   . GLN C 2  633  ? 492.167 -7.205  669.148 1.00 89.35  ? 633  GLN C NE2   1 
ATOM   8497  N  N     . GLY C 2  634  ? 495.128 -2.255  672.430 1.00 90.98  ? 634  GLY C N     1 
ATOM   8498  C  CA    . GLY C 2  634  ? 495.610 -1.212  673.293 1.00 90.85  ? 634  GLY C CA    1 
ATOM   8499  C  C     . GLY C 2  634  ? 495.439 -1.537  674.757 1.00 89.22  ? 634  GLY C C     1 
ATOM   8500  O  O     . GLY C 2  634  ? 495.759 -0.696  675.611 1.00 92.90  ? 634  GLY C O     1 
ATOM   8501  N  N     . THR C 2  635  ? 494.984 -2.749  675.077 1.00 87.51  ? 635  THR C N     1 
ATOM   8502  C  CA    . THR C 2  635  ? 494.987 -3.176  676.463 1.00 86.77  ? 635  THR C CA    1 
ATOM   8503  C  C     . THR C 2  635  ? 496.408 -3.581  676.794 1.00 89.03  ? 635  THR C C     1 
ATOM   8504  O  O     . THR C 2  635  ? 497.122 -4.137  675.958 1.00 88.21  ? 635  THR C O     1 
ATOM   8505  C  CB    . THR C 2  635  ? 494.026 -4.348  676.718 1.00 80.70  ? 635  THR C CB    1 
ATOM   8506  O  OG1   . THR C 2  635  ? 494.441 -5.509  675.975 1.00 86.93  ? 635  THR C OG1   1 
ATOM   8507  C  CG2   . THR C 2  635  ? 492.589 -3.974  676.399 1.00 65.19  ? 635  THR C CG2   1 
ATOM   8508  N  N     . ALA C 2  636  ? 496.775 -3.416  678.049 1.00 94.85  ? 636  ALA C N     1 
ATOM   8509  C  CA    . ALA C 2  636  ? 498.144 -3.672  678.455 1.00 93.03  ? 636  ALA C CA    1 
ATOM   8510  C  C     . ALA C 2  636  ? 498.316 -5.143  678.797 1.00 100.96 ? 636  ALA C C     1 
ATOM   8511  O  O     . ALA C 2  636  ? 497.517 -5.705  679.547 1.00 101.01 ? 636  ALA C O     1 
ATOM   8512  C  CB    . ALA C 2  636  ? 498.534 -2.774  679.627 1.00 77.37  ? 636  ALA C CB    1 
ATOM   8513  N  N     . LEU C 2  637  ? 499.230 -5.804  678.099 1.00 101.92 ? 637  LEU C N     1 
ATOM   8514  C  CA    . LEU C 2  637  ? 499.624 -7.162  678.451 1.00 104.50 ? 637  LEU C CA    1 
ATOM   8515  C  C     . LEU C 2  637  ? 500.827 -7.004  679.350 1.00 110.41 ? 637  LEU C C     1 
ATOM   8516  O  O     . LEU C 2  637  ? 501.873 -6.529  678.903 1.00 115.15 ? 637  LEU C O     1 
ATOM   8517  C  CB    . LEU C 2  637  ? 499.955 -8.034  677.249 1.00 106.39 ? 637  LEU C CB    1 
ATOM   8518  C  CG    . LEU C 2  637  ? 498.793 -8.029  676.270 1.00 106.04 ? 637  LEU C CG    1 
ATOM   8519  C  CD1   . LEU C 2  637  ? 499.156 -8.935  675.079 1.00 103.91 ? 637  LEU C CD1   1 
ATOM   8520  C  CD2   . LEU C 2  637  ? 497.373 -8.309  676.953 1.00 102.85 ? 637  LEU C CD2   1 
ATOM   8521  N  N     . ASP C 2  638  ? 500.682 -7.398  680.611 1.00 117.24 ? 638  ASP C N     1 
ATOM   8522  C  CA    . ASP C 2  638  ? 501.800 -7.338  681.533 1.00 119.39 ? 638  ASP C CA    1 
ATOM   8523  C  C     . ASP C 2  638  ? 501.710 -8.507  682.503 1.00 114.35 ? 638  ASP C C     1 
ATOM   8524  O  O     . ASP C 2  638  ? 500.649 -8.777  683.082 1.00 108.49 ? 638  ASP C O     1 
ATOM   8525  C  CB    . ASP C 2  638  ? 501.714 -5.968  682.240 1.00 118.51 ? 638  ASP C CB    1 
ATOM   8526  C  CG    . ASP C 2  638  ? 502.557 -5.848  683.473 1.00 123.64 ? 638  ASP C CG    1 
ATOM   8527  O  OD1   . ASP C 2  638  ? 503.210 -6.810  683.907 1.00 127.88 ? 638  ASP C OD1   1 
ATOM   8528  O  OD2   . ASP C 2  638  ? 502.555 -4.731  684.023 1.00 124.92 ? 638  ASP C OD2   1 
ATOM   8529  N  N     . GLN C 2  639  ? 502.874 -9.107  682.753 1.00 115.29 ? 639  GLN C N     1 
ATOM   8530  C  CA    . GLN C 2  639  ? 503.008 -10.281 683.594 1.00 118.37 ? 639  GLN C CA    1 
ATOM   8531  C  C     . GLN C 2  639  ? 503.552 -9.852  684.946 1.00 127.79 ? 639  GLN C C     1 
ATOM   8532  O  O     . GLN C 2  639  ? 504.520 -9.088  685.016 1.00 133.31 ? 639  GLN C O     1 
ATOM   8533  C  CB    . GLN C 2  639  ? 503.916 -11.345 682.970 1.00 118.04 ? 639  GLN C CB    1 
ATOM   8534  C  CG    . GLN C 2  639  ? 503.412 -12.015 681.693 1.00 117.06 ? 639  GLN C CG    1 
ATOM   8535  C  CD    . GLN C 2  639  ? 504.503 -12.879 681.044 1.00 127.08 ? 639  GLN C CD    1 
ATOM   8536  O  OE1   . GLN C 2  639  ? 505.475 -12.363 680.478 1.00 131.70 ? 639  GLN C OE1   1 
ATOM   8537  N  NE2   . GLN C 2  639  ? 504.369 -14.205 681.171 1.00 129.34 ? 639  GLN C NE2   1 
ATOM   8538  N  N     . ARG C 2  640  ? 502.968 -10.388 686.019 1.00 123.49 ? 640  ARG C N     1 
ATOM   8539  C  CA    . ARG C 2  640  ? 503.504 -10.030 687.312 1.00 120.30 ? 640  ARG C CA    1 
ATOM   8540  C  C     . ARG C 2  640  ? 504.026 -11.245 688.074 1.00 118.75 ? 640  ARG C C     1 
ATOM   8541  O  O     . ARG C 2  640  ? 503.424 -12.320 688.001 1.00 113.49 ? 640  ARG C O     1 
ATOM   8542  C  CB    . ARG C 2  640  ? 502.467 -9.263  688.138 1.00 119.61 ? 640  ARG C CB    1 
ATOM   8543  C  CG    . ARG C 2  640  ? 502.397 -7.809  687.691 1.00 118.25 ? 640  ARG C CG    1 
ATOM   8544  C  CD    . ARG C 2  640  ? 501.239 -7.507  686.807 1.00 116.41 ? 640  ARG C CD    1 
ATOM   8545  N  NE    . ARG C 2  640  ? 500.028 -7.528  687.600 1.00 121.26 ? 640  ARG C NE    1 
ATOM   8546  C  CZ    . ARG C 2  640  ? 499.055 -8.403  687.432 1.00 125.69 ? 640  ARG C CZ    1 
ATOM   8547  N  NH1   . ARG C 2  640  ? 499.159 -9.325  686.484 1.00 121.53 ? 640  ARG C NH1   1 
ATOM   8548  N  NH2   . ARG C 2  640  ? 497.984 -8.347  688.218 1.00 131.22 ? 640  ARG C NH2   1 
ATOM   8549  N  N     . PRO C 2  641  ? 505.196 -11.130 688.719 1.00 121.00 ? 641  PRO C N     1 
ATOM   8550  C  CA    . PRO C 2  641  ? 505.752 -12.265 689.481 1.00 123.45 ? 641  PRO C CA    1 
ATOM   8551  C  C     . PRO C 2  641  ? 504.845 -12.588 690.659 1.00 123.42 ? 641  PRO C C     1 
ATOM   8552  O  O     . PRO C 2  641  ? 504.384 -11.677 691.357 1.00 115.70 ? 641  PRO C O     1 
ATOM   8553  C  CB    . PRO C 2  641  ? 507.104 -11.739 689.975 1.00 123.04 ? 641  PRO C CB    1 
ATOM   8554  C  CG    . PRO C 2  641  ? 506.922 -10.231 689.970 1.00 122.49 ? 641  PRO C CG    1 
ATOM   8555  C  CD    . PRO C 2  641  ? 506.040 -9.927  688.816 1.00 119.56 ? 641  PRO C CD    1 
ATOM   8556  N  N     . ARG C 2  642  ? 504.457 -13.862 690.780 1.00 128.56 ? 642  ARG C N     1 
ATOM   8557  C  CA    . ARG C 2  642  ? 503.641 -14.300 691.911 1.00 127.45 ? 642  ARG C CA    1 
ATOM   8558  C  C     . ARG C 2  642  ? 504.393 -15.085 693.006 1.00 131.24 ? 642  ARG C C     1 
ATOM   8559  O  O     . ARG C 2  642  ? 503.771 -15.464 694.008 1.00 133.47 ? 642  ARG C O     1 
ATOM   8560  C  CB    . ARG C 2  642  ? 502.447 -15.112 691.386 1.00 120.93 ? 642  ARG C CB    1 
ATOM   8561  C  CG    . ARG C 2  642  ? 501.357 -14.250 690.682 1.00 110.31 ? 642  ARG C CG    1 
ATOM   8562  C  CD    . ARG C 2  642  ? 500.823 -13.194 691.630 1.00 105.34 ? 642  ARG C CD    1 
ATOM   8563  N  NE    . ARG C 2  642  ? 500.000 -12.151 691.019 1.00 99.51  ? 642  ARG C NE    1 
ATOM   8564  C  CZ    . ARG C 2  642  ? 500.393 -10.888 690.866 1.00 98.63  ? 642  ARG C CZ    1 
ATOM   8565  N  NH1   . ARG C 2  642  ? 501.604 -10.524 691.271 1.00 99.61  ? 642  ARG C NH1   1 
ATOM   8566  N  NH2   . ARG C 2  642  ? 499.581 -9.987  690.318 1.00 93.49  ? 642  ARG C NH2   1 
ATOM   8567  N  N     . VAL C 2  643  ? 505.709 -15.273 692.894 1.00 133.47 ? 643  VAL C N     1 
ATOM   8568  C  CA    . VAL C 2  643  ? 506.471 -16.076 693.851 1.00 136.58 ? 643  VAL C CA    1 
ATOM   8569  C  C     . VAL C 2  643  ? 507.564 -15.215 694.469 1.00 137.22 ? 643  VAL C C     1 
ATOM   8570  O  O     . VAL C 2  643  ? 507.943 -14.172 693.941 1.00 133.74 ? 643  VAL C O     1 
ATOM   8571  C  CB    . VAL C 2  643  ? 507.071 -17.360 693.248 1.00 136.85 ? 643  VAL C CB    1 
ATOM   8572  C  CG1   . VAL C 2  643  ? 505.966 -18.279 692.740 1.00 134.24 ? 643  VAL C CG1   1 
ATOM   8573  C  CG2   . VAL C 2  643  ? 508.094 -17.036 692.193 1.00 137.01 ? 643  VAL C CG2   1 
ATOM   8574  N  N     . VAL C 2  644  ? 508.147 -15.728 695.540 1.00 139.26 ? 644  VAL C N     1 
ATOM   8575  C  CA    . VAL C 2  644  ? 509.168 -15.001 696.267 1.00 140.65 ? 644  VAL C CA    1 
ATOM   8576  C  C     . VAL C 2  644  ? 510.472 -15.789 696.215 1.00 140.62 ? 644  VAL C C     1 
ATOM   8577  O  O     . VAL C 2  644  ? 510.482 -17.011 696.056 1.00 139.55 ? 644  VAL C O     1 
ATOM   8578  C  CB    . VAL C 2  644  ? 508.694 -14.754 697.711 1.00 146.53 ? 644  VAL C CB    1 
ATOM   8579  C  CG1   . VAL C 2  644  ? 508.680 -16.057 698.474 1.00 151.50 ? 644  VAL C CG1   1 
ATOM   8580  C  CG2   . VAL C 2  644  ? 509.551 -13.705 698.414 1.00 152.95 ? 644  VAL C CG2   1 
ATOM   8581  N  N     . VAL C 2  645  ? 511.577 -15.071 696.449 1.00 141.51 ? 645  VAL C N     1 
ATOM   8582  C  CA    . VAL C 2  645  ? 512.914 -15.657 696.371 1.00 146.78 ? 645  VAL C CA    1 
ATOM   8583  C  C     . VAL C 2  645  ? 513.040 -16.842 697.307 1.00 146.33 ? 645  VAL C C     1 
ATOM   8584  O  O     . VAL C 2  645  ? 512.634 -16.785 698.472 1.00 158.19 ? 645  VAL C O     1 
ATOM   8585  C  CB    . VAL C 2  645  ? 513.980 -14.598 696.708 1.00 149.06 ? 645  VAL C CB    1 
ATOM   8586  C  CG1   . VAL C 2  645  ? 515.369 -15.107 696.413 1.00 149.62 ? 645  VAL C CG1   1 
ATOM   8587  C  CG2   . VAL C 2  645  ? 513.713 -13.296 695.967 1.00 147.05 ? 645  VAL C CG2   1 
ATOM   8588  N  N     . GLY C 2  646  ? 513.511 -17.960 696.760 1.00 148.16 ? 646  GLY C N     1 
ATOM   8589  C  CA    . GLY C 2  646  ? 513.746 -19.154 697.532 1.00 152.08 ? 646  GLY C CA    1 
ATOM   8590  C  C     . GLY C 2  646  ? 512.560 -20.079 697.625 1.00 151.04 ? 646  GLY C C     1 
ATOM   8591  O  O     . GLY C 2  646  ? 512.662 -21.129 698.270 1.00 153.38 ? 646  GLY C O     1 
ATOM   8592  N  N     . GLN C 2  647  ? 511.471 -19.772 696.936 1.00 145.47 ? 647  GLN C N     1 
ATOM   8593  C  CA    . GLN C 2  647  ? 510.290 -20.611 697.026 1.00 148.87 ? 647  GLN C CA    1 
ATOM   8594  C  C     . GLN C 2  647  ? 510.523 -21.898 696.245 1.00 150.45 ? 647  GLN C C     1 
ATOM   8595  O  O     . GLN C 2  647  ? 511.081 -21.892 695.145 1.00 143.77 ? 647  GLN C O     1 
ATOM   8596  C  CB    . GLN C 2  647  ? 509.071 -19.831 696.541 1.00 141.02 ? 647  GLN C CB    1 
ATOM   8597  C  CG    . GLN C 2  647  ? 507.803 -20.601 696.306 1.00 134.73 ? 647  GLN C CG    1 
ATOM   8598  C  CD    . GLN C 2  647  ? 506.644 -19.645 696.127 1.00 131.77 ? 647  GLN C CD    1 
ATOM   8599  O  OE1   . GLN C 2  647  ? 506.767 -18.453 696.430 1.00 129.07 ? 647  GLN C OE1   1 
ATOM   8600  N  NE2   . GLN C 2  647  ? 505.525 -20.145 695.612 1.00 130.42 ? 647  GLN C NE2   1 
ATOM   8601  N  N     . ARG C 2  648  ? 510.118 -23.009 696.852 1.00 156.74 ? 648  ARG C N     1 
ATOM   8602  C  CA    . ARG C 2  648  ? 510.218 -24.327 696.243 1.00 156.23 ? 648  ARG C CA    1 
ATOM   8603  C  C     . ARG C 2  648  ? 509.027 -24.551 695.331 1.00 155.29 ? 648  ARG C C     1 
ATOM   8604  O  O     . ARG C 2  648  ? 507.871 -24.442 695.756 1.00 152.49 ? 648  ARG C O     1 
ATOM   8605  C  CB    . ARG C 2  648  ? 510.265 -25.399 697.325 1.00 163.30 ? 648  ARG C CB    1 
ATOM   8606  C  CG    . ARG C 2  648  ? 511.520 -25.363 698.152 1.00 172.98 ? 648  ARG C CG    1 
ATOM   8607  C  CD    . ARG C 2  648  ? 512.691 -25.884 697.371 1.00 180.53 ? 648  ARG C CD    1 
ATOM   8608  N  NE    . ARG C 2  648  ? 513.015 -27.255 697.745 1.00 190.07 ? 648  ARG C NE    1 
ATOM   8609  C  CZ    . ARG C 2  648  ? 513.938 -27.997 697.140 1.00 196.74 ? 648  ARG C CZ    1 
ATOM   8610  N  NH1   . ARG C 2  648  ? 514.632 -27.504 696.117 1.00 195.56 ? 648  ARG C NH1   1 
ATOM   8611  N  NH2   . ARG C 2  648  ? 514.164 -29.236 697.560 1.00 202.31 ? 648  ARG C NH2   1 
ATOM   8612  N  N     . VAL C 2  649  ? 509.315 -24.784 694.061 1.00 158.71 ? 649  VAL C N     1 
ATOM   8613  C  CA    . VAL C 2  649  ? 508.284 -25.023 693.071 1.00 159.61 ? 649  VAL C CA    1 
ATOM   8614  C  C     . VAL C 2  649  ? 508.398 -26.427 692.480 1.00 164.59 ? 649  VAL C C     1 
ATOM   8615  O  O     . VAL C 2  649  ? 509.496 -26.981 692.364 1.00 171.22 ? 649  VAL C O     1 
ATOM   8616  C  CB    . VAL C 2  649  ? 508.472 -23.938 691.996 1.00 134.33 ? 649  VAL C CB    1 
ATOM   8617  C  CG1   . VAL C 2  649  ? 507.567 -24.152 690.883 1.00 130.44 ? 649  VAL C CG1   1 
ATOM   8618  C  CG2   . VAL C 2  649  ? 508.284 -22.554 692.594 1.00 132.50 ? 649  VAL C CG2   1 
ATOM   8619  N  N     . ARG C 2  650  ? 507.251 -27.010 692.109 1.00 167.21 ? 650  ARG C N     1 
ATOM   8620  C  CA    . ARG C 2  650  ? 507.182 -28.292 691.416 1.00 173.42 ? 650  ARG C CA    1 
ATOM   8621  C  C     . ARG C 2  650  ? 506.925 -28.065 689.925 1.00 172.16 ? 650  ARG C C     1 
ATOM   8622  O  O     . ARG C 2  650  ? 506.799 -26.929 689.470 1.00 172.84 ? 650  ARG C O     1 
ATOM   8623  C  CB    . ARG C 2  650  ? 506.164 -29.199 692.110 1.00 177.04 ? 650  ARG C CB    1 
ATOM   8624  C  CG    . ARG C 2  650  ? 506.693 -29.545 693.492 1.00 189.50 ? 650  ARG C CG    1 
ATOM   8625  C  CD    . ARG C 2  650  ? 506.079 -30.765 694.146 1.00 196.89 ? 650  ARG C CD    1 
ATOM   8626  N  NE    . ARG C 2  650  ? 506.211 -30.683 695.602 1.00 205.09 ? 650  ARG C NE    1 
ATOM   8627  C  CZ    . ARG C 2  650  ? 505.308 -30.177 696.434 1.00 205.90 ? 650  ARG C CZ    1 
ATOM   8628  N  NH1   . ARG C 2  650  ? 504.169 -29.686 695.962 1.00 202.56 ? 650  ARG C NH1   1 
ATOM   8629  N  NH2   . ARG C 2  650  ? 505.556 -30.162 697.742 1.00 207.73 ? 650  ARG C NH2   1 
ATOM   8630  N  N     . LYS C 2  651  ? 506.837 -29.150 689.145 1.00 166.98 ? 651  LYS C N     1 
ATOM   8631  C  CA    . LYS C 2  651  ? 506.562 -29.002 687.710 1.00 156.17 ? 651  LYS C CA    1 
ATOM   8632  C  C     . LYS C 2  651  ? 505.123 -28.555 687.488 1.00 145.41 ? 651  LYS C C     1 
ATOM   8633  O  O     . LYS C 2  651  ? 504.184 -29.206 687.957 1.00 141.90 ? 651  LYS C O     1 
ATOM   8634  C  CB    . LYS C 2  651  ? 506.860 -30.276 686.913 1.00 154.88 ? 651  LYS C CB    1 
ATOM   8635  C  CG    . LYS C 2  651  ? 506.450 -30.131 685.424 1.00 147.23 ? 651  LYS C CG    1 
ATOM   8636  C  CD    . LYS C 2  651  ? 506.539 -31.399 684.551 1.00 146.62 ? 651  LYS C CD    1 
ATOM   8637  C  CE    . LYS C 2  651  ? 506.229 -32.700 685.263 1.00 149.45 ? 651  LYS C CE    1 
ATOM   8638  N  NZ    . LYS C 2  651  ? 506.766 -33.865 684.481 1.00 150.41 ? 651  LYS C NZ    1 
ATOM   8639  N  N     . GLY C 2  652  ? 504.956 -27.448 686.767 1.00 138.97 ? 652  GLY C N     1 
ATOM   8640  C  CA    . GLY C 2  652  ? 503.647 -26.900 686.472 1.00 136.77 ? 652  GLY C CA    1 
ATOM   8641  C  C     . GLY C 2  652  ? 503.081 -25.939 687.498 1.00 133.62 ? 652  GLY C C     1 
ATOM   8642  O  O     . GLY C 2  652  ? 501.891 -25.613 687.419 1.00 131.28 ? 652  GLY C O     1 
ATOM   8643  N  N     . ASP C 2  653  ? 503.878 -25.495 688.471 1.00 140.47 ? 653  ASP C N     1 
ATOM   8644  C  CA    . ASP C 2  653  ? 503.419 -24.524 689.462 1.00 139.14 ? 653  ASP C CA    1 
ATOM   8645  C  C     . ASP C 2  653  ? 503.495 -23.122 688.860 1.00 131.88 ? 653  ASP C C     1 
ATOM   8646  O  O     . ASP C 2  653  ? 504.357 -22.819 688.027 1.00 131.44 ? 653  ASP C O     1 
ATOM   8647  C  CB    . ASP C 2  653  ? 504.237 -24.575 690.767 1.00 147.38 ? 653  ASP C CB    1 
ATOM   8648  C  CG    . ASP C 2  653  ? 503.763 -25.659 691.754 1.00 151.44 ? 653  ASP C CG    1 
ATOM   8649  O  OD1   . ASP C 2  653  ? 504.111 -25.569 692.959 1.00 153.45 ? 653  ASP C OD1   1 
ATOM   8650  O  OD2   . ASP C 2  653  ? 503.049 -26.596 691.337 1.00 151.69 ? 653  ASP C OD2   1 
ATOM   8651  N  N     . LEU C 2  654  ? 502.580 -22.267 689.296 1.00 127.84 ? 654  LEU C N     1 
ATOM   8652  C  CA    . LEU C 2  654  ? 502.504 -20.902 688.797 1.00 122.81 ? 654  LEU C CA    1 
ATOM   8653  C  C     . LEU C 2  654  ? 503.712 -20.072 689.228 1.00 129.02 ? 654  LEU C C     1 
ATOM   8654  O  O     . LEU C 2  654  ? 504.176 -20.171 690.372 1.00 133.81 ? 654  LEU C O     1 
ATOM   8655  C  CB    . LEU C 2  654  ? 501.210 -20.254 689.271 1.00 115.97 ? 654  LEU C CB    1 
ATOM   8656  C  CG    . LEU C 2  654  ? 501.047 -18.855 688.696 1.00 117.10 ? 654  LEU C CG    1 
ATOM   8657  C  CD1   . LEU C 2  654  ? 500.625 -18.954 687.258 1.00 118.36 ? 654  LEU C CD1   1 
ATOM   8658  C  CD2   . LEU C 2  654  ? 500.003 -18.061 689.476 1.00 111.84 ? 654  LEU C CD2   1 
ATOM   8659  N  N     . LEU C 2  655  ? 504.286 -19.339 688.261 1.00 121.65 ? 655  LEU C N     1 
ATOM   8660  C  CA    . LEU C 2  655  ? 505.406 -18.425 688.480 1.00 120.52 ? 655  LEU C CA    1 
ATOM   8661  C  C     . LEU C 2  655  ? 505.023 -16.948 688.424 1.00 113.60 ? 655  LEU C C     1 
ATOM   8662  O  O     . LEU C 2  655  ? 505.390 -16.177 689.319 1.00 116.17 ? 655  LEU C O     1 
ATOM   8663  C  CB    . LEU C 2  655  ? 506.508 -18.730 687.468 1.00 117.11 ? 655  LEU C CB    1 
ATOM   8664  C  CG    . LEU C 2  655  ? 507.182 -20.063 687.763 1.00 121.18 ? 655  LEU C CG    1 
ATOM   8665  C  CD1   . LEU C 2  655  ? 508.259 -20.397 686.752 1.00 120.05 ? 655  LEU C CD1   1 
ATOM   8666  C  CD2   . LEU C 2  655  ? 507.783 -19.945 689.121 1.00 127.39 ? 655  LEU C CD2   1 
ATOM   8667  N  N     . ALA C 2  656  ? 504.449 -16.489 687.325 1.00 106.29 ? 656  ALA C N     1 
ATOM   8668  C  CA    . ALA C 2  656  ? 503.974 -15.120 687.205 1.00 103.51 ? 656  ALA C CA    1 
ATOM   8669  C  C     . ALA C 2  656  ? 502.517 -15.044 686.756 1.00 116.90 ? 656  ALA C C     1 
ATOM   8670  O  O     . ALA C 2  656  ? 502.038 -15.903 686.014 1.00 119.54 ? 656  ALA C O     1 
ATOM   8671  C  CB    . ALA C 2  656  ? 504.842 -14.329 686.240 1.00 113.02 ? 656  ALA C CB    1 
ATOM   8672  N  N     . ASP C 2  657  ? 501.791 -14.043 687.252 1.00 114.83 ? 657  ASP C N     1 
ATOM   8673  C  CA    . ASP C 2  657  ? 500.451 -13.774 686.727 1.00 111.12 ? 657  ASP C CA    1 
ATOM   8674  C  C     . ASP C 2  657  ? 500.527 -12.936 685.458 1.00 109.64 ? 657  ASP C C     1 
ATOM   8675  O  O     . ASP C 2  657  ? 501.231 -11.924 685.419 1.00 107.62 ? 657  ASP C O     1 
ATOM   8676  C  CB    . ASP C 2  657  ? 499.564 -13.003 687.720 1.00 113.57 ? 657  ASP C CB    1 
ATOM   8677  C  CG    . ASP C 2  657  ? 498.587 -13.887 688.479 1.00 116.44 ? 657  ASP C CG    1 
ATOM   8678  O  OD1   . ASP C 2  657  ? 498.246 -14.982 687.980 1.00 115.09 ? 657  ASP C OD1   1 
ATOM   8679  O  OD2   . ASP C 2  657  ? 498.068 -13.420 689.523 1.00 120.16 ? 657  ASP C OD2   1 
ATOM   8680  N  N     . GLY C 2  658  ? 499.747 -13.329 684.441 1.00 109.26 ? 658  GLY C N     1 
ATOM   8681  C  CA    . GLY C 2  658  ? 499.596 -12.554 683.226 1.00 112.64 ? 658  GLY C CA    1 
ATOM   8682  C  C     . GLY C 2  658  ? 498.609 -11.414 683.398 1.00 111.92 ? 658  GLY C C     1 
ATOM   8683  O  O     . GLY C 2  658  ? 498.232 -11.071 684.526 1.00 117.09 ? 658  GLY C O     1 
ATOM   8684  N  N     . PRO C 2  659  ? 498.182 -10.775 682.304 1.00 112.67 ? 659  PRO C N     1 
ATOM   8685  C  CA    . PRO C 2  659  ? 497.154 -9.746  682.448 1.00 111.38 ? 659  PRO C CA    1 
ATOM   8686  C  C     . PRO C 2  659  ? 495.844 -10.444 682.707 1.00 112.74 ? 659  PRO C C     1 
ATOM   8687  O  O     . PRO C 2  659  ? 495.611 -11.548 682.205 1.00 116.06 ? 659  PRO C O     1 
ATOM   8688  C  CB    . PRO C 2  659  ? 497.103 -9.067  681.074 1.00 107.94 ? 659  PRO C CB    1 
ATOM   8689  C  CG    . PRO C 2  659  ? 498.027 -9.812  680.212 1.00 113.62 ? 659  PRO C CG    1 
ATOM   8690  C  CD    . PRO C 2  659  ? 498.399 -11.099 680.893 1.00 113.67 ? 659  PRO C CD    1 
ATOM   8691  N  N     . ALA C 2  660  ? 494.961 -9.778  683.438 1.00 105.46 ? 660  ALA C N     1 
ATOM   8692  C  CA    . ALA C 2  660  ? 493.655 -10.354 683.666 1.00 104.73 ? 660  ALA C CA    1 
ATOM   8693  C  C     . ALA C 2  660  ? 493.798 -11.785 684.170 1.00 99.14  ? 660  ALA C C     1 
ATOM   8694  O  O     . ALA C 2  660  ? 493.086 -12.698 683.742 1.00 91.13  ? 660  ALA C O     1 
ATOM   8695  C  CB    . ALA C 2  660  ? 492.781 -10.288 682.419 1.00 102.34 ? 660  ALA C CB    1 
ATOM   8696  N  N     . SER C 2  661  ? 494.764 -11.999 685.052 1.00 108.89 ? 661  SER C N     1 
ATOM   8697  C  CA    . SER C 2  661  ? 494.778 -13.276 685.736 1.00 114.06 ? 661  SER C CA    1 
ATOM   8698  C  C     . SER C 2  661  ? 495.226 -13.090 687.178 1.00 116.55 ? 661  SER C C     1 
ATOM   8699  O  O     . SER C 2  661  ? 496.098 -12.272 687.493 1.00 120.48 ? 661  SER C O     1 
ATOM   8700  C  CB    . SER C 2  661  ? 495.709 -14.272 685.038 1.00 117.50 ? 661  SER C CB    1 
ATOM   8701  O  OG    . SER C 2  661  ? 496.332 -15.111 686.002 1.00 123.96 ? 661  SER C OG    1 
ATOM   8702  N  N     . GLU C 2  662  ? 494.623 -13.888 688.042 1.00 109.02 ? 662  GLU C N     1 
ATOM   8703  C  CA    . GLU C 2  662  ? 494.872 -13.841 689.466 1.00 108.11 ? 662  GLU C CA    1 
ATOM   8704  C  C     . GLU C 2  662  ? 495.200 -15.225 689.977 1.00 106.79 ? 662  GLU C C     1 
ATOM   8705  O  O     . GLU C 2  662  ? 494.353 -16.123 689.915 1.00 102.67 ? 662  GLU C O     1 
ATOM   8706  C  CB    . GLU C 2  662  ? 493.683 -13.241 690.191 1.00 109.12 ? 662  GLU C CB    1 
ATOM   8707  C  CG    . GLU C 2  662  ? 493.884 -13.234 691.662 1.00 111.37 ? 662  GLU C CG    1 
ATOM   8708  C  CD    . GLU C 2  662  ? 492.638 -12.874 692.379 1.00 102.57 ? 662  GLU C CD    1 
ATOM   8709  O  OE1   . GLU C 2  662  ? 491.603 -13.551 692.148 1.00 95.21  ? 662  GLU C OE1   1 
ATOM   8710  O  OE2   . GLU C 2  662  ? 492.755 -11.966 693.236 1.00 103.52 ? 662  GLU C OE2   1 
ATOM   8711  N  N     . ASN C 2  663  ? 496.441 -15.405 690.416 1.00 114.14 ? 663  ASN C N     1 
ATOM   8712  C  CA    . ASN C 2  663  ? 496.919 -16.686 690.935 1.00 118.62 ? 663  ASN C CA    1 
ATOM   8713  C  C     . ASN C 2  663  ? 496.581 -17.828 689.983 1.00 118.67 ? 663  ASN C C     1 
ATOM   8714  O  O     . ASN C 2  663  ? 496.229 -18.932 690.414 1.00 115.84 ? 663  ASN C O     1 
ATOM   8715  C  CB    . ASN C 2  663  ? 496.355 -16.947 692.331 1.00 119.84 ? 663  ASN C CB    1 
ATOM   8716  C  CG    . ASN C 2  663  ? 496.750 -15.867 693.321 1.00 121.87 ? 663  ASN C CG    1 
ATOM   8717  O  OD1   . ASN C 2  663  ? 497.356 -14.853 692.947 1.00 119.54 ? 663  ASN C OD1   1 
ATOM   8718  N  ND2   . ASN C 2  663  ? 496.390 -16.065 694.590 1.00 124.04 ? 663  ASN C ND2   1 
ATOM   8719  N  N     . GLY C 2  664  ? 496.617 -17.548 688.680 1.00 119.87 ? 664  GLY C N     1 
ATOM   8720  C  CA    . GLY C 2  664  ? 496.380 -18.570 687.691 1.00 115.44 ? 664  GLY C CA    1 
ATOM   8721  C  C     . GLY C 2  664  ? 494.937 -18.731 687.261 1.00 111.65 ? 664  GLY C C     1 
ATOM   8722  O  O     . GLY C 2  664  ? 494.660 -19.614 686.437 1.00 115.92 ? 664  GLY C O     1 
ATOM   8723  N  N     . PHE C 2  665  ? 494.000 -17.979 687.854 1.00 101.18 ? 665  PHE C N     1 
ATOM   8724  C  CA    . PHE C 2  665  ? 492.590 -18.027 687.476 1.00 95.95  ? 665  PHE C CA    1 
ATOM   8725  C  C     . PHE C 2  665  ? 492.201 -16.839 686.593 1.00 92.91  ? 665  PHE C C     1 
ATOM   8726  O  O     . PHE C 2  665  ? 492.580 -15.699 686.886 1.00 93.83  ? 665  PHE C O     1 
ATOM   8727  C  CB    . PHE C 2  665  ? 491.744 -18.043 688.733 1.00 96.50  ? 665  PHE C CB    1 
ATOM   8728  C  CG    . PHE C 2  665  ? 491.846 -19.329 689.513 1.00 100.70 ? 665  PHE C CG    1 
ATOM   8729  C  CD1   . PHE C 2  665  ? 493.046 -19.699 690.112 1.00 101.54 ? 665  PHE C CD1   1 
ATOM   8730  C  CD2   . PHE C 2  665  ? 490.739 -20.147 689.690 1.00 99.64  ? 665  PHE C CD2   1 
ATOM   8731  C  CE1   . PHE C 2  665  ? 493.137 -20.865 690.842 1.00 101.34 ? 665  PHE C CE1   1 
ATOM   8732  C  CE2   . PHE C 2  665  ? 490.825 -21.318 690.428 1.00 97.85  ? 665  PHE C CE2   1 
ATOM   8733  C  CZ    . PHE C 2  665  ? 492.017 -21.666 691.013 1.00 99.15  ? 665  PHE C CZ    1 
ATOM   8734  N  N     . LEU C 2  666  ? 491.310 -17.079 685.618 1.00 84.17  ? 666  LEU C N     1 
ATOM   8735  C  CA    . LEU C 2  666  ? 490.908 -16.017 684.705 1.00 84.32  ? 666  LEU C CA    1 
ATOM   8736  C  C     . LEU C 2  666  ? 490.222 -14.904 685.478 1.00 88.75  ? 666  LEU C C     1 
ATOM   8737  O  O     . LEU C 2  666  ? 489.236 -15.149 686.180 1.00 95.49  ? 666  LEU C O     1 
ATOM   8738  C  CB    . LEU C 2  666  ? 490.004 -16.583 683.601 1.00 85.31  ? 666  LEU C CB    1 
ATOM   8739  C  CG    . LEU C 2  666  ? 489.504 -15.618 682.491 1.00 77.99  ? 666  LEU C CG    1 
ATOM   8740  C  CD1   . LEU C 2  666  ? 490.674 -14.984 681.812 1.00 79.92  ? 666  LEU C CD1   1 
ATOM   8741  C  CD2   . LEU C 2  666  ? 488.545 -16.242 681.424 1.00 69.52  ? 666  LEU C CD2   1 
ATOM   8742  N  N     . ALA C 2  667  ? 490.773 -13.680 685.383 1.00 88.12  ? 667  ALA C N     1 
ATOM   8743  C  CA    . ALA C 2  667  ? 490.191 -12.494 686.029 1.00 81.60  ? 667  ALA C CA    1 
ATOM   8744  C  C     . ALA C 2  667  ? 489.730 -11.445 685.015 1.00 75.68  ? 667  ALA C C     1 
ATOM   8745  O  O     . ALA C 2  667  ? 490.478 -10.530 684.639 1.00 70.52  ? 667  ALA C O     1 
ATOM   8746  C  CB    . ALA C 2  667  ? 491.212 -11.878 686.977 1.00 80.06  ? 667  ALA C CB    1 
ATOM   8747  N  N     . LEU C 2  668  ? 488.441 -11.462 684.727 1.00 70.95  ? 668  LEU C N     1 
ATOM   8748  C  CA    . LEU C 2  668  ? 487.942 -10.588 683.698 1.00 80.95  ? 668  LEU C CA    1 
ATOM   8749  C  C     . LEU C 2  668  ? 487.327 -9.329  684.283 1.00 85.73  ? 668  LEU C C     1 
ATOM   8750  O  O     . LEU C 2  668  ? 486.931 -8.419  683.533 1.00 84.07  ? 668  LEU C O     1 
ATOM   8751  C  CB    . LEU C 2  668  ? 486.935 -11.363 682.863 1.00 87.88  ? 668  LEU C CB    1 
ATOM   8752  C  CG    . LEU C 2  668  ? 487.618 -12.452 682.042 1.00 91.56  ? 668  LEU C CG    1 
ATOM   8753  C  CD1   . LEU C 2  668  ? 486.592 -13.106 681.177 1.00 93.33  ? 668  LEU C CD1   1 
ATOM   8754  C  CD2   . LEU C 2  668  ? 488.717 -11.873 681.180 1.00 87.58  ? 668  LEU C CD2   1 
ATOM   8755  N  N     . GLY C 2  669  ? 487.297 -9.240  685.605 1.00 90.86  ? 669  GLY C N     1 
ATOM   8756  C  CA    . GLY C 2  669  ? 486.532 -8.209  686.265 1.00 91.54  ? 669  GLY C CA    1 
ATOM   8757  C  C     . GLY C 2  669  ? 486.804 -8.167  687.749 1.00 92.59  ? 669  GLY C C     1 
ATOM   8758  O  O     . GLY C 2  669  ? 487.826 -8.662  688.225 1.00 95.58  ? 669  GLY C O     1 
ATOM   8759  N  N     . GLN C 2  670  ? 485.860 -7.597  688.494 1.00 95.18  ? 670  GLN C N     1 
ATOM   8760  C  CA    . GLN C 2  670  ? 485.989 -7.553  689.940 1.00 101.33 ? 670  GLN C CA    1 
ATOM   8761  C  C     . GLN C 2  670  ? 484.730 -8.135  690.571 1.00 98.76  ? 670  GLN C C     1 
ATOM   8762  O  O     . GLN C 2  670  ? 483.676 -8.223  689.931 1.00 97.73  ? 670  GLN C O     1 
ATOM   8763  C  CB    . GLN C 2  670  ? 486.281 -6.119  690.399 1.00 103.59 ? 670  GLN C CB    1 
ATOM   8764  C  CG    . GLN C 2  670  ? 487.782 -5.900  690.665 1.00 109.13 ? 670  GLN C CG    1 
ATOM   8765  C  CD    . GLN C 2  670  ? 488.295 -4.630  690.022 1.00 110.48 ? 670  GLN C CD    1 
ATOM   8766  O  OE1   . GLN C 2  670  ? 487.545 -3.927  689.346 1.00 112.24 ? 670  GLN C OE1   1 
ATOM   8767  N  NE2   . GLN C 2  670  ? 489.584 -4.361  690.170 1.00 108.44 ? 670  GLN C NE2   1 
ATOM   8768  N  N     . ASN C 2  671  ? 484.864 -8.564  691.833 1.00 95.94  ? 671  ASN C N     1 
ATOM   8769  C  CA    . ASN C 2  671  ? 483.736 -9.027  692.643 1.00 87.69  ? 671  ASN C CA    1 
ATOM   8770  C  C     . ASN C 2  671  ? 483.237 -7.870  693.477 1.00 84.91  ? 671  ASN C C     1 
ATOM   8771  O  O     . ASN C 2  671  ? 483.921 -7.413  694.401 1.00 88.17  ? 671  ASN C O     1 
ATOM   8772  C  CB    . ASN C 2  671  ? 484.180 -10.161 693.558 1.00 84.92  ? 671  ASN C CB    1 
ATOM   8773  C  CG    . ASN C 2  671  ? 484.667 -11.345 692.795 1.00 82.75  ? 671  ASN C CG    1 
ATOM   8774  O  OD1   . ASN C 2  671  ? 483.872 -12.004 692.135 1.00 82.99  ? 671  ASN C OD1   1 
ATOM   8775  N  ND2   . ASN C 2  671  ? 485.975 -11.601 692.821 1.00 82.11  ? 671  ASN C ND2   1 
ATOM   8776  N  N     . VAL C 2  672  ? 482.019 -7.443  693.203 1.00 75.72  ? 672  VAL C N     1 
ATOM   8777  C  CA    . VAL C 2  672  ? 481.489 -6.301  693.915 1.00 77.40  ? 672  VAL C CA    1 
ATOM   8778  C  C     . VAL C 2  672  ? 480.212 -6.653  694.676 1.00 86.51  ? 672  VAL C C     1 
ATOM   8779  O  O     . VAL C 2  672  ? 479.474 -7.587  694.341 1.00 91.55  ? 672  VAL C O     1 
ATOM   8780  C  CB    . VAL C 2  672  ? 481.272 -5.137  692.947 1.00 69.21  ? 672  VAL C CB    1 
ATOM   8781  C  CG1   . VAL C 2  672  ? 482.612 -4.598  692.523 1.00 68.38  ? 672  VAL C CG1   1 
ATOM   8782  C  CG2   . VAL C 2  672  ? 480.542 -5.649  691.740 1.00 62.96  ? 672  VAL C CG2   1 
ATOM   8783  N  N     . LEU C 2  673  ? 479.946 -5.851  695.700 1.00 85.18  ? 673  LEU C N     1 
ATOM   8784  C  CA    . LEU C 2  673  ? 478.741 -5.994  696.494 1.00 81.34  ? 673  LEU C CA    1 
ATOM   8785  C  C     . LEU C 2  673  ? 477.626 -5.238  695.802 1.00 82.02  ? 673  LEU C C     1 
ATOM   8786  O  O     . LEU C 2  673  ? 477.701 -4.014  695.648 1.00 87.63  ? 673  LEU C O     1 
ATOM   8787  C  CB    . LEU C 2  673  ? 478.948 -5.415  697.880 1.00 84.43  ? 673  LEU C CB    1 
ATOM   8788  C  CG    . LEU C 2  673  ? 478.012 -5.942  698.948 1.00 88.03  ? 673  LEU C CG    1 
ATOM   8789  C  CD1   . LEU C 2  673  ? 478.165 -7.447  699.069 1.00 92.30  ? 673  LEU C CD1   1 
ATOM   8790  C  CD2   . LEU C 2  673  ? 478.352 -5.259  700.253 1.00 89.32  ? 673  LEU C CD2   1 
ATOM   8791  N  N     . VAL C 2  674  ? 476.599 -5.950  695.375 1.00 76.37  ? 674  VAL C N     1 
ATOM   8792  C  CA    . VAL C 2  674  ? 475.547 -5.347  694.580 1.00 70.77  ? 674  VAL C CA    1 
ATOM   8793  C  C     . VAL C 2  674  ? 474.246 -5.403  695.360 1.00 78.74  ? 674  VAL C C     1 
ATOM   8794  O  O     . VAL C 2  674  ? 473.955 -6.393  696.039 1.00 86.50  ? 674  VAL C O     1 
ATOM   8795  C  CB    . VAL C 2  674  ? 475.369 -6.029  693.224 1.00 71.85  ? 674  VAL C CB    1 
ATOM   8796  C  CG1   . VAL C 2  674  ? 474.778 -7.402  693.397 1.00 72.44  ? 674  VAL C CG1   1 
ATOM   8797  C  CG2   . VAL C 2  674  ? 474.399 -5.221  692.451 1.00 77.40  ? 674  VAL C CG2   1 
ATOM   8798  N  N     . ALA C 2  675  ? 473.439 -4.359  695.217 1.00 77.71  ? 675  ALA C N     1 
ATOM   8799  C  CA    . ALA C 2  675  ? 472.086 -4.327  695.740 1.00 74.44  ? 675  ALA C CA    1 
ATOM   8800  C  C     . ALA C 2  675  ? 471.208 -4.256  694.509 1.00 78.49  ? 675  ALA C C     1 
ATOM   8801  O  O     . ALA C 2  675  ? 471.413 -3.402  693.641 1.00 82.42  ? 675  ALA C O     1 
ATOM   8802  C  CB    . ALA C 2  675  ? 471.861 -3.126  696.647 1.00 61.17  ? 675  ALA C CB    1 
ATOM   8803  N  N     . ILE C 2  676  ? 470.190 -5.096  694.474 1.00 79.39  ? 676  ILE C N     1 
ATOM   8804  C  CA    . ILE C 2  676  ? 469.270 -5.146  693.354 1.00 76.58  ? 676  ILE C CA    1 
ATOM   8805  C  C     . ILE C 2  676  ? 468.033 -4.369  693.745 1.00 72.76  ? 676  ILE C C     1 
ATOM   8806  O  O     . ILE C 2  676  ? 467.158 -4.897  694.430 1.00 79.58  ? 676  ILE C O     1 
ATOM   8807  C  CB    . ILE C 2  676  ? 468.913 -6.598  693.047 1.00 80.00  ? 676  ILE C CB    1 
ATOM   8808  C  CG1   . ILE C 2  676  ? 470.199 -7.377  692.843 1.00 78.45  ? 676  ILE C CG1   1 
ATOM   8809  C  CG2   . ILE C 2  676  ? 468.101 -6.666  691.750 1.00 88.03  ? 676  ILE C CG2   1 
ATOM   8810  C  CD1   . ILE C 2  676  ? 469.957 -8.742  692.350 1.00 78.84  ? 676  ILE C CD1   1 
ATOM   8811  N  N     . MET C 2  677  ? 467.872 -3.208  693.174 1.00 59.49  ? 677  MET C N     1 
ATOM   8812  C  CA    . MET C 2  677  ? 466.813 -2.313  693.597 1.00 60.47  ? 677  MET C CA    1 
ATOM   8813  C  C     . MET C 2  677  ? 466.837 -1.106  692.695 1.00 63.30  ? 677  MET C C     1 
ATOM   8814  O  O     . MET C 2  677  ? 467.919 -0.619  692.359 1.00 76.13  ? 677  MET C O     1 
ATOM   8815  C  CB    . MET C 2  677  ? 466.986 -1.827  695.055 1.00 58.97  ? 677  MET C CB    1 
ATOM   8816  C  CG    . MET C 2  677  ? 468.228 -0.990  695.295 1.00 62.19  ? 677  MET C CG    1 
ATOM   8817  S  SD    . MET C 2  677  ? 468.552 -0.077  696.885 1.00 73.32  ? 677  MET C SD    1 
ATOM   8818  C  CE    . MET C 2  677  ? 467.208 1.144   696.985 1.00 64.93  ? 677  MET C CE    1 
ATOM   8819  N  N     . PRO C 2  678  ? 465.700 -0.490  692.439 1.00 55.49  ? 678  PRO C N     1 
ATOM   8820  C  CA    . PRO C 2  678  ? 465.707 0.743   691.659 1.00 58.05  ? 678  PRO C CA    1 
ATOM   8821  C  C     . PRO C 2  678  ? 466.435 1.786   692.472 1.00 59.91  ? 678  PRO C C     1 
ATOM   8822  O  O     . PRO C 2  678  ? 466.636 1.606   693.673 1.00 55.85  ? 678  PRO C O     1 
ATOM   8823  C  CB    . PRO C 2  678  ? 464.222 1.106   691.541 1.00 53.32  ? 678  PRO C CB    1 
ATOM   8824  C  CG    . PRO C 2  678  ? 463.502 -0.137  691.846 1.00 53.30  ? 678  PRO C CG    1 
ATOM   8825  C  CD    . PRO C 2  678  ? 464.342 -0.890  692.812 1.00 54.17  ? 678  PRO C CD    1 
ATOM   8826  N  N     . PHE C 2  679  ? 467.082 2.724   691.785 1.00 65.51  ? 679  PHE C N     1 
ATOM   8827  C  CA    . PHE C 2  679  ? 467.577 3.863   692.542 1.00 67.22  ? 679  PHE C CA    1 
ATOM   8828  C  C     . PHE C 2  679  ? 467.288 5.158   691.795 1.00 69.34  ? 679  PHE C C     1 
ATOM   8829  O  O     . PHE C 2  679  ? 467.998 5.502   690.853 1.00 72.39  ? 679  PHE C O     1 
ATOM   8830  C  CB    . PHE C 2  679  ? 469.064 3.707   692.815 1.00 67.02  ? 679  PHE C CB    1 
ATOM   8831  C  CG    . PHE C 2  679  ? 469.568 4.677   693.816 1.00 73.68  ? 679  PHE C CG    1 
ATOM   8832  C  CD1   . PHE C 2  679  ? 470.155 5.857   693.410 1.00 73.60  ? 679  PHE C CD1   1 
ATOM   8833  C  CD2   . PHE C 2  679  ? 469.391 4.449   695.165 1.00 78.90  ? 679  PHE C CD2   1 
ATOM   8834  C  CE1   . PHE C 2  679  ? 470.613 6.774   694.327 1.00 74.64  ? 679  PHE C CE1   1 
ATOM   8835  C  CE2   . PHE C 2  679  ? 469.831 5.370   696.091 1.00 81.03  ? 679  PHE C CE2   1 
ATOM   8836  C  CZ    . PHE C 2  679  ? 470.451 6.535   695.667 1.00 78.77  ? 679  PHE C CZ    1 
ATOM   8837  N  N     . ASP C 2  680  ? 466.270 5.886   692.266 1.00 73.03  ? 680  ASP C N     1 
ATOM   8838  C  CA    . ASP C 2  680  ? 465.928 7.235   691.832 1.00 78.94  ? 680  ASP C CA    1 
ATOM   8839  C  C     . ASP C 2  680  ? 466.004 7.478   690.327 1.00 77.26  ? 680  ASP C C     1 
ATOM   8840  O  O     . ASP C 2  680  ? 466.368 8.584   689.925 1.00 80.49  ? 680  ASP C O     1 
ATOM   8841  C  CB    . ASP C 2  680  ? 466.701 8.280   692.611 1.00 92.92  ? 680  ASP C CB    1 
ATOM   8842  C  CG    . ASP C 2  680  ? 465.861 8.841   693.798 1.00 107.78 ? 680  ASP C CG    1 
ATOM   8843  O  OD1   . ASP C 2  680  ? 465.086 8.071   694.433 1.00 111.14 ? 680  ASP C OD1   1 
ATOM   8844  O  OD2   . ASP C 2  680  ? 465.941 10.060  694.087 1.00 111.96 ? 680  ASP C OD2   1 
ATOM   8845  N  N     . GLY C 2  681  ? 465.706 6.469   689.495 1.00 69.22  ? 681  GLY C N     1 
ATOM   8846  C  CA    . GLY C 2  681  ? 465.833 6.527   688.053 1.00 64.69  ? 681  GLY C CA    1 
ATOM   8847  C  C     . GLY C 2  681  ? 467.231 6.572   687.471 1.00 66.89  ? 681  GLY C C     1 
ATOM   8848  O  O     . GLY C 2  681  ? 467.368 6.689   686.257 1.00 72.97  ? 681  GLY C O     1 
ATOM   8849  N  N     . TYR C 2  682  ? 468.281 6.474   688.267 1.00 73.06  ? 682  TYR C N     1 
ATOM   8850  C  CA    . TYR C 2  682  ? 469.625 6.374   687.700 1.00 65.63  ? 682  TYR C CA    1 
ATOM   8851  C  C     . TYR C 2  682  ? 469.859 4.947   687.217 1.00 56.59  ? 682  TYR C C     1 
ATOM   8852  O  O     . TYR C 2  682  ? 470.877 4.658   686.606 1.00 57.07  ? 682  TYR C O     1 
ATOM   8853  C  CB    . TYR C 2  682  ? 470.667 6.796   688.738 1.00 67.41  ? 682  TYR C CB    1 
ATOM   8854  C  CG    . TYR C 2  682  ? 470.664 8.279   689.039 1.00 74.74  ? 682  TYR C CG    1 
ATOM   8855  C  CD1   . TYR C 2  682  ? 470.972 9.217   688.075 1.00 81.83  ? 682  TYR C CD1   1 
ATOM   8856  C  CD2   . TYR C 2  682  ? 470.204 8.744   690.254 1.00 78.87  ? 682  TYR C CD2   1 
ATOM   8857  C  CE1   . TYR C 2  682  ? 470.929 10.585  688.354 1.00 84.10  ? 682  TYR C CE1   1 
ATOM   8858  C  CE2   . TYR C 2  682  ? 470.146 10.089  690.532 1.00 79.60  ? 682  TYR C CE2   1 
ATOM   8859  C  CZ    . TYR C 2  682  ? 470.506 11.008  689.583 1.00 80.70  ? 682  TYR C CZ    1 
ATOM   8860  O  OH    . TYR C 2  682  ? 470.449 12.354  689.890 1.00 79.59  ? 682  TYR C OH    1 
ATOM   8861  N  N     . ASN C 2  683  ? 468.964 4.046   687.579 1.00 57.29  ? 683  ASN C N     1 
ATOM   8862  C  CA    . ASN C 2  683  ? 468.982 2.648   687.227 1.00 59.90  ? 683  ASN C CA    1 
ATOM   8863  C  C     . ASN C 2  683  ? 468.211 2.398   685.969 1.00 65.68  ? 683  ASN C C     1 
ATOM   8864  O  O     . ASN C 2  683  ? 468.106 1.245   685.530 1.00 69.82  ? 683  ASN C O     1 
ATOM   8865  C  CB    . ASN C 2  683  ? 468.303 1.855   688.322 1.00 72.60  ? 683  ASN C CB    1 
ATOM   8866  C  CG    . ASN C 2  683  ? 469.256 1.230   689.210 1.00 82.86  ? 683  ASN C CG    1 
ATOM   8867  O  OD1   . ASN C 2  683  ? 470.421 1.133   688.860 1.00 91.24  ? 683  ASN C OD1   1 
ATOM   8868  N  ND2   . ASN C 2  683  ? 468.797 0.738   690.342 1.00 83.84  ? 683  ASN C ND2   1 
ATOM   8869  N  N     . PHE C 2  684  ? 467.648 3.462   685.415 1.00 66.88  ? 684  PHE C N     1 
ATOM   8870  C  CA    . PHE C 2  684  ? 466.620 3.349   684.395 1.00 65.67  ? 684  PHE C CA    1 
ATOM   8871  C  C     . PHE C 2  684  ? 467.164 2.672   683.145 1.00 70.41  ? 684  PHE C C     1 
ATOM   8872  O  O     . PHE C 2  684  ? 468.236 3.029   682.632 1.00 73.10  ? 684  PHE C O     1 
ATOM   8873  C  CB    . PHE C 2  684  ? 466.131 4.760   684.092 1.00 59.86  ? 684  PHE C CB    1 
ATOM   8874  C  CG    . PHE C 2  684  ? 464.953 4.843   683.215 1.00 61.36  ? 684  PHE C CG    1 
ATOM   8875  C  CD1   . PHE C 2  684  ? 463.732 4.334   683.622 1.00 63.72  ? 684  PHE C CD1   1 
ATOM   8876  C  CD2   . PHE C 2  684  ? 465.022 5.578   682.019 1.00 61.12  ? 684  PHE C CD2   1 
ATOM   8877  C  CE1   . PHE C 2  684  ? 462.621 4.459   682.780 1.00 65.75  ? 684  PHE C CE1   1 
ATOM   8878  C  CE2   . PHE C 2  684  ? 463.913 5.726   681.185 1.00 58.42  ? 684  PHE C CE2   1 
ATOM   8879  C  CZ    . PHE C 2  684  ? 462.722 5.168   681.547 1.00 60.68  ? 684  PHE C CZ    1 
ATOM   8880  N  N     . GLU C 2  685  ? 466.380 1.739   682.623 1.00 71.19  ? 685  GLU C N     1 
ATOM   8881  C  CA    . GLU C 2  685  ? 466.638 1.117   681.330 1.00 65.43  ? 685  GLU C CA    1 
ATOM   8882  C  C     . GLU C 2  685  ? 468.103 0.659   681.165 1.00 66.28  ? 685  GLU C C     1 
ATOM   8883  O  O     . GLU C 2  685  ? 468.824 1.063   680.246 1.00 61.46  ? 685  GLU C O     1 
ATOM   8884  C  CB    . GLU C 2  685  ? 466.169 2.062   680.229 1.00 57.93  ? 685  GLU C CB    1 
ATOM   8885  C  CG    . GLU C 2  685  ? 464.656 2.057   680.049 1.00 57.80  ? 685  GLU C CG    1 
ATOM   8886  C  CD    . GLU C 2  685  ? 464.155 0.782   679.314 1.00 67.59  ? 685  GLU C CD    1 
ATOM   8887  O  OE1   . GLU C 2  685  ? 464.762 -0.308  679.512 1.00 72.37  ? 685  GLU C OE1   1 
ATOM   8888  O  OE2   . GLU C 2  685  ? 463.157 0.875   678.523 1.00 68.32  ? 685  GLU C OE2   1 
ATOM   8889  N  N     . ASP C 2  686  ? 468.553 -0.160  682.115 1.00 65.03  ? 686  ASP C N     1 
ATOM   8890  C  CA    . ASP C 2  686  ? 469.838 -0.848  682.118 1.00 61.25  ? 686  ASP C CA    1 
ATOM   8891  C  C     . ASP C 2  686  ? 470.980 0.047   682.545 1.00 64.79  ? 686  ASP C C     1 
ATOM   8892  O  O     . ASP C 2  686  ? 472.103 -0.473  682.755 1.00 57.82  ? 686  ASP C O     1 
ATOM   8893  C  CB    . ASP C 2  686  ? 470.156 -1.532  680.781 1.00 59.73  ? 686  ASP C CB    1 
ATOM   8894  C  CG    . ASP C 2  686  ? 469.030 -2.435  680.338 1.00 71.80  ? 686  ASP C CG    1 
ATOM   8895  O  OD1   . ASP C 2  686  ? 469.022 -3.616  680.743 1.00 80.08  ? 686  ASP C OD1   1 
ATOM   8896  O  OD2   . ASP C 2  686  ? 468.100 -1.959  679.658 1.00 77.32  ? 686  ASP C OD2   1 
ATOM   8897  N  N     . ALA C 2  687  ? 470.742 1.328   682.794 1.00 48.74  ? 687  ALA C N     1 
ATOM   8898  C  CA    . ALA C 2  687  ? 471.832 2.118   683.346 1.00 66.00  ? 687  ALA C CA    1 
ATOM   8899  C  C     . ALA C 2  687  ? 472.252 1.586   684.733 1.00 64.20  ? 687  ALA C C     1 
ATOM   8900  O  O     . ALA C 2  687  ? 471.500 0.886   685.440 1.00 69.84  ? 687  ALA C O     1 
ATOM   8901  C  CB    . ALA C 2  687  ? 471.407 3.585   683.441 1.00 50.20  ? 687  ALA C CB    1 
ATOM   8902  N  N     . ILE C 2  688  ? 473.476 1.900   685.129 1.00 58.68  ? 688  ILE C N     1 
ATOM   8903  C  CA    . ILE C 2  688  ? 474.011 1.333   686.362 1.00 64.23  ? 688  ILE C CA    1 
ATOM   8904  C  C     . ILE C 2  688  ? 474.532 2.457   687.244 1.00 71.64  ? 688  ILE C C     1 
ATOM   8905  O  O     . ILE C 2  688  ? 475.115 3.432   686.755 1.00 80.56  ? 688  ILE C O     1 
ATOM   8906  C  CB    . ILE C 2  688  ? 475.092 0.261   686.121 1.00 61.77  ? 688  ILE C CB    1 
ATOM   8907  C  CG1   . ILE C 2  688  ? 474.493 -0.913  685.333 1.00 62.74  ? 688  ILE C CG1   1 
ATOM   8908  C  CG2   . ILE C 2  688  ? 475.666 -0.225  687.456 1.00 60.11  ? 688  ILE C CG2   1 
ATOM   8909  C  CD1   . ILE C 2  688  ? 475.475 -2.030  685.096 1.00 59.54  ? 688  ILE C CD1   1 
ATOM   8910  N  N     . VAL C 2  689  ? 474.303 2.318   688.545 1.00 62.06  ? 689  VAL C N     1 
ATOM   8911  C  CA    . VAL C 2  689  ? 474.774 3.245   689.557 1.00 62.98  ? 689  VAL C CA    1 
ATOM   8912  C  C     . VAL C 2  689  ? 475.893 2.572   690.314 1.00 66.78  ? 689  VAL C C     1 
ATOM   8913  O  O     . VAL C 2  689  ? 475.737 1.425   690.749 1.00 75.47  ? 689  VAL C O     1 
ATOM   8914  C  CB    . VAL C 2  689  ? 473.635 3.598   690.524 1.00 62.16  ? 689  VAL C CB    1 
ATOM   8915  C  CG1   . VAL C 2  689  ? 474.111 4.535   691.601 1.00 63.15  ? 689  VAL C CG1   1 
ATOM   8916  C  CG2   . VAL C 2  689  ? 472.501 4.218   689.764 1.00 66.22  ? 689  VAL C CG2   1 
ATOM   8917  N  N     . ILE C 2  690  ? 476.998 3.291   690.525 1.00 66.03  ? 690  ILE C N     1 
ATOM   8918  C  CA    . ILE C 2  690  ? 478.140 2.702   691.209 1.00 67.77  ? 690  ILE C CA    1 
ATOM   8919  C  C     . ILE C 2  690  ? 478.591 3.616   692.330 1.00 72.42  ? 690  ILE C C     1 
ATOM   8920  O  O     . ILE C 2  690  ? 478.375 4.829   692.306 1.00 78.30  ? 690  ILE C O     1 
ATOM   8921  C  CB    . ILE C 2  690  ? 479.299 2.474   690.260 1.00 71.95  ? 690  ILE C CB    1 
ATOM   8922  C  CG1   . ILE C 2  690  ? 479.812 3.841   689.795 1.00 72.90  ? 690  ILE C CG1   1 
ATOM   8923  C  CG2   . ILE C 2  690  ? 478.849 1.597   689.111 1.00 74.67  ? 690  ILE C CG2   1 
ATOM   8924  C  CD1   . ILE C 2  690  ? 481.240 3.797   689.269 1.00 72.97  ? 690  ILE C CD1   1 
ATOM   8925  N  N     . SER C 2  691  ? 479.292 3.028   693.286 1.00 70.31  ? 691  SER C N     1 
ATOM   8926  C  CA    . SER C 2  691  ? 479.776 3.796   694.418 1.00 72.45  ? 691  SER C CA    1 
ATOM   8927  C  C     . SER C 2  691  ? 481.124 4.420   694.108 1.00 77.25  ? 691  SER C C     1 
ATOM   8928  O  O     . SER C 2  691  ? 482.021 3.758   693.577 1.00 87.67  ? 691  SER C O     1 
ATOM   8929  C  CB    . SER C 2  691  ? 479.881 2.892   695.652 1.00 82.87  ? 691  SER C CB    1 
ATOM   8930  O  OG    . SER C 2  691  ? 480.509 3.532   696.764 1.00 89.64  ? 691  SER C OG    1 
ATOM   8931  N  N     . GLU C 2  692  ? 481.302 5.664   694.537 1.00 68.13  ? 692  GLU C N     1 
ATOM   8932  C  CA    . GLU C 2  692  ? 482.606 6.298   694.393 1.00 71.89  ? 692  GLU C CA    1 
ATOM   8933  C  C     . GLU C 2  692  ? 483.695 5.501   695.111 1.00 78.10  ? 692  GLU C C     1 
ATOM   8934  O  O     . GLU C 2  692  ? 484.880 5.758   694.897 1.00 74.53  ? 692  GLU C O     1 
ATOM   8935  C  CB    . GLU C 2  692  ? 482.530 7.749   694.867 1.00 71.09  ? 692  GLU C CB    1 
ATOM   8936  C  CG    . GLU C 2  692  ? 483.749 8.611   694.590 1.00 72.78  ? 692  GLU C CG    1 
ATOM   8937  C  CD    . GLU C 2  692  ? 483.562 10.082  694.960 1.00 81.89  ? 692  GLU C CD    1 
ATOM   8938  O  OE1   . GLU C 2  692  ? 483.065 10.395  696.058 1.00 83.97  ? 692  GLU C OE1   1 
ATOM   8939  O  OE2   . GLU C 2  692  ? 484.063 10.940  694.215 1.00 87.15  ? 692  GLU C OE2   1 
ATOM   8940  N  N     . GLU C 2  693  ? 483.320 4.645   696.066 1.00 94.33  ? 693  GLU C N     1 
ATOM   8941  C  CA    . GLU C 2  693  ? 484.286 3.767   696.728 1.00 96.41  ? 693  GLU C CA    1 
ATOM   8942  C  C     . GLU C 2  693  ? 485.061 2.909   695.738 1.00 91.72  ? 693  GLU C C     1 
ATOM   8943  O  O     . GLU C 2  693  ? 486.154 2.440   696.074 1.00 95.76  ? 693  GLU C O     1 
ATOM   8944  C  CB    . GLU C 2  693  ? 483.596 2.871   697.753 1.00 100.12 ? 693  GLU C CB    1 
ATOM   8945  C  CG    . GLU C 2  693  ? 483.242 3.660   698.935 1.00 106.90 ? 693  GLU C CG    1 
ATOM   8946  C  CD    . GLU C 2  693  ? 484.493 4.205   699.579 1.00 115.68 ? 693  GLU C CD    1 
ATOM   8947  O  OE1   . GLU C 2  693  ? 485.481 3.447   699.696 1.00 122.73 ? 693  GLU C OE1   1 
ATOM   8948  O  OE2   . GLU C 2  693  ? 484.496 5.399   699.946 1.00 118.83 ? 693  GLU C OE2   1 
ATOM   8949  N  N     . LEU C 2  694  ? 484.442 2.543   694.608 1.00 82.13  ? 694  LEU C N     1 
ATOM   8950  C  CA    . LEU C 2  694  ? 485.137 1.756   693.586 1.00 85.21  ? 694  LEU C CA    1 
ATOM   8951  C  C     . LEU C 2  694  ? 486.348 2.484   692.971 1.00 90.52  ? 694  LEU C C     1 
ATOM   8952  O  O     . LEU C 2  694  ? 487.437 1.901   692.835 1.00 89.31  ? 694  LEU C O     1 
ATOM   8953  C  CB    . LEU C 2  694  ? 484.137 1.324   692.510 1.00 74.82  ? 694  LEU C CB    1 
ATOM   8954  C  CG    . LEU C 2  694  ? 483.167 0.196   692.863 1.00 69.72  ? 694  LEU C CG    1 
ATOM   8955  C  CD1   . LEU C 2  694  ? 482.313 -0.173  691.676 1.00 65.27  ? 694  LEU C CD1   1 
ATOM   8956  C  CD2   . LEU C 2  694  ? 483.992 -1.043  693.254 1.00 68.01  ? 694  LEU C CD2   1 
ATOM   8957  N  N     . LEU C 2  695  ? 486.190 3.765   692.615 1.00 88.30  ? 695  LEU C N     1 
ATOM   8958  C  CA    . LEU C 2  695  ? 487.321 4.525   692.084 1.00 79.81  ? 695  LEU C CA    1 
ATOM   8959  C  C     . LEU C 2  695  ? 488.379 4.741   693.147 1.00 90.31  ? 695  LEU C C     1 
ATOM   8960  O  O     . LEU C 2  695  ? 489.580 4.636   692.877 1.00 101.29 ? 695  LEU C O     1 
ATOM   8961  C  CB    . LEU C 2  695  ? 486.875 5.868   691.500 1.00 71.53  ? 695  LEU C CB    1 
ATOM   8962  C  CG    . LEU C 2  695  ? 485.637 5.931   690.584 1.00 68.92  ? 695  LEU C CG    1 
ATOM   8963  C  CD1   . LEU C 2  695  ? 485.521 7.244   689.821 1.00 68.76  ? 695  LEU C CD1   1 
ATOM   8964  C  CD2   . LEU C 2  695  ? 485.519 4.780   689.648 1.00 78.13  ? 695  LEU C CD2   1 
ATOM   8965  N  N     . LYS C 2  696  ? 487.946 5.097   694.345 1.00 92.31  ? 696  LYS C N     1 
ATOM   8966  C  CA    . LYS C 2  696  ? 488.857 5.339   695.452 1.00 93.41  ? 696  LYS C CA    1 
ATOM   8967  C  C     . LYS C 2  696  ? 489.836 4.182   695.632 1.00 90.39  ? 696  LYS C C     1 
ATOM   8968  O  O     . LYS C 2  696  ? 491.033 4.400   695.837 1.00 96.64  ? 696  LYS C O     1 
ATOM   8969  C  CB    . LYS C 2  696  ? 488.023 5.529   696.716 1.00 100.89 ? 696  LYS C CB    1 
ATOM   8970  C  CG    . LYS C 2  696  ? 487.311 6.880   696.876 1.00 105.40 ? 696  LYS C CG    1 
ATOM   8971  C  CD    . LYS C 2  696  ? 486.329 6.760   698.040 1.00 107.94 ? 696  LYS C CD    1 
ATOM   8972  C  CE    . LYS C 2  696  ? 485.418 7.956   698.207 1.00 105.39 ? 696  LYS C CE    1 
ATOM   8973  N  NZ    . LYS C 2  696  ? 484.503 7.758   699.373 1.00 100.28 ? 696  LYS C NZ    1 
ATOM   8974  N  N     . ARG C 2  697  ? 489.352 2.945   695.578 1.00 87.11  ? 697  ARG C N     1 
ATOM   8975  C  CA    . ARG C 2  697  ? 490.214 1.781   695.733 1.00 97.62  ? 697  ARG C CA    1 
ATOM   8976  C  C     . ARG C 2  697  ? 490.697 1.199   694.404 1.00 106.78 ? 697  ARG C C     1 
ATOM   8977  O  O     . ARG C 2  697  ? 491.269 0.098   694.394 1.00 111.88 ? 697  ARG C O     1 
ATOM   8978  C  CB    . ARG C 2  697  ? 489.536 0.739   696.624 1.00 99.00  ? 697  ARG C CB    1 
ATOM   8979  C  CG    . ARG C 2  697  ? 488.387 -0.082  696.085 1.00 100.24 ? 697  ARG C CG    1 
ATOM   8980  C  CD    . ARG C 2  697  ? 488.039 -1.016  697.239 1.00 100.07 ? 697  ARG C CD    1 
ATOM   8981  N  NE    . ARG C 2  697  ? 486.947 -1.938  697.002 1.00 95.59  ? 697  ARG C NE    1 
ATOM   8982  C  CZ    . ARG C 2  697  ? 485.689 -1.590  697.231 1.00 97.06  ? 697  ARG C CZ    1 
ATOM   8983  N  NH1   . ARG C 2  697  ? 485.430 -0.358  697.666 1.00 95.27  ? 697  ARG C NH1   1 
ATOM   8984  N  NH2   . ARG C 2  697  ? 484.701 -2.456  697.045 1.00 98.69  ? 697  ARG C NH2   1 
ATOM   8985  N  N     . ASP C 2  698  ? 490.459 1.907   693.291 1.00 110.41 ? 698  ASP C N     1 
ATOM   8986  C  CA    . ASP C 2  698  ? 490.971 1.567   691.952 1.00 107.66 ? 698  ASP C CA    1 
ATOM   8987  C  C     . ASP C 2  698  ? 490.397 0.265   691.405 1.00 107.49 ? 698  ASP C C     1 
ATOM   8988  O  O     . ASP C 2  698  ? 491.053 -0.455  690.645 1.00 110.43 ? 698  ASP C O     1 
ATOM   8989  C  CB    . ASP C 2  698  ? 492.512 1.530   691.912 1.00 107.68 ? 698  ASP C CB    1 
ATOM   8990  C  CG    . ASP C 2  698  ? 493.118 2.829   691.388 1.00 106.99 ? 698  ASP C CG    1 
ATOM   8991  O  OD1   . ASP C 2  698  ? 492.546 3.406   690.423 1.00 106.16 ? 698  ASP C OD1   1 
ATOM   8992  O  OD2   . ASP C 2  698  ? 494.168 3.257   691.933 1.00 106.13 ? 698  ASP C OD2   1 
ATOM   8993  N  N     . PHE C 2  699  ? 489.156 -0.032  691.748 1.00 99.33  ? 699  PHE C N     1 
ATOM   8994  C  CA    . PHE C 2  699  ? 488.476 -1.103  691.058 1.00 95.27  ? 699  PHE C CA    1 
ATOM   8995  C  C     . PHE C 2  699  ? 488.063 -0.575  689.689 1.00 94.98  ? 699  PHE C C     1 
ATOM   8996  O  O     . PHE C 2  699  ? 487.814 0.624   689.511 1.00 96.29  ? 699  PHE C O     1 
ATOM   8997  C  CB    . PHE C 2  699  ? 487.271 -1.587  691.851 1.00 92.72  ? 699  PHE C CB    1 
ATOM   8998  C  CG    . PHE C 2  699  ? 487.590 -2.686  692.830 1.00 95.57  ? 699  PHE C CG    1 
ATOM   8999  C  CD1   . PHE C 2  699  ? 488.789 -2.694  693.512 1.00 97.37  ? 699  PHE C CD1   1 
ATOM   9000  C  CD2   . PHE C 2  699  ? 486.691 -3.705  693.073 1.00 95.72  ? 699  PHE C CD2   1 
ATOM   9001  C  CE1   . PHE C 2  699  ? 489.080 -3.696  694.421 1.00 95.49  ? 699  PHE C CE1   1 
ATOM   9002  C  CE2   . PHE C 2  699  ? 486.992 -4.712  693.975 1.00 94.55  ? 699  PHE C CE2   1 
ATOM   9003  C  CZ    . PHE C 2  699  ? 488.181 -4.704  694.643 1.00 93.02  ? 699  PHE C CZ    1 
ATOM   9004  N  N     . TYR C 2  700  ? 488.098 -1.458  688.698 1.00 95.24  ? 700  TYR C N     1 
ATOM   9005  C  CA    . TYR C 2  700  ? 487.735 -1.118  687.320 1.00 90.82  ? 700  TYR C CA    1 
ATOM   9006  C  C     . TYR C 2  700  ? 488.667 -0.066  686.738 1.00 94.07  ? 700  TYR C C     1 
ATOM   9007  O  O     . TYR C 2  700  ? 488.294 0.689   685.846 1.00 99.19  ? 700  TYR C O     1 
ATOM   9008  C  CB    . TYR C 2  700  ? 486.247 -0.688  687.205 1.00 82.44  ? 700  TYR C CB    1 
ATOM   9009  C  CG    . TYR C 2  700  ? 485.342 -1.843  687.567 1.00 77.95  ? 700  TYR C CG    1 
ATOM   9010  C  CD1   . TYR C 2  700  ? 485.203 -2.894  686.689 1.00 82.29  ? 700  TYR C CD1   1 
ATOM   9011  C  CD2   . TYR C 2  700  ? 484.704 -1.935  688.793 1.00 79.22  ? 700  TYR C CD2   1 
ATOM   9012  C  CE1   . TYR C 2  700  ? 484.447 -3.992  686.984 1.00 84.12  ? 700  TYR C CE1   1 
ATOM   9013  C  CE2   . TYR C 2  700  ? 483.930 -3.054  689.111 1.00 82.16  ? 700  TYR C CE2   1 
ATOM   9014  C  CZ    . TYR C 2  700  ? 483.820 -4.078  688.186 1.00 84.88  ? 700  TYR C CZ    1 
ATOM   9015  O  OH    . TYR C 2  700  ? 483.084 -5.210  688.404 1.00 88.66  ? 700  TYR C OH    1 
ATOM   9016  N  N     . THR C 2  701  ? 489.889 0.010   687.238 1.00 98.48  ? 701  THR C N     1 
ATOM   9017  C  CA    . THR C 2  701  ? 490.898 0.833   686.594 1.00 100.44 ? 701  THR C CA    1 
ATOM   9018  C  C     . THR C 2  701  ? 491.778 -0.056  685.707 1.00 100.76 ? 701  THR C C     1 
ATOM   9019  O  O     . THR C 2  701  ? 492.178 -1.158  686.104 1.00 98.78  ? 701  THR C O     1 
ATOM   9020  C  CB    . THR C 2  701  ? 491.712 1.616   687.631 1.00 105.65 ? 701  THR C CB    1 
ATOM   9021  O  OG1   . THR C 2  701  ? 490.840 2.514   688.347 1.00 103.60 ? 701  THR C OG1   1 
ATOM   9022  C  CG2   . THR C 2  701  ? 492.788 2.432   686.937 1.00 109.78 ? 701  THR C CG2   1 
ATOM   9023  N  N     . SER C 2  702  ? 492.035 0.403   684.492 1.00 97.39  ? 702  SER C N     1 
ATOM   9024  C  CA    . SER C 2  702  ? 492.772 -0.368  683.506 1.00 94.19  ? 702  SER C CA    1 
ATOM   9025  C  C     . SER C 2  702  ? 493.753 0.539   682.799 1.00 92.51  ? 702  SER C C     1 
ATOM   9026  O  O     . SER C 2  702  ? 493.449 1.713   682.566 1.00 92.54  ? 702  SER C O     1 
ATOM   9027  C  CB    . SER C 2  702  ? 491.834 -0.991  682.499 1.00 92.59  ? 702  SER C CB    1 
ATOM   9028  O  OG    . SER C 2  702  ? 491.058 0.021   681.887 1.00 89.31  ? 702  SER C OG    1 
ATOM   9029  N  N     . ILE C 2  703  ? 494.914 -0.002  682.452 1.00 95.05  ? 703  ILE C N     1 
ATOM   9030  C  CA    . ILE C 2  703  ? 495.935 0.740   681.709 1.00 94.53  ? 703  ILE C CA    1 
ATOM   9031  C  C     . ILE C 2  703  ? 495.792 0.525   680.207 1.00 96.77  ? 703  ILE C C     1 
ATOM   9032  O  O     . ILE C 2  703  ? 495.650 -0.611  679.733 1.00 96.55  ? 703  ILE C O     1 
ATOM   9033  C  CB    . ILE C 2  703  ? 497.340 0.373   682.172 1.00 94.11  ? 703  ILE C CB    1 
ATOM   9034  C  CG1   . ILE C 2  703  ? 497.457 0.628   683.651 1.00 99.49  ? 703  ILE C CG1   1 
ATOM   9035  C  CG2   . ILE C 2  703  ? 498.299 1.268   681.492 1.00 96.87  ? 703  ILE C CG2   1 
ATOM   9036  C  CD1   . ILE C 2  703  ? 498.844 0.395   684.143 1.00 105.02 ? 703  ILE C CD1   1 
ATOM   9037  N  N     . HIS C 2  704  ? 495.905 1.617   679.444 1.00 98.71  ? 704  HIS C N     1 
ATOM   9038  C  CA    . HIS C 2  704  ? 495.748 1.578   677.998 1.00 97.47  ? 704  HIS C CA    1 
ATOM   9039  C  C     . HIS C 2  704  ? 496.855 2.370   677.336 1.00 101.50 ? 704  HIS C C     1 
ATOM   9040  O  O     . HIS C 2  704  ? 497.206 3.459   677.800 1.00 106.10 ? 704  HIS C O     1 
ATOM   9041  C  CB    . HIS C 2  704  ? 494.411 2.178   677.621 1.00 95.11  ? 704  HIS C CB    1 
ATOM   9042  C  CG    . HIS C 2  704  ? 493.267 1.385   678.152 1.00 94.77  ? 704  HIS C CG    1 
ATOM   9043  N  ND1   . HIS C 2  704  ? 492.564 0.478   677.391 1.00 93.48  ? 704  HIS C ND1   1 
ATOM   9044  C  CD2   . HIS C 2  704  ? 492.732 1.338   679.394 1.00 93.88  ? 704  HIS C CD2   1 
ATOM   9045  C  CE1   . HIS C 2  704  ? 491.640 -0.090  678.142 1.00 92.88  ? 704  HIS C CE1   1 
ATOM   9046  N  NE2   . HIS C 2  704  ? 491.713 0.425   679.357 1.00 94.46  ? 704  HIS C NE2   1 
ATOM   9047  N  N     . ILE C 2  705  ? 497.366 1.840   676.226 1.00 102.61 ? 705  ILE C N     1 
ATOM   9048  C  CA    . ILE C 2  705  ? 498.464 2.451   675.480 1.00 99.12  ? 705  ILE C CA    1 
ATOM   9049  C  C     . ILE C 2  705  ? 498.062 2.668   674.034 1.00 95.82  ? 705  ILE C C     1 
ATOM   9050  O  O     . ILE C 2  705  ? 497.516 1.769   673.389 1.00 96.08  ? 705  ILE C O     1 
ATOM   9051  C  CB    . ILE C 2  705  ? 499.750 1.614   675.540 1.00 96.98  ? 705  ILE C CB    1 
ATOM   9052  C  CG1   . ILE C 2  705  ? 500.008 1.141   676.963 1.00 97.70  ? 705  ILE C CG1   1 
ATOM   9053  C  CG2   . ILE C 2  705  ? 500.914 2.430   675.059 1.00 99.73  ? 705  ILE C CG2   1 
ATOM   9054  C  CD1   . ILE C 2  705  ? 501.023 0.025   677.046 1.00 101.35 ? 705  ILE C CD1   1 
ATOM   9055  N  N     . GLU C 2  706  ? 498.330 3.863   673.535 1.00 98.43  ? 706  GLU C N     1 
ATOM   9056  C  CA    . GLU C 2  706  ? 498.083 4.207   672.150 1.00 103.92 ? 706  GLU C CA    1 
ATOM   9057  C  C     . GLU C 2  706  ? 499.452 4.399   671.514 1.00 106.87 ? 706  GLU C C     1 
ATOM   9058  O  O     . GLU C 2  706  ? 500.368 4.929   672.151 1.00 108.19 ? 706  GLU C O     1 
ATOM   9059  C  CB    . GLU C 2  706  ? 497.253 5.488   672.049 1.00 108.36 ? 706  GLU C CB    1 
ATOM   9060  C  CG    . GLU C 2  706  ? 496.587 5.747   670.710 1.00 112.67 ? 706  GLU C CG    1 
ATOM   9061  C  CD    . GLU C 2  706  ? 495.925 4.506   670.140 1.00 119.79 ? 706  GLU C CD    1 
ATOM   9062  O  OE1   . GLU C 2  706  ? 495.132 3.874   670.881 1.00 123.19 ? 706  GLU C OE1   1 
ATOM   9063  O  OE2   . GLU C 2  706  ? 496.158 4.192   668.951 1.00 123.11 ? 706  GLU C OE2   1 
ATOM   9064  N  N     . ARG C 2  707  ? 499.583 3.982   670.255 1.00 109.85 ? 707  ARG C N     1 
ATOM   9065  C  CA    . ARG C 2  707  ? 500.831 4.051   669.494 1.00 105.65 ? 707  ARG C CA    1 
ATOM   9066  C  C     . ARG C 2  707  ? 500.750 5.196   668.492 1.00 92.99  ? 707  ARG C C     1 
ATOM   9067  O  O     . ARG C 2  707  ? 499.762 5.320   667.761 1.00 89.68  ? 707  ARG C O     1 
ATOM   9068  C  CB    . ARG C 2  707  ? 501.097 2.710   668.789 1.00 114.72 ? 707  ARG C CB    1 
ATOM   9069  C  CG    . ARG C 2  707  ? 502.331 2.672   667.889 1.00 124.67 ? 707  ARG C CG    1 
ATOM   9070  C  CD    . ARG C 2  707  ? 502.599 1.287   667.268 1.00 127.85 ? 707  ARG C CD    1 
ATOM   9071  N  NE    . ARG C 2  707  ? 502.886 1.328   665.832 1.00 129.33 ? 707  ARG C NE    1 
ATOM   9072  C  CZ    . ARG C 2  707  ? 503.325 0.284   665.127 1.00 129.61 ? 707  ARG C CZ    1 
ATOM   9073  N  NH1   . ARG C 2  707  ? 503.537 -0.881  665.737 1.00 127.30 ? 707  ARG C NH1   1 
ATOM   9074  N  NH2   . ARG C 2  707  ? 503.559 0.403   663.816 1.00 130.27 ? 707  ARG C NH2   1 
ATOM   9075  N  N     . TYR C 2  708  ? 501.772 6.048   668.487 1.00 92.34  ? 708  TYR C N     1 
ATOM   9076  C  CA    . TYR C 2  708  ? 501.861 7.148   667.540 1.00 98.15  ? 708  TYR C CA    1 
ATOM   9077  C  C     . TYR C 2  708  ? 503.090 6.944   666.648 1.00 113.90 ? 708  TYR C C     1 
ATOM   9078  O  O     . TYR C 2  708  ? 504.110 6.409   667.093 1.00 122.04 ? 708  TYR C O     1 
ATOM   9079  C  CB    . TYR C 2  708  ? 501.940 8.444   668.350 1.00 89.01  ? 708  TYR C CB    1 
ATOM   9080  C  CG    . TYR C 2  708  ? 500.667 8.581   669.135 1.00 91.73  ? 708  TYR C CG    1 
ATOM   9081  C  CD1   . TYR C 2  708  ? 500.520 7.951   670.380 1.00 94.53  ? 708  TYR C CD1   1 
ATOM   9082  C  CD2   . TYR C 2  708  ? 499.595 9.308   668.658 1.00 90.77  ? 708  TYR C CD2   1 
ATOM   9083  C  CE1   . TYR C 2  708  ? 499.313 8.029   671.112 1.00 89.46  ? 708  TYR C CE1   1 
ATOM   9084  C  CE2   . TYR C 2  708  ? 498.385 9.412   669.385 1.00 84.19  ? 708  TYR C CE2   1 
ATOM   9085  C  CZ    . TYR C 2  708  ? 498.257 8.762   670.594 1.00 85.35  ? 708  TYR C CZ    1 
ATOM   9086  O  OH    . TYR C 2  708  ? 497.072 8.857   671.280 1.00 91.26  ? 708  TYR C OH    1 
ATOM   9087  N  N     . GLU C 2  709  ? 502.992 7.334   665.373 1.00 108.59 ? 709  GLU C N     1 
ATOM   9088  C  CA    . GLU C 2  709  ? 504.061 7.081   664.414 1.00 103.37 ? 709  GLU C CA    1 
ATOM   9089  C  C     . GLU C 2  709  ? 504.169 8.300   663.511 1.00 96.11  ? 709  GLU C C     1 
ATOM   9090  O  O     . GLU C 2  709  ? 503.206 9.046   663.367 1.00 91.70  ? 709  GLU C O     1 
ATOM   9091  C  CB    . GLU C 2  709  ? 503.808 5.759   663.625 1.00 110.84 ? 709  GLU C CB    1 
ATOM   9092  C  CG    . GLU C 2  709  ? 505.008 5.239   662.777 1.00 124.09 ? 709  GLU C CG    1 
ATOM   9093  C  CD    . GLU C 2  709  ? 504.730 3.917   662.017 1.00 133.10 ? 709  GLU C CD    1 
ATOM   9094  O  OE1   . GLU C 2  709  ? 503.748 3.842   661.237 1.00 136.40 ? 709  GLU C OE1   1 
ATOM   9095  O  OE2   . GLU C 2  709  ? 505.519 2.949   662.198 1.00 135.37 ? 709  GLU C OE2   1 
ATOM   9096  N  N     . ILE C 2  710  ? 505.377 8.633   663.080 1.00 96.98  ? 710  ILE C N     1 
ATOM   9097  C  CA    . ILE C 2  710  ? 505.532 9.708   662.101 1.00 99.40  ? 710  ILE C CA    1 
ATOM   9098  C  C     . ILE C 2  710  ? 506.762 9.407   661.254 1.00 107.18 ? 710  ILE C C     1 
ATOM   9099  O  O     . ILE C 2  710  ? 507.758 8.888   661.767 1.00 113.77 ? 710  ILE C O     1 
ATOM   9100  C  CB    . ILE C 2  710  ? 505.634 11.096  662.763 1.00 96.10  ? 710  ILE C CB    1 
ATOM   9101  C  CG1   . ILE C 2  710  ? 505.701 12.190  661.705 1.00 94.67  ? 710  ILE C CG1   1 
ATOM   9102  C  CG2   . ILE C 2  710  ? 506.939 11.200  663.519 1.00 101.91 ? 710  ILE C CG2   1 
ATOM   9103  C  CD1   . ILE C 2  710  ? 505.544 13.594  662.250 1.00 95.99  ? 710  ILE C CD1   1 
ATOM   9104  N  N     . GLU C 2  711  ? 506.688 9.689   659.954 1.00 110.53 ? 711  GLU C N     1 
ATOM   9105  C  CA    . GLU C 2  711  ? 507.809 9.491   659.031 1.00 106.95 ? 711  GLU C CA    1 
ATOM   9106  C  C     . GLU C 2  711  ? 508.371 10.840  658.577 1.00 102.54 ? 711  GLU C C     1 
ATOM   9107  O  O     . GLU C 2  711  ? 507.631 11.816  658.436 1.00 99.27  ? 711  GLU C O     1 
ATOM   9108  C  CB    . GLU C 2  711  ? 507.445 8.641   657.801 1.00 111.24 ? 711  GLU C CB    1 
ATOM   9109  C  CG    . GLU C 2  711  ? 507.109 7.199   658.132 1.00 116.62 ? 711  GLU C CG    1 
ATOM   9110  C  CD    . GLU C 2  711  ? 506.685 6.403   656.924 1.00 124.91 ? 711  GLU C CD    1 
ATOM   9111  O  OE1   . GLU C 2  711  ? 506.340 7.013   655.892 1.00 129.35 ? 711  GLU C OE1   1 
ATOM   9112  O  OE2   . GLU C 2  711  ? 506.733 5.158   656.997 1.00 128.47 ? 711  GLU C OE2   1 
ATOM   9113  N  N     . ALA C 2  712  ? 509.686 10.930  658.423 1.00 106.67 ? 712  ALA C N     1 
ATOM   9114  C  CA    . ALA C 2  712  ? 510.291 12.086  657.763 1.00 120.36 ? 712  ALA C CA    1 
ATOM   9115  C  C     . ALA C 2  712  ? 510.887 11.596  656.451 1.00 127.26 ? 712  ALA C C     1 
ATOM   9116  O  O     . ALA C 2  712  ? 511.744 10.709  656.446 1.00 130.55 ? 712  ALA C O     1 
ATOM   9117  C  CB    . ALA C 2  712  ? 511.367 12.742  658.625 1.00 123.19 ? 712  ALA C CB    1 
ATOM   9118  N  N     . ARG C 2  713  ? 510.426 12.160  655.341 1.00 132.06 ? 713  ARG C N     1 
ATOM   9119  C  CA    . ARG C 2  713  ? 510.797 11.632  654.042 1.00 134.37 ? 713  ARG C CA    1 
ATOM   9120  C  C     . ARG C 2  713  ? 511.354 12.704  653.114 1.00 134.30 ? 713  ARG C C     1 
ATOM   9121  O  O     . ARG C 2  713  ? 511.188 13.909  653.331 1.00 134.91 ? 713  ARG C O     1 
ATOM   9122  C  CB    . ARG C 2  713  ? 509.552 10.991  653.426 1.00 143.72 ? 713  ARG C CB    1 
ATOM   9123  C  CG    . ARG C 2  713  ? 508.551 12.052  652.939 1.00 156.56 ? 713  ARG C CG    1 
ATOM   9124  C  CD    . ARG C 2  713  ? 507.370 11.508  652.117 1.00 163.02 ? 713  ARG C CD    1 
ATOM   9125  N  NE    . ARG C 2  713  ? 506.487 12.596  651.682 1.00 165.63 ? 713  ARG C NE    1 
ATOM   9126  C  CZ    . ARG C 2  713  ? 506.438 13.070  650.438 1.00 164.40 ? 713  ARG C CZ    1 
ATOM   9127  N  NH1   . ARG C 2  713  ? 507.214 12.547  649.501 1.00 165.07 ? 713  ARG C NH1   1 
ATOM   9128  N  NH2   . ARG C 2  713  ? 505.620 14.068  650.131 1.00 163.85 ? 713  ARG C NH2   1 
ATOM   9129  N  N     . ASP C 2  714  ? 512.035 12.238  652.067 1.00 132.30 ? 714  ASP C N     1 
ATOM   9130  C  CA    . ASP C 2  714  ? 512.488 13.132  651.015 1.00 129.44 ? 714  ASP C CA    1 
ATOM   9131  C  C     . ASP C 2  714  ? 511.330 13.548  650.125 1.00 125.81 ? 714  ASP C C     1 
ATOM   9132  O  O     . ASP C 2  714  ? 510.498 12.732  649.714 1.00 122.46 ? 714  ASP C O     1 
ATOM   9133  C  CB    . ASP C 2  714  ? 513.628 12.504  650.231 1.00 127.80 ? 714  ASP C CB    1 
ATOM   9134  C  CG    . ASP C 2  714  ? 514.942 12.590  650.984 1.00 133.95 ? 714  ASP C CG    1 
ATOM   9135  O  OD1   . ASP C 2  714  ? 515.275 13.687  651.496 1.00 136.84 ? 714  ASP C OD1   1 
ATOM   9136  O  OD2   . ASP C 2  714  ? 515.606 11.554  651.149 1.00 136.12 ? 714  ASP C OD2   1 
ATOM   9137  N  N     . THR C 2  715  ? 511.298 14.828  649.821 1.00 126.06 ? 715  THR C N     1 
ATOM   9138  C  CA    . THR C 2  715  ? 510.319 15.416  648.937 1.00 129.99 ? 715  THR C CA    1 
ATOM   9139  C  C     . THR C 2  715  ? 511.098 16.082  647.833 1.00 131.65 ? 715  THR C C     1 
ATOM   9140  O  O     . THR C 2  715  ? 512.282 16.391  648.000 1.00 134.56 ? 715  THR C O     1 
ATOM   9141  C  CB    . THR C 2  715  ? 509.428 16.435  649.648 1.00 138.43 ? 715  THR C CB    1 
ATOM   9142  O  OG1   . THR C 2  715  ? 510.246 17.379  650.347 1.00 150.30 ? 715  THR C OG1   1 
ATOM   9143  C  CG2   . THR C 2  715  ? 508.479 15.743  650.634 1.00 130.19 ? 715  THR C CG2   1 
ATOM   9144  N  N     . LYS C 2  716  ? 510.389 16.395  646.748 1.00 134.74 ? 716  LYS C N     1 
ATOM   9145  C  CA    . LYS C 2  716  ? 511.003 17.124  645.643 1.00 137.14 ? 716  LYS C CA    1 
ATOM   9146  C  C     . LYS C 2  716  ? 511.331 18.547  646.044 1.00 142.67 ? 716  LYS C C     1 
ATOM   9147  O  O     . LYS C 2  716  ? 512.060 19.235  645.314 1.00 144.58 ? 716  LYS C O     1 
ATOM   9148  C  CB    . LYS C 2  716  ? 510.098 17.104  644.409 1.00 136.11 ? 716  LYS C CB    1 
ATOM   9149  C  CG    . LYS C 2  716  ? 509.789 15.693  643.958 1.00 132.80 ? 716  LYS C CG    1 
ATOM   9150  C  CD    . LYS C 2  716  ? 509.228 15.604  642.561 1.00 130.54 ? 716  LYS C CD    1 
ATOM   9151  C  CE    . LYS C 2  716  ? 509.287 14.154  642.160 1.00 129.75 ? 716  LYS C CE    1 
ATOM   9152  N  NZ    . LYS C 2  716  ? 510.709 13.721  642.214 1.00 134.16 ? 716  LYS C NZ    1 
ATOM   9153  N  N     . LEU C 2  717  ? 510.784 18.992  647.174 1.00 139.47 ? 717  LEU C N     1 
ATOM   9154  C  CA    . LEU C 2  717  ? 510.998 20.321  647.700 1.00 140.59 ? 717  LEU C CA    1 
ATOM   9155  C  C     . LEU C 2  717  ? 512.118 20.320  648.735 1.00 140.40 ? 717  LEU C C     1 
ATOM   9156  O  O     . LEU C 2  717  ? 512.492 21.390  649.225 1.00 141.49 ? 717  LEU C O     1 
ATOM   9157  C  CB    . LEU C 2  717  ? 509.693 20.816  648.348 1.00 134.33 ? 717  LEU C CB    1 
ATOM   9158  C  CG    . LEU C 2  717  ? 508.476 21.347  647.570 1.00 131.15 ? 717  LEU C CG    1 
ATOM   9159  C  CD1   . LEU C 2  717  ? 508.266 20.581  646.288 1.00 136.06 ? 717  LEU C CD1   1 
ATOM   9160  C  CD2   . LEU C 2  717  ? 507.189 21.268  648.394 1.00 122.47 ? 717  LEU C CD2   1 
ATOM   9161  N  N     . GLY C 2  718  ? 512.740 19.159  648.988 1.00 146.19 ? 718  GLY C N     1 
ATOM   9162  C  CA    . GLY C 2  718  ? 513.717 19.021  650.048 1.00 150.35 ? 718  GLY C CA    1 
ATOM   9163  C  C     . GLY C 2  718  ? 513.278 18.162  651.230 1.00 150.82 ? 718  GLY C C     1 
ATOM   9164  O  O     . GLY C 2  718  ? 512.102 17.821  651.395 1.00 154.88 ? 718  GLY C O     1 
ATOM   9165  N  N     . PRO C 2  719  ? 514.241 17.794  652.076 1.00 141.99 ? 719  PRO C N     1 
ATOM   9166  C  CA    . PRO C 2  719  ? 513.985 16.816  653.146 1.00 137.02 ? 719  PRO C CA    1 
ATOM   9167  C  C     . PRO C 2  719  ? 513.075 17.308  654.272 1.00 135.15 ? 719  PRO C C     1 
ATOM   9168  O  O     . PRO C 2  719  ? 513.200 18.427  654.779 1.00 138.54 ? 719  PRO C O     1 
ATOM   9169  C  CB    . PRO C 2  719  ? 515.390 16.515  653.674 1.00 134.53 ? 719  PRO C CB    1 
ATOM   9170  C  CG    . PRO C 2  719  ? 516.132 17.765  653.443 1.00 139.14 ? 719  PRO C CG    1 
ATOM   9171  C  CD    . PRO C 2  719  ? 515.626 18.287  652.115 1.00 144.77 ? 719  PRO C CD    1 
ATOM   9172  N  N     . GLU C 2  720  ? 512.161 16.434  654.675 1.00 130.68 ? 720  GLU C N     1 
ATOM   9173  C  CA    . GLU C 2  720  ? 511.510 16.602  655.966 1.00 122.06 ? 720  GLU C CA    1 
ATOM   9174  C  C     . GLU C 2  720  ? 512.541 16.331  657.050 1.00 118.71 ? 720  GLU C C     1 
ATOM   9175  O  O     . GLU C 2  720  ? 513.336 15.393  656.960 1.00 119.43 ? 720  GLU C O     1 
ATOM   9176  C  CB    . GLU C 2  720  ? 510.354 15.605  656.102 1.00 118.23 ? 720  GLU C CB    1 
ATOM   9177  C  CG    . GLU C 2  720  ? 509.125 15.913  655.230 1.00 125.32 ? 720  GLU C CG    1 
ATOM   9178  C  CD    . GLU C 2  720  ? 508.013 14.836  655.294 1.00 128.70 ? 720  GLU C CD    1 
ATOM   9179  O  OE1   . GLU C 2  720  ? 508.305 13.697  655.712 1.00 130.54 ? 720  GLU C OE1   1 
ATOM   9180  O  OE2   . GLU C 2  720  ? 506.845 15.116  654.916 1.00 128.21 ? 720  GLU C OE2   1 
ATOM   9181  N  N     . ARG C 2  721  ? 512.548 17.154  658.070 1.00 121.91 ? 721  ARG C N     1 
ATOM   9182  C  CA    . ARG C 2  721  ? 513.497 16.953  659.147 1.00 126.24 ? 721  ARG C CA    1 
ATOM   9183  C  C     . ARG C 2  721  ? 512.772 16.901  660.487 1.00 127.30 ? 721  ARG C C     1 
ATOM   9184  O  O     . ARG C 2  721  ? 511.873 17.705  660.759 1.00 126.57 ? 721  ARG C O     1 
ATOM   9185  C  CB    . ARG C 2  721  ? 514.537 18.033  659.093 1.00 138.04 ? 721  ARG C CB    1 
ATOM   9186  C  CG    . ARG C 2  721  ? 515.461 17.836  657.923 1.00 152.62 ? 721  ARG C CG    1 
ATOM   9187  C  CD    . ARG C 2  721  ? 516.567 18.852  657.975 1.00 168.24 ? 721  ARG C CD    1 
ATOM   9188  N  NE    . ARG C 2  721  ? 516.170 19.990  657.153 1.00 178.08 ? 721  ARG C NE    1 
ATOM   9189  C  CZ    . ARG C 2  721  ? 515.515 21.052  657.619 1.00 184.49 ? 721  ARG C CZ    1 
ATOM   9190  N  NH1   . ARG C 2  721  ? 515.182 21.131  658.910 1.00 183.14 ? 721  ARG C NH1   1 
ATOM   9191  N  NH2   . ARG C 2  721  ? 515.188 22.036  656.791 1.00 187.95 ? 721  ARG C NH2   1 
ATOM   9192  N  N     . ILE C 2  722  ? 513.183 15.962  661.331 1.00 124.11 ? 722  ILE C N     1 
ATOM   9193  C  CA    . ILE C 2  722  ? 512.663 15.860  662.686 1.00 123.67 ? 722  ILE C CA    1 
ATOM   9194  C  C     . ILE C 2  722  ? 513.592 16.662  663.571 1.00 125.74 ? 722  ILE C C     1 
ATOM   9195  O  O     . ILE C 2  722  ? 514.719 16.252  663.854 1.00 131.98 ? 722  ILE C O     1 
ATOM   9196  C  CB    . ILE C 2  722  ? 512.573 14.413  663.161 1.00 112.61 ? 722  ILE C CB    1 
ATOM   9197  C  CG1   . ILE C 2  722  ? 511.370 13.742  662.532 1.00 108.90 ? 722  ILE C CG1   1 
ATOM   9198  C  CG2   . ILE C 2  722  ? 512.482 14.368  664.659 1.00 112.34 ? 722  ILE C CG2   1 
ATOM   9199  C  CD1   . ILE C 2  722  ? 511.485 12.263  662.522 1.00 115.56 ? 722  ILE C CD1   1 
ATOM   9200  N  N     . THR C 2  723  ? 513.089 17.777  664.067 1.00 126.86 ? 723  THR C N     1 
ATOM   9201  C  CA    . THR C 2  723  ? 513.957 18.765  664.665 1.00 133.86 ? 723  THR C CA    1 
ATOM   9202  C  C     . THR C 2  723  ? 513.224 19.421  665.821 1.00 138.79 ? 723  THR C C     1 
ATOM   9203  O  O     . THR C 2  723  ? 512.001 19.318  665.964 1.00 133.95 ? 723  THR C O     1 
ATOM   9204  C  CB    . THR C 2  723  ? 514.403 19.808  663.646 1.00 137.80 ? 723  THR C CB    1 
ATOM   9205  O  OG1   . THR C 2  723  ? 515.029 20.902  664.327 1.00 143.41 ? 723  THR C OG1   1 
ATOM   9206  C  CG2   . THR C 2  723  ? 513.185 20.310  662.887 1.00 133.85 ? 723  THR C CG2   1 
ATOM   9207  N  N     . ARG C 2  724  ? 514.011 19.978  666.717 1.00 146.71 ? 724  ARG C N     1 
ATOM   9208  C  CA    . ARG C 2  724  ? 513.452 20.735  667.812 1.00 143.55 ? 724  ARG C CA    1 
ATOM   9209  C  C     . ARG C 2  724  ? 513.138 22.170  667.380 1.00 143.00 ? 724  ARG C C     1 
ATOM   9210  O  O     . ARG C 2  724  ? 512.522 22.909  668.149 1.00 142.34 ? 724  ARG C O     1 
ATOM   9211  C  CB    . ARG C 2  724  ? 514.424 20.631  668.986 1.00 149.34 ? 724  ARG C CB    1 
ATOM   9212  C  CG    . ARG C 2  724  ? 513.847 20.978  670.326 1.00 152.65 ? 724  ARG C CG    1 
ATOM   9213  C  CD    . ARG C 2  724  ? 514.909 21.129  671.394 1.00 157.98 ? 724  ARG C CD    1 
ATOM   9214  N  NE    . ARG C 2  724  ? 514.264 21.134  672.704 1.00 159.11 ? 724  ARG C NE    1 
ATOM   9215  C  CZ    . ARG C 2  724  ? 513.665 22.178  673.258 1.00 164.81 ? 724  ARG C CZ    1 
ATOM   9216  N  NH1   . ARG C 2  724  ? 513.622 23.332  672.612 1.00 169.63 ? 724  ARG C NH1   1 
ATOM   9217  N  NH2   . ARG C 2  724  ? 513.098 22.060  674.455 1.00 164.93 ? 724  ARG C NH2   1 
ATOM   9218  N  N     . ASP C 2  725  ? 513.590 22.590  666.188 1.00 145.08 ? 725  ASP C N     1 
ATOM   9219  C  CA    . ASP C 2  725  ? 513.403 23.948  665.656 1.00 149.73 ? 725  ASP C CA    1 
ATOM   9220  C  C     . ASP C 2  725  ? 512.146 24.022  664.785 1.00 148.64 ? 725  ASP C C     1 
ATOM   9221  O  O     . ASP C 2  725  ? 512.143 23.573  663.641 1.00 151.54 ? 725  ASP C O     1 
ATOM   9222  C  CB    . ASP C 2  725  ? 514.632 24.358  664.850 1.00 159.29 ? 725  ASP C CB    1 
ATOM   9223  C  CG    . ASP C 2  725  ? 514.692 25.852  664.573 1.00 167.57 ? 725  ASP C CG    1 
ATOM   9224  O  OD1   . ASP C 2  725  ? 513.615 26.478  664.418 1.00 166.37 ? 725  ASP C OD1   1 
ATOM   9225  O  OD2   . ASP C 2  725  ? 515.824 26.395  664.497 1.00 174.03 ? 725  ASP C OD2   1 
ATOM   9226  N  N     . ILE C 2  726  ? 511.084 24.608  665.324 1.00 147.82 ? 726  ILE C N     1 
ATOM   9227  C  CA    . ILE C 2  726  ? 509.784 24.761  664.680 1.00 147.94 ? 726  ILE C CA    1 
ATOM   9228  C  C     . ILE C 2  726  ? 509.405 26.236  664.606 1.00 155.94 ? 726  ILE C C     1 
ATOM   9229  O  O     . ILE C 2  726  ? 509.242 26.877  665.649 1.00 159.47 ? 726  ILE C O     1 
ATOM   9230  C  CB    . ILE C 2  726  ? 508.707 23.955  665.424 1.00 145.54 ? 726  ILE C CB    1 
ATOM   9231  C  CG1   . ILE C 2  726  ? 509.121 22.482  665.554 1.00 143.82 ? 726  ILE C CG1   1 
ATOM   9232  C  CG2   . ILE C 2  726  ? 507.348 24.245  664.907 1.00 143.49 ? 726  ILE C CG2   1 
ATOM   9233  C  CD1   . ILE C 2  726  ? 509.420 22.036  666.939 1.00 145.62 ? 726  ILE C CD1   1 
ATOM   9234  N  N     . PRO C 2  727  ? 509.183 26.802  663.417 1.00 159.14 ? 727  PRO C N     1 
ATOM   9235  C  CA    . PRO C 2  727  ? 508.919 28.250  663.316 1.00 169.09 ? 727  PRO C CA    1 
ATOM   9236  C  C     . PRO C 2  727  ? 507.827 28.797  664.242 1.00 175.46 ? 727  PRO C C     1 
ATOM   9237  O  O     . PRO C 2  727  ? 506.722 28.252  664.342 1.00 171.04 ? 727  PRO C O     1 
ATOM   9238  C  CB    . PRO C 2  727  ? 508.538 28.428  661.840 1.00 161.68 ? 727  PRO C CB    1 
ATOM   9239  C  CG    . PRO C 2  727  ? 508.022 27.088  661.412 1.00 154.71 ? 727  PRO C CG    1 
ATOM   9240  C  CD    . PRO C 2  727  ? 508.870 26.097  662.160 1.00 154.74 ? 727  PRO C CD    1 
ATOM   9241  N  N     . HIS C 2  728  ? 508.170 29.890  664.933 1.00 188.92 ? 728  HIS C N     1 
ATOM   9242  C  CA    . HIS C 2  728  ? 507.251 30.707  665.731 1.00 192.42 ? 728  HIS C CA    1 
ATOM   9243  C  C     . HIS C 2  728  ? 506.638 29.998  666.937 1.00 190.31 ? 728  HIS C C     1 
ATOM   9244  O  O     . HIS C 2  728  ? 505.507 30.304  667.317 1.00 194.02 ? 728  HIS C O     1 
ATOM   9245  C  CB    . HIS C 2  728  ? 506.167 31.309  664.833 1.00 196.40 ? 728  HIS C CB    1 
ATOM   9246  C  CG    . HIS C 2  728  ? 506.728 32.069  663.673 1.00 204.82 ? 728  HIS C CG    1 
ATOM   9247  N  ND1   . HIS C 2  728  ? 506.666 33.443  663.585 1.00 209.44 ? 728  HIS C ND1   1 
ATOM   9248  C  CD2   . HIS C 2  728  ? 507.415 31.654  662.581 1.00 206.38 ? 728  HIS C CD2   1 
ATOM   9249  C  CE1   . HIS C 2  728  ? 507.267 33.839  662.476 1.00 212.22 ? 728  HIS C CE1   1 
ATOM   9250  N  NE2   . HIS C 2  728  ? 507.737 32.773  661.854 1.00 210.05 ? 728  HIS C NE2   1 
ATOM   9251  N  N     . LEU C 2  729  ? 507.337 29.050  667.562 1.00 185.86 ? 729  LEU C N     1 
ATOM   9252  C  CA    . LEU C 2  729  ? 506.795 28.338  668.720 1.00 182.72 ? 729  LEU C CA    1 
ATOM   9253  C  C     . LEU C 2  729  ? 507.615 28.611  669.982 1.00 182.82 ? 729  LEU C C     1 
ATOM   9254  O  O     . LEU C 2  729  ? 508.846 28.637  669.945 1.00 183.34 ? 729  LEU C O     1 
ATOM   9255  C  CB    . LEU C 2  729  ? 506.654 26.836  668.445 1.00 179.35 ? 729  LEU C CB    1 
ATOM   9256  C  CG    . LEU C 2  729  ? 505.433 26.539  667.556 1.00 177.41 ? 729  LEU C CG    1 
ATOM   9257  C  CD1   . LEU C 2  729  ? 505.051 25.070  667.600 1.00 174.53 ? 729  LEU C CD1   1 
ATOM   9258  C  CD2   . LEU C 2  729  ? 504.229 27.381  668.015 1.00 175.46 ? 729  LEU C CD2   1 
ATOM   9259  N  N     . SER C 2  730  ? 506.907 28.810  671.094 1.00 182.28 ? 730  SER C N     1 
ATOM   9260  C  CA    . SER C 2  730  ? 507.486 29.094  672.403 1.00 182.53 ? 730  SER C CA    1 
ATOM   9261  C  C     . SER C 2  730  ? 508.180 27.886  673.036 1.00 183.30 ? 730  SER C C     1 
ATOM   9262  O  O     . SER C 2  730  ? 507.928 26.728  672.688 1.00 180.08 ? 730  SER C O     1 
ATOM   9263  C  CB    . SER C 2  730  ? 506.386 29.560  673.349 1.00 179.51 ? 730  SER C CB    1 
ATOM   9264  O  OG    . SER C 2  730  ? 505.439 28.517  673.525 1.00 171.83 ? 730  SER C OG    1 
ATOM   9265  N  N     . GLU C 2  731  ? 509.048 28.184  674.018 1.00 186.46 ? 731  GLU C N     1 
ATOM   9266  C  CA    . GLU C 2  731  ? 509.698 27.137  674.808 1.00 189.01 ? 731  GLU C CA    1 
ATOM   9267  C  C     . GLU C 2  731  ? 508.703 26.397  675.691 1.00 184.82 ? 731  GLU C C     1 
ATOM   9268  O  O     . GLU C 2  731  ? 508.902 25.214  675.996 1.00 183.64 ? 731  GLU C O     1 
ATOM   9269  C  CB    . GLU C 2  731  ? 510.814 27.722  675.677 1.00 192.41 ? 731  GLU C CB    1 
ATOM   9270  C  CG    . GLU C 2  731  ? 511.488 26.677  676.573 1.00 192.82 ? 731  GLU C CG    1 
ATOM   9271  C  CD    . GLU C 2  731  ? 512.072 25.501  675.802 1.00 190.14 ? 731  GLU C CD    1 
ATOM   9272  O  OE1   . GLU C 2  731  ? 512.484 25.696  674.639 1.00 190.36 ? 731  GLU C OE1   1 
ATOM   9273  O  OE2   . GLU C 2  731  ? 512.064 24.369  676.343 1.00 187.38 ? 731  GLU C OE2   1 
ATOM   9274  N  N     . ALA C 2  732  ? 507.608 27.058  676.069 1.00 184.98 ? 732  ALA C N     1 
ATOM   9275  C  CA    . ALA C 2  732  ? 506.553 26.363  676.789 1.00 182.02 ? 732  ALA C CA    1 
ATOM   9276  C  C     . ALA C 2  732  ? 506.068 25.194  675.951 1.00 179.57 ? 732  ALA C C     1 
ATOM   9277  O  O     . ALA C 2  732  ? 505.788 24.108  676.475 1.00 180.40 ? 732  ALA C O     1 
ATOM   9278  C  CB    . ALA C 2  732  ? 505.414 27.321  677.134 1.00 183.69 ? 732  ALA C CB    1 
ATOM   9279  N  N     . ALA C 2  733  ? 505.942 25.415  674.642 1.00 172.22 ? 733  ALA C N     1 
ATOM   9280  C  CA    . ALA C 2  733  ? 505.464 24.377  673.741 1.00 161.38 ? 733  ALA C CA    1 
ATOM   9281  C  C     . ALA C 2  733  ? 506.519 23.293  673.551 1.00 153.66 ? 733  ALA C C     1 
ATOM   9282  O  O     . ALA C 2  733  ? 506.182 22.125  673.321 1.00 149.92 ? 733  ALA C O     1 
ATOM   9283  C  CB    . ALA C 2  733  ? 505.085 24.995  672.392 1.00 160.14 ? 733  ALA C CB    1 
ATOM   9284  N  N     . LEU C 2  734  ? 507.791 23.657  673.634 1.00 146.17 ? 734  LEU C N     1 
ATOM   9285  C  CA    . LEU C 2  734  ? 508.886 22.738  673.376 1.00 143.65 ? 734  LEU C CA    1 
ATOM   9286  C  C     . LEU C 2  734  ? 509.469 22.106  674.632 1.00 144.51 ? 734  LEU C C     1 
ATOM   9287  O  O     . LEU C 2  734  ? 510.367 21.268  674.523 1.00 150.01 ? 734  LEU C O     1 
ATOM   9288  C  CB    . LEU C 2  734  ? 509.971 23.504  672.630 1.00 140.16 ? 734  LEU C CB    1 
ATOM   9289  C  CG    . LEU C 2  734  ? 509.375 24.081  671.343 1.00 134.47 ? 734  LEU C CG    1 
ATOM   9290  C  CD1   . LEU C 2  734  ? 510.357 24.948  670.633 1.00 135.86 ? 734  LEU C CD1   1 
ATOM   9291  C  CD2   . LEU C 2  734  ? 508.894 22.990  670.408 1.00 128.93 ? 734  LEU C CD2   1 
ATOM   9292  N  N     . ARG C 2  735  ? 508.946 22.455  675.808 1.00 148.13 ? 735  ARG C N     1 
ATOM   9293  C  CA    . ARG C 2  735  ? 509.567 22.114  677.090 1.00 150.97 ? 735  ARG C CA    1 
ATOM   9294  C  C     . ARG C 2  735  ? 509.930 20.638  677.188 1.00 148.25 ? 735  ARG C C     1 
ATOM   9295  O  O     . ARG C 2  735  ? 511.064 20.277  677.532 1.00 144.95 ? 735  ARG C O     1 
ATOM   9296  C  CB    . ARG C 2  735  ? 508.599 22.462  678.220 1.00 153.10 ? 735  ARG C CB    1 
ATOM   9297  C  CG    . ARG C 2  735  ? 509.064 22.131  679.628 1.00 157.43 ? 735  ARG C CG    1 
ATOM   9298  C  CD    . ARG C 2  735  ? 507.809 21.916  680.432 1.00 157.69 ? 735  ARG C CD    1 
ATOM   9299  N  NE    . ARG C 2  735  ? 506.890 23.031  680.256 1.00 158.97 ? 735  ARG C NE    1 
ATOM   9300  C  CZ    . ARG C 2  735  ? 505.599 22.989  680.565 1.00 156.14 ? 735  ARG C CZ    1 
ATOM   9301  N  NH1   . ARG C 2  735  ? 505.058 21.878  681.062 1.00 150.66 ? 735  ARG C NH1   1 
ATOM   9302  N  NH2   . ARG C 2  735  ? 504.844 24.059  680.359 1.00 158.16 ? 735  ARG C NH2   1 
ATOM   9303  N  N     . ASP C 2  736  ? 508.991 19.775  676.811 1.00 148.49 ? 736  ASP C N     1 
ATOM   9304  C  CA    . ASP C 2  736  ? 509.097 18.340  676.997 1.00 147.68 ? 736  ASP C CA    1 
ATOM   9305  C  C     . ASP C 2  736  ? 509.778 17.640  675.819 1.00 144.77 ? 736  ASP C C     1 
ATOM   9306  O  O     . ASP C 2  736  ? 509.792 16.406  675.774 1.00 141.06 ? 736  ASP C O     1 
ATOM   9307  C  CB    . ASP C 2  736  ? 507.683 17.763  677.211 1.00 146.64 ? 736  ASP C CB    1 
ATOM   9308  C  CG    . ASP C 2  736  ? 507.069 18.152  678.572 1.00 148.07 ? 736  ASP C CG    1 
ATOM   9309  O  OD1   . ASP C 2  736  ? 507.809 18.235  679.575 1.00 150.84 ? 736  ASP C OD1   1 
ATOM   9310  O  OD2   . ASP C 2  736  ? 505.832 18.362  678.639 1.00 144.60 ? 736  ASP C OD2   1 
ATOM   9311  N  N     . LEU C 2  737  ? 510.302 18.400  674.851 1.00 144.93 ? 737  LEU C N     1 
ATOM   9312  C  CA    . LEU C 2  737  ? 511.044 17.863  673.706 1.00 141.86 ? 737  LEU C CA    1 
ATOM   9313  C  C     . LEU C 2  737  ? 512.546 17.787  673.981 1.00 144.65 ? 737  LEU C C     1 
ATOM   9314  O  O     . LEU C 2  737  ? 513.141 18.750  674.472 1.00 152.58 ? 737  LEU C O     1 
ATOM   9315  C  CB    . LEU C 2  737  ? 510.827 18.709  672.461 1.00 140.11 ? 737  LEU C CB    1 
ATOM   9316  C  CG    . LEU C 2  737  ? 509.366 18.881  672.108 1.00 134.61 ? 737  LEU C CG    1 
ATOM   9317  C  CD1   . LEU C 2  737  ? 509.310 19.631  670.797 1.00 132.55 ? 737  LEU C CD1   1 
ATOM   9318  C  CD2   . LEU C 2  737  ? 508.646 17.545  672.069 1.00 128.69 ? 737  LEU C CD2   1 
ATOM   9319  N  N     . ASP C 2  738  ? 513.176 16.677  673.600 1.00 141.16 ? 738  ASP C N     1 
ATOM   9320  C  CA    . ASP C 2  738  ? 514.619 16.578  673.786 1.00 146.76 ? 738  ASP C CA    1 
ATOM   9321  C  C     . ASP C 2  738  ? 515.320 17.444  672.739 1.00 150.60 ? 738  ASP C C     1 
ATOM   9322  O  O     . ASP C 2  738  ? 514.687 18.197  671.996 1.00 148.89 ? 738  ASP C O     1 
ATOM   9323  C  CB    . ASP C 2  738  ? 515.089 15.124  673.761 1.00 139.49 ? 738  ASP C CB    1 
ATOM   9324  C  CG    . ASP C 2  738  ? 514.834 14.420  672.441 1.00 136.78 ? 738  ASP C CG    1 
ATOM   9325  O  OD1   . ASP C 2  738  ? 514.937 15.034  671.356 1.00 138.28 ? 738  ASP C OD1   1 
ATOM   9326  O  OD2   . ASP C 2  738  ? 514.546 13.208  672.495 1.00 135.53 ? 738  ASP C OD2   1 
ATOM   9327  N  N     . GLU C 2  739  ? 516.658 17.361  672.707 1.00 162.85 ? 739  GLU C N     1 
ATOM   9328  C  CA    . GLU C 2  739  ? 517.480 18.127  671.761 1.00 169.55 ? 739  GLU C CA    1 
ATOM   9329  C  C     . GLU C 2  739  ? 517.057 17.915  670.313 1.00 167.09 ? 739  GLU C C     1 
ATOM   9330  O  O     . GLU C 2  739  ? 517.124 18.837  669.491 1.00 166.70 ? 739  GLU C O     1 
ATOM   9331  C  CB    . GLU C 2  739  ? 518.952 17.742  671.939 1.00 177.83 ? 739  GLU C CB    1 
ATOM   9332  C  CG    . GLU C 2  739  ? 519.683 18.566  672.988