data_5VT2
# 
_entry.id   5VT2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5VT2         
WWPDB D_1000227964 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5VT2 
_pdbx_database_status.recvd_initial_deposition_date   2017-05-15 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Min, X.'  1 ? 
'Wang, Z.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Sci Transl Med' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1946-6242 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            9 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Long-acting MIC-1/GDF15 molecules to treat obesity: Evidence from mice to monkeys.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1126/scitranslmed.aan8732 
_citation.pdbx_database_id_PubMed   29046435 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Xiong, Y.'      1  
primary 'Walker, K.'     2  
primary 'Min, X.'        3  
primary 'Hale, C.'       4  
primary 'Tran, T.'       5  
primary 'Komorowski, R.' 6  
primary 'Yang, J.'       7  
primary 'Davda, J.'      8  
primary 'Nuanmanee, N.'  9  
primary 'Kemp, D.'       10 
primary 'Wang, X.'       11 
primary 'Liu, H.'        12 
primary 'Miller, S.'     13 
primary 'Lee, K.J.'      14 
primary 'Wang, Z.'       15 
primary 'Veniant, M.M.'  16 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5VT2 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     64.720 
_cell.length_a_esd                 ? 
_cell.length_b                     64.720 
_cell.length_b_esd                 ? 
_cell.length_c                     172.530 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5VT2 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Growth/differentiation factor 15' 12303.248 2  ? ? ? ? 
2 non-polymer syn 1,2-ETHANEDIOL                     62.068    6  ? ? ? ? 
3 water       nat water                              18.015    86 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;GDF-15, Macrophage inhibitory cytokine 1, MIC-1, NSAID-activated gene 1 protein, NAG-1, NSAID-regulated gene 1 protein, NRG-1, Placental TGF-beta, Placental bone morphogenetic protein, Prostate differentiation factor
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVP
ASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVP
ASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ARG n 
1 3   ASN n 
1 4   GLY n 
1 5   ASP n 
1 6   HIS n 
1 7   CYS n 
1 8   PRO n 
1 9   LEU n 
1 10  GLY n 
1 11  PRO n 
1 12  GLY n 
1 13  ARG n 
1 14  CYS n 
1 15  CYS n 
1 16  ARG n 
1 17  LEU n 
1 18  HIS n 
1 19  THR n 
1 20  VAL n 
1 21  ARG n 
1 22  ALA n 
1 23  SER n 
1 24  LEU n 
1 25  GLU n 
1 26  ASP n 
1 27  LEU n 
1 28  GLY n 
1 29  TRP n 
1 30  ALA n 
1 31  ASP n 
1 32  TRP n 
1 33  VAL n 
1 34  LEU n 
1 35  SER n 
1 36  PRO n 
1 37  ARG n 
1 38  GLU n 
1 39  VAL n 
1 40  GLN n 
1 41  VAL n 
1 42  THR n 
1 43  MET n 
1 44  CYS n 
1 45  ILE n 
1 46  GLY n 
1 47  ALA n 
1 48  CYS n 
1 49  PRO n 
1 50  SER n 
1 51  GLN n 
1 52  PHE n 
1 53  ARG n 
1 54  ALA n 
1 55  ALA n 
1 56  ASN n 
1 57  MET n 
1 58  HIS n 
1 59  ALA n 
1 60  GLN n 
1 61  ILE n 
1 62  LYS n 
1 63  THR n 
1 64  SER n 
1 65  LEU n 
1 66  HIS n 
1 67  ARG n 
1 68  LEU n 
1 69  LYS n 
1 70  PRO n 
1 71  ASP n 
1 72  THR n 
1 73  VAL n 
1 74  PRO n 
1 75  ALA n 
1 76  PRO n 
1 77  CYS n 
1 78  CYS n 
1 79  VAL n 
1 80  PRO n 
1 81  ALA n 
1 82  SER n 
1 83  TYR n 
1 84  ASN n 
1 85  PRO n 
1 86  MET n 
1 87  VAL n 
1 88  LEU n 
1 89  ILE n 
1 90  GLN n 
1 91  LYS n 
1 92  THR n 
1 93  ASP n 
1 94  THR n 
1 95  GLY n 
1 96  VAL n 
1 97  SER n 
1 98  LEU n 
1 99  GLN n 
1 100 THR n 
1 101 TYR n 
1 102 ASP n 
1 103 ASP n 
1 104 LEU n 
1 105 LEU n 
1 106 ALA n 
1 107 LYS n 
1 108 ASP n 
1 109 CYS n 
1 110 HIS n 
1 111 CYS n 
1 112 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   112 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'GDF15, MIC1, PDF, PLAB, PTGFB' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GDF15_HUMAN 
_struct_ref.pdbx_db_accession          Q99988 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;ARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVP
ASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
;
_struct_ref.pdbx_align_begin           197 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5VT2 A 1 ? 112 ? Q99988 197 ? 308 ? 1 112 
2 1 5VT2 B 1 ? 112 ? Q99988 197 ? 308 ? 1 112 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL  'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE       ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5VT2 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.24 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         70.98 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '15% w/v Tascimate, pH 7.0, 0.1 M HEPES, pH 7.0, 2% PEG3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 225 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2009-09-27 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'double crystal Si(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9793 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'CLSI BEAMLINE 08ID-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9793 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   08ID-1 
_diffrn_source.pdbx_synchrotron_site       CLSI 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5VT2 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.282 
_reflns.d_resolution_low                 40.139 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       19823 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.800 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.000 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.080 
_reflns.pdbx_netI_over_av_sigmaI         6.400 
_reflns.pdbx_netI_over_sigmaI            11.300 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.090 
_reflns.pdbx_Rpim_I_all                  0.040 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.3   2.410 ? 1.100  ? ? ? ? ? 99.000  ? ? ? ? 0.704 ? ? ? ? ? ? ? ? 4.500 0.704 ? ? ? 0.797 0.366 ? 1  1 ? ? 
2.410 2.550 ? 1.600  ? ? ? ? ? 100.000 ? ? ? ? 0.459 ? ? ? ? ? ? ? ? 5.100 0.459 ? ? ? 0.512 0.223 ? 2  1 ? ? 
2.550 2.730 ? 2.500  ? ? ? ? ? 100.000 ? ? ? ? 0.298 ? ? ? ? ? ? ? ? 5.200 0.298 ? ? ? 0.332 0.144 ? 3  1 ? ? 
2.730 2.950 ? 4.300  ? ? ? ? ? 100.000 ? ? ? ? 0.179 ? ? ? ? ? ? ? ? 5.100 0.179 ? ? ? 0.199 0.087 ? 4  1 ? ? 
2.950 3.230 ? 6.900  ? ? ? ? ? 100.000 ? ? ? ? 0.106 ? ? ? ? ? ? ? ? 5.200 0.106 ? ? ? 0.118 0.051 ? 5  1 ? ? 
3.230 3.610 ? 10.200 ? ? ? ? ? 100.000 ? ? ? ? 0.068 ? ? ? ? ? ? ? ? 5.100 0.068 ? ? ? 0.076 0.033 ? 6  1 ? ? 
3.610 4.170 ? 11.400 ? ? ? ? ? 100.000 ? ? ? ? 0.057 ? ? ? ? ? ? ? ? 5.100 0.057 ? ? ? 0.064 0.028 ? 7  1 ? ? 
4.170 5.100 ? 9.400  ? ? ? ? ? 100.000 ? ? ? ? 0.063 ? ? ? ? ? ? ? ? 5.000 0.063 ? ? ? 0.071 0.031 ? 8  1 ? ? 
5.100 7.220 ? 10.400 ? ? ? ? ? 100.000 ? ? ? ? 0.058 ? ? ? ? ? ? ? ? 4.900 0.058 ? ? ? 0.065 0.029 ? 9  1 ? ? 
7.220 10    ? 13.800 ? ? ? ? ? 98.500  ? ? ? ? 0.041 ? ? ? ? ? ? ? ? 4.400 0.041 ? ? ? 0.047 0.023 ? 10 1 ? ? 
# 
_refine.aniso_B[1][1]                            0.3300 
_refine.aniso_B[1][2]                            0.1600 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            0.3300 
_refine.aniso_B[2][3]                            -0.0000 
_refine.aniso_B[3][3]                            -1.0700 
_refine.B_iso_max                                123.400 
_refine.B_iso_mean                               52.3220 
_refine.B_iso_min                                28.870 
_refine.correlation_coeff_Fo_to_Fc               0.9530 
_refine.correlation_coeff_Fo_to_Fc_free          0.9320 
_refine.details                                  'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5VT2 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.3 
_refine.ls_d_res_low                             30 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     18768 
_refine.ls_number_reflns_R_free                  1003 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.7200 
_refine.ls_percent_reflns_R_free                 5.1000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2083 
_refine.ls_R_factor_R_free                       0.2418 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2065 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 2R52' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.1870 
_refine.pdbx_overall_ESU_R_Free                  0.1730 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             5.9870 
_refine.overall_SU_ML                            0.1410 
_refine.overall_SU_R_Cruickshank_DPI             0.1871 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.3 
_refine_hist.d_res_low                        30 
_refine_hist.pdbx_number_atoms_ligand         24 
_refine_hist.number_atoms_solvent             86 
_refine_hist.number_atoms_total               1760 
_refine_hist.pdbx_number_residues_total       216 
_refine_hist.pdbx_B_iso_mean_ligand           72.99 
_refine_hist.pdbx_B_iso_mean_solvent          54.15 
_refine_hist.pdbx_number_atoms_protein        1650 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.011  0.019  1732 ? r_bond_refined_d       ? ? 
'X-RAY DIFFRACTION' ? 1.643  1.964  2358 ? r_angle_refined_deg    ? ? 
'X-RAY DIFFRACTION' ? 6.213  5.000  218  ? r_dihedral_angle_1_deg ? ? 
'X-RAY DIFFRACTION' ? 41.481 23.529 68   ? r_dihedral_angle_2_deg ? ? 
'X-RAY DIFFRACTION' ? 18.274 15.000 276  ? r_dihedral_angle_3_deg ? ? 
'X-RAY DIFFRACTION' ? 14.345 15.000 12   ? r_dihedral_angle_4_deg ? ? 
'X-RAY DIFFRACTION' ? 0.125  0.200  268  ? r_chiral_restr         ? ? 
'X-RAY DIFFRACTION' ? 0.006  0.021  1282 ? r_gen_planes_refined   ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.2820 
_refine_ls_shell.d_res_low                        2.3410 
_refine_ls_shell.number_reflns_all                1405 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             81 
_refine_ls_shell.number_reflns_R_work             1324 
_refine_ls_shell.percent_reflns_obs               97.5700 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.3100 
_refine_ls_shell.R_factor_R_free_error            0.0000 
_refine_ls_shell.R_factor_R_work                  0.3050 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5VT2 
_struct.title                        'Crystal structure of growth differentiation factor' 
_struct.pdbx_descriptor              'Growth/differentiation factor 15' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5VT2 
_struct_keywords.text            'TGF-beta family, SIGNALING PROTEIN' 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 ASN A 56 ? LYS A 69 ? ASN A 56 LYS A 69 1 ? 14 
HELX_P HELX_P2 AA2 LEU B 24 ? GLY B 28 ? LEU B 24 GLY B 28 1 ? 5  
HELX_P HELX_P3 AA3 ASN B 56 ? LYS B 69 ? ASN B 56 LYS B 69 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 7  SG ? ? ? 1_555 A CYS 14  SG ? ? A CYS 7  A CYS 14  1_555 ? ? ? ? ? ? ? 2.074 ? 
disulf2 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 78  SG ? ? A CYS 15 A CYS 78  1_555 ? ? ? ? ? ? ? 2.061 ? 
disulf3 disulf ? ? A CYS 44 SG ? ? ? 1_555 A CYS 109 SG ? ? A CYS 44 A CYS 109 1_555 ? ? ? ? ? ? ? 2.079 ? 
disulf4 disulf ? ? A CYS 48 SG ? ? ? 1_555 A CYS 111 SG ? ? A CYS 48 A CYS 111 1_555 ? ? ? ? ? ? ? 2.090 ? 
disulf5 disulf ? ? A CYS 77 SG ? ? ? 1_555 B CYS 77  SG ? ? A CYS 77 B CYS 77  1_555 ? ? ? ? ? ? ? 2.046 ? 
disulf6 disulf ? ? B CYS 7  SG ? ? ? 1_555 B CYS 14  SG ? ? B CYS 7  B CYS 14  1_555 ? ? ? ? ? ? ? 2.057 ? 
disulf7 disulf ? ? B CYS 15 SG ? ? ? 1_555 B CYS 78  SG ? ? B CYS 15 B CYS 78  1_555 ? ? ? ? ? ? ? 2.057 ? 
disulf8 disulf ? ? B CYS 44 SG ? ? ? 1_555 B CYS 109 SG ? ? B CYS 44 B CYS 109 1_555 ? ? ? ? ? ? ? 2.097 ? 
disulf9 disulf ? ? B CYS 48 SG ? ? ? 1_555 B CYS 111 SG ? ? B CYS 48 B CYS 111 1_555 ? ? ? ? ? ? ? 2.063 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 35 A . ? SER 35 A PRO 36 A ? PRO 36 A 1 -4.30 
2 SER 35 B . ? SER 35 B PRO 36 B ? PRO 36 B 1 -0.51 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 16 ? SER A 23  ? ARG A 16 SER A 23  
AA1 2 GLU A 38 ? ILE A 45  ? GLU A 38 ILE A 45  
AA2 1 VAL A 33 ? SER A 35  ? VAL A 33 SER A 35  
AA2 2 CYS A 78 ? LYS A 91  ? CYS A 78 LYS A 91  
AA2 3 VAL A 96 ? CYS A 111 ? VAL A 96 CYS A 111 
AA3 1 ARG B 16 ? SER B 23  ? ARG B 16 SER B 23  
AA3 2 GLU B 38 ? ILE B 45  ? GLU B 38 ILE B 45  
AA4 1 VAL B 33 ? SER B 35  ? VAL B 33 SER B 35  
AA4 2 CYS B 77 ? LYS B 91  ? CYS B 77 LYS B 91  
AA4 3 VAL B 96 ? ILE B 112 ? VAL B 96 ILE B 112 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ALA A 22 ? N ALA A 22 O VAL A 39 ? O VAL A 39 
AA2 1 2 N LEU A 34 ? N LEU A 34 O ILE A 89 ? O ILE A 89 
AA2 2 3 N LEU A 88 ? N LEU A 88 O GLN A 99 ? O GLN A 99 
AA3 1 2 N ALA B 22 ? N ALA B 22 O VAL B 39 ? O VAL B 39 
AA4 1 2 N LEU B 34 ? N LEU B 34 O ILE B 89 ? O ILE B 89 
AA4 2 3 N LEU B 88 ? N LEU B 88 O GLN B 99 ? O GLN B 99 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A EDO 201 ? 3 'binding site for residue EDO A 201' 
AC2 Software A EDO 202 ? 2 'binding site for residue EDO A 202' 
AC3 Software A EDO 203 ? 5 'binding site for residue EDO A 203' 
AC4 Software A EDO 204 ? 4 'binding site for residue EDO A 204' 
AC5 Software B EDO 201 ? 1 'binding site for residue EDO B 201' 
AC6 Software B EDO 202 ? 6 'binding site for residue EDO B 202' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3 ASN A 56  ? ASN A 56  . ? 1_555 ? 
2  AC1 3 HOH I .   ? HOH A 316 . ? 1_555 ? 
3  AC1 3 ASP B 103 ? ASP B 103 . ? 1_555 ? 
4  AC2 2 GLN A 40  ? GLN A 40  . ? 1_555 ? 
5  AC2 2 HOH I .   ? HOH A 301 . ? 1_555 ? 
6  AC3 5 ASP A 5   ? ASP A 5   . ? 1_555 ? 
7  AC3 5 HIS A 6   ? HIS A 6   . ? 1_555 ? 
8  AC3 5 CYS A 7   ? CYS A 7   . ? 1_555 ? 
9  AC3 5 PRO A 11  ? PRO A 11  . ? 1_555 ? 
10 AC3 5 GLY A 12  ? GLY A 12  . ? 1_555 ? 
11 AC4 4 TYR A 83  ? TYR A 83  . ? 1_555 ? 
12 AC4 4 ASP A 102 ? ASP A 102 . ? 1_555 ? 
13 AC4 4 ASP A 103 ? ASP A 103 . ? 1_555 ? 
14 AC4 4 ASN B 56  ? ASN B 56  . ? 1_555 ? 
15 AC5 1 TRP B 32  ? TRP B 32  . ? 1_555 ? 
16 AC6 6 ALA B 47  ? ALA B 47  . ? 1_555 ? 
17 AC6 6 CYS B 48  ? CYS B 48  . ? 1_555 ? 
18 AC6 6 ALA B 75  ? ALA B 75  . ? 1_555 ? 
19 AC6 6 PRO B 76  ? PRO B 76  . ? 1_555 ? 
20 AC6 6 HOH J .   ? HOH B 306 . ? 1_555 ? 
21 AC6 6 HOH J .   ? HOH B 325 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5VT2 
_atom_sites.fract_transf_matrix[1][1]   0.015451 
_atom_sites.fract_transf_matrix[1][2]   0.008921 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017842 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005796 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 5   ? 15.215 -12.029 -17.228 1.00 91.81  ? 5   ASP A N   1 
ATOM   2    C CA  . ASP A 1 5   ? 14.056 -12.904 -17.609 1.00 98.59  ? 5   ASP A CA  1 
ATOM   3    C C   . ASP A 1 5   ? 13.807 -13.042 -19.140 1.00 91.19  ? 5   ASP A C   1 
ATOM   4    O O   . ASP A 1 5   ? 14.478 -13.848 -19.794 1.00 88.09  ? 5   ASP A O   1 
ATOM   5    C CB  . ASP A 1 5   ? 12.783 -12.480 -16.854 1.00 104.14 ? 5   ASP A CB  1 
ATOM   6    C CG  . ASP A 1 5   ? 11.689 -13.539 -16.916 1.00 113.48 ? 5   ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 5   ? 10.668 -13.305 -17.607 1.00 112.50 ? 5   ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 5   ? 11.862 -14.612 -16.291 1.00 113.41 ? 5   ASP A OD2 1 
ATOM   9    N N   . HIS A 1 6   ? 12.849 -12.282 -19.694 1.00 84.53  ? 6   HIS A N   1 
ATOM   10   C CA  . HIS A 1 6   ? 12.528 -12.337 -21.135 1.00 79.50  ? 6   HIS A CA  1 
ATOM   11   C C   . HIS A 1 6   ? 13.551 -11.566 -21.975 1.00 68.56  ? 6   HIS A C   1 
ATOM   12   O O   . HIS A 1 6   ? 13.733 -10.357 -21.803 1.00 64.01  ? 6   HIS A O   1 
ATOM   13   C CB  . HIS A 1 6   ? 11.091 -11.849 -21.440 1.00 85.52  ? 6   HIS A CB  1 
ATOM   14   C CG  . HIS A 1 6   ? 10.785 -11.722 -22.914 1.00 94.32  ? 6   HIS A CG  1 
ATOM   15   N ND1 . HIS A 1 6   ? 10.655 -12.815 -23.751 1.00 93.14  ? 6   HIS A ND1 1 
ATOM   16   C CD2 . HIS A 1 6   ? 10.590 -10.629 -23.695 1.00 90.15  ? 6   HIS A CD2 1 
ATOM   17   C CE1 . HIS A 1 6   ? 10.397 -12.400 -24.980 1.00 92.16  ? 6   HIS A CE1 1 
ATOM   18   N NE2 . HIS A 1 6   ? 10.350 -11.079 -24.973 1.00 87.76  ? 6   HIS A NE2 1 
ATOM   19   N N   . CYS A 1 7   ? 14.204 -12.278 -22.882 1.00 61.01  ? 7   CYS A N   1 
ATOM   20   C CA  . CYS A 1 7   ? 15.196 -11.684 -23.768 1.00 58.11  ? 7   CYS A CA  1 
ATOM   21   C C   . CYS A 1 7   ? 14.522 -11.014 -24.988 1.00 54.55  ? 7   CYS A C   1 
ATOM   22   O O   . CYS A 1 7   ? 13.986 -11.720 -25.855 1.00 50.45  ? 7   CYS A O   1 
ATOM   23   C CB  . CYS A 1 7   ? 16.217 -12.741 -24.203 1.00 53.55  ? 7   CYS A CB  1 
ATOM   24   S SG  . CYS A 1 7   ? 17.422 -12.154 -25.420 1.00 53.88  ? 7   CYS A SG  1 
ATOM   25   N N   . PRO A 1 8   ? 14.566 -9.655  -25.068 1.00 55.46  ? 8   PRO A N   1 
ATOM   26   C CA  . PRO A 1 8   ? 13.988 -8.934  -26.226 1.00 53.79  ? 8   PRO A CA  1 
ATOM   27   C C   . PRO A 1 8   ? 14.650 -9.247  -27.565 1.00 54.27  ? 8   PRO A C   1 
ATOM   28   O O   . PRO A 1 8   ? 14.156 -8.809  -28.595 1.00 60.79  ? 8   PRO A O   1 
ATOM   29   C CB  . PRO A 1 8   ? 14.219 -7.454  -25.889 1.00 52.31  ? 8   PRO A CB  1 
ATOM   30   C CG  . PRO A 1 8   ? 15.352 -7.453  -24.930 1.00 54.32  ? 8   PRO A CG  1 
ATOM   31   C CD  . PRO A 1 8   ? 15.202 -8.715  -24.119 1.00 53.61  ? 8   PRO A CD  1 
ATOM   32   N N   . LEU A 1 9   ? 15.756 -9.981  -27.568 1.00 50.30  ? 9   LEU A N   1 
ATOM   33   C CA  . LEU A 1 9   ? 16.388 -10.353 -28.837 1.00 51.63  ? 9   LEU A CA  1 
ATOM   34   C C   . LEU A 1 9   ? 16.022 -11.779 -29.255 1.00 53.25  ? 9   LEU A C   1 
ATOM   35   O O   . LEU A 1 9   ? 16.581 -12.321 -30.223 1.00 49.42  ? 9   LEU A O   1 
ATOM   36   C CB  . LEU A 1 9   ? 17.917 -10.143 -28.781 1.00 51.11  ? 9   LEU A CB  1 
ATOM   37   C CG  . LEU A 1 9   ? 18.459 -8.854  -28.114 1.00 53.11  ? 9   LEU A CG  1 
ATOM   38   C CD1 . LEU A 1 9   ? 19.977 -8.903  -27.974 1.00 50.22  ? 9   LEU A CD1 1 
ATOM   39   C CD2 . LEU A 1 9   ? 18.042 -7.577  -28.842 1.00 51.53  ? 9   LEU A CD2 1 
ATOM   40   N N   . GLY A 1 10  ? 15.085 -12.380 -28.516 1.00 56.55  ? 10  GLY A N   1 
ATOM   41   C CA  . GLY A 1 10  ? 14.649 -13.750 -28.772 1.00 63.68  ? 10  GLY A CA  1 
ATOM   42   C C   . GLY A 1 10  ? 15.282 -14.746 -27.820 1.00 72.01  ? 10  GLY A C   1 
ATOM   43   O O   . GLY A 1 10  ? 16.400 -14.519 -27.348 1.00 73.74  ? 10  GLY A O   1 
ATOM   44   N N   . PRO A 1 11  ? 14.570 -15.857 -27.529 1.00 77.40  ? 11  PRO A N   1 
ATOM   45   C CA  . PRO A 1 11  ? 15.044 -16.907 -26.614 1.00 72.66  ? 11  PRO A CA  1 
ATOM   46   C C   . PRO A 1 11  ? 16.535 -17.315 -26.723 1.00 68.03  ? 11  PRO A C   1 
ATOM   47   O O   . PRO A 1 11  ? 17.034 -17.690 -27.809 1.00 58.91  ? 11  PRO A O   1 
ATOM   48   C CB  . PRO A 1 11  ? 14.100 -18.072 -26.923 1.00 75.02  ? 11  PRO A CB  1 
ATOM   49   C CG  . PRO A 1 11  ? 12.806 -17.377 -27.206 1.00 78.33  ? 11  PRO A CG  1 
ATOM   50   C CD  . PRO A 1 11  ? 13.177 -16.121 -27.960 1.00 78.41  ? 11  PRO A CD  1 
ATOM   51   N N   . GLY A 1 12  ? 17.221 -17.188 -25.579 1.00 60.36  ? 12  GLY A N   1 
ATOM   52   C CA  . GLY A 1 12  ? 18.605 -17.629 -25.413 1.00 58.15  ? 12  GLY A CA  1 
ATOM   53   C C   . GLY A 1 12  ? 19.679 -16.713 -25.973 1.00 55.34  ? 12  GLY A C   1 
ATOM   54   O O   . GLY A 1 12  ? 20.855 -17.056 -25.955 1.00 57.83  ? 12  GLY A O   1 
ATOM   55   N N   . ARG A 1 13  ? 19.282 -15.541 -26.451 1.00 54.42  ? 13  ARG A N   1 
ATOM   56   C CA  . ARG A 1 13  ? 20.192 -14.699 -27.215 1.00 54.22  ? 13  ARG A CA  1 
ATOM   57   C C   . ARG A 1 13  ? 20.837 -13.596 -26.351 1.00 52.98  ? 13  ARG A C   1 
ATOM   58   O O   . ARG A 1 13  ? 21.848 -13.001 -26.747 1.00 56.19  ? 13  ARG A O   1 
ATOM   59   C CB  . ARG A 1 13  ? 19.516 -14.234 -28.529 1.00 56.62  ? 13  ARG A CB  1 
ATOM   60   C CG  . ARG A 1 13  ? 19.206 -15.443 -29.439 1.00 59.16  ? 13  ARG A CG  1 
ATOM   61   C CD  . ARG A 1 13  ? 18.264 -15.204 -30.619 1.00 62.26  ? 13  ARG A CD  1 
ATOM   62   N NE  . ARG A 1 13  ? 18.809 -14.235 -31.578 1.00 61.30  ? 13  ARG A NE  1 
ATOM   63   C CZ  . ARG A 1 13  ? 19.684 -14.504 -32.553 1.00 59.71  ? 13  ARG A CZ  1 
ATOM   64   N NH1 . ARG A 1 13  ? 20.144 -15.736 -32.752 1.00 58.93  ? 13  ARG A NH1 1 
ATOM   65   N NH2 . ARG A 1 13  ? 20.111 -13.521 -33.340 1.00 56.65  ? 13  ARG A NH2 1 
ATOM   66   N N   . CYS A 1 14  ? 20.291 -13.396 -25.147 1.00 45.15  ? 14  CYS A N   1 
ATOM   67   C CA  . CYS A 1 14  ? 20.812 -12.455 -24.167 1.00 45.98  ? 14  CYS A CA  1 
ATOM   68   C C   . CYS A 1 14  ? 21.786 -13.094 -23.166 1.00 46.89  ? 14  CYS A C   1 
ATOM   69   O O   . CYS A 1 14  ? 22.002 -14.305 -23.170 1.00 41.93  ? 14  CYS A O   1 
ATOM   70   C CB  . CYS A 1 14  ? 19.667 -11.825 -23.394 1.00 45.71  ? 14  CYS A CB  1 
ATOM   71   S SG  . CYS A 1 14  ? 18.581 -10.779 -24.386 1.00 54.70  ? 14  CYS A SG  1 
ATOM   72   N N   . CYS A 1 15  ? 22.366 -12.245 -22.322 1.00 46.66  ? 15  CYS A N   1 
ATOM   73   C CA  . CYS A 1 15  ? 23.222 -12.639 -21.203 1.00 46.39  ? 15  CYS A CA  1 
ATOM   74   C C   . CYS A 1 15  ? 22.659 -13.846 -20.416 1.00 45.66  ? 15  CYS A C   1 
ATOM   75   O O   . CYS A 1 15  ? 21.614 -13.751 -19.782 1.00 45.16  ? 15  CYS A O   1 
ATOM   76   C CB  . CYS A 1 15  ? 23.389 -11.422 -20.294 1.00 44.56  ? 15  CYS A CB  1 
ATOM   77   S SG  . CYS A 1 15  ? 24.308 -11.697 -18.762 1.00 46.80  ? 15  CYS A SG  1 
ATOM   78   N N   . ARG A 1 16  ? 23.362 -14.976 -20.484 1.00 46.57  ? 16  ARG A N   1 
ATOM   79   C CA  . ARG A 1 16  ? 22.988 -16.216 -19.755 1.00 46.79  ? 16  ARG A CA  1 
ATOM   80   C C   . ARG A 1 16  ? 24.229 -17.116 -19.506 1.00 45.31  ? 16  ARG A C   1 
ATOM   81   O O   . ARG A 1 16  ? 25.341 -16.792 -19.941 1.00 42.92  ? 16  ARG A O   1 
ATOM   82   C CB  . ARG A 1 16  ? 21.901 -16.993 -20.508 1.00 44.95  ? 16  ARG A CB  1 
ATOM   83   C CG  . ARG A 1 16  ? 22.247 -17.248 -21.960 1.00 52.72  ? 16  ARG A CG  1 
ATOM   84   C CD  . ARG A 1 16  ? 21.125 -17.944 -22.705 1.00 60.06  ? 16  ARG A CD  1 
ATOM   85   N NE  . ARG A 1 16  ? 21.386 -19.377 -22.784 1.00 69.77  ? 16  ARG A NE  1 
ATOM   86   C CZ  . ARG A 1 16  ? 22.085 -19.975 -23.745 1.00 71.08  ? 16  ARG A CZ  1 
ATOM   87   N NH1 . ARG A 1 16  ? 22.274 -21.280 -23.689 1.00 76.69  ? 16  ARG A NH1 1 
ATOM   88   N NH2 . ARG A 1 16  ? 22.597 -19.282 -24.757 1.00 76.30  ? 16  ARG A NH2 1 
ATOM   89   N N   . LEU A 1 17  ? 24.030 -18.225 -18.796 1.00 46.90  ? 17  LEU A N   1 
ATOM   90   C CA  . LEU A 1 17  ? 25.112 -19.151 -18.464 1.00 46.69  ? 17  LEU A CA  1 
ATOM   91   C C   . LEU A 1 17  ? 25.386 -20.077 -19.643 1.00 46.52  ? 17  LEU A C   1 
ATOM   92   O O   . LEU A 1 17  ? 24.471 -20.720 -20.148 1.00 50.46  ? 17  LEU A O   1 
ATOM   93   C CB  . LEU A 1 17  ? 24.767 -19.952 -17.193 1.00 46.79  ? 17  LEU A CB  1 
ATOM   94   C CG  . LEU A 1 17  ? 25.946 -20.496 -16.364 1.00 49.41  ? 17  LEU A CG  1 
ATOM   95   C CD1 . LEU A 1 17  ? 26.533 -19.413 -15.475 1.00 46.61  ? 17  LEU A CD1 1 
ATOM   96   C CD2 . LEU A 1 17  ? 25.561 -21.700 -15.508 1.00 46.31  ? 17  LEU A CD2 1 
ATOM   97   N N   . HIS A 1 18  ? 26.632 -20.092 -20.110 1.00 48.23  ? 18  HIS A N   1 
ATOM   98   C CA  . HIS A 1 18  ? 27.101 -21.046 -21.127 1.00 50.86  ? 18  HIS A CA  1 
ATOM   99   C C   . HIS A 1 18  ? 28.080 -21.999 -20.475 1.00 50.58  ? 18  HIS A C   1 
ATOM   100  O O   . HIS A 1 18  ? 28.711 -21.646 -19.480 1.00 51.08  ? 18  HIS A O   1 
ATOM   101  C CB  . HIS A 1 18  ? 27.833 -20.335 -22.266 1.00 53.68  ? 18  HIS A CB  1 
ATOM   102  C CG  . HIS A 1 18  ? 26.934 -19.565 -23.174 1.00 64.62  ? 18  HIS A CG  1 
ATOM   103  N ND1 . HIS A 1 18  ? 26.098 -18.564 -22.722 1.00 67.61  ? 18  HIS A ND1 1 
ATOM   104  C CD2 . HIS A 1 18  ? 26.746 -19.637 -24.512 1.00 68.30  ? 18  HIS A CD2 1 
ATOM   105  C CE1 . HIS A 1 18  ? 25.429 -18.060 -23.741 1.00 67.13  ? 18  HIS A CE1 1 
ATOM   106  N NE2 . HIS A 1 18  ? 25.801 -18.694 -24.838 1.00 72.99  ? 18  HIS A NE2 1 
ATOM   107  N N   . THR A 1 19  ? 28.221 -23.188 -21.057 1.00 51.26  ? 19  THR A N   1 
ATOM   108  C CA  . THR A 1 19  ? 29.186 -24.180 -20.611 1.00 48.34  ? 19  THR A CA  1 
ATOM   109  C C   . THR A 1 19  ? 30.213 -24.408 -21.706 1.00 49.37  ? 19  THR A C   1 
ATOM   110  O O   . THR A 1 19  ? 29.862 -24.733 -22.837 1.00 53.50  ? 19  THR A O   1 
ATOM   111  C CB  . THR A 1 19  ? 28.479 -25.482 -20.191 1.00 46.23  ? 19  THR A CB  1 
ATOM   112  O OG1 . THR A 1 19  ? 27.625 -25.186 -19.088 1.00 50.11  ? 19  THR A OG1 1 
ATOM   113  C CG2 . THR A 1 19  ? 29.484 -26.564 -19.751 1.00 48.52  ? 19  THR A CG2 1 
ATOM   114  N N   . VAL A 1 20  ? 31.484 -24.219 -21.366 1.00 47.05  ? 20  VAL A N   1 
ATOM   115  C CA  . VAL A 1 20  ? 32.556 -24.518 -22.285 1.00 48.72  ? 20  VAL A CA  1 
ATOM   116  C C   . VAL A 1 20  ? 33.471 -25.590 -21.649 1.00 57.30  ? 20  VAL A C   1 
ATOM   117  O O   . VAL A 1 20  ? 34.181 -25.312 -20.671 1.00 50.19  ? 20  VAL A O   1 
ATOM   118  C CB  . VAL A 1 20  ? 33.341 -23.240 -22.657 1.00 51.33  ? 20  VAL A CB  1 
ATOM   119  C CG1 . VAL A 1 20  ? 34.372 -23.530 -23.743 1.00 49.88  ? 20  VAL A CG1 1 
ATOM   120  C CG2 . VAL A 1 20  ? 32.389 -22.123 -23.113 1.00 49.30  ? 20  VAL A CG2 1 
ATOM   121  N N   . ARG A 1 21  ? 33.420 -26.816 -22.189 1.00 60.02  ? 21  ARG A N   1 
ATOM   122  C CA  . ARG A 1 21  ? 34.395 -27.873 -21.871 1.00 58.33  ? 21  ARG A CA  1 
ATOM   123  C C   . ARG A 1 21  ? 35.806 -27.360 -22.161 1.00 55.38  ? 21  ARG A C   1 
ATOM   124  O O   . ARG A 1 21  ? 36.050 -26.806 -23.232 1.00 55.74  ? 21  ARG A O   1 
ATOM   125  C CB  . ARG A 1 21  ? 34.081 -29.152 -22.671 1.00 67.74  ? 21  ARG A CB  1 
ATOM   126  C CG  . ARG A 1 21  ? 35.173 -30.225 -22.710 1.00 75.02  ? 21  ARG A CG  1 
ATOM   127  C CD  . ARG A 1 21  ? 34.691 -31.514 -23.372 1.00 81.98  ? 21  ARG A CD  1 
ATOM   128  N NE  . ARG A 1 21  ? 33.886 -32.309 -22.439 1.00 91.80  ? 21  ARG A NE  1 
ATOM   129  C CZ  . ARG A 1 21  ? 32.580 -32.569 -22.551 1.00 95.23  ? 21  ARG A CZ  1 
ATOM   130  N NH1 . ARG A 1 21  ? 31.873 -32.124 -23.583 1.00 98.20  ? 21  ARG A NH1 1 
ATOM   131  N NH2 . ARG A 1 21  ? 31.975 -33.297 -21.618 1.00 94.02  ? 21  ARG A NH2 1 
ATOM   132  N N   . ALA A 1 22  ? 36.711 -27.502 -21.187 1.00 52.38  ? 22  ALA A N   1 
ATOM   133  C CA  . ALA A 1 22  ? 38.118 -27.096 -21.336 1.00 51.20  ? 22  ALA A CA  1 
ATOM   134  C C   . ALA A 1 22  ? 39.065 -28.046 -20.610 1.00 53.41  ? 22  ALA A C   1 
ATOM   135  O O   . ALA A 1 22  ? 38.749 -28.531 -19.527 1.00 55.14  ? 22  ALA A O   1 
ATOM   136  C CB  . ALA A 1 22  ? 38.323 -25.685 -20.828 1.00 47.64  ? 22  ALA A CB  1 
ATOM   137  N N   . SER A 1 23  ? 40.224 -28.286 -21.214 1.00 51.70  ? 23  SER A N   1 
ATOM   138  C CA  . SER A 1 23  ? 41.260 -29.167 -20.679 1.00 51.59  ? 23  SER A CA  1 
ATOM   139  C C   . SER A 1 23  ? 42.220 -28.323 -19.842 1.00 51.38  ? 23  SER A C   1 
ATOM   140  O O   . SER A 1 23  ? 42.198 -27.093 -19.909 1.00 53.08  ? 23  SER A O   1 
ATOM   141  C CB  . SER A 1 23  ? 42.020 -29.844 -21.843 1.00 50.12  ? 23  SER A CB  1 
ATOM   142  O OG  . SER A 1 23  ? 43.026 -28.972 -22.386 1.00 49.26  ? 23  SER A OG  1 
ATOM   143  N N   . LEU A 1 24  ? 43.082 -28.981 -19.077 1.00 49.93  ? 24  LEU A N   1 
ATOM   144  C CA  . LEU A 1 24  ? 44.105 -28.293 -18.281 1.00 48.68  ? 24  LEU A CA  1 
ATOM   145  C C   . LEU A 1 24  ? 45.081 -27.519 -19.154 1.00 49.77  ? 24  LEU A C   1 
ATOM   146  O O   . LEU A 1 24  ? 45.533 -26.425 -18.790 1.00 51.04  ? 24  LEU A O   1 
ATOM   147  C CB  . LEU A 1 24  ? 44.873 -29.312 -17.432 1.00 46.53  ? 24  LEU A CB  1 
ATOM   148  C CG  . LEU A 1 24  ? 44.506 -29.614 -15.977 1.00 53.38  ? 24  LEU A CG  1 
ATOM   149  C CD1 . LEU A 1 24  ? 43.037 -29.372 -15.629 1.00 54.11  ? 24  LEU A CD1 1 
ATOM   150  C CD2 . LEU A 1 24  ? 44.959 -31.020 -15.588 1.00 51.32  ? 24  LEU A CD2 1 
ATOM   151  N N   . GLU A 1 25  ? 45.416 -28.120 -20.292 1.00 50.37  ? 25  GLU A N   1 
ATOM   152  C CA  . GLU A 1 25  ? 46.223 -27.489 -21.324 1.00 55.15  ? 25  GLU A CA  1 
ATOM   153  C C   . GLU A 1 25  ? 45.554 -26.204 -21.806 1.00 48.32  ? 25  GLU A C   1 
ATOM   154  O O   . GLU A 1 25  ? 46.166 -25.151 -21.727 1.00 49.37  ? 25  GLU A O   1 
ATOM   155  C CB  . GLU A 1 25  ? 46.482 -28.461 -22.493 1.00 66.69  ? 25  GLU A CB  1 
ATOM   156  C CG  . GLU A 1 25  ? 47.603 -28.036 -23.452 1.00 80.85  ? 25  GLU A CG  1 
ATOM   157  C CD  . GLU A 1 25  ? 48.997 -27.937 -22.812 1.00 95.47  ? 25  GLU A CD  1 
ATOM   158  O OE1 . GLU A 1 25  ? 49.286 -28.649 -21.816 1.00 103.86 ? 25  GLU A OE1 1 
ATOM   159  O OE2 . GLU A 1 25  ? 49.826 -27.141 -23.320 1.00 99.18  ? 25  GLU A OE2 1 
ATOM   160  N N   . ASP A 1 26  ? 44.301 -26.295 -22.258 1.00 45.83  ? 26  ASP A N   1 
ATOM   161  C CA  . ASP A 1 26  ? 43.491 -25.115 -22.620 1.00 50.80  ? 26  ASP A CA  1 
ATOM   162  C C   . ASP A 1 26  ? 43.624 -24.012 -21.575 1.00 53.96  ? 26  ASP A C   1 
ATOM   163  O O   . ASP A 1 26  ? 43.861 -22.851 -21.908 1.00 50.45  ? 26  ASP A O   1 
ATOM   164  C CB  . ASP A 1 26  ? 42.000 -25.476 -22.763 1.00 53.71  ? 26  ASP A CB  1 
ATOM   165  C CG  . ASP A 1 26  ? 41.718 -26.440 -23.914 1.00 55.86  ? 26  ASP A CG  1 
ATOM   166  O OD1 . ASP A 1 26  ? 42.577 -26.556 -24.812 1.00 58.27  ? 26  ASP A OD1 1 
ATOM   167  O OD2 . ASP A 1 26  ? 40.626 -27.067 -23.929 1.00 55.73  ? 26  ASP A OD2 1 
ATOM   168  N N   . LEU A 1 27  ? 43.527 -24.396 -20.305 1.00 51.50  ? 27  LEU A N   1 
ATOM   169  C CA  . LEU A 1 27  ? 43.518 -23.425 -19.223 1.00 49.21  ? 27  LEU A CA  1 
ATOM   170  C C   . LEU A 1 27  ? 44.895 -22.956 -18.802 1.00 48.33  ? 27  LEU A C   1 
ATOM   171  O O   . LEU A 1 27  ? 44.992 -22.056 -17.966 1.00 48.77  ? 27  LEU A O   1 
ATOM   172  C CB  . LEU A 1 27  ? 42.795 -24.031 -18.023 1.00 50.96  ? 27  LEU A CB  1 
ATOM   173  C CG  . LEU A 1 27  ? 41.286 -23.915 -17.787 1.00 52.41  ? 27  LEU A CG  1 
ATOM   174  C CD1 . LEU A 1 27  ? 40.480 -23.324 -18.929 1.00 55.65  ? 27  LEU A CD1 1 
ATOM   175  C CD2 . LEU A 1 27  ? 40.720 -25.254 -17.352 1.00 50.00  ? 27  LEU A CD2 1 
ATOM   176  N N   . GLY A 1 28  ? 45.957 -23.574 -19.340 1.00 44.97  ? 28  GLY A N   1 
ATOM   177  C CA  . GLY A 1 28  ? 47.339 -23.239 -18.930 1.00 42.59  ? 28  GLY A CA  1 
ATOM   178  C C   . GLY A 1 28  ? 47.688 -23.725 -17.518 1.00 42.11  ? 28  GLY A C   1 
ATOM   179  O O   . GLY A 1 28  ? 48.557 -23.153 -16.846 1.00 42.35  ? 28  GLY A O   1 
ATOM   180  N N   . TRP A 1 29  ? 46.989 -24.774 -17.081 1.00 40.98  ? 29  TRP A N   1 
ATOM   181  C CA  . TRP A 1 29  ? 47.091 -25.331 -15.721 1.00 45.66  ? 29  TRP A CA  1 
ATOM   182  C C   . TRP A 1 29  ? 47.824 -26.679 -15.599 1.00 48.62  ? 29  TRP A C   1 
ATOM   183  O O   . TRP A 1 29  ? 47.792 -27.294 -14.518 1.00 47.96  ? 29  TRP A O   1 
ATOM   184  C CB  . TRP A 1 29  ? 45.688 -25.548 -15.125 1.00 42.13  ? 29  TRP A CB  1 
ATOM   185  C CG  . TRP A 1 29  ? 44.912 -24.313 -14.791 1.00 44.46  ? 29  TRP A CG  1 
ATOM   186  C CD1 . TRP A 1 29  ? 45.328 -22.997 -14.872 1.00 40.85  ? 29  TRP A CD1 1 
ATOM   187  C CD2 . TRP A 1 29  ? 43.575 -24.280 -14.293 1.00 44.10  ? 29  TRP A CD2 1 
ATOM   188  N NE1 . TRP A 1 29  ? 44.312 -22.161 -14.476 1.00 45.36  ? 29  TRP A NE1 1 
ATOM   189  C CE2 . TRP A 1 29  ? 43.226 -22.918 -14.118 1.00 44.61  ? 29  TRP A CE2 1 
ATOM   190  C CE3 . TRP A 1 29  ? 42.633 -25.276 -13.964 1.00 44.22  ? 29  TRP A CE3 1 
ATOM   191  C CZ2 . TRP A 1 29  ? 41.974 -22.525 -13.631 1.00 44.79  ? 29  TRP A CZ2 1 
ATOM   192  C CZ3 . TRP A 1 29  ? 41.386 -24.888 -13.500 1.00 44.24  ? 29  TRP A CZ3 1 
ATOM   193  C CH2 . TRP A 1 29  ? 41.068 -23.519 -13.332 1.00 44.51  ? 29  TRP A CH2 1 
ATOM   194  N N   . ALA A 1 30  ? 48.464 -27.131 -16.680 1.00 48.35  ? 30  ALA A N   1 
ATOM   195  C CA  . ALA A 1 30  ? 49.060 -28.474 -16.756 1.00 52.62  ? 30  ALA A CA  1 
ATOM   196  C C   . ALA A 1 30  ? 50.155 -28.695 -15.708 1.00 53.17  ? 30  ALA A C   1 
ATOM   197  O O   . ALA A 1 30  ? 50.322 -29.810 -15.241 1.00 55.62  ? 30  ALA A O   1 
ATOM   198  C CB  . ALA A 1 30  ? 49.593 -28.742 -18.161 1.00 53.41  ? 30  ALA A CB  1 
ATOM   199  N N   . ASP A 1 31  ? 50.853 -27.616 -15.329 1.00 57.56  ? 31  ASP A N   1 
ATOM   200  C CA  . ASP A 1 31  ? 51.969 -27.634 -14.370 1.00 59.27  ? 31  ASP A CA  1 
ATOM   201  C C   . ASP A 1 31  ? 51.570 -27.844 -12.922 1.00 61.53  ? 31  ASP A C   1 
ATOM   202  O O   . ASP A 1 31  ? 52.287 -28.535 -12.190 1.00 64.30  ? 31  ASP A O   1 
ATOM   203  C CB  . ASP A 1 31  ? 52.757 -26.322 -14.423 1.00 67.70  ? 31  ASP A CB  1 
ATOM   204  C CG  . ASP A 1 31  ? 53.517 -26.132 -15.725 1.00 79.86  ? 31  ASP A CG  1 
ATOM   205  O OD1 . ASP A 1 31  ? 53.689 -27.103 -16.502 1.00 81.04  ? 31  ASP A OD1 1 
ATOM   206  O OD2 . ASP A 1 31  ? 53.951 -24.986 -15.970 1.00 91.12  ? 31  ASP A OD2 1 
ATOM   207  N N   . TRP A 1 32  ? 50.460 -27.231 -12.502 1.00 54.58  ? 32  TRP A N   1 
ATOM   208  C CA  . TRP A 1 32  ? 50.095 -27.208 -11.082 1.00 49.58  ? 32  TRP A CA  1 
ATOM   209  C C   . TRP A 1 32  ? 48.795 -27.917 -10.712 1.00 43.90  ? 32  TRP A C   1 
ATOM   210  O O   . TRP A 1 32  ? 48.654 -28.355 -9.581  1.00 44.96  ? 32  TRP A O   1 
ATOM   211  C CB  . TRP A 1 32  ? 50.143 -25.779 -10.513 1.00 56.52  ? 32  TRP A CB  1 
ATOM   212  C CG  . TRP A 1 32  ? 49.205 -24.805 -11.184 1.00 63.33  ? 32  TRP A CG  1 
ATOM   213  C CD1 . TRP A 1 32  ? 49.347 -24.253 -12.436 1.00 65.53  ? 32  TRP A CD1 1 
ATOM   214  C CD2 . TRP A 1 32  ? 47.995 -24.258 -10.642 1.00 66.42  ? 32  TRP A CD2 1 
ATOM   215  N NE1 . TRP A 1 32  ? 48.294 -23.415 -12.708 1.00 66.46  ? 32  TRP A NE1 1 
ATOM   216  C CE2 . TRP A 1 32  ? 47.448 -23.394 -11.629 1.00 67.99  ? 32  TRP A CE2 1 
ATOM   217  C CE3 . TRP A 1 32  ? 47.307 -24.420 -9.426  1.00 70.47  ? 32  TRP A CE3 1 
ATOM   218  C CZ2 . TRP A 1 32  ? 46.243 -22.684 -11.431 1.00 65.59  ? 32  TRP A CZ2 1 
ATOM   219  C CZ3 . TRP A 1 32  ? 46.095 -23.710 -9.233  1.00 69.72  ? 32  TRP A CZ3 1 
ATOM   220  C CH2 . TRP A 1 32  ? 45.585 -22.854 -10.235 1.00 64.82  ? 32  TRP A CH2 1 
ATOM   221  N N   . VAL A 1 33  ? 47.859 -28.052 -11.645 1.00 42.85  ? 33  VAL A N   1 
ATOM   222  C CA  . VAL A 1 33  ? 46.598 -28.751 -11.378 1.00 41.96  ? 33  VAL A CA  1 
ATOM   223  C C   . VAL A 1 33  ? 46.688 -30.211 -11.830 1.00 44.22  ? 33  VAL A C   1 
ATOM   224  O O   . VAL A 1 33  ? 47.080 -30.480 -12.949 1.00 44.86  ? 33  VAL A O   1 
ATOM   225  C CB  . VAL A 1 33  ? 45.390 -28.052 -12.054 1.00 38.37  ? 33  VAL A CB  1 
ATOM   226  C CG1 . VAL A 1 33  ? 44.100 -28.857 -11.871 1.00 35.15  ? 33  VAL A CG1 1 
ATOM   227  C CG2 . VAL A 1 33  ? 45.216 -26.656 -11.492 1.00 41.96  ? 33  VAL A CG2 1 
ATOM   228  N N   . LEU A 1 34  ? 46.287 -31.134 -10.961 1.00 45.12  ? 34  LEU A N   1 
ATOM   229  C CA  . LEU A 1 34  ? 46.387 -32.554 -11.245 1.00 43.03  ? 34  LEU A CA  1 
ATOM   230  C C   . LEU A 1 34  ? 45.066 -33.167 -11.572 1.00 44.06  ? 34  LEU A C   1 
ATOM   231  O O   . LEU A 1 34  ? 45.005 -34.130 -12.355 1.00 47.82  ? 34  LEU A O   1 
ATOM   232  C CB  . LEU A 1 34  ? 47.032 -33.300 -10.066 1.00 44.79  ? 34  LEU A CB  1 
ATOM   233  C CG  . LEU A 1 34  ? 48.443 -32.806 -9.717  1.00 47.57  ? 34  LEU A CG  1 
ATOM   234  C CD1 . LEU A 1 34  ? 48.931 -33.464 -8.445  1.00 48.72  ? 34  LEU A CD1 1 
ATOM   235  C CD2 . LEU A 1 34  ? 49.433 -33.081 -10.848 1.00 45.23  ? 34  LEU A CD2 1 
ATOM   236  N N   . SER A 1 35  ? 44.008 -32.652 -10.948 1.00 43.49  ? 35  SER A N   1 
ATOM   237  C CA  . SER A 1 35  ? 42.656 -33.181 -11.154 1.00 43.74  ? 35  SER A CA  1 
ATOM   238  C C   . SER A 1 35  ? 41.621 -32.102 -10.817 1.00 42.91  ? 35  SER A C   1 
ATOM   239  O O   . SER A 1 35  ? 41.860 -31.299 -9.919  1.00 44.93  ? 35  SER A O   1 
ATOM   240  C CB  . SER A 1 35  ? 42.436 -34.447 -10.304 1.00 41.86  ? 35  SER A CB  1 
ATOM   241  O OG  . SER A 1 35  ? 41.111 -34.974 -10.411 1.00 43.79  ? 35  SER A OG  1 
ATOM   242  N N   . PRO A 1 36  ? 40.491 -32.070 -11.524 1.00 45.25  ? 36  PRO A N   1 
ATOM   243  C CA  . PRO A 1 36  ? 40.230 -32.957 -12.666 1.00 44.81  ? 36  PRO A CA  1 
ATOM   244  C C   . PRO A 1 36  ? 41.018 -32.542 -13.914 1.00 48.36  ? 36  PRO A C   1 
ATOM   245  O O   . PRO A 1 36  ? 41.625 -31.469 -13.946 1.00 44.92  ? 36  PRO A O   1 
ATOM   246  C CB  . PRO A 1 36  ? 38.730 -32.818 -12.869 1.00 45.31  ? 36  PRO A CB  1 
ATOM   247  C CG  . PRO A 1 36  ? 38.421 -31.421 -12.418 1.00 46.92  ? 36  PRO A CG  1 
ATOM   248  C CD  . PRO A 1 36  ? 39.479 -30.999 -11.428 1.00 44.91  ? 36  PRO A CD  1 
ATOM   249  N N   . ARG A 1 37  ? 41.034 -33.409 -14.917 1.00 51.86  ? 37  ARG A N   1 
ATOM   250  C CA  . ARG A 1 37  ? 41.862 -33.193 -16.105 1.00 58.85  ? 37  ARG A CA  1 
ATOM   251  C C   . ARG A 1 37  ? 41.117 -32.386 -17.173 1.00 54.66  ? 37  ARG A C   1 
ATOM   252  O O   . ARG A 1 37  ? 41.715 -31.906 -18.133 1.00 58.10  ? 37  ARG A O   1 
ATOM   253  C CB  . ARG A 1 37  ? 42.370 -34.537 -16.633 1.00 63.99  ? 37  ARG A CB  1 
ATOM   254  C CG  . ARG A 1 37  ? 43.146 -35.340 -15.587 1.00 66.78  ? 37  ARG A CG  1 
ATOM   255  C CD  . ARG A 1 37  ? 43.494 -36.736 -16.083 1.00 71.26  ? 37  ARG A CD  1 
ATOM   256  N NE  . ARG A 1 37  ? 44.449 -36.674 -17.188 1.00 72.46  ? 37  ARG A NE  1 
ATOM   257  C CZ  . ARG A 1 37  ? 44.592 -37.608 -18.123 1.00 74.02  ? 37  ARG A CZ  1 
ATOM   258  N NH1 . ARG A 1 37  ? 43.845 -38.711 -18.104 1.00 67.96  ? 37  ARG A NH1 1 
ATOM   259  N NH2 . ARG A 1 37  ? 45.497 -37.439 -19.081 1.00 73.89  ? 37  ARG A NH2 1 
ATOM   260  N N   . GLU A 1 38  ? 39.815 -32.230 -16.938 1.00 54.35  ? 38  GLU A N   1 
ATOM   261  C CA  . GLU A 1 38  ? 38.879 -31.487 -17.759 1.00 54.45  ? 38  GLU A CA  1 
ATOM   262  C C   . GLU A 1 38  ? 37.870 -30.736 -16.855 1.00 51.00  ? 38  GLU A C   1 
ATOM   263  O O   . GLU A 1 38  ? 37.378 -31.279 -15.867 1.00 48.93  ? 38  GLU A O   1 
ATOM   264  C CB  . GLU A 1 38  ? 38.160 -32.474 -18.673 1.00 58.56  ? 38  GLU A CB  1 
ATOM   265  C CG  . GLU A 1 38  ? 37.244 -31.871 -19.714 1.00 68.47  ? 38  GLU A CG  1 
ATOM   266  C CD  . GLU A 1 38  ? 36.584 -32.934 -20.564 1.00 75.58  ? 38  GLU A CD  1 
ATOM   267  O OE1 . GLU A 1 38  ? 35.464 -33.351 -20.193 1.00 79.33  ? 38  GLU A OE1 1 
ATOM   268  O OE2 . GLU A 1 38  ? 37.188 -33.351 -21.585 1.00 75.50  ? 38  GLU A OE2 1 
ATOM   269  N N   . VAL A 1 39  ? 37.564 -29.489 -17.209 1.00 49.67  ? 39  VAL A N   1 
ATOM   270  C CA  . VAL A 1 39  ? 36.613 -28.645 -16.457 1.00 49.67  ? 39  VAL A CA  1 
ATOM   271  C C   . VAL A 1 39  ? 35.456 -28.191 -17.344 1.00 47.46  ? 39  VAL A C   1 
ATOM   272  O O   . VAL A 1 39  ? 35.678 -27.651 -18.423 1.00 48.10  ? 39  VAL A O   1 
ATOM   273  C CB  . VAL A 1 39  ? 37.304 -27.393 -15.860 1.00 44.52  ? 39  VAL A CB  1 
ATOM   274  C CG1 . VAL A 1 39  ? 36.323 -26.581 -15.037 1.00 46.14  ? 39  VAL A CG1 1 
ATOM   275  C CG2 . VAL A 1 39  ? 38.502 -27.786 -14.995 1.00 44.21  ? 39  VAL A CG2 1 
ATOM   276  N N   . GLN A 1 40  ? 34.235 -28.419 -16.880 1.00 49.34  ? 40  GLN A N   1 
ATOM   277  C CA  . GLN A 1 40  ? 33.036 -27.882 -17.518 1.00 51.16  ? 40  GLN A CA  1 
ATOM   278  C C   . GLN A 1 40  ? 32.859 -26.438 -17.003 1.00 51.01  ? 40  GLN A C   1 
ATOM   279  O O   . GLN A 1 40  ? 32.179 -26.186 -15.994 1.00 51.26  ? 40  GLN A O   1 
ATOM   280  C CB  . GLN A 1 40  ? 31.808 -28.772 -17.222 1.00 55.23  ? 40  GLN A CB  1 
ATOM   281  C CG  . GLN A 1 40  ? 31.856 -30.186 -17.807 1.00 61.09  ? 40  GLN A CG  1 
ATOM   282  C CD  . GLN A 1 40  ? 31.677 -30.218 -19.328 1.00 71.94  ? 40  GLN A CD  1 
ATOM   283  O OE1 . GLN A 1 40  ? 30.594 -29.954 -19.851 1.00 77.79  ? 40  GLN A OE1 1 
ATOM   284  N NE2 . GLN A 1 40  ? 32.743 -30.554 -20.040 1.00 78.01  ? 40  GLN A NE2 1 
ATOM   285  N N   . VAL A 1 41  ? 33.528 -25.505 -17.680 1.00 46.14  ? 41  VAL A N   1 
ATOM   286  C CA  . VAL A 1 41  ? 33.561 -24.107 -17.261 1.00 43.55  ? 41  VAL A CA  1 
ATOM   287  C C   . VAL A 1 41  ? 32.260 -23.404 -17.596 1.00 41.55  ? 41  VAL A C   1 
ATOM   288  O O   . VAL A 1 41  ? 31.935 -23.192 -18.769 1.00 43.21  ? 41  VAL A O   1 
ATOM   289  C CB  . VAL A 1 41  ? 34.711 -23.323 -17.913 1.00 41.94  ? 41  VAL A CB  1 
ATOM   290  C CG1 . VAL A 1 41  ? 34.712 -21.890 -17.391 1.00 42.69  ? 41  VAL A CG1 1 
ATOM   291  C CG2 . VAL A 1 41  ? 36.044 -23.958 -17.591 1.00 38.96  ? 41  VAL A CG2 1 
ATOM   292  N N   . THR A 1 42  ? 31.522 -23.054 -16.557 1.00 42.57  ? 42  THR A N   1 
ATOM   293  C CA  . THR A 1 42  ? 30.329 -22.229 -16.700 1.00 42.30  ? 42  THR A CA  1 
ATOM   294  C C   . THR A 1 42  ? 30.716 -20.743 -16.644 1.00 42.66  ? 42  THR A C   1 
ATOM   295  O O   . THR A 1 42  ? 31.449 -20.305 -15.757 1.00 37.02  ? 42  THR A O   1 
ATOM   296  C CB  . THR A 1 42  ? 29.264 -22.575 -15.658 1.00 43.04  ? 42  THR A CB  1 
ATOM   297  O OG1 . THR A 1 42  ? 29.846 -22.518 -14.341 1.00 45.30  ? 42  THR A OG1 1 
ATOM   298  C CG2 . THR A 1 42  ? 28.671 -23.978 -15.942 1.00 38.28  ? 42  THR A CG2 1 
ATOM   299  N N   . MET A 1 43  ? 30.248 -19.993 -17.637 1.00 43.12  ? 43  MET A N   1 
ATOM   300  C CA  . MET A 1 43  ? 30.542 -18.569 -17.758 1.00 45.18  ? 43  MET A CA  1 
ATOM   301  C C   . MET A 1 43  ? 29.354 -17.802 -18.328 1.00 42.76  ? 43  MET A C   1 
ATOM   302  O O   . MET A 1 43  ? 28.329 -18.386 -18.704 1.00 39.59  ? 43  MET A O   1 
ATOM   303  C CB  . MET A 1 43  ? 31.812 -18.318 -18.597 1.00 45.00  ? 43  MET A CB  1 
ATOM   304  C CG  . MET A 1 43  ? 31.772 -18.910 -20.003 1.00 50.49  ? 43  MET A CG  1 
ATOM   305  S SD  . MET A 1 43  ? 33.153 -18.431 -21.064 1.00 55.89  ? 43  MET A SD  1 
ATOM   306  C CE  . MET A 1 43  ? 34.479 -19.397 -20.343 1.00 47.70  ? 43  MET A CE  1 
ATOM   307  N N   . CYS A 1 44  ? 29.519 -16.487 -18.393 1.00 42.39  ? 44  CYS A N   1 
ATOM   308  C CA  . CYS A 1 44  ? 28.422 -15.570 -18.718 1.00 41.64  ? 44  CYS A CA  1 
ATOM   309  C C   . CYS A 1 44  ? 28.645 -14.934 -20.091 1.00 39.79  ? 44  CYS A C   1 
ATOM   310  O O   . CYS A 1 44  ? 29.652 -14.271 -20.312 1.00 36.11  ? 44  CYS A O   1 
ATOM   311  C CB  . CYS A 1 44  ? 28.315 -14.520 -17.621 1.00 40.90  ? 44  CYS A CB  1 
ATOM   312  S SG  . CYS A 1 44  ? 27.782 -15.214 -16.048 1.00 42.86  ? 44  CYS A SG  1 
ATOM   313  N N   . ILE A 1 45  ? 27.732 -15.212 -21.020 1.00 39.99  ? 45  ILE A N   1 
ATOM   314  C CA  . ILE A 1 45  ? 27.858 -14.749 -22.405 1.00 42.96  ? 45  ILE A CA  1 
ATOM   315  C C   . ILE A 1 45  ? 26.505 -14.231 -22.885 1.00 44.37  ? 45  ILE A C   1 
ATOM   316  O O   . ILE A 1 45  ? 25.446 -14.790 -22.544 1.00 43.87  ? 45  ILE A O   1 
ATOM   317  C CB  . ILE A 1 45  ? 28.410 -15.849 -23.359 1.00 45.78  ? 45  ILE A CB  1 
ATOM   318  C CG1 . ILE A 1 45  ? 29.826 -16.304 -22.916 1.00 44.91  ? 45  ILE A CG1 1 
ATOM   319  C CG2 . ILE A 1 45  ? 28.458 -15.337 -24.810 1.00 43.57  ? 45  ILE A CG2 1 
ATOM   320  C CD1 . ILE A 1 45  ? 30.333 -17.594 -23.528 1.00 42.89  ? 45  ILE A CD1 1 
ATOM   321  N N   . GLY A 1 46  ? 26.557 -13.138 -23.645 1.00 45.72  ? 46  GLY A N   1 
ATOM   322  C CA  . GLY A 1 46  ? 25.384 -12.611 -24.344 1.00 42.81  ? 46  GLY A CA  1 
ATOM   323  C C   . GLY A 1 46  ? 25.193 -11.131 -24.160 1.00 41.63  ? 46  GLY A C   1 
ATOM   324  O O   . GLY A 1 46  ? 25.808 -10.519 -23.283 1.00 41.10  ? 46  GLY A O   1 
ATOM   325  N N   . ALA A 1 47  ? 24.334 -10.561 -24.995 1.00 41.25  ? 47  ALA A N   1 
ATOM   326  C CA  . ALA A 1 47  ? 24.038 -9.137  -24.957 1.00 40.17  ? 47  ALA A CA  1 
ATOM   327  C C   . ALA A 1 47  ? 23.268 -8.757  -23.707 1.00 36.74  ? 47  ALA A C   1 
ATOM   328  O O   . ALA A 1 47  ? 22.503 -9.555  -23.142 1.00 40.46  ? 47  ALA A O   1 
ATOM   329  C CB  . ALA A 1 47  ? 23.246 -8.738  -26.200 1.00 40.13  ? 47  ALA A CB  1 
ATOM   330  N N   . CYS A 1 48  ? 23.456 -7.507  -23.317 1.00 37.75  ? 48  CYS A N   1 
ATOM   331  C CA  . CYS A 1 48  ? 22.732 -6.864  -22.240 1.00 38.37  ? 48  CYS A CA  1 
ATOM   332  C C   . CYS A 1 48  ? 21.858 -5.700  -22.766 1.00 39.84  ? 48  CYS A C   1 
ATOM   333  O O   . CYS A 1 48  ? 22.183 -4.538  -22.534 1.00 40.09  ? 48  CYS A O   1 
ATOM   334  C CB  . CYS A 1 48  ? 23.745 -6.345  -21.212 1.00 38.76  ? 48  CYS A CB  1 
ATOM   335  S SG  . CYS A 1 48  ? 24.449 -7.648  -20.189 1.00 40.17  ? 48  CYS A SG  1 
ATOM   336  N N   . PRO A 1 49  ? 20.733 -5.996  -23.451 1.00 41.50  ? 49  PRO A N   1 
ATOM   337  C CA  . PRO A 1 49  ? 19.874 -4.870  -23.901 1.00 41.68  ? 49  PRO A CA  1 
ATOM   338  C C   . PRO A 1 49  ? 19.211 -4.090  -22.749 1.00 46.12  ? 49  PRO A C   1 
ATOM   339  O O   . PRO A 1 49  ? 19.315 -4.482  -21.578 1.00 46.50  ? 49  PRO A O   1 
ATOM   340  C CB  . PRO A 1 49  ? 18.830 -5.545  -24.797 1.00 40.96  ? 49  PRO A CB  1 
ATOM   341  C CG  . PRO A 1 49  ? 18.837 -6.985  -24.392 1.00 42.11  ? 49  PRO A CG  1 
ATOM   342  C CD  . PRO A 1 49  ? 20.206 -7.309  -23.878 1.00 42.85  ? 49  PRO A CD  1 
ATOM   343  N N   . SER A 1 50  ? 18.567 -2.974  -23.086 1.00 45.31  ? 50  SER A N   1 
ATOM   344  C CA  . SER A 1 50  ? 17.904 -2.110  -22.115 1.00 48.88  ? 50  SER A CA  1 
ATOM   345  C C   . SER A 1 50  ? 16.987 -2.905  -21.173 1.00 46.85  ? 50  SER A C   1 
ATOM   346  O O   . SER A 1 50  ? 16.257 -3.775  -21.624 1.00 43.76  ? 50  SER A O   1 
ATOM   347  C CB  . SER A 1 50  ? 17.087 -1.041  -22.850 1.00 47.21  ? 50  SER A CB  1 
ATOM   348  O OG  . SER A 1 50  ? 16.541 -0.127  -21.923 1.00 50.17  ? 50  SER A OG  1 
ATOM   349  N N   . GLN A 1 51  ? 17.068 -2.626  -19.869 1.00 48.74  ? 51  GLN A N   1 
ATOM   350  C CA  . GLN A 1 51  ? 16.243 -3.303  -18.849 1.00 54.99  ? 51  GLN A CA  1 
ATOM   351  C C   . GLN A 1 51  ? 16.525 -4.804  -18.645 1.00 52.38  ? 51  GLN A C   1 
ATOM   352  O O   . GLN A 1 51  ? 15.896 -5.414  -17.786 1.00 54.71  ? 51  GLN A O   1 
ATOM   353  C CB  . GLN A 1 51  ? 14.716 -3.104  -19.094 1.00 59.66  ? 51  GLN A CB  1 
ATOM   354  C CG  . GLN A 1 51  ? 14.223 -1.667  -19.220 1.00 65.27  ? 51  GLN A CG  1 
ATOM   355  C CD  . GLN A 1 51  ? 14.900 -0.736  -18.231 1.00 73.60  ? 51  GLN A CD  1 
ATOM   356  O OE1 . GLN A 1 51  ? 15.824 -0.003  -18.591 1.00 79.14  ? 51  GLN A OE1 1 
ATOM   357  N NE2 . GLN A 1 51  ? 14.469 -0.782  -16.972 1.00 77.86  ? 51  GLN A NE2 1 
ATOM   358  N N   . PHE A 1 52  ? 17.425 -5.412  -19.417 1.00 46.08  ? 52  PHE A N   1 
ATOM   359  C CA  . PHE A 1 52  ? 17.672 -6.857  -19.236 1.00 46.10  ? 52  PHE A CA  1 
ATOM   360  C C   . PHE A 1 52  ? 18.648 -7.140  -18.080 1.00 44.96  ? 52  PHE A C   1 
ATOM   361  O O   . PHE A 1 52  ? 19.850 -6.869  -18.188 1.00 41.71  ? 52  PHE A O   1 
ATOM   362  C CB  . PHE A 1 52  ? 18.098 -7.557  -20.530 1.00 42.43  ? 52  PHE A CB  1 
ATOM   363  C CG  . PHE A 1 52  ? 18.195 -9.042  -20.391 1.00 44.09  ? 52  PHE A CG  1 
ATOM   364  C CD1 . PHE A 1 52  ? 17.050 -9.851  -20.530 1.00 43.78  ? 52  PHE A CD1 1 
ATOM   365  C CD2 . PHE A 1 52  ? 19.420 -9.648  -20.064 1.00 40.39  ? 52  PHE A CD2 1 
ATOM   366  C CE1 . PHE A 1 52  ? 17.131 -11.241 -20.372 1.00 40.19  ? 52  PHE A CE1 1 
ATOM   367  C CE2 . PHE A 1 52  ? 19.509 -11.028 -19.914 1.00 41.35  ? 52  PHE A CE2 1 
ATOM   368  C CZ  . PHE A 1 52  ? 18.365 -11.828 -20.059 1.00 41.07  ? 52  PHE A CZ  1 
ATOM   369  N N   . ARG A 1 53  ? 18.097 -7.623  -16.963 1.00 42.33  ? 53  ARG A N   1 
ATOM   370  C CA  . ARG A 1 53  ? 18.866 -8.065  -15.797 1.00 42.36  ? 53  ARG A CA  1 
ATOM   371  C C   . ARG A 1 53  ? 19.886 -7.036  -15.323 1.00 44.45  ? 53  ARG A C   1 
ATOM   372  O O   . ARG A 1 53  ? 21.046 -7.377  -15.001 1.00 41.97  ? 53  ARG A O   1 
ATOM   373  C CB  . ARG A 1 53  ? 19.502 -9.454  -16.052 1.00 45.99  ? 53  ARG A CB  1 
ATOM   374  C CG  . ARG A 1 53  ? 18.475 -10.578 -16.088 1.00 49.56  ? 53  ARG A CG  1 
ATOM   375  C CD  . ARG A 1 53  ? 19.058 -11.947 -16.416 1.00 54.32  ? 53  ARG A CD  1 
ATOM   376  N NE  . ARG A 1 53  ? 19.481 -12.809 -15.281 1.00 64.25  ? 53  ARG A NE  1 
ATOM   377  C CZ  . ARG A 1 53  ? 19.366 -12.582 -13.955 1.00 63.37  ? 53  ARG A CZ  1 
ATOM   378  N NH1 . ARG A 1 53  ? 18.814 -11.478 -13.448 1.00 65.29  ? 53  ARG A NH1 1 
ATOM   379  N NH2 . ARG A 1 53  ? 19.840 -13.485 -13.105 1.00 57.65  ? 53  ARG A NH2 1 
ATOM   380  N N   . ALA A 1 54  ? 19.451 -5.775  -15.279 1.00 40.71  ? 54  ALA A N   1 
ATOM   381  C CA  . ALA A 1 54  ? 20.334 -4.686  -14.895 1.00 42.95  ? 54  ALA A CA  1 
ATOM   382  C C   . ALA A 1 54  ? 20.597 -4.771  -13.396 1.00 47.59  ? 54  ALA A C   1 
ATOM   383  O O   . ALA A 1 54  ? 19.674 -4.737  -12.582 1.00 57.48  ? 54  ALA A O   1 
ATOM   384  C CB  . ALA A 1 54  ? 19.773 -3.329  -15.305 1.00 37.11  ? 54  ALA A CB  1 
ATOM   385  N N   . ALA A 1 55  ? 21.867 -4.904  -13.046 1.00 43.68  ? 55  ALA A N   1 
ATOM   386  C CA  . ALA A 1 55  ? 22.278 -5.216  -11.683 1.00 44.05  ? 55  ALA A CA  1 
ATOM   387  C C   . ALA A 1 55  ? 22.068 -4.093  -10.689 1.00 44.08  ? 55  ALA A C   1 
ATOM   388  O O   . ALA A 1 55  ? 21.889 -4.334  -9.495  1.00 48.30  ? 55  ALA A O   1 
ATOM   389  C CB  . ALA A 1 55  ? 23.741 -5.650  -11.675 1.00 41.95  ? 55  ALA A CB  1 
ATOM   390  N N   . ASN A 1 56  ? 22.123 -2.864  -11.181 1.00 41.74  ? 56  ASN A N   1 
ATOM   391  C CA  . ASN A 1 56  ? 22.089 -1.689  -10.324 1.00 41.53  ? 56  ASN A CA  1 
ATOM   392  C C   . ASN A 1 56  ? 21.890 -0.422  -11.165 1.00 39.11  ? 56  ASN A C   1 
ATOM   393  O O   . ASN A 1 56  ? 21.752 -0.503  -12.379 1.00 36.83  ? 56  ASN A O   1 
ATOM   394  C CB  . ASN A 1 56  ? 23.379 -1.608  -9.483  1.00 42.21  ? 56  ASN A CB  1 
ATOM   395  C CG  . ASN A 1 56  ? 24.645 -1.728  -10.324 1.00 42.21  ? 56  ASN A CG  1 
ATOM   396  O OD1 . ASN A 1 56  ? 24.700 -1.289  -11.475 1.00 39.73  ? 56  ASN A OD1 1 
ATOM   397  N ND2 . ASN A 1 56  ? 25.674 -2.337  -9.742  1.00 46.28  ? 56  ASN A ND2 1 
ATOM   398  N N   . MET A 1 57  ? 21.919 0.728   -10.506 1.00 41.30  ? 57  MET A N   1 
ATOM   399  C CA  . MET A 1 57  ? 21.721 2.036   -11.124 1.00 45.94  ? 57  MET A CA  1 
ATOM   400  C C   . MET A 1 57  ? 22.778 2.323   -12.187 1.00 46.53  ? 57  MET A C   1 
ATOM   401  O O   . MET A 1 57  ? 22.439 2.795   -13.279 1.00 43.28  ? 57  MET A O   1 
ATOM   402  C CB  . MET A 1 57  ? 21.771 3.124   -10.043 1.00 56.12  ? 57  MET A CB  1 
ATOM   403  C CG  . MET A 1 57  ? 21.092 4.442   -10.390 1.00 67.64  ? 57  MET A CG  1 
ATOM   404  S SD  . MET A 1 57  ? 19.280 4.428   -10.417 1.00 85.08  ? 57  MET A SD  1 
ATOM   405  C CE  . MET A 1 57  ? 18.851 3.501   -8.940  1.00 75.54  ? 57  MET A CE  1 
ATOM   406  N N   . HIS A 1 58  ? 24.048 2.044   -11.859 1.00 43.30  ? 58  HIS A N   1 
ATOM   407  C CA  . HIS A 1 58  ? 25.165 2.214   -12.787 1.00 38.74  ? 58  HIS A CA  1 
ATOM   408  C C   . HIS A 1 58  ? 24.938 1.534   -14.140 1.00 37.86  ? 58  HIS A C   1 
ATOM   409  O O   . HIS A 1 58  ? 25.150 2.153   -15.187 1.00 37.91  ? 58  HIS A O   1 
ATOM   410  C CB  . HIS A 1 58  ? 26.473 1.741   -12.171 1.00 38.58  ? 58  HIS A CB  1 
ATOM   411  C CG  . HIS A 1 58  ? 27.674 2.276   -12.872 1.00 39.26  ? 58  HIS A CG  1 
ATOM   412  N ND1 . HIS A 1 58  ? 28.445 1.508   -13.721 1.00 40.09  ? 58  HIS A ND1 1 
ATOM   413  C CD2 . HIS A 1 58  ? 28.210 3.518   -12.899 1.00 37.05  ? 58  HIS A CD2 1 
ATOM   414  C CE1 . HIS A 1 58  ? 29.417 2.250   -14.220 1.00 37.66  ? 58  HIS A CE1 1 
ATOM   415  N NE2 . HIS A 1 58  ? 29.297 3.471   -13.737 1.00 38.74  ? 58  HIS A NE2 1 
ATOM   416  N N   . ALA A 1 59  ? 24.467 0.289   -14.113 1.00 34.96  ? 59  ALA A N   1 
ATOM   417  C CA  . ALA A 1 59  ? 24.120 -0.432  -15.336 1.00 36.55  ? 59  ALA A CA  1 
ATOM   418  C C   . ALA A 1 59  ? 23.092 0.332   -16.202 1.00 40.68  ? 59  ALA A C   1 
ATOM   419  O O   . ALA A 1 59  ? 23.219 0.383   -17.446 1.00 43.04  ? 59  ALA A O   1 
ATOM   420  C CB  . ALA A 1 59  ? 23.598 -1.824  -15.008 1.00 30.87  ? 59  ALA A CB  1 
ATOM   421  N N   . GLN A 1 60  ? 22.098 0.922   -15.544 1.00 38.94  ? 60  GLN A N   1 
ATOM   422  C CA  . GLN A 1 60  ? 21.037 1.703   -16.224 1.00 41.06  ? 60  GLN A CA  1 
ATOM   423  C C   . GLN A 1 60  ? 21.614 2.976   -16.855 1.00 37.86  ? 60  GLN A C   1 
ATOM   424  O O   . GLN A 1 60  ? 21.318 3.284   -18.010 1.00 39.64  ? 60  GLN A O   1 
ATOM   425  C CB  . GLN A 1 60  ? 19.908 2.045   -15.251 1.00 41.65  ? 60  GLN A CB  1 
ATOM   426  C CG  . GLN A 1 60  ? 19.032 0.854   -14.868 1.00 50.56  ? 60  GLN A CG  1 
ATOM   427  C CD  . GLN A 1 60  ? 18.118 1.133   -13.673 1.00 60.67  ? 60  GLN A CD  1 
ATOM   428  O OE1 . GLN A 1 60  ? 17.908 2.287   -13.267 1.00 68.33  ? 60  GLN A OE1 1 
ATOM   429  N NE2 . GLN A 1 60  ? 17.560 0.071   -13.107 1.00 65.06  ? 60  GLN A NE2 1 
ATOM   430  N N   . ILE A 1 61  ? 22.460 3.682   -16.109 1.00 33.82  ? 61  ILE A N   1 
ATOM   431  C CA  . ILE A 1 61  ? 23.242 4.780   -16.660 1.00 35.80  ? 61  ILE A CA  1 
ATOM   432  C C   . ILE A 1 61  ? 24.039 4.363   -17.917 1.00 37.55  ? 61  ILE A C   1 
ATOM   433  O O   . ILE A 1 61  ? 23.995 5.070   -18.913 1.00 37.83  ? 61  ILE A O   1 
ATOM   434  C CB  . ILE A 1 61  ? 24.155 5.412   -15.587 1.00 34.27  ? 61  ILE A CB  1 
ATOM   435  C CG1 . ILE A 1 61  ? 23.336 6.190   -14.561 1.00 33.89  ? 61  ILE A CG1 1 
ATOM   436  C CG2 . ILE A 1 61  ? 25.207 6.317   -16.210 1.00 33.09  ? 61  ILE A CG2 1 
ATOM   437  C CD1 . ILE A 1 61  ? 24.092 6.453   -13.265 1.00 33.52  ? 61  ILE A CD1 1 
ATOM   438  N N   . LYS A 1 62  ? 24.731 3.216   -17.881 1.00 36.66  ? 62  LYS A N   1 
ATOM   439  C CA  . LYS A 1 62  ? 25.527 2.767   -19.034 1.00 35.87  ? 62  LYS A CA  1 
ATOM   440  C C   . LYS A 1 62  ? 24.642 2.544   -20.256 1.00 34.99  ? 62  LYS A C   1 
ATOM   441  O O   . LYS A 1 62  ? 25.031 2.920   -21.365 1.00 37.82  ? 62  LYS A O   1 
ATOM   442  C CB  . LYS A 1 62  ? 26.355 1.494   -18.747 1.00 37.34  ? 62  LYS A CB  1 
ATOM   443  C CG  . LYS A 1 62  ? 27.622 1.698   -17.929 1.00 41.45  ? 62  LYS A CG  1 
ATOM   444  C CD  . LYS A 1 62  ? 28.244 0.377   -17.468 1.00 43.55  ? 62  LYS A CD  1 
ATOM   445  C CE  . LYS A 1 62  ? 28.985 -0.360  -18.580 1.00 50.52  ? 62  LYS A CE  1 
ATOM   446  N NZ  . LYS A 1 62  ? 29.422 -1.728  -18.159 1.00 53.67  ? 62  LYS A NZ  1 
ATOM   447  N N   . THR A 1 63  ? 23.476 1.930   -20.061 1.00 33.68  ? 63  THR A N   1 
ATOM   448  C CA  . THR A 1 63  ? 22.463 1.787   -21.113 1.00 36.30  ? 63  THR A CA  1 
ATOM   449  C C   . THR A 1 63  ? 22.091 3.137   -21.771 1.00 37.40  ? 63  THR A C   1 
ATOM   450  O O   . THR A 1 63  ? 22.182 3.272   -22.996 1.00 37.68  ? 63  THR A O   1 
ATOM   451  C CB  . THR A 1 63  ? 21.193 1.061   -20.601 1.00 35.61  ? 63  THR A CB  1 
ATOM   452  O OG1 . THR A 1 63  ? 21.515 -0.300  -20.362 1.00 33.83  ? 63  THR A OG1 1 
ATOM   453  C CG2 . THR A 1 63  ? 20.053 1.073   -21.654 1.00 34.55  ? 63  THR A CG2 1 
ATOM   454  N N   . SER A 1 64  ? 21.717 4.116   -20.948 1.00 37.81  ? 64  SER A N   1 
ATOM   455  C CA  . SER A 1 64  ? 21.276 5.434   -21.422 1.00 36.50  ? 64  SER A CA  1 
ATOM   456  C C   . SER A 1 64  ? 22.362 6.123   -22.242 1.00 38.91  ? 64  SER A C   1 
ATOM   457  O O   . SER A 1 64  ? 22.125 6.593   -23.357 1.00 39.38  ? 64  SER A O   1 
ATOM   458  C CB  . SER A 1 64  ? 20.897 6.304   -20.233 1.00 34.30  ? 64  SER A CB  1 
ATOM   459  O OG  . SER A 1 64  ? 19.858 5.681   -19.512 1.00 38.32  ? 64  SER A OG  1 
ATOM   460  N N   . LEU A 1 65  ? 23.556 6.158   -21.672 1.00 39.60  ? 65  LEU A N   1 
ATOM   461  C CA  . LEU A 1 65  ? 24.694 6.820   -22.258 1.00 39.42  ? 65  LEU A CA  1 
ATOM   462  C C   . LEU A 1 65  ? 25.260 6.092   -23.500 1.00 40.99  ? 65  LEU A C   1 
ATOM   463  O O   . LEU A 1 65  ? 25.806 6.738   -24.403 1.00 43.69  ? 65  LEU A O   1 
ATOM   464  C CB  . LEU A 1 65  ? 25.755 6.976   -21.166 1.00 40.65  ? 65  LEU A CB  1 
ATOM   465  C CG  . LEU A 1 65  ? 25.895 8.335   -20.437 1.00 44.47  ? 65  LEU A CG  1 
ATOM   466  C CD1 . LEU A 1 65  ? 24.641 9.217   -20.427 1.00 43.74  ? 65  LEU A CD1 1 
ATOM   467  C CD2 . LEU A 1 65  ? 26.535 8.237   -19.052 1.00 36.38  ? 65  LEU A CD2 1 
ATOM   468  N N   . HIS A 1 66  ? 25.106 4.768   -23.545 1.00 36.59  ? 66  HIS A N   1 
ATOM   469  C CA  . HIS A 1 66  ? 25.518 3.965   -24.695 1.00 37.66  ? 66  HIS A CA  1 
ATOM   470  C C   . HIS A 1 66  ? 24.703 4.295   -25.938 1.00 39.71  ? 66  HIS A C   1 
ATOM   471  O O   . HIS A 1 66  ? 25.269 4.337   -27.029 1.00 40.94  ? 66  HIS A O   1 
ATOM   472  C CB  . HIS A 1 66  ? 25.483 2.447   -24.416 1.00 33.71  ? 66  HIS A CB  1 
ATOM   473  C CG  . HIS A 1 66  ? 25.909 1.608   -25.581 1.00 33.91  ? 66  HIS A CG  1 
ATOM   474  N ND1 . HIS A 1 66  ? 27.212 1.582   -26.045 1.00 36.01  ? 66  HIS A ND1 1 
ATOM   475  C CD2 . HIS A 1 66  ? 25.211 0.763   -26.374 1.00 32.95  ? 66  HIS A CD2 1 
ATOM   476  C CE1 . HIS A 1 66  ? 27.296 0.761   -27.076 1.00 37.18  ? 66  HIS A CE1 1 
ATOM   477  N NE2 . HIS A 1 66  ? 26.094 0.251   -27.298 1.00 39.37  ? 66  HIS A NE2 1 
ATOM   478  N N   . ARG A 1 67  ? 23.398 4.526   -25.803 1.00 38.50  ? 67  ARG A N   1 
ATOM   479  C CA  . ARG A 1 67  ? 22.645 4.857   -27.010 1.00 45.26  ? 67  ARG A CA  1 
ATOM   480  C C   . ARG A 1 67  ? 22.888 6.283   -27.545 1.00 44.59  ? 67  ARG A C   1 
ATOM   481  O O   . ARG A 1 67  ? 22.635 6.541   -28.710 1.00 46.35  ? 67  ARG A O   1 
ATOM   482  C CB  . ARG A 1 67  ? 21.162 4.472   -26.922 1.00 47.29  ? 67  ARG A CB  1 
ATOM   483  C CG  . ARG A 1 67  ? 20.361 5.228   -25.916 1.00 47.94  ? 67  ARG A CG  1 
ATOM   484  C CD  . ARG A 1 67  ? 18.889 5.038   -26.228 1.00 48.98  ? 67  ARG A CD  1 
ATOM   485  N NE  . ARG A 1 67  ? 18.344 3.843   -25.583 1.00 49.66  ? 67  ARG A NE  1 
ATOM   486  C CZ  . ARG A 1 67  ? 18.013 3.757   -24.293 1.00 46.94  ? 67  ARG A CZ  1 
ATOM   487  N NH1 . ARG A 1 67  ? 18.178 4.800   -23.481 1.00 45.09  ? 67  ARG A NH1 1 
ATOM   488  N NH2 . ARG A 1 67  ? 17.515 2.620   -23.809 1.00 47.88  ? 67  ARG A NH2 1 
ATOM   489  N N   . LEU A 1 68  ? 23.414 7.170   -26.701 1.00 45.16  ? 68  LEU A N   1 
ATOM   490  C CA  . LEU A 1 68  ? 23.824 8.514   -27.097 1.00 46.89  ? 68  LEU A CA  1 
ATOM   491  C C   . LEU A 1 68  ? 25.209 8.569   -27.699 1.00 47.67  ? 68  LEU A C   1 
ATOM   492  O O   . LEU A 1 68  ? 25.437 9.296   -28.649 1.00 46.87  ? 68  LEU A O   1 
ATOM   493  C CB  . LEU A 1 68  ? 23.841 9.431   -25.888 1.00 48.16  ? 68  LEU A CB  1 
ATOM   494  C CG  . LEU A 1 68  ? 22.757 10.454  -25.645 1.00 54.33  ? 68  LEU A CG  1 
ATOM   495  C CD1 . LEU A 1 68  ? 21.427 9.770   -25.436 1.00 56.33  ? 68  LEU A CD1 1 
ATOM   496  C CD2 . LEU A 1 68  ? 23.161 11.191  -24.388 1.00 53.56  ? 68  LEU A CD2 1 
ATOM   497  N N   . LYS A 1 69  ? 26.137 7.822   -27.106 1.00 47.16  ? 69  LYS A N   1 
ATOM   498  C CA  . LYS A 1 69  ? 27.545 7.898   -27.466 1.00 46.88  ? 69  LYS A CA  1 
ATOM   499  C C   . LYS A 1 69  ? 28.168 6.493   -27.549 1.00 44.73  ? 69  LYS A C   1 
ATOM   500  O O   . LYS A 1 69  ? 29.134 6.209   -26.800 1.00 42.23  ? 69  LYS A O   1 
ATOM   501  C CB  . LYS A 1 69  ? 28.310 8.769   -26.448 1.00 52.02  ? 69  LYS A CB  1 
ATOM   502  C CG  . LYS A 1 69  ? 27.791 10.198  -26.292 1.00 59.60  ? 69  LYS A CG  1 
ATOM   503  C CD  . LYS A 1 69  ? 28.508 10.968  -25.183 1.00 63.49  ? 69  LYS A CD  1 
ATOM   504  C CE  . LYS A 1 69  ? 27.700 12.189  -24.747 1.00 64.95  ? 69  LYS A CE  1 
ATOM   505  N NZ  . LYS A 1 69  ? 28.573 13.297  -24.262 1.00 68.68  ? 69  LYS A NZ  1 
ATOM   506  N N   . PRO A 1 70  ? 27.648 5.616   -28.460 1.00 41.74  ? 70  PRO A N   1 
ATOM   507  C CA  . PRO A 1 70  ? 28.105 4.197   -28.463 1.00 44.88  ? 70  PRO A CA  1 
ATOM   508  C C   . PRO A 1 70  ? 29.598 3.996   -28.745 1.00 49.48  ? 70  PRO A C   1 
ATOM   509  O O   . PRO A 1 70  ? 30.158 2.951   -28.386 1.00 51.15  ? 70  PRO A O   1 
ATOM   510  C CB  . PRO A 1 70  ? 27.260 3.537   -29.562 1.00 43.48  ? 70  PRO A CB  1 
ATOM   511  C CG  . PRO A 1 70  ? 26.827 4.669   -30.467 1.00 42.02  ? 70  PRO A CG  1 
ATOM   512  C CD  . PRO A 1 70  ? 26.733 5.902   -29.596 1.00 41.63  ? 70  PRO A CD  1 
ATOM   513  N N   A ASP A 1 71  ? 30.174 4.988   -29.426 0.50 53.31  ? 71  ASP A N   1 
ATOM   514  N N   B ASP A 1 71  ? 30.244 4.977   -29.371 0.50 52.17  ? 71  ASP A N   1 
ATOM   515  C CA  A ASP A 1 71  ? 31.602 5.143   -29.678 0.50 57.42  ? 71  ASP A CA  1 
ATOM   516  C CA  B ASP A 1 71  ? 31.686 4.892   -29.628 0.50 55.66  ? 71  ASP A CA  1 
ATOM   517  C C   A ASP A 1 71  ? 32.389 5.211   -28.359 0.50 59.21  ? 71  ASP A C   1 
ATOM   518  C C   B ASP A 1 71  ? 32.547 5.388   -28.435 0.50 59.50  ? 71  ASP A C   1 
ATOM   519  O O   A ASP A 1 71  ? 33.335 4.446   -28.148 0.50 56.16  ? 71  ASP A O   1 
ATOM   520  O O   B ASP A 1 71  ? 33.743 5.098   -28.392 0.50 62.81  ? 71  ASP A O   1 
ATOM   521  C CB  A ASP A 1 71  ? 31.808 6.433   -30.494 0.50 55.93  ? 71  ASP A CB  1 
ATOM   522  C CB  B ASP A 1 71  ? 32.052 5.581   -30.957 0.50 51.60  ? 71  ASP A CB  1 
ATOM   523  C CG  A ASP A 1 71  ? 30.771 7.520   -30.148 0.50 56.79  ? 71  ASP A CG  1 
ATOM   524  C CG  B ASP A 1 71  ? 31.223 5.063   -32.138 0.50 51.23  ? 71  ASP A CG  1 
ATOM   525  O OD1 A ASP A 1 71  ? 29.581 7.358   -30.520 0.50 51.50  ? 71  ASP A OD1 1 
ATOM   526  O OD1 B ASP A 1 71  ? 31.239 3.840   -32.418 0.50 47.25  ? 71  ASP A OD1 1 
ATOM   527  O OD2 A ASP A 1 71  ? 31.145 8.535   -29.507 0.50 51.80  ? 71  ASP A OD2 1 
ATOM   528  O OD2 B ASP A 1 71  ? 30.557 5.888   -32.798 0.50 48.66  ? 71  ASP A OD2 1 
ATOM   529  N N   . THR A 1 72  ? 31.934 6.105   -27.477 1.00 60.99  ? 72  THR A N   1 
ATOM   530  C CA  . THR A 1 72  ? 32.587 6.500   -26.196 1.00 59.62  ? 72  THR A CA  1 
ATOM   531  C C   . THR A 1 72  ? 32.242 5.575   -25.010 1.00 54.03  ? 72  THR A C   1 
ATOM   532  O O   . THR A 1 72  ? 33.109 5.195   -24.241 1.00 51.54  ? 72  THR A O   1 
ATOM   533  C CB  . THR A 1 72  ? 32.133 7.928   -25.760 1.00 70.46  ? 72  THR A CB  1 
ATOM   534  O OG1 . THR A 1 72  ? 31.834 8.730   -26.910 1.00 79.51  ? 72  THR A OG1 1 
ATOM   535  C CG2 . THR A 1 72  ? 33.175 8.644   -24.845 1.00 73.95  ? 72  THR A CG2 1 
ATOM   536  N N   . VAL A 1 73  ? 30.962 5.265   -24.836 1.00 47.29  ? 73  VAL A N   1 
ATOM   537  C CA  . VAL A 1 73  ? 30.529 4.548   -23.656 1.00 42.43  ? 73  VAL A CA  1 
ATOM   538  C C   . VAL A 1 73  ? 29.938 3.175   -23.940 1.00 40.56  ? 73  VAL A C   1 
ATOM   539  O O   . VAL A 1 73  ? 29.007 3.040   -24.736 1.00 40.34  ? 73  VAL A O   1 
ATOM   540  C CB  . VAL A 1 73  ? 29.747 5.432   -22.630 1.00 43.45  ? 73  VAL A CB  1 
ATOM   541  C CG1 . VAL A 1 73  ? 29.319 6.760   -23.222 1.00 46.67  ? 73  VAL A CG1 1 
ATOM   542  C CG2 . VAL A 1 73  ? 28.616 4.687   -21.918 1.00 42.04  ? 73  VAL A CG2 1 
ATOM   543  N N   . PRO A 1 74  ? 30.514 2.143   -23.288 1.00 38.42  ? 74  PRO A N   1 
ATOM   544  C CA  . PRO A 1 74  ? 30.138 0.756   -23.508 1.00 40.10  ? 74  PRO A CA  1 
ATOM   545  C C   . PRO A 1 74  ? 28.768 0.451   -22.936 1.00 37.95  ? 74  PRO A C   1 
ATOM   546  O O   . PRO A 1 74  ? 28.287 1.141   -22.027 1.00 37.09  ? 74  PRO A O   1 
ATOM   547  C CB  . PRO A 1 74  ? 31.204 -0.018  -22.720 1.00 39.12  ? 74  PRO A CB  1 
ATOM   548  C CG  . PRO A 1 74  ? 31.542 0.890   -21.592 1.00 41.70  ? 74  PRO A CG  1 
ATOM   549  C CD  . PRO A 1 74  ? 31.508 2.263   -22.202 1.00 37.60  ? 74  PRO A CD  1 
ATOM   550  N N   . ALA A 1 75  ? 28.163 -0.595  -23.475 1.00 39.51  ? 75  ALA A N   1 
ATOM   551  C CA  . ALA A 1 75  ? 26.894 -1.095  -23.005 1.00 39.89  ? 75  ALA A CA  1 
ATOM   552  C C   . ALA A 1 75  ? 27.179 -1.857  -21.697 1.00 41.42  ? 75  ALA A C   1 
ATOM   553  O O   . ALA A 1 75  ? 28.336 -2.189  -21.409 1.00 39.48  ? 75  ALA A O   1 
ATOM   554  C CB  . ALA A 1 75  ? 26.299 -2.023  -24.059 1.00 41.24  ? 75  ALA A CB  1 
ATOM   555  N N   . PRO A 1 76  ? 26.132 -2.146  -20.901 1.00 41.52  ? 76  PRO A N   1 
ATOM   556  C CA  . PRO A 1 76  ? 26.397 -3.028  -19.776 1.00 38.34  ? 76  PRO A CA  1 
ATOM   557  C C   . PRO A 1 76  ? 26.965 -4.350  -20.299 1.00 37.44  ? 76  PRO A C   1 
ATOM   558  O O   . PRO A 1 76  ? 26.713 -4.744  -21.450 1.00 39.31  ? 76  PRO A O   1 
ATOM   559  C CB  . PRO A 1 76  ? 25.001 -3.240  -19.151 1.00 39.31  ? 76  PRO A CB  1 
ATOM   560  C CG  . PRO A 1 76  ? 24.213 -2.051  -19.572 1.00 39.96  ? 76  PRO A CG  1 
ATOM   561  C CD  . PRO A 1 76  ? 24.719 -1.702  -20.940 1.00 40.11  ? 76  PRO A CD  1 
ATOM   562  N N   . CYS A 1 77  ? 27.729 -5.006  -19.452 1.00 36.50  ? 77  CYS A N   1 
ATOM   563  C CA  . CYS A 1 77  ? 28.413 -6.223  -19.811 1.00 38.25  ? 77  CYS A CA  1 
ATOM   564  C C   . CYS A 1 77  ? 27.905 -7.435  -19.014 1.00 35.69  ? 77  CYS A C   1 
ATOM   565  O O   . CYS A 1 77  ? 27.579 -7.290  -17.843 1.00 36.76  ? 77  CYS A O   1 
ATOM   566  C CB  . CYS A 1 77  ? 29.907 -6.018  -19.556 1.00 41.60  ? 77  CYS A CB  1 
ATOM   567  S SG  . CYS A 1 77  ? 30.833 -6.947  -20.785 1.00 58.12  ? 77  CYS A SG  1 
ATOM   568  N N   . CYS A 1 78  ? 27.869 -8.624  -19.643 1.00 35.69  ? 78  CYS A N   1 
ATOM   569  C CA  . CYS A 1 78  ? 27.389 -9.856  -19.009 1.00 35.05  ? 78  CYS A CA  1 
ATOM   570  C C   . CYS A 1 78  ? 28.423 -10.500 -18.021 1.00 35.61  ? 78  CYS A C   1 
ATOM   571  O O   . CYS A 1 78  ? 29.459 -10.981 -18.450 1.00 35.59  ? 78  CYS A O   1 
ATOM   572  C CB  . CYS A 1 78  ? 26.993 -10.859 -20.093 1.00 34.64  ? 78  CYS A CB  1 
ATOM   573  S SG  . CYS A 1 78  ? 26.154 -12.324 -19.432 1.00 42.47  ? 78  CYS A SG  1 
ATOM   574  N N   . VAL A 1 79  ? 28.138 -10.504 -16.712 1.00 35.23  ? 79  VAL A N   1 
ATOM   575  C CA  . VAL A 1 79  ? 29.113 -10.961 -15.710 1.00 34.82  ? 79  VAL A CA  1 
ATOM   576  C C   . VAL A 1 79  ? 28.461 -11.871 -14.671 1.00 38.48  ? 79  VAL A C   1 
ATOM   577  O O   . VAL A 1 79  ? 27.244 -11.860 -14.533 1.00 38.40  ? 79  VAL A O   1 
ATOM   578  C CB  . VAL A 1 79  ? 29.879 -9.804  -15.005 1.00 35.14  ? 79  VAL A CB  1 
ATOM   579  C CG1 . VAL A 1 79  ? 30.444 -8.796  -16.000 1.00 35.67  ? 79  VAL A CG1 1 
ATOM   580  C CG2 . VAL A 1 79  ? 29.039 -9.106  -13.953 1.00 33.39  ? 79  VAL A CG2 1 
ATOM   581  N N   . PRO A 1 80  ? 29.273 -12.660 -13.928 1.00 38.69  ? 80  PRO A N   1 
ATOM   582  C CA  . PRO A 1 80  ? 28.668 -13.516 -12.918 1.00 36.62  ? 80  PRO A CA  1 
ATOM   583  C C   . PRO A 1 80  ? 28.065 -12.728 -11.756 1.00 35.61  ? 80  PRO A C   1 
ATOM   584  O O   . PRO A 1 80  ? 28.670 -11.784 -11.251 1.00 36.09  ? 80  PRO A O   1 
ATOM   585  C CB  . PRO A 1 80  ? 29.847 -14.406 -12.473 1.00 36.27  ? 80  PRO A CB  1 
ATOM   586  C CG  . PRO A 1 80  ? 30.765 -14.399 -13.649 1.00 34.51  ? 80  PRO A CG  1 
ATOM   587  C CD  . PRO A 1 80  ? 30.707 -12.976 -14.084 1.00 36.81  ? 80  PRO A CD  1 
ATOM   588  N N   . ALA A 1 81  ? 26.850 -13.100 -11.378 1.00 36.50  ? 81  ALA A N   1 
ATOM   589  C CA  . ALA A 1 81  ? 26.190 -12.515 -10.205 1.00 39.80  ? 81  ALA A CA  1 
ATOM   590  C C   . ALA A 1 81  ? 26.558 -13.322 -8.961  1.00 40.41  ? 81  ALA A C   1 
ATOM   591  O O   . ALA A 1 81  ? 26.512 -12.780 -7.866  1.00 45.54  ? 81  ALA A O   1 
ATOM   592  C CB  . ALA A 1 81  ? 24.668 -12.494 -10.392 1.00 37.06  ? 81  ALA A CB  1 
ATOM   593  N N   . SER A 1 82  ? 26.876 -14.613 -9.155  1.00 38.13  ? 82  SER A N   1 
ATOM   594  C CA  . SER A 1 82  ? 27.377 -15.524 -8.115  1.00 40.00  ? 82  SER A CA  1 
ATOM   595  C C   . SER A 1 82  ? 28.128 -16.722 -8.746  1.00 41.71  ? 82  SER A C   1 
ATOM   596  O O   . SER A 1 82  ? 28.124 -16.894 -9.976  1.00 42.37  ? 82  SER A O   1 
ATOM   597  C CB  . SER A 1 82  ? 26.225 -16.034 -7.238  1.00 34.95  ? 82  SER A CB  1 
ATOM   598  O OG  . SER A 1 82  ? 25.325 -16.788 -8.039  1.00 39.17  ? 82  SER A OG  1 
ATOM   599  N N   . TYR A 1 83  ? 28.724 -17.550 -7.880  1.00 43.05  ? 83  TYR A N   1 
ATOM   600  C CA  . TYR A 1 83  ? 29.583 -18.685 -8.245  1.00 41.97  ? 83  TYR A CA  1 
ATOM   601  C C   . TYR A 1 83  ? 29.234 -20.007 -7.549  1.00 45.74  ? 83  TYR A C   1 
ATOM   602  O O   . TYR A 1 83  ? 28.702 -20.011 -6.438  1.00 48.64  ? 83  TYR A O   1 
ATOM   603  C CB  . TYR A 1 83  ? 31.009 -18.341 -7.871  1.00 39.94  ? 83  TYR A CB  1 
ATOM   604  C CG  . TYR A 1 83  ? 31.547 -17.156 -8.607  1.00 38.87  ? 83  TYR A CG  1 
ATOM   605  C CD1 . TYR A 1 83  ? 32.162 -17.317 -9.850  1.00 38.08  ? 83  TYR A CD1 1 
ATOM   606  C CD2 . TYR A 1 83  ? 31.436 -15.858 -8.079  1.00 38.78  ? 83  TYR A CD2 1 
ATOM   607  C CE1 . TYR A 1 83  ? 32.664 -16.223 -10.549 1.00 34.69  ? 83  TYR A CE1 1 
ATOM   608  C CE2 . TYR A 1 83  ? 31.923 -14.755 -8.783  1.00 34.87  ? 83  TYR A CE2 1 
ATOM   609  C CZ  . TYR A 1 83  ? 32.545 -14.961 -10.023 1.00 35.32  ? 83  TYR A CZ  1 
ATOM   610  O OH  . TYR A 1 83  ? 33.072 -13.910 -10.748 1.00 37.49  ? 83  TYR A OH  1 
ATOM   611  N N   . ASN A 1 84  ? 29.534 -21.124 -8.207  1.00 46.11  ? 84  ASN A N   1 
ATOM   612  C CA  . ASN A 1 84  ? 29.471 -22.445 -7.578  1.00 46.85  ? 84  ASN A CA  1 
ATOM   613  C C   . ASN A 1 84  ? 30.881 -22.841 -7.202  1.00 47.26  ? 84  ASN A C   1 
ATOM   614  O O   . ASN A 1 84  ? 31.799 -22.562 -7.964  1.00 44.39  ? 84  ASN A O   1 
ATOM   615  C CB  . ASN A 1 84  ? 28.921 -23.506 -8.530  1.00 49.18  ? 84  ASN A CB  1 
ATOM   616  C CG  . ASN A 1 84  ? 27.407 -23.431 -8.706  1.00 50.20  ? 84  ASN A CG  1 
ATOM   617  O OD1 . ASN A 1 84  ? 26.917 -23.650 -9.810  1.00 52.28  ? 84  ASN A OD1 1 
ATOM   618  N ND2 . ASN A 1 84  ? 26.665 -23.151 -7.627  1.00 51.00  ? 84  ASN A ND2 1 
ATOM   619  N N   . PRO A 1 85  ? 31.057 -23.498 -6.037  1.00 48.98  ? 85  PRO A N   1 
ATOM   620  C CA  . PRO A 1 85  ? 32.395 -23.936 -5.602  1.00 49.07  ? 85  PRO A CA  1 
ATOM   621  C C   . PRO A 1 85  ? 32.974 -25.070 -6.474  1.00 47.34  ? 85  PRO A C   1 
ATOM   622  O O   . PRO A 1 85  ? 32.225 -25.902 -7.001  1.00 48.63  ? 85  PRO A O   1 
ATOM   623  C CB  . PRO A 1 85  ? 32.157 -24.422 -4.161  1.00 50.75  ? 85  PRO A CB  1 
ATOM   624  C CG  . PRO A 1 85  ? 30.721 -24.834 -4.128  1.00 53.13  ? 85  PRO A CG  1 
ATOM   625  C CD  . PRO A 1 85  ? 30.010 -23.876 -5.059  1.00 50.79  ? 85  PRO A CD  1 
ATOM   626  N N   . MET A 1 86  ? 34.293 -25.067 -6.644  1.00 45.13  ? 86  MET A N   1 
ATOM   627  C CA  . MET A 1 86  ? 34.999 -26.062 -7.466  1.00 47.82  ? 86  MET A CA  1 
ATOM   628  C C   . MET A 1 86  ? 36.184 -26.646 -6.677  1.00 42.24  ? 86  MET A C   1 
ATOM   629  O O   . MET A 1 86  ? 37.029 -25.895 -6.174  1.00 41.69  ? 86  MET A O   1 
ATOM   630  C CB  . MET A 1 86  ? 35.493 -25.391 -8.756  1.00 51.00  ? 86  MET A CB  1 
ATOM   631  C CG  . MET A 1 86  ? 36.401 -26.222 -9.655  1.00 58.65  ? 86  MET A CG  1 
ATOM   632  S SD  . MET A 1 86  ? 35.399 -27.347 -10.623 1.00 69.12  ? 86  MET A SD  1 
ATOM   633  C CE  . MET A 1 86  ? 36.572 -28.590 -11.143 1.00 61.37  ? 86  MET A CE  1 
ATOM   634  N N   . VAL A 1 87  ? 36.255 -27.973 -6.593  1.00 41.73  ? 87  VAL A N   1 
ATOM   635  C CA  . VAL A 1 87  ? 37.407 -28.647 -5.943  1.00 39.79  ? 87  VAL A CA  1 
ATOM   636  C C   . VAL A 1 87  ? 38.514 -29.006 -6.946  1.00 41.63  ? 87  VAL A C   1 
ATOM   637  O O   . VAL A 1 87  ? 38.251 -29.681 -7.953  1.00 43.74  ? 87  VAL A O   1 
ATOM   638  C CB  . VAL A 1 87  ? 36.957 -29.864 -5.109  1.00 41.83  ? 87  VAL A CB  1 
ATOM   639  C CG1 . VAL A 1 87  ? 38.158 -30.597 -4.519  1.00 40.51  ? 87  VAL A CG1 1 
ATOM   640  C CG2 . VAL A 1 87  ? 36.005 -29.417 -3.981  1.00 38.34  ? 87  VAL A CG2 1 
ATOM   641  N N   . LEU A 1 88  ? 39.731 -28.527 -6.665  1.00 37.68  ? 88  LEU A N   1 
ATOM   642  C CA  . LEU A 1 88  ? 40.931 -28.829 -7.437  1.00 40.38  ? 88  LEU A CA  1 
ATOM   643  C C   . LEU A 1 88  ? 41.978 -29.553 -6.573  1.00 42.37  ? 88  LEU A C   1 
ATOM   644  O O   . LEU A 1 88  ? 42.227 -29.166 -5.414  1.00 40.23  ? 88  LEU A O   1 
ATOM   645  C CB  . LEU A 1 88  ? 41.577 -27.531 -7.994  1.00 40.59  ? 88  LEU A CB  1 
ATOM   646  C CG  . LEU A 1 88  ? 40.850 -26.614 -8.999  1.00 39.13  ? 88  LEU A CG  1 
ATOM   647  C CD1 . LEU A 1 88  ? 41.690 -25.397 -9.312  1.00 39.23  ? 88  LEU A CD1 1 
ATOM   648  C CD2 . LEU A 1 88  ? 40.540 -27.327 -10.301 1.00 34.97  ? 88  LEU A CD2 1 
ATOM   649  N N   . ILE A 1 89  ? 42.592 -30.587 -7.160  1.00 41.24  ? 89  ILE A N   1 
ATOM   650  C CA  . ILE A 1 89  ? 43.759 -31.251 -6.591  1.00 37.27  ? 89  ILE A CA  1 
ATOM   651  C C   . ILE A 1 89  ? 44.962 -30.675 -7.283  1.00 37.25  ? 89  ILE A C   1 
ATOM   652  O O   . ILE A 1 89  ? 45.071 -30.717 -8.516  1.00 40.09  ? 89  ILE A O   1 
ATOM   653  C CB  . ILE A 1 89  ? 43.728 -32.795 -6.745  1.00 38.44  ? 89  ILE A CB  1 
ATOM   654  C CG1 . ILE A 1 89  ? 42.494 -33.337 -6.039  1.00 39.99  ? 89  ILE A CG1 1 
ATOM   655  C CG2 . ILE A 1 89  ? 44.982 -33.443 -6.121  1.00 36.84  ? 89  ILE A CG2 1 
ATOM   656  C CD1 . ILE A 1 89  ? 42.156 -34.790 -6.326  1.00 43.93  ? 89  ILE A CD1 1 
ATOM   657  N N   . GLN A 1 90  ? 45.858 -30.132 -6.478  1.00 37.13  ? 90  GLN A N   1 
ATOM   658  C CA  . GLN A 1 90  ? 47.045 -29.451 -6.965  1.00 38.05  ? 90  GLN A CA  1 
ATOM   659  C C   . GLN A 1 90  ? 48.352 -30.106 -6.522  1.00 41.28  ? 90  GLN A C   1 
ATOM   660  O O   . GLN A 1 90  ? 48.417 -30.728 -5.452  1.00 46.18  ? 90  GLN A O   1 
ATOM   661  C CB  . GLN A 1 90  ? 47.029 -28.013 -6.472  1.00 39.67  ? 90  GLN A CB  1 
ATOM   662  C CG  . GLN A 1 90  ? 45.926 -27.168 -7.089  1.00 42.57  ? 90  GLN A CG  1 
ATOM   663  C CD  . GLN A 1 90  ? 45.718 -25.858 -6.345  1.00 45.91  ? 90  GLN A CD  1 
ATOM   664  O OE1 . GLN A 1 90  ? 46.679 -25.156 -5.998  1.00 48.03  ? 90  GLN A OE1 1 
ATOM   665  N NE2 . GLN A 1 90  ? 44.461 -25.527 -6.084  1.00 50.15  ? 90  GLN A NE2 1 
ATOM   666  N N   . LYS A 1 91  ? 49.396 -29.943 -7.332  1.00 40.23  ? 91  LYS A N   1 
ATOM   667  C CA  . LYS A 1 91  ? 50.740 -30.388 -6.961  1.00 45.38  ? 91  LYS A CA  1 
ATOM   668  C C   . LYS A 1 91  ? 51.355 -29.366 -6.026  1.00 44.75  ? 91  LYS A C   1 
ATOM   669  O O   . LYS A 1 91  ? 51.197 -28.180 -6.227  1.00 46.64  ? 91  LYS A O   1 
ATOM   670  C CB  . LYS A 1 91  ? 51.626 -30.547 -8.213  1.00 47.96  ? 91  LYS A CB  1 
ATOM   671  C CG  . LYS A 1 91  ? 53.054 -31.047 -7.979  1.00 51.73  ? 91  LYS A CG  1 
ATOM   672  C CD  . LYS A 1 91  ? 53.186 -32.569 -8.105  1.00 58.80  ? 91  LYS A CD  1 
ATOM   673  C CE  . LYS A 1 91  ? 54.312 -33.159 -7.245  1.00 59.45  ? 91  LYS A CE  1 
ATOM   674  N NZ  . LYS A 1 91  ? 53.891 -33.561 -5.856  1.00 51.24  ? 91  LYS A NZ  1 
ATOM   675  N N   . THR A 1 92  ? 52.048 -29.837 -5.002  1.00 45.76  ? 92  THR A N   1 
ATOM   676  C CA  . THR A 1 92  ? 52.961 -28.994 -4.232  1.00 46.76  ? 92  THR A CA  1 
ATOM   677  C C   . THR A 1 92  ? 54.330 -29.673 -4.345  1.00 47.97  ? 92  THR A C   1 
ATOM   678  O O   . THR A 1 92  ? 54.437 -30.794 -4.872  1.00 43.64  ? 92  THR A O   1 
ATOM   679  C CB  . THR A 1 92  ? 52.528 -28.871 -2.746  1.00 44.38  ? 92  THR A CB  1 
ATOM   680  O OG1 . THR A 1 92  ? 52.471 -30.173 -2.158  1.00 48.76  ? 92  THR A OG1 1 
ATOM   681  C CG2 . THR A 1 92  ? 51.167 -28.227 -2.607  1.00 40.88  ? 92  THR A CG2 1 
ATOM   682  N N   . ASP A 1 93  ? 55.390 -29.017 -3.876  1.00 54.16  ? 93  ASP A N   1 
ATOM   683  C CA  . ASP A 1 93  ? 56.629 -29.762 -3.621  1.00 60.71  ? 93  ASP A CA  1 
ATOM   684  C C   . ASP A 1 93  ? 56.212 -30.561 -2.412  1.00 64.44  ? 93  ASP A C   1 
ATOM   685  O O   . ASP A 1 93  ? 55.444 -30.050 -1.586  1.00 78.02  ? 93  ASP A O   1 
ATOM   686  C CB  . ASP A 1 93  ? 57.801 -28.845 -3.243  1.00 66.03  ? 93  ASP A CB  1 
ATOM   687  C CG  . ASP A 1 93  ? 57.750 -27.476 -3.925  1.00 73.14  ? 93  ASP A CG  1 
ATOM   688  O OD1 . ASP A 1 93  ? 57.525 -27.399 -5.153  1.00 78.26  ? 93  ASP A OD1 1 
ATOM   689  O OD2 . ASP A 1 93  ? 57.950 -26.462 -3.222  1.00 75.45  ? 93  ASP A OD2 1 
ATOM   690  N N   . THR A 1 94  ? 56.657 -31.804 -2.285  1.00 59.63  ? 94  THR A N   1 
ATOM   691  C CA  . THR A 1 94  ? 56.371 -32.564 -1.052  1.00 56.12  ? 94  THR A CA  1 
ATOM   692  C C   . THR A 1 94  ? 55.106 -33.412 -1.167  1.00 49.61  ? 94  THR A C   1 
ATOM   693  O O   . THR A 1 94  ? 55.031 -34.482 -0.563  1.00 45.50  ? 94  THR A O   1 
ATOM   694  C CB  . THR A 1 94  ? 56.313 -31.620 0.195   1.00 65.39  ? 94  THR A CB  1 
ATOM   695  O OG1 . THR A 1 94  ? 57.534 -30.874 0.277   1.00 66.88  ? 94  THR A OG1 1 
ATOM   696  C CG2 . THR A 1 94  ? 56.139 -32.356 1.480   1.00 71.59  ? 94  THR A CG2 1 
ATOM   697  N N   . GLY A 1 95  ? 54.121 -32.950 -1.941  1.00 45.23  ? 95  GLY A N   1 
ATOM   698  C CA  . GLY A 1 95  ? 52.911 -33.730 -2.135  1.00 41.06  ? 95  GLY A CA  1 
ATOM   699  C C   . GLY A 1 95  ? 51.820 -33.059 -2.943  1.00 44.38  ? 95  GLY A C   1 
ATOM   700  O O   . GLY A 1 95  ? 52.058 -32.539 -4.030  1.00 43.17  ? 95  GLY A O   1 
ATOM   701  N N   . VAL A 1 96  ? 50.604 -33.107 -2.406  1.00 42.60  ? 96  VAL A N   1 
ATOM   702  C CA  . VAL A 1 96  ? 49.411 -32.592 -3.079  1.00 39.87  ? 96  VAL A CA  1 
ATOM   703  C C   . VAL A 1 96  ? 48.532 -31.824 -2.114  1.00 39.75  ? 96  VAL A C   1 
ATOM   704  O O   . VAL A 1 96  ? 48.574 -32.046 -0.897  1.00 39.41  ? 96  VAL A O   1 
ATOM   705  C CB  . VAL A 1 96  ? 48.529 -33.684 -3.793  1.00 37.98  ? 96  VAL A CB  1 
ATOM   706  C CG1 . VAL A 1 96  ? 49.288 -34.428 -4.874  1.00 38.60  ? 96  VAL A CG1 1 
ATOM   707  C CG2 . VAL A 1 96  ? 47.903 -34.665 -2.818  1.00 40.10  ? 96  VAL A CG2 1 
ATOM   708  N N   . SER A 1 97  ? 47.710 -30.945 -2.681  1.00 40.34  ? 97  SER A N   1 
ATOM   709  C CA  . SER A 1 97  ? 46.640 -30.297 -1.945  1.00 38.95  ? 97  SER A CA  1 
ATOM   710  C C   . SER A 1 97  ? 45.299 -30.514 -2.624  1.00 41.33  ? 97  SER A C   1 
ATOM   711  O O   . SER A 1 97  ? 45.209 -30.707 -3.844  1.00 42.63  ? 97  SER A O   1 
ATOM   712  C CB  . SER A 1 97  ? 46.917 -28.820 -1.777  1.00 38.33  ? 97  SER A CB  1 
ATOM   713  O OG  . SER A 1 97  ? 46.855 -28.196 -3.032  1.00 43.71  ? 97  SER A OG  1 
ATOM   714  N N   . LEU A 1 98  ? 44.265 -30.497 -1.796  1.00 42.65  ? 98  LEU A N   1 
ATOM   715  C CA  . LEU A 1 98  ? 42.895 -30.639 -2.206  1.00 40.39  ? 98  LEU A CA  1 
ATOM   716  C C   . LEU A 1 98  ? 42.243 -29.367 -1.698  1.00 42.12  ? 98  LEU A C   1 
ATOM   717  O O   . LEU A 1 98  ? 42.269 -29.078 -0.493  1.00 41.82  ? 98  LEU A O   1 
ATOM   718  C CB  . LEU A 1 98  ? 42.314 -31.881 -1.548  1.00 40.91  ? 98  LEU A CB  1 
ATOM   719  C CG  . LEU A 1 98  ? 40.868 -32.306 -1.785  1.00 49.78  ? 98  LEU A CG  1 
ATOM   720  C CD1 . LEU A 1 98  ? 40.681 -32.799 -3.196  1.00 54.17  ? 98  LEU A CD1 1 
ATOM   721  C CD2 . LEU A 1 98  ? 40.468 -33.440 -0.857  1.00 51.45  ? 98  LEU A CD2 1 
ATOM   722  N N   . GLN A 1 99  ? 41.688 -28.584 -2.621  1.00 41.95  ? 99  GLN A N   1 
ATOM   723  C CA  . GLN A 1 99  ? 41.221 -27.224 -2.309  1.00 43.01  ? 99  GLN A CA  1 
ATOM   724  C C   . GLN A 1 99  ? 39.975 -26.785 -3.078  1.00 43.00  ? 99  GLN A C   1 
ATOM   725  O O   . GLN A 1 99  ? 39.801 -27.127 -4.248  1.00 40.47  ? 99  GLN A O   1 
ATOM   726  C CB  . GLN A 1 99  ? 42.341 -26.224 -2.532  1.00 42.33  ? 99  GLN A CB  1 
ATOM   727  C CG  . GLN A 1 99  ? 43.372 -26.250 -1.409  1.00 51.20  ? 99  GLN A CG  1 
ATOM   728  C CD  . GLN A 1 99  ? 44.606 -25.426 -1.702  1.00 50.60  ? 99  GLN A CD  1 
ATOM   729  O OE1 . GLN A 1 99  ? 44.809 -24.960 -2.825  1.00 54.56  ? 99  GLN A OE1 1 
ATOM   730  N NE2 . GLN A 1 99  ? 45.437 -25.238 -0.690  1.00 51.38  ? 99  GLN A NE2 1 
ATOM   731  N N   . THR A 1 100 ? 39.119 -26.039 -2.378  1.00 41.14  ? 100 THR A N   1 
ATOM   732  C CA  . THR A 1 100 ? 37.892 -25.483 -2.909  1.00 43.75  ? 100 THR A CA  1 
ATOM   733  C C   . THR A 1 100 ? 38.088 -24.017 -3.343  1.00 46.11  ? 100 THR A C   1 
ATOM   734  O O   . THR A 1 100 ? 38.631 -23.216 -2.590  1.00 43.90  ? 100 THR A O   1 
ATOM   735  C CB  . THR A 1 100 ? 36.777 -25.621 -1.867  1.00 45.79  ? 100 THR A CB  1 
ATOM   736  O OG1 . THR A 1 100 ? 36.609 -27.014 -1.579  1.00 45.53  ? 100 THR A OG1 1 
ATOM   737  C CG2 . THR A 1 100 ? 35.441 -25.065 -2.399  1.00 48.10  ? 100 THR A CG2 1 
ATOM   738  N N   . TYR A 1 101 ? 37.677 -23.707 -4.575  1.00 46.00  ? 101 TYR A N   1 
ATOM   739  C CA  . TYR A 1 101 ? 37.679 -22.339 -5.140  1.00 47.05  ? 101 TYR A CA  1 
ATOM   740  C C   . TYR A 1 101 ? 36.260 -21.822 -5.276  1.00 44.06  ? 101 TYR A C   1 
ATOM   741  O O   . TYR A 1 101 ? 35.398 -22.506 -5.822  1.00 43.59  ? 101 TYR A O   1 
ATOM   742  C CB  . TYR A 1 101 ? 38.350 -22.324 -6.528  1.00 50.42  ? 101 TYR A CB  1 
ATOM   743  C CG  . TYR A 1 101 ? 39.846 -22.487 -6.461  1.00 52.25  ? 101 TYR A CG  1 
ATOM   744  C CD1 . TYR A 1 101 ? 40.424 -23.728 -6.133  1.00 53.03  ? 101 TYR A CD1 1 
ATOM   745  C CD2 . TYR A 1 101 ? 40.695 -21.397 -6.717  1.00 57.94  ? 101 TYR A CD2 1 
ATOM   746  C CE1 . TYR A 1 101 ? 41.799 -23.871 -6.042  1.00 57.27  ? 101 TYR A CE1 1 
ATOM   747  C CE2 . TYR A 1 101 ? 42.075 -21.531 -6.645  1.00 56.86  ? 101 TYR A CE2 1 
ATOM   748  C CZ  . TYR A 1 101 ? 42.619 -22.765 -6.314  1.00 59.47  ? 101 TYR A CZ  1 
ATOM   749  O OH  . TYR A 1 101 ? 43.983 -22.890 -6.240  1.00 60.88  ? 101 TYR A OH  1 
ATOM   750  N N   . ASP A 1 102 ? 36.037 -20.608 -4.792  1.00 48.16  ? 102 ASP A N   1 
ATOM   751  C CA  . ASP A 1 102 ? 34.713 -19.982 -4.787  1.00 52.50  ? 102 ASP A CA  1 
ATOM   752  C C   . ASP A 1 102 ? 34.498 -18.956 -5.910  1.00 49.42  ? 102 ASP A C   1 
ATOM   753  O O   . ASP A 1 102 ? 33.405 -18.440 -6.069  1.00 48.85  ? 102 ASP A O   1 
ATOM   754  C CB  . ASP A 1 102 ? 34.480 -19.316 -3.422  1.00 55.99  ? 102 ASP A CB  1 
ATOM   755  C CG  . ASP A 1 102 ? 34.130 -20.323 -2.336  1.00 64.23  ? 102 ASP A CG  1 
ATOM   756  O OD1 . ASP A 1 102 ? 33.505 -21.368 -2.636  1.00 70.11  ? 102 ASP A OD1 1 
ATOM   757  O OD2 . ASP A 1 102 ? 34.475 -20.068 -1.169  1.00 70.20  ? 102 ASP A OD2 1 
ATOM   758  N N   . ASP A 1 103 ? 35.553 -18.673 -6.666  1.00 44.86  ? 103 ASP A N   1 
ATOM   759  C CA  . ASP A 1 103 ? 35.585 -17.592 -7.654  1.00 43.56  ? 103 ASP A CA  1 
ATOM   760  C C   . ASP A 1 103 ? 35.901 -18.180 -9.048  1.00 39.21  ? 103 ASP A C   1 
ATOM   761  O O   . ASP A 1 103 ? 36.664 -17.609 -9.836  1.00 38.39  ? 103 ASP A O   1 
ATOM   762  C CB  . ASP A 1 103 ? 36.656 -16.565 -7.229  1.00 45.00  ? 103 ASP A CB  1 
ATOM   763  C CG  . ASP A 1 103 ? 38.104 -17.158 -7.209  1.00 48.35  ? 103 ASP A CG  1 
ATOM   764  O OD1 . ASP A 1 103 ? 38.258 -18.403 -7.208  1.00 47.68  ? 103 ASP A OD1 1 
ATOM   765  O OD2 . ASP A 1 103 ? 39.085 -16.371 -7.213  1.00 48.46  ? 103 ASP A OD2 1 
ATOM   766  N N   . LEU A 1 104 ? 35.349 -19.344 -9.342  1.00 37.72  ? 104 LEU A N   1 
ATOM   767  C CA  . LEU A 1 104 ? 35.839 -20.064 -10.519 1.00 40.22  ? 104 LEU A CA  1 
ATOM   768  C C   . LEU A 1 104 ? 34.751 -20.432 -11.509 1.00 37.05  ? 104 LEU A C   1 
ATOM   769  O O   . LEU A 1 104 ? 34.899 -20.176 -12.705 1.00 39.25  ? 104 LEU A O   1 
ATOM   770  C CB  . LEU A 1 104 ? 36.664 -21.277 -10.081 1.00 40.18  ? 104 LEU A CB  1 
ATOM   771  C CG  . LEU A 1 104 ? 37.585 -22.001 -11.046 1.00 44.84  ? 104 LEU A CG  1 
ATOM   772  C CD1 . LEU A 1 104 ? 38.685 -22.735 -10.251 1.00 40.56  ? 104 LEU A CD1 1 
ATOM   773  C CD2 . LEU A 1 104 ? 36.780 -22.945 -11.963 1.00 37.15  ? 104 LEU A CD2 1 
ATOM   774  N N   . LEU A 1 105 ? 33.681 -21.044 -11.014 1.00 35.95  ? 105 LEU A N   1 
ATOM   775  C CA  . LEU A 1 105 ? 32.563 -21.481 -11.823 1.00 37.87  ? 105 LEU A CA  1 
ATOM   776  C C   . LEU A 1 105 ? 31.381 -20.526 -11.638 1.00 43.90  ? 105 LEU A C   1 
ATOM   777  O O   . LEU A 1 105 ? 30.832 -20.434 -10.524 1.00 42.52  ? 105 LEU A O   1 
ATOM   778  C CB  . LEU A 1 105 ? 32.142 -22.881 -11.379 1.00 40.23  ? 105 LEU A CB  1 
ATOM   779  C CG  . LEU A 1 105 ? 32.437 -24.180 -12.142 1.00 42.95  ? 105 LEU A CG  1 
ATOM   780  C CD1 . LEU A 1 105 ? 33.658 -24.110 -13.049 1.00 40.71  ? 105 LEU A CD1 1 
ATOM   781  C CD2 . LEU A 1 105 ? 32.495 -25.359 -11.168 1.00 38.11  ? 105 LEU A CD2 1 
ATOM   782  N N   . ALA A 1 106 ? 30.990 -19.823 -12.710 1.00 40.71  ? 106 ALA A N   1 
ATOM   783  C CA  . ALA A 1 106 ? 29.810 -18.939 -12.655 1.00 42.00  ? 106 ALA A CA  1 
ATOM   784  C C   . ALA A 1 106 ? 28.540 -19.745 -12.373 1.00 40.68  ? 106 ALA A C   1 
ATOM   785  O O   . ALA A 1 106 ? 28.352 -20.832 -12.926 1.00 41.86  ? 106 ALA A O   1 
ATOM   786  C CB  . ALA A 1 106 ? 29.662 -18.129 -13.950 1.00 37.16  ? 106 ALA A CB  1 
ATOM   787  N N   . LYS A 1 107 ? 27.683 -19.200 -11.515 1.00 42.72  ? 107 LYS A N   1 
ATOM   788  C CA  . LYS A 1 107 ? 26.413 -19.823 -11.141 1.00 45.70  ? 107 LYS A CA  1 
ATOM   789  C C   . LYS A 1 107 ? 25.259 -19.162 -11.887 1.00 45.04  ? 107 LYS A C   1 
ATOM   790  O O   . LYS A 1 107 ? 24.452 -19.851 -12.484 1.00 52.63  ? 107 LYS A O   1 
ATOM   791  C CB  . LYS A 1 107 ? 26.204 -19.694 -9.635  1.00 45.58  ? 107 LYS A CB  1 
ATOM   792  C CG  . LYS A 1 107 ? 24.928 -20.275 -9.053  1.00 48.28  ? 107 LYS A CG  1 
ATOM   793  C CD  . LYS A 1 107 ? 24.814 -19.774 -7.610  1.00 55.34  ? 107 LYS A CD  1 
ATOM   794  C CE  . LYS A 1 107 ? 24.086 -20.717 -6.681  1.00 58.85  ? 107 LYS A CE  1 
ATOM   795  N NZ  . LYS A 1 107 ? 22.850 -21.218 -7.332  1.00 65.04  ? 107 LYS A NZ  1 
ATOM   796  N N   . ASP A 1 108 ? 25.161 -17.837 -11.804 1.00 46.25  ? 108 ASP A N   1 
ATOM   797  C CA  . ASP A 1 108 ? 24.204 -17.064 -12.616 1.00 47.29  ? 108 ASP A CA  1 
ATOM   798  C C   . ASP A 1 108 ? 24.806 -15.759 -13.117 1.00 42.18  ? 108 ASP A C   1 
ATOM   799  O O   . ASP A 1 108 ? 25.919 -15.387 -12.739 1.00 43.45  ? 108 ASP A O   1 
ATOM   800  C CB  . ASP A 1 108 ? 22.845 -16.843 -11.908 1.00 53.48  ? 108 ASP A CB  1 
ATOM   801  C CG  . ASP A 1 108 ? 22.980 -16.329 -10.488 1.00 63.71  ? 108 ASP A CG  1 
ATOM   802  O OD1 . ASP A 1 108 ? 24.010 -15.723 -10.129 1.00 72.39  ? 108 ASP A OD1 1 
ATOM   803  O OD2 . ASP A 1 108 ? 22.031 -16.539 -9.705  1.00 79.16  ? 108 ASP A OD2 1 
ATOM   804  N N   . CYS A 1 109 ? 24.061 -15.064 -13.965 1.00 41.64  ? 109 CYS A N   1 
ATOM   805  C CA  . CYS A 1 109 ? 24.611 -13.974 -14.768 1.00 41.68  ? 109 CYS A CA  1 
ATOM   806  C C   . CYS A 1 109 ? 23.716 -12.769 -14.697 1.00 41.57  ? 109 CYS A C   1 
ATOM   807  O O   . CYS A 1 109 ? 22.498 -12.898 -14.702 1.00 41.99  ? 109 CYS A O   1 
ATOM   808  C CB  . CYS A 1 109 ? 24.755 -14.439 -16.217 1.00 39.49  ? 109 CYS A CB  1 
ATOM   809  S SG  . CYS A 1 109 ? 25.845 -15.887 -16.392 1.00 49.56  ? 109 CYS A SG  1 
ATOM   810  N N   . HIS A 1 110 ? 24.320 -11.590 -14.603 1.00 41.70  ? 110 HIS A N   1 
ATOM   811  C CA  . HIS A 1 110 ? 23.569 -10.356 -14.733 1.00 38.07  ? 110 HIS A CA  1 
ATOM   812  C C   . HIS A 1 110 ? 24.364 -9.315  -15.494 1.00 41.28  ? 110 HIS A C   1 
ATOM   813  O O   . HIS A 1 110 ? 25.528 -9.565  -15.856 1.00 41.60  ? 110 HIS A O   1 
ATOM   814  C CB  . HIS A 1 110 ? 23.001 -9.853  -13.384 1.00 36.49  ? 110 HIS A CB  1 
ATOM   815  C CG  . HIS A 1 110 ? 24.021 -9.480  -12.351 1.00 35.27  ? 110 HIS A CG  1 
ATOM   816  N ND1 . HIS A 1 110 ? 25.373 -9.438  -12.593 1.00 36.80  ? 110 HIS A ND1 1 
ATOM   817  C CD2 . HIS A 1 110 ? 23.864 -9.091  -11.061 1.00 37.34  ? 110 HIS A CD2 1 
ATOM   818  C CE1 . HIS A 1 110 ? 26.005 -9.040  -11.499 1.00 34.78  ? 110 HIS A CE1 1 
ATOM   819  N NE2 . HIS A 1 110 ? 25.112 -8.818  -10.559 1.00 35.64  ? 110 HIS A NE2 1 
ATOM   820  N N   . CYS A 1 111 ? 23.728 -8.165  -15.738 1.00 38.29  ? 111 CYS A N   1 
ATOM   821  C CA  . CYS A 1 111 ? 24.269 -7.123  -16.602 1.00 39.12  ? 111 CYS A CA  1 
ATOM   822  C C   . CYS A 1 111 ? 24.799 -5.937  -15.821 1.00 39.67  ? 111 CYS A C   1 
ATOM   823  O O   . CYS A 1 111 ? 24.075 -5.292  -15.058 1.00 41.99  ? 111 CYS A O   1 
ATOM   824  C CB  . CYS A 1 111 ? 23.208 -6.693  -17.613 1.00 34.88  ? 111 CYS A CB  1 
ATOM   825  S SG  . CYS A 1 111 ? 22.924 -8.006  -18.805 1.00 39.00  ? 111 CYS A SG  1 
ATOM   826  N N   . ILE A 1 112 ? 26.064 -5.630  -16.032 1.00 39.79  ? 112 ILE A N   1 
ATOM   827  C CA  . ILE A 1 112 ? 26.712 -4.641  -15.192 1.00 46.09  ? 112 ILE A CA  1 
ATOM   828  C C   . ILE A 1 112 ? 27.521 -3.712  -16.095 1.00 44.24  ? 112 ILE A C   1 
ATOM   829  O O   . ILE A 1 112 ? 27.839 -2.602  -15.691 1.00 46.65  ? 112 ILE A O   1 
ATOM   830  C CB  . ILE A 1 112 ? 27.546 -5.355  -14.073 1.00 49.96  ? 112 ILE A CB  1 
ATOM   831  C CG1 . ILE A 1 112 ? 27.192 -4.829  -12.679 1.00 58.60  ? 112 ILE A CG1 1 
ATOM   832  C CG2 . ILE A 1 112 ? 29.032 -5.256  -14.325 1.00 48.48  ? 112 ILE A CG2 1 
ATOM   833  C CD1 . ILE A 1 112 ? 27.489 -5.787  -11.538 1.00 57.06  ? 112 ILE A CD1 1 
ATOM   834  N N   . ASP B 1 5   ? 47.363 -1.603  -13.606 1.00 111.89 ? 5   ASP B N   1 
ATOM   835  C CA  . ASP B 1 5   ? 48.647 -0.864  -13.828 1.00 108.43 ? 5   ASP B CA  1 
ATOM   836  C C   . ASP B 1 5   ? 49.558 -1.591  -14.826 1.00 98.28  ? 5   ASP B C   1 
ATOM   837  O O   . ASP B 1 5   ? 49.622 -2.821  -14.844 1.00 98.55  ? 5   ASP B O   1 
ATOM   838  C CB  . ASP B 1 5   ? 49.362 -0.610  -12.494 1.00 114.42 ? 5   ASP B CB  1 
ATOM   839  C CG  . ASP B 1 5   ? 49.355 -1.831  -11.581 1.00 120.33 ? 5   ASP B CG  1 
ATOM   840  O OD1 . ASP B 1 5   ? 48.259 -2.264  -11.153 1.00 116.34 ? 5   ASP B OD1 1 
ATOM   841  O OD2 . ASP B 1 5   ? 50.451 -2.357  -11.290 1.00 123.40 ? 5   ASP B OD2 1 
ATOM   842  N N   . HIS B 1 6   ? 50.284 -0.803  -15.615 1.00 91.74  ? 6   HIS B N   1 
ATOM   843  C CA  . HIS B 1 6   ? 50.946 -1.226  -16.870 1.00 84.53  ? 6   HIS B CA  1 
ATOM   844  C C   . HIS B 1 6   ? 50.048 -1.881  -17.914 1.00 75.75  ? 6   HIS B C   1 
ATOM   845  O O   . HIS B 1 6   ? 49.692 -3.071  -17.830 1.00 67.35  ? 6   HIS B O   1 
ATOM   846  C CB  . HIS B 1 6   ? 52.257 -2.013  -16.707 1.00 85.99  ? 6   HIS B CB  1 
ATOM   847  C CG  . HIS B 1 6   ? 52.862 -2.405  -18.026 1.00 94.57  ? 6   HIS B CG  1 
ATOM   848  N ND1 . HIS B 1 6   ? 53.515 -1.504  -18.843 1.00 95.34  ? 6   HIS B ND1 1 
ATOM   849  C CD2 . HIS B 1 6   ? 52.848 -3.581  -18.703 1.00 93.97  ? 6   HIS B CD2 1 
ATOM   850  C CE1 . HIS B 1 6   ? 53.907 -2.116  -19.948 1.00 95.29  ? 6   HIS B CE1 1 
ATOM   851  N NE2 . HIS B 1 6   ? 53.513 -3.376  -19.889 1.00 95.90  ? 6   HIS B NE2 1 
ATOM   852  N N   . CYS B 1 7   ? 49.754 -1.095  -18.934 1.00 67.26  ? 7   CYS B N   1 
ATOM   853  C CA  . CYS B 1 7   ? 48.889 -1.515  -20.010 1.00 71.38  ? 7   CYS B CA  1 
ATOM   854  C C   . CYS B 1 7   ? 49.736 -1.885  -21.223 1.00 70.12  ? 7   CYS B C   1 
ATOM   855  O O   . CYS B 1 7   ? 50.430 -1.018  -21.772 1.00 74.41  ? 7   CYS B O   1 
ATOM   856  C CB  . CYS B 1 7   ? 47.912 -0.377  -20.341 1.00 67.67  ? 7   CYS B CB  1 
ATOM   857  S SG  . CYS B 1 7   ? 46.798 -0.684  -21.730 1.00 68.93  ? 7   CYS B SG  1 
ATOM   858  N N   . PRO B 1 8   ? 49.685 -3.167  -21.649 1.00 68.04  ? 8   PRO B N   1 
ATOM   859  C CA  . PRO B 1 8   ? 50.401 -3.598  -22.861 1.00 64.82  ? 8   PRO B CA  1 
ATOM   860  C C   . PRO B 1 8   ? 49.863 -3.007  -24.181 1.00 67.23  ? 8   PRO B C   1 
ATOM   861  O O   . PRO B 1 8   ? 50.434 -3.267  -25.239 1.00 70.80  ? 8   PRO B O   1 
ATOM   862  C CB  . PRO B 1 8   ? 50.253 -5.124  -22.841 1.00 63.32  ? 8   PRO B CB  1 
ATOM   863  C CG  . PRO B 1 8   ? 49.060 -5.387  -21.990 1.00 66.27  ? 8   PRO B CG  1 
ATOM   864  C CD  . PRO B 1 8   ? 49.066 -4.309  -20.948 1.00 67.12  ? 8   PRO B CD  1 
ATOM   865  N N   . LEU B 1 9   ? 48.794 -2.218  -24.129 1.00 67.74  ? 9   LEU B N   1 
ATOM   866  C CA  . LEU B 1 9   ? 48.256 -1.568  -25.334 1.00 72.37  ? 9   LEU B CA  1 
ATOM   867  C C   . LEU B 1 9   ? 48.660 -0.084  -25.435 1.00 74.87  ? 9   LEU B C   1 
ATOM   868  O O   . LEU B 1 9   ? 48.197 0.659   -26.326 1.00 76.00  ? 9   LEU B O   1 
ATOM   869  C CB  . LEU B 1 9   ? 46.730 -1.756  -25.409 1.00 75.60  ? 9   LEU B CB  1 
ATOM   870  C CG  . LEU B 1 9   ? 46.179 -3.045  -26.040 1.00 80.55  ? 9   LEU B CG  1 
ATOM   871  C CD1 . LEU B 1 9   ? 46.311 -4.260  -25.130 1.00 77.86  ? 9   LEU B CD1 1 
ATOM   872  C CD2 . LEU B 1 9   ? 44.726 -2.847  -26.439 1.00 84.04  ? 9   LEU B CD2 1 
ATOM   873  N N   . GLY B 1 10  ? 49.538 0.327   -24.521 1.00 76.09  ? 10  GLY B N   1 
ATOM   874  C CA  . GLY B 1 10  ? 49.968 1.720   -24.399 1.00 83.43  ? 10  GLY B CA  1 
ATOM   875  C C   . GLY B 1 10  ? 49.149 2.423   -23.333 1.00 85.89  ? 10  GLY B C   1 
ATOM   876  O O   . GLY B 1 10  ? 47.979 2.082   -23.151 1.00 92.86  ? 10  GLY B O   1 
ATOM   877  N N   . PRO B 1 11  ? 49.743 3.419   -22.635 1.00 84.66  ? 11  PRO B N   1 
ATOM   878  C CA  . PRO B 1 11  ? 49.111 4.049   -21.459 1.00 77.91  ? 11  PRO B CA  1 
ATOM   879  C C   . PRO B 1 11  ? 47.680 4.560   -21.706 1.00 71.55  ? 11  PRO B C   1 
ATOM   880  O O   . PRO B 1 11  ? 47.380 5.095   -22.782 1.00 63.58  ? 11  PRO B O   1 
ATOM   881  C CB  . PRO B 1 11  ? 50.061 5.213   -21.120 1.00 82.05  ? 11  PRO B CB  1 
ATOM   882  C CG  . PRO B 1 11  ? 50.851 5.449   -22.365 1.00 86.87  ? 11  PRO B CG  1 
ATOM   883  C CD  . PRO B 1 11  ? 51.004 4.097   -22.995 1.00 87.79  ? 11  PRO B CD  1 
ATOM   884  N N   . GLY B 1 12  ? 46.810 4.344   -20.719 1.00 64.66  ? 12  GLY B N   1 
ATOM   885  C CA  . GLY B 1 12  ? 45.421 4.785   -20.775 1.00 60.86  ? 12  GLY B CA  1 
ATOM   886  C C   . GLY B 1 12  ? 44.424 3.906   -21.521 1.00 60.96  ? 12  GLY B C   1 
ATOM   887  O O   . GLY B 1 12  ? 43.225 4.076   -21.346 1.00 60.10  ? 12  GLY B O   1 
ATOM   888  N N   . ARG B 1 13  ? 44.908 2.970   -22.338 1.00 61.41  ? 13  ARG B N   1 
ATOM   889  C CA  . ARG B 1 13  ? 44.046 2.184   -23.245 1.00 60.06  ? 13  ARG B CA  1 
ATOM   890  C C   . ARG B 1 13  ? 43.398 0.930   -22.636 1.00 57.12  ? 13  ARG B C   1 
ATOM   891  O O   . ARG B 1 13  ? 42.523 0.307   -23.259 1.00 53.83  ? 13  ARG B O   1 
ATOM   892  C CB  . ARG B 1 13  ? 44.783 1.854   -24.551 1.00 67.64  ? 13  ARG B CB  1 
ATOM   893  C CG  . ARG B 1 13  ? 45.025 3.081   -25.418 1.00 76.16  ? 13  ARG B CG  1 
ATOM   894  C CD  . ARG B 1 13  ? 45.555 2.737   -26.794 1.00 80.20  ? 13  ARG B CD  1 
ATOM   895  N NE  . ARG B 1 13  ? 46.083 3.934   -27.446 1.00 88.03  ? 13  ARG B NE  1 
ATOM   896  C CZ  . ARG B 1 13  ? 47.320 4.413   -27.273 1.00 90.50  ? 13  ARG B CZ  1 
ATOM   897  N NH1 . ARG B 1 13  ? 48.190 3.808   -26.464 1.00 88.09  ? 13  ARG B NH1 1 
ATOM   898  N NH2 . ARG B 1 13  ? 47.694 5.508   -27.918 1.00 83.91  ? 13  ARG B NH2 1 
ATOM   899  N N   . CYS B 1 14  ? 43.821 0.579   -21.420 1.00 52.67  ? 14  CYS B N   1 
ATOM   900  C CA  . CYS B 1 14  ? 43.273 -0.551  -20.678 1.00 49.00  ? 14  CYS B CA  1 
ATOM   901  C C   . CYS B 1 14  ? 42.196 -0.108  -19.677 1.00 50.31  ? 14  CYS B C   1 
ATOM   902  O O   . CYS B 1 14  ? 42.095 1.079   -19.344 1.00 45.38  ? 14  CYS B O   1 
ATOM   903  C CB  . CYS B 1 14  ? 44.393 -1.293  -19.964 1.00 51.70  ? 14  CYS B CB  1 
ATOM   904  S SG  . CYS B 1 14  ? 45.524 -2.156  -21.066 1.00 62.47  ? 14  CYS B SG  1 
ATOM   905  N N   . CYS B 1 15  ? 41.393 -1.071  -19.223 1.00 50.09  ? 15  CYS B N   1 
ATOM   906  C CA  . CYS B 1 15  ? 40.334 -0.862  -18.224 1.00 50.78  ? 15  CYS B CA  1 
ATOM   907  C C   . CYS B 1 15  ? 40.774 0.033   -17.048 1.00 51.69  ? 15  CYS B C   1 
ATOM   908  O O   . CYS B 1 15  ? 41.668 -0.330  -16.271 1.00 49.74  ? 15  CYS B O   1 
ATOM   909  C CB  . CYS B 1 15  ? 39.853 -2.218  -17.707 1.00 51.23  ? 15  CYS B CB  1 
ATOM   910  S SG  . CYS B 1 15  ? 38.367 -2.217  -16.673 1.00 50.09  ? 15  CYS B SG  1 
ATOM   911  N N   . ARG B 1 16  ? 40.140 1.206   -16.959 1.00 48.65  ? 16  ARG B N   1 
ATOM   912  C CA  . ARG B 1 16  ? 40.425 2.225   -15.946 1.00 47.84  ? 16  ARG B CA  1 
ATOM   913  C C   . ARG B 1 16  ? 39.210 3.143   -15.797 1.00 49.38  ? 16  ARG B C   1 
ATOM   914  O O   . ARG B 1 16  ? 38.279 3.108   -16.611 1.00 48.12  ? 16  ARG B O   1 
ATOM   915  C CB  . ARG B 1 16  ? 41.673 3.059   -16.314 1.00 47.80  ? 16  ARG B CB  1 
ATOM   916  C CG  . ARG B 1 16  ? 41.592 3.713   -17.682 1.00 48.15  ? 16  ARG B CG  1 
ATOM   917  C CD  . ARG B 1 16  ? 42.658 4.761   -17.893 1.00 56.80  ? 16  ARG B CD  1 
ATOM   918  N NE  . ARG B 1 16  ? 42.058 6.096   -17.873 1.00 64.69  ? 16  ARG B NE  1 
ATOM   919  C CZ  . ARG B 1 16  ? 41.902 6.868   -18.942 1.00 62.71  ? 16  ARG B CZ  1 
ATOM   920  N NH1 . ARG B 1 16  ? 41.321 8.052   -18.815 1.00 67.22  ? 16  ARG B NH1 1 
ATOM   921  N NH2 . ARG B 1 16  ? 42.329 6.465   -20.132 1.00 62.34  ? 16  ARG B NH2 1 
ATOM   922  N N   . LEU B 1 17  ? 39.243 3.973   -14.761 1.00 47.16  ? 17  LEU B N   1 
ATOM   923  C CA  . LEU B 1 17  ? 38.186 4.919   -14.483 1.00 48.55  ? 17  LEU B CA  1 
ATOM   924  C C   . LEU B 1 17  ? 38.166 6.109   -15.455 1.00 49.30  ? 17  LEU B C   1 
ATOM   925  O O   . LEU B 1 17  ? 39.180 6.753   -15.680 1.00 50.04  ? 17  LEU B O   1 
ATOM   926  C CB  . LEU B 1 17  ? 38.322 5.411   -13.044 1.00 48.88  ? 17  LEU B CB  1 
ATOM   927  C CG  . LEU B 1 17  ? 37.040 5.892   -12.383 1.00 50.25  ? 17  LEU B CG  1 
ATOM   928  C CD1 . LEU B 1 17  ? 36.044 4.736   -12.241 1.00 49.93  ? 17  LEU B CD1 1 
ATOM   929  C CD2 . LEU B 1 17  ? 37.399 6.502   -11.032 1.00 51.10  ? 17  LEU B CD2 1 
ATOM   930  N N   . HIS B 1 18  ? 37.003 6.367   -16.044 1.00 47.19  ? 18  HIS B N   1 
ATOM   931  C CA  . HIS B 1 18  ? 36.774 7.574   -16.835 1.00 49.04  ? 18  HIS B CA  1 
ATOM   932  C C   . HIS B 1 18  ? 35.680 8.370   -16.170 1.00 48.68  ? 18  HIS B C   1 
ATOM   933  O O   . HIS B 1 18  ? 34.861 7.840   -15.389 1.00 51.72  ? 18  HIS B O   1 
ATOM   934  C CB  . HIS B 1 18  ? 36.298 7.252   -18.253 1.00 50.56  ? 18  HIS B CB  1 
ATOM   935  C CG  . HIS B 1 18  ? 37.374 6.809   -19.184 1.00 52.12  ? 18  HIS B CG  1 
ATOM   936  N ND1 . HIS B 1 18  ? 38.091 5.642   -19.000 1.00 55.17  ? 18  HIS B ND1 1 
ATOM   937  C CD2 . HIS B 1 18  ? 37.821 7.349   -20.341 1.00 52.21  ? 18  HIS B CD2 1 
ATOM   938  C CE1 . HIS B 1 18  ? 38.950 5.497   -19.992 1.00 50.32  ? 18  HIS B CE1 1 
ATOM   939  N NE2 . HIS B 1 18  ? 38.810 6.521   -20.815 1.00 55.10  ? 18  HIS B NE2 1 
ATOM   940  N N   . THR B 1 19  ? 35.663 9.646   -16.502 1.00 48.11  ? 19  THR B N   1 
ATOM   941  C CA  . THR B 1 19  ? 34.595 10.523  -16.099 1.00 49.40  ? 19  THR B CA  1 
ATOM   942  C C   . THR B 1 19  ? 33.902 10.987  -17.362 1.00 50.25  ? 19  THR B C   1 
ATOM   943  O O   . THR B 1 19  ? 34.544 11.486  -18.289 1.00 48.83  ? 19  THR B O   1 
ATOM   944  C CB  . THR B 1 19  ? 35.143 11.698  -15.276 1.00 50.71  ? 19  THR B CB  1 
ATOM   945  O OG1 . THR B 1 19  ? 35.927 11.170  -14.206 1.00 50.84  ? 19  THR B OG1 1 
ATOM   946  C CG2 . THR B 1 19  ? 34.010 12.532  -14.703 1.00 51.99  ? 19  THR B CG2 1 
ATOM   947  N N   . VAL B 1 20  ? 32.593 10.761  -17.409 1.00 49.92  ? 20  VAL B N   1 
ATOM   948  C CA  . VAL B 1 20  ? 31.765 11.194  -18.527 1.00 48.16  ? 20  VAL B CA  1 
ATOM   949  C C   . VAL B 1 20  ? 30.686 12.123  -17.965 1.00 49.39  ? 20  VAL B C   1 
ATOM   950  O O   . VAL B 1 20  ? 29.915 11.730  -17.072 1.00 45.83  ? 20  VAL B O   1 
ATOM   951  C CB  . VAL B 1 20  ? 31.135 9.982   -19.263 1.00 49.90  ? 20  VAL B CB  1 
ATOM   952  C CG1 . VAL B 1 20  ? 30.374 10.434  -20.509 1.00 44.22  ? 20  VAL B CG1 1 
ATOM   953  C CG2 . VAL B 1 20  ? 32.208 8.957   -19.625 1.00 45.34  ? 20  VAL B CG2 1 
ATOM   954  N N   . ARG B 1 21  ? 30.667 13.354  -18.475 1.00 51.22  ? 21  ARG B N   1 
ATOM   955  C CA  . ARG B 1 21  ? 29.720 14.384  -18.048 1.00 55.59  ? 21  ARG B CA  1 
ATOM   956  C C   . ARG B 1 21  ? 28.357 14.051  -18.648 1.00 53.72  ? 21  ARG B C   1 
ATOM   957  O O   . ARG B 1 21  ? 28.237 13.876  -19.851 1.00 53.13  ? 21  ARG B O   1 
ATOM   958  C CB  . ARG B 1 21  ? 30.185 15.769  -18.521 1.00 64.28  ? 21  ARG B CB  1 
ATOM   959  C CG  . ARG B 1 21  ? 29.603 16.959  -17.761 1.00 75.21  ? 21  ARG B CG  1 
ATOM   960  C CD  . ARG B 1 21  ? 29.133 18.095  -18.677 1.00 83.37  ? 21  ARG B CD  1 
ATOM   961  N NE  . ARG B 1 21  ? 30.205 18.744  -19.447 1.00 94.15  ? 21  ARG B NE  1 
ATOM   962  C CZ  . ARG B 1 21  ? 30.859 19.856  -19.093 1.00 101.08 ? 21  ARG B CZ  1 
ATOM   963  N NH1 . ARG B 1 21  ? 30.583 20.490  -17.958 1.00 105.35 ? 21  ARG B NH1 1 
ATOM   964  N NH2 . ARG B 1 21  ? 31.808 20.341  -19.885 1.00 102.42 ? 21  ARG B NH2 1 
ATOM   965  N N   . ALA B 1 22  ? 27.335 13.943  -17.809 1.00 49.78  ? 22  ALA B N   1 
ATOM   966  C CA  . ALA B 1 22  ? 25.994 13.683  -18.307 1.00 50.23  ? 22  ALA B CA  1 
ATOM   967  C C   . ALA B 1 22  ? 25.000 14.649  -17.681 1.00 50.76  ? 22  ALA B C   1 
ATOM   968  O O   . ALA B 1 22  ? 25.057 14.925  -16.478 1.00 50.44  ? 22  ALA B O   1 
ATOM   969  C CB  . ALA B 1 22  ? 25.588 12.240  -18.035 1.00 48.42  ? 22  ALA B CB  1 
ATOM   970  N N   . SER B 1 23  ? 24.095 15.149  -18.511 1.00 48.60  ? 23  SER B N   1 
ATOM   971  C CA  . SER B 1 23  ? 22.983 15.972  -18.059 1.00 50.40  ? 23  SER B CA  1 
ATOM   972  C C   . SER B 1 23  ? 21.853 15.021  -17.637 1.00 49.51  ? 23  SER B C   1 
ATOM   973  O O   . SER B 1 23  ? 21.888 13.811  -17.963 1.00 48.98  ? 23  SER B O   1 
ATOM   974  C CB  . SER B 1 23  ? 22.521 16.870  -19.209 1.00 45.27  ? 23  SER B CB  1 
ATOM   975  O OG  . SER B 1 23  ? 21.859 16.060  -20.173 1.00 42.36  ? 23  SER B OG  1 
ATOM   976  N N   . LEU B 1 24  ? 20.843 15.566  -16.951 1.00 47.28  ? 24  LEU B N   1 
ATOM   977  C CA  . LEU B 1 24  ? 19.662 14.783  -16.538 1.00 46.32  ? 24  LEU B CA  1 
ATOM   978  C C   . LEU B 1 24  ? 18.921 14.187  -17.707 1.00 44.14  ? 24  LEU B C   1 
ATOM   979  O O   . LEU B 1 24  ? 18.373 13.073  -17.613 1.00 46.35  ? 24  LEU B O   1 
ATOM   980  C CB  . LEU B 1 24  ? 18.701 15.602  -15.673 1.00 44.04  ? 24  LEU B CB  1 
ATOM   981  C CG  . LEU B 1 24  ? 19.236 16.199  -14.370 1.00 47.65  ? 24  LEU B CG  1 
ATOM   982  C CD1 . LEU B 1 24  ? 18.065 16.795  -13.597 1.00 45.82  ? 24  LEU B CD1 1 
ATOM   983  C CD2 . LEU B 1 24  ? 19.988 15.187  -13.503 1.00 47.52  ? 24  LEU B CD2 1 
ATOM   984  N N   . GLU B 1 25  ? 18.915 14.938  -18.804 1.00 48.75  ? 25  GLU B N   1 
ATOM   985  C CA  . GLU B 1 25  ? 18.304 14.508  -20.058 1.00 50.26  ? 25  GLU B CA  1 
ATOM   986  C C   . GLU B 1 25  ? 18.992 13.248  -20.605 1.00 46.09  ? 25  GLU B C   1 
ATOM   987  O O   . GLU B 1 25  ? 18.323 12.256  -20.914 1.00 43.45  ? 25  GLU B O   1 
ATOM   988  C CB  . GLU B 1 25  ? 18.351 15.647  -21.079 1.00 57.21  ? 25  GLU B CB  1 
ATOM   989  C CG  . GLU B 1 25  ? 17.266 15.582  -22.136 1.00 67.39  ? 25  GLU B CG  1 
ATOM   990  C CD  . GLU B 1 25  ? 15.884 15.753  -21.530 1.00 86.39  ? 25  GLU B CD  1 
ATOM   991  O OE1 . GLU B 1 25  ? 15.527 16.899  -21.143 1.00 90.58  ? 25  GLU B OE1 1 
ATOM   992  O OE2 . GLU B 1 25  ? 15.167 14.729  -21.425 1.00 88.35  ? 25  GLU B OE2 1 
ATOM   993  N N   . ASP B 1 26  ? 20.318 13.288  -20.693 1.00 42.49  ? 26  ASP B N   1 
ATOM   994  C CA  . ASP B 1 26  ? 21.122 12.107  -21.085 1.00 48.51  ? 26  ASP B CA  1 
ATOM   995  C C   . ASP B 1 26  ? 20.723 10.821  -20.348 1.00 48.44  ? 26  ASP B C   1 
ATOM   996  O O   . ASP B 1 26  ? 20.635 9.734   -20.942 1.00 51.65  ? 26  ASP B O   1 
ATOM   997  C CB  . ASP B 1 26  ? 22.618 12.388  -20.861 1.00 46.23  ? 26  ASP B CB  1 
ATOM   998  C CG  . ASP B 1 26  ? 23.116 13.571  -21.670 1.00 50.07  ? 26  ASP B CG  1 
ATOM   999  O OD1 . ASP B 1 26  ? 22.386 13.988  -22.600 1.00 51.83  ? 26  ASP B OD1 1 
ATOM   1000 O OD2 . ASP B 1 26  ? 24.221 14.091  -21.379 1.00 52.55  ? 26  ASP B OD2 1 
ATOM   1001 N N   . LEU B 1 27  ? 20.475 10.973  -19.050 1.00 47.60  ? 27  LEU B N   1 
ATOM   1002 C CA  . LEU B 1 27  ? 20.164 9.871   -18.152 1.00 42.00  ? 27  LEU B CA  1 
ATOM   1003 C C   . LEU B 1 27  ? 18.695 9.480   -18.197 1.00 42.60  ? 27  LEU B C   1 
ATOM   1004 O O   . LEU B 1 27  ? 18.325 8.385   -17.757 1.00 43.32  ? 27  LEU B O   1 
ATOM   1005 C CB  . LEU B 1 27  ? 20.561 10.277  -16.743 1.00 40.59  ? 27  LEU B CB  1 
ATOM   1006 C CG  . LEU B 1 27  ? 22.011 10.116  -16.271 1.00 42.07  ? 27  LEU B CG  1 
ATOM   1007 C CD1 . LEU B 1 27  ? 23.030 9.588   -17.274 1.00 41.32  ? 27  LEU B CD1 1 
ATOM   1008 C CD2 . LEU B 1 27  ? 22.503 11.378  -15.616 1.00 43.29  ? 27  LEU B CD2 1 
ATOM   1009 N N   . GLY B 1 28  ? 17.846 10.355  -18.728 1.00 40.39  ? 28  GLY B N   1 
ATOM   1010 C CA  . GLY B 1 28  ? 16.399 10.101  -18.689 1.00 38.82  ? 28  GLY B CA  1 
ATOM   1011 C C   . GLY B 1 28  ? 15.847 10.364  -17.287 1.00 39.12  ? 28  GLY B C   1 
ATOM   1012 O O   . GLY B 1 28  ? 14.883 9.739   -16.881 1.00 36.69  ? 28  GLY B O   1 
ATOM   1013 N N   . TRP B 1 29  ? 16.460 11.312  -16.575 1.00 41.95  ? 29  TRP B N   1 
ATOM   1014 C CA  . TRP B 1 29  ? 16.109 11.646  -15.188 1.00 47.07  ? 29  TRP B CA  1 
ATOM   1015 C C   . TRP B 1 29  ? 15.469 13.039  -15.011 1.00 50.23  ? 29  TRP B C   1 
ATOM   1016 O O   . TRP B 1 29  ? 15.139 13.427  -13.878 1.00 48.54  ? 29  TRP B O   1 
ATOM   1017 C CB  . TRP B 1 29  ? 17.370 11.629  -14.322 1.00 42.37  ? 29  TRP B CB  1 
ATOM   1018 C CG  . TRP B 1 29  ? 18.003 10.320  -14.092 1.00 40.29  ? 29  TRP B CG  1 
ATOM   1019 C CD1 . TRP B 1 29  ? 17.613 9.102   -14.577 1.00 42.23  ? 29  TRP B CD1 1 
ATOM   1020 C CD2 . TRP B 1 29  ? 19.198 10.097  -13.360 1.00 37.67  ? 29  TRP B CD2 1 
ATOM   1021 N NE1 . TRP B 1 29  ? 18.480 8.128   -14.159 1.00 40.92  ? 29  TRP B NE1 1 
ATOM   1022 C CE2 . TRP B 1 29  ? 19.470 8.713   -13.414 1.00 39.23  ? 29  TRP B CE2 1 
ATOM   1023 C CE3 . TRP B 1 29  ? 20.050 10.931  -12.623 1.00 37.66  ? 29  TRP B CE3 1 
ATOM   1024 C CZ2 . TRP B 1 29  ? 20.572 8.128   -12.746 1.00 39.99  ? 29  TRP B CZ2 1 
ATOM   1025 C CZ3 . TRP B 1 29  ? 21.159 10.358  -11.973 1.00 41.18  ? 29  TRP B CZ3 1 
ATOM   1026 C CH2 . TRP B 1 29  ? 21.403 8.962   -12.038 1.00 39.55  ? 29  TRP B CH2 1 
ATOM   1027 N N   . ALA B 1 30  ? 15.318 13.789  -16.103 1.00 50.50  ? 30  ALA B N   1 
ATOM   1028 C CA  . ALA B 1 30  ? 14.846 15.186  -16.029 1.00 52.74  ? 30  ALA B CA  1 
ATOM   1029 C C   . ALA B 1 30  ? 13.418 15.357  -15.486 1.00 49.88  ? 30  ALA B C   1 
ATOM   1030 O O   . ALA B 1 30  ? 13.067 16.439  -15.043 1.00 57.94  ? 30  ALA B O   1 
ATOM   1031 C CB  . ALA B 1 30  ? 15.018 15.897  -17.371 1.00 53.21  ? 30  ALA B CB  1 
ATOM   1032 N N   . ASP B 1 31  ? 12.620 14.293  -15.499 1.00 49.49  ? 31  ASP B N   1 
ATOM   1033 C CA  . ASP B 1 31  ? 11.302 14.297  -14.862 1.00 54.23  ? 31  ASP B CA  1 
ATOM   1034 C C   . ASP B 1 31  ? 11.318 14.154  -13.342 1.00 54.68  ? 31  ASP B C   1 
ATOM   1035 O O   . ASP B 1 31  ? 10.407 14.657  -12.693 1.00 55.04  ? 31  ASP B O   1 
ATOM   1036 C CB  . ASP B 1 31  ? 10.407 13.177  -15.419 1.00 61.34  ? 31  ASP B CB  1 
ATOM   1037 C CG  . ASP B 1 31  ? 9.797  13.510  -16.787 1.00 70.72  ? 31  ASP B CG  1 
ATOM   1038 O OD1 . ASP B 1 31  ? 10.082 14.594  -17.359 1.00 73.70  ? 31  ASP B OD1 1 
ATOM   1039 O OD2 . ASP B 1 31  ? 9.021  12.667  -17.301 1.00 71.70  ? 31  ASP B OD2 1 
ATOM   1040 N N   . TRP B 1 32  ? 12.295 13.432  -12.776 1.00 50.90  ? 32  TRP B N   1 
ATOM   1041 C CA  . TRP B 1 32  ? 12.280 13.144  -11.315 1.00 48.66  ? 32  TRP B CA  1 
ATOM   1042 C C   . TRP B 1 32  ? 13.452 13.704  -10.509 1.00 45.73  ? 32  TRP B C   1 
ATOM   1043 O O   . TRP B 1 32  ? 13.325 13.893  -9.303  1.00 43.36  ? 32  TRP B O   1 
ATOM   1044 C CB  . TRP B 1 32  ? 12.002 11.656  -10.981 1.00 51.55  ? 32  TRP B CB  1 
ATOM   1045 C CG  . TRP B 1 32  ? 12.991 10.693  -11.556 1.00 60.09  ? 32  TRP B CG  1 
ATOM   1046 C CD1 . TRP B 1 32  ? 13.011 10.206  -12.842 1.00 59.01  ? 32  TRP B CD1 1 
ATOM   1047 C CD2 . TRP B 1 32  ? 14.104 10.083  -10.876 1.00 59.43  ? 32  TRP B CD2 1 
ATOM   1048 N NE1 . TRP B 1 32  ? 14.072 9.344   -13.006 1.00 60.60  ? 32  TRP B NE1 1 
ATOM   1049 C CE2 . TRP B 1 32  ? 14.755 9.238   -11.818 1.00 59.98  ? 32  TRP B CE2 1 
ATOM   1050 C CE3 . TRP B 1 32  ? 14.608 10.154  -9.564  1.00 57.21  ? 32  TRP B CE3 1 
ATOM   1051 C CZ2 . TRP B 1 32  ? 15.903 8.482   -11.493 1.00 53.30  ? 32  TRP B CZ2 1 
ATOM   1052 C CZ3 . TRP B 1 32  ? 15.750 9.398   -9.239  1.00 58.43  ? 32  TRP B CZ3 1 
ATOM   1053 C CH2 . TRP B 1 32  ? 16.378 8.572   -10.204 1.00 55.61  ? 32  TRP B CH2 1 
ATOM   1054 N N   . VAL B 1 33  ? 14.558 14.031  -11.170 1.00 39.23  ? 33  VAL B N   1 
ATOM   1055 C CA  . VAL B 1 33  ? 15.691 14.558  -10.460 1.00 41.18  ? 33  VAL B CA  1 
ATOM   1056 C C   . VAL B 1 33  ? 15.647 16.063  -10.567 1.00 43.94  ? 33  VAL B C   1 
ATOM   1057 O O   . VAL B 1 33  ? 15.421 16.591  -11.632 1.00 45.46  ? 33  VAL B O   1 
ATOM   1058 C CB  . VAL B 1 33  ? 17.038 14.010  -10.983 1.00 39.51  ? 33  VAL B CB  1 
ATOM   1059 C CG1 . VAL B 1 33  ? 18.221 14.634  -10.225 1.00 38.13  ? 33  VAL B CG1 1 
ATOM   1060 C CG2 . VAL B 1 33  ? 17.057 12.498  -10.875 1.00 39.03  ? 33  VAL B CG2 1 
ATOM   1061 N N   . LEU B 1 34  ? 15.882 16.732  -9.445  1.00 46.28  ? 34  LEU B N   1 
ATOM   1062 C CA  . LEU B 1 34  ? 15.947 18.184  -9.399  1.00 49.75  ? 34  LEU B CA  1 
ATOM   1063 C C   . LEU B 1 34  ? 17.400 18.667  -9.334  1.00 52.07  ? 34  LEU B C   1 
ATOM   1064 O O   . LEU B 1 34  ? 17.779 19.554  -10.083 1.00 58.63  ? 34  LEU B O   1 
ATOM   1065 C CB  . LEU B 1 34  ? 15.112 18.724  -8.215  1.00 45.93  ? 34  LEU B CB  1 
ATOM   1066 C CG  . LEU B 1 34  ? 13.580 18.499  -8.234  1.00 46.01  ? 34  LEU B CG  1 
ATOM   1067 C CD1 . LEU B 1 34  ? 13.084 18.410  -6.804  1.00 48.58  ? 34  LEU B CD1 1 
ATOM   1068 C CD2 . LEU B 1 34  ? 12.808 19.577  -8.997  1.00 38.51  ? 34  LEU B CD2 1 
ATOM   1069 N N   . SER B 1 35  ? 18.198 18.070  -8.452  1.00 51.91  ? 35  SER B N   1 
ATOM   1070 C CA  . SER B 1 35  ? 19.618 18.404  -8.284  1.00 55.54  ? 35  SER B CA  1 
ATOM   1071 C C   . SER B 1 35  ? 20.433 17.110  -8.017  1.00 55.24  ? 35  SER B C   1 
ATOM   1072 O O   . SER B 1 35  ? 19.924 16.216  -7.353  1.00 51.43  ? 35  SER B O   1 
ATOM   1073 C CB  . SER B 1 35  ? 19.790 19.398  -7.133  1.00 59.17  ? 35  SER B CB  1 
ATOM   1074 O OG  . SER B 1 35  ? 21.153 19.727  -6.923  1.00 66.70  ? 35  SER B OG  1 
ATOM   1075 N N   . PRO B 1 36  ? 21.667 16.985  -8.522  1.00 54.63  ? 36  PRO B N   1 
ATOM   1076 C CA  . PRO B 1 36  ? 22.347 17.995  -9.348  1.00 52.97  ? 36  PRO B CA  1 
ATOM   1077 C C   . PRO B 1 36  ? 21.819 18.063  -10.784 1.00 52.66  ? 36  PRO B C   1 
ATOM   1078 O O   . PRO B 1 36  ? 21.065 17.186  -11.206 1.00 50.56  ? 36  PRO B O   1 
ATOM   1079 C CB  . PRO B 1 36  ? 23.817 17.542  -9.303  1.00 56.74  ? 36  PRO B CB  1 
ATOM   1080 C CG  . PRO B 1 36  ? 23.733 16.050  -9.153  1.00 54.62  ? 36  PRO B CG  1 
ATOM   1081 C CD  . PRO B 1 36  ? 22.488 15.769  -8.342  1.00 53.03  ? 36  PRO B CD  1 
ATOM   1082 N N   . ARG B 1 37  ? 22.210 19.111  -11.510 1.00 57.24  ? 37  ARG B N   1 
ATOM   1083 C CA  . ARG B 1 37  ? 21.724 19.373  -12.878 1.00 56.41  ? 37  ARG B CA  1 
ATOM   1084 C C   . ARG B 1 37  ? 22.433 18.506  -13.896 1.00 52.75  ? 37  ARG B C   1 
ATOM   1085 O O   . ARG B 1 37  ? 21.911 18.214  -14.976 1.00 51.24  ? 37  ARG B O   1 
ATOM   1086 C CB  . ARG B 1 37  ? 21.916 20.855  -13.228 1.00 61.44  ? 37  ARG B CB  1 
ATOM   1087 C CG  . ARG B 1 37  ? 21.241 21.835  -12.263 1.00 66.59  ? 37  ARG B CG  1 
ATOM   1088 C CD  . ARG B 1 37  ? 19.751 21.556  -12.137 1.00 68.51  ? 37  ARG B CD  1 
ATOM   1089 N NE  . ARG B 1 37  ? 19.092 21.426  -13.446 1.00 71.98  ? 37  ARG B NE  1 
ATOM   1090 C CZ  . ARG B 1 37  ? 17.955 20.763  -13.683 1.00 74.25  ? 37  ARG B CZ  1 
ATOM   1091 N NH1 . ARG B 1 37  ? 17.470 20.719  -14.922 1.00 75.08  ? 37  ARG B NH1 1 
ATOM   1092 N NH2 . ARG B 1 37  ? 17.297 20.134  -12.705 1.00 76.63  ? 37  ARG B NH2 1 
ATOM   1093 N N   . GLU B 1 38  ? 23.645 18.120  -13.526 1.00 54.22  ? 38  GLU B N   1 
ATOM   1094 C CA  . GLU B 1 38  ? 24.469 17.223  -14.299 1.00 56.05  ? 38  GLU B CA  1 
ATOM   1095 C C   . GLU B 1 38  ? 25.386 16.410  -13.387 1.00 54.79  ? 38  GLU B C   1 
ATOM   1096 O O   . GLU B 1 38  ? 25.690 16.807  -12.254 1.00 54.28  ? 38  GLU B O   1 
ATOM   1097 C CB  . GLU B 1 38  ? 25.246 17.974  -15.384 1.00 58.03  ? 38  GLU B CB  1 
ATOM   1098 C CG  . GLU B 1 38  ? 26.196 19.047  -14.911 1.00 67.20  ? 38  GLU B CG  1 
ATOM   1099 C CD  . GLU B 1 38  ? 27.093 19.507  -16.045 1.00 80.83  ? 38  GLU B CD  1 
ATOM   1100 O OE1 . GLU B 1 38  ? 26.590 19.709  -17.182 1.00 81.88  ? 38  GLU B OE1 1 
ATOM   1101 O OE2 . GLU B 1 38  ? 28.311 19.650  -15.801 1.00 84.25  ? 38  GLU B OE2 1 
ATOM   1102 N N   . VAL B 1 39  ? 25.790 15.244  -13.873 1.00 52.56  ? 39  VAL B N   1 
ATOM   1103 C CA  . VAL B 1 39  ? 26.566 14.328  -13.051 1.00 48.50  ? 39  VAL B CA  1 
ATOM   1104 C C   . VAL B 1 39  ? 27.841 13.886  -13.737 1.00 47.44  ? 39  VAL B C   1 
ATOM   1105 O O   . VAL B 1 39  ? 27.860 13.574  -14.926 1.00 46.94  ? 39  VAL B O   1 
ATOM   1106 C CB  . VAL B 1 39  ? 25.692 13.194  -12.408 1.00 50.11  ? 39  VAL B CB  1 
ATOM   1107 C CG1 . VAL B 1 39  ? 24.348 13.030  -13.098 1.00 45.65  ? 39  VAL B CG1 1 
ATOM   1108 C CG2 . VAL B 1 39  ? 26.433 11.871  -12.225 1.00 50.87  ? 39  VAL B CG2 1 
ATOM   1109 N N   . GLN B 1 40  ? 28.918 13.941  -12.972 1.00 49.28  ? 40  GLN B N   1 
ATOM   1110 C CA  . GLN B 1 40  ? 30.205 13.458  -13.415 1.00 51.09  ? 40  GLN B CA  1 
ATOM   1111 C C   . GLN B 1 40  ? 30.193 11.966  -13.164 1.00 50.57  ? 40  GLN B C   1 
ATOM   1112 O O   . GLN B 1 40  ? 30.568 11.508  -12.080 1.00 51.60  ? 40  GLN B O   1 
ATOM   1113 C CB  . GLN B 1 40  ? 31.321 14.125  -12.606 1.00 56.97  ? 40  GLN B CB  1 
ATOM   1114 C CG  . GLN B 1 40  ? 31.311 15.640  -12.642 1.00 63.59  ? 40  GLN B CG  1 
ATOM   1115 C CD  . GLN B 1 40  ? 31.499 16.173  -14.049 1.00 70.99  ? 40  GLN B CD  1 
ATOM   1116 O OE1 . GLN B 1 40  ? 32.490 15.874  -14.708 1.00 74.74  ? 40  GLN B OE1 1 
ATOM   1117 N NE2 . GLN B 1 40  ? 30.541 16.958  -14.517 1.00 72.41  ? 40  GLN B NE2 1 
ATOM   1118 N N   . VAL B 1 41  ? 29.719 11.210  -14.151 1.00 50.32  ? 41  VAL B N   1 
ATOM   1119 C CA  . VAL B 1 41  ? 29.634 9.749   -14.018 1.00 45.33  ? 41  VAL B CA  1 
ATOM   1120 C C   . VAL B 1 41  ? 31.021 9.117   -14.111 1.00 43.13  ? 41  VAL B C   1 
ATOM   1121 O O   . VAL B 1 41  ? 31.698 9.233   -15.131 1.00 44.32  ? 41  VAL B O   1 
ATOM   1122 C CB  . VAL B 1 41  ? 28.708 9.106   -15.060 1.00 45.92  ? 41  VAL B CB  1 
ATOM   1123 C CG1 . VAL B 1 41  ? 28.521 7.622   -14.741 1.00 42.32  ? 41  VAL B CG1 1 
ATOM   1124 C CG2 . VAL B 1 41  ? 27.367 9.831   -15.105 1.00 43.51  ? 41  VAL B CG2 1 
ATOM   1125 N N   . THR B 1 42  ? 31.435 8.479   -13.022 1.00 39.93  ? 42  THR B N   1 
ATOM   1126 C CA  . THR B 1 42  ? 32.646 7.686   -13.026 1.00 41.45  ? 42  THR B CA  1 
ATOM   1127 C C   . THR B 1 42  ? 32.280 6.277   -13.513 1.00 42.66  ? 42  THR B C   1 
ATOM   1128 O O   . THR B 1 42  ? 31.291 5.678   -13.083 1.00 36.13  ? 42  THR B O   1 
ATOM   1129 C CB  . THR B 1 42  ? 33.379 7.677   -11.660 1.00 41.31  ? 42  THR B CB  1 
ATOM   1130 O OG1 . THR B 1 42  ? 32.453 7.370   -10.614 1.00 43.95  ? 42  THR B OG1 1 
ATOM   1131 C CG2 . THR B 1 42  ? 34.031 9.036   -11.370 1.00 36.50  ? 42  THR B CG2 1 
ATOM   1132 N N   . MET B 1 43  ? 33.087 5.762   -14.433 1.00 43.18  ? 43  MET B N   1 
ATOM   1133 C CA  . MET B 1 43  ? 32.710 4.591   -15.187 1.00 45.55  ? 43  MET B CA  1 
ATOM   1134 C C   . MET B 1 43  ? 33.956 3.897   -15.688 1.00 43.35  ? 43  MET B C   1 
ATOM   1135 O O   . MET B 1 43  ? 34.930 4.548   -16.061 1.00 41.51  ? 43  MET B O   1 
ATOM   1136 C CB  . MET B 1 43  ? 31.875 5.068   -16.360 1.00 48.57  ? 43  MET B CB  1 
ATOM   1137 C CG  . MET B 1 43  ? 31.231 4.010   -17.215 1.00 55.97  ? 43  MET B CG  1 
ATOM   1138 S SD  . MET B 1 43  ? 30.577 4.865   -18.672 1.00 61.35  ? 43  MET B SD  1 
ATOM   1139 C CE  . MET B 1 43  ? 29.194 5.760   -17.974 1.00 53.94  ? 43  MET B CE  1 
ATOM   1140 N N   . CYS B 1 44  ? 33.905 2.573   -15.715 1.00 42.89  ? 44  CYS B N   1 
ATOM   1141 C CA  . CYS B 1 44  ? 35.035 1.763   -16.131 1.00 42.66  ? 44  CYS B CA  1 
ATOM   1142 C C   . CYS B 1 44  ? 35.024 1.507   -17.646 1.00 41.51  ? 44  CYS B C   1 
ATOM   1143 O O   . CYS B 1 44  ? 34.065 0.970   -18.182 1.00 39.70  ? 44  CYS B O   1 
ATOM   1144 C CB  . CYS B 1 44  ? 35.018 0.467   -15.350 1.00 43.21  ? 44  CYS B CB  1 
ATOM   1145 S SG  . CYS B 1 44  ? 35.272 0.734   -13.583 1.00 48.12  ? 44  CYS B SG  1 
ATOM   1146 N N   . ILE B 1 45  ? 36.097 1.915   -18.323 1.00 39.12  ? 45  ILE B N   1 
ATOM   1147 C CA  . ILE B 1 45  ? 36.236 1.778   -19.768 1.00 39.72  ? 45  ILE B CA  1 
ATOM   1148 C C   . ILE B 1 45  ? 37.671 1.360   -20.128 1.00 42.64  ? 45  ILE B C   1 
ATOM   1149 O O   . ILE B 1 45  ? 38.629 1.806   -19.486 1.00 45.83  ? 45  ILE B O   1 
ATOM   1150 C CB  . ILE B 1 45  ? 35.947 3.114   -20.482 1.00 37.52  ? 45  ILE B CB  1 
ATOM   1151 C CG1 . ILE B 1 45  ? 34.614 3.722   -20.025 1.00 37.32  ? 45  ILE B CG1 1 
ATOM   1152 C CG2 . ILE B 1 45  ? 35.999 2.948   -22.008 1.00 36.92  ? 45  ILE B CG2 1 
ATOM   1153 C CD1 . ILE B 1 45  ? 34.299 5.064   -20.666 1.00 38.84  ? 45  ILE B CD1 1 
ATOM   1154 N N   . GLY B 1 46  ? 37.803 0.526   -21.163 1.00 40.51  ? 46  GLY B N   1 
ATOM   1155 C CA  . GLY B 1 46  ? 39.100 0.155   -21.730 1.00 45.07  ? 46  GLY B CA  1 
ATOM   1156 C C   . GLY B 1 46  ? 39.243 -1.349  -21.947 1.00 49.76  ? 46  GLY B C   1 
ATOM   1157 O O   . GLY B 1 46  ? 38.411 -2.154  -21.471 1.00 43.55  ? 46  GLY B O   1 
ATOM   1158 N N   . ALA B 1 47  ? 40.310 -1.732  -22.649 1.00 46.71  ? 47  ALA B N   1 
ATOM   1159 C CA  . ALA B 1 47  ? 40.552 -3.136  -22.975 1.00 46.80  ? 47  ALA B CA  1 
ATOM   1160 C C   . ALA B 1 47  ? 40.940 -3.960  -21.743 1.00 46.22  ? 47  ALA B C   1 
ATOM   1161 O O   . ALA B 1 47  ? 41.395 -3.415  -20.724 1.00 43.77  ? 47  ALA B O   1 
ATOM   1162 C CB  . ALA B 1 47  ? 41.605 -3.251  -24.080 1.00 43.07  ? 47  ALA B CB  1 
ATOM   1163 N N   . CYS B 1 48  ? 40.765 -5.273  -21.858 1.00 45.99  ? 48  CYS B N   1 
ATOM   1164 C CA  . CYS B 1 48  ? 41.101 -6.229  -20.805 1.00 48.02  ? 48  CYS B CA  1 
ATOM   1165 C C   . CYS B 1 48  ? 41.996 -7.331  -21.388 1.00 47.29  ? 48  CYS B C   1 
ATOM   1166 O O   . CYS B 1 48  ? 41.534 -8.456  -21.583 1.00 44.08  ? 48  CYS B O   1 
ATOM   1167 C CB  . CYS B 1 48  ? 39.811 -6.848  -20.226 1.00 50.86  ? 48  CYS B CB  1 
ATOM   1168 S SG  . CYS B 1 48  ? 38.928 -5.795  -19.054 1.00 51.65  ? 48  CYS B SG  1 
ATOM   1169 N N   . PRO B 1 49  ? 43.276 -7.010  -21.683 1.00 49.91  ? 49  PRO B N   1 
ATOM   1170 C CA  . PRO B 1 49  ? 44.178 -8.047  -22.204 1.00 50.16  ? 49  PRO B CA  1 
ATOM   1171 C C   . PRO B 1 49  ? 44.663 -8.977  -21.093 1.00 52.93  ? 49  PRO B C   1 
ATOM   1172 O O   . PRO B 1 49  ? 44.428 -8.687  -19.903 1.00 47.56  ? 49  PRO B O   1 
ATOM   1173 C CB  . PRO B 1 49  ? 45.346 -7.241  -22.779 1.00 53.04  ? 49  PRO B CB  1 
ATOM   1174 C CG  . PRO B 1 49  ? 45.345 -5.957  -22.016 1.00 54.10  ? 49  PRO B CG  1 
ATOM   1175 C CD  . PRO B 1 49  ? 43.971 -5.718  -21.478 1.00 48.47  ? 49  PRO B CD  1 
ATOM   1176 N N   . SER B 1 50  ? 45.319 -10.082 -21.484 1.00 58.14  ? 50  SER B N   1 
ATOM   1177 C CA  . SER B 1 50  ? 45.835 -11.104 -20.553 1.00 57.72  ? 50  SER B CA  1 
ATOM   1178 C C   . SER B 1 50  ? 46.496 -10.519 -19.332 1.00 54.60  ? 50  SER B C   1 
ATOM   1179 O O   . SER B 1 50  ? 47.308 -9.592  -19.442 1.00 54.30  ? 50  SER B O   1 
ATOM   1180 C CB  . SER B 1 50  ? 46.830 -12.028 -21.241 1.00 60.23  ? 50  SER B CB  1 
ATOM   1181 O OG  . SER B 1 50  ? 46.151 -12.893 -22.121 1.00 69.83  ? 50  SER B OG  1 
ATOM   1182 N N   . GLN B 1 51  ? 46.120 -11.056 -18.174 1.00 57.39  ? 51  GLN B N   1 
ATOM   1183 C CA  . GLN B 1 51  ? 46.674 -10.655 -16.875 1.00 59.91  ? 51  GLN B CA  1 
ATOM   1184 C C   . GLN B 1 51  ? 46.437 -9.189  -16.483 1.00 55.80  ? 51  GLN B C   1 
ATOM   1185 O O   . GLN B 1 51  ? 46.986 -8.732  -15.482 1.00 56.99  ? 51  GLN B O   1 
ATOM   1186 C CB  . GLN B 1 51  ? 48.179 -11.012 -16.742 1.00 70.00  ? 51  GLN B CB  1 
ATOM   1187 C CG  . GLN B 1 51  ? 48.536 -12.498 -16.753 1.00 80.08  ? 51  GLN B CG  1 
ATOM   1188 C CD  . GLN B 1 51  ? 49.382 -12.900 -17.958 1.00 91.70  ? 51  GLN B CD  1 
ATOM   1189 O OE1 . GLN B 1 51  ? 48.974 -13.743 -18.760 1.00 101.17 ? 51  GLN B OE1 1 
ATOM   1190 N NE2 . GLN B 1 51  ? 50.568 -12.299 -18.090 1.00 87.94  ? 51  GLN B NE2 1 
ATOM   1191 N N   . PHE B 1 52  ? 45.638 -8.436  -17.241 1.00 49.64  ? 52  PHE B N   1 
ATOM   1192 C CA  . PHE B 1 52  ? 45.343 -7.074  -16.797 1.00 50.28  ? 52  PHE B CA  1 
ATOM   1193 C C   . PHE B 1 52  ? 44.153 -7.020  -15.812 1.00 52.45  ? 52  PHE B C   1 
ATOM   1194 O O   . PHE B 1 52  ? 43.016 -7.356  -16.189 1.00 49.66  ? 52  PHE B O   1 
ATOM   1195 C CB  . PHE B 1 52  ? 45.138 -6.112  -17.954 1.00 47.50  ? 52  PHE B CB  1 
ATOM   1196 C CG  . PHE B 1 52  ? 45.033 -4.693  -17.512 1.00 52.66  ? 52  PHE B CG  1 
ATOM   1197 C CD1 . PHE B 1 52  ? 46.184 -3.915  -17.350 1.00 53.16  ? 52  PHE B CD1 1 
ATOM   1198 C CD2 . PHE B 1 52  ? 43.786 -4.129  -17.209 1.00 53.18  ? 52  PHE B CD2 1 
ATOM   1199 C CE1 . PHE B 1 52  ? 46.093 -2.597  -16.914 1.00 55.05  ? 52  PHE B CE1 1 
ATOM   1200 C CE2 . PHE B 1 52  ? 43.689 -2.806  -16.777 1.00 53.35  ? 52  PHE B CE2 1 
ATOM   1201 C CZ  . PHE B 1 52  ? 44.846 -2.042  -16.620 1.00 56.00  ? 52  PHE B CZ  1 
ATOM   1202 N N   . ARG B 1 53  ? 44.451 -6.605  -14.570 1.00 49.43  ? 53  ARG B N   1 
ATOM   1203 C CA  . ARG B 1 53  ? 43.501 -6.426  -13.467 1.00 48.03  ? 53  ARG B CA  1 
ATOM   1204 C C   . ARG B 1 53  ? 42.436 -7.532  -13.386 1.00 51.30  ? 53  ARG B C   1 
ATOM   1205 O O   . ARG B 1 53  ? 41.247 -7.254  -13.137 1.00 48.70  ? 53  ARG B O   1 
ATOM   1206 C CB  . ARG B 1 53  ? 42.814 -5.050  -13.549 1.00 52.53  ? 53  ARG B CB  1 
ATOM   1207 C CG  . ARG B 1 53  ? 43.719 -3.828  -13.554 1.00 57.72  ? 53  ARG B CG  1 
ATOM   1208 C CD  . ARG B 1 53  ? 44.421 -3.583  -12.234 1.00 75.65  ? 53  ARG B CD  1 
ATOM   1209 N NE  . ARG B 1 53  ? 43.517 -3.085  -11.196 1.00 86.95  ? 53  ARG B NE  1 
ATOM   1210 C CZ  . ARG B 1 53  ? 43.116 -1.820  -11.076 1.00 91.85  ? 53  ARG B CZ  1 
ATOM   1211 N NH1 . ARG B 1 53  ? 43.512 -0.888  -11.946 1.00 99.27  ? 53  ARG B NH1 1 
ATOM   1212 N NH2 . ARG B 1 53  ? 42.299 -1.487  -10.083 1.00 85.80  ? 53  ARG B NH2 1 
ATOM   1213 N N   . ALA B 1 54  ? 42.863 -8.774  -13.620 1.00 43.61  ? 54  ALA B N   1 
ATOM   1214 C CA  . ALA B 1 54  ? 41.990 -9.946  -13.522 1.00 45.01  ? 54  ALA B CA  1 
ATOM   1215 C C   . ALA B 1 54  ? 41.271 -9.946  -12.160 1.00 44.13  ? 54  ALA B C   1 
ATOM   1216 O O   . ALA B 1 54  ? 41.923 -9.846  -11.127 1.00 45.73  ? 54  ALA B O   1 
ATOM   1217 C CB  . ALA B 1 54  ? 42.794 -11.226 -13.730 1.00 36.66  ? 54  ALA B CB  1 
ATOM   1218 N N   . ALA B 1 55  ? 39.936 -9.999  -12.158 1.00 44.43  ? 55  ALA B N   1 
ATOM   1219 C CA  . ALA B 1 55  ? 39.171 -9.856  -10.883 1.00 45.55  ? 55  ALA B CA  1 
ATOM   1220 C C   . ALA B 1 55  ? 39.383 -11.022 -9.933  1.00 42.57  ? 55  ALA B C   1 
ATOM   1221 O O   . ALA B 1 55  ? 39.347 -10.830 -8.724  1.00 46.52  ? 55  ALA B O   1 
ATOM   1222 C CB  . ALA B 1 55  ? 37.678 -9.684  -11.133 1.00 40.05  ? 55  ALA B CB  1 
ATOM   1223 N N   . ASN B 1 56  ? 39.579 -12.215 -10.508 1.00 39.35  ? 56  ASN B N   1 
ATOM   1224 C CA  . ASN B 1 56  ? 39.560 -13.492 -9.801  1.00 40.86  ? 56  ASN B CA  1 
ATOM   1225 C C   . ASN B 1 56  ? 40.006 -14.630 -10.744 1.00 40.59  ? 56  ASN B C   1 
ATOM   1226 O O   . ASN B 1 56  ? 40.459 -14.382 -11.870 1.00 44.66  ? 56  ASN B O   1 
ATOM   1227 C CB  . ASN B 1 56  ? 38.156 -13.741 -9.198  1.00 39.66  ? 56  ASN B CB  1 
ATOM   1228 C CG  . ASN B 1 56  ? 37.042 -13.748 -10.248 1.00 41.26  ? 56  ASN B CG  1 
ATOM   1229 O OD1 . ASN B 1 56  ? 37.296 -13.851 -11.453 1.00 40.31  ? 56  ASN B OD1 1 
ATOM   1230 N ND2 . ASN B 1 56  ? 35.790 -13.663 -9.784  1.00 40.36  ? 56  ASN B ND2 1 
ATOM   1231 N N   . MET B 1 57  ? 39.866 -15.873 -10.297 1.00 46.77  ? 57  MET B N   1 
ATOM   1232 C CA  . MET B 1 57  ? 40.266 -17.039 -11.098 1.00 46.31  ? 57  MET B CA  1 
ATOM   1233 C C   . MET B 1 57  ? 39.457 -17.133 -12.404 1.00 43.99  ? 57  MET B C   1 
ATOM   1234 O O   . MET B 1 57  ? 40.021 -17.351 -13.480 1.00 43.17  ? 57  MET B O   1 
ATOM   1235 C CB  . MET B 1 57  ? 40.149 -18.327 -10.266 1.00 54.66  ? 57  MET B CB  1 
ATOM   1236 C CG  . MET B 1 57  ? 40.841 -19.557 -10.860 1.00 67.36  ? 57  MET B CG  1 
ATOM   1237 S SD  . MET B 1 57  ? 42.627 -19.398 -11.180 1.00 78.56  ? 57  MET B SD  1 
ATOM   1238 C CE  . MET B 1 57  ? 43.274 -19.272 -9.500  1.00 76.89  ? 57  MET B CE  1 
ATOM   1239 N N   . HIS B 1 58  ? 38.137 -16.957 -12.298 1.00 40.67  ? 58  HIS B N   1 
ATOM   1240 C CA  . HIS B 1 58  ? 37.261 -16.886 -13.450 1.00 34.83  ? 58  HIS B CA  1 
ATOM   1241 C C   . HIS B 1 58  ? 37.758 -15.936 -14.538 1.00 34.51  ? 58  HIS B C   1 
ATOM   1242 O O   . HIS B 1 58  ? 37.729 -16.290 -15.708 1.00 38.53  ? 58  HIS B O   1 
ATOM   1243 C CB  . HIS B 1 58  ? 35.875 -16.466 -13.023 1.00 34.42  ? 58  HIS B CB  1 
ATOM   1244 C CG  . HIS B 1 58  ? 34.827 -16.797 -14.032 1.00 33.70  ? 58  HIS B CG  1 
ATOM   1245 N ND1 . HIS B 1 58  ? 34.349 -15.873 -14.941 1.00 34.71  ? 58  HIS B ND1 1 
ATOM   1246 C CD2 . HIS B 1 58  ? 34.183 -17.953 -14.293 1.00 28.87  ? 58  HIS B CD2 1 
ATOM   1247 C CE1 . HIS B 1 58  ? 33.430 -16.442 -15.698 1.00 30.49  ? 58  HIS B CE1 1 
ATOM   1248 N NE2 . HIS B 1 58  ? 33.305 -17.702 -15.317 1.00 34.50  ? 58  HIS B NE2 1 
ATOM   1249 N N   . ALA B 1 59  ? 38.219 -14.746 -14.163 1.00 33.28  ? 59  ALA B N   1 
ATOM   1250 C CA  . ALA B 1 59  ? 38.735 -13.806 -15.137 1.00 35.86  ? 59  ALA B CA  1 
ATOM   1251 C C   . ALA B 1 59  ? 39.990 -14.312 -15.893 1.00 38.63  ? 59  ALA B C   1 
ATOM   1252 O O   . ALA B 1 59  ? 40.154 -14.035 -17.087 1.00 40.02  ? 59  ALA B O   1 
ATOM   1253 C CB  . ALA B 1 59  ? 38.989 -12.460 -14.496 1.00 33.66  ? 59  ALA B CB  1 
ATOM   1254 N N   . GLN B 1 60  ? 40.862 -15.037 -15.194 1.00 44.54  ? 60  GLN B N   1 
ATOM   1255 C CA  . GLN B 1 60  ? 42.069 -15.662 -15.795 1.00 44.93  ? 60  GLN B CA  1 
ATOM   1256 C C   . GLN B 1 60  ? 41.663 -16.716 -16.801 1.00 41.23  ? 60  GLN B C   1 
ATOM   1257 O O   . GLN B 1 60  ? 42.186 -16.755 -17.902 1.00 40.54  ? 60  GLN B O   1 
ATOM   1258 C CB  . GLN B 1 60  ? 42.967 -16.284 -14.721 1.00 46.53  ? 60  GLN B CB  1 
ATOM   1259 C CG  . GLN B 1 60  ? 43.662 -15.251 -13.862 1.00 57.11  ? 60  GLN B CG  1 
ATOM   1260 C CD  . GLN B 1 60  ? 44.171 -15.809 -12.548 1.00 66.79  ? 60  GLN B CD  1 
ATOM   1261 O OE1 . GLN B 1 60  ? 44.909 -16.801 -12.515 1.00 77.46  ? 60  GLN B OE1 1 
ATOM   1262 N NE2 . GLN B 1 60  ? 43.792 -15.161 -11.450 1.00 67.16  ? 60  GLN B NE2 1 
ATOM   1263 N N   . ILE B 1 61  ? 40.698 -17.549 -16.423 1.00 41.33  ? 61  ILE B N   1 
ATOM   1264 C CA  . ILE B 1 61  ? 40.176 -18.579 -17.306 1.00 41.12  ? 61  ILE B CA  1 
ATOM   1265 C C   . ILE B 1 61  ? 39.564 -17.971 -18.564 1.00 45.79  ? 61  ILE B C   1 
ATOM   1266 O O   . ILE B 1 61  ? 39.790 -18.459 -19.678 1.00 44.31  ? 61  ILE B O   1 
ATOM   1267 C CB  . ILE B 1 61  ? 39.127 -19.417 -16.581 1.00 41.55  ? 61  ILE B CB  1 
ATOM   1268 C CG1 . ILE B 1 61  ? 39.815 -20.266 -15.494 1.00 45.44  ? 61  ILE B CG1 1 
ATOM   1269 C CG2 . ILE B 1 61  ? 38.341 -20.289 -17.564 1.00 35.77  ? 61  ILE B CG2 1 
ATOM   1270 C CD1 . ILE B 1 61  ? 38.851 -21.023 -14.589 1.00 51.25  ? 61  ILE B CD1 1 
ATOM   1271 N N   . LYS B 1 62  ? 38.800 -16.899 -18.368 1.00 47.02  ? 62  LYS B N   1 
ATOM   1272 C CA  . LYS B 1 62  ? 38.164 -16.185 -19.453 1.00 49.74  ? 62  LYS B CA  1 
ATOM   1273 C C   . LYS B 1 62  ? 39.221 -15.692 -20.468 1.00 48.57  ? 62  LYS B C   1 
ATOM   1274 O O   . LYS B 1 62  ? 39.076 -15.906 -21.670 1.00 44.33  ? 62  LYS B O   1 
ATOM   1275 C CB  . LYS B 1 62  ? 37.313 -15.037 -18.890 1.00 54.14  ? 62  LYS B CB  1 
ATOM   1276 C CG  . LYS B 1 62  ? 36.567 -14.217 -19.943 1.00 59.36  ? 62  LYS B CG  1 
ATOM   1277 C CD  . LYS B 1 62  ? 35.296 -14.900 -20.434 1.00 57.79  ? 62  LYS B CD  1 
ATOM   1278 C CE  . LYS B 1 62  ? 34.252 -14.960 -19.343 1.00 59.55  ? 62  LYS B CE  1 
ATOM   1279 N NZ  . LYS B 1 62  ? 33.975 -13.594 -18.827 1.00 60.42  ? 62  LYS B NZ  1 
ATOM   1280 N N   . THR B 1 63  ? 40.270 -15.054 -19.960 1.00 45.86  ? 63  THR B N   1 
ATOM   1281 C CA  . THR B 1 63  ? 41.430 -14.625 -20.734 1.00 48.84  ? 63  THR B CA  1 
ATOM   1282 C C   . THR B 1 63  ? 42.062 -15.773 -21.565 1.00 50.56  ? 63  THR B C   1 
ATOM   1283 O O   . THR B 1 63  ? 42.252 -15.631 -22.770 1.00 48.98  ? 63  THR B O   1 
ATOM   1284 C CB  . THR B 1 63  ? 42.421 -13.949 -19.767 1.00 53.11  ? 63  THR B CB  1 
ATOM   1285 O OG1 . THR B 1 63  ? 42.093 -12.561 -19.682 1.00 58.15  ? 63  THR B OG1 1 
ATOM   1286 C CG2 . THR B 1 63  ? 43.869 -14.123 -20.186 1.00 60.41  ? 63  THR B CG2 1 
ATOM   1287 N N   . SER B 1 64  ? 42.326 -16.915 -20.933 1.00 48.39  ? 64  SER B N   1 
ATOM   1288 C CA  . SER B 1 64  ? 42.952 -18.052 -21.618 1.00 50.82  ? 64  SER B CA  1 
ATOM   1289 C C   . SER B 1 64  ? 42.061 -18.662 -22.698 1.00 51.31  ? 64  SER B C   1 
ATOM   1290 O O   . SER B 1 64  ? 42.545 -19.024 -23.791 1.00 53.32  ? 64  SER B O   1 
ATOM   1291 C CB  . SER B 1 64  ? 43.365 -19.121 -20.603 1.00 49.13  ? 64  SER B CB  1 
ATOM   1292 O OG  . SER B 1 64  ? 44.240 -18.542 -19.642 1.00 50.77  ? 64  SER B OG  1 
ATOM   1293 N N   . LEU B 1 65  ? 40.772 -18.775 -22.381 1.00 48.06  ? 65  LEU B N   1 
ATOM   1294 C CA  . LEU B 1 65  ? 39.784 -19.338 -23.285 1.00 44.77  ? 65  LEU B CA  1 
ATOM   1295 C C   . LEU B 1 65  ? 39.428 -18.447 -24.463 1.00 49.33  ? 65  LEU B C   1 
ATOM   1296 O O   . LEU B 1 65  ? 39.139 -18.962 -25.552 1.00 50.68  ? 65  LEU B O   1 
ATOM   1297 C CB  . LEU B 1 65  ? 38.538 -19.732 -22.525 1.00 44.73  ? 65  LEU B CB  1 
ATOM   1298 C CG  . LEU B 1 65  ? 38.371 -21.231 -22.209 1.00 51.59  ? 65  LEU B CG  1 
ATOM   1299 C CD1 . LEU B 1 65  ? 39.686 -22.011 -22.134 1.00 48.96  ? 65  LEU B CD1 1 
ATOM   1300 C CD2 . LEU B 1 65  ? 37.508 -21.485 -20.976 1.00 43.24  ? 65  LEU B CD2 1 
ATOM   1301 N N   . HIS B 1 66  ? 39.447 -17.126 -24.255 1.00 45.90  ? 66  HIS B N   1 
ATOM   1302 C CA  . HIS B 1 66  ? 39.179 -16.172 -25.333 1.00 45.46  ? 66  HIS B CA  1 
ATOM   1303 C C   . HIS B 1 66  ? 40.316 -16.157 -26.359 1.00 47.10  ? 66  HIS B C   1 
ATOM   1304 O O   . HIS B 1 66  ? 40.061 -16.146 -27.565 1.00 48.47  ? 66  HIS B O   1 
ATOM   1305 C CB  . HIS B 1 66  ? 38.895 -14.760 -24.794 1.00 42.66  ? 66  HIS B CB  1 
ATOM   1306 C CG  . HIS B 1 66  ? 38.841 -13.709 -25.861 1.00 43.45  ? 66  HIS B CG  1 
ATOM   1307 N ND1 . HIS B 1 66  ? 39.807 -12.727 -25.994 1.00 42.11  ? 66  HIS B ND1 1 
ATOM   1308 C CD2 . HIS B 1 66  ? 37.977 -13.528 -26.888 1.00 39.39  ? 66  HIS B CD2 1 
ATOM   1309 C CE1 . HIS B 1 66  ? 39.510 -11.959 -27.028 1.00 41.14  ? 66  HIS B CE1 1 
ATOM   1310 N NE2 . HIS B 1 66  ? 38.403 -12.422 -27.584 1.00 41.22  ? 66  HIS B NE2 1 
ATOM   1311 N N   . ARG B 1 67  ? 41.553 -16.155 -25.859 1.00 51.81  ? 67  ARG B N   1 
ATOM   1312 C CA  . ARG B 1 67  ? 42.766 -16.295 -26.656 1.00 54.11  ? 67  ARG B CA  1 
ATOM   1313 C C   . ARG B 1 67  ? 42.709 -17.569 -27.517 1.00 56.64  ? 67  ARG B C   1 
ATOM   1314 O O   . ARG B 1 67  ? 43.092 -17.543 -28.677 1.00 54.57  ? 67  ARG B O   1 
ATOM   1315 C CB  . ARG B 1 67  ? 43.966 -16.310 -25.720 1.00 58.02  ? 67  ARG B CB  1 
ATOM   1316 C CG  . ARG B 1 67  ? 45.320 -16.431 -26.386 1.00 68.21  ? 67  ARG B CG  1 
ATOM   1317 C CD  . ARG B 1 67  ? 46.389 -16.693 -25.338 1.00 79.23  ? 67  ARG B CD  1 
ATOM   1318 N NE  . ARG B 1 67  ? 46.791 -15.457 -24.660 1.00 91.23  ? 67  ARG B NE  1 
ATOM   1319 C CZ  . ARG B 1 67  ? 47.844 -14.706 -24.995 1.00 93.43  ? 67  ARG B CZ  1 
ATOM   1320 N NH1 . ARG B 1 67  ? 48.109 -13.599 -24.314 1.00 91.37  ? 67  ARG B NH1 1 
ATOM   1321 N NH2 . ARG B 1 67  ? 48.640 -15.050 -26.003 1.00 97.96  ? 67  ARG B NH2 1 
ATOM   1322 N N   . LEU B 1 68  ? 42.155 -18.642 -26.958 1.00 59.34  ? 68  LEU B N   1 
ATOM   1323 C CA  . LEU B 1 68  ? 42.087 -19.956 -27.604 1.00 61.69  ? 68  LEU B CA  1 
ATOM   1324 C C   . LEU B 1 68  ? 40.871 -20.177 -28.526 1.00 61.60  ? 68  LEU B C   1 
ATOM   1325 O O   . LEU B 1 68  ? 41.018 -20.697 -29.623 1.00 67.90  ? 68  LEU B O   1 
ATOM   1326 C CB  . LEU B 1 68  ? 42.137 -21.038 -26.526 1.00 58.33  ? 68  LEU B CB  1 
ATOM   1327 C CG  . LEU B 1 68  ? 42.266 -22.496 -26.925 1.00 62.28  ? 68  LEU B CG  1 
ATOM   1328 C CD1 . LEU B 1 68  ? 43.727 -22.841 -27.166 1.00 58.29  ? 68  LEU B CD1 1 
ATOM   1329 C CD2 . LEU B 1 68  ? 41.654 -23.375 -25.839 1.00 57.68  ? 68  LEU B CD2 1 
ATOM   1330 N N   . LYS B 1 69  ? 39.679 -19.811 -28.075 1.00 63.20  ? 69  LYS B N   1 
ATOM   1331 C CA  . LYS B 1 69  ? 38.465 -19.926 -28.879 1.00 57.45  ? 69  LYS B CA  1 
ATOM   1332 C C   . LYS B 1 69  ? 37.773 -18.561 -29.011 1.00 58.71  ? 69  LYS B C   1 
ATOM   1333 O O   . LYS B 1 69  ? 36.676 -18.389 -28.466 1.00 58.56  ? 69  LYS B O   1 
ATOM   1334 C CB  . LYS B 1 69  ? 37.477 -20.909 -28.246 1.00 60.93  ? 69  LYS B CB  1 
ATOM   1335 C CG  . LYS B 1 69  ? 37.845 -22.384 -28.254 1.00 70.71  ? 69  LYS B CG  1 
ATOM   1336 C CD  . LYS B 1 69  ? 36.566 -23.227 -28.319 1.00 75.62  ? 69  LYS B CD  1 
ATOM   1337 C CE  . LYS B 1 69  ? 36.564 -24.421 -27.371 1.00 75.81  ? 69  LYS B CE  1 
ATOM   1338 N NZ  . LYS B 1 69  ? 37.637 -25.409 -27.671 1.00 76.49  ? 69  LYS B NZ  1 
ATOM   1339 N N   . PRO B 1 70  ? 38.374 -17.592 -29.756 1.00 57.89  ? 70  PRO B N   1 
ATOM   1340 C CA  . PRO B 1 70  ? 37.721 -16.269 -29.898 1.00 58.64  ? 70  PRO B CA  1 
ATOM   1341 C C   . PRO B 1 70  ? 36.286 -16.342 -30.425 1.00 58.65  ? 70  PRO B C   1 
ATOM   1342 O O   . PRO B 1 70  ? 35.486 -15.447 -30.151 1.00 54.76  ? 70  PRO B O   1 
ATOM   1343 C CB  . PRO B 1 70  ? 38.608 -15.537 -30.914 1.00 58.40  ? 70  PRO B CB  1 
ATOM   1344 C CG  . PRO B 1 70  ? 39.899 -16.262 -30.915 1.00 59.35  ? 70  PRO B CG  1 
ATOM   1345 C CD  . PRO B 1 70  ? 39.575 -17.689 -30.607 1.00 60.50  ? 70  PRO B CD  1 
ATOM   1346 N N   . ASP B 1 71  ? 36.010 -17.413 -31.177 1.00 62.80  ? 71  ASP B N   1 
ATOM   1347 C CA  A ASP B 1 71  ? 34.682 -17.639 -31.748 0.50 62.84  ? 71  ASP B CA  1 
ATOM   1348 C CA  B ASP B 1 71  ? 34.706 -17.757 -31.757 0.50 61.98  ? 71  ASP B CA  1 
ATOM   1349 C C   . ASP B 1 71  ? 33.612 -17.971 -30.712 1.00 63.91  ? 71  ASP B C   1 
ATOM   1350 O O   . ASP B 1 71  ? 32.470 -17.547 -30.881 1.00 67.61  ? 71  ASP B O   1 
ATOM   1351 C CB  A ASP B 1 71  ? 34.721 -18.714 -32.837 0.50 62.68  ? 71  ASP B CB  1 
ATOM   1352 C CB  B ASP B 1 71  ? 34.833 -19.029 -32.637 0.50 60.05  ? 71  ASP B CB  1 
ATOM   1353 C CG  A ASP B 1 71  ? 35.252 -18.186 -34.159 0.50 61.82  ? 71  ASP B CG  1 
ATOM   1354 C CG  B ASP B 1 71  ? 35.832 -20.072 -32.070 0.50 57.94  ? 71  ASP B CG  1 
ATOM   1355 O OD1 A ASP B 1 71  ? 35.576 -16.978 -34.245 0.50 54.90  ? 71  ASP B OD1 1 
ATOM   1356 O OD1 B ASP B 1 71  ? 37.057 -19.843 -32.148 0.50 53.54  ? 71  ASP B OD1 1 
ATOM   1357 O OD2 A ASP B 1 71  ? 35.339 -18.990 -35.112 0.50 63.07  ? 71  ASP B OD2 1 
ATOM   1358 O OD2 B ASP B 1 71  ? 35.399 -21.136 -31.571 0.50 56.83  ? 71  ASP B OD2 1 
ATOM   1359 N N   . THR B 1 72  ? 33.980 -18.682 -29.644 1.00 63.92  ? 72  THR B N   1 
ATOM   1360 C CA  . THR B 1 72  ? 33.036 -19.139 -28.611 1.00 60.25  ? 72  THR B CA  1 
ATOM   1361 C C   . THR B 1 72  ? 33.013 -18.206 -27.383 1.00 57.78  ? 72  THR B C   1 
ATOM   1362 O O   . THR B 1 72  ? 31.935 -17.855 -26.883 1.00 53.19  ? 72  THR B O   1 
ATOM   1363 C CB  . THR B 1 72  ? 33.375 -20.580 -28.156 1.00 62.91  ? 72  THR B CB  1 
ATOM   1364 O OG1 . THR B 1 72  ? 33.758 -21.370 -29.292 1.00 67.42  ? 72  THR B OG1 1 
ATOM   1365 C CG2 . THR B 1 72  ? 32.192 -21.243 -27.439 1.00 60.18  ? 72  THR B CG2 1 
ATOM   1366 N N   . VAL B 1 73  ? 34.198 -17.824 -26.900 1.00 53.07  ? 73  VAL B N   1 
ATOM   1367 C CA  . VAL B 1 73  ? 34.303 -17.052 -25.657 1.00 51.45  ? 73  VAL B CA  1 
ATOM   1368 C C   . VAL B 1 73  ? 34.796 -15.626 -25.884 1.00 50.06  ? 73  VAL B C   1 
ATOM   1369 O O   . VAL B 1 73  ? 35.849 -15.411 -26.483 1.00 46.21  ? 73  VAL B O   1 
ATOM   1370 C CB  . VAL B 1 73  ? 34.951 -17.836 -24.445 1.00 51.92  ? 73  VAL B CB  1 
ATOM   1371 C CG1 . VAL B 1 73  ? 35.376 -19.251 -24.808 1.00 49.95  ? 73  VAL B CG1 1 
ATOM   1372 C CG2 . VAL B 1 73  ? 36.076 -17.089 -23.744 1.00 46.22  ? 73  VAL B CG2 1 
ATOM   1373 N N   . PRO B 1 74  ? 33.993 -14.641 -25.433 1.00 49.36  ? 74  PRO B N   1 
ATOM   1374 C CA  . PRO B 1 74  ? 34.318 -13.236 -25.644 1.00 49.17  ? 74  PRO B CA  1 
ATOM   1375 C C   . PRO B 1 74  ? 35.421 -12.790 -24.712 1.00 48.17  ? 74  PRO B C   1 
ATOM   1376 O O   . PRO B 1 74  ? 35.754 -13.476 -23.742 1.00 44.33  ? 74  PRO B O   1 
ATOM   1377 C CB  . PRO B 1 74  ? 33.011 -12.522 -25.280 1.00 48.41  ? 74  PRO B CB  1 
ATOM   1378 C CG  . PRO B 1 74  ? 32.426 -13.394 -24.217 1.00 50.26  ? 74  PRO B CG  1 
ATOM   1379 C CD  . PRO B 1 74  ? 32.727 -14.796 -24.691 1.00 49.35  ? 74  PRO B CD  1 
ATOM   1380 N N   . ALA B 1 75  ? 35.988 -11.636 -25.024 1.00 50.04  ? 75  ALA B N   1 
ATOM   1381 C CA  . ALA B 1 75  ? 36.944 -10.982 -24.154 1.00 52.29  ? 75  ALA B CA  1 
ATOM   1382 C C   . ALA B 1 75  ? 36.319 -10.658 -22.757 1.00 51.83  ? 75  ALA B C   1 
ATOM   1383 O O   . ALA B 1 75  ? 35.098 -10.503 -22.656 1.00 49.24  ? 75  ALA B O   1 
ATOM   1384 C CB  . ALA B 1 75  ? 37.447 -9.724  -24.857 1.00 49.69  ? 75  ALA B CB  1 
ATOM   1385 N N   . PRO B 1 76  ? 37.150 -10.567 -21.681 1.00 52.87  ? 76  PRO B N   1 
ATOM   1386 C CA  . PRO B 1 76  ? 36.620 -10.207 -20.352 1.00 53.55  ? 76  PRO B CA  1 
ATOM   1387 C C   . PRO B 1 76  ? 35.995 -8.816  -20.335 1.00 53.39  ? 76  PRO B C   1 
ATOM   1388 O O   . PRO B 1 76  ? 36.435 -7.938  -21.079 1.00 48.71  ? 76  PRO B O   1 
ATOM   1389 C CB  . PRO B 1 76  ? 37.867 -10.200 -19.462 1.00 52.06  ? 76  PRO B CB  1 
ATOM   1390 C CG  . PRO B 1 76  ? 38.827 -11.110 -20.152 1.00 54.24  ? 76  PRO B CG  1 
ATOM   1391 C CD  . PRO B 1 76  ? 38.599 -10.852 -21.613 1.00 52.35  ? 76  PRO B CD  1 
ATOM   1392 N N   . CYS B 1 77  ? 34.976 -8.643  -19.495 1.00 50.24  ? 77  CYS B N   1 
ATOM   1393 C CA  . CYS B 1 77  ? 34.285 -7.360  -19.327 1.00 47.91  ? 77  CYS B CA  1 
ATOM   1394 C C   . CYS B 1 77  ? 35.096 -6.418  -18.439 1.00 43.54  ? 77  CYS B C   1 
ATOM   1395 O O   . CYS B 1 77  ? 35.525 -6.810  -17.351 1.00 44.14  ? 77  CYS B O   1 
ATOM   1396 C CB  . CYS B 1 77  ? 32.898 -7.582  -18.694 1.00 44.81  ? 77  CYS B CB  1 
ATOM   1397 S SG  . CYS B 1 77  ? 31.693 -8.471  -19.724 1.00 54.90  ? 77  CYS B SG  1 
ATOM   1398 N N   . CYS B 1 78  ? 35.290 -5.182  -18.904 1.00 41.37  ? 78  CYS B N   1 
ATOM   1399 C CA  . CYS B 1 78  ? 35.762 -4.086  -18.065 1.00 39.87  ? 78  CYS B CA  1 
ATOM   1400 C C   . CYS B 1 78  ? 34.608 -3.532  -17.232 1.00 40.26  ? 78  CYS B C   1 
ATOM   1401 O O   . CYS B 1 78  ? 33.657 -2.978  -17.785 1.00 40.62  ? 78  CYS B O   1 
ATOM   1402 C CB  . CYS B 1 78  ? 36.376 -2.978  -18.915 1.00 40.21  ? 78  CYS B CB  1 
ATOM   1403 S SG  . CYS B 1 78  ? 36.878 -1.546  -17.924 1.00 48.99  ? 78  CYS B SG  1 
ATOM   1404 N N   . VAL B 1 79  ? 34.694 -3.666  -15.910 1.00 38.41  ? 79  VAL B N   1 
ATOM   1405 C CA  . VAL B 1 79  ? 33.542 -3.390  -15.012 1.00 42.29  ? 79  VAL B CA  1 
ATOM   1406 C C   . VAL B 1 79  ? 33.945 -2.868  -13.628 1.00 39.80  ? 79  VAL B C   1 
ATOM   1407 O O   . VAL B 1 79  ? 35.086 -3.052  -13.228 1.00 40.41  ? 79  VAL B O   1 
ATOM   1408 C CB  . VAL B 1 79  ? 32.638 -4.645  -14.822 1.00 40.82  ? 79  VAL B CB  1 
ATOM   1409 C CG1 . VAL B 1 79  ? 31.976 -5.052  -16.134 1.00 45.49  ? 79  VAL B CG1 1 
ATOM   1410 C CG2 . VAL B 1 79  ? 33.388 -5.804  -14.177 1.00 40.79  ? 79  VAL B CG2 1 
ATOM   1411 N N   . PRO B 1 80  ? 33.010 -2.233  -12.888 1.00 41.51  ? 80  PRO B N   1 
ATOM   1412 C CA  . PRO B 1 80  ? 33.380 -1.747  -11.550 1.00 40.78  ? 80  PRO B CA  1 
ATOM   1413 C C   . PRO B 1 80  ? 33.676 -2.854  -10.550 1.00 43.43  ? 80  PRO B C   1 
ATOM   1414 O O   . PRO B 1 80  ? 32.915 -3.824  -10.472 1.00 43.72  ? 80  PRO B O   1 
ATOM   1415 C CB  . PRO B 1 80  ? 32.146 -0.963  -11.091 1.00 40.00  ? 80  PRO B CB  1 
ATOM   1416 C CG  . PRO B 1 80  ? 31.331 -0.724  -12.324 1.00 39.16  ? 80  PRO B CG  1 
ATOM   1417 C CD  . PRO B 1 80  ? 31.619 -1.873  -13.233 1.00 39.63  ? 80  PRO B CD  1 
ATOM   1418 N N   . ALA B 1 81  ? 34.784 -2.691  -9.814  1.00 43.29  ? 81  ALA B N   1 
ATOM   1419 C CA  . ALA B 1 81  ? 35.159 -3.553  -8.662  1.00 45.63  ? 81  ALA B CA  1 
ATOM   1420 C C   . ALA B 1 81  ? 34.476 -3.098  -7.372  1.00 46.10  ? 81  ALA B C   1 
ATOM   1421 O O   . ALA B 1 81  ? 34.230 -3.907  -6.473  1.00 47.00  ? 81  ALA B O   1 
ATOM   1422 C CB  . ALA B 1 81  ? 36.674 -3.557  -8.467  1.00 42.80  ? 81  ALA B CB  1 
ATOM   1423 N N   . SER B 1 82  ? 34.212 -1.789  -7.296  1.00 44.28  ? 82  SER B N   1 
ATOM   1424 C CA  . SER B 1 82  ? 33.433 -1.161  -6.231  1.00 46.34  ? 82  SER B CA  1 
ATOM   1425 C C   . SER B 1 82  ? 32.792 0.146   -6.755  1.00 46.13  ? 82  SER B C   1 
ATOM   1426 O O   . SER B 1 82  ? 33.116 0.629   -7.854  1.00 44.65  ? 82  SER B O   1 
ATOM   1427 C CB  . SER B 1 82  ? 34.309 -0.867  -5.006  1.00 38.69  ? 82  SER B CB  1 
ATOM   1428 O OG  . SER B 1 82  ? 35.254 0.133   -5.351  1.00 43.34  ? 82  SER B OG  1 
ATOM   1429 N N   . TYR B 1 83  ? 31.925 0.721   -5.925  1.00 47.24  ? 83  TYR B N   1 
ATOM   1430 C CA  . TYR B 1 83  ? 31.081 1.855   -6.281  1.00 47.49  ? 83  TYR B CA  1 
ATOM   1431 C C   . TYR B 1 83  ? 31.146 2.949   -5.239  1.00 47.03  ? 83  TYR B C   1 
ATOM   1432 O O   . TYR B 1 83  ? 31.444 2.682   -4.077  1.00 45.90  ? 83  TYR B O   1 
ATOM   1433 C CB  . TYR B 1 83  ? 29.624 1.388   -6.397  1.00 42.71  ? 83  TYR B CB  1 
ATOM   1434 C CG  . TYR B 1 83  ? 29.366 0.404   -7.514  1.00 41.67  ? 83  TYR B CG  1 
ATOM   1435 C CD1 . TYR B 1 83  ? 29.019 0.850   -8.797  1.00 40.98  ? 83  TYR B CD1 1 
ATOM   1436 C CD2 . TYR B 1 83  ? 29.451 -0.981  -7.295  1.00 43.81  ? 83  TYR B CD2 1 
ATOM   1437 C CE1 . TYR B 1 83  ? 28.768 -0.047  -9.834  1.00 38.98  ? 83  TYR B CE1 1 
ATOM   1438 C CE2 . TYR B 1 83  ? 29.213 -1.899  -8.332  1.00 42.90  ? 83  TYR B CE2 1 
ATOM   1439 C CZ  . TYR B 1 83  ? 28.866 -1.415  -9.602  1.00 44.64  ? 83  TYR B CZ  1 
ATOM   1440 O OH  . TYR B 1 83  ? 28.616 -2.293  -10.637 1.00 47.72  ? 83  TYR B OH  1 
ATOM   1441 N N   . ASN B 1 84  ? 30.867 4.178   -5.672  1.00 50.42  ? 84  ASN B N   1 
ATOM   1442 C CA  . ASN B 1 84  ? 30.608 5.292   -4.769  1.00 52.38  ? 84  ASN B CA  1 
ATOM   1443 C C   . ASN B 1 84  ? 29.126 5.649   -4.698  1.00 53.96  ? 84  ASN B C   1 
ATOM   1444 O O   . ASN B 1 84  ? 28.427 5.589   -5.705  1.00 54.25  ? 84  ASN B O   1 
ATOM   1445 C CB  . ASN B 1 84  ? 31.416 6.521   -5.162  1.00 55.59  ? 84  ASN B CB  1 
ATOM   1446 C CG  . ASN B 1 84  ? 32.831 6.482   -4.619  1.00 56.61  ? 84  ASN B CG  1 
ATOM   1447 O OD1 . ASN B 1 84  ? 33.726 7.099   -5.189  1.00 54.62  ? 84  ASN B OD1 1 
ATOM   1448 N ND2 . ASN B 1 84  ? 33.041 5.753   -3.517  1.00 53.47  ? 84  ASN B ND2 1 
ATOM   1449 N N   . PRO B 1 85  ? 28.641 6.011   -3.496  1.00 55.81  ? 85  PRO B N   1 
ATOM   1450 C CA  . PRO B 1 85  ? 27.256 6.464   -3.395  1.00 56.71  ? 85  PRO B CA  1 
ATOM   1451 C C   . PRO B 1 85  ? 27.034 7.870   -3.999  1.00 57.62  ? 85  PRO B C   1 
ATOM   1452 O O   . PRO B 1 85  ? 27.990 8.612   -4.227  1.00 51.39  ? 85  PRO B O   1 
ATOM   1453 C CB  . PRO B 1 85  ? 26.995 6.462   -1.876  1.00 58.13  ? 85  PRO B CB  1 
ATOM   1454 C CG  . PRO B 1 85  ? 28.346 6.604   -1.252  1.00 56.88  ? 85  PRO B CG  1 
ATOM   1455 C CD  . PRO B 1 85  ? 29.272 5.857   -2.164  1.00 57.52  ? 85  PRO B CD  1 
ATOM   1456 N N   . MET B 1 86  ? 25.779 8.221   -4.269  1.00 57.92  ? 86  MET B N   1 
ATOM   1457 C CA  . MET B 1 86  ? 25.464 9.597   -4.618  1.00 57.47  ? 86  MET B CA  1 
ATOM   1458 C C   . MET B 1 86  ? 24.133 10.047  -4.044  1.00 52.08  ? 86  MET B C   1 
ATOM   1459 O O   . MET B 1 86  ? 23.157 9.275   -4.031  1.00 46.11  ? 86  MET B O   1 
ATOM   1460 C CB  . MET B 1 86  ? 25.475 9.796   -6.128  1.00 59.16  ? 86  MET B CB  1 
ATOM   1461 C CG  . MET B 1 86  ? 25.801 11.220  -6.517  1.00 63.57  ? 86  MET B CG  1 
ATOM   1462 S SD  . MET B 1 86  ? 25.635 11.487  -8.283  1.00 68.31  ? 86  MET B SD  1 
ATOM   1463 C CE  . MET B 1 86  ? 26.188 13.192  -8.327  1.00 72.72  ? 86  MET B CE  1 
ATOM   1464 N N   . VAL B 1 87  ? 24.124 11.302  -3.582  1.00 50.41  ? 87  VAL B N   1 
ATOM   1465 C CA  . VAL B 1 87  ? 22.906 11.991  -3.142  1.00 52.34  ? 87  VAL B CA  1 
ATOM   1466 C C   . VAL B 1 87  ? 22.160 12.600  -4.349  1.00 48.19  ? 87  VAL B C   1 
ATOM   1467 O O   . VAL B 1 87  ? 22.716 13.379  -5.118  1.00 50.36  ? 87  VAL B O   1 
ATOM   1468 C CB  . VAL B 1 87  ? 23.213 13.062  -2.053  1.00 55.56  ? 87  VAL B CB  1 
ATOM   1469 C CG1 . VAL B 1 87  ? 22.007 13.957  -1.810  1.00 55.01  ? 87  VAL B CG1 1 
ATOM   1470 C CG2 . VAL B 1 87  ? 23.613 12.396  -0.740  1.00 56.41  ? 87  VAL B CG2 1 
ATOM   1471 N N   . LEU B 1 88  ? 20.904 12.218  -4.512  1.00 45.65  ? 88  LEU B N   1 
ATOM   1472 C CA  . LEU B 1 88  ? 20.003 12.865  -5.475  1.00 47.22  ? 88  LEU B CA  1 
ATOM   1473 C C   . LEU B 1 88  ? 18.893 13.629  -4.728  1.00 48.06  ? 88  LEU B C   1 
ATOM   1474 O O   . LEU B 1 88  ? 18.343 13.134  -3.732  1.00 44.76  ? 88  LEU B O   1 
ATOM   1475 C CB  . LEU B 1 88  ? 19.382 11.815  -6.407  1.00 43.58  ? 88  LEU B CB  1 
ATOM   1476 C CG  . LEU B 1 88  ? 20.037 11.452  -7.742  1.00 44.43  ? 88  LEU B CG  1 
ATOM   1477 C CD1 . LEU B 1 88  ? 21.546 11.346  -7.695  1.00 47.42  ? 88  LEU B CD1 1 
ATOM   1478 C CD2 . LEU B 1 88  ? 19.418 10.184  -8.325  1.00 43.55  ? 88  LEU B CD2 1 
ATOM   1479 N N   . ILE B 1 89  ? 18.600 14.843  -5.188  1.00 47.26  ? 89  ILE B N   1 
ATOM   1480 C CA  . ILE B 1 89  ? 17.408 15.559  -4.734  1.00 47.72  ? 89  ILE B CA  1 
ATOM   1481 C C   . ILE B 1 89  ? 16.330 15.365  -5.783  1.00 42.34  ? 89  ILE B C   1 
ATOM   1482 O O   . ILE B 1 89  ? 16.483 15.791  -6.923  1.00 40.59  ? 89  ILE B O   1 
ATOM   1483 C CB  . ILE B 1 89  ? 17.660 17.063  -4.473  1.00 52.10  ? 89  ILE B CB  1 
ATOM   1484 C CG1 . ILE B 1 89  ? 18.730 17.230  -3.384  1.00 49.46  ? 89  ILE B CG1 1 
ATOM   1485 C CG2 . ILE B 1 89  ? 16.352 17.736  -4.051  1.00 51.01  ? 89  ILE B CG2 1 
ATOM   1486 C CD1 . ILE B 1 89  ? 19.278 18.632  -3.242  1.00 55.82  ? 89  ILE B CD1 1 
ATOM   1487 N N   . GLN B 1 90  ? 15.242 14.709  -5.395  1.00 43.13  ? 90  GLN B N   1 
ATOM   1488 C CA  . GLN B 1 90  ? 14.198 14.360  -6.346  1.00 44.63  ? 90  GLN B CA  1 
ATOM   1489 C C   . GLN B 1 90  ? 12.835 15.026  -6.111  1.00 45.64  ? 90  GLN B C   1 
ATOM   1490 O O   . GLN B 1 90  ? 12.554 15.537  -5.014  1.00 43.80  ? 90  GLN B O   1 
ATOM   1491 C CB  . GLN B 1 90  ? 14.076 12.832  -6.543  1.00 46.44  ? 90  GLN B CB  1 
ATOM   1492 C CG  . GLN B 1 90  ? 14.559 11.950  -5.412  1.00 54.31  ? 90  GLN B CG  1 
ATOM   1493 C CD  . GLN B 1 90  ? 14.502 10.465  -5.729  1.00 52.38  ? 90  GLN B CD  1 
ATOM   1494 O OE1 . GLN B 1 90  ? 13.447 9.918   -6.035  1.00 53.29  ? 90  GLN B OE1 1 
ATOM   1495 N NE2 . GLN B 1 90  ? 15.640 9.804   -5.625  1.00 52.78  ? 90  GLN B NE2 1 
ATOM   1496 N N   . LYS B 1 91  ? 12.004 15.017  -7.155  1.00 45.64  ? 91  LYS B N   1 
ATOM   1497 C CA  . LYS B 1 91  ? 10.670 15.582  -7.094  1.00 50.36  ? 91  LYS B CA  1 
ATOM   1498 C C   . LYS B 1 91  ? 9.677  14.543  -6.600  1.00 48.41  ? 91  LYS B C   1 
ATOM   1499 O O   . LYS B 1 91  ? 9.730  13.393  -7.013  1.00 49.71  ? 91  LYS B O   1 
ATOM   1500 C CB  . LYS B 1 91  ? 10.239 16.110  -8.463  1.00 56.12  ? 91  LYS B CB  1 
ATOM   1501 C CG  . LYS B 1 91  ? 9.109  17.129  -8.390  1.00 59.16  ? 91  LYS B CG  1 
ATOM   1502 C CD  . LYS B 1 91  ? 8.527  17.411  -9.761  1.00 67.83  ? 91  LYS B CD  1 
ATOM   1503 C CE  . LYS B 1 91  ? 7.424  18.461  -9.691  1.00 73.92  ? 91  LYS B CE  1 
ATOM   1504 N NZ  . LYS B 1 91  ? 6.282  18.073  -8.810  1.00 77.76  ? 91  LYS B NZ  1 
ATOM   1505 N N   . THR B 1 92  ? 8.794  14.960  -5.696  1.00 47.95  ? 92  THR B N   1 
ATOM   1506 C CA  . THR B 1 92  ? 7.599  14.180  -5.329  1.00 47.39  ? 92  THR B CA  1 
ATOM   1507 C C   . THR B 1 92  ? 6.375  14.945  -5.831  1.00 47.30  ? 92  THR B C   1 
ATOM   1508 O O   . THR B 1 92  ? 6.522  16.061  -6.347  1.00 50.25  ? 92  THR B O   1 
ATOM   1509 C CB  . THR B 1 92  ? 7.484  13.964  -3.801  1.00 45.92  ? 92  THR B CB  1 
ATOM   1510 O OG1 . THR B 1 92  ? 7.208  15.219  -3.169  1.00 43.17  ? 92  THR B OG1 1 
ATOM   1511 C CG2 . THR B 1 92  ? 8.770  13.338  -3.218  1.00 42.79  ? 92  THR B CG2 1 
ATOM   1512 N N   . ASP B 1 93  ? 5.174  14.381  -5.670  1.00 51.74  ? 93  ASP B N   1 
ATOM   1513 C CA  . ASP B 1 93  ? 3.944  15.076  -6.120  1.00 57.86  ? 93  ASP B CA  1 
ATOM   1514 C C   . ASP B 1 93  ? 3.671  16.406  -5.415  1.00 58.20  ? 93  ASP B C   1 
ATOM   1515 O O   . ASP B 1 93  ? 3.151  17.350  -6.031  1.00 60.89  ? 93  ASP B O   1 
ATOM   1516 C CB  . ASP B 1 93  ? 2.718  14.158  -6.064  1.00 66.07  ? 93  ASP B CB  1 
ATOM   1517 C CG  . ASP B 1 93  ? 2.724  13.110  -7.177  1.00 71.71  ? 93  ASP B CG  1 
ATOM   1518 O OD1 . ASP B 1 93  ? 2.784  13.492  -8.374  1.00 75.93  ? 93  ASP B OD1 1 
ATOM   1519 O OD2 . ASP B 1 93  ? 2.675  11.904  -6.850  1.00 71.61  ? 93  ASP B OD2 1 
ATOM   1520 N N   . THR B 1 94  ? 4.067  16.489  -4.147  1.00 54.50  ? 94  THR B N   1 
ATOM   1521 C CA  . THR B 1 94  ? 3.772  17.662  -3.323  1.00 56.24  ? 94  THR B CA  1 
ATOM   1522 C C   . THR B 1 94  ? 5.016  18.386  -2.834  1.00 51.73  ? 94  THR B C   1 
ATOM   1523 O O   . THR B 1 94  ? 4.900  19.431  -2.214  1.00 52.52  ? 94  THR B O   1 
ATOM   1524 C CB  . THR B 1 94  ? 2.917  17.270  -2.103  1.00 57.99  ? 94  THR B CB  1 
ATOM   1525 O OG1 . THR B 1 94  ? 3.566  16.193  -1.407  1.00 56.97  ? 94  THR B OG1 1 
ATOM   1526 C CG2 . THR B 1 94  ? 1.487  16.850  -2.531  1.00 51.69  ? 94  THR B CG2 1 
ATOM   1527 N N   . GLY B 1 95  ? 6.201  17.834  -3.105  1.00 50.37  ? 95  GLY B N   1 
ATOM   1528 C CA  . GLY B 1 95  ? 7.436  18.438  -2.624  1.00 48.11  ? 95  GLY B CA  1 
ATOM   1529 C C   . GLY B 1 95  ? 8.740  17.867  -3.145  1.00 46.13  ? 95  GLY B C   1 
ATOM   1530 O O   . GLY B 1 95  ? 8.887  17.653  -4.346  1.00 44.52  ? 95  GLY B O   1 
ATOM   1531 N N   . VAL B 1 96  ? 9.698  17.661  -2.236  1.00 42.28  ? 96  VAL B N   1 
ATOM   1532 C CA  . VAL B 1 96  ? 11.013 17.146  -2.579  1.00 44.79  ? 96  VAL B CA  1 
ATOM   1533 C C   . VAL B 1 96  ? 11.498 16.067  -1.619  1.00 49.88  ? 96  VAL B C   1 
ATOM   1534 O O   . VAL B 1 96  ? 11.154 16.067  -0.429  1.00 45.47  ? 96  VAL B O   1 
ATOM   1535 C CB  . VAL B 1 96  ? 12.107 18.238  -2.712  1.00 45.30  ? 96  VAL B CB  1 
ATOM   1536 C CG1 . VAL B 1 96  ? 11.621 19.450  -3.495  1.00 42.62  ? 96  VAL B CG1 1 
ATOM   1537 C CG2 . VAL B 1 96  ? 12.644 18.664  -1.356  1.00 47.72  ? 96  VAL B CG2 1 
ATOM   1538 N N   . SER B 1 97  ? 12.316 15.163  -2.164  1.00 50.96  ? 97  SER B N   1 
ATOM   1539 C CA  . SER B 1 97  ? 12.921 14.058  -1.429  1.00 49.26  ? 97  SER B CA  1 
ATOM   1540 C C   . SER B 1 97  ? 14.450 14.127  -1.609  1.00 55.40  ? 97  SER B C   1 
ATOM   1541 O O   . SER B 1 97  ? 14.956 14.721  -2.571  1.00 66.68  ? 97  SER B O   1 
ATOM   1542 C CB  . SER B 1 97  ? 12.344 12.733  -1.929  1.00 50.67  ? 97  SER B CB  1 
ATOM   1543 O OG  . SER B 1 97  ? 12.815 11.636  -1.169  1.00 54.88  ? 97  SER B OG  1 
ATOM   1544 N N   . LEU B 1 98  ? 15.185 13.576  -0.656  1.00 51.12  ? 98  LEU B N   1 
ATOM   1545 C CA  . LEU B 1 98  ? 16.646 13.577  -0.693  1.00 54.72  ? 98  LEU B CA  1 
ATOM   1546 C C   . LEU B 1 98  ? 16.965 12.113  -0.485  1.00 52.43  ? 98  LEU B C   1 
ATOM   1547 O O   . LEU B 1 98  ? 16.549 11.531  0.505   1.00 53.42  ? 98  LEU B O   1 
ATOM   1548 C CB  . LEU B 1 98  ? 17.191 14.486  0.420   1.00 56.78  ? 98  LEU B CB  1 
ATOM   1549 C CG  . LEU B 1 98  ? 18.618 14.866  0.844   1.00 60.32  ? 98  LEU B CG  1 
ATOM   1550 C CD1 . LEU B 1 98  ? 19.562 13.689  1.146   1.00 59.42  ? 98  LEU B CD1 1 
ATOM   1551 C CD2 . LEU B 1 98  ? 19.250 15.870  -0.100  1.00 59.71  ? 98  LEU B CD2 1 
ATOM   1552 N N   . GLN B 1 99  ? 17.629 11.508  -1.465  1.00 53.66  ? 99  GLN B N   1 
ATOM   1553 C CA  . GLN B 1 99  ? 17.884 10.063  -1.476  1.00 55.31  ? 99  GLN B CA  1 
ATOM   1554 C C   . GLN B 1 99  ? 19.354 9.768   -1.794  1.00 49.79  ? 99  GLN B C   1 
ATOM   1555 O O   . GLN B 1 99  ? 19.941 10.439  -2.626  1.00 45.31  ? 99  GLN B O   1 
ATOM   1556 C CB  . GLN B 1 99  ? 16.967 9.379   -2.490  1.00 59.96  ? 99  GLN B CB  1 
ATOM   1557 C CG  . GLN B 1 99  ? 15.555 9.057   -2.000  1.00 66.00  ? 99  GLN B CG  1 
ATOM   1558 C CD  . GLN B 1 99  ? 15.320 7.559   -1.926  1.00 76.68  ? 99  GLN B CD  1 
ATOM   1559 O OE1 . GLN B 1 99  ? 15.716 6.908   -0.959  1.00 84.10  ? 99  GLN B OE1 1 
ATOM   1560 N NE2 . GLN B 1 99  ? 14.697 6.996   -2.966  1.00 80.19  ? 99  GLN B NE2 1 
ATOM   1561 N N   . THR B 1 100 ? 19.939 8.788   -1.095  1.00 50.41  ? 100 THR B N   1 
ATOM   1562 C CA  . THR B 1 100 ? 21.304 8.312   -1.374  1.00 51.97  ? 100 THR B CA  1 
ATOM   1563 C C   . THR B 1 100 ? 21.160 7.018   -2.186  1.00 52.13  ? 100 THR B C   1 
ATOM   1564 O O   . THR B 1 100 ? 20.395 6.121   -1.799  1.00 49.00  ? 100 THR B O   1 
ATOM   1565 C CB  . THR B 1 100 ? 22.133 8.080   -0.076  1.00 48.42  ? 100 THR B CB  1 
ATOM   1566 O OG1 . THR B 1 100 ? 22.407 9.337   0.547   1.00 51.36  ? 100 THR B OG1 1 
ATOM   1567 C CG2 . THR B 1 100 ? 23.484 7.399   -0.372  1.00 47.82  ? 100 THR B CG2 1 
ATOM   1568 N N   . TYR B 1 101 ? 21.859 6.952   -3.320  1.00 49.40  ? 101 TYR B N   1 
ATOM   1569 C CA  . TYR B 1 101 ? 21.927 5.726   -4.145  1.00 49.72  ? 101 TYR B CA  1 
ATOM   1570 C C   . TYR B 1 101 ? 23.319 5.138   -4.038  1.00 47.78  ? 101 TYR B C   1 
ATOM   1571 O O   . TYR B 1 101 ? 24.306 5.870   -4.168  1.00 47.73  ? 101 TYR B O   1 
ATOM   1572 C CB  . TYR B 1 101 ? 21.547 6.009   -5.606  1.00 46.20  ? 101 TYR B CB  1 
ATOM   1573 C CG  . TYR B 1 101 ? 20.083 6.353   -5.749  1.00 47.84  ? 101 TYR B CG  1 
ATOM   1574 C CD1 . TYR B 1 101 ? 19.632 7.677   -5.608  1.00 44.59  ? 101 TYR B CD1 1 
ATOM   1575 C CD2 . TYR B 1 101 ? 19.127 5.351   -5.968  1.00 46.88  ? 101 TYR B CD2 1 
ATOM   1576 C CE1 . TYR B 1 101 ? 18.271 7.985   -5.696  1.00 42.77  ? 101 TYR B CE1 1 
ATOM   1577 C CE2 . TYR B 1 101 ? 17.771 5.653   -6.073  1.00 45.94  ? 101 TYR B CE2 1 
ATOM   1578 C CZ  . TYR B 1 101 ? 17.350 6.973   -5.931  1.00 45.30  ? 101 TYR B CZ  1 
ATOM   1579 O OH  . TYR B 1 101 ? 16.008 7.275   -6.029  1.00 47.90  ? 101 TYR B OH  1 
ATOM   1580 N N   . ASP B 1 102 ? 23.388 3.831   -3.794  1.00 49.63  ? 102 ASP B N   1 
ATOM   1581 C CA  . ASP B 1 102 ? 24.659 3.168   -3.467  1.00 58.64  ? 102 ASP B CA  1 
ATOM   1582 C C   . ASP B 1 102 ? 25.572 2.833   -4.636  1.00 59.74  ? 102 ASP B C   1 
ATOM   1583 O O   . ASP B 1 102 ? 26.797 3.024   -4.553  1.00 66.12  ? 102 ASP B O   1 
ATOM   1584 C CB  . ASP B 1 102 ? 24.423 1.894   -2.648  1.00 57.76  ? 102 ASP B CB  1 
ATOM   1585 C CG  . ASP B 1 102 ? 24.065 2.185   -1.206  1.00 62.61  ? 102 ASP B CG  1 
ATOM   1586 O OD1 . ASP B 1 102 ? 24.524 3.204   -0.639  1.00 60.59  ? 102 ASP B OD1 1 
ATOM   1587 O OD2 . ASP B 1 102 ? 23.308 1.378   -0.639  1.00 66.96  ? 102 ASP B OD2 1 
ATOM   1588 N N   . ASP B 1 103 ? 24.994 2.297   -5.700  1.00 51.97  ? 103 ASP B N   1 
ATOM   1589 C CA  . ASP B 1 103 ? 25.816 1.717   -6.750  1.00 52.74  ? 103 ASP B CA  1 
ATOM   1590 C C   . ASP B 1 103 ? 25.565 2.462   -8.062  1.00 46.02  ? 103 ASP B C   1 
ATOM   1591 O O   . ASP B 1 103 ? 25.044 1.928   -9.039  1.00 44.65  ? 103 ASP B O   1 
ATOM   1592 C CB  . ASP B 1 103 ? 25.593 0.197   -6.804  1.00 54.77  ? 103 ASP B CB  1 
ATOM   1593 C CG  . ASP B 1 103 ? 26.067 -0.525  -5.513  1.00 58.73  ? 103 ASP B CG  1 
ATOM   1594 O OD1 . ASP B 1 103 ? 27.024 -0.061  -4.853  1.00 60.52  ? 103 ASP B OD1 1 
ATOM   1595 O OD2 . ASP B 1 103 ? 25.494 -1.579  -5.168  1.00 60.73  ? 103 ASP B OD2 1 
ATOM   1596 N N   . LEU B 1 104 ? 25.960 3.726   -8.035  1.00 44.54  ? 104 LEU B N   1 
ATOM   1597 C CA  . LEU B 1 104 ? 25.697 4.673   -9.101  1.00 44.17  ? 104 LEU B CA  1 
ATOM   1598 C C   . LEU B 1 104 ? 26.967 5.113   -9.840  1.00 40.93  ? 104 LEU B C   1 
ATOM   1599 O O   . LEU B 1 104 ? 26.972 5.237   -11.058 1.00 41.25  ? 104 LEU B O   1 
ATOM   1600 C CB  . LEU B 1 104 ? 25.002 5.876   -8.491  1.00 44.98  ? 104 LEU B CB  1 
ATOM   1601 C CG  . LEU B 1 104 ? 24.163 6.687   -9.451  1.00 46.47  ? 104 LEU B CG  1 
ATOM   1602 C CD1 . LEU B 1 104 ? 22.837 7.089   -8.823  1.00 45.87  ? 104 LEU B CD1 1 
ATOM   1603 C CD2 . LEU B 1 104 ? 24.967 7.893   -9.904  1.00 48.64  ? 104 LEU B CD2 1 
ATOM   1604 N N   . LEU B 1 105 ? 28.015 5.370   -9.080  1.00 39.12  ? 105 LEU B N   1 
ATOM   1605 C CA  . LEU B 1 105 ? 29.289 5.870   -9.580  1.00 44.89  ? 105 LEU B CA  1 
ATOM   1606 C C   . LEU B 1 105 ? 30.263 4.734   -9.372  1.00 46.65  ? 105 LEU B C   1 
ATOM   1607 O O   . LEU B 1 105 ? 30.184 4.041   -8.359  1.00 44.27  ? 105 LEU B O   1 
ATOM   1608 C CB  . LEU B 1 105 ? 29.750 7.052   -8.735  1.00 43.70  ? 105 LEU B CB  1 
ATOM   1609 C CG  . LEU B 1 105 ? 29.453 8.537   -9.016  1.00 48.92  ? 105 LEU B CG  1 
ATOM   1610 C CD1 . LEU B 1 105 ? 28.592 8.813   -10.248 1.00 44.35  ? 105 LEU B CD1 1 
ATOM   1611 C CD2 . LEU B 1 105 ? 28.923 9.235   -7.750  1.00 44.25  ? 105 LEU B CD2 1 
ATOM   1612 N N   . ALA B 1 106 ? 31.147 4.506   -10.339 1.00 44.36  ? 106 ALA B N   1 
ATOM   1613 C CA  . ALA B 1 106 ? 32.142 3.445   -10.195 1.00 47.00  ? 106 ALA B CA  1 
ATOM   1614 C C   . ALA B 1 106 ? 33.281 4.030   -9.406  1.00 44.81  ? 106 ALA B C   1 
ATOM   1615 O O   . ALA B 1 106 ? 33.587 5.209   -9.567  1.00 44.86  ? 106 ALA B O   1 
ATOM   1616 C CB  . ALA B 1 106 ? 32.623 2.941   -11.551 1.00 41.67  ? 106 ALA B CB  1 
ATOM   1617 N N   . LYS B 1 107 ? 33.882 3.223   -8.536  1.00 47.47  ? 107 LYS B N   1 
ATOM   1618 C CA  . LYS B 1 107 ? 35.034 3.673   -7.740  1.00 52.06  ? 107 LYS B CA  1 
ATOM   1619 C C   . LYS B 1 107 ? 36.313 3.091   -8.346  1.00 51.46  ? 107 LYS B C   1 
ATOM   1620 O O   . LYS B 1 107 ? 37.243 3.822   -8.667  1.00 55.83  ? 107 LYS B O   1 
ATOM   1621 C CB  . LYS B 1 107 ? 34.843 3.302   -6.252  1.00 57.89  ? 107 LYS B CB  1 
ATOM   1622 C CG  . LYS B 1 107 ? 36.027 3.534   -5.309  1.00 66.31  ? 107 LYS B CG  1 
ATOM   1623 C CD  . LYS B 1 107 ? 36.065 4.948   -4.742  1.00 76.78  ? 107 LYS B CD  1 
ATOM   1624 C CE  . LYS B 1 107 ? 37.412 5.314   -4.129  1.00 78.86  ? 107 LYS B CE  1 
ATOM   1625 N NZ  . LYS B 1 107 ? 37.650 4.544   -2.879  1.00 80.65  ? 107 LYS B NZ  1 
ATOM   1626 N N   . ASP B 1 108 ? 36.289 1.781   -8.572  1.00 55.16  ? 108 ASP B N   1 
ATOM   1627 C CA  . ASP B 1 108 ? 37.443 0.945   -8.900  1.00 58.95  ? 108 ASP B CA  1 
ATOM   1628 C C   . ASP B 1 108 ? 37.099 0.080   -10.103 1.00 54.37  ? 108 ASP B C   1 
ATOM   1629 O O   . ASP B 1 108 ? 35.935 -0.309  -10.263 1.00 46.94  ? 108 ASP B O   1 
ATOM   1630 C CB  . ASP B 1 108 ? 37.680 -0.021  -7.726  1.00 65.50  ? 108 ASP B CB  1 
ATOM   1631 C CG  . ASP B 1 108 ? 38.877 0.337   -6.899  1.00 75.89  ? 108 ASP B CG  1 
ATOM   1632 O OD1 . ASP B 1 108 ? 39.927 0.690   -7.476  1.00 87.53  ? 108 ASP B OD1 1 
ATOM   1633 O OD2 . ASP B 1 108 ? 38.778 0.233   -5.660  1.00 83.50  ? 108 ASP B OD2 1 
ATOM   1634 N N   . CYS B 1 109 ? 38.106 -0.288  -10.897 1.00 48.57  ? 109 CYS B N   1 
ATOM   1635 C CA  . CYS B 1 109 ? 37.878 -1.097  -12.108 1.00 47.58  ? 109 CYS B CA  1 
ATOM   1636 C C   . CYS B 1 109 ? 38.644 -2.411  -12.135 1.00 48.31  ? 109 CYS B C   1 
ATOM   1637 O O   . CYS B 1 109 ? 39.817 -2.465  -11.761 1.00 50.20  ? 109 CYS B O   1 
ATOM   1638 C CB  . CYS B 1 109 ? 38.190 -0.281  -13.370 1.00 45.58  ? 109 CYS B CB  1 
ATOM   1639 S SG  . CYS B 1 109 ? 37.288 1.294   -13.445 1.00 55.41  ? 109 CYS B SG  1 
ATOM   1640 N N   . HIS B 1 110 ? 37.976 -3.470  -12.585 1.00 46.43  ? 110 HIS B N   1 
ATOM   1641 C CA  . HIS B 1 110 ? 38.653 -4.730  -12.904 1.00 44.75  ? 110 HIS B CA  1 
ATOM   1642 C C   . HIS B 1 110 ? 38.013 -5.446  -14.093 1.00 46.49  ? 110 HIS B C   1 
ATOM   1643 O O   . HIS B 1 110 ? 36.936 -5.046  -14.565 1.00 45.44  ? 110 HIS B O   1 
ATOM   1644 C CB  . HIS B 1 110 ? 38.791 -5.646  -11.665 1.00 47.99  ? 110 HIS B CB  1 
ATOM   1645 C CG  . HIS B 1 110 ? 37.494 -6.123  -11.066 1.00 48.63  ? 110 HIS B CG  1 
ATOM   1646 N ND1 . HIS B 1 110 ? 37.391 -6.485  -9.736  1.00 49.91  ? 110 HIS B ND1 1 
ATOM   1647 C CD2 . HIS B 1 110 ? 36.268 -6.334  -11.606 1.00 48.40  ? 110 HIS B CD2 1 
ATOM   1648 C CE1 . HIS B 1 110 ? 36.158 -6.892  -9.485  1.00 47.61  ? 110 HIS B CE1 1 
ATOM   1649 N NE2 . HIS B 1 110 ? 35.456 -6.810  -10.603 1.00 48.99  ? 110 HIS B NE2 1 
ATOM   1650 N N   . CYS B 1 111 ? 38.677 -6.506  -14.552 1.00 43.74  ? 111 CYS B N   1 
ATOM   1651 C CA  . CYS B 1 111 ? 38.285 -7.292  -15.722 1.00 44.86  ? 111 CYS B CA  1 
ATOM   1652 C C   . CYS B 1 111 ? 37.727 -8.656  -15.318 1.00 46.79  ? 111 CYS B C   1 
ATOM   1653 O O   . CYS B 1 111 ? 38.246 -9.276  -14.394 1.00 47.92  ? 111 CYS B O   1 
ATOM   1654 C CB  . CYS B 1 111 ? 39.497 -7.473  -16.642 1.00 43.76  ? 111 CYS B CB  1 
ATOM   1655 S SG  . CYS B 1 111 ? 40.105 -5.931  -17.365 1.00 44.60  ? 111 CYS B SG  1 
ATOM   1656 N N   . ILE B 1 112 ? 36.660 -9.100  -15.991 1.00 47.45  ? 112 ILE B N   1 
ATOM   1657 C CA  . ILE B 1 112 ? 36.043 -10.411 -15.727 1.00 45.80  ? 112 ILE B CA  1 
ATOM   1658 C C   . ILE B 1 112 ? 35.416 -11.092 -16.959 1.00 45.11  ? 112 ILE B C   1 
ATOM   1659 O O   . ILE B 1 112 ? 34.458 -10.586 -17.548 1.00 49.85  ? 112 ILE B O   1 
ATOM   1660 C CB  . ILE B 1 112 ? 35.103 -10.402 -14.488 1.00 44.86  ? 112 ILE B CB  1 
ATOM   1661 C CG1 . ILE B 1 112 ? 34.422 -11.764 -14.321 1.00 45.82  ? 112 ILE B CG1 1 
ATOM   1662 C CG2 . ILE B 1 112 ? 34.059 -9.295  -14.559 1.00 44.52  ? 112 ILE B CG2 1 
ATOM   1663 C CD1 . ILE B 1 112 ? 34.325 -12.232 -12.893 1.00 47.58  ? 112 ILE B CD1 1 
HETATM 1664 C C1  . EDO C 2 .   ? 25.871 -5.000  -7.402  1.00 69.90  ? 201 EDO A C1  1 
HETATM 1665 O O1  . EDO C 2 .   ? 25.394 -3.674  -7.135  1.00 63.85  ? 201 EDO A O1  1 
HETATM 1666 C C2  . EDO C 2 .   ? 24.673 -5.947  -7.420  1.00 73.38  ? 201 EDO A C2  1 
HETATM 1667 O O2  . EDO C 2 .   ? 25.054 -7.194  -6.823  1.00 84.20  ? 201 EDO A O2  1 
HETATM 1668 C C1  . EDO D 2 .   ? 31.631 -29.547 -13.006 1.00 65.36  ? 202 EDO A C1  1 
HETATM 1669 O O1  . EDO D 2 .   ? 31.719 -29.309 -11.601 1.00 69.02  ? 202 EDO A O1  1 
HETATM 1670 C C2  . EDO D 2 .   ? 32.763 -28.753 -13.637 1.00 65.82  ? 202 EDO A C2  1 
HETATM 1671 O O2  . EDO D 2 .   ? 33.578 -29.607 -14.437 1.00 59.75  ? 202 EDO A O2  1 
HETATM 1672 C C1  . EDO E 2 .   ? 13.410 -15.972 -23.271 1.00 93.08  ? 203 EDO A C1  1 
HETATM 1673 O O1  . EDO E 2 .   ? 13.243 -14.996 -24.311 1.00 97.39  ? 203 EDO A O1  1 
HETATM 1674 C C2  . EDO E 2 .   ? 14.624 -15.647 -22.402 1.00 91.49  ? 203 EDO A C2  1 
HETATM 1675 O O2  . EDO E 2 .   ? 15.857 -15.882 -23.093 1.00 82.35  ? 203 EDO A O2  1 
HETATM 1676 C C1  . EDO F 2 .   ? 34.310 -13.281 -6.189  1.00 70.43  ? 204 EDO A C1  1 
HETATM 1677 O O1  . EDO F 2 .   ? 35.662 -13.120 -6.657  1.00 64.40  ? 204 EDO A O1  1 
HETATM 1678 C C2  . EDO F 2 .   ? 34.263 -14.316 -5.058  1.00 70.99  ? 204 EDO A C2  1 
HETATM 1679 O O2  . EDO F 2 .   ? 33.671 -15.548 -5.506  1.00 62.10  ? 204 EDO A O2  1 
HETATM 1680 C C1  . EDO G 2 .   ? 11.446 6.071   -10.700 1.00 83.10  ? 201 EDO B C1  1 
HETATM 1681 O O1  . EDO G 2 .   ? 12.155 7.232   -10.245 1.00 80.28  ? 201 EDO B O1  1 
HETATM 1682 C C2  . EDO G 2 .   ? 11.879 4.849   -9.888  1.00 85.90  ? 201 EDO B C2  1 
HETATM 1683 O O2  . EDO G 2 .   ? 13.301 4.838   -9.675  1.00 84.21  ? 201 EDO B O2  1 
HETATM 1684 C C1  . EDO H 2 .   ? 37.745 -6.318  -24.353 1.00 58.45  ? 202 EDO B C1  1 
HETATM 1685 O O1  . EDO H 2 .   ? 36.976 -6.463  -23.151 1.00 50.81  ? 202 EDO B O1  1 
HETATM 1686 C C2  . EDO H 2 .   ? 39.197 -6.664  -24.048 1.00 54.60  ? 202 EDO B C2  1 
HETATM 1687 O O2  . EDO H 2 .   ? 40.004 -6.058  -25.049 1.00 70.93  ? 202 EDO B O2  1 
HETATM 1688 O O   . HOH I 3 .   ? 35.550 -31.432 -14.234 1.00 63.80  ? 301 HOH A O   1 
HETATM 1689 O O   . HOH I 3 .   ? 21.786 -1.845  -22.276 1.00 39.08  ? 302 HOH A O   1 
HETATM 1690 O O   . HOH I 3 .   ? 34.107 -21.682 -8.177  1.00 43.11  ? 303 HOH A O   1 
HETATM 1691 O O   . HOH I 3 .   ? 39.661 -35.506 -14.750 1.00 60.87  ? 304 HOH A O   1 
HETATM 1692 O O   . HOH I 3 .   ? 16.707 -5.051  -15.377 1.00 51.73  ? 305 HOH A O   1 
HETATM 1693 O O   . HOH I 3 .   ? 29.666 1.832   -31.997 1.00 44.44  ? 306 HOH A O   1 
HETATM 1694 O O   . HOH I 3 .   ? 20.073 6.166   -16.976 1.00 39.21  ? 307 HOH A O   1 
HETATM 1695 O O   . HOH I 3 .   ? 24.158 -11.901 -27.386 1.00 55.39  ? 308 HOH A O   1 
HETATM 1696 O O   . HOH I 3 .   ? 29.801 -26.724 -7.708  1.00 52.38  ? 309 HOH A O   1 
HETATM 1697 O O   . HOH I 3 .   ? 31.133 -30.003 -25.062 1.00 97.20  ? 310 HOH A O   1 
HETATM 1698 O O   . HOH I 3 .   ? 21.677 5.006   -30.705 1.00 52.00  ? 311 HOH A O   1 
HETATM 1699 O O   . HOH I 3 .   ? 27.836 -8.890  -22.524 1.00 38.23  ? 312 HOH A O   1 
HETATM 1700 O O   . HOH I 3 .   ? 43.135 -20.140 -17.458 1.00 52.20  ? 313 HOH A O   1 
HETATM 1701 O O   . HOH I 3 .   ? 49.817 -25.843 -6.029  1.00 59.57  ? 314 HOH A O   1 
HETATM 1702 O O   . HOH I 3 .   ? 34.382 -29.744 -7.496  1.00 52.88  ? 315 HOH A O   1 
HETATM 1703 O O   . HOH I 3 .   ? 25.880 -10.132 -7.353  1.00 65.99  ? 316 HOH A O   1 
HETATM 1704 O O   . HOH I 3 .   ? 28.616 -24.241 -12.537 1.00 61.39  ? 317 HOH A O   1 
HETATM 1705 O O   . HOH I 3 .   ? 18.726 -1.960  -25.674 1.00 45.55  ? 318 HOH A O   1 
HETATM 1706 O O   . HOH I 3 .   ? 18.667 3.170   -19.061 1.00 45.45  ? 319 HOH A O   1 
HETATM 1707 O O   . HOH I 3 .   ? 22.038 1.267   -24.974 1.00 47.06  ? 320 HOH A O   1 
HETATM 1708 O O   . HOH I 3 .   ? 20.885 -4.438  -19.177 1.00 43.18  ? 321 HOH A O   1 
HETATM 1709 O O   . HOH I 3 .   ? 21.716 0.721   -7.630  1.00 41.71  ? 322 HOH A O   1 
HETATM 1710 O O   . HOH I 3 .   ? 23.662 -15.931 -24.877 1.00 53.39  ? 323 HOH A O   1 
HETATM 1711 O O   . HOH I 3 .   ? 19.469 7.648   -23.765 1.00 51.67  ? 324 HOH A O   1 
HETATM 1712 O O   . HOH I 3 .   ? 46.971 -20.418 -16.625 1.00 56.54  ? 325 HOH A O   1 
HETATM 1713 O O   . HOH I 3 .   ? 45.090 -31.005 -20.468 1.00 64.22  ? 326 HOH A O   1 
HETATM 1714 O O   . HOH I 3 .   ? 25.807 -23.812 -22.654 1.00 55.79  ? 327 HOH A O   1 
HETATM 1715 O O   . HOH I 3 .   ? 29.076 -16.844 -5.020  1.00 51.03  ? 328 HOH A O   1 
HETATM 1716 O O   . HOH I 3 .   ? 15.475 -9.087  -16.870 1.00 50.00  ? 329 HOH A O   1 
HETATM 1717 O O   . HOH I 3 .   ? 18.929 -10.824 -32.598 1.00 64.92  ? 330 HOH A O   1 
HETATM 1718 O O   . HOH I 3 .   ? 38.606 -19.194 -3.932  1.00 63.92  ? 331 HOH A O   1 
HETATM 1719 O O   . HOH I 3 .   ? 56.145 -30.800 -7.483  1.00 68.48  ? 332 HOH A O   1 
HETATM 1720 O O   . HOH I 3 .   ? 55.655 -36.910 -2.428  1.00 56.46  ? 333 HOH A O   1 
HETATM 1721 O O   . HOH I 3 .   ? 38.792 -33.840 -8.539  1.00 64.24  ? 334 HOH A O   1 
HETATM 1722 O O   . HOH I 3 .   ? 29.234 -11.658 -24.615 1.00 50.73  ? 335 HOH A O   1 
HETATM 1723 O O   . HOH I 3 .   ? 28.559 -8.700  -10.085 1.00 50.40  ? 336 HOH A O   1 
HETATM 1724 O O   . HOH I 3 .   ? 23.912 -2.176  -27.949 1.00 49.43  ? 337 HOH A O   1 
HETATM 1725 O O   . HOH I 3 .   ? 21.726 -17.490 -16.234 1.00 51.65  ? 338 HOH A O   1 
HETATM 1726 O O   . HOH I 3 .   ? 30.164 -28.326 -23.009 1.00 68.02  ? 339 HOH A O   1 
HETATM 1727 O O   . HOH I 3 .   ? 23.686 -3.672  -25.702 1.00 51.93  ? 340 HOH A O   1 
HETATM 1728 O O   . HOH I 3 .   ? 33.975 1.730   -25.819 1.00 60.14  ? 341 HOH A O   1 
HETATM 1729 O O   . HOH I 3 .   ? 27.908 -22.330 -25.211 1.00 63.69  ? 342 HOH A O   1 
HETATM 1730 O O   . HOH I 3 .   ? 20.895 -8.881  -10.496 1.00 51.75  ? 343 HOH A O   1 
HETATM 1731 O O   . HOH I 3 .   ? 11.199 -4.681  -20.232 1.00 73.86  ? 344 HOH A O   1 
HETATM 1732 O O   . HOH J 3 .   ? 22.811 2.476   -6.469  1.00 51.38  ? 301 HOH B O   1 
HETATM 1733 O O   . HOH J 3 .   ? 16.566 6.998   -16.921 1.00 45.77  ? 302 HOH B O   1 
HETATM 1734 O O   . HOH J 3 .   ? 33.579 -11.636 -21.029 1.00 40.37  ? 303 HOH B O   1 
HETATM 1735 O O   . HOH J 3 .   ? 41.664 -10.380 -23.405 1.00 47.67  ? 304 HOH B O   1 
HETATM 1736 O O   . HOH J 3 .   ? 4.143  13.829  -2.511  1.00 61.07  ? 305 HOH B O   1 
HETATM 1737 O O   . HOH J 3 .   ? 36.723 -3.830  -22.761 1.00 48.95  ? 306 HOH B O   1 
HETATM 1738 O O   . HOH J 3 .   ? 21.065 17.011  -22.547 1.00 53.64  ? 307 HOH B O   1 
HETATM 1739 O O   . HOH J 3 .   ? 27.146 -1.537  -12.766 1.00 46.09  ? 308 HOH B O   1 
HETATM 1740 O O   . HOH J 3 .   ? 5.370  11.634  -5.461  1.00 63.11  ? 309 HOH B O   1 
HETATM 1741 O O   . HOH J 3 .   ? 40.637 3.098   -20.877 1.00 50.29  ? 310 HOH B O   1 
HETATM 1742 O O   . HOH J 3 .   ? 42.141 -9.046  -18.196 1.00 49.20  ? 311 HOH B O   1 
HETATM 1743 O O   . HOH J 3 .   ? 7.334  15.104  -0.403  1.00 52.35  ? 312 HOH B O   1 
HETATM 1744 O O   . HOH J 3 .   ? 12.823 11.454  -16.135 1.00 52.68  ? 313 HOH B O   1 
HETATM 1745 O O   . HOH J 3 .   ? 46.956 -5.866  -13.607 1.00 49.09  ? 314 HOH B O   1 
HETATM 1746 O O   . HOH J 3 .   ? 31.813 -12.290 -17.648 1.00 34.97  ? 315 HOH B O   1 
HETATM 1747 O O   . HOH J 3 .   ? 31.677 0.917   -15.359 1.00 39.35  ? 316 HOH B O   1 
HETATM 1748 O O   . HOH J 3 .   ? 24.753 -2.975  -2.834  1.00 62.04  ? 317 HOH B O   1 
HETATM 1749 O O   . HOH J 3 .   ? 7.212  18.991  -6.213  1.00 60.14  ? 318 HOH B O   1 
HETATM 1750 O O   . HOH J 3 .   ? 31.896 -14.921 -17.409 1.00 34.04  ? 319 HOH B O   1 
HETATM 1751 O O   . HOH J 3 .   ? 45.291 -19.662 -24.248 1.00 48.23  ? 320 HOH B O   1 
HETATM 1752 O O   . HOH J 3 .   ? 38.449 9.830   -14.263 1.00 64.81  ? 321 HOH B O   1 
HETATM 1753 O O   . HOH J 3 .   ? 46.943 -19.357 -20.273 1.00 55.22  ? 322 HOH B O   1 
HETATM 1754 O O   . HOH J 3 .   ? 30.777 -0.957  -3.835  1.00 51.11  ? 323 HOH B O   1 
HETATM 1755 O O   . HOH J 3 .   ? 45.016 1.847   -19.078 1.00 51.40  ? 324 HOH B O   1 
HETATM 1756 O O   . HOH J 3 .   ? 41.246 -8.680  -25.381 1.00 55.69  ? 325 HOH B O   1 
HETATM 1757 O O   . HOH J 3 .   ? 41.618 -11.361 -17.039 1.00 79.17  ? 326 HOH B O   1 
HETATM 1758 O O   . HOH J 3 .   ? 35.318 -0.878  -21.878 1.00 50.48  ? 327 HOH B O   1 
HETATM 1759 O O   . HOH J 3 .   ? 48.484 -7.167  -18.261 1.00 52.85  ? 328 HOH B O   1 
HETATM 1760 O O   . HOH J 3 .   ? 19.187 17.891  -18.660 1.00 55.84  ? 329 HOH B O   1 
HETATM 1761 O O   . HOH J 3 .   ? 45.649 -9.507  -12.841 1.00 45.83  ? 330 HOH B O   1 
HETATM 1762 O O   . HOH J 3 .   ? 28.848 14.448  -10.020 1.00 52.14  ? 331 HOH B O   1 
HETATM 1763 O O   . HOH J 3 .   ? 26.596 13.008  -3.670  1.00 50.75  ? 332 HOH B O   1 
HETATM 1764 O O   . HOH J 3 .   ? 14.761 12.831  -19.122 1.00 46.49  ? 333 HOH B O   1 
HETATM 1765 O O   . HOH J 3 .   ? 18.774 5.221   -14.904 1.00 53.66  ? 334 HOH B O   1 
HETATM 1766 O O   . HOH J 3 .   ? 23.987 21.029  -10.001 1.00 72.41  ? 335 HOH B O   1 
HETATM 1767 O O   . HOH J 3 .   ? 18.075 7.274   0.892   1.00 56.16  ? 336 HOH B O   1 
HETATM 1768 O O   . HOH J 3 .   ? 45.132 -13.427 -15.968 1.00 66.09  ? 337 HOH B O   1 
HETATM 1769 O O   . HOH J 3 .   ? -0.316 13.036  -5.088  1.00 63.33  ? 338 HOH B O   1 
HETATM 1770 O O   . HOH J 3 .   ? 20.197 19.106  -21.384 1.00 56.68  ? 339 HOH B O   1 
HETATM 1771 O O   . HOH J 3 .   ? 21.855 -1.831  -6.201  1.00 51.28  ? 340 HOH B O   1 
HETATM 1772 O O   . HOH J 3 .   ? 5.557  21.458  -5.751  1.00 55.23  ? 341 HOH B O   1 
HETATM 1773 O O   . HOH J 3 .   ? 31.179 -7.751  -11.264 1.00 54.84  ? 342 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   ?   ?   ?   A . n 
A 1 2   ARG 2   2   ?   ?   ?   A . n 
A 1 3   ASN 3   3   ?   ?   ?   A . n 
A 1 4   GLY 4   4   ?   ?   ?   A . n 
A 1 5   ASP 5   5   5   ASP ASP A . n 
A 1 6   HIS 6   6   6   HIS HIS A . n 
A 1 7   CYS 7   7   7   CYS CYS A . n 
A 1 8   PRO 8   8   8   PRO PRO A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  GLY 10  10  10  GLY GLY A . n 
A 1 11  PRO 11  11  11  PRO PRO A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  ARG 13  13  13  ARG ARG A . n 
A 1 14  CYS 14  14  14  CYS CYS A . n 
A 1 15  CYS 15  15  15  CYS CYS A . n 
A 1 16  ARG 16  16  16  ARG ARG A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  HIS 18  18  18  HIS HIS A . n 
A 1 19  THR 19  19  19  THR THR A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  ALA 22  22  22  ALA ALA A . n 
A 1 23  SER 23  23  23  SER SER A . n 
A 1 24  LEU 24  24  24  LEU LEU A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  ASP 26  26  26  ASP ASP A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  GLY 28  28  28  GLY GLY A . n 
A 1 29  TRP 29  29  29  TRP TRP A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  ASP 31  31  31  ASP ASP A . n 
A 1 32  TRP 32  32  32  TRP TRP A . n 
A 1 33  VAL 33  33  33  VAL VAL A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  SER 35  35  35  SER SER A . n 
A 1 36  PRO 36  36  36  PRO PRO A . n 
A 1 37  ARG 37  37  37  ARG ARG A . n 
A 1 38  GLU 38  38  38  GLU GLU A . n 
A 1 39  VAL 39  39  39  VAL VAL A . n 
A 1 40  GLN 40  40  40  GLN GLN A . n 
A 1 41  VAL 41  41  41  VAL VAL A . n 
A 1 42  THR 42  42  42  THR THR A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  CYS 44  44  44  CYS CYS A . n 
A 1 45  ILE 45  45  45  ILE ILE A . n 
A 1 46  GLY 46  46  46  GLY GLY A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  CYS 48  48  48  CYS CYS A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  SER 50  50  50  SER SER A . n 
A 1 51  GLN 51  51  51  GLN GLN A . n 
A 1 52  PHE 52  52  52  PHE PHE A . n 
A 1 53  ARG 53  53  53  ARG ARG A . n 
A 1 54  ALA 54  54  54  ALA ALA A . n 
A 1 55  ALA 55  55  55  ALA ALA A . n 
A 1 56  ASN 56  56  56  ASN ASN A . n 
A 1 57  MET 57  57  57  MET MET A . n 
A 1 58  HIS 58  58  58  HIS HIS A . n 
A 1 59  ALA 59  59  59  ALA ALA A . n 
A 1 60  GLN 60  60  60  GLN GLN A . n 
A 1 61  ILE 61  61  61  ILE ILE A . n 
A 1 62  LYS 62  62  62  LYS LYS A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  SER 64  64  64  SER SER A . n 
A 1 65  LEU 65  65  65  LEU LEU A . n 
A 1 66  HIS 66  66  66  HIS HIS A . n 
A 1 67  ARG 67  67  67  ARG ARG A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  LYS 69  69  69  LYS LYS A . n 
A 1 70  PRO 70  70  70  PRO PRO A . n 
A 1 71  ASP 71  71  71  ASP ASP A . n 
A 1 72  THR 72  72  72  THR THR A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  PRO 74  74  74  PRO PRO A . n 
A 1 75  ALA 75  75  75  ALA ALA A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  CYS 77  77  77  CYS CYS A . n 
A 1 78  CYS 78  78  78  CYS CYS A . n 
A 1 79  VAL 79  79  79  VAL VAL A . n 
A 1 80  PRO 80  80  80  PRO PRO A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  SER 82  82  82  SER SER A . n 
A 1 83  TYR 83  83  83  TYR TYR A . n 
A 1 84  ASN 84  84  84  ASN ASN A . n 
A 1 85  PRO 85  85  85  PRO PRO A . n 
A 1 86  MET 86  86  86  MET MET A . n 
A 1 87  VAL 87  87  87  VAL VAL A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  ILE 89  89  89  ILE ILE A . n 
A 1 90  GLN 90  90  90  GLN GLN A . n 
A 1 91  LYS 91  91  91  LYS LYS A . n 
A 1 92  THR 92  92  92  THR THR A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  THR 94  94  94  THR THR A . n 
A 1 95  GLY 95  95  95  GLY GLY A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  SER 97  97  97  SER SER A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  GLN 99  99  99  GLN GLN A . n 
A 1 100 THR 100 100 100 THR THR A . n 
A 1 101 TYR 101 101 101 TYR TYR A . n 
A 1 102 ASP 102 102 102 ASP ASP A . n 
A 1 103 ASP 103 103 103 ASP ASP A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 ALA 106 106 106 ALA ALA A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 ASP 108 108 108 ASP ASP A . n 
A 1 109 CYS 109 109 109 CYS CYS A . n 
A 1 110 HIS 110 110 110 HIS HIS A . n 
A 1 111 CYS 111 111 111 CYS CYS A . n 
A 1 112 ILE 112 112 112 ILE ILE A . n 
B 1 1   ALA 1   1   ?   ?   ?   B . n 
B 1 2   ARG 2   2   ?   ?   ?   B . n 
B 1 3   ASN 3   3   ?   ?   ?   B . n 
B 1 4   GLY 4   4   ?   ?   ?   B . n 
B 1 5   ASP 5   5   5   ASP ASP B . n 
B 1 6   HIS 6   6   6   HIS HIS B . n 
B 1 7   CYS 7   7   7   CYS CYS B . n 
B 1 8   PRO 8   8   8   PRO PRO B . n 
B 1 9   LEU 9   9   9   LEU LEU B . n 
B 1 10  GLY 10  10  10  GLY GLY B . n 
B 1 11  PRO 11  11  11  PRO PRO B . n 
B 1 12  GLY 12  12  12  GLY GLY B . n 
B 1 13  ARG 13  13  13  ARG ARG B . n 
B 1 14  CYS 14  14  14  CYS CYS B . n 
B 1 15  CYS 15  15  15  CYS CYS B . n 
B 1 16  ARG 16  16  16  ARG ARG B . n 
B 1 17  LEU 17  17  17  LEU LEU B . n 
B 1 18  HIS 18  18  18  HIS HIS B . n 
B 1 19  THR 19  19  19  THR THR B . n 
B 1 20  VAL 20  20  20  VAL VAL B . n 
B 1 21  ARG 21  21  21  ARG ARG B . n 
B 1 22  ALA 22  22  22  ALA ALA B . n 
B 1 23  SER 23  23  23  SER SER B . n 
B 1 24  LEU 24  24  24  LEU LEU B . n 
B 1 25  GLU 25  25  25  GLU GLU B . n 
B 1 26  ASP 26  26  26  ASP ASP B . n 
B 1 27  LEU 27  27  27  LEU LEU B . n 
B 1 28  GLY 28  28  28  GLY GLY B . n 
B 1 29  TRP 29  29  29  TRP TRP B . n 
B 1 30  ALA 30  30  30  ALA ALA B . n 
B 1 31  ASP 31  31  31  ASP ASP B . n 
B 1 32  TRP 32  32  32  TRP TRP B . n 
B 1 33  VAL 33  33  33  VAL VAL B . n 
B 1 34  LEU 34  34  34  LEU LEU B . n 
B 1 35  SER 35  35  35  SER SER B . n 
B 1 36  PRO 36  36  36  PRO PRO B . n 
B 1 37  ARG 37  37  37  ARG ARG B . n 
B 1 38  GLU 38  38  38  GLU GLU B . n 
B 1 39  VAL 39  39  39  VAL VAL B . n 
B 1 40  GLN 40  40  40  GLN GLN B . n 
B 1 41  VAL 41  41  41  VAL VAL B . n 
B 1 42  THR 42  42  42  THR THR B . n 
B 1 43  MET 43  43  43  MET MET B . n 
B 1 44  CYS 44  44  44  CYS CYS B . n 
B 1 45  ILE 45  45  45  ILE ILE B . n 
B 1 46  GLY 46  46  46  GLY GLY B . n 
B 1 47  ALA 47  47  47  ALA ALA B . n 
B 1 48  CYS 48  48  48  CYS CYS B . n 
B 1 49  PRO 49  49  49  PRO PRO B . n 
B 1 50  SER 50  50  50  SER SER B . n 
B 1 51  GLN 51  51  51  GLN GLN B . n 
B 1 52  PHE 52  52  52  PHE PHE B . n 
B 1 53  ARG 53  53  53  ARG ARG B . n 
B 1 54  ALA 54  54  54  ALA ALA B . n 
B 1 55  ALA 55  55  55  ALA ALA B . n 
B 1 56  ASN 56  56  56  ASN ASN B . n 
B 1 57  MET 57  57  57  MET MET B . n 
B 1 58  HIS 58  58  58  HIS HIS B . n 
B 1 59  ALA 59  59  59  ALA ALA B . n 
B 1 60  GLN 60  60  60  GLN GLN B . n 
B 1 61  ILE 61  61  61  ILE ILE B . n 
B 1 62  LYS 62  62  62  LYS LYS B . n 
B 1 63  THR 63  63  63  THR THR B . n 
B 1 64  SER 64  64  64  SER SER B . n 
B 1 65  LEU 65  65  65  LEU LEU B . n 
B 1 66  HIS 66  66  66  HIS HIS B . n 
B 1 67  ARG 67  67  67  ARG ARG B . n 
B 1 68  LEU 68  68  68  LEU LEU B . n 
B 1 69  LYS 69  69  69  LYS LYS B . n 
B 1 70  PRO 70  70  70  PRO PRO B . n 
B 1 71  ASP 71  71  71  ASP ASP B . n 
B 1 72  THR 72  72  72  THR THR B . n 
B 1 73  VAL 73  73  73  VAL VAL B . n 
B 1 74  PRO 74  74  74  PRO PRO B . n 
B 1 75  ALA 75  75  75  ALA ALA B . n 
B 1 76  PRO 76  76  76  PRO PRO B . n 
B 1 77  CYS 77  77  77  CYS CYS B . n 
B 1 78  CYS 78  78  78  CYS CYS B . n 
B 1 79  VAL 79  79  79  VAL VAL B . n 
B 1 80  PRO 80  80  80  PRO PRO B . n 
B 1 81  ALA 81  81  81  ALA ALA B . n 
B 1 82  SER 82  82  82  SER SER B . n 
B 1 83  TYR 83  83  83  TYR TYR B . n 
B 1 84  ASN 84  84  84  ASN ASN B . n 
B 1 85  PRO 85  85  85  PRO PRO B . n 
B 1 86  MET 86  86  86  MET MET B . n 
B 1 87  VAL 87  87  87  VAL VAL B . n 
B 1 88  LEU 88  88  88  LEU LEU B . n 
B 1 89  ILE 89  89  89  ILE ILE B . n 
B 1 90  GLN 90  90  90  GLN GLN B . n 
B 1 91  LYS 91  91  91  LYS LYS B . n 
B 1 92  THR 92  92  92  THR THR B . n 
B 1 93  ASP 93  93  93  ASP ASP B . n 
B 1 94  THR 94  94  94  THR THR B . n 
B 1 95  GLY 95  95  95  GLY GLY B . n 
B 1 96  VAL 96  96  96  VAL VAL B . n 
B 1 97  SER 97  97  97  SER SER B . n 
B 1 98  LEU 98  98  98  LEU LEU B . n 
B 1 99  GLN 99  99  99  GLN GLN B . n 
B 1 100 THR 100 100 100 THR THR B . n 
B 1 101 TYR 101 101 101 TYR TYR B . n 
B 1 102 ASP 102 102 102 ASP ASP B . n 
B 1 103 ASP 103 103 103 ASP ASP B . n 
B 1 104 LEU 104 104 104 LEU LEU B . n 
B 1 105 LEU 105 105 105 LEU LEU B . n 
B 1 106 ALA 106 106 106 ALA ALA B . n 
B 1 107 LYS 107 107 107 LYS LYS B . n 
B 1 108 ASP 108 108 108 ASP ASP B . n 
B 1 109 CYS 109 109 109 CYS CYS B . n 
B 1 110 HIS 110 110 110 HIS HIS B . n 
B 1 111 CYS 111 111 111 CYS CYS B . n 
B 1 112 ILE 112 112 112 ILE ILE B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 EDO 1  201 1  EDO EDO A . 
D 2 EDO 1  202 2  EDO EDO A . 
E 2 EDO 1  203 5  EDO EDO A . 
F 2 EDO 1  204 6  EDO EDO A . 
G 2 EDO 1  201 3  EDO EDO B . 
H 2 EDO 1  202 4  EDO EDO B . 
I 3 HOH 1  301 62 HOH HOH A . 
I 3 HOH 2  302 81 HOH HOH A . 
I 3 HOH 3  303 8  HOH HOH A . 
I 3 HOH 4  304 64 HOH HOH A . 
I 3 HOH 5  305 5  HOH HOH A . 
I 3 HOH 6  306 42 HOH HOH A . 
I 3 HOH 7  307 33 HOH HOH A . 
I 3 HOH 8  308 79 HOH HOH A . 
I 3 HOH 9  309 48 HOH HOH A . 
I 3 HOH 10 310 61 HOH HOH A . 
I 3 HOH 11 311 70 HOH HOH A . 
I 3 HOH 12 312 24 HOH HOH A . 
I 3 HOH 13 313 68 HOH HOH A . 
I 3 HOH 14 314 76 HOH HOH A . 
I 3 HOH 15 315 55 HOH HOH A . 
I 3 HOH 16 316 72 HOH HOH A . 
I 3 HOH 17 317 82 HOH HOH A . 
I 3 HOH 18 318 26 HOH HOH A . 
I 3 HOH 19 319 54 HOH HOH A . 
I 3 HOH 20 320 27 HOH HOH A . 
I 3 HOH 21 321 29 HOH HOH A . 
I 3 HOH 22 322 7  HOH HOH A . 
I 3 HOH 23 323 1  HOH HOH A . 
I 3 HOH 24 324 31 HOH HOH A . 
I 3 HOH 25 325 71 HOH HOH A . 
I 3 HOH 26 326 2  HOH HOH A . 
I 3 HOH 27 327 21 HOH HOH A . 
I 3 HOH 28 328 86 HOH HOH A . 
I 3 HOH 29 329 30 HOH HOH A . 
I 3 HOH 30 330 75 HOH HOH A . 
I 3 HOH 31 331 65 HOH HOH A . 
I 3 HOH 32 332 9  HOH HOH A . 
I 3 HOH 33 333 59 HOH HOH A . 
I 3 HOH 34 334 66 HOH HOH A . 
I 3 HOH 35 335 25 HOH HOH A . 
I 3 HOH 36 336 10 HOH HOH A . 
I 3 HOH 37 337 28 HOH HOH A . 
I 3 HOH 38 338 60 HOH HOH A . 
I 3 HOH 39 339 23 HOH HOH A . 
I 3 HOH 40 340 53 HOH HOH A . 
I 3 HOH 41 341 74 HOH HOH A . 
I 3 HOH 42 342 22 HOH HOH A . 
I 3 HOH 43 343 6  HOH HOH A . 
I 3 HOH 44 344 78 HOH HOH A . 
J 3 HOH 1  301 83 HOH HOH B . 
J 3 HOH 2  302 51 HOH HOH B . 
J 3 HOH 3  303 4  HOH HOH B . 
J 3 HOH 4  304 34 HOH HOH B . 
J 3 HOH 5  305 17 HOH HOH B . 
J 3 HOH 6  306 85 HOH HOH B . 
J 3 HOH 7  307 43 HOH HOH B . 
J 3 HOH 8  308 58 HOH HOH B . 
J 3 HOH 9  309 69 HOH HOH B . 
J 3 HOH 10 310 13 HOH HOH B . 
J 3 HOH 11 311 41 HOH HOH B . 
J 3 HOH 12 312 63 HOH HOH B . 
J 3 HOH 13 313 32 HOH HOH B . 
J 3 HOH 14 314 11 HOH HOH B . 
J 3 HOH 15 315 20 HOH HOH B . 
J 3 HOH 16 316 15 HOH HOH B . 
J 3 HOH 17 317 19 HOH HOH B . 
J 3 HOH 18 318 80 HOH HOH B . 
J 3 HOH 19 319 3  HOH HOH B . 
J 3 HOH 20 320 84 HOH HOH B . 
J 3 HOH 21 321 50 HOH HOH B . 
J 3 HOH 22 322 47 HOH HOH B . 
J 3 HOH 23 323 45 HOH HOH B . 
J 3 HOH 24 324 12 HOH HOH B . 
J 3 HOH 25 325 73 HOH HOH B . 
J 3 HOH 26 326 77 HOH HOH B . 
J 3 HOH 27 327 40 HOH HOH B . 
J 3 HOH 28 328 39 HOH HOH B . 
J 3 HOH 29 329 14 HOH HOH B . 
J 3 HOH 30 330 52 HOH HOH B . 
J 3 HOH 31 331 44 HOH HOH B . 
J 3 HOH 32 332 16 HOH HOH B . 
J 3 HOH 33 333 46 HOH HOH B . 
J 3 HOH 34 334 37 HOH HOH B . 
J 3 HOH 35 335 38 HOH HOH B . 
J 3 HOH 36 336 18 HOH HOH B . 
J 3 HOH 37 337 35 HOH HOH B . 
J 3 HOH 38 338 57 HOH HOH B . 
J 3 HOH 39 339 67 HOH HOH B . 
J 3 HOH 40 340 36 HOH HOH B . 
J 3 HOH 41 341 49 HOH HOH B . 
J 3 HOH 42 342 56 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3800  ? 
1 MORE         -19   ? 
1 'SSA (A^2)'  11680 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2017-11-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data collection' ? ? ? ? ? ? ? ? ? ? ? MOSFLM      ? ? ? 7.0.5    1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? SCALA       ? ? ? 3.3.9    2 
? refinement        ? ? ? ? ? ? ? ? ? ? ? REFMAC      ? ? ? 5.8.0155 3 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22     4 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? MOSFLM      ? ? ? 7.0.5    5 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? 1.3.3    6 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              98 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              98 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              98 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                132.49 
_pdbx_validate_rmsd_angle.angle_target_value         115.30 
_pdbx_validate_rmsd_angle.angle_deviation            17.19 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 48  ? ? -114.98 73.54   
2 1 GLN A 51  ? ? 66.53   -3.06   
3 1 THR A 94  ? ? 93.19   -31.70  
4 1 LEU A 104 ? ? -125.48 -50.29  
5 1 HIS B 6   ? ? 54.71   104.62  
6 1 ASN B 56  ? ? -172.57 -171.12 
7 1 ASP B 103 ? ? -119.15 65.47   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ALA 1 ? A ALA 1 
2 1 Y 1 A ARG 2 ? A ARG 2 
3 1 Y 1 A ASN 3 ? A ASN 3 
4 1 Y 1 A GLY 4 ? A GLY 4 
5 1 Y 1 B ALA 1 ? B ALA 1 
6 1 Y 1 B ARG 2 ? B ARG 2 
7 1 Y 1 B ASN 3 ? B ASN 3 
8 1 Y 1 B GLY 4 ? B GLY 4 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 1,2-ETHANEDIOL EDO 
3 water          HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                'Biological dimer' 
#