data_5VZ7
# 
_entry.id   5VZ7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5VZ7         
WWPDB D_1000228172 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 5TWP unspecified 
PDB . 5TWQ unspecified 
PDB . 5TWR unspecified 
PDB . 5TWS unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5VZ7 
_pdbx_database_status.recvd_initial_deposition_date   2017-05-27 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Moon, A.F.'     1 ? 
'Pryor, J.M.'    2 ? 
'Ramsden, D.A.'  3 ? 
'Kunkel, T.A.'   4 ? 
'Bebenek, K.'    5 ? 
'Pedersen, L.C.' 6 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            45 
_citation.language                  ? 
_citation.page_first                9138 
_citation.page_last                 9148 
_citation.title                     
'Structural accommodation of ribonucleotide incorporation by the DNA repair enzyme polymerase Mu.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gkx527 
_citation.pdbx_database_id_PubMed   28911097 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Moon, A.F.'     1 
primary 'Pryor, J.M.'    2 
primary 'Ramsden, D.A.'  3 
primary 'Kunkel, T.A.'   4 
primary 'Bebenek, K.'    5 
primary 'Pedersen, L.C.' 6 
# 
_cell.entry_id           5VZ7 
_cell.length_a           59.805 
_cell.length_b           68.825 
_cell.length_c           109.757 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5VZ7 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'DNA-directed DNA/RNA polymerase mu'                                              39858.188 1   2.7.7.7 G433A 
'residues 134-494' ? 
2  polymer     syn 
;DNA (5'-D(*CP*GP*GP*CP*AP*TP*AP*CP*G)-3')
;
2740.812  1   ?       ?     ?                  ? 
3  polymer     syn 
;DNA (5'-D(*CP*GP*TP*A)-3')
;
1190.830  1   ?       ?     ?                  ? 
4  polymer     syn 
;DNA (5'-D(P*GP*CP*CP*G)-3')
;
1191.818  1   ?       ?     ?                  ? 
5  non-polymer syn "5'-O-[(S)-hydroxy{[(S)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]uridine" 483.156   1   ?       ?     ? 
? 
6  non-polymer syn 'MAGNESIUM ION'                                                                   24.305    2   ?       ?     ? 
? 
7  non-polymer syn 'SODIUM ION'                                                                      22.990    1   ?       ?     ? 
? 
8  non-polymer syn 'CHLORIDE ION'                                                                    35.453    1   ?       ?     ? 
? 
9  non-polymer syn 1,2-ETHANEDIOL                                                                    62.068    1   ?       ?     ? 
? 
10 non-polymer syn '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID'                             238.305   1   ?       ?     ? 
? 
11 water       nat water                                                                             18.015    397 ?       ?     ? 
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Pol Mu,Terminal transferase' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GSAAASPAWMPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLKALPSPVTTLSQLQGLPHFGEH
SSRVVQELLEHGVCEEVERVRRSERYQTMKLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDLST
PVLRSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLITHPKEGQEAGLLPRVMCRLQDQGLILYHQHQHS
CCESPTRLAQQSHMDAFERSFCIFRLPQPGSWKAVRVDLVVAPVSQFPFALLAWTGSKLFQRELRRFSRKEKGLWLNSHG
LFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRNA
;
;GSAAASPAWMPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLKALPSPVTTLSQLQGLPHFGEH
SSRVVQELLEHGVCEEVERVRRSERYQTMKLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDLST
PVLRSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLITHPKEGQEAGLLPRVMCRLQDQGLILYHQHQHS
CCESPTRLAQQSHMDAFERSFCIFRLPQPGSWKAVRVDLVVAPVSQFPFALLAWTGSKLFQRELRRFSRKEKGLWLNSHG
LFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRNA
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DG)(DG)(DC)(DA)(DT)(DA)(DC)(DG)' CGGCATACG T ? 
3 polydeoxyribonucleotide no no '(DC)(DG)(DT)(DA)' CGTA P ? 
4 polydeoxyribonucleotide no no '(DG)(DC)(DC)(DG)' GCCG D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   ALA n 
1 4   ALA n 
1 5   ALA n 
1 6   SER n 
1 7   PRO n 
1 8   ALA n 
1 9   TRP n 
1 10  MET n 
1 11  PRO n 
1 12  ALA n 
1 13  TYR n 
1 14  ALA n 
1 15  CYS n 
1 16  GLN n 
1 17  ARG n 
1 18  PRO n 
1 19  THR n 
1 20  PRO n 
1 21  LEU n 
1 22  THR n 
1 23  HIS n 
1 24  HIS n 
1 25  ASN n 
1 26  THR n 
1 27  GLY n 
1 28  LEU n 
1 29  SER n 
1 30  GLU n 
1 31  ALA n 
1 32  LEU n 
1 33  GLU n 
1 34  ILE n 
1 35  LEU n 
1 36  ALA n 
1 37  GLU n 
1 38  ALA n 
1 39  ALA n 
1 40  GLY n 
1 41  PHE n 
1 42  GLU n 
1 43  GLY n 
1 44  SER n 
1 45  GLU n 
1 46  GLY n 
1 47  ARG n 
1 48  LEU n 
1 49  LEU n 
1 50  THR n 
1 51  PHE n 
1 52  CYS n 
1 53  ARG n 
1 54  ALA n 
1 55  ALA n 
1 56  SER n 
1 57  VAL n 
1 58  LEU n 
1 59  LYS n 
1 60  ALA n 
1 61  LEU n 
1 62  PRO n 
1 63  SER n 
1 64  PRO n 
1 65  VAL n 
1 66  THR n 
1 67  THR n 
1 68  LEU n 
1 69  SER n 
1 70  GLN n 
1 71  LEU n 
1 72  GLN n 
1 73  GLY n 
1 74  LEU n 
1 75  PRO n 
1 76  HIS n 
1 77  PHE n 
1 78  GLY n 
1 79  GLU n 
1 80  HIS n 
1 81  SER n 
1 82  SER n 
1 83  ARG n 
1 84  VAL n 
1 85  VAL n 
1 86  GLN n 
1 87  GLU n 
1 88  LEU n 
1 89  LEU n 
1 90  GLU n 
1 91  HIS n 
1 92  GLY n 
1 93  VAL n 
1 94  CYS n 
1 95  GLU n 
1 96  GLU n 
1 97  VAL n 
1 98  GLU n 
1 99  ARG n 
1 100 VAL n 
1 101 ARG n 
1 102 ARG n 
1 103 SER n 
1 104 GLU n 
1 105 ARG n 
1 106 TYR n 
1 107 GLN n 
1 108 THR n 
1 109 MET n 
1 110 LYS n 
1 111 LEU n 
1 112 PHE n 
1 113 THR n 
1 114 GLN n 
1 115 ILE n 
1 116 PHE n 
1 117 GLY n 
1 118 VAL n 
1 119 GLY n 
1 120 VAL n 
1 121 LYS n 
1 122 THR n 
1 123 ALA n 
1 124 ASP n 
1 125 ARG n 
1 126 TRP n 
1 127 TYR n 
1 128 ARG n 
1 129 GLU n 
1 130 GLY n 
1 131 LEU n 
1 132 ARG n 
1 133 THR n 
1 134 LEU n 
1 135 ASP n 
1 136 ASP n 
1 137 LEU n 
1 138 ARG n 
1 139 GLU n 
1 140 GLN n 
1 141 PRO n 
1 142 GLN n 
1 143 LYS n 
1 144 LEU n 
1 145 THR n 
1 146 GLN n 
1 147 GLN n 
1 148 GLN n 
1 149 LYS n 
1 150 ALA n 
1 151 GLY n 
1 152 LEU n 
1 153 GLN n 
1 154 HIS n 
1 155 HIS n 
1 156 GLN n 
1 157 ASP n 
1 158 LEU n 
1 159 SER n 
1 160 THR n 
1 161 PRO n 
1 162 VAL n 
1 163 LEU n 
1 164 ARG n 
1 165 SER n 
1 166 ASP n 
1 167 VAL n 
1 168 ASP n 
1 169 ALA n 
1 170 LEU n 
1 171 GLN n 
1 172 GLN n 
1 173 VAL n 
1 174 VAL n 
1 175 GLU n 
1 176 GLU n 
1 177 ALA n 
1 178 VAL n 
1 179 GLY n 
1 180 GLN n 
1 181 ALA n 
1 182 LEU n 
1 183 PRO n 
1 184 GLY n 
1 185 ALA n 
1 186 THR n 
1 187 VAL n 
1 188 THR n 
1 189 LEU n 
1 190 THR n 
1 191 GLY n 
1 192 GLY n 
1 193 PHE n 
1 194 ARG n 
1 195 ARG n 
1 196 GLY n 
1 197 LYS n 
1 198 LEU n 
1 199 GLN n 
1 200 GLY n 
1 201 HIS n 
1 202 ASP n 
1 203 VAL n 
1 204 ASP n 
1 205 PHE n 
1 206 LEU n 
1 207 ILE n 
1 208 THR n 
1 209 HIS n 
1 210 PRO n 
1 211 LYS n 
1 212 GLU n 
1 213 GLY n 
1 214 GLN n 
1 215 GLU n 
1 216 ALA n 
1 217 GLY n 
1 218 LEU n 
1 219 LEU n 
1 220 PRO n 
1 221 ARG n 
1 222 VAL n 
1 223 MET n 
1 224 CYS n 
1 225 ARG n 
1 226 LEU n 
1 227 GLN n 
1 228 ASP n 
1 229 GLN n 
1 230 GLY n 
1 231 LEU n 
1 232 ILE n 
1 233 LEU n 
1 234 TYR n 
1 235 HIS n 
1 236 GLN n 
1 237 HIS n 
1 238 GLN n 
1 239 HIS n 
1 240 SER n 
1 241 CYS n 
1 242 CYS n 
1 243 GLU n 
1 244 SER n 
1 245 PRO n 
1 246 THR n 
1 247 ARG n 
1 248 LEU n 
1 249 ALA n 
1 250 GLN n 
1 251 GLN n 
1 252 SER n 
1 253 HIS n 
1 254 MET n 
1 255 ASP n 
1 256 ALA n 
1 257 PHE n 
1 258 GLU n 
1 259 ARG n 
1 260 SER n 
1 261 PHE n 
1 262 CYS n 
1 263 ILE n 
1 264 PHE n 
1 265 ARG n 
1 266 LEU n 
1 267 PRO n 
1 268 GLN n 
1 269 PRO n 
1 270 GLY n 
1 271 SER n 
1 272 TRP n 
1 273 LYS n 
1 274 ALA n 
1 275 VAL n 
1 276 ARG n 
1 277 VAL n 
1 278 ASP n 
1 279 LEU n 
1 280 VAL n 
1 281 VAL n 
1 282 ALA n 
1 283 PRO n 
1 284 VAL n 
1 285 SER n 
1 286 GLN n 
1 287 PHE n 
1 288 PRO n 
1 289 PHE n 
1 290 ALA n 
1 291 LEU n 
1 292 LEU n 
1 293 ALA n 
1 294 TRP n 
1 295 THR n 
1 296 GLY n 
1 297 SER n 
1 298 LYS n 
1 299 LEU n 
1 300 PHE n 
1 301 GLN n 
1 302 ARG n 
1 303 GLU n 
1 304 LEU n 
1 305 ARG n 
1 306 ARG n 
1 307 PHE n 
1 308 SER n 
1 309 ARG n 
1 310 LYS n 
1 311 GLU n 
1 312 LYS n 
1 313 GLY n 
1 314 LEU n 
1 315 TRP n 
1 316 LEU n 
1 317 ASN n 
1 318 SER n 
1 319 HIS n 
1 320 GLY n 
1 321 LEU n 
1 322 PHE n 
1 323 ASP n 
1 324 PRO n 
1 325 GLU n 
1 326 GLN n 
1 327 LYS n 
1 328 THR n 
1 329 PHE n 
1 330 PHE n 
1 331 GLN n 
1 332 ALA n 
1 333 ALA n 
1 334 SER n 
1 335 GLU n 
1 336 GLU n 
1 337 ASP n 
1 338 ILE n 
1 339 PHE n 
1 340 ARG n 
1 341 HIS n 
1 342 LEU n 
1 343 GLY n 
1 344 LEU n 
1 345 GLU n 
1 346 TYR n 
1 347 LEU n 
1 348 PRO n 
1 349 PRO n 
1 350 GLU n 
1 351 GLN n 
1 352 ARG n 
1 353 ASN n 
1 354 ALA n 
2 1   DC  n 
2 2   DG  n 
2 3   DG  n 
2 4   DC  n 
2 5   DA  n 
2 6   DT  n 
2 7   DA  n 
2 8   DC  n 
2 9   DG  n 
3 1   DC  n 
3 2   DG  n 
3 3   DT  n 
3 4   DA  n 
4 1   DG  n 
4 2   DC  n 
4 3   DC  n 
4 4   DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   354 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLM, polmu' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEXM 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 9 'synthetic construct' ? 32630 ? 
3 1 sample 1 4 'synthetic construct' ? 32630 ? 
4 1 sample 1 4 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP DPOLM_HUMAN Q9NP87 ? 1 
;SPAWMPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLKALPSPVTTLSQLQGLPHFGEHSSRVV
QELLEHGVCEEVERVRRSERYQTMKLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDLSTPVLRS
DVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLITHPKEGQEAGLLPRVMCRLQDQGLILYHQHQHSCCESP
TRLAQQSHMDAFERSFCIFRLPQPPGAAVGGSTRPCPSWKAVRVDLVVAPVSQFPFALLGWTGSKLFQRELRRFSRKEKG
LWLNSHGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRNA
;
134 
2 PDB 5VZ7        5VZ7   ? 2 ? 1   
3 PDB 5VZ7        5VZ7   ? 3 ? 1   
4 PDB 5VZ7        5VZ7   ? 4 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5VZ7 A 6 ? 354 ? Q9NP87 134 ? 494 ? 134 494 
2 2 5VZ7 T 1 ? 9   ? 5VZ7   1   ? 9   ? 1   9   
3 3 5VZ7 P 1 ? 4   ? 5VZ7   1   ? 4   ? 1   4   
4 4 5VZ7 D 1 ? 4   ? 5VZ7   1   ? 4   ? 1   4   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5VZ7 GLY A 1   ? UNP Q9NP87 ?   ?   'expression tag'      129 1  
1 5VZ7 SER A 2   ? UNP Q9NP87 ?   ?   'expression tag'      130 2  
1 5VZ7 ALA A 3   ? UNP Q9NP87 ?   ?   'expression tag'      131 3  
1 5VZ7 ALA A 4   ? UNP Q9NP87 ?   ?   'expression tag'      132 4  
1 5VZ7 ALA A 5   ? UNP Q9NP87 ?   ?   'expression tag'      133 5  
1 5VZ7 ?   A ?   ? UNP Q9NP87 PRO 398 deletion              ?   6  
1 5VZ7 ?   A ?   ? UNP Q9NP87 GLY 399 deletion              ?   7  
1 5VZ7 ?   A ?   ? UNP Q9NP87 ALA 400 deletion              ?   8  
1 5VZ7 ?   A ?   ? UNP Q9NP87 ALA 401 deletion              ?   9  
1 5VZ7 ?   A ?   ? UNP Q9NP87 VAL 402 deletion              ?   10 
1 5VZ7 ?   A ?   ? UNP Q9NP87 GLY 403 deletion              ?   11 
1 5VZ7 ?   A ?   ? UNP Q9NP87 GLY 404 deletion              ?   12 
1 5VZ7 ?   A ?   ? UNP Q9NP87 SER 405 deletion              ?   13 
1 5VZ7 ?   A ?   ? UNP Q9NP87 THR 406 deletion              ?   14 
1 5VZ7 ?   A ?   ? UNP Q9NP87 ARG 407 deletion              ?   15 
1 5VZ7 ?   A ?   ? UNP Q9NP87 PRO 408 deletion              ?   16 
1 5VZ7 ?   A ?   ? UNP Q9NP87 CYS 409 deletion              ?   17 
1 5VZ7 GLY A 270 ? UNP Q9NP87 PRO 410 linker                410 18 
1 5VZ7 ALA A 293 ? UNP Q9NP87 GLY 433 'engineered mutation' 433 19 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2KH non-polymer         . "5'-O-[(S)-hydroxy{[(S)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]uridine" ?                 
'C9 H16 N3 O14 P3' 483.156 
ALA 'L-peptide linking' y ALANINE                                                                           ?                 
'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                                                          ?                 
'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                        ?                 
'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                   ?                 
'C4 H7 N O4'       133.103 
CL  non-polymer         . 'CHLORIDE ION'                                                                    ?                 
'Cl -1'            35.453  
CYS 'L-peptide linking' y CYSTEINE                                                                          ?                 
'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                              ?                 
'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                               ?                 
'C9 H14 N3 O7 P'   307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                              ?                 
'C10 H14 N5 O7 P'  347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                                      ?                 
'C10 H15 N2 O8 P'  322.208 
EDO non-polymer         . 1,2-ETHANEDIOL                                                                    'ETHYLENE GLYCOL' 
'C2 H6 O2'         62.068  
EPE non-polymer         . '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID'                             HEPES             
'C8 H18 N2 O4 S'   238.305 
GLN 'L-peptide linking' y GLUTAMINE                                                                         ?                 
'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                   ?                 
'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                                                           ?                 
'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                         ?                 
'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                                                             ?                 
'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                        ?                 
'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                                                           ?                 
'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                                                            ?                 
'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                                                        ?                 
'C5 H11 N O2 S'    149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                                                   ?                 
'Mg 2'             24.305  
NA  non-polymer         . 'SODIUM ION'                                                                      ?                 
'Na 1'             22.990  
PHE 'L-peptide linking' y PHENYLALANINE                                                                     ?                 
'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                                                           ?                 
'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                                                            ?                 
'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                                                         ?                 
'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                        ?                 
'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                                                          ?                 
'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                                                            ?                 
'C5 H11 N O2'      117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5VZ7 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.51 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         51.01 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '50mM HEPES pH 7.5, 10% PEG4K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      'Rosenbaum-Rock vertical focusing mirror' 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 300 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-04-13 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    
'Rosenbaum-Rock monochromator high-resolution double-crystal Si(220) sagittal focusing' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5VZ7 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.55 
_reflns.d_resolution_low                 50.00 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       66226 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.9 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.055 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            31.7 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 0.911 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.022 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.55 
_reflns_shell.d_res_low                   1.58 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.13 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           3201 
_reflns_shell.percent_possible_all        98.3 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             4.1 
_reflns_shell.pdbx_Rsym_value             0.675 
_reflns_shell.pdbx_chi_squared            0.819 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             0.350 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.755 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5VZ7 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     63709 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.50 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.435 
_refine.ls_d_res_high                            1.551 
_refine.ls_percent_reflns_obs                    96.02 
_refine.ls_R_factor_obs                          0.1710 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1701 
_refine.ls_R_factor_R_free                       0.1880 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.99 
_refine.ls_number_reflns_R_free                  3180 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      4M04 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.12 
_refine.pdbx_overall_phase_error                 17.18 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2528 
_refine_hist.pdbx_number_atoms_nucleic_acid   344 
_refine_hist.pdbx_number_atoms_ligand         47 
_refine_hist.number_atoms_solvent             397 
_refine_hist.number_atoms_total               3316 
_refine_hist.d_res_high                       1.551 
_refine_hist.d_res_low                        40.435 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.009  ? ? 3275 'X-RAY DIFFRACTION' ? 
f_angle_d          1.057  ? ? 4561 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 12.552 ? ? 1046 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.059  ? ? 503  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.007  ? ? 532  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 1.5509 1.5740  1425 0.2154 52.00  0.2144 . . 64  . . . . 
'X-RAY DIFFRACTION' . 1.5740 1.5986  2067 0.2038 77.00  0.2249 . . 111 . . . . 
'X-RAY DIFFRACTION' . 1.5986 1.6248  2354 0.2033 87.00  0.2496 . . 125 . . . . 
'X-RAY DIFFRACTION' . 1.6248 1.6528  2587 0.1939 96.00  0.1938 . . 136 . . . . 
'X-RAY DIFFRACTION' . 1.6528 1.6829  2692 0.1916 99.00  0.2159 . . 140 . . . . 
'X-RAY DIFFRACTION' . 1.6829 1.7153  2725 0.1862 100.00 0.1988 . . 143 . . . . 
'X-RAY DIFFRACTION' . 1.7153 1.7503  2684 0.1789 100.00 0.2087 . . 141 . . . . 
'X-RAY DIFFRACTION' . 1.7503 1.7883  2721 0.1746 100.00 0.1758 . . 143 . . . . 
'X-RAY DIFFRACTION' . 1.7883 1.8299  2714 0.1738 100.00 0.1979 . . 144 . . . . 
'X-RAY DIFFRACTION' . 1.8299 1.8757  2729 0.1753 100.00 0.2055 . . 143 . . . . 
'X-RAY DIFFRACTION' . 1.8757 1.9264  2707 0.1736 100.00 0.1800 . . 142 . . . . 
'X-RAY DIFFRACTION' . 1.9264 1.9831  2743 0.1726 100.00 0.2016 . . 142 . . . . 
'X-RAY DIFFRACTION' . 1.9831 2.0471  2695 0.1669 100.00 0.1769 . . 145 . . . . 
'X-RAY DIFFRACTION' . 2.0471 2.1203  2733 0.1680 100.00 0.1910 . . 141 . . . . 
'X-RAY DIFFRACTION' . 2.1203 2.2052  2735 0.1628 100.00 0.1769 . . 145 . . . . 
'X-RAY DIFFRACTION' . 2.2052 2.3055  2738 0.1677 100.00 0.1900 . . 151 . . . . 
'X-RAY DIFFRACTION' . 2.3055 2.4270  2722 0.1631 100.00 0.1845 . . 138 . . . . 
'X-RAY DIFFRACTION' . 2.4270 2.5791  2749 0.1747 100.00 0.1771 . . 147 . . . . 
'X-RAY DIFFRACTION' . 2.5791 2.7782  2769 0.1818 100.00 0.1858 . . 145 . . . . 
'X-RAY DIFFRACTION' . 2.7782 3.0577  2772 0.1815 100.00 0.2058 . . 145 . . . . 
'X-RAY DIFFRACTION' . 3.0577 3.4999  2808 0.1600 100.00 0.1788 . . 148 . . . . 
'X-RAY DIFFRACTION' . 3.4999 4.4087  2792 0.1384 100.00 0.1379 . . 147 . . . . 
'X-RAY DIFFRACTION' . 4.4087 40.4484 2868 0.1776 97.00  0.2221 . . 154 . . . . 
# 
_struct.entry_id                     5VZ7 
_struct.title                        
'Pre-catalytic ternary complex of human Polymerase Mu (G433A) mutant with incoming nonhydrolyzable UMPNPP' 
_struct.pdbx_descriptor              'DNA-directed DNA/RNA polymerase mu/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5VZ7 
_struct_keywords.text            
'Family X, nonhomologous end-joining, DNA double strand break repair, ribonucleotide incorporation, TRANSFERASE-DNA complex' 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 6  ? 
H N N 7  ? 
I N N 8  ? 
J N N 9  ? 
K N N 10 ? 
L N N 11 ? 
M N N 11 ? 
N N N 11 ? 
O N N 11 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 TYR A 13  ? ARG A 17  ? TYR A 141 ARG A 145 5 ? 5  
HELX_P HELX_P2  AA2 ASN A 25  ? GLU A 42  ? ASN A 153 GLU A 170 1 ? 18 
HELX_P HELX_P3  AA3 SER A 44  ? LEU A 61  ? SER A 172 LEU A 189 1 ? 18 
HELX_P HELX_P4  AA4 THR A 67  ? GLN A 72  ? THR A 195 GLN A 200 5 ? 6  
HELX_P HELX_P5  AA5 GLY A 78  ? GLY A 92  ? GLY A 206 GLY A 220 1 ? 15 
HELX_P HELX_P6  AA6 CYS A 94  ? ARG A 102 ? CYS A 222 ARG A 230 1 ? 9  
HELX_P HELX_P7  AA7 SER A 103 ? GLN A 114 ? SER A 231 GLN A 242 1 ? 12 
HELX_P HELX_P8  AA8 GLY A 119 ? GLU A 129 ? GLY A 247 GLU A 257 1 ? 11 
HELX_P HELX_P9  AA9 THR A 133 ? GLU A 139 ? THR A 261 GLU A 267 1 ? 7  
HELX_P HELX_P10 AB1 GLN A 140 ? LEU A 144 ? GLN A 268 LEU A 272 5 ? 5  
HELX_P HELX_P11 AB2 THR A 145 ? HIS A 154 ? THR A 273 HIS A 282 1 ? 10 
HELX_P HELX_P12 AB3 HIS A 154 ? SER A 159 ? HIS A 282 SER A 287 1 ? 6  
HELX_P HELX_P13 AB4 ARG A 164 ? LEU A 182 ? ARG A 292 LEU A 310 1 ? 19 
HELX_P HELX_P14 AB5 THR A 190 ? ARG A 195 ? THR A 318 ARG A 323 1 ? 6  
HELX_P HELX_P15 AB6 GLY A 217 ? GLN A 229 ? GLY A 345 GLN A 357 1 ? 13 
HELX_P HELX_P16 AB7 PRO A 283 ? SER A 285 ? PRO A 423 SER A 425 5 ? 3  
HELX_P HELX_P17 AB8 GLN A 286 ? GLY A 296 ? GLN A 426 GLY A 436 1 ? 11 
HELX_P HELX_P18 AB9 SER A 297 ? GLY A 313 ? SER A 437 GLY A 453 1 ? 17 
HELX_P HELX_P19 AC1 SER A 334 ? LEU A 342 ? SER A 474 LEU A 482 1 ? 9  
HELX_P HELX_P20 AC2 PRO A 348 ? ARG A 352 ? PRO A 488 ARG A 492 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A THR 113 O     ? ? ? 1_555 H NA  . NA ? ? A THR 241 A NA  704 1_555 ? ? ? ? ? ? ?            2.408 ? 
metalc2  metalc ? ? A ILE 115 O     ? ? ? 1_555 H NA  . NA ? ? A ILE 243 A NA  704 1_555 ? ? ? ? ? ? ?            2.406 ? 
metalc3  metalc ? ? A VAL 118 O     ? ? ? 1_555 H NA  . NA ? ? A VAL 246 A NA  704 1_555 ? ? ? ? ? ? ?            2.325 ? 
metalc4  metalc ? ? A ASP 202 OD1   ? ? ? 1_555 G MG  . MG ? ? A ASP 330 A MG  703 1_555 ? ? ? ? ? ? ?            2.014 ? 
metalc5  metalc ? ? A ASP 202 OD2   ? ? ? 1_555 F MG  . MG ? ? A ASP 330 A MG  702 1_555 ? ? ? ? ? ? ?            1.965 ? 
metalc6  metalc ? ? A ASP 204 OD1   ? ? ? 1_555 F MG  . MG ? ? A ASP 332 A MG  702 1_555 ? ? ? ? ? ? ?            2.044 ? 
metalc7  metalc ? ? A ASP 204 OD2   ? ? ? 1_555 G MG  . MG ? ? A ASP 332 A MG  703 1_555 ? ? ? ? ? ? ?            2.064 ? 
metalc8  metalc ? ? A ASP 278 OD2   ? ? ? 1_555 F MG  . MG ? ? A ASP 418 A MG  702 1_555 ? ? ? ? ? ? ?            2.101 ? 
metalc9  metalc ? ? C DT  3   OP1   ? ? ? 1_555 H NA  . NA ? ? P DT  3   A NA  704 1_555 ? ? ? ? ? ? ?            2.527 ? 
metalc10 metalc ? ? C DA  4   "O3'" A ? ? 1_555 F MG  . MG ? ? P DA  4   A MG  702 1_555 ? ? ? ? ? ? ?            2.166 ? 
metalc11 metalc ? ? E 2KH .   O2A   ? ? ? 1_555 F MG  . MG ? ? A 2KH 701 A MG  702 1_555 ? ? ? ? ? ? ?            2.284 ? 
metalc12 metalc ? ? E 2KH .   O2A   ? ? ? 1_555 G MG  . MG ? ? A 2KH 701 A MG  703 1_555 ? ? ? ? ? ? ?            2.155 ? 
metalc13 metalc ? ? E 2KH .   O1B   ? ? ? 1_555 G MG  . MG ? ? A 2KH 701 A MG  703 1_555 ? ? ? ? ? ? ?            2.050 ? 
metalc14 metalc ? ? E 2KH .   O3G   ? ? ? 1_555 G MG  . MG ? ? A 2KH 701 A MG  703 1_555 ? ? ? ? ? ? ?            2.094 ? 
metalc15 metalc ? ? F MG  .   MG    ? ? ? 1_555 L HOH . O  B ? A MG  702 A HOH 942 1_555 ? ? ? ? ? ? ?            2.163 ? 
metalc16 metalc ? ? F MG  .   MG    ? ? ? 1_555 N HOH . O  ? ? A MG  702 P HOH 105 1_555 ? ? ? ? ? ? ?            2.059 ? 
metalc17 metalc ? ? G MG  .   MG    ? ? ? 1_555 L HOH . O  ? ? A MG  703 A HOH 902 1_555 ? ? ? ? ? ? ?            2.150 ? 
metalc18 metalc ? ? H NA  .   NA    ? ? ? 1_555 N HOH . O  A ? A NA  704 P HOH 111 1_555 ? ? ? ? ? ? ?            2.554 ? 
metalc19 metalc ? ? H NA  .   NA    ? ? ? 1_555 N HOH . O  ? ? A NA  704 P HOH 114 1_555 ? ? ? ? ? ? ?            2.360 ? 
hydrog1  hydrog ? ? B DC  1   N3    ? ? ? 1_555 D DG  4 N1 A ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DC  1   N3    ? ? ? 1_555 D DG  4 N1 B ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DC  1   N4    ? ? ? 1_555 D DG  4 O6 A ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DC  1   N4    ? ? ? 1_555 D DG  4 O6 B ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DC  1   O2    ? ? ? 1_555 D DG  4 N2 A ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DC  1   O2    ? ? ? 1_555 D DG  4 N2 B ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  2   N1    ? ? ? 1_555 D DC  3 N3 A ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DG  2   N1    ? ? ? 1_555 D DC  3 N3 B ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DG  2   N2    ? ? ? 1_555 D DC  3 O2 A ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DG  2   N2    ? ? ? 1_555 D DC  3 O2 B ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DG  2   O6    ? ? ? 1_555 D DC  3 N4 A ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DG  2   O6    ? ? ? 1_555 D DC  3 N4 B ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DG  3   N1    ? ? ? 1_555 D DC  2 N3 ? ? T DG  3   D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG  3   N2    ? ? ? 1_555 D DC  2 O2 ? ? T DG  3   D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  3   O6    ? ? ? 1_555 D DC  2 N4 ? ? T DG  3   D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC  4   N3    ? ? ? 1_555 D DG  1 N1 ? ? T DC  4   D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DC  4   N4    ? ? ? 1_555 D DG  1 O6 ? ? T DC  4   D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  4   O2    ? ? ? 1_555 D DG  1 N2 ? ? T DC  4   D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DT  6   N3    ? ? ? 1_555 C DA  4 N1 A ? T DT  6   P DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DT  6   O4    ? ? ? 1_555 C DA  4 N6 A ? T DT  6   P DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DA  7   N1    ? ? ? 1_555 C DT  3 N3 ? ? T DA  7   P DT  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DA  7   N6    ? ? ? 1_555 C DT  3 O4 ? ? T DA  7   P DT  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DC  8   N3    ? ? ? 1_555 C DG  2 N1 ? ? T DC  8   P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DC  8   N4    ? ? ? 1_555 C DG  2 O6 ? ? T DC  8   P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DC  8   O2    ? ? ? 1_555 C DG  2 N2 ? ? T DC  8   P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DG  9   N1    ? ? ? 1_555 C DC  1 N3 ? ? T DG  9   P DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DG  9   N2    ? ? ? 1_555 C DC  1 O2 ? ? T DG  9   P DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? B DG  9   O6    ? ? ? 1_555 C DC  1 N4 ? ? T DG  9   P DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           296 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            436 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   SER 
_struct_mon_prot_cis.pdbx_label_seq_id_2    297 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    SER 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     437 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -5.51 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 5 ? 
AA3 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 162 ? LEU A 163 ? VAL A 290 LEU A 291 
AA1 2 GLN A 199 ? GLY A 200 ? GLN A 327 GLY A 328 
AA2 1 THR A 186 ? LEU A 189 ? THR A 314 LEU A 317 
AA2 2 VAL A 203 ? THR A 208 ? VAL A 331 THR A 336 
AA2 3 SER A 271 ? VAL A 281 ? SER A 411 VAL A 421 
AA2 4 ARG A 259 ? GLN A 268 ? ARG A 387 GLN A 396 
AA2 5 ILE A 232 ? TYR A 234 ? ILE A 360 TYR A 362 
AA3 1 TRP A 315 ? ASN A 317 ? TRP A 455 ASN A 457 
AA3 2 GLY A 320 ? ASP A 323 ? GLY A 460 ASP A 463 
AA3 3 THR A 328 ? PHE A 329 ? THR A 468 PHE A 469 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 162 ? N VAL A 290 O GLY A 200 ? O GLY A 328 
AA2 1 2 N THR A 188 ? N THR A 316 O LEU A 206 ? O LEU A 334 
AA2 2 3 N ILE A 207 ? N ILE A 335 O VAL A 280 ? O VAL A 420 
AA2 3 4 O VAL A 275 ? O VAL A 415 N PHE A 264 ? N PHE A 392 
AA2 4 5 O ILE A 263 ? O ILE A 391 N TYR A 234 ? N TYR A 362 
AA3 1 2 N TRP A 315 ? N TRP A 455 O PHE A 322 ? O PHE A 462 
AA3 2 3 N ASP A 323 ? N ASP A 463 O THR A 328 ? O THR A 468 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A 2KH 701 ? 27 'binding site for residue 2KH A 701' 
AC2 Software A MG  702 ? 8  'binding site for residue MG A 702'  
AC3 Software A MG  703 ? 5  'binding site for residue MG A 703'  
AC4 Software A NA  704 ? 6  'binding site for residue NA A 704'  
AC5 Software A CL  705 ? 3  'binding site for residue CL A 705'  
AC6 Software A EDO 706 ? 4  'binding site for residue EDO A 706' 
AC7 Software A EPE 707 ? 5  'binding site for residue EPE A 707' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 27 GLY A 191 ? GLY A 319 . ? 1_555 ? 
2  AC1 27 GLY A 192 ? GLY A 320 . ? 1_555 ? 
3  AC1 27 ARG A 195 ? ARG A 323 . ? 1_555 ? 
4  AC1 27 LYS A 197 ? LYS A 325 . ? 1_555 ? 
5  AC1 27 GLY A 200 ? GLY A 328 . ? 1_555 ? 
6  AC1 27 HIS A 201 ? HIS A 329 . ? 1_555 ? 
7  AC1 27 ASP A 202 ? ASP A 330 . ? 1_555 ? 
8  AC1 27 ASP A 204 ? ASP A 332 . ? 1_555 ? 
9  AC1 27 ALA A 293 ? ALA A 433 . ? 1_555 ? 
10 AC1 27 TRP A 294 ? TRP A 434 . ? 1_555 ? 
11 AC1 27 GLY A 296 ? GLY A 436 . ? 1_555 ? 
12 AC1 27 LYS A 298 ? LYS A 438 . ? 1_555 ? 
13 AC1 27 MG  F .   ? MG  A 702 . ? 1_555 ? 
14 AC1 27 MG  G .   ? MG  A 703 . ? 1_555 ? 
15 AC1 27 CL  I .   ? CL  A 705 . ? 1_555 ? 
16 AC1 27 HOH L .   ? HOH A 837 . ? 1_555 ? 
17 AC1 27 HOH L .   ? HOH A 873 . ? 1_555 ? 
18 AC1 27 HOH L .   ? HOH A 874 . ? 1_555 ? 
19 AC1 27 HOH L .   ? HOH A 888 . ? 1_555 ? 
20 AC1 27 HOH L .   ? HOH A 902 . ? 1_555 ? 
21 AC1 27 HOH L .   ? HOH A 907 . ? 1_555 ? 
22 AC1 27 HOH L .   ? HOH A 937 . ? 1_555 ? 
23 AC1 27 HOH L .   ? HOH A 942 . ? 1_555 ? 
24 AC1 27 HOH L .   ? HOH A 954 . ? 1_555 ? 
25 AC1 27 DA  C 4   ? DA  P 4   . ? 1_555 ? 
26 AC1 27 HOH N .   ? HOH P 105 . ? 1_555 ? 
27 AC1 27 DA  B 5   ? DA  T 5   . ? 1_555 ? 
28 AC2 8  ASP A 202 ? ASP A 330 . ? 1_555 ? 
29 AC2 8  ASP A 204 ? ASP A 332 . ? 1_555 ? 
30 AC2 8  ASP A 278 ? ASP A 418 . ? 1_555 ? 
31 AC2 8  2KH E .   ? 2KH A 701 . ? 1_555 ? 
32 AC2 8  MG  G .   ? MG  A 703 . ? 1_555 ? 
33 AC2 8  HOH L .   ? HOH A 942 . ? 1_555 ? 
34 AC2 8  DA  C 4   ? DA  P 4   . ? 1_555 ? 
35 AC2 8  HOH N .   ? HOH P 105 . ? 1_555 ? 
36 AC3 5  ASP A 202 ? ASP A 330 . ? 1_555 ? 
37 AC3 5  ASP A 204 ? ASP A 332 . ? 1_555 ? 
38 AC3 5  2KH E .   ? 2KH A 701 . ? 1_555 ? 
39 AC3 5  MG  F .   ? MG  A 702 . ? 1_555 ? 
40 AC3 5  HOH L .   ? HOH A 902 . ? 1_555 ? 
41 AC4 6  THR A 113 ? THR A 241 . ? 1_555 ? 
42 AC4 6  ILE A 115 ? ILE A 243 . ? 1_555 ? 
43 AC4 6  VAL A 118 ? VAL A 246 . ? 1_555 ? 
44 AC4 6  DT  C 3   ? DT  P 3   . ? 1_555 ? 
45 AC4 6  HOH N .   ? HOH P 111 . ? 1_555 ? 
46 AC4 6  HOH N .   ? HOH P 114 . ? 1_555 ? 
47 AC5 3  TRP A 294 ? TRP A 434 . ? 1_555 ? 
48 AC5 3  ARG A 305 ? ARG A 445 . ? 1_555 ? 
49 AC5 3  2KH E .   ? 2KH A 701 . ? 1_555 ? 
50 AC6 4  PRO A 62  ? PRO A 190 . ? 1_555 ? 
51 AC6 4  SER A 63  ? SER A 191 . ? 1_555 ? 
52 AC6 4  PRO A 64  ? PRO A 192 . ? 1_555 ? 
53 AC6 4  GLN A 70  ? GLN A 198 . ? 1_555 ? 
54 AC7 5  LYS A 197 ? LYS A 325 . ? 1_555 ? 
55 AC7 5  LEU A 198 ? LEU A 326 . ? 1_555 ? 
56 AC7 5  GLN A 199 ? GLN A 327 . ? 1_555 ? 
57 AC7 5  HOH L .   ? HOH A 827 . ? 1_555 ? 
58 AC7 5  HOH L .   ? HOH A 838 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5VZ7 
_atom_sites.fract_transf_matrix[1][1]   0.016721 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014530 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009111 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
MG 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1  10  ? 0.432   -28.657 -11.739 1.00 28.71 ?  138  MET A N     1 
ATOM   2    C  CA    . MET A 1  10  ? 0.695   -27.218 -11.797 1.00 24.45 ?  138  MET A CA    1 
ATOM   3    C  C     . MET A 1  10  ? -0.130  -26.573 -12.922 1.00 23.25 ?  138  MET A C     1 
ATOM   4    O  O     . MET A 1  10  ? 0.134   -26.814 -14.101 1.00 24.11 ?  138  MET A O     1 
ATOM   5    C  CB    . MET A 1  10  ? 2.200   -26.987 -11.988 1.00 25.12 ?  138  MET A CB    1 
ATOM   6    C  CG    . MET A 1  10  ? 2.676   -25.558 -12.270 1.00 25.31 ?  138  MET A CG    1 
ATOM   7    S  SD    . MET A 1  10  ? 2.809   -24.422 -10.880 1.00 26.16 ?  138  MET A SD    1 
ATOM   8    C  CE    . MET A 1  10  ? 3.855   -25.294 -9.701  1.00 24.13 ?  138  MET A CE    1 
ATOM   9    N  N     A PRO A 1  11  ? -1.128  -25.762 -12.564 0.53 20.55 ?  139  PRO A N     1 
ATOM   10   N  N     B PRO A 1  11  ? -1.125  -25.757 -12.575 0.47 20.58 ?  139  PRO A N     1 
ATOM   11   C  CA    A PRO A 1  11  ? -1.930  -25.080 -13.589 0.53 21.26 ?  139  PRO A CA    1 
ATOM   12   C  CA    B PRO A 1  11  ? -1.930  -25.107 -13.616 0.47 21.13 ?  139  PRO A CA    1 
ATOM   13   C  C     A PRO A 1  11  ? -1.114  -24.066 -14.386 0.53 19.43 ?  139  PRO A C     1 
ATOM   14   C  C     B PRO A 1  11  ? -1.125  -24.067 -14.384 0.47 19.46 ?  139  PRO A C     1 
ATOM   15   O  O     A PRO A 1  11  ? -0.070  -23.572 -13.949 0.53 19.12 ?  139  PRO A O     1 
ATOM   16   O  O     B PRO A 1  11  ? -0.096  -23.563 -13.927 0.47 19.03 ?  139  PRO A O     1 
ATOM   17   C  CB    A PRO A 1  11  ? -3.034  -24.392 -12.775 0.53 21.56 ?  139  PRO A CB    1 
ATOM   18   C  CB    B PRO A 1  11  ? -3.076  -24.463 -12.829 0.47 21.43 ?  139  PRO A CB    1 
ATOM   19   C  CG    A PRO A 1  11  ? -3.082  -25.129 -11.479 0.53 20.66 ?  139  PRO A CG    1 
ATOM   20   C  CG    B PRO A 1  11  ? -2.505  -24.221 -11.491 0.47 18.68 ?  139  PRO A CG    1 
ATOM   21   C  CD    A PRO A 1  11  ? -1.678  -25.568 -11.213 0.53 21.24 ?  139  PRO A CD    1 
ATOM   22   C  CD    B PRO A 1  11  ? -1.565  -25.367 -11.226 0.47 21.07 ?  139  PRO A CD    1 
ATOM   23   N  N     . ALA A 1  12  ? -1.620  -23.740 -15.579 1.00 18.19 ?  140  ALA A N     1 
ATOM   24   C  CA    . ALA A 1  12  ? -0.862  -22.909 -16.499 1.00 16.52 ?  140  ALA A CA    1 
ATOM   25   C  C     . ALA A 1  12  ? -0.969  -21.416 -16.207 1.00 15.80 ?  140  ALA A C     1 
ATOM   26   O  O     . ALA A 1  12  ? -0.082  -20.663 -16.622 1.00 18.83 ?  140  ALA A O     1 
ATOM   27   C  CB    . ALA A 1  12  ? -1.310  -23.187 -17.929 1.00 20.63 ?  140  ALA A CB    1 
ATOM   28   N  N     . TYR A 1  13  ? -2.012  -20.976 -15.503 1.00 13.34 ?  141  TYR A N     1 
ATOM   29   C  CA    . TYR A 1  13  ? -2.198  -19.566 -15.175 1.00 12.66 ?  141  TYR A CA    1 
ATOM   30   C  C     . TYR A 1  13  ? -1.805  -19.298 -13.728 1.00 13.26 ?  141  TYR A C     1 
ATOM   31   O  O     . TYR A 1  13  ? -2.151  -20.062 -12.830 1.00 13.45 ?  141  TYR A O     1 
ATOM   32   C  CB    . TYR A 1  13  ? -3.654  -19.153 -15.349 1.00 12.96 ?  141  TYR A CB    1 
ATOM   33   C  CG    . TYR A 1  13  ? -4.179  -19.086 -16.756 1.00 11.90 ?  141  TYR A CG    1 
ATOM   34   C  CD1   . TYR A 1  13  ? -4.690  -20.226 -17.374 1.00 14.53 ?  141  TYR A CD1   1 
ATOM   35   C  CD2   . TYR A 1  13  ? -4.254  -17.891 -17.438 1.00 14.24 ?  141  TYR A CD2   1 
ATOM   36   C  CE1   . TYR A 1  13  ? -5.221  -20.164 -18.650 1.00 16.44 ?  141  TYR A CE1   1 
ATOM   37   C  CE2   . TYR A 1  13  ? -4.789  -17.820 -18.715 1.00 15.08 ?  141  TYR A CE2   1 
ATOM   38   C  CZ    . TYR A 1  13  ? -5.272  -18.961 -19.311 1.00 15.99 ?  141  TYR A CZ    1 
ATOM   39   O  OH    . TYR A 1  13  ? -5.791  -18.863 -20.579 1.00 20.62 ?  141  TYR A OH    1 
ATOM   40   N  N     . ALA A 1  14  ? -1.155  -18.156 -13.495 1.00 11.68 ?  142  ALA A N     1 
ATOM   41   C  CA    . ALA A 1  14  ? -0.697  -17.844 -12.144 1.00 11.49 ?  142  ALA A CA    1 
ATOM   42   C  C     . ALA A 1  14  ? -1.856  -17.618 -11.177 1.00 13.81 ?  142  ALA A C     1 
ATOM   43   O  O     . ALA A 1  14  ? -1.702  -17.830 -9.968  1.00 13.69 ?  142  ALA A O     1 
ATOM   44   C  CB    . ALA A 1  14  ? 0.215   -16.620 -12.172 1.00 12.12 ?  142  ALA A CB    1 
ATOM   45   N  N     . CYS A 1  15  ? -3.016  -17.201 -11.673 1.00 11.84 ?  143  CYS A N     1 
ATOM   46   C  CA    . CYS A 1  15  ? -4.156  -16.980 -10.791 1.00 11.99 ?  143  CYS A CA    1 
ATOM   47   C  C     . CYS A 1  15  ? -4.816  -18.274 -10.335 1.00 14.01 ?  143  CYS A C     1 
ATOM   48   O  O     . CYS A 1  15  ? -5.748  -18.223 -9.523  1.00 15.98 ?  143  CYS A O     1 
ATOM   49   C  CB    . CYS A 1  15  ? -5.190  -16.092 -11.480 1.00 13.54 ?  143  CYS A CB    1 
ATOM   50   S  SG    . CYS A 1  15  ? -5.730  -16.747 -13.095 1.00 14.52 ?  143  CYS A SG    1 
ATOM   51   N  N     . GLN A 1  16  ? -4.367  -19.424 -10.833 1.00 12.51 ?  144  GLN A N     1 
ATOM   52   C  CA    . GLN A 1  16  ? -4.917  -20.711 -10.435 1.00 12.83 ?  144  GLN A CA    1 
ATOM   53   C  C     . GLN A 1  16  ? -4.107  -21.394 -9.346  1.00 14.63 ?  144  GLN A C     1 
ATOM   54   O  O     . GLN A 1  16  ? -4.436  -22.523 -8.964  1.00 16.62 ?  144  GLN A O     1 
ATOM   55   C  CB    . GLN A 1  16  ? -5.016  -21.643 -11.644 1.00 13.81 ?  144  GLN A CB    1 
ATOM   56   C  CG    . GLN A 1  16  ? -5.993  -21.192 -12.705 1.00 15.02 ?  144  GLN A CG    1 
ATOM   57   C  CD    . GLN A 1  16  ? -5.977  -22.106 -13.908 1.00 18.43 ?  144  GLN A CD    1 
ATOM   58   O  OE1   . GLN A 1  16  ? -4.948  -22.261 -14.568 1.00 17.38 ?  144  GLN A OE1   1 
ATOM   59   N  NE2   . GLN A 1  16  ? -7.114  -22.721 -14.196 1.00 21.88 ?  144  GLN A NE2   1 
ATOM   60   N  N     . ARG A 1  17  ? -3.064  -20.753 -8.834  1.00 16.07 ?  145  ARG A N     1 
ATOM   61   C  CA    . ARG A 1  17  ? -2.232  -21.407 -7.845  1.00 16.88 ?  145  ARG A CA    1 
ATOM   62   C  C     . ARG A 1  17  ? -1.768  -20.368 -6.840  1.00 14.28 ?  145  ARG A C     1 
ATOM   63   O  O     . ARG A 1  17  ? -1.563  -19.200 -7.199  1.00 15.55 ?  145  ARG A O     1 
ATOM   64   C  CB    . ARG A 1  17  ? -1.029  -22.094 -8.503  1.00 18.06 ?  145  ARG A CB    1 
ATOM   65   C  CG    . ARG A 1  17  ? -0.110  -21.126 -9.176  1.00 18.49 ?  145  ARG A CG    1 
ATOM   66   C  CD    . ARG A 1  17  ? 0.601   -21.711 -10.370 1.00 21.67 ?  145  ARG A CD    1 
ATOM   67   N  NE    . ARG A 1  17  ? 1.511   -20.696 -10.881 1.00 20.91 ?  145  ARG A NE    1 
ATOM   68   C  CZ    . ARG A 1  17  ? 1.773   -20.469 -12.161 1.00 21.52 ?  145  ARG A CZ    1 
ATOM   69   N  NH1   . ARG A 1  17  ? 1.208   -21.197 -13.134 1.00 20.44 ?  145  ARG A NH1   1 
ATOM   70   N  NH2   . ARG A 1  17  ? 2.594   -19.483 -12.460 1.00 21.70 ?  145  ARG A NH2   1 
ATOM   71   N  N     . PRO A 1  18  ? -1.613  -20.751 -5.578  1.00 10.66 ?  146  PRO A N     1 
ATOM   72   C  CA    . PRO A 1  18  ? -1.050  -19.830 -4.584  1.00 10.03 ?  146  PRO A CA    1 
ATOM   73   C  C     . PRO A 1  18  ? 0.412   -19.558 -4.869  1.00 10.28 ?  146  PRO A C     1 
ATOM   74   O  O     . PRO A 1  18  ? 1.184   -20.463 -5.214  1.00 11.94 ?  146  PRO A O     1 
ATOM   75   C  CB    . PRO A 1  18  ? -1.222  -20.567 -3.251  1.00 14.22 ?  146  PRO A CB    1 
ATOM   76   C  CG    . PRO A 1  18  ? -1.877  -21.864 -3.575  1.00 15.92 ?  146  PRO A CG    1 
ATOM   77   C  CD    . PRO A 1  18  ? -1.951  -22.068 -5.004  1.00 12.97 ?  146  PRO A CD    1 
ATOM   78   N  N     . THR A 1  19  ? 0.795   -18.292 -4.760  1.00 9.89  ?  147  THR A N     1 
ATOM   79   C  CA    . THR A 1  19  ? 2.199   -17.923 -4.869  1.00 9.87  ?  147  THR A CA    1 
ATOM   80   C  C     . THR A 1  19  ? 2.588   -17.080 -3.669  1.00 9.61  ?  147  THR A C     1 
ATOM   81   O  O     . THR A 1  19  ? 2.157   -15.907 -3.566  1.00 9.96  ?  147  THR A O     1 
ATOM   82   C  CB    . THR A 1  19  ? 2.487   -17.199 -6.181  1.00 10.08 ?  147  THR A CB    1 
ATOM   83   O  OG1   . THR A 1  19  ? 1.849   -17.874 -7.271  1.00 11.01 ?  147  THR A OG1   1 
ATOM   84   C  CG2   . THR A 1  19  ? 3.978   -17.201 -6.433  1.00 10.73 ?  147  THR A CG2   1 
ATOM   85   N  N     . PRO A 1  20  ? 3.344   -17.622 -2.725  1.00 9.28  ?  148  PRO A N     1 
ATOM   86   C  CA    . PRO A 1  20  ? 3.715   -16.859 -1.530  1.00 9.57  ?  148  PRO A CA    1 
ATOM   87   C  C     . PRO A 1  20  ? 4.826   -15.880 -1.846  1.00 9.87  ?  148  PRO A C     1 
ATOM   88   O  O     . PRO A 1  20  ? 5.491   -15.951 -2.875  1.00 10.05 ?  148  PRO A O     1 
ATOM   89   C  CB    . PRO A 1  20  ? 4.187   -17.924 -0.549  1.00 11.79 ?  148  PRO A CB    1 
ATOM   90   C  CG    . PRO A 1  20  ? 4.732   -19.021 -1.453  1.00 11.31 ?  148  PRO A CG    1 
ATOM   91   C  CD    . PRO A 1  20  ? 3.938   -18.981 -2.721  1.00 9.86  ?  148  PRO A CD    1 
ATOM   92   N  N     . LEU A 1  21  ? 5.025   -14.951 -0.917  1.00 11.07 ?  149  LEU A N     1 
ATOM   93   C  CA    . LEU A 1  21  ? 6.036   -13.924 -1.122  1.00 10.43 ?  149  LEU A CA    1 
ATOM   94   C  C     . LEU A 1  21  ? 7.436   -14.504 -1.076  1.00 12.14 ?  149  LEU A C     1 
ATOM   95   O  O     . LEU A 1  21  ? 8.297   -14.154 -1.906  1.00 12.56 ?  149  LEU A O     1 
ATOM   96   C  CB    . LEU A 1  21  ? 5.883   -12.851 -0.055  1.00 12.01 ?  149  LEU A CB    1 
ATOM   97   C  CG    . LEU A 1  21  ? 6.885   -11.715 -0.150  1.00 13.89 ?  149  LEU A CG    1 
ATOM   98   C  CD1   . LEU A 1  21  ? 6.852   -11.029 -1.512  1.00 13.67 ?  149  LEU A CD1   1 
ATOM   99   C  CD2   . LEU A 1  21  ? 6.620   -10.745 0.999   1.00 16.49 ?  149  LEU A CD2   1 
ATOM   100  N  N     . THR A 1  22  ? 7.672   -15.400 -0.136  1.00 11.61 ?  150  THR A N     1 
ATOM   101  C  CA    . THR A 1  22  ? 8.952   -16.084 -0.014  1.00 11.16 ?  150  THR A CA    1 
ATOM   102  C  C     . THR A 1  22  ? 8.754   -17.560 -0.328  1.00 10.54 ?  150  THR A C     1 
ATOM   103  O  O     . THR A 1  22  ? 7.689   -18.131 -0.077  1.00 12.79 ?  150  THR A O     1 
ATOM   104  C  CB    . THR A 1  22  ? 9.574   -15.920 1.400   1.00 12.45 ?  150  THR A CB    1 
ATOM   105  O  OG1   . THR A 1  22  ? 8.718   -16.502 2.383   1.00 15.27 ?  150  THR A OG1   1 
ATOM   106  C  CG2   . THR A 1  22  ? 9.825   -14.460 1.742   1.00 15.88 ?  150  THR A CG2   1 
ATOM   107  N  N     . HIS A 1  23  ? 9.780   -18.167 -0.907  1.00 9.42  ?  151  HIS A N     1 
ATOM   108  C  CA    . HIS A 1  23  ? 9.599   -19.490 -1.475  1.00 8.77  ?  151  HIS A CA    1 
ATOM   109  C  C     . HIS A 1  23  ? 10.920  -20.238 -1.479  1.00 9.75  ?  151  HIS A C     1 
ATOM   110  O  O     . HIS A 1  23  ? 11.820  -19.926 -0.694  1.00 10.77 ?  151  HIS A O     1 
ATOM   111  C  CB    . HIS A 1  23  ? 8.962   -19.367 -2.866  1.00 8.42  ?  151  HIS A CB    1 
ATOM   112  C  CG    . HIS A 1  23  ? 9.768   -18.572 -3.835  1.00 8.03  ?  151  HIS A CG    1 
ATOM   113  N  ND1   . HIS A 1  23  ? 10.717  -19.130 -4.665  1.00 9.04  ?  151  HIS A ND1   1 
ATOM   114  C  CD2   . HIS A 1  23  ? 9.762   -17.247 -4.111  1.00 8.73  ?  151  HIS A CD2   1 
ATOM   115  C  CE1   . HIS A 1  23  ? 11.266  -18.183 -5.404  1.00 10.03 ?  151  HIS A CE1   1 
ATOM   116  N  NE2   . HIS A 1  23  ? 10.727  -17.025 -5.063  1.00 9.70  ?  151  HIS A NE2   1 
ATOM   117  N  N     . HIS A 1  24  ? 11.000  -21.286 -2.298  1.00 9.34  ?  152  HIS A N     1 
ATOM   118  C  CA    . HIS A 1  24  ? 12.076  -22.274 -2.191  1.00 9.96  ?  152  HIS A CA    1 
ATOM   119  C  C     . HIS A 1  24  ? 12.957  -22.312 -3.423  1.00 9.98  ?  152  HIS A C     1 
ATOM   120  O  O     . HIS A 1  24  ? 13.800  -23.219 -3.550  1.00 10.58 ?  152  HIS A O     1 
ATOM   121  C  CB    . HIS A 1  24  ? 11.472  -23.659 -1.939  1.00 10.43 ?  152  HIS A CB    1 
ATOM   122  C  CG    . HIS A 1  24  ? 10.427  -23.639 -0.884  1.00 10.62 ?  152  HIS A CG    1 
ATOM   123  N  ND1   . HIS A 1  24  ? 10.714  -23.383 0.439   1.00 11.99 ?  152  HIS A ND1   1 
ATOM   124  C  CD2   . HIS A 1  24  ? 9.078   -23.688 -0.973  1.00 11.32 ?  152  HIS A CD2   1 
ATOM   125  C  CE1   . HIS A 1  24  ? 9.588   -23.347 1.131   1.00 14.21 ?  152  HIS A CE1   1 
ATOM   126  N  NE2   . HIS A 1  24  ? 8.578   -23.519 0.291   1.00 13.14 ?  152  HIS A NE2   1 
ATOM   127  N  N     . ASN A 1  25  ? 12.807  -21.365 -4.344  1.00 9.46  ?  153  ASN A N     1 
ATOM   128  C  CA    . ASN A 1  25  ? 13.571  -21.379 -5.582  1.00 9.57  ?  153  ASN A CA    1 
ATOM   129  C  C     . ASN A 1  25  ? 14.026  -19.972 -5.946  1.00 9.38  ?  153  ASN A C     1 
ATOM   130  O  O     . ASN A 1  25  ? 14.071  -19.592 -7.121  1.00 10.10 ?  153  ASN A O     1 
ATOM   131  C  CB    . ASN A 1  25  ? 12.746  -22.014 -6.694  1.00 9.46  ?  153  ASN A CB    1 
ATOM   132  C  CG    . ASN A 1  25  ? 12.650  -23.518 -6.533  1.00 10.06 ?  153  ASN A CG    1 
ATOM   133  O  OD1   . ASN A 1  25  ? 13.650  -24.234 -6.757  1.00 11.02 ?  153  ASN A OD1   1 
ATOM   134  N  ND2   . ASN A 1  25  ? 11.507  -24.003 -6.079  1.00 10.47 ?  153  ASN A ND2   1 
ATOM   135  N  N     . THR A 1  26  ? 14.444  -19.218 -4.931  1.00 10.15 ?  154  THR A N     1 
ATOM   136  C  CA    . THR A 1  26  ? 14.712  -17.786 -5.090  1.00 9.09  ?  154  THR A CA    1 
ATOM   137  C  C     . THR A 1  26  ? 15.774  -17.510 -6.153  1.00 10.55 ?  154  THR A C     1 
ATOM   138  O  O     . THR A 1  26  ? 15.582  -16.655 -7.027  1.00 11.81 ?  154  THR A O     1 
ATOM   139  C  CB    . THR A 1  26  ? 15.112  -17.214 -3.729  1.00 10.59 ?  154  THR A CB    1 
ATOM   140  O  OG1   . THR A 1  26  ? 14.123  -17.598 -2.759  1.00 11.84 ?  154  THR A OG1   1 
ATOM   141  C  CG2   . THR A 1  26  ? 15.222  -15.712 -3.773  1.00 12.61 ?  154  THR A CG2   1 
ATOM   142  N  N     . GLY A 1  27  ? 16.903  -18.226 -6.099  1.00 11.95 ?  155  GLY A N     1 
ATOM   143  C  CA    . GLY A 1  27  ? 17.962  -17.995 -7.072  1.00 14.65 ?  155  GLY A CA    1 
ATOM   144  C  C     . GLY A 1  27  ? 17.538  -18.298 -8.493  1.00 14.39 ?  155  GLY A C     1 
ATOM   145  O  O     . GLY A 1  27  ? 17.868  -17.552 -9.421  1.00 14.61 ?  155  GLY A O     1 
ATOM   146  N  N     . LEU A 1  28  ? 16.787  -19.380 -8.686  1.00 11.41 ?  156  LEU A N     1 
ATOM   147  C  CA    . LEU A 1  28  ? 16.376  -19.734 -10.028 1.00 12.82 ?  156  LEU A CA    1 
ATOM   148  C  C     . LEU A 1  28  ? 15.402  -18.702 -10.574 1.00 11.63 ?  156  LEU A C     1 
ATOM   149  O  O     . LEU A 1  28  ? 15.512  -18.275 -11.731 1.00 11.00 ?  156  LEU A O     1 
ATOM   150  C  CB    . LEU A 1  28  ? 15.749  -21.120 -10.041 1.00 12.30 ?  156  LEU A CB    1 
ATOM   151  C  CG    . LEU A 1  28  ? 16.615  -22.303 -9.603  1.00 13.75 ?  156  LEU A CG    1 
ATOM   152  C  CD1   . LEU A 1  28  ? 15.797  -23.552 -9.658  1.00 13.33 ?  156  LEU A CD1   1 
ATOM   153  C  CD2   . LEU A 1  28  ? 17.885  -22.438 -10.472 1.00 13.81 ?  156  LEU A CD2   1 
ATOM   154  N  N     . SER A 1  29  ? 14.445  -18.277 -9.750  1.00 10.50 ?  157  SER A N     1 
ATOM   155  C  CA    A SER A 1  29  ? 13.470  -17.300 -10.219 0.63 8.82  ?  157  SER A CA    1 
ATOM   156  C  CA    B SER A 1  29  ? 13.467  -17.294 -10.206 0.37 9.23  ?  157  SER A CA    1 
ATOM   157  C  C     . SER A 1  29  ? 14.129  -15.957 -10.524 1.00 9.69  ?  157  SER A C     1 
ATOM   158  O  O     . SER A 1  29  ? 13.760  -15.295 -11.499 1.00 10.40 ?  157  SER A O     1 
ATOM   159  C  CB    A SER A 1  29  ? 12.334  -17.133 -9.202  0.63 10.05 ?  157  SER A CB    1 
ATOM   160  C  CB    B SER A 1  29  ? 12.365  -17.099 -9.161  0.37 10.00 ?  157  SER A CB    1 
ATOM   161  O  OG    A SER A 1  29  ? 12.784  -16.624 -7.945  0.63 11.68 ?  157  SER A OG    1 
ATOM   162  O  OG    B SER A 1  29  ? 11.521  -18.231 -9.049  0.37 8.85  ?  157  SER A OG    1 
ATOM   163  N  N     . GLU A 1  30  ? 15.112  -15.541 -9.711  1.00 9.58  ?  158  GLU A N     1 
ATOM   164  C  CA    A GLU A 1  30  ? 15.804  -14.280 -9.965  0.60 12.27 ?  158  GLU A CA    1 
ATOM   165  C  CA    B GLU A 1  30  ? 15.825  -14.284 -9.959  0.40 12.21 ?  158  GLU A CA    1 
ATOM   166  C  C     . GLU A 1  30  ? 16.512  -14.296 -11.316 1.00 12.10 ?  158  GLU A C     1 
ATOM   167  O  O     . GLU A 1  30  ? 16.503  -13.290 -12.044 1.00 11.41 ?  158  GLU A O     1 
ATOM   168  C  CB    A GLU A 1  30  ? 16.793  -13.998 -8.832  0.60 12.22 ?  158  GLU A CB    1 
ATOM   169  C  CB    B GLU A 1  30  ? 16.858  -14.043 -8.856  0.40 13.54 ?  158  GLU A CB    1 
ATOM   170  C  CG    A GLU A 1  30  ? 16.251  -13.002 -7.813  0.60 23.93 ?  158  GLU A CG    1 
ATOM   171  C  CG    B GLU A 1  30  ? 17.442  -12.621 -8.812  0.40 9.77  ?  158  GLU A CG    1 
ATOM   172  C  CD    A GLU A 1  30  ? 16.782  -13.187 -6.392  0.60 32.20 ?  158  GLU A CD    1 
ATOM   173  C  CD    B GLU A 1  30  ? 18.685  -12.413 -9.662  0.40 26.22 ?  158  GLU A CD    1 
ATOM   174  O  OE1   A GLU A 1  30  ? 17.900  -13.719 -6.239  0.60 35.00 ?  158  GLU A OE1   1 
ATOM   175  O  OE1   B GLU A 1  30  ? 19.321  -13.404 -10.071 0.40 22.19 ?  158  GLU A OE1   1 
ATOM   176  O  OE2   A GLU A 1  30  ? 16.082  -12.779 -5.426  0.60 26.87 ?  158  GLU A OE2   1 
ATOM   177  O  OE2   B GLU A 1  30  ? 19.031  -11.235 -9.907  0.40 19.31 ?  158  GLU A OE2   1 
ATOM   178  N  N     . ALA A 1  31  ? 17.108  -15.427 -11.674 1.00 11.09 ?  159  ALA A N     1 
ATOM   179  C  CA    . ALA A 1  31  ? 17.817  -15.540 -12.945 1.00 11.46 ?  159  ALA A CA    1 
ATOM   180  C  C     . ALA A 1  31  ? 16.856  -15.389 -14.106 1.00 11.74 ?  159  ALA A C     1 
ATOM   181  O  O     . ALA A 1  31  ? 17.115  -14.645 -15.055 1.00 12.70 ?  159  ALA A O     1 
ATOM   182  C  CB    . ALA A 1  31  ? 18.534  -16.891 -13.013 1.00 13.18 ?  159  ALA A CB    1 
ATOM   183  N  N     . LEU A 1  32  ? 15.738  -16.109 -14.053 1.00 11.51 ?  160  LEU A N     1 
ATOM   184  C  CA    . LEU A 1  32  ? 14.756  -15.999 -15.121 1.00 11.10 ?  160  LEU A CA    1 
ATOM   185  C  C     . LEU A 1  32  ? 14.175  -14.597 -15.206 1.00 11.42 ?  160  LEU A C     1 
ATOM   186  O  O     . LEU A 1  32  ? 13.863  -14.113 -16.309 1.00 11.73 ?  160  LEU A O     1 
ATOM   187  C  CB    . LEU A 1  32  ? 13.666  -17.041 -14.915 1.00 10.05 ?  160  LEU A CB    1 
ATOM   188  C  CG    . LEU A 1  32  ? 14.154  -18.485 -15.098 1.00 11.29 ?  160  LEU A CG    1 
ATOM   189  C  CD1   . LEU A 1  32  ? 13.162  -19.475 -14.518 1.00 11.60 ?  160  LEU A CD1   1 
ATOM   190  C  CD2   . LEU A 1  32  ? 14.396  -18.778 -16.556 1.00 13.26 ?  160  LEU A CD2   1 
ATOM   191  N  N     . GLU A 1  33  ? 14.025  -13.913 -14.064 1.00 10.29 ?  161  GLU A N     1 
ATOM   192  C  CA    . GLU A 1  33  ? 13.519  -12.543 -14.099 1.00 9.84  ?  161  GLU A CA    1 
ATOM   193  C  C     . GLU A 1  33  ? 14.527  -11.555 -14.697 1.00 11.77 ?  161  GLU A C     1 
ATOM   194  O  O     . GLU A 1  33  ? 14.119  -10.543 -15.274 1.00 11.62 ?  161  GLU A O     1 
ATOM   195  C  CB    . GLU A 1  33  ? 13.054  -12.146 -12.693 1.00 11.12 ?  161  GLU A CB    1 
ATOM   196  C  CG    . GLU A 1  33  ? 11.762  -12.874 -12.412 1.00 12.31 ?  161  GLU A CG    1 
ATOM   197  C  CD    . GLU A 1  33  ? 11.177  -12.678 -11.043 1.00 23.57 ?  161  GLU A CD    1 
ATOM   198  O  OE1   . GLU A 1  33  ? 11.893  -12.216 -10.134 1.00 21.98 ?  161  GLU A OE1   1 
ATOM   199  O  OE2   . GLU A 1  33  ? 9.977   -13.015 -10.885 1.00 22.39 ?  161  GLU A OE2   1 
ATOM   200  N  N     . ILE A 1  34  ? 15.840  -11.830 -14.626 1.00 9.77  ?  162  ILE A N     1 
ATOM   201  C  CA    . ILE A 1  34  ? 16.793  -10.995 -15.356 1.00 10.29 ?  162  ILE A CA    1 
ATOM   202  C  C     . ILE A 1  34  ? 16.549  -11.102 -16.859 1.00 11.42 ?  162  ILE A C     1 
ATOM   203  O  O     . ILE A 1  34  ? 16.559  -10.095 -17.579 1.00 12.32 ?  162  ILE A O     1 
ATOM   204  C  CB    . ILE A 1  34  ? 18.242  -11.396 -15.016 1.00 11.82 ?  162  ILE A CB    1 
ATOM   205  C  CG1   . ILE A 1  34  ? 18.582  -11.069 -13.555 1.00 15.22 ?  162  ILE A CG1   1 
ATOM   206  C  CG2   . ILE A 1  34  ? 19.216  -10.732 -16.001 1.00 14.14 ?  162  ILE A CG2   1 
ATOM   207  C  CD1   . ILE A 1  34  ? 18.707  -9.609  -13.259 1.00 19.53 ?  162  ILE A CD1   1 
ATOM   208  N  N     . LEU A 1  35  ? 16.338  -12.331 -17.354 1.00 11.01 ?  163  LEU A N     1 
ATOM   209  C  CA    . LEU A 1  35  ? 16.084  -12.518 -18.780 1.00 12.71 ?  163  LEU A CA    1 
ATOM   210  C  C     . LEU A 1  35  ? 14.766  -11.888 -19.187 1.00 12.79 ?  163  LEU A C     1 
ATOM   211  O  O     . LEU A 1  35  ? 14.650  -11.345 -20.291 1.00 12.30 ?  163  LEU A O     1 
ATOM   212  C  CB    . LEU A 1  35  ? 16.108  -14.000 -19.114 1.00 11.87 ?  163  LEU A CB    1 
ATOM   213  C  CG    . LEU A 1  35  ? 17.445  -14.707 -18.809 1.00 13.23 ?  163  LEU A CG    1 
ATOM   214  C  CD1   . LEU A 1  35  ? 17.376  -16.182 -19.189 1.00 14.05 ?  163  LEU A CD1   1 
ATOM   215  C  CD2   . LEU A 1  35  ? 18.615  -14.028 -19.506 1.00 14.31 ?  163  LEU A CD2   1 
ATOM   216  N  N     . ALA A 1  36  ? 13.774  -11.924 -18.304 1.00 10.79 ?  164  ALA A N     1 
ATOM   217  C  CA    . ALA A 1  36  ? 12.503  -11.278 -18.602 1.00 10.63 ?  164  ALA A CA    1 
ATOM   218  C  C     . ALA A 1  36  ? 12.680  -9.780  -18.734 1.00 10.47 ?  164  ALA A C     1 
ATOM   219  O  O     . ALA A 1  36  ? 12.173  -9.156  -19.677 1.00 10.65 ?  164  ALA A O     1 
ATOM   220  C  CB    . ALA A 1  36  ? 11.483  -11.611 -17.516 1.00 9.45  ?  164  ALA A CB    1 
ATOM   221  N  N     . GLU A 1  37  ? 13.405  -9.174  -17.787 1.00 12.22 ?  165  GLU A N     1 
ATOM   222  C  CA    . GLU A 1  37  ? 13.655  -7.741  -17.828 1.00 12.46 ?  165  GLU A CA    1 
ATOM   223  C  C     . GLU A 1  37  ? 14.419  -7.363  -19.093 1.00 14.06 ?  165  GLU A C     1 
ATOM   224  O  O     . GLU A 1  37  ? 14.068  -6.389  -19.773 1.00 13.51 ?  165  GLU A O     1 
ATOM   225  C  CB    . GLU A 1  37  ? 14.428  -7.352  -16.565 1.00 13.46 ?  165  GLU A CB    1 
ATOM   226  C  CG    . GLU A 1  37  ? 14.733  -5.905  -16.370 1.00 17.32 ?  165  GLU A CG    1 
ATOM   227  C  CD    . GLU A 1  37  ? 15.460  -5.654  -15.052 1.00 24.62 ?  165  GLU A CD    1 
ATOM   228  O  OE1   . GLU A 1  37  ? 16.164  -6.572  -14.554 1.00 22.25 ?  165  GLU A OE1   1 
ATOM   229  O  OE2   . GLU A 1  37  ? 15.324  -4.537  -14.519 1.00 27.28 ?  165  GLU A OE2   1 
ATOM   230  N  N     . ALA A 1  38  ? 15.435  -8.147  -19.446 1.00 12.50 ?  166  ALA A N     1 
ATOM   231  C  CA    . ALA A 1  38  ? 16.215  -7.854  -20.642 1.00 15.09 ?  166  ALA A CA    1 
ATOM   232  C  C     . ALA A 1  38  ? 15.363  -7.967  -21.890 1.00 15.08 ?  166  ALA A C     1 
ATOM   233  O  O     . ALA A 1  38  ? 15.525  -7.175  -22.824 1.00 15.80 ?  166  ALA A O     1 
ATOM   234  C  CB    . ALA A 1  38  ? 17.410  -8.803  -20.744 1.00 16.16 ?  166  ALA A CB    1 
ATOM   235  N  N     . ALA A 1  39  ? 14.455  -8.942  -21.930 1.00 14.15 ?  167  ALA A N     1 
ATOM   236  C  CA    . ALA A 1  39  ? 13.538  -9.041  -23.059 1.00 14.16 ?  167  ALA A CA    1 
ATOM   237  C  C     . ALA A 1  39  ? 12.671  -7.794  -23.182 1.00 15.28 ?  167  ALA A C     1 
ATOM   238  O  O     . ALA A 1  39  ? 12.446  -7.284  -24.286 1.00 16.45 ?  167  ALA A O     1 
ATOM   239  C  CB    . ALA A 1  39  ? 12.688  -10.299 -22.917 1.00 14.32 ?  167  ALA A CB    1 
ATOM   240  N  N     . GLY A 1  40  ? 12.198  -7.263  -22.061 1.00 13.89 ?  168  GLY A N     1 
ATOM   241  C  CA    . GLY A 1  40  ? 11.427  -6.027  -22.108 1.00 15.32 ?  168  GLY A CA    1 
ATOM   242  C  C     . GLY A 1  40  ? 12.236  -4.847  -22.604 1.00 15.51 ?  168  GLY A C     1 
ATOM   243  O  O     . GLY A 1  40  ? 11.718  -3.973  -23.302 1.00 16.68 ?  168  GLY A O     1 
ATOM   244  N  N     . PHE A 1  41  ? 13.513  -4.779  -22.231 1.00 15.39 ?  169  PHE A N     1 
ATOM   245  C  CA    . PHE A 1  41  ? 14.342  -3.688  -22.724 1.00 16.85 ?  169  PHE A CA    1 
ATOM   246  C  C     . PHE A 1  41  ? 14.497  -3.742  -24.243 1.00 20.01 ?  169  PHE A C     1 
ATOM   247  O  O     . PHE A 1  41  ? 14.751  -2.705  -24.870 1.00 20.57 ?  169  PHE A O     1 
ATOM   248  C  CB    . PHE A 1  41  ? 15.715  -3.725  -22.057 1.00 16.70 ?  169  PHE A CB    1 
ATOM   249  C  CG    . PHE A 1  41  ? 15.711  -3.399  -20.581 1.00 16.23 ?  169  PHE A CG    1 
ATOM   250  C  CD1   . PHE A 1  41  ? 14.684  -2.703  -19.987 1.00 16.10 ?  169  PHE A CD1   1 
ATOM   251  C  CD2   . PHE A 1  41  ? 16.775  -3.803  -19.793 1.00 16.73 ?  169  PHE A CD2   1 
ATOM   252  C  CE1   . PHE A 1  41  ? 14.717  -2.415  -18.634 1.00 16.88 ?  169  PHE A CE1   1 
ATOM   253  C  CE2   . PHE A 1  41  ? 16.828  -3.505  -18.437 1.00 18.08 ?  169  PHE A CE2   1 
ATOM   254  C  CZ    . PHE A 1  41  ? 15.810  -2.823  -17.857 1.00 16.46 ?  169  PHE A CZ    1 
ATOM   255  N  N     . GLU A 1  42  ? 14.353  -4.923  -24.846 1.00 19.93 ?  170  GLU A N     1 
ATOM   256  C  CA    . GLU A 1  42  ? 14.456  -5.101  -26.293 1.00 23.20 ?  170  GLU A CA    1 
ATOM   257  C  C     . GLU A 1  42  ? 13.113  -5.002  -27.001 1.00 25.71 ?  170  GLU A C     1 
ATOM   258  O  O     . GLU A 1  42  ? 13.057  -5.198  -28.219 1.00 28.06 ?  170  GLU A O     1 
ATOM   259  C  CB    . GLU A 1  42  ? 15.085  -6.459  -26.630 1.00 24.52 ?  170  GLU A CB    1 
ATOM   260  C  CG    . GLU A 1  42  ? 16.504  -6.654  -26.138 1.00 28.22 ?  170  GLU A CG    1 
ATOM   261  N  N     . GLY A 1  43  ? 12.037  -4.721  -26.280 1.00 24.64 ?  171  GLY A N     1 
ATOM   262  C  CA    . GLY A 1  43  ? 10.720  -4.672  -26.879 1.00 25.77 ?  171  GLY A CA    1 
ATOM   263  C  C     . GLY A 1  43  ? 10.034  -6.003  -27.074 1.00 23.83 ?  171  GLY A C     1 
ATOM   264  O  O     . GLY A 1  43  ? 9.020   -6.058  -27.782 1.00 23.97 ?  171  GLY A O     1 
ATOM   265  N  N     . SER A 1  44  ? 10.514  -7.081  -26.453 1.00 19.43 ?  172  SER A N     1 
ATOM   266  C  CA    . SER A 1  44  ? 9.948   -8.403  -26.696 1.00 20.39 ?  172  SER A CA    1 
ATOM   267  C  C     . SER A 1  44  ? 9.027   -8.787  -25.542 1.00 19.37 ?  172  SER A C     1 
ATOM   268  O  O     . SER A 1  44  ? 9.394   -9.536  -24.631 1.00 17.96 ?  172  SER A O     1 
ATOM   269  C  CB    . SER A 1  44  ? 11.032  -9.448  -26.905 1.00 26.27 ?  172  SER A CB    1 
ATOM   270  O  OG    . SER A 1  44  ? 10.407  -10.683 -27.225 1.00 32.45 ?  172  SER A OG    1 
ATOM   271  N  N     . GLU A 1  45  ? 7.782   -8.320  -25.650 1.00 18.27 ?  173  GLU A N     1 
ATOM   272  C  CA    . GLU A 1  45  ? 6.781   -8.533  -24.604 1.00 18.22 ?  173  GLU A CA    1 
ATOM   273  C  C     . GLU A 1  45  ? 6.466   -10.007 -24.420 1.00 16.21 ?  173  GLU A C     1 
ATOM   274  O  O     . GLU A 1  45  ? 6.215   -10.466 -23.302 1.00 15.83 ?  173  GLU A O     1 
ATOM   275  C  CB    . GLU A 1  45  ? 5.490   -7.784  -24.948 1.00 22.19 ?  173  GLU A CB    1 
ATOM   276  C  CG    . GLU A 1  45  ? 5.351   -6.398  -24.350 1.00 30.81 ?  173  GLU A CG    1 
ATOM   277  C  CD    . GLU A 1  45  ? 5.543   -6.386  -22.845 1.00 34.44 ?  173  GLU A CD    1 
ATOM   278  O  OE1   . GLU A 1  45  ? 4.739   -7.013  -22.119 1.00 37.09 ?  173  GLU A OE1   1 
ATOM   279  O  OE2   . GLU A 1  45  ? 6.517   -5.770  -22.393 1.00 34.85 ?  173  GLU A OE2   1 
ATOM   280  N  N     . GLY A 1  46  ? 6.417   -10.763 -25.520 1.00 14.74 ?  174  GLY A N     1 
ATOM   281  C  CA    . GLY A 1  46  ? 6.106   -12.177 -25.417 1.00 13.63 ?  174  GLY A CA    1 
ATOM   282  C  C     . GLY A 1  46  ? 7.161   -12.952 -24.649 1.00 12.81 ?  174  GLY A C     1 
ATOM   283  O  O     . GLY A 1  46  ? 6.849   -13.774 -23.787 1.00 13.60 ?  174  GLY A O     1 
ATOM   284  N  N     A ARG A 1  47  ? 8.427   -12.725 -24.997 0.48 12.11 ?  175  ARG A N     1 
ATOM   285  N  N     B ARG A 1  47  ? 8.429   -12.709 -24.958 0.52 12.23 ?  175  ARG A N     1 
ATOM   286  C  CA    A ARG A 1  47  ? 9.511   -13.367 -24.265 0.48 12.78 ?  175  ARG A CA    1 
ATOM   287  C  CA    B ARG A 1  47  ? 9.467   -13.425 -24.226 0.52 12.76 ?  175  ARG A CA    1 
ATOM   288  C  C     A ARG A 1  47  ? 9.486   -12.958 -22.799 0.48 11.71 ?  175  ARG A C     1 
ATOM   289  C  C     B ARG A 1  47  ? 9.575   -12.940 -22.784 0.52 11.81 ?  175  ARG A C     1 
ATOM   290  O  O     A ARG A 1  47  ? 9.622   -13.814 -21.917 0.48 11.34 ?  175  ARG A O     1 
ATOM   291  O  O     B ARG A 1  47  ? 9.902   -13.737 -21.901 0.52 11.56 ?  175  ARG A O     1 
ATOM   292  C  CB    A ARG A 1  47  ? 10.861  -13.024 -24.895 0.48 13.59 ?  175  ARG A CB    1 
ATOM   293  C  CB    B ARG A 1  47  ? 10.806  -13.301 -24.941 0.52 13.30 ?  175  ARG A CB    1 
ATOM   294  C  CG    A ARG A 1  47  ? 11.036  -13.497 -26.340 0.48 14.42 ?  175  ARG A CG    1 
ATOM   295  C  CG    B ARG A 1  47  ? 10.875  -14.123 -26.227 0.52 13.34 ?  175  ARG A CG    1 
ATOM   296  C  CD    A ARG A 1  47  ? 12.386  -13.064 -26.904 0.48 15.43 ?  175  ARG A CD    1 
ATOM   297  C  CD    B ARG A 1  47  ? 12.019  -13.651 -27.090 0.52 14.97 ?  175  ARG A CD    1 
ATOM   298  N  NE    A ARG A 1  47  ? 13.448  -13.996 -26.552 0.48 18.58 ?  175  ARG A NE    1 
ATOM   299  N  NE    B ARG A 1  47  ? 12.370  -14.581 -28.161 0.52 19.16 ?  175  ARG A NE    1 
ATOM   300  C  CZ    A ARG A 1  47  ? 14.469  -13.744 -25.729 0.48 19.80 ?  175  ARG A CZ    1 
ATOM   301  C  CZ    B ARG A 1  47  ? 11.734  -14.701 -29.327 0.52 19.61 ?  175  ARG A CZ    1 
ATOM   302  N  NH1   A ARG A 1  47  ? 14.609  -12.557 -25.134 0.48 16.35 ?  175  ARG A NH1   1 
ATOM   303  N  NH1   B ARG A 1  47  ? 10.670  -13.959 -29.620 0.52 19.53 ?  175  ARG A NH1   1 
ATOM   304  N  NH2   A ARG A 1  47  ? 15.366  -14.699 -25.503 0.48 17.99 ?  175  ARG A NH2   1 
ATOM   305  N  NH2   B ARG A 1  47  ? 12.168  -15.587 -30.208 0.52 18.44 ?  175  ARG A NH2   1 
ATOM   306  N  N     . LEU A 1  48  ? 9.300   -11.659 -22.524 1.00 10.05 ?  176  LEU A N     1 
ATOM   307  C  CA    . LEU A 1  48  ? 9.227   -11.184 -21.137 1.00 9.54  ?  176  LEU A CA    1 
ATOM   308  C  C     . LEU A 1  48  ? 8.161   -11.960 -20.381 1.00 10.01 ?  176  LEU A C     1 
ATOM   309  O  O     . LEU A 1  48  ? 8.382   -12.433 -19.259 1.00 10.06 ?  176  LEU A O     1 
ATOM   310  C  CB    . LEU A 1  48  ? 8.936   -9.677  -21.098 1.00 10.00 ?  176  LEU A CB    1 
ATOM   311  C  CG    . LEU A 1  48  ? 8.656   -9.046  -19.716 1.00 10.64 ?  176  LEU A CG    1 
ATOM   312  C  CD1   . LEU A 1  48  ? 9.052   -7.612  -19.773 1.00 13.61 ?  176  LEU A CD1   1 
ATOM   313  C  CD2   . LEU A 1  48  ? 7.176   -9.150  -19.299 1.00 11.23 ?  176  LEU A CD2   1 
ATOM   314  N  N     . LEU A 1  49  ? 6.992   -12.134 -20.999 1.00 10.54 ?  177  LEU A N     1 
ATOM   315  C  CA    . LEU A 1  49  ? 5.920   -12.853 -20.327 1.00 9.74  ?  177  LEU A CA    1 
ATOM   316  C  C     . LEU A 1  49  ? 6.297   -14.304 -20.053 1.00 10.26 ?  177  LEU A C     1 
ATOM   317  O  O     . LEU A 1  49  ? 6.030   -14.827 -18.967 1.00 9.36  ?  177  LEU A O     1 
ATOM   318  C  CB    . LEU A 1  49  ? 4.618   -12.763 -21.141 1.00 10.14 ?  177  LEU A CB    1 
ATOM   319  C  CG    . LEU A 1  49  ? 3.821   -11.505 -20.972 1.00 12.26 ?  177  LEU A CG    1 
ATOM   320  C  CD1   . LEU A 1  49  ? 2.725   -11.557 -22.014 1.00 12.64 ?  177  LEU A CD1   1 
ATOM   321  C  CD2   . LEU A 1  49  ? 3.224   -11.448 -19.550 1.00 12.45 ?  177  LEU A CD2   1 
ATOM   322  N  N     . THR A 1  50  ? 6.931   -14.991 -21.018 1.00 10.66 ?  178  THR A N     1 
ATOM   323  C  CA    . THR A 1  50  ? 7.247   -16.387 -20.780 1.00 9.34  ?  178  THR A CA    1 
ATOM   324  C  C     . THR A 1  50  ? 8.279   -16.547 -19.671 1.00 10.36 ?  178  THR A C     1 
ATOM   325  O  O     . THR A 1  50  ? 8.107   -17.395 -18.787 1.00 10.49 ?  178  THR A O     1 
ATOM   326  C  CB    . THR A 1  50  ? 7.717   -17.038 -22.075 1.00 12.36 ?  178  THR A CB    1 
ATOM   327  O  OG1   . THR A 1  50  ? 6.555   -17.335 -22.856 1.00 12.92 ?  178  THR A OG1   1 
ATOM   328  C  CG2   . THR A 1  50  ? 8.513   -18.322 -21.791 1.00 12.83 ?  178  THR A CG2   1 
ATOM   329  N  N     . PHE A 1  51  ? 9.297   -15.681 -19.637 1.00 10.67 ?  179  PHE A N     1 
ATOM   330  C  CA    . PHE A 1  51  ? 10.296  -15.816 -18.580 1.00 10.58 ?  179  PHE A CA    1 
ATOM   331  C  C     . PHE A 1  51  ? 9.692   -15.454 -17.225 1.00 10.91 ?  179  PHE A C     1 
ATOM   332  O  O     . PHE A 1  51  ? 9.997   -16.099 -16.219 1.00 10.23 ?  179  PHE A O     1 
ATOM   333  C  CB    . PHE A 1  51  ? 11.534  -14.964 -18.873 1.00 11.33 ?  179  PHE A CB    1 
ATOM   334  C  CG    . PHE A 1  51  ? 12.441  -15.533 -19.948 1.00 11.81 ?  179  PHE A CG    1 
ATOM   335  C  CD1   . PHE A 1  51  ? 12.885  -16.831 -19.885 1.00 13.68 ?  179  PHE A CD1   1 
ATOM   336  C  CD2   . PHE A 1  51  ? 12.854  -14.733 -20.998 1.00 13.00 ?  179  PHE A CD2   1 
ATOM   337  C  CE1   . PHE A 1  51  ? 13.721  -17.340 -20.889 1.00 14.90 ?  179  PHE A CE1   1 
ATOM   338  C  CE2   . PHE A 1  51  ? 13.693  -15.246 -21.987 1.00 15.18 ?  179  PHE A CE2   1 
ATOM   339  C  CZ    . PHE A 1  51  ? 14.123  -16.537 -21.906 1.00 13.84 ?  179  PHE A CZ    1 
ATOM   340  N  N     . CYS A 1  52  ? 8.819   -14.443 -17.184 1.00 10.18 ?  180  CYS A N     1 
ATOM   341  C  CA    . CYS A 1  52  ? 8.125   -14.102 -15.933 1.00 10.02 ?  180  CYS A CA    1 
ATOM   342  C  C     . CYS A 1  52  ? 7.242   -15.247 -15.467 1.00 9.16  ?  180  CYS A C     1 
ATOM   343  O  O     . CYS A 1  52  ? 7.172   -15.561 -14.265 1.00 10.02 ?  180  CYS A O     1 
ATOM   344  C  CB    . CYS A 1  52  ? 7.257   -12.859 -16.121 1.00 11.00 ?  180  CYS A CB    1 
ATOM   345  S  SG    . CYS A 1  52  ? 8.120   -11.310 -16.152 1.00 15.54 ?  180  CYS A SG    1 
ATOM   346  N  N     . ARG A 1  53  ? 6.507   -15.862 -16.403 1.00 8.06  ?  181  ARG A N     1 
ATOM   347  C  CA    . ARG A 1  53  ? 5.635   -16.974 -16.042 1.00 8.26  ?  181  ARG A CA    1 
ATOM   348  C  C     . ARG A 1  53  ? 6.437   -18.166 -15.536 1.00 8.54  ?  181  ARG A C     1 
ATOM   349  O  O     . ARG A 1  53  ? 6.036   -18.816 -14.567 1.00 8.86  ?  181  ARG A O     1 
ATOM   350  C  CB    . ARG A 1  53  ? 4.759   -17.384 -17.216 1.00 8.26  ?  181  ARG A CB    1 
ATOM   351  C  CG    . ARG A 1  53  ? 3.736   -16.338 -17.594 1.00 8.67  ?  181  ARG A CG    1 
ATOM   352  C  CD    . ARG A 1  53  ? 3.148   -16.669 -18.963 1.00 9.44  ?  181  ARG A CD    1 
ATOM   353  N  NE    . ARG A 1  53  ? 2.150   -15.705 -19.399 1.00 10.80 ?  181  ARG A NE    1 
ATOM   354  C  CZ    . ARG A 1  53  ? 1.710   -15.614 -20.649 1.00 10.15 ?  181  ARG A CZ    1 
ATOM   355  N  NH1   . ARG A 1  53  ? 2.209   -16.416 -21.582 1.00 11.85 ?  181  ARG A NH1   1 
ATOM   356  N  NH2   . ARG A 1  53  ? 0.784   -14.716 -20.962 1.00 12.43 ?  181  ARG A NH2   1 
ATOM   357  N  N     . ALA A 1  54  ? 7.572   -18.474 -16.181 1.00 8.46  ?  182  ALA A N     1 
ATOM   358  C  CA    . ALA A 1  54  ? 8.418   -19.568 -15.721 1.00 8.95  ?  182  ALA A CA    1 
ATOM   359  C  C     . ALA A 1  54  ? 8.971   -19.291 -14.332 1.00 8.63  ?  182  ALA A C     1 
ATOM   360  O  O     . ALA A 1  54  ? 8.955   -20.174 -13.463 1.00 9.66  ?  182  ALA A O     1 
ATOM   361  C  CB    . ALA A 1  54  ? 9.555   -19.779 -16.717 1.00 10.27 ?  182  ALA A CB    1 
ATOM   362  N  N     . ALA A 1  55  ? 9.454   -18.065 -14.110 1.00 9.07  ?  183  ALA A N     1 
ATOM   363  C  CA    . ALA A 1  55  ? 9.910   -17.681 -12.784 1.00 9.13  ?  183  ALA A CA    1 
ATOM   364  C  C     . ALA A 1  55  ? 8.812   -17.895 -11.758 1.00 9.71  ?  183  ALA A C     1 
ATOM   365  O  O     . ALA A 1  55  ? 9.062   -18.417 -10.662 1.00 9.19  ?  183  ALA A O     1 
ATOM   366  C  CB    . ALA A 1  55  ? 10.361  -16.220 -12.793 1.00 10.14 ?  183  ALA A CB    1 
ATOM   367  N  N     . SER A 1  56  ? 7.580   -17.491 -12.103 1.00 7.31  ?  184  SER A N     1 
ATOM   368  C  CA    A SER A 1  56  ? 6.452   -17.577 -11.178 0.30 8.01  ?  184  SER A CA    1 
ATOM   369  C  CA    B SER A 1  56  ? 6.487   -17.578 -11.138 0.70 8.32  ?  184  SER A CA    1 
ATOM   370  C  C     . SER A 1  56  ? 6.094   -19.027 -10.845 1.00 9.22  ?  184  SER A C     1 
ATOM   371  O  O     . SER A 1  56  ? 5.715   -19.339 -9.719  1.00 9.66  ?  184  SER A O     1 
ATOM   372  C  CB    A SER A 1  56  ? 5.263   -16.845 -11.793 0.30 9.82  ?  184  SER A CB    1 
ATOM   373  C  CB    B SER A 1  56  ? 5.288   -16.772 -11.635 0.70 10.37 ?  184  SER A CB    1 
ATOM   374  O  OG    A SER A 1  56  ? 4.158   -16.853 -10.923 0.30 6.79  ?  184  SER A OG    1 
ATOM   375  O  OG    B SER A 1  56  ? 4.516   -17.514 -12.553 0.70 16.15 ?  184  SER A OG    1 
ATOM   376  N  N     . VAL A 1  57  ? 6.194   -19.929 -11.831 1.00 8.59  ?  185  VAL A N     1 
ATOM   377  C  CA    . VAL A 1  57  ? 5.953   -21.349 -11.577 1.00 9.04  ?  185  VAL A CA    1 
ATOM   378  C  C     . VAL A 1  57  ? 6.878   -21.847 -10.470 1.00 10.52 ?  185  VAL A C     1 
ATOM   379  O  O     . VAL A 1  57  ? 6.459   -22.568 -9.560  1.00 10.68 ?  185  VAL A O     1 
ATOM   380  C  CB    . VAL A 1  57  ? 6.160   -22.139 -12.883 1.00 9.99  ?  185  VAL A CB    1 
ATOM   381  C  CG1   . VAL A 1  57  ? 6.344   -23.631 -12.609 1.00 12.58 ?  185  VAL A CG1   1 
ATOM   382  C  CG2   . VAL A 1  57  ? 4.988   -21.944 -13.836 1.00 11.37 ?  185  VAL A CG2   1 
ATOM   383  N  N     . LEU A 1  58  ? 8.144   -21.455 -10.537 1.00 9.61  ?  186  LEU A N     1 
ATOM   384  C  CA    . LEU A 1  58  ? 9.110   -21.890 -9.530  1.00 9.39  ?  186  LEU A CA    1 
ATOM   385  C  C     . LEU A 1  58  ? 8.763   -21.354 -8.152  1.00 10.97 ?  186  LEU A C     1 
ATOM   386  O  O     . LEU A 1  58  ? 8.997   -22.031 -7.144  1.00 10.67 ?  186  LEU A O     1 
ATOM   387  C  CB    . LEU A 1  58  ? 10.520  -21.472 -9.916  1.00 11.59 ?  186  LEU A CB    1 
ATOM   388  C  CG    . LEU A 1  58  ? 11.045  -22.049 -11.232 1.00 11.46 ?  186  LEU A CG    1 
ATOM   389  C  CD1   . LEU A 1  58  ? 12.459  -21.644 -11.466 1.00 14.31 ?  186  LEU A CD1   1 
ATOM   390  C  CD2   . LEU A 1  58  ? 10.916  -23.569 -11.240 1.00 13.86 ?  186  LEU A CD2   1 
ATOM   391  N  N     . LYS A 1  59  ? 8.228   -20.131 -8.085  1.00 9.88  ?  187  LYS A N     1 
ATOM   392  C  CA    . LYS A 1  59  ? 7.823   -19.561 -6.808  1.00 8.49  ?  187  LYS A CA    1 
ATOM   393  C  C     . LYS A 1  59  ? 6.686   -20.343 -6.169  1.00 9.43  ?  187  LYS A C     1 
ATOM   394  O  O     . LYS A 1  59  ? 6.508   -20.301 -4.946  1.00 11.76 ?  187  LYS A O     1 
ATOM   395  C  CB    . LYS A 1  59  ? 7.379   -18.115 -7.004  1.00 8.81  ?  187  LYS A CB    1 
ATOM   396  C  CG    . LYS A 1  59  ? 8.371   -17.212 -7.650  1.00 8.70  ?  187  LYS A CG    1 
ATOM   397  C  CD    . LYS A 1  59  ? 7.845   -15.791 -7.783  1.00 10.87 ?  187  LYS A CD    1 
ATOM   398  C  CE    . LYS A 1  59  ? 8.773   -14.982 -8.652  1.00 14.39 ?  187  LYS A CE    1 
ATOM   399  N  NZ    . LYS A 1  59  ? 8.220   -13.609 -8.868  1.00 16.15 ?  187  LYS A NZ    1 
ATOM   400  N  N     . ALA A 1  60  ? 5.859   -20.994 -6.994  1.00 9.31  ?  188  ALA A N     1 
ATOM   401  C  CA    . ALA A 1  60  ? 4.699   -21.743 -6.548  1.00 10.87 ?  188  ALA A CA    1 
ATOM   402  C  C     . ALA A 1  60  ? 5.018   -23.175 -6.132  1.00 11.33 ?  188  ALA A C     1 
ATOM   403  O  O     . ALA A 1  60  ? 4.157   -23.832 -5.559  1.00 13.01 ?  188  ALA A O     1 
ATOM   404  C  CB    . ALA A 1  60  ? 3.642   -21.763 -7.663  1.00 11.55 ?  188  ALA A CB    1 
ATOM   405  N  N     . LEU A 1  61  ? 6.233   -23.646 -6.380  1.00 10.61 ?  189  LEU A N     1 
ATOM   406  C  CA    . LEU A 1  61  ? 6.586   -25.020 -6.033  1.00 11.52 ?  189  LEU A CA    1 
ATOM   407  C  C     . LEU A 1  61  ? 6.763   -25.193 -4.526  1.00 11.95 ?  189  LEU A C     1 
ATOM   408  O  O     . LEU A 1  61  ? 7.178   -24.274 -3.831  1.00 11.13 ?  189  LEU A O     1 
ATOM   409  C  CB    . LEU A 1  61  ? 7.870   -25.433 -6.741  1.00 11.95 ?  189  LEU A CB    1 
ATOM   410  C  CG    . LEU A 1  61  ? 7.806   -25.613 -8.263  1.00 11.50 ?  189  LEU A CG    1 
ATOM   411  C  CD1   . LEU A 1  61  ? 9.187   -25.835 -8.812  1.00 13.42 ?  189  LEU A CD1   1 
ATOM   412  C  CD2   . LEU A 1  61  ? 6.889   -26.759 -8.578  1.00 15.49 ?  189  LEU A CD2   1 
ATOM   413  N  N     . PRO A 1  62  ? 6.518   -26.395 -4.006  1.00 11.56 ?  190  PRO A N     1 
ATOM   414  C  CA    . PRO A 1  62  ? 6.565   -26.617 -2.564  1.00 11.42 ?  190  PRO A CA    1 
ATOM   415  C  C     . PRO A 1  62  ? 7.940   -26.902 -1.999  1.00 12.33 ?  190  PRO A C     1 
ATOM   416  O  O     . PRO A 1  62  ? 8.051   -26.990 -0.777  1.00 13.02 ?  190  PRO A O     1 
ATOM   417  C  CB    . PRO A 1  62  ? 5.654   -27.828 -2.386  1.00 14.05 ?  190  PRO A CB    1 
ATOM   418  C  CG    . PRO A 1  62  ? 5.843   -28.594 -3.651  1.00 14.93 ?  190  PRO A CG    1 
ATOM   419  C  CD    . PRO A 1  62  ? 5.927   -27.532 -4.727  1.00 13.28 ?  190  PRO A CD    1 
ATOM   420  N  N     . SER A 1  63  ? 8.961   -27.027 -2.837  1.00 13.14 ?  191  SER A N     1 
ATOM   421  C  CA    . SER A 1  63  ? 10.304  -27.325 -2.359  1.00 12.72 ?  191  SER A CA    1 
ATOM   422  C  C     . SER A 1  63  ? 11.291  -26.963 -3.463  1.00 12.56 ?  191  SER A C     1 
ATOM   423  O  O     . SER A 1  63  ? 10.877  -26.615 -4.583  1.00 12.79 ?  191  SER A O     1 
ATOM   424  C  CB    . SER A 1  63  ? 10.425  -28.809 -1.961  1.00 15.89 ?  191  SER A CB    1 
ATOM   425  O  OG    . SER A 1  63  ? 10.278  -29.597 -3.104  1.00 18.28 ?  191  SER A OG    1 
ATOM   426  N  N     . PRO A 1  64  ? 12.605  -26.991 -3.175  1.00 12.16 ?  192  PRO A N     1 
ATOM   427  C  CA    . PRO A 1  64  ? 13.600  -26.602 -4.183  1.00 12.09 ?  192  PRO A CA    1 
ATOM   428  C  C     . PRO A 1  64  ? 13.673  -27.571 -5.348  1.00 12.75 ?  192  PRO A C     1 
ATOM   429  O  O     . PRO A 1  64  ? 13.565  -28.800 -5.184  1.00 13.34 ?  192  PRO A O     1 
ATOM   430  C  CB    . PRO A 1  64  ? 14.926  -26.593 -3.408  1.00 12.63 ?  192  PRO A CB    1 
ATOM   431  C  CG    . PRO A 1  64  ? 14.539  -26.462 -1.981  1.00 12.65 ?  192  PRO A CG    1 
ATOM   432  C  CD    . PRO A 1  64  ? 13.237  -27.181 -1.855  1.00 12.67 ?  192  PRO A CD    1 
ATOM   433  N  N     . VAL A 1  65  ? 13.839  -27.002 -6.540  1.00 12.38 ?  193  VAL A N     1 
ATOM   434  C  CA    . VAL A 1  65  ? 14.262  -27.790 -7.691  1.00 13.05 ?  193  VAL A CA    1 
ATOM   435  C  C     . VAL A 1  65  ? 15.731  -28.152 -7.516  1.00 13.91 ?  193  VAL A C     1 
ATOM   436  O  O     . VAL A 1  65  ? 16.594  -27.277 -7.388  1.00 15.90 ?  193  VAL A O     1 
ATOM   437  C  CB    . VAL A 1  65  ? 14.035  -27.033 -8.997  1.00 12.54 ?  193  VAL A CB    1 
ATOM   438  C  CG1   . VAL A 1  65  ? 14.604  -27.844 -10.194 1.00 13.38 ?  193  VAL A CG1   1 
ATOM   439  C  CG2   . VAL A 1  65  ? 12.584  -26.758 -9.183  1.00 12.57 ?  193  VAL A CG2   1 
ATOM   440  N  N     . THR A 1  66  ? 16.020  -29.464 -7.547  1.00 17.53 ?  194  THR A N     1 
ATOM   441  C  CA    . THR A 1  66  ? 17.375  -29.985 -7.438  1.00 20.65 ?  194  THR A CA    1 
ATOM   442  C  C     . THR A 1  66  ? 17.841  -30.732 -8.680  1.00 21.40 ?  194  THR A C     1 
ATOM   443  O  O     . THR A 1  66  ? 19.050  -30.892 -8.860  1.00 22.96 ?  194  THR A O     1 
ATOM   444  C  CB    . THR A 1  66  ? 17.495  -30.940 -6.237  1.00 23.18 ?  194  THR A CB    1 
ATOM   445  O  OG1   . THR A 1  66  ? 16.626  -32.063 -6.429  1.00 26.62 ?  194  THR A OG1   1 
ATOM   446  C  CG2   . THR A 1  66  ? 17.114  -30.233 -4.945  1.00 25.63 ?  194  THR A CG2   1 
ATOM   447  N  N     . THR A 1  67  ? 16.932  -31.192 -9.525  1.00 22.88 ?  195  THR A N     1 
ATOM   448  C  CA    . THR A 1  67  ? 17.297  -31.971 -10.700 1.00 25.90 ?  195  THR A CA    1 
ATOM   449  C  C     . THR A 1  67  ? 16.474  -31.491 -11.882 1.00 24.45 ?  195  THR A C     1 
ATOM   450  O  O     . THR A 1  67  ? 15.328  -31.076 -11.723 1.00 22.52 ?  195  THR A O     1 
ATOM   451  C  CB    . THR A 1  67  ? 17.069  -33.484 -10.471 1.00 27.99 ?  195  THR A CB    1 
ATOM   452  O  OG1   . THR A 1  67  ? 15.670  -33.776 -10.440 1.00 31.82 ?  195  THR A OG1   1 
ATOM   453  C  CG2   . THR A 1  67  ? 17.676  -33.929 -9.153  1.00 29.88 ?  195  THR A CG2   1 
ATOM   454  N  N     . LEU A 1  68  ? 17.064  -31.576 -13.075 1.00 24.93 ?  196  LEU A N     1 
ATOM   455  C  CA    . LEU A 1  68  ? 16.379  -31.101 -14.272 1.00 26.77 ?  196  LEU A CA    1 
ATOM   456  C  C     . LEU A 1  68  ? 15.081  -31.850 -14.516 1.00 27.66 ?  196  LEU A C     1 
ATOM   457  O  O     . LEU A 1  68  ? 14.130  -31.284 -15.071 1.00 27.46 ?  196  LEU A O     1 
ATOM   458  C  CB    . LEU A 1  68  ? 17.293  -31.237 -15.490 1.00 28.61 ?  196  LEU A CB    1 
ATOM   459  C  CG    . LEU A 1  68  ? 16.852  -30.428 -16.712 1.00 31.05 ?  196  LEU A CG    1 
ATOM   460  C  CD1   . LEU A 1  68  ? 16.995  -28.938 -16.416 1.00 28.79 ?  196  LEU A CD1   1 
ATOM   461  C  CD2   . LEU A 1  68  ? 17.656  -30.812 -17.945 1.00 32.94 ?  196  LEU A CD2   1 
ATOM   462  N  N     . SER A 1  69  ? 15.015  -33.125 -14.130 1.00 27.19 ?  197  SER A N     1 
ATOM   463  C  CA    . SER A 1  69  ? 13.815  -33.906 -14.401 1.00 29.61 ?  197  SER A CA    1 
ATOM   464  C  C     . SER A 1  69  ? 12.598  -33.351 -13.681 1.00 28.25 ?  197  SER A C     1 
ATOM   465  O  O     . SER A 1  69  ? 11.467  -33.612 -14.109 1.00 28.10 ?  197  SER A O     1 
ATOM   466  C  CB    . SER A 1  69  ? 14.035  -35.370 -14.006 1.00 30.36 ?  197  SER A CB    1 
ATOM   467  O  OG    . SER A 1  69  ? 14.289  -35.488 -12.618 1.00 34.29 ?  197  SER A OG    1 
ATOM   468  N  N     . GLN A 1  70  ? 12.807  -32.580 -12.607 1.00 24.71 ?  198  GLN A N     1 
ATOM   469  C  CA    . GLN A 1  70  ? 11.704  -31.975 -11.869 1.00 23.09 ?  198  GLN A CA    1 
ATOM   470  C  C     . GLN A 1  70  ? 10.995  -30.884 -12.664 1.00 21.27 ?  198  GLN A C     1 
ATOM   471  O  O     . GLN A 1  70  ? 9.878   -30.515 -12.299 1.00 22.12 ?  198  GLN A O     1 
ATOM   472  C  CB    . GLN A 1  70  ? 12.218  -31.424 -10.534 1.00 22.73 ?  198  GLN A CB    1 
ATOM   473  C  CG    . GLN A 1  70  ? 12.633  -32.532 -9.579  1.00 25.89 ?  198  GLN A CG    1 
ATOM   474  C  CD    . GLN A 1  70  ? 13.394  -32.063 -8.347  1.00 28.79 ?  198  GLN A CD    1 
ATOM   475  O  OE1   . GLN A 1  70  ? 14.107  -31.065 -8.380  1.00 24.65 ?  198  GLN A OE1   1 
ATOM   476  N  NE2   . GLN A 1  70  ? 13.262  -32.814 -7.254  1.00 30.10 ?  198  GLN A NE2   1 
ATOM   477  N  N     . LEU A 1  71  ? 11.589  -30.392 -13.750 1.00 19.38 ?  199  LEU A N     1 
ATOM   478  C  CA    . LEU A 1  71  ? 10.903  -29.452 -14.626 1.00 20.51 ?  199  LEU A CA    1 
ATOM   479  C  C     . LEU A 1  71  ? 9.956   -30.123 -15.612 1.00 23.86 ?  199  LEU A C     1 
ATOM   480  O  O     . LEU A 1  71  ? 9.134   -29.436 -16.221 1.00 20.90 ?  199  LEU A O     1 
ATOM   481  C  CB    . LEU A 1  71  ? 11.920  -28.622 -15.397 1.00 20.70 ?  199  LEU A CB    1 
ATOM   482  C  CG    . LEU A 1  71  ? 12.870  -27.766 -14.573 1.00 19.12 ?  199  LEU A CG    1 
ATOM   483  C  CD1   . LEU A 1  71  ? 13.766  -27.024 -15.522 1.00 21.10 ?  199  LEU A CD1   1 
ATOM   484  C  CD2   . LEU A 1  71  ? 12.116  -26.792 -13.641 1.00 17.16 ?  199  LEU A CD2   1 
ATOM   485  N  N     . GLN A 1  72  ? 10.031  -31.441 -15.783 1.00 26.59 ?  200  GLN A N     1 
ATOM   486  C  CA    . GLN A 1  72  ? 9.202   -32.091 -16.789 1.00 25.97 ?  200  GLN A CA    1 
ATOM   487  C  C     . GLN A 1  72  ? 7.732   -31.916 -16.455 1.00 25.08 ?  200  GLN A C     1 
ATOM   488  O  O     . GLN A 1  72  ? 7.299   -32.142 -15.322 1.00 30.62 ?  200  GLN A O     1 
ATOM   489  C  CB    . GLN A 1  72  ? 9.559   -33.577 -16.881 1.00 31.44 ?  200  GLN A CB    1 
ATOM   490  C  CG    . GLN A 1  72  ? 10.934  -33.843 -17.467 1.00 33.26 ?  200  GLN A CG    1 
ATOM   491  N  N     . GLY A 1  73  ? 6.955   -31.501 -17.449 1.00 26.77 ?  201  GLY A N     1 
ATOM   492  C  CA    . GLY A 1  73  ? 5.544   -31.288 -17.242 1.00 27.94 ?  201  GLY A CA    1 
ATOM   493  C  C     . GLY A 1  73  ? 5.183   -29.968 -16.599 1.00 27.75 ?  201  GLY A C     1 
ATOM   494  O  O     . GLY A 1  73  ? 3.989   -29.669 -16.484 1.00 31.87 ?  201  GLY A O     1 
ATOM   495  N  N     . LEU A 1  74  ? 6.171   -29.170 -16.149 1.00 21.86 ?  202  LEU A N     1 
ATOM   496  C  CA    . LEU A 1  74  ? 5.812   -27.856 -15.613 1.00 18.35 ?  202  LEU A CA    1 
ATOM   497  C  C     . LEU A 1  74  ? 5.495   -26.907 -16.756 1.00 16.95 ?  202  LEU A C     1 
ATOM   498  O  O     . LEU A 1  74  ? 6.218   -26.862 -17.743 1.00 18.70 ?  202  LEU A O     1 
ATOM   499  C  CB    . LEU A 1  74  ? 6.942   -27.253 -14.778 1.00 17.47 ?  202  LEU A CB    1 
ATOM   500  C  CG    . LEU A 1  74  ? 7.252   -27.924 -13.447 1.00 18.84 ?  202  LEU A CG    1 
ATOM   501  C  CD1   . LEU A 1  74  ? 8.378   -27.152 -12.778 1.00 18.68 ?  202  LEU A CD1   1 
ATOM   502  C  CD2   . LEU A 1  74  ? 6.047   -28.018 -12.565 1.00 19.86 ?  202  LEU A CD2   1 
ATOM   503  N  N     . PRO A 1  75  ? 4.454   -26.101 -16.624 1.00 15.02 ?  203  PRO A N     1 
ATOM   504  C  CA    . PRO A 1  75  ? 4.132   -25.146 -17.677 1.00 15.65 ?  203  PRO A CA    1 
ATOM   505  C  C     . PRO A 1  75  ? 5.177   -24.054 -17.773 1.00 16.17 ?  203  PRO A C     1 
ATOM   506  O  O     . PRO A 1  75  ? 5.798   -23.666 -16.782 1.00 14.75 ?  203  PRO A O     1 
ATOM   507  C  CB    . PRO A 1  75  ? 2.780   -24.590 -17.245 1.00 17.91 ?  203  PRO A CB    1 
ATOM   508  C  CG    . PRO A 1  75  ? 2.780   -24.757 -15.771 1.00 17.50 ?  203  PRO A CG    1 
ATOM   509  C  CD    . PRO A 1  75  ? 3.555   -26.003 -15.473 1.00 16.76 ?  203  PRO A CD    1 
ATOM   510  N  N     . HIS A 1  76  ? 5.385   -23.595 -19.003 1.00 14.94 ?  204  HIS A N     1 
ATOM   511  C  CA    . HIS A 1  76  ? 6.242   -22.477 -19.374 1.00 13.48 ?  204  HIS A CA    1 
ATOM   512  C  C     . HIS A 1  76  ? 7.721   -22.821 -19.339 1.00 14.80 ?  204  HIS A C     1 
ATOM   513  O  O     . HIS A 1  76  ? 8.572   -21.931 -19.514 1.00 16.27 ?  204  HIS A O     1 
ATOM   514  C  CB    . HIS A 1  76  ? 5.930   -21.259 -18.496 1.00 12.93 ?  204  HIS A CB    1 
ATOM   515  C  CG    . HIS A 1  76  ? 4.482   -20.917 -18.519 1.00 13.88 ?  204  HIS A CG    1 
ATOM   516  N  ND1   . HIS A 1  76  ? 3.847   -20.466 -19.654 1.00 13.55 ?  204  HIS A ND1   1 
ATOM   517  C  CD2   . HIS A 1  76  ? 3.523   -21.035 -17.571 1.00 16.42 ?  204  HIS A CD2   1 
ATOM   518  C  CE1   . HIS A 1  76  ? 2.560   -20.305 -19.402 1.00 15.39 ?  204  HIS A CE1   1 
ATOM   519  N  NE2   . HIS A 1  76  ? 2.339   -20.641 -18.143 1.00 17.17 ?  204  HIS A NE2   1 
ATOM   520  N  N     . PHE A 1  77  ? 8.071   -24.100 -19.166 1.00 15.92 ?  205  PHE A N     1 
ATOM   521  C  CA    . PHE A 1  77  ? 9.460   -24.549 -19.242 1.00 15.27 ?  205  PHE A CA    1 
ATOM   522  C  C     . PHE A 1  77  ? 9.660   -25.321 -20.539 1.00 18.22 ?  205  PHE A C     1 
ATOM   523  O  O     . PHE A 1  77  ? 9.239   -26.472 -20.660 1.00 25.80 ?  205  PHE A O     1 
ATOM   524  C  CB    . PHE A 1  77  ? 9.840   -25.374 -18.027 1.00 15.51 ?  205  PHE A CB    1 
ATOM   525  C  CG    . PHE A 1  77  ? 10.240  -24.514 -16.860 1.00 13.35 ?  205  PHE A CG    1 
ATOM   526  C  CD1   . PHE A 1  77  ? 11.521  -24.034 -16.772 1.00 13.23 ?  205  PHE A CD1   1 
ATOM   527  C  CD2   . PHE A 1  77  ? 9.303   -24.106 -15.925 1.00 14.14 ?  205  PHE A CD2   1 
ATOM   528  C  CE1   . PHE A 1  77  ? 11.893  -23.190 -15.754 1.00 13.08 ?  205  PHE A CE1   1 
ATOM   529  C  CE2   . PHE A 1  77  ? 9.668   -23.272 -14.901 1.00 13.66 ?  205  PHE A CE2   1 
ATOM   530  C  CZ    . PHE A 1  77  ? 10.959  -22.803 -14.816 1.00 13.43 ?  205  PHE A CZ    1 
ATOM   531  N  N     . GLY A 1  78  ? 10.302  -24.668 -21.486 1.00 15.94 ?  206  GLY A N     1 
ATOM   532  C  CA    . GLY A 1  78  ? 10.720  -25.304 -22.714 1.00 15.79 ?  206  GLY A CA    1 
ATOM   533  C  C     . GLY A 1  78  ? 12.224  -25.316 -22.777 1.00 18.90 ?  206  GLY A C     1 
ATOM   534  O  O     . GLY A 1  78  ? 12.903  -25.289 -21.745 1.00 18.56 ?  206  GLY A O     1 
ATOM   535  N  N     . GLU A 1  79  ? 12.762  -25.340 -23.994 1.00 19.89 ?  207  GLU A N     1 
ATOM   536  C  CA    . GLU A 1  79  ? 14.193  -25.559 -24.146 1.00 20.31 ?  207  GLU A CA    1 
ATOM   537  C  C     . GLU A 1  79  ? 15.007  -24.449 -23.493 1.00 20.14 ?  207  GLU A C     1 
ATOM   538  O  O     . GLU A 1  79  ? 16.014  -24.721 -22.830 1.00 21.36 ?  207  GLU A O     1 
ATOM   539  C  CB    . GLU A 1  79  ? 14.554  -25.678 -25.632 1.00 23.56 ?  207  GLU A CB    1 
ATOM   540  C  CG    . GLU A 1  79  ? 16.009  -26.042 -25.872 1.00 26.64 ?  207  GLU A CG    1 
ATOM   541  N  N     . HIS A 1  80  ? 14.590  -23.192 -23.665 1.00 19.07 ?  208  HIS A N     1 
ATOM   542  C  CA    . HIS A 1  80  ? 15.409  -22.073 -23.206 1.00 18.77 ?  208  HIS A CA    1 
ATOM   543  C  C     . HIS A 1  80  ? 15.375  -21.946 -21.681 1.00 19.02 ?  208  HIS A C     1 
ATOM   544  O  O     . HIS A 1  80  ? 16.423  -21.909 -21.028 1.00 18.38 ?  208  HIS A O     1 
ATOM   545  C  CB    . HIS A 1  80  ? 14.945  -20.777 -23.876 1.00 18.44 ?  208  HIS A CB    1 
ATOM   546  C  CG    . HIS A 1  80  ? 15.943  -19.664 -23.813 1.00 21.42 ?  208  HIS A CG    1 
ATOM   547  N  ND1   . HIS A 1  80  ? 16.034  -18.700 -24.790 1.00 21.15 ?  208  HIS A ND1   1 
ATOM   548  C  CD2   . HIS A 1  80  ? 16.896  -19.363 -22.901 1.00 22.38 ?  208  HIS A CD2   1 
ATOM   549  C  CE1   . HIS A 1  80  ? 16.999  -17.855 -24.489 1.00 22.99 ?  208  HIS A CE1   1 
ATOM   550  N  NE2   . HIS A 1  80  ? 17.535  -18.230 -23.343 1.00 22.21 ?  208  HIS A NE2   1 
ATOM   551  N  N     . SER A 1  81  ? 14.186  -21.863 -21.083 1.00 16.93 ?  209  SER A N     1 
ATOM   552  C  CA    A SER A 1  81  ? 14.123  -21.718 -19.631 0.46 14.45 ?  209  SER A CA    1 
ATOM   553  C  CA    B SER A 1  81  ? 14.139  -21.709 -19.632 0.54 13.98 ?  209  SER A CA    1 
ATOM   554  C  C     . SER A 1  81  ? 14.685  -22.941 -18.922 1.00 17.36 ?  209  SER A C     1 
ATOM   555  O  O     . SER A 1  81  ? 15.289  -22.814 -17.854 1.00 17.14 ?  209  SER A O     1 
ATOM   556  C  CB    A SER A 1  81  ? 12.682  -21.461 -19.190 0.46 16.00 ?  209  SER A CB    1 
ATOM   557  C  CB    B SER A 1  81  ? 12.709  -21.410 -19.167 0.54 16.05 ?  209  SER A CB    1 
ATOM   558  O  OG    A SER A 1  81  ? 12.186  -20.304 -19.826 0.46 13.58 ?  209  SER A OG    1 
ATOM   559  O  OG    B SER A 1  81  ? 11.820  -22.425 -19.582 0.54 17.96 ?  209  SER A OG    1 
ATOM   560  N  N     . SER A 1  82  ? 14.511  -24.131 -19.506 1.00 16.99 ?  210  SER A N     1 
ATOM   561  C  CA    . SER A 1  82  ? 15.066  -25.335 -18.892 1.00 19.22 ?  210  SER A CA    1 
ATOM   562  C  C     . SER A 1  82  ? 16.586  -25.307 -18.934 1.00 19.70 ?  210  SER A C     1 
ATOM   563  O  O     . SER A 1  82  ? 17.248  -25.750 -17.984 1.00 20.43 ?  210  SER A O     1 
ATOM   564  C  CB    . SER A 1  82  ? 14.548  -26.594 -19.592 1.00 20.78 ?  210  SER A CB    1 
ATOM   565  O  OG    . SER A 1  82  ? 13.157  -26.763 -19.375 1.00 20.04 ?  210  SER A OG    1 
ATOM   566  N  N     . ARG A 1  83  ? 17.155  -24.803 -20.029 1.00 19.60 ?  211  ARG A N     1 
ATOM   567  C  CA    . ARG A 1  83  ? 18.611  -24.725 -20.135 1.00 20.66 ?  211  ARG A CA    1 
ATOM   568  C  C     . ARG A 1  83  ? 19.183  -23.793 -19.081 1.00 19.76 ?  211  ARG A C     1 
ATOM   569  O  O     . ARG A 1  83  ? 20.223  -24.081 -18.479 1.00 21.15 ?  211  ARG A O     1 
ATOM   570  C  CB    . ARG A 1  83  ? 19.004  -24.254 -21.529 1.00 19.09 ?  211  ARG A CB    1 
ATOM   571  C  CG    . ARG A 1  83  ? 20.509  -24.183 -21.778 1.00 24.87 ?  211  ARG A CG    1 
ATOM   572  C  CD    . ARG A 1  83  ? 20.818  -23.404 -23.058 1.00 29.91 ?  211  ARG A CD    1 
ATOM   573  N  N     . VAL A 1  84  ? 18.512  -22.664 -18.843 1.00 17.70 ?  212  VAL A N     1 
ATOM   574  C  CA    . VAL A 1  84  ? 18.937  -21.737 -17.799 1.00 18.72 ?  212  VAL A CA    1 
ATOM   575  C  C     . VAL A 1  84  ? 18.994  -22.444 -16.451 1.00 17.43 ?  212  VAL A C     1 
ATOM   576  O  O     . VAL A 1  84  ? 19.984  -22.335 -15.723 1.00 18.07 ?  212  VAL A O     1 
ATOM   577  C  CB    . VAL A 1  84  ? 17.993  -20.525 -17.756 1.00 17.61 ?  212  VAL A CB    1 
ATOM   578  C  CG1   . VAL A 1  84  ? 18.328  -19.623 -16.585 1.00 17.98 ?  212  VAL A CG1   1 
ATOM   579  C  CG2   . VAL A 1  84  ? 18.051  -19.776 -19.073 1.00 19.95 ?  212  VAL A CG2   1 
ATOM   580  N  N     . VAL A 1  85  ? 17.919  -23.145 -16.083 1.00 15.70 ?  213  VAL A N     1 
ATOM   581  C  CA    . VAL A 1  85  ? 17.881  -23.857 -14.808 1.00 15.41 ?  213  VAL A CA    1 
ATOM   582  C  C     . VAL A 1  85  ? 18.965  -24.925 -14.766 1.00 16.92 ?  213  VAL A C     1 
ATOM   583  O  O     . VAL A 1  85  ? 19.656  -25.078 -13.750 1.00 19.11 ?  213  VAL A O     1 
ATOM   584  C  CB    . VAL A 1  85  ? 16.490  -24.464 -14.563 1.00 16.48 ?  213  VAL A CB    1 
ATOM   585  C  CG1   . VAL A 1  85  ? 16.496  -25.445 -13.394 1.00 17.34 ?  213  VAL A CG1   1 
ATOM   586  C  CG2   . VAL A 1  85  ? 15.495  -23.375 -14.258 1.00 17.20 ?  213  VAL A CG2   1 
ATOM   587  N  N     . GLN A 1  86  ? 19.125  -25.670 -15.865 1.00 16.28 ?  214  GLN A N     1 
ATOM   588  C  CA    . GLN A 1  86  ? 20.137  -26.725 -15.926 1.00 17.11 ?  214  GLN A CA    1 
ATOM   589  C  C     . GLN A 1  86  ? 21.513  -26.174 -15.589 1.00 19.85 ?  214  GLN A C     1 
ATOM   590  O  O     . GLN A 1  86  ? 22.255  -26.760 -14.792 1.00 20.81 ?  214  GLN A O     1 
ATOM   591  C  CB    . GLN A 1  86  ? 20.148  -27.357 -17.322 1.00 19.88 ?  214  GLN A CB    1 
ATOM   592  C  CG    . GLN A 1  86  ? 21.239  -28.428 -17.531 1.00 23.73 ?  214  GLN A CG    1 
ATOM   593  C  CD    . GLN A 1  86  ? 21.341  -28.879 -18.988 1.00 31.91 ?  214  GLN A CD    1 
ATOM   594  O  OE1   . GLN A 1  86  ? 20.500  -28.536 -19.823 1.00 34.38 ?  214  GLN A OE1   1 
ATOM   595  N  NE2   . GLN A 1  86  ? 22.383  -29.642 -19.297 1.00 34.04 ?  214  GLN A NE2   1 
ATOM   596  N  N     . GLU A 1  87  ? 21.871  -25.038 -16.192 1.00 19.98 ?  215  GLU A N     1 
ATOM   597  C  CA    . GLU A 1  87  ? 23.189  -24.463 -15.966 1.00 21.01 ?  215  GLU A CA    1 
ATOM   598  C  C     . GLU A 1  87  ? 23.343  -23.972 -14.533 1.00 20.44 ?  215  GLU A C     1 
ATOM   599  O  O     . GLU A 1  87  ? 24.402  -24.145 -13.922 1.00 21.78 ?  215  GLU A O     1 
ATOM   600  C  CB    . GLU A 1  87  ? 23.455  -23.342 -16.973 1.00 23.42 ?  215  GLU A CB    1 
ATOM   601  C  CG    . GLU A 1  87  ? 23.655  -23.857 -18.389 1.00 26.48 ?  215  GLU A CG    1 
ATOM   602  C  CD    . GLU A 1  87  ? 23.961  -22.769 -19.412 1.00 33.12 ?  215  GLU A CD    1 
ATOM   603  O  OE1   . GLU A 1  87  ? 24.410  -21.666 -19.027 1.00 32.86 ?  215  GLU A OE1   1 
ATOM   604  O  OE2   . GLU A 1  87  ? 23.760  -23.033 -20.619 1.00 37.04 ?  215  GLU A OE2   1 
ATOM   605  N  N     . LEU A 1  88  ? 22.304  -23.354 -13.966 1.00 17.65 ?  216  LEU A N     1 
ATOM   606  C  CA    . LEU A 1  88  ? 22.384  -22.942 -12.567 1.00 16.51 ?  216  LEU A CA    1 
ATOM   607  C  C     . LEU A 1  88  ? 22.550  -24.138 -11.638 1.00 19.77 ?  216  LEU A C     1 
ATOM   608  O  O     . LEU A 1  88  ? 23.293  -24.061 -10.654 1.00 21.54 ?  216  LEU A O     1 
ATOM   609  C  CB    . LEU A 1  88  ? 21.139  -22.129 -12.197 1.00 15.82 ?  216  LEU A CB    1 
ATOM   610  C  CG    . LEU A 1  88  ? 21.163  -20.778 -12.887 1.00 18.25 ?  216  LEU A CG    1 
ATOM   611  C  CD1   . LEU A 1  88  ? 19.760  -20.195 -12.927 1.00 17.18 ?  216  LEU A CD1   1 
ATOM   612  C  CD2   . LEU A 1  88  ? 22.135  -19.828 -12.192 1.00 21.86 ?  216  LEU A CD2   1 
ATOM   613  N  N     . LEU A 1  89  ? 21.870  -25.246 -11.925 1.00 19.63 ?  217  LEU A N     1 
ATOM   614  C  CA    . LEU A 1  89  ? 21.977  -26.419 -11.062 1.00 20.25 ?  217  LEU A CA    1 
ATOM   615  C  C     . LEU A 1  89  ? 23.356  -27.053 -11.175 1.00 23.29 ?  217  LEU A C     1 
ATOM   616  O  O     . LEU A 1  89  ? 23.898  -27.547 -10.181 1.00 28.04 ?  217  LEU A O     1 
ATOM   617  C  CB    . LEU A 1  89  ? 20.904  -27.444 -11.418 1.00 22.73 ?  217  LEU A CB    1 
ATOM   618  C  CG    . LEU A 1  89  ? 19.447  -27.048 -11.182 1.00 22.26 ?  217  LEU A CG    1 
ATOM   619  C  CD1   . LEU A 1  89  ? 18.534  -28.101 -11.770 1.00 21.02 ?  217  LEU A CD1   1 
ATOM   620  C  CD2   . LEU A 1  89  ? 19.191  -26.877 -9.690  1.00 21.11 ?  217  LEU A CD2   1 
ATOM   621  N  N     . GLU A 1  90  ? 23.933  -27.046 -12.377 1.00 21.64 ?  218  GLU A N     1 
ATOM   622  C  CA    . GLU A 1  90  ? 25.196  -27.743 -12.631 1.00 23.67 ?  218  GLU A CA    1 
ATOM   623  C  C     . GLU A 1  90  ? 26.416  -26.910 -12.250 1.00 30.40 ?  218  GLU A C     1 
ATOM   624  O  O     . GLU A 1  90  ? 27.416  -27.459 -11.778 1.00 32.01 ?  218  GLU A O     1 
ATOM   625  C  CB    . GLU A 1  90  ? 25.291  -28.143 -14.105 1.00 26.35 ?  218  GLU A CB    1 
ATOM   626  N  N     . HIS A 1  91  ? 26.366  -25.595 -12.456 1.00 30.00 ?  219  HIS A N     1 
ATOM   627  C  CA    . HIS A 1  91  ? 27.535  -24.740 -12.292 1.00 30.05 ?  219  HIS A CA    1 
ATOM   628  C  C     . HIS A 1  91  ? 27.332  -23.572 -11.342 1.00 29.09 ?  219  HIS A C     1 
ATOM   629  O  O     . HIS A 1  91  ? 28.300  -22.848 -11.079 1.00 33.34 ?  219  HIS A O     1 
ATOM   630  C  CB    . HIS A 1  91  ? 27.983  -24.193 -13.656 1.00 33.20 ?  219  HIS A CB    1 
ATOM   631  C  CG    . HIS A 1  91  ? 28.275  -25.261 -14.663 1.00 36.81 ?  219  HIS A CG    1 
ATOM   632  N  ND1   . HIS A 1  91  ? 27.513  -25.447 -15.797 1.00 37.41 ?  219  HIS A ND1   1 
ATOM   633  C  CD2   . HIS A 1  91  ? 29.237  -26.212 -14.697 1.00 37.25 ?  219  HIS A CD2   1 
ATOM   634  C  CE1   . HIS A 1  91  ? 27.996  -26.465 -16.488 1.00 37.87 ?  219  HIS A CE1   1 
ATOM   635  N  NE2   . HIS A 1  91  ? 29.044  -26.945 -15.842 1.00 41.31 ?  219  HIS A NE2   1 
ATOM   636  N  N     . GLY A 1  92  ? 26.117  -23.347 -10.834 1.00 26.29 ?  220  GLY A N     1 
ATOM   637  C  CA    . GLY A 1  92  ? 25.830  -22.219 -9.971  1.00 26.68 ?  220  GLY A CA    1 
ATOM   638  C  C     . GLY A 1  92  ? 25.682  -20.896 -10.684 1.00 26.65 ?  220  GLY A C     1 
ATOM   639  O  O     . GLY A 1  92  ? 25.460  -19.873 -10.027 1.00 25.81 ?  220  GLY A O     1 
ATOM   640  N  N     . VAL A 1  93  ? 25.755  -20.895 -12.015 1.00 27.69 ?  221  VAL A N     1 
ATOM   641  C  CA    . VAL A 1  93  ? 25.768  -19.677 -12.803 1.00 28.59 ?  221  VAL A CA    1 
ATOM   642  C  C     . VAL A 1  93  ? 25.285  -20.051 -14.195 1.00 27.18 ?  221  VAL A C     1 
ATOM   643  O  O     . VAL A 1  93  ? 25.531  -21.166 -14.666 1.00 26.41 ?  221  VAL A O     1 
ATOM   644  C  CB    . VAL A 1  93  ? 27.195  -19.072 -12.815 1.00 31.99 ?  221  VAL A CB    1 
ATOM   645  C  CG1   . VAL A 1  93  ? 28.179  -20.080 -13.376 1.00 33.17 ?  221  VAL A CG1   1 
ATOM   646  C  CG2   . VAL A 1  93  ? 27.240  -17.786 -13.589 1.00 34.30 ?  221  VAL A CG2   1 
ATOM   647  N  N     . CYS A 1  94  ? 24.575  -19.125 -14.846 1.00 21.99 ?  222  CYS A N     1 
ATOM   648  C  CA    . CYS A 1  94  ? 24.129  -19.266 -16.229 1.00 21.02 ?  222  CYS A CA    1 
ATOM   649  C  C     . CYS A 1  94  ? 24.844  -18.222 -17.073 1.00 23.00 ?  222  CYS A C     1 
ATOM   650  O  O     . CYS A 1  94  ? 24.730  -17.019 -16.812 1.00 22.31 ?  222  CYS A O     1 
ATOM   651  C  CB    . CYS A 1  94  ? 22.613  -19.091 -16.358 1.00 19.94 ?  222  CYS A CB    1 
ATOM   652  S  SG    . CYS A 1  94  ? 22.035  -18.993 -18.067 1.00 23.58 ?  222  CYS A SG    1 
ATOM   653  N  N     . GLU A 1  95  ? 25.575  -18.675 -18.091 1.00 20.74 ?  223  GLU A N     1 
ATOM   654  C  CA    . GLU A 1  95  ? 26.418  -17.746 -18.830 1.00 21.68 ?  223  GLU A CA    1 
ATOM   655  C  C     . GLU A 1  95  ? 25.593  -16.661 -19.511 1.00 20.57 ?  223  GLU A C     1 
ATOM   656  O  O     . GLU A 1  95  ? 25.986  -15.490 -19.507 1.00 21.39 ?  223  GLU A O     1 
ATOM   657  C  CB    . GLU A 1  95  ? 27.259  -18.499 -19.856 1.00 25.22 ?  223  GLU A CB    1 
ATOM   658  C  CG    . GLU A 1  95  ? 28.269  -17.621 -20.564 1.00 31.99 ?  223  GLU A CG    1 
ATOM   659  N  N     . GLU A 1  96  ? 24.435  -17.023 -20.070 1.00 19.38 ?  224  GLU A N     1 
ATOM   660  C  CA    . GLU A 1  96  ? 23.584  -16.015 -20.703 1.00 19.55 ?  224  GLU A CA    1 
ATOM   661  C  C     . GLU A 1  96  ? 23.156  -14.945 -19.705 1.00 18.67 ?  224  GLU A C     1 
ATOM   662  O  O     . GLU A 1  96  ? 23.174  -13.750 -20.021 1.00 19.40 ?  224  GLU A O     1 
ATOM   663  C  CB    . GLU A 1  96  ? 22.346  -16.655 -21.327 1.00 19.15 ?  224  GLU A CB    1 
ATOM   664  C  CG    . GLU A 1  96  ? 21.522  -15.627 -22.077 1.00 22.28 ?  224  GLU A CG    1 
ATOM   665  C  CD    . GLU A 1  96  ? 20.203  -16.155 -22.577 1.00 25.71 ?  224  GLU A CD    1 
ATOM   666  O  OE1   . GLU A 1  96  ? 19.845  -17.299 -22.234 1.00 25.68 ?  224  GLU A OE1   1 
ATOM   667  O  OE2   . GLU A 1  96  ? 19.524  -15.404 -23.310 1.00 27.06 ?  224  GLU A OE2   1 
ATOM   668  N  N     . VAL A 1  97  ? 22.762  -15.357 -18.496 1.00 15.84 ?  225  VAL A N     1 
ATOM   669  C  CA    . VAL A 1  97  ? 22.341  -14.392 -17.477 1.00 15.08 ?  225  VAL A CA    1 
ATOM   670  C  C     . VAL A 1  97  ? 23.486  -13.479 -17.099 1.00 16.04 ?  225  VAL A C     1 
ATOM   671  O  O     . VAL A 1  97  ? 23.320  -12.266 -16.958 1.00 15.50 ?  225  VAL A O     1 
ATOM   672  C  CB    . VAL A 1  97  ? 21.793  -15.142 -16.248 1.00 16.21 ?  225  VAL A CB    1 
ATOM   673  C  CG1   . VAL A 1  97  ? 21.502  -14.195 -15.079 1.00 15.47 ?  225  VAL A CG1   1 
ATOM   674  C  CG2   . VAL A 1  97  ? 20.549  -15.943 -16.619 1.00 14.81 ?  225  VAL A CG2   1 
ATOM   675  N  N     . GLU A 1  98  ? 24.677  -14.050 -16.906 1.00 20.29 ?  226  GLU A N     1 
ATOM   676  C  CA    . GLU A 1  98  ? 25.802  -13.214 -16.516 1.00 22.05 ?  226  GLU A CA    1 
ATOM   677  C  C     . GLU A 1  98  ? 26.200  -12.265 -17.632 1.00 20.92 ?  226  GLU A C     1 
ATOM   678  O  O     . GLU A 1  98  ? 26.570  -11.118 -17.355 1.00 23.15 ?  226  GLU A O     1 
ATOM   679  C  CB    . GLU A 1  98  ? 26.970  -14.093 -16.087 1.00 22.70 ?  226  GLU A CB    1 
ATOM   680  C  CG    . GLU A 1  98  ? 26.665  -14.919 -14.832 1.00 24.28 ?  226  GLU A CG    1 
ATOM   681  C  CD    . GLU A 1  98  ? 26.137  -14.059 -13.700 1.00 29.93 ?  226  GLU A CD    1 
ATOM   682  O  OE1   . GLU A 1  98  ? 26.828  -13.077 -13.335 1.00 33.13 ?  226  GLU A OE1   1 
ATOM   683  O  OE2   . GLU A 1  98  ? 25.019  -14.337 -13.203 1.00 30.78 ?  226  GLU A OE2   1 
ATOM   684  N  N     . ARG A 1  99  ? 26.083  -12.708 -18.891 1.00 21.32 ?  227  ARG A N     1 
ATOM   685  C  CA    . ARG A 1  99  ? 26.349  -11.837 -20.029 1.00 22.56 ?  227  ARG A CA    1 
ATOM   686  C  C     . ARG A 1  99  ? 25.382  -10.655 -20.053 1.00 22.21 ?  227  ARG A C     1 
ATOM   687  O  O     . ARG A 1  99  ? 25.799  -9.511  -20.263 1.00 23.50 ?  227  ARG A O     1 
ATOM   688  C  CB    . ARG A 1  99  ? 26.265  -12.661 -21.316 1.00 24.55 ?  227  ARG A CB    1 
ATOM   689  C  CG    . ARG A 1  99  ? 26.559  -11.900 -22.585 1.00 30.26 ?  227  ARG A CG    1 
ATOM   690  C  CD    . ARG A 1  99  ? 26.896  -12.853 -23.737 1.00 30.89 ?  227  ARG A CD    1 
ATOM   691  N  NE    . ARG A 1  99  ? 25.742  -13.619 -24.215 1.00 33.83 ?  227  ARG A NE    1 
ATOM   692  C  CZ    . ARG A 1  99  ? 25.524  -14.912 -23.982 1.00 36.16 ?  227  ARG A CZ    1 
ATOM   693  N  NH1   . ARG A 1  99  ? 26.375  -15.635 -23.265 1.00 35.65 ?  227  ARG A NH1   1 
ATOM   694  N  NH2   . ARG A 1  99  ? 24.439  -15.492 -24.481 1.00 36.19 ?  227  ARG A NH2   1 
ATOM   695  N  N     . VAL A 1  100 ? 24.093  -10.911 -19.810 1.00 17.86 ?  228  VAL A N     1 
ATOM   696  C  CA    . VAL A 1  100 ? 23.131  -9.818  -19.687 1.00 18.16 ?  228  VAL A CA    1 
ATOM   697  C  C     . VAL A 1  100 ? 23.519  -8.888  -18.543 1.00 16.95 ?  228  VAL A C     1 
ATOM   698  O  O     . VAL A 1  100 ? 23.559  -7.666  -18.701 1.00 20.45 ?  228  VAL A O     1 
ATOM   699  C  CB    . VAL A 1  100 ? 21.706  -10.369 -19.491 1.00 19.00 ?  228  VAL A CB    1 
ATOM   700  C  CG1   . VAL A 1  100 ? 20.745  -9.227  -19.188 1.00 19.76 ?  228  VAL A CG1   1 
ATOM   701  C  CG2   . VAL A 1  100 ? 21.242  -11.103 -20.717 1.00 19.69 ?  228  VAL A CG2   1 
ATOM   702  N  N     . ARG A 1  101 ? 23.793  -9.457  -17.366 1.00 21.32 ?  229  ARG A N     1 
ATOM   703  C  CA    . ARG A 1  101 ? 24.013  -8.661  -16.161 1.00 23.41 ?  229  ARG A CA    1 
ATOM   704  C  C     . ARG A 1  101 ? 25.109  -7.620  -16.338 1.00 26.33 ?  229  ARG A C     1 
ATOM   705  O  O     . ARG A 1  101 ? 25.002  -6.503  -15.823 1.00 31.68 ?  229  ARG A O     1 
ATOM   706  C  CB    . ARG A 1  101 ? 24.410  -9.566  -14.997 1.00 24.91 ?  229  ARG A CB    1 
ATOM   707  C  CG    . ARG A 1  101 ? 23.312  -10.245 -14.243 1.00 26.59 ?  229  ARG A CG    1 
ATOM   708  C  CD    . ARG A 1  101 ? 23.905  -10.753 -12.932 1.00 26.53 ?  229  ARG A CD    1 
ATOM   709  N  NE    . ARG A 1  101 ? 23.332  -12.009 -12.477 1.00 31.05 ?  229  ARG A NE    1 
ATOM   710  C  CZ    . ARG A 1  101 ? 22.274  -12.102 -11.685 1.00 32.60 ?  229  ARG A CZ    1 
ATOM   711  N  NH1   . ARG A 1  101 ? 21.657  -11.004 -11.264 1.00 30.89 ?  229  ARG A NH1   1 
ATOM   712  N  NH2   . ARG A 1  101 ? 21.831  -13.298 -11.319 1.00 32.31 ?  229  ARG A NH2   1 
ATOM   713  N  N     A ARG A 1  102 ? 26.188  -7.974  -17.031 0.61 24.26 ?  230  ARG A N     1 
ATOM   714  N  N     B ARG A 1  102 ? 26.192  -7.975  -17.022 0.39 24.56 ?  230  ARG A N     1 
ATOM   715  C  CA    A ARG A 1  102 ? 27.320  -7.069  -17.167 0.61 25.98 ?  230  ARG A CA    1 
ATOM   716  C  CA    B ARG A 1  102 ? 27.315  -7.058  -17.178 0.39 26.30 ?  230  ARG A CA    1 
ATOM   717  C  C     A ARG A 1  102 ? 27.309  -6.304  -18.482 0.61 28.35 ?  230  ARG A C     1 
ATOM   718  C  C     B ARG A 1  102 ? 27.275  -6.293  -18.493 0.39 28.14 ?  230  ARG A C     1 
ATOM   719  O  O     A ARG A 1  102 ? 28.268  -5.581  -18.770 0.61 30.86 ?  230  ARG A O     1 
ATOM   720  O  O     B ARG A 1  102 ? 28.206  -5.535  -18.783 0.39 30.79 ?  230  ARG A O     1 
ATOM   721  C  CB    A ARG A 1  102 ? 28.633  -7.837  -17.027 0.61 29.31 ?  230  ARG A CB    1 
ATOM   722  C  CB    B ARG A 1  102 ? 28.640  -7.818  -17.051 0.39 28.97 ?  230  ARG A CB    1 
ATOM   723  C  CG    A ARG A 1  102 ? 28.847  -8.877  -18.093 0.61 29.17 ?  230  ARG A CG    1 
ATOM   724  C  CG    B ARG A 1  102 ? 28.815  -8.938  -18.042 0.39 29.22 ?  230  ARG A CG    1 
ATOM   725  C  CD    A ARG A 1  102 ? 30.181  -9.592  -17.904 0.61 31.71 ?  230  ARG A CD    1 
ATOM   726  C  CD    B ARG A 1  102 ? 30.012  -9.819  -17.677 0.39 30.65 ?  230  ARG A CD    1 
ATOM   727  N  NE    A ARG A 1  102 ? 30.269  -10.743 -18.796 0.61 30.58 ?  230  ARG A NE    1 
ATOM   728  N  NE    B ARG A 1  102 ? 30.081  -10.986 -18.550 0.39 30.36 ?  230  ARG A NE    1 
ATOM   729  C  CZ    A ARG A 1  102 ? 30.215  -12.019 -18.418 0.61 28.84 ?  230  ARG A CZ    1 
ATOM   730  C  CZ    B ARG A 1  102 ? 30.377  -10.931 -19.844 0.39 29.60 ?  230  ARG A CZ    1 
ATOM   731  N  NH1   A ARG A 1  102 ? 30.122  -12.360 -17.138 0.61 26.20 ?  230  ARG A NH1   1 
ATOM   732  N  NH1   B ARG A 1  102 ? 30.642  -9.764  -20.420 0.39 29.93 ?  230  ARG A NH1   1 
ATOM   733  N  NH2   A ARG A 1  102 ? 30.279  -12.962 -19.337 0.61 32.05 ?  230  ARG A NH2   1 
ATOM   734  N  NH2   B ARG A 1  102 ? 30.405  -12.043 -20.563 0.39 29.95 ?  230  ARG A NH2   1 
ATOM   735  N  N     A SER A 1  103 ? 26.256  -6.435  -19.281 0.61 21.32 ?  231  SER A N     1 
ATOM   736  N  N     B SER A 1  103 ? 26.217  -6.462  -19.283 0.39 21.60 ?  231  SER A N     1 
ATOM   737  C  CA    A SER A 1  103 ? 26.193  -5.721  -20.542 0.61 22.16 ?  231  SER A CA    1 
ATOM   738  C  CA    B SER A 1  103 ? 26.065  -5.713  -20.521 0.39 21.91 ?  231  SER A CA    1 
ATOM   739  C  C     A SER A 1  103 ? 25.855  -4.253  -20.315 0.61 23.22 ?  231  SER A C     1 
ATOM   740  C  C     B SER A 1  103 ? 25.900  -4.223  -20.241 0.39 22.98 ?  231  SER A C     1 
ATOM   741  O  O     A SER A 1  103 ? 25.054  -3.899  -19.443 0.61 22.38 ?  231  SER A O     1 
ATOM   742  O  O     B SER A 1  103 ? 25.248  -3.818  -19.271 0.39 22.15 ?  231  SER A O     1 
ATOM   743  C  CB    A SER A 1  103 ? 25.172  -6.365  -21.476 0.61 21.48 ?  231  SER A CB    1 
ATOM   744  C  CB    B SER A 1  103 ? 24.856  -6.242  -21.294 0.39 21.59 ?  231  SER A CB    1 
ATOM   745  O  OG    A SER A 1  103 ? 23.844  -6.076  -21.087 0.61 18.18 ?  231  SER A OG    1 
ATOM   746  O  OG    B SER A 1  103 ? 24.411  -5.318  -22.270 0.39 22.46 ?  231  SER A OG    1 
ATOM   747  N  N     . GLU A 1  104 ? 26.503  -3.397  -21.101 1.00 21.71 ?  232  GLU A N     1 
ATOM   748  C  CA    . GLU A 1  104 ? 26.293  -1.962  -20.985 1.00 21.12 ?  232  GLU A CA    1 
ATOM   749  C  C     . GLU A 1  104 ? 24.847  -1.610  -21.286 1.00 19.83 ?  232  GLU A C     1 
ATOM   750  O  O     . GLU A 1  104 ? 24.256  -0.744  -20.627 1.00 20.47 ?  232  GLU A O     1 
ATOM   751  C  CB    . GLU A 1  104 ? 27.238  -1.218  -21.932 1.00 23.81 ?  232  GLU A CB    1 
ATOM   752  C  CG    . GLU A 1  104 ? 27.269  0.280   -21.710 1.00 26.13 ?  232  GLU A CG    1 
ATOM   753  C  CD    . GLU A 1  104 ? 28.234  0.997   -22.647 1.00 32.50 ?  232  GLU A CD    1 
ATOM   754  O  OE1   . GLU A 1  104 ? 28.660  0.383   -23.649 1.00 36.59 ?  232  GLU A OE1   1 
ATOM   755  O  OE2   . GLU A 1  104 ? 28.563  2.174   -22.381 1.00 32.05 ?  232  GLU A OE2   1 
ATOM   756  N  N     . ARG A 1  105 ? 24.263  -2.287  -22.270 1.00 20.35 ?  233  ARG A N     1 
ATOM   757  C  CA    . ARG A 1  105 ? 22.875  -2.045  -22.642 1.00 20.91 ?  233  ARG A CA    1 
ATOM   758  C  C     . ARG A 1  105 ? 21.945  -2.332  -21.470 1.00 19.52 ?  233  ARG A C     1 
ATOM   759  O  O     . ARG A 1  105 ? 21.090  -1.505  -21.115 1.00 18.41 ?  233  ARG A O     1 
ATOM   760  C  CB    . ARG A 1  105 ? 22.524  -2.917  -23.847 1.00 21.62 ?  233  ARG A CB    1 
ATOM   761  C  CG    . ARG A 1  105 ? 21.053  -3.019  -24.205 1.00 24.03 ?  233  ARG A CG    1 
ATOM   762  C  CD    . ARG A 1  105 ? 20.545  -1.757  -24.856 1.00 24.00 ?  233  ARG A CD    1 
ATOM   763  N  NE    . ARG A 1  105 ? 19.133  -1.895  -25.215 1.00 22.04 ?  233  ARG A NE    1 
ATOM   764  C  CZ    . ARG A 1  105 ? 18.420  -0.965  -25.836 1.00 22.74 ?  233  ARG A CZ    1 
ATOM   765  N  NH1   . ARG A 1  105 ? 18.988  0.183   -26.188 1.00 25.13 ?  233  ARG A NH1   1 
ATOM   766  N  NH2   . ARG A 1  105 ? 17.142  -1.182  -26.114 1.00 21.79 ?  233  ARG A NH2   1 
ATOM   767  N  N     . TYR A 1  106 ? 22.090  -3.508  -20.860 1.00 17.84 ?  234  TYR A N     1 
ATOM   768  C  CA    . TYR A 1  106 ? 21.221  -3.856  -19.736 1.00 15.98 ?  234  TYR A CA    1 
ATOM   769  C  C     . TYR A 1  106 ? 21.384  -2.874  -18.583 1.00 15.32 ?  234  TYR A C     1 
ATOM   770  O  O     . TYR A 1  106 ? 20.399  -2.375  -18.028 1.00 15.71 ?  234  TYR A O     1 
ATOM   771  C  CB    . TYR A 1  106 ? 21.511  -5.288  -19.274 1.00 17.71 ?  234  TYR A CB    1 
ATOM   772  C  CG    . TYR A 1  106 ? 20.774  -5.673  -18.021 1.00 17.17 ?  234  TYR A CG    1 
ATOM   773  C  CD1   . TYR A 1  106 ? 19.486  -6.188  -18.083 1.00 17.90 ?  234  TYR A CD1   1 
ATOM   774  C  CD2   . TYR A 1  106 ? 21.357  -5.504  -16.782 1.00 18.25 ?  234  TYR A CD2   1 
ATOM   775  C  CE1   . TYR A 1  106 ? 18.799  -6.532  -16.926 1.00 16.65 ?  234  TYR A CE1   1 
ATOM   776  C  CE2   . TYR A 1  106 ? 20.683  -5.841  -15.622 1.00 17.91 ?  234  TYR A CE2   1 
ATOM   777  C  CZ    . TYR A 1  106 ? 19.401  -6.355  -15.702 1.00 18.98 ?  234  TYR A CZ    1 
ATOM   778  O  OH    . TYR A 1  106 ? 18.739  -6.687  -14.536 1.00 21.68 ?  234  TYR A OH    1 
ATOM   779  N  N     . GLN A 1  107 ? 22.627  -2.583  -18.196 1.00 16.80 ?  235  GLN A N     1 
ATOM   780  C  CA    . GLN A 1  107 ? 22.866  -1.741  -17.036 1.00 17.17 ?  235  GLN A CA    1 
ATOM   781  C  C     . GLN A 1  107 ? 22.327  -0.331  -17.248 1.00 17.51 ?  235  GLN A C     1 
ATOM   782  O  O     . GLN A 1  107 ? 21.772  0.271   -16.321 1.00 16.69 ?  235  GLN A O     1 
ATOM   783  C  CB    . GLN A 1  107 ? 24.364  -1.719  -16.716 1.00 19.46 ?  235  GLN A CB    1 
ATOM   784  C  CG    . GLN A 1  107 ? 24.863  -3.043  -16.174 1.00 23.41 ?  235  GLN A CG    1 
ATOM   785  C  CD    . GLN A 1  107 ? 26.356  -3.043  -15.872 1.00 30.89 ?  235  GLN A CD    1 
ATOM   786  O  OE1   . GLN A 1  107 ? 27.001  -4.090  -15.912 1.00 34.15 ?  235  GLN A OE1   1 
ATOM   787  N  NE2   . GLN A 1  107 ? 26.909  -1.874  -15.560 1.00 30.34 ?  235  GLN A NE2   1 
ATOM   788  N  N     . THR A 1  108 ? 22.461  0.209   -18.464 1.00 17.39 ?  236  THR A N     1 
ATOM   789  C  CA    . THR A 1  108 ? 21.985  1.566   -18.724 1.00 15.27 ?  236  THR A CA    1 
ATOM   790  C  C     . THR A 1  108 ? 20.468  1.630   -18.824 1.00 15.40 ?  236  THR A C     1 
ATOM   791  O  O     . THR A 1  108 ? 19.846  2.579   -18.311 1.00 15.98 ?  236  THR A O     1 
ATOM   792  C  CB    . THR A 1  108 ? 22.606  2.109   -20.011 1.00 17.59 ?  236  THR A CB    1 
ATOM   793  O  OG1   . THR A 1  108 ? 24.034  2.036   -19.894 1.00 20.09 ?  236  THR A OG1   1 
ATOM   794  C  CG2   . THR A 1  108 ? 22.204  3.546   -20.200 1.00 17.61 ?  236  THR A CG2   1 
ATOM   795  N  N     . MET A 1  109 ? 19.866  0.651   -19.502 1.00 15.99 ?  237  MET A N     1 
ATOM   796  C  CA    . MET A 1  109 ? 18.413  0.628   -19.617 1.00 15.43 ?  237  MET A CA    1 
ATOM   797  C  C     . MET A 1  109 ? 17.789  0.457   -18.245 1.00 14.66 ?  237  MET A C     1 
ATOM   798  O  O     . MET A 1  109 ? 16.784  1.099   -17.919 1.00 15.18 ?  237  MET A O     1 
ATOM   799  C  CB    . MET A 1  109 ? 17.974  -0.496  -20.548 1.00 13.98 ?  237  MET A CB    1 
ATOM   800  C  CG    . MET A 1  109 ? 18.290  -0.261  -22.022 1.00 16.83 ?  237  MET A CG    1 
ATOM   801  S  SD    . MET A 1  109 ? 17.347  1.101   -22.734 1.00 16.92 ?  237  MET A SD    1 
ATOM   802  C  CE    . MET A 1  109 ? 15.713  0.335   -22.813 1.00 16.29 ?  237  MET A CE    1 
ATOM   803  N  N     . LYS A 1  110 ? 18.377  -0.405  -17.424 1.00 13.65 ?  238  LYS A N     1 
ATOM   804  C  CA    . LYS A 1  110 ? 17.899  -0.545  -16.054 1.00 13.81 ?  238  LYS A CA    1 
ATOM   805  C  C     . LYS A 1  110 ? 18.000  0.776   -15.307 1.00 14.90 ?  238  LYS A C     1 
ATOM   806  O  O     . LYS A 1  110 ? 17.047  1.207   -14.656 1.00 15.79 ?  238  LYS A O     1 
ATOM   807  C  CB    . LYS A 1  110 ? 18.674  -1.648  -15.338 1.00 13.99 ?  238  LYS A CB    1 
ATOM   808  C  CG    . LYS A 1  110 ? 18.126  -1.947  -13.932 1.00 17.90 ?  238  LYS A CG    1 
ATOM   809  C  CD    . LYS A 1  110 ? 18.669  -3.256  -13.381 1.00 24.33 ?  238  LYS A CD    1 
ATOM   810  C  CE    . LYS A 1  110 ? 18.003  -3.618  -12.059 1.00 26.28 ?  238  LYS A CE    1 
ATOM   811  N  NZ    . LYS A 1  110 ? 16.532  -3.897  -12.191 1.00 25.65 ?  238  LYS A NZ    1 
ATOM   812  N  N     . LEU A 1  111 ? 19.149  1.446   -15.404 1.00 15.08 ?  239  LEU A N     1 
ATOM   813  C  CA    . LEU A 1  111 ? 19.347  2.720   -14.721 1.00 16.70 ?  239  LEU A CA    1 
ATOM   814  C  C     . LEU A 1  111 ? 18.336  3.768   -15.173 1.00 18.11 ?  239  LEU A C     1 
ATOM   815  O  O     . LEU A 1  111 ? 17.752  4.485   -14.346 1.00 18.02 ?  239  LEU A O     1 
ATOM   816  C  CB    . LEU A 1  111 ? 20.771  3.216   -14.979 1.00 17.09 ?  239  LEU A CB    1 
ATOM   817  C  CG    . LEU A 1  111 ? 21.072  4.620   -14.477 1.00 18.78 ?  239  LEU A CG    1 
ATOM   818  C  CD1   . LEU A 1  111 ? 21.016  4.644   -12.963 1.00 21.54 ?  239  LEU A CD1   1 
ATOM   819  C  CD2   . LEU A 1  111 ? 22.428  5.074   -14.994 1.00 21.85 ?  239  LEU A CD2   1 
ATOM   820  N  N     . PHE A 1  112 ? 18.146  3.900   -16.488 1.00 13.17 ?  240  PHE A N     1 
ATOM   821  C  CA    . PHE A 1  112 ? 17.267  4.934   -17.004 1.00 13.28 ?  240  PHE A CA    1 
ATOM   822  C  C     . PHE A 1  112 ? 15.798  4.610   -16.718 1.00 12.89 ?  240  PHE A C     1 
ATOM   823  O  O     . PHE A 1  112 ? 15.044  5.506   -16.332 1.00 13.32 ?  240  PHE A O     1 
ATOM   824  C  CB    . PHE A 1  112 ? 17.492  5.134   -18.507 1.00 13.60 ?  240  PHE A CB    1 
ATOM   825  C  CG    . PHE A 1  112 ? 18.789  5.839   -18.869 1.00 14.94 ?  240  PHE A CG    1 
ATOM   826  C  CD1   . PHE A 1  112 ? 19.585  6.447   -17.921 1.00 17.31 ?  240  PHE A CD1   1 
ATOM   827  C  CD2   . PHE A 1  112 ? 19.175  5.891   -20.194 1.00 15.84 ?  240  PHE A CD2   1 
ATOM   828  C  CE1   . PHE A 1  112 ? 20.770  7.089   -18.287 1.00 17.83 ?  240  PHE A CE1   1 
ATOM   829  C  CE2   . PHE A 1  112 ? 20.351  6.539   -20.573 1.00 16.45 ?  240  PHE A CE2   1 
ATOM   830  C  CZ    . PHE A 1  112 ? 21.139  7.135   -19.624 1.00 16.95 ?  240  PHE A CZ    1 
ATOM   831  N  N     . THR A 1  113 ? 15.365  3.351   -16.900 1.00 13.20 ?  241  THR A N     1 
ATOM   832  C  CA    . THR A 1  113 ? 13.939  3.050   -16.701 1.00 13.50 ?  241  THR A CA    1 
ATOM   833  C  C     . THR A 1  113 ? 13.548  3.112   -15.234 1.00 14.01 ?  241  THR A C     1 
ATOM   834  O  O     . THR A 1  113 ? 12.359  3.276   -14.928 1.00 15.56 ?  241  THR A O     1 
ATOM   835  C  CB    . THR A 1  113 ? 13.549  1.688   -17.263 1.00 14.17 ?  241  THR A CB    1 
ATOM   836  O  OG1   . THR A 1  113 ? 14.355  0.655   -16.671 1.00 12.89 ?  241  THR A OG1   1 
ATOM   837  C  CG2   . THR A 1  113 ? 13.708  1.639   -18.799 1.00 14.32 ?  241  THR A CG2   1 
ATOM   838  N  N     . GLN A 1  114 ? 14.516  3.014   -14.328 1.00 17.82 ?  242  GLN A N     1 
ATOM   839  C  CA    . GLN A 1  114 ? 14.244  3.210   -12.913 1.00 17.66 ?  242  GLN A CA    1 
ATOM   840  C  C     . GLN A 1  114 ? 13.865  4.644   -12.576 1.00 19.72 ?  242  GLN A C     1 
ATOM   841  O  O     . GLN A 1  114 ? 13.357  4.888   -11.473 1.00 20.29 ?  242  GLN A O     1 
ATOM   842  C  CB    . GLN A 1  114 ? 15.469  2.813   -12.078 1.00 21.64 ?  242  GLN A CB    1 
ATOM   843  C  CG    . GLN A 1  114 ? 15.681  1.337   -11.951 1.00 28.69 ?  242  GLN A CG    1 
ATOM   844  C  CD    . GLN A 1  114 ? 17.034  0.989   -11.334 1.00 31.47 ?  242  GLN A CD    1 
ATOM   845  O  OE1   . GLN A 1  114 ? 17.903  1.853   -11.147 1.00 30.70 ?  242  GLN A OE1   1 
ATOM   846  N  NE2   . GLN A 1  114 ? 17.217  -0.284  -11.023 1.00 32.16 ?  242  GLN A NE2   1 
ATOM   847  N  N     . ILE A 1  115 ? 14.132  5.604   -13.469 1.00 14.10 ?  243  ILE A N     1 
ATOM   848  C  CA    . ILE A 1  115 ? 13.785  6.996   -13.209 1.00 13.01 ?  243  ILE A CA    1 
ATOM   849  C  C     . ILE A 1  115 ? 12.280  7.169   -13.352 1.00 16.16 ?  243  ILE A C     1 
ATOM   850  O  O     . ILE A 1  115 ? 11.706  6.746   -14.353 1.00 13.52 ?  243  ILE A O     1 
ATOM   851  C  CB    . ILE A 1  115 ? 14.503  7.919   -14.199 1.00 15.19 ?  243  ILE A CB    1 
ATOM   852  C  CG1   . ILE A 1  115 ? 16.017  7.694   -14.137 1.00 14.31 ?  243  ILE A CG1   1 
ATOM   853  C  CG2   . ILE A 1  115 ? 14.153  9.374   -13.920 1.00 15.44 ?  243  ILE A CG2   1 
ATOM   854  C  CD1   . ILE A 1  115 ? 16.770  8.431   -15.246 1.00 17.74 ?  243  ILE A CD1   1 
ATOM   855  N  N     . PHE A 1  116 ? 11.650  7.833   -12.380 1.00 12.63 ?  244  PHE A N     1 
ATOM   856  C  CA    . PHE A 1  116 ? 10.246  8.192   -12.498 1.00 12.44 ?  244  PHE A CA    1 
ATOM   857  C  C     . PHE A 1  116 ? 10.059  9.168   -13.650 1.00 13.20 ?  244  PHE A C     1 
ATOM   858  O  O     . PHE A 1  116 ? 10.642  10.257  -13.659 1.00 13.84 ?  244  PHE A O     1 
ATOM   859  C  CB    . PHE A 1  116 ? 9.769   8.781   -11.172 1.00 12.26 ?  244  PHE A CB    1 
ATOM   860  C  CG    . PHE A 1  116 ? 8.331   9.223   -11.165 1.00 11.76 ?  244  PHE A CG    1 
ATOM   861  C  CD1   . PHE A 1  116 ? 7.310   8.293   -11.226 1.00 12.37 ?  244  PHE A CD1   1 
ATOM   862  C  CD2   . PHE A 1  116 ? 8.012   10.548  -11.011 1.00 15.04 ?  244  PHE A CD2   1 
ATOM   863  C  CE1   . PHE A 1  116 ? 5.995   8.678   -11.190 1.00 12.73 ?  244  PHE A CE1   1 
ATOM   864  C  CE2   . PHE A 1  116 ? 6.695   10.945  -10.952 1.00 18.60 ?  244  PHE A CE2   1 
ATOM   865  C  CZ    . PHE A 1  116 ? 5.685   10.000  -11.053 1.00 16.26 ?  244  PHE A CZ    1 
ATOM   866  N  N     . GLY A 1  117 ? 9.289   8.737   -14.644 1.00 11.97 ?  245  GLY A N     1 
ATOM   867  C  CA    . GLY A 1  117 ? 9.022   9.519   -15.837 1.00 12.64 ?  245  GLY A CA    1 
ATOM   868  C  C     . GLY A 1  117 ? 9.737   9.016   -17.076 1.00 12.45 ?  245  GLY A C     1 
ATOM   869  O  O     . GLY A 1  117 ? 9.506   9.557   -18.173 1.00 13.20 ?  245  GLY A O     1 
ATOM   870  N  N     . VAL A 1  118 ? 10.540  7.964   -16.950 1.00 12.05 ?  246  VAL A N     1 
ATOM   871  C  CA    . VAL A 1  118 ? 11.273  7.377   -18.064 1.00 12.44 ?  246  VAL A CA    1 
ATOM   872  C  C     . VAL A 1  118 ? 10.831  5.935   -18.216 1.00 11.98 ?  246  VAL A C     1 
ATOM   873  O  O     . VAL A 1  118 ? 10.992  5.139   -17.286 1.00 11.61 ?  246  VAL A O     1 
ATOM   874  C  CB    . VAL A 1  118 ? 12.791  7.434   -17.840 1.00 12.63 ?  246  VAL A CB    1 
ATOM   875  C  CG1   . VAL A 1  118 ? 13.517  6.840   -19.050 1.00 13.63 ?  246  VAL A CG1   1 
ATOM   876  C  CG2   . VAL A 1  118 ? 13.246  8.844   -17.517 1.00 14.17 ?  246  VAL A CG2   1 
ATOM   877  N  N     . GLY A 1  119 ? 10.332  5.586   -19.400 1.00 13.44 ?  247  GLY A N     1 
ATOM   878  C  CA    . GLY A 1  119 ? 10.026  4.225   -19.758 1.00 12.58 ?  247  GLY A CA    1 
ATOM   879  C  C     . GLY A 1  119 ? 11.045  3.636   -20.719 1.00 14.78 ?  247  GLY A C     1 
ATOM   880  O  O     . GLY A 1  119 ? 12.054  4.254   -21.052 1.00 13.06 ?  247  GLY A O     1 
ATOM   881  N  N     . VAL A 1  120 ? 10.750  2.424   -21.186 1.00 15.11 ?  248  VAL A N     1 
ATOM   882  C  CA    . VAL A 1  120 ? 11.664  1.734   -22.091 1.00 16.00 ?  248  VAL A CA    1 
ATOM   883  C  C     . VAL A 1  120 ? 11.914  2.563   -23.345 1.00 15.47 ?  248  VAL A C     1 
ATOM   884  O  O     . VAL A 1  120 ? 13.056  2.695   -23.791 1.00 15.63 ?  248  VAL A O     1 
ATOM   885  C  CB    . VAL A 1  120 ? 11.139  0.332   -22.443 1.00 15.86 ?  248  VAL A CB    1 
ATOM   886  C  CG1   . VAL A 1  120 ? 11.984  -0.311  -23.546 1.00 16.23 ?  248  VAL A CG1   1 
ATOM   887  C  CG2   . VAL A 1  120 ? 11.182  -0.550  -21.212 1.00 20.08 ?  248  VAL A CG2   1 
ATOM   888  N  N     . LYS A 1  121 ? 10.858  3.109   -23.954 1.00 16.70 ?  249  LYS A N     1 
ATOM   889  C  CA    . LYS A 1  121 ? 11.053  3.846   -25.202 1.00 17.46 ?  249  LYS A CA    1 
ATOM   890  C  C     . LYS A 1  121 ? 11.961  5.059   -25.014 1.00 18.66 ?  249  LYS A C     1 
ATOM   891  O  O     . LYS A 1  121 ? 12.846  5.301   -25.846 1.00 20.18 ?  249  LYS A O     1 
ATOM   892  C  CB    . LYS A 1  121 ? 9.709   4.253   -25.791 1.00 20.33 ?  249  LYS A CB    1 
ATOM   893  C  CG    . LYS A 1  121 ? 8.903   3.047   -26.251 1.00 25.06 ?  249  LYS A CG    1 
ATOM   894  C  CD    . LYS A 1  121 ? 7.667   3.448   -27.046 1.00 29.13 ?  249  LYS A CD    1 
ATOM   895  C  CE    . LYS A 1  121 ? 6.964   2.212   -27.617 1.00 28.93 ?  249  LYS A CE    1 
ATOM   896  N  NZ    . LYS A 1  121 ? 6.559   1.263   -26.560 1.00 34.21 ?  249  LYS A NZ    1 
ATOM   897  N  N     . THR A 1  122 ? 11.768  5.836   -23.939 1.00 15.90 ?  250  THR A N     1 
ATOM   898  C  CA    . THR A 1  122 ? 12.631  6.992   -23.709 1.00 16.09 ?  250  THR A CA    1 
ATOM   899  C  C     . THR A 1  122 ? 14.056  6.550   -23.413 1.00 15.61 ?  250  THR A C     1 
ATOM   900  O  O     . THR A 1  122 ? 15.018  7.116   -23.951 1.00 16.45 ?  250  THR A O     1 
ATOM   901  C  CB    . THR A 1  122 ? 12.089  7.852   -22.570 1.00 16.94 ?  250  THR A CB    1 
ATOM   902  O  OG1   . THR A 1  122 ? 10.805  8.349   -22.941 1.00 17.01 ?  250  THR A OG1   1 
ATOM   903  C  CG2   . THR A 1  122 ? 13.003  9.038   -22.313 1.00 17.62 ?  250  THR A CG2   1 
ATOM   904  N  N     . ALA A 1  123 ? 14.207  5.548   -22.538 1.00 15.62 ?  251  ALA A N     1 
ATOM   905  C  CA    . ALA A 1  123 ? 15.527  5.030   -22.186 1.00 14.78 ?  251  ALA A CA    1 
ATOM   906  C  C     . ALA A 1  123 ? 16.293  4.567   -23.417 1.00 17.45 ?  251  ALA A C     1 
ATOM   907  O  O     . ALA A 1  123 ? 17.498  4.818   -23.535 1.00 16.67 ?  251  ALA A O     1 
ATOM   908  C  CB    . ALA A 1  123 ? 15.384  3.859   -21.213 1.00 15.00 ?  251  ALA A CB    1 
ATOM   909  N  N     . ASP A 1  124 ? 15.618  3.852   -24.311 1.00 15.58 ?  252  ASP A N     1 
ATOM   910  C  CA    . ASP A 1  124 ? 16.268  3.344   -25.514 1.00 17.43 ?  252  ASP A CA    1 
ATOM   911  C  C     . ASP A 1  124 ? 16.725  4.487   -26.406 1.00 17.93 ?  252  ASP A C     1 
ATOM   912  O  O     . ASP A 1  124 ? 17.834  4.446   -26.948 1.00 19.89 ?  252  ASP A O     1 
ATOM   913  C  CB    . ASP A 1  124 ? 15.315  2.416   -26.259 1.00 17.45 ?  252  ASP A CB    1 
ATOM   914  C  CG    . ASP A 1  124 ? 15.868  1.943   -27.603 1.00 20.61 ?  252  ASP A CG    1 
ATOM   915  O  OD1   . ASP A 1  124 ? 16.837  1.158   -27.605 1.00 21.20 ?  252  ASP A OD1   1 
ATOM   916  O  OD2   . ASP A 1  124 ? 15.301  2.332   -28.650 1.00 24.27 ?  252  ASP A OD2   1 
ATOM   917  N  N     A ARG A 1  125 ? 15.893  5.520   -26.560 0.58 19.36 ?  253  ARG A N     1 
ATOM   918  N  N     B ARG A 1  125 ? 15.890  5.515   -26.585 0.42 19.64 ?  253  ARG A N     1 
ATOM   919  C  CA    A ARG A 1  125 ? 16.281  6.656   -27.394 0.58 21.20 ?  253  ARG A CA    1 
ATOM   920  C  CA    B ARG A 1  125 ? 16.320  6.645   -27.406 0.42 21.37 ?  253  ARG A CA    1 
ATOM   921  C  C     A ARG A 1  125 ? 17.520  7.345   -26.838 0.58 21.35 ?  253  ARG A C     1 
ATOM   922  C  C     B ARG A 1  125 ? 17.573  7.282   -26.828 0.42 21.46 ?  253  ARG A C     1 
ATOM   923  O  O     A ARG A 1  125 ? 18.441  7.692   -27.589 0.58 21.93 ?  253  ARG A O     1 
ATOM   924  O  O     B ARG A 1  125 ? 18.544  7.547   -27.550 0.42 22.20 ?  253  ARG A O     1 
ATOM   925  C  CB    A ARG A 1  125 ? 15.110  7.634   -27.511 0.58 23.21 ?  253  ARG A CB    1 
ATOM   926  C  CB    B ARG A 1  125 ? 15.210  7.690   -27.536 0.42 23.53 ?  253  ARG A CB    1 
ATOM   927  C  CG    A ARG A 1  125 ? 15.418  8.873   -28.338 0.58 25.01 ?  253  ARG A CG    1 
ATOM   928  C  CG    B ARG A 1  125 ? 15.725  8.985   -28.182 0.42 24.92 ?  253  ARG A CG    1 
ATOM   929  C  CD    A ARG A 1  125 ? 14.162  9.676   -28.648 0.58 26.45 ?  253  ARG A CD    1 
ATOM   930  C  CD    B ARG A 1  125 ? 14.634  9.963   -28.563 0.42 26.42 ?  253  ARG A CD    1 
ATOM   931  N  NE    A ARG A 1  125 ? 13.455  10.118  -27.447 0.58 25.48 ?  253  ARG A NE    1 
ATOM   932  N  NE    B ARG A 1  125 ? 14.052  10.647  -27.408 0.42 25.15 ?  253  ARG A NE    1 
ATOM   933  C  CZ    A ARG A 1  125 ? 13.873  11.096  -26.645 0.58 25.26 ?  253  ARG A CZ    1 
ATOM   934  C  CZ    B ARG A 1  125 ? 12.894  10.325  -26.835 0.42 24.74 ?  253  ARG A CZ    1 
ATOM   935  N  NH1   A ARG A 1  125 ? 15.004  11.742  -26.903 0.58 25.21 ?  253  ARG A NH1   1 
ATOM   936  N  NH1   B ARG A 1  125 ? 12.166  9.319   -27.302 0.42 25.32 ?  253  ARG A NH1   1 
ATOM   937  N  NH2   A ARG A 1  125 ? 13.157  11.428  -25.573 0.58 25.61 ?  253  ARG A NH2   1 
ATOM   938  N  NH2   B ARG A 1  125 ? 12.463  11.016  -25.788 0.42 24.99 ?  253  ARG A NH2   1 
ATOM   939  N  N     . TRP A 1  126 ? 17.569  7.536   -25.515 1.00 19.75 ?  254  TRP A N     1 
ATOM   940  C  CA    . TRP A 1  126 ? 18.728  8.132   -24.870 1.00 20.12 ?  254  TRP A CA    1 
ATOM   941  C  C     . TRP A 1  126 ? 19.957  7.253   -25.031 1.00 20.33 ?  254  TRP A C     1 
ATOM   942  O  O     . TRP A 1  126 ? 21.067  7.748   -25.264 1.00 20.78 ?  254  TRP A O     1 
ATOM   943  C  CB    . TRP A 1  126 ? 18.425  8.372   -23.390 1.00 17.95 ?  254  TRP A CB    1 
ATOM   944  C  CG    . TRP A 1  126 ? 17.455  9.512   -23.145 1.00 19.59 ?  254  TRP A CG    1 
ATOM   945  C  CD1   . TRP A 1  126 ? 17.017  10.448  -24.049 1.00 22.54 ?  254  TRP A CD1   1 
ATOM   946  C  CD2   . TRP A 1  126 ? 16.807  9.824   -21.908 1.00 18.58 ?  254  TRP A CD2   1 
ATOM   947  N  NE1   . TRP A 1  126 ? 16.146  11.321  -23.442 1.00 21.79 ?  254  TRP A NE1   1 
ATOM   948  C  CE2   . TRP A 1  126 ? 16.005  10.960  -22.127 1.00 18.79 ?  254  TRP A CE2   1 
ATOM   949  C  CE3   . TRP A 1  126 ? 16.830  9.249   -20.637 1.00 17.85 ?  254  TRP A CE3   1 
ATOM   950  C  CZ2   . TRP A 1  126 ? 15.224  11.528  -21.118 1.00 20.23 ?  254  TRP A CZ2   1 
ATOM   951  C  CZ3   . TRP A 1  126 ? 16.062  9.824   -19.632 1.00 18.09 ?  254  TRP A CZ3   1 
ATOM   952  C  CH2   . TRP A 1  126 ? 15.273  10.950  -19.880 1.00 19.38 ?  254  TRP A CH2   1 
ATOM   953  N  N     . TYR A 1  127 ? 19.778  5.945   -24.900 1.00 19.65 ?  255  TYR A N     1 
ATOM   954  C  CA    . TYR A 1  127 ? 20.882  5.022   -25.114 1.00 19.09 ?  255  TYR A CA    1 
ATOM   955  C  C     . TYR A 1  127 ? 21.430  5.158   -26.534 1.00 20.69 ?  255  TYR A C     1 
ATOM   956  O  O     . TYR A 1  127 ? 22.648  5.212   -26.734 1.00 22.13 ?  255  TYR A O     1 
ATOM   957  C  CB    . TYR A 1  127 ? 20.427  3.587   -24.846 1.00 19.66 ?  255  TYR A CB    1 
ATOM   958  C  CG    . TYR A 1  127 ? 21.577  2.620   -24.838 1.00 21.00 ?  255  TYR A CG    1 
ATOM   959  C  CD1   . TYR A 1  127 ? 22.305  2.423   -23.686 1.00 20.11 ?  255  TYR A CD1   1 
ATOM   960  C  CD2   . TYR A 1  127 ? 21.961  1.939   -25.991 1.00 22.84 ?  255  TYR A CD2   1 
ATOM   961  C  CE1   . TYR A 1  127 ? 23.366  1.571   -23.653 1.00 23.28 ?  255  TYR A CE1   1 
ATOM   962  C  CE2   . TYR A 1  127 ? 23.041  1.064   -25.969 1.00 22.51 ?  255  TYR A CE2   1 
ATOM   963  C  CZ    . TYR A 1  127 ? 23.736  0.898   -24.790 1.00 23.73 ?  255  TYR A CZ    1 
ATOM   964  O  OH    . TYR A 1  127 ? 24.812  0.057   -24.674 1.00 26.37 ?  255  TYR A OH    1 
ATOM   965  N  N     . ARG A 1  128 ? 20.546  5.222   -27.525 1.00 22.88 ?  256  ARG A N     1 
ATOM   966  C  CA    . ARG A 1  128 ? 21.009  5.306   -28.909 1.00 25.06 ?  256  ARG A CA    1 
ATOM   967  C  C     . ARG A 1  128 ? 21.690  6.639   -29.189 1.00 29.18 ?  256  ARG A C     1 
ATOM   968  O  O     . ARG A 1  128 ? 22.571  6.715   -30.054 1.00 32.93 ?  256  ARG A O     1 
ATOM   969  C  CB    . ARG A 1  128 ? 19.840  5.079   -29.862 1.00 27.72 ?  256  ARG A CB    1 
ATOM   970  C  CG    . ARG A 1  128 ? 19.316  3.659   -29.820 1.00 28.99 ?  256  ARG A CG    1 
ATOM   971  C  CD    . ARG A 1  128 ? 18.270  3.406   -30.897 1.00 30.02 ?  256  ARG A CD    1 
ATOM   972  N  NE    . ARG A 1  128 ? 16.915  3.786   -30.502 1.00 33.26 ?  256  ARG A NE    1 
ATOM   973  C  CZ    . ARG A 1  128 ? 16.318  4.944   -30.793 1.00 34.94 ?  256  ARG A CZ    1 
ATOM   974  N  NH1   . ARG A 1  128 ? 16.938  5.886   -31.497 1.00 34.64 ?  256  ARG A NH1   1 
ATOM   975  N  NH2   . ARG A 1  128 ? 15.076  5.158   -30.377 1.00 35.67 ?  256  ARG A NH2   1 
ATOM   976  N  N     . GLU A 1  129 ? 21.317  7.687   -28.466 1.00 26.96 ?  257  GLU A N     1 
ATOM   977  C  CA    . GLU A 1  129 ? 21.973  8.986   -28.562 1.00 28.70 ?  257  GLU A CA    1 
ATOM   978  C  C     . GLU A 1  129 ? 23.321  9.036   -27.845 1.00 31.91 ?  257  GLU A C     1 
ATOM   979  O  O     . GLU A 1  129 ? 23.993  10.070  -27.897 1.00 35.55 ?  257  GLU A O     1 
ATOM   980  C  CB    . GLU A 1  129 ? 21.053  10.077  -27.992 1.00 30.33 ?  257  GLU A CB    1 
ATOM   981  C  CG    . GLU A 1  129 ? 19.779  10.294  -28.785 1.00 32.14 ?  257  GLU A CG    1 
ATOM   982  C  CD    . GLU A 1  129 ? 18.816  11.282  -28.127 1.00 38.57 ?  257  GLU A CD    1 
ATOM   983  O  OE1   . GLU A 1  129 ? 19.135  11.817  -27.047 1.00 37.98 ?  257  GLU A OE1   1 
ATOM   984  O  OE2   . GLU A 1  129 ? 17.731  11.522  -28.692 1.00 43.87 ?  257  GLU A OE2   1 
ATOM   985  N  N     . GLY A 1  130 ? 23.725  7.970   -27.163 1.00 25.55 ?  258  GLY A N     1 
ATOM   986  C  CA    . GLY A 1  130 ? 25.007  7.921   -26.505 1.00 24.89 ?  258  GLY A CA    1 
ATOM   987  C  C     . GLY A 1  130 ? 24.995  8.188   -25.021 1.00 26.51 ?  258  GLY A C     1 
ATOM   988  O  O     . GLY A 1  130 ? 26.062  8.145   -24.404 1.00 27.13 ?  258  GLY A O     1 
ATOM   989  N  N     . LEU A 1  131 ? 23.836  8.448   -24.421 1.00 23.11 ?  259  LEU A N     1 
ATOM   990  C  CA    . LEU A 1  131 ? 23.784  8.758   -23.000 1.00 23.54 ?  259  LEU A CA    1 
ATOM   991  C  C     . LEU A 1  131 ? 23.915  7.479   -22.176 1.00 23.13 ?  259  LEU A C     1 
ATOM   992  O  O     . LEU A 1  131 ? 23.434  6.415   -22.578 1.00 22.05 ?  259  LEU A O     1 
ATOM   993  C  CB    . LEU A 1  131 ? 22.480  9.481   -22.673 1.00 24.05 ?  259  LEU A CB    1 
ATOM   994  C  CG    . LEU A 1  131 ? 22.270  10.807  -23.422 1.00 23.75 ?  259  LEU A CG    1 
ATOM   995  C  CD1   . LEU A 1  131 ? 20.830  11.204  -23.468 1.00 26.18 ?  259  LEU A CD1   1 
ATOM   996  C  CD2   . LEU A 1  131 ? 23.094  11.901  -22.764 1.00 27.77 ?  259  LEU A CD2   1 
ATOM   997  N  N     . ARG A 1  132 ? 24.615  7.574   -21.039 1.00 21.39 ?  260  ARG A N     1 
ATOM   998  C  CA    . ARG A 1  132 ? 24.896  6.404   -20.218 1.00 20.42 ?  260  ARG A CA    1 
ATOM   999  C  C     . ARG A 1  132 ? 24.700  6.604   -18.724 1.00 22.67 ?  260  ARG A C     1 
ATOM   1000 O  O     . ARG A 1  132 ? 24.513  5.603   -18.025 1.00 22.80 ?  260  ARG A O     1 
ATOM   1001 C  CB    . ARG A 1  132 ? 26.338  5.922   -20.448 1.00 21.60 ?  260  ARG A CB    1 
ATOM   1002 C  CG    . ARG A 1  132 ? 26.614  5.430   -21.857 1.00 23.42 ?  260  ARG A CG    1 
ATOM   1003 C  CD    . ARG A 1  132 ? 25.863  4.154   -22.186 1.00 22.83 ?  260  ARG A CD    1 
ATOM   1004 N  NE    . ARG A 1  132 ? 26.212  3.619   -23.507 1.00 23.73 ?  260  ARG A NE    1 
ATOM   1005 C  CZ    . ARG A 1  132 ? 25.614  3.957   -24.646 1.00 22.97 ?  260  ARG A CZ    1 
ATOM   1006 N  NH1   . ARG A 1  132 ? 24.631  4.847   -24.657 1.00 22.68 ?  260  ARG A NH1   1 
ATOM   1007 N  NH2   . ARG A 1  132 ? 26.009  3.406   -25.793 1.00 25.10 ?  260  ARG A NH2   1 
ATOM   1008 N  N     . THR A 1  133 ? 24.746  7.836   -18.206 1.00 24.37 ?  261  THR A N     1 
ATOM   1009 C  CA    . THR A 1  133 ? 24.725  8.078   -16.774 1.00 24.05 ?  261  THR A CA    1 
ATOM   1010 C  C     . THR A 1  133 ? 23.689  9.139   -16.425 1.00 22.07 ?  261  THR A C     1 
ATOM   1011 O  O     . THR A 1  133 ? 23.233  9.907   -17.272 1.00 23.47 ?  261  THR A O     1 
ATOM   1012 C  CB    . THR A 1  133 ? 26.097  8.541   -16.254 1.00 25.70 ?  261  THR A CB    1 
ATOM   1013 O  OG1   . THR A 1  133 ? 26.339  9.872   -16.710 1.00 30.35 ?  261  THR A OG1   1 
ATOM   1014 C  CG2   . THR A 1  133 ? 27.196  7.637   -16.746 1.00 26.88 ?  261  THR A CG2   1 
ATOM   1015 N  N     . LEU A 1  134 ? 23.336  9.186   -15.138 1.00 22.46 ?  262  LEU A N     1 
ATOM   1016 C  CA    . LEU A 1  134 ? 22.385  10.188  -14.678 1.00 22.10 ?  262  LEU A CA    1 
ATOM   1017 C  C     . LEU A 1  134 ? 22.940  11.590  -14.872 1.00 25.17 ?  262  LEU A C     1 
ATOM   1018 O  O     . LEU A 1  134 ? 22.202  12.507  -15.252 1.00 27.28 ?  262  LEU A O     1 
ATOM   1019 C  CB    . LEU A 1  134 ? 22.025  9.936   -13.215 1.00 22.75 ?  262  LEU A CB    1 
ATOM   1020 C  CG    . LEU A 1  134 ? 21.362  8.589   -12.932 1.00 23.17 ?  262  LEU A CG    1 
ATOM   1021 C  CD1   . LEU A 1  134 ? 20.986  8.520   -11.463 1.00 25.45 ?  262  LEU A CD1   1 
ATOM   1022 C  CD2   . LEU A 1  134 ? 20.137  8.381   -13.817 1.00 21.66 ?  262  LEU A CD2   1 
ATOM   1023 N  N     . ASP A 1  135 ? 24.241  11.767  -14.653 1.00 29.41 ?  263  ASP A N     1 
ATOM   1024 C  CA    . ASP A 1  135 ? 24.850  13.076  -14.886 1.00 32.58 ?  263  ASP A CA    1 
ATOM   1025 C  C     . ASP A 1  135 ? 24.779  13.471  -16.360 1.00 33.74 ?  263  ASP A C     1 
ATOM   1026 O  O     . ASP A 1  135 ? 24.598  14.651  -16.682 1.00 35.31 ?  263  ASP A O     1 
ATOM   1027 C  CB    . ASP A 1  135 ? 26.287  13.076  -14.372 1.00 33.99 ?  263  ASP A CB    1 
ATOM   1028 C  CG    . ASP A 1  135 ? 26.356  13.123  -12.849 1.00 40.23 ?  263  ASP A CG    1 
ATOM   1029 O  OD1   . ASP A 1  135 ? 25.341  13.504  -12.217 1.00 43.17 ?  263  ASP A OD1   1 
ATOM   1030 O  OD2   . ASP A 1  135 ? 27.415  12.782  -12.281 1.00 45.58 ?  263  ASP A OD2   1 
ATOM   1031 N  N     . ASP A 1  136 ? 24.890  12.500  -17.276 1.00 28.33 ?  264  ASP A N     1 
ATOM   1032 C  CA    . ASP A 1  136 ? 24.660  12.802  -18.687 1.00 27.36 ?  264  ASP A CA    1 
ATOM   1033 C  C     . ASP A 1  136 ? 23.288  13.429  -18.898 1.00 27.09 ?  264  ASP A C     1 
ATOM   1034 O  O     . ASP A 1  136 ? 23.124  14.327  -19.730 1.00 29.81 ?  264  ASP A O     1 
ATOM   1035 C  CB    . ASP A 1  136 ? 24.774  11.540  -19.545 1.00 26.58 ?  264  ASP A CB    1 
ATOM   1036 C  CG    . ASP A 1  136 ? 26.184  10.992  -19.619 1.00 32.35 ?  264  ASP A CG    1 
ATOM   1037 O  OD1   . ASP A 1  136 ? 27.138  11.747  -19.341 1.00 34.67 ?  264  ASP A OD1   1 
ATOM   1038 O  OD2   . ASP A 1  136 ? 26.331  9.800   -19.979 1.00 30.75 ?  264  ASP A OD2   1 
ATOM   1039 N  N     . LEU A 1  137 ? 22.274  12.938  -18.181 1.00 24.63 ?  265  LEU A N     1 
ATOM   1040 C  CA    . LEU A 1  137 ? 20.935  13.483  -18.345 1.00 25.25 ?  265  LEU A CA    1 
ATOM   1041 C  C     . LEU A 1  137 ? 20.826  14.848  -17.685 1.00 28.09 ?  265  LEU A C     1 
ATOM   1042 O  O     . LEU A 1  137 ? 20.155  15.746  -18.202 1.00 30.26 ?  265  LEU A O     1 
ATOM   1043 C  CB    . LEU A 1  137 ? 19.904  12.515  -17.751 1.00 21.99 ?  265  LEU A CB    1 
ATOM   1044 C  CG    . LEU A 1  137 ? 19.900  11.090  -18.277 1.00 23.02 ?  265  LEU A CG    1 
ATOM   1045 C  CD1   . LEU A 1  137 ? 18.931  10.225  -17.456 1.00 22.25 ?  265  LEU A CD1   1 
ATOM   1046 C  CD2   . LEU A 1  137 ? 19.520  11.069  -19.726 1.00 25.48 ?  265  LEU A CD2   1 
ATOM   1047 N  N     . ARG A 1  138 ? 21.484  15.016  -16.541 1.00 29.49 ?  266  ARG A N     1 
ATOM   1048 C  CA    . ARG A 1  138 ? 21.427  16.275  -15.813 1.00 30.82 ?  266  ARG A CA    1 
ATOM   1049 C  C     . ARG A 1  138 ? 22.130  17.398  -16.570 1.00 33.73 ?  266  ARG A C     1 
ATOM   1050 O  O     . ARG A 1  138 ? 21.799  18.572  -16.377 1.00 36.92 ?  266  ARG A O     1 
ATOM   1051 C  CB    . ARG A 1  138 ? 22.054  16.089  -14.436 1.00 27.78 ?  266  ARG A CB    1 
ATOM   1052 C  CG    . ARG A 1  138 ? 21.259  15.140  -13.534 1.00 28.43 ?  266  ARG A CG    1 
ATOM   1053 C  CD    . ARG A 1  138 ? 21.830  15.086  -12.143 1.00 29.57 ?  266  ARG A CD    1 
ATOM   1054 N  NE    . ARG A 1  138 ? 20.922  14.395  -11.221 1.00 31.48 ?  266  ARG A NE    1 
ATOM   1055 C  CZ    . ARG A 1  138 ? 21.240  13.327  -10.498 1.00 30.79 ?  266  ARG A CZ    1 
ATOM   1056 N  NH1   . ARG A 1  138 ? 22.452  12.803  -10.568 1.00 27.92 ?  266  ARG A NH1   1 
ATOM   1057 N  NH2   . ARG A 1  138 ? 20.337  12.778  -9.695  1.00 29.01 ?  266  ARG A NH2   1 
ATOM   1058 N  N     . GLU A 1  139 ? 23.090  17.060  -17.435 1.00 36.26 ?  267  GLU A N     1 
ATOM   1059 C  CA    . GLU A 1  139 ? 23.835  18.077  -18.170 1.00 38.74 ?  267  GLU A CA    1 
ATOM   1060 C  C     . GLU A 1  139 ? 23.026  18.683  -19.312 1.00 41.78 ?  267  GLU A C     1 
ATOM   1061 O  O     . GLU A 1  139 ? 23.375  19.765  -19.793 1.00 45.10 ?  267  GLU A O     1 
ATOM   1062 C  CB    . GLU A 1  139 ? 25.133  17.484  -18.719 1.00 36.80 ?  267  GLU A CB    1 
ATOM   1063 N  N     . GLN A 1  140 ? 21.959  18.023  -19.754 1.00 41.68 ?  268  GLN A N     1 
ATOM   1064 C  CA    . GLN A 1  140 ? 21.114  18.523  -20.841 1.00 42.17 ?  268  GLN A CA    1 
ATOM   1065 C  C     . GLN A 1  140 ? 19.661  18.571  -20.382 1.00 43.43 ?  268  GLN A C     1 
ATOM   1066 O  O     . GLN A 1  140 ? 18.789  17.914  -20.958 1.00 44.37 ?  268  GLN A O     1 
ATOM   1067 C  CB    . GLN A 1  140 ? 21.269  17.646  -22.083 1.00 41.97 ?  268  GLN A CB    1 
ATOM   1068 N  N     . PRO A 1  141 ? 19.359  19.361  -19.345 1.00 44.17 ?  269  PRO A N     1 
ATOM   1069 C  CA    . PRO A 1  141 ? 18.013  19.310  -18.754 1.00 43.03 ?  269  PRO A CA    1 
ATOM   1070 C  C     . PRO A 1  141 ? 16.935  19.857  -19.658 1.00 46.15 ?  269  PRO A C     1 
ATOM   1071 O  O     . PRO A 1  141 ? 15.750  19.692  -19.341 1.00 49.61 ?  269  PRO A O     1 
ATOM   1072 C  CB    . PRO A 1  141 ? 18.158  20.153  -17.484 1.00 41.87 ?  269  PRO A CB    1 
ATOM   1073 C  CG    . PRO A 1  141 ? 19.227  21.126  -17.816 1.00 43.44 ?  269  PRO A CG    1 
ATOM   1074 C  CD    . PRO A 1  141 ? 20.190  20.408  -18.727 1.00 44.62 ?  269  PRO A CD    1 
ATOM   1075 N  N     . GLN A 1  142 ? 17.298  20.494  -20.773 1.00 47.60 ?  270  GLN A N     1 
ATOM   1076 C  CA    . GLN A 1  142 ? 16.288  20.976  -21.708 1.00 48.89 ?  270  GLN A CA    1 
ATOM   1077 C  C     . GLN A 1  142 ? 15.505  19.825  -22.320 1.00 48.15 ?  270  GLN A C     1 
ATOM   1078 O  O     . GLN A 1  142 ? 14.343  20.000  -22.705 1.00 53.20 ?  270  GLN A O     1 
ATOM   1079 C  CB    . GLN A 1  142 ? 16.947  21.814  -22.808 1.00 48.17 ?  270  GLN A CB    1 
ATOM   1080 N  N     . LYS A 1  143 ? 16.115  18.646  -22.416 1.00 44.23 ?  271  LYS A N     1 
ATOM   1081 C  CA    . LYS A 1  143 ? 15.465  17.494  -23.024 1.00 43.06 ?  271  LYS A CA    1 
ATOM   1082 C  C     . LYS A 1  143 ? 14.554  16.735  -22.061 1.00 39.97 ?  271  LYS A C     1 
ATOM   1083 O  O     . LYS A 1  143 ? 14.012  15.697  -22.450 1.00 42.93 ?  271  LYS A O     1 
ATOM   1084 C  CB    . LYS A 1  143 ? 16.523  16.535  -23.578 1.00 45.10 ?  271  LYS A CB    1 
ATOM   1085 N  N     . LEU A 1  144 ? 14.369  17.211  -20.833 1.00 26.96 ?  272  LEU A N     1 
ATOM   1086 C  CA    . LEU A 1  144 ? 13.614  16.471  -19.826 1.00 23.81 ?  272  LEU A CA    1 
ATOM   1087 C  C     . LEU A 1  144 ? 12.233  17.068  -19.627 1.00 22.97 ?  272  LEU A C     1 
ATOM   1088 O  O     . LEU A 1  144 ? 12.076  18.290  -19.570 1.00 25.64 ?  272  LEU A O     1 
ATOM   1089 C  CB    . LEU A 1  144 ? 14.348  16.480  -18.492 1.00 23.93 ?  272  LEU A CB    1 
ATOM   1090 C  CG    . LEU A 1  144 ? 15.776  15.989  -18.524 1.00 24.33 ?  272  LEU A CG    1 
ATOM   1091 C  CD1   . LEU A 1  144 ? 16.424  16.251  -17.184 1.00 26.32 ?  272  LEU A CD1   1 
ATOM   1092 C  CD2   . LEU A 1  144 ? 15.775  14.518  -18.852 1.00 23.45 ?  272  LEU A CD2   1 
ATOM   1093 N  N     . THR A 1  145 ? 11.238  16.201  -19.470 1.00 20.34 ?  273  THR A N     1 
ATOM   1094 C  CA    . THR A 1  145 ? 9.937   16.660  -19.019 1.00 20.19 ?  273  THR A CA    1 
ATOM   1095 C  C     . THR A 1  145 ? 10.008  17.067  -17.552 1.00 21.90 ?  273  THR A C     1 
ATOM   1096 O  O     . THR A 1  145 ? 10.949  16.727  -16.842 1.00 22.82 ?  273  THR A O     1 
ATOM   1097 C  CB    . THR A 1  145 ? 8.890   15.574  -19.171 1.00 20.72 ?  273  THR A CB    1 
ATOM   1098 O  OG1   . THR A 1  145 ? 9.198   14.495  -18.280 1.00 19.16 ?  273  THR A OG1   1 
ATOM   1099 C  CG2   . THR A 1  145 ? 8.846   15.040  -20.584 1.00 20.42 ?  273  THR A CG2   1 
ATOM   1100 N  N     . GLN A 1  146 ? 9.005   17.830  -17.106 1.00 25.15 ?  274  GLN A N     1 
ATOM   1101 C  CA    . GLN A 1  146 ? 8.950   18.227  -15.699 1.00 23.28 ?  274  GLN A CA    1 
ATOM   1102 C  C     . GLN A 1  146 ? 8.899   17.000  -14.796 1.00 21.39 ?  274  GLN A C     1 
ATOM   1103 O  O     . GLN A 1  146 ? 9.507   16.976  -13.722 1.00 22.91 ?  274  GLN A O     1 
ATOM   1104 C  CB    . GLN A 1  146 ? 7.738   19.127  -15.450 1.00 26.08 ?  274  GLN A CB    1 
ATOM   1105 N  N     . GLN A 1  147 ? 8.178   15.972  -15.225 1.00 17.19 ?  275  GLN A N     1 
ATOM   1106 C  CA    . GLN A 1  147 ? 8.093   14.730  -14.472 1.00 16.76 ?  275  GLN A CA    1 
ATOM   1107 C  C     . GLN A 1  147 ? 9.459   14.067  -14.360 1.00 18.03 ?  275  GLN A C     1 
ATOM   1108 O  O     . GLN A 1  147 ? 9.858   13.596  -13.284 1.00 17.76 ?  275  GLN A O     1 
ATOM   1109 C  CB    . GLN A 1  147 ? 7.109   13.793  -15.154 1.00 18.38 ?  275  GLN A CB    1 
ATOM   1110 C  CG    . GLN A 1  147 ? 6.874   12.476  -14.442 1.00 20.25 ?  275  GLN A CG    1 
ATOM   1111 C  CD    . GLN A 1  147 ? 5.895   11.567  -15.192 1.00 25.25 ?  275  GLN A CD    1 
ATOM   1112 O  OE1   . GLN A 1  147 ? 6.053   11.300  -16.380 1.00 25.07 ?  275  GLN A OE1   1 
ATOM   1113 N  NE2   . GLN A 1  147 ? 4.884   11.095  -14.496 1.00 23.20 ?  275  GLN A NE2   1 
ATOM   1114 N  N     . GLN A 1  148 ? 10.179  14.001  -15.482 1.00 15.72 ?  276  GLN A N     1 
ATOM   1115 C  CA    . GLN A 1  148 ? 11.519  13.433  -15.481 1.00 14.20 ?  276  GLN A CA    1 
ATOM   1116 C  C     . GLN A 1  148 ? 12.476  14.266  -14.650 1.00 14.56 ?  276  GLN A C     1 
ATOM   1117 O  O     . GLN A 1  148 ? 13.377  13.725  -14.008 1.00 14.21 ?  276  GLN A O     1 
ATOM   1118 C  CB    . GLN A 1  148 ? 12.029  13.310  -16.917 1.00 16.55 ?  276  GLN A CB    1 
ATOM   1119 C  CG    . GLN A 1  148 ? 11.321  12.221  -17.725 1.00 14.56 ?  276  GLN A CG    1 
ATOM   1120 C  CD    . GLN A 1  148 ? 11.510  12.357  -19.226 1.00 15.50 ?  276  GLN A CD    1 
ATOM   1121 O  OE1   . GLN A 1  148 ? 12.104  13.322  -19.711 1.00 16.50 ?  276  GLN A OE1   1 
ATOM   1122 N  NE2   . GLN A 1  148 ? 10.989  11.408  -19.966 1.00 15.30 ?  276  GLN A NE2   1 
ATOM   1123 N  N     . LYS A 1  149 ? 12.320  15.590  -14.652 1.00 17.61 ?  277  LYS A N     1 
ATOM   1124 C  CA    . LYS A 1  149 ? 13.198  16.410  -13.825 1.00 18.28 ?  277  LYS A CA    1 
ATOM   1125 C  C     . LYS A 1  149 ? 13.007  16.069  -12.355 1.00 17.08 ?  277  LYS A C     1 
ATOM   1126 O  O     . LYS A 1  149 ? 13.981  15.946  -11.605 1.00 17.06 ?  277  LYS A O     1 
ATOM   1127 C  CB    . LYS A 1  149 ? 12.938  17.905  -14.085 1.00 18.51 ?  277  LYS A CB    1 
ATOM   1128 C  CG    . LYS A 1  149 ? 13.307  18.385  -15.464 1.00 24.15 ?  277  LYS A CG    1 
ATOM   1129 C  CD    . LYS A 1  149 ? 12.989  19.879  -15.629 1.00 25.72 ?  277  LYS A CD    1 
ATOM   1130 C  CE    . LYS A 1  149 ? 13.402  20.383  -17.016 1.00 28.57 ?  277  LYS A CE    1 
ATOM   1131 N  NZ    . LYS A 1  149 ? 13.149  21.838  -17.218 1.00 32.47 ?  277  LYS A NZ    1 
ATOM   1132 N  N     . ALA A 1  150 ? 11.746  15.889  -11.933 1.00 16.84 ?  278  ALA A N     1 
ATOM   1133 C  CA    . ALA A 1  150 ? 11.448  15.484  -10.563 1.00 18.06 ?  278  ALA A CA    1 
ATOM   1134 C  C     . ALA A 1  150 ? 11.997  14.096  -10.258 1.00 16.68 ?  278  ALA A C     1 
ATOM   1135 O  O     . ALA A 1  150 ? 12.584  13.868  -9.187  1.00 15.03 ?  278  ALA A O     1 
ATOM   1136 C  CB    . ALA A 1  150 ? 9.938   15.507  -10.329 1.00 17.21 ?  278  ALA A CB    1 
ATOM   1137 N  N     . GLY A 1  151 ? 11.819  13.155  -11.186 1.00 12.56 ?  279  GLY A N     1 
ATOM   1138 C  CA    . GLY A 1  151 ? 12.361  11.819  -10.991 1.00 14.04 ?  279  GLY A CA    1 
ATOM   1139 C  C     . GLY A 1  151 ? 13.870  11.820  -10.835 1.00 13.43 ?  279  GLY A C     1 
ATOM   1140 O  O     . GLY A 1  151 ? 14.413  11.080  -10.014 1.00 13.02 ?  279  GLY A O     1 
ATOM   1141 N  N     A LEU A 1  152 ? 14.553  12.683  -11.590 0.55 13.15 ?  280  LEU A N     1 
ATOM   1142 N  N     B LEU A 1  152 ? 14.565  12.639  -11.634 0.45 13.14 ?  280  LEU A N     1 
ATOM   1143 C  CA    A LEU A 1  152 ? 16.007  12.749  -11.546 0.55 13.75 ?  280  LEU A CA    1 
ATOM   1144 C  CA    B LEU A 1  152 ? 16.018  12.734  -11.520 0.45 13.74 ?  280  LEU A CA    1 
ATOM   1145 C  C     A LEU A 1  152 ? 16.499  13.472  -10.297 0.55 14.03 ?  280  LEU A C     1 
ATOM   1146 C  C     B LEU A 1  152 ? 16.421  13.399  -10.211 0.45 13.93 ?  280  LEU A C     1 
ATOM   1147 O  O     A LEU A 1  152 ? 17.506  13.067  -9.705  0.55 14.16 ?  280  LEU A O     1 
ATOM   1148 O  O     B LEU A 1  152 ? 17.301  12.901  -9.498  0.45 13.92 ?  280  LEU A O     1 
ATOM   1149 C  CB    A LEU A 1  152 ? 16.515  13.436  -12.811 0.55 14.84 ?  280  LEU A CB    1 
ATOM   1150 C  CB    B LEU A 1  152 ? 16.602  13.512  -12.702 0.45 14.89 ?  280  LEU A CB    1 
ATOM   1151 C  CG    A LEU A 1  152 ? 18.009  13.423  -13.111 0.55 15.72 ?  280  LEU A CG    1 
ATOM   1152 C  CG    B LEU A 1  152 ? 17.115  12.783  -13.949 0.45 16.10 ?  280  LEU A CG    1 
ATOM   1153 C  CD1   A LEU A 1  152 ? 18.562  12.003  -13.133 0.55 15.94 ?  280  LEU A CD1   1 
ATOM   1154 C  CD1   B LEU A 1  152 ? 17.729  13.813  -14.896 0.45 16.95 ?  280  LEU A CD1   1 
ATOM   1155 C  CD2   A LEU A 1  152 ? 18.233  14.096  -14.461 0.55 17.67 ?  280  LEU A CD2   1 
ATOM   1156 C  CD2   B LEU A 1  152 ? 18.142  11.720  -13.602 0.45 15.63 ?  280  LEU A CD2   1 
ATOM   1157 N  N     . GLN A 1  153 ? 15.804  14.536  -9.884  1.00 14.23 ?  281  GLN A N     1 
ATOM   1158 C  CA    . GLN A 1  153 ? 16.170  15.234  -8.654  1.00 15.81 ?  281  GLN A CA    1 
ATOM   1159 C  C     . GLN A 1  153 ? 16.011  14.325  -7.453  1.00 13.68 ?  281  GLN A C     1 
ATOM   1160 O  O     . GLN A 1  153 ? 16.882  14.278  -6.573  1.00 14.16 ?  281  GLN A O     1 
ATOM   1161 C  CB    . GLN A 1  153 ? 15.325  16.498  -8.482  1.00 14.92 ?  281  GLN A CB    1 
ATOM   1162 C  CG    . GLN A 1  153 ? 15.801  17.659  -9.339  1.00 17.63 ?  281  GLN A CG    1 
ATOM   1163 C  CD    . GLN A 1  153 ? 14.792  18.785  -9.434  1.00 27.42 ?  281  GLN A CD    1 
ATOM   1164 O  OE1   . GLN A 1  153 ? 15.155  19.961  -9.358  1.00 37.82 ?  281  GLN A OE1   1 
ATOM   1165 N  NE2   . GLN A 1  153 ? 13.519  18.436  -9.608  1.00 23.21 ?  281  GLN A NE2   1 
ATOM   1166 N  N     . HIS A 1  154 ? 14.926  13.555  -7.412  1.00 12.77 ?  282  HIS A N     1 
ATOM   1167 C  CA    . HIS A 1  154 ? 14.645  12.727  -6.256  1.00 12.08 ?  282  HIS A CA    1 
ATOM   1168 C  C     . HIS A 1  154 ? 15.146  11.295  -6.405  1.00 12.01 ?  282  HIS A C     1 
ATOM   1169 O  O     . HIS A 1  154 ? 14.820  10.458  -5.558  1.00 11.13 ?  282  HIS A O     1 
ATOM   1170 C  CB    . HIS A 1  154 ? 13.144  12.735  -5.983  1.00 11.50 ?  282  HIS A CB    1 
ATOM   1171 C  CG    . HIS A 1  154 ? 12.644  14.082  -5.584  1.00 11.94 ?  282  HIS A CG    1 
ATOM   1172 N  ND1   . HIS A 1  154 ? 13.055  14.695  -4.424  1.00 12.41 ?  282  HIS A ND1   1 
ATOM   1173 C  CD2   . HIS A 1  154 ? 11.817  14.950  -6.207  1.00 12.75 ?  282  HIS A CD2   1 
ATOM   1174 C  CE1   . HIS A 1  154 ? 12.460  15.871  -4.325  1.00 14.33 ?  282  HIS A CE1   1 
ATOM   1175 N  NE2   . HIS A 1  154 ? 11.713  16.054  -5.398  1.00 12.71 ?  282  HIS A NE2   1 
ATOM   1176 N  N     . HIS A 1  155 ? 15.953  11.007  -7.439  1.00 13.13 ?  283  HIS A N     1 
ATOM   1177 C  CA    . HIS A 1  155 ? 16.292  9.619   -7.762  1.00 13.24 ?  283  HIS A CA    1 
ATOM   1178 C  C     . HIS A 1  155 ? 16.945  8.893   -6.595  1.00 11.60 ?  283  HIS A C     1 
ATOM   1179 O  O     . HIS A 1  155 ? 16.644  7.719   -6.337  1.00 11.90 ?  283  HIS A O     1 
ATOM   1180 C  CB    . HIS A 1  155 ? 17.209  9.567   -8.976  1.00 13.42 ?  283  HIS A CB    1 
ATOM   1181 C  CG    . HIS A 1  155 ? 17.553  8.184   -9.411  1.00 14.87 ?  283  HIS A CG    1 
ATOM   1182 N  ND1   . HIS A 1  155 ? 18.684  7.536   -8.967  1.00 16.58 ?  283  HIS A ND1   1 
ATOM   1183 C  CD2   . HIS A 1  155 ? 16.926  7.327   -10.251 1.00 21.01 ?  283  HIS A CD2   1 
ATOM   1184 C  CE1   . HIS A 1  155 ? 18.737  6.335   -9.511  1.00 20.40 ?  283  HIS A CE1   1 
ATOM   1185 N  NE2   . HIS A 1  155 ? 17.692  6.188   -10.303 1.00 20.77 ?  283  HIS A NE2   1 
ATOM   1186 N  N     . GLN A 1  156 ? 17.856  9.555   -5.875  1.00 12.24 ?  284  GLN A N     1 
ATOM   1187 C  CA    . GLN A 1  156 ? 18.555  8.888   -4.789  1.00 14.07 ?  284  GLN A CA    1 
ATOM   1188 C  C     . GLN A 1  156 ? 17.583  8.447   -3.700  1.00 13.12 ?  284  GLN A C     1 
ATOM   1189 O  O     . GLN A 1  156 ? 17.612  7.292   -3.261  1.00 12.59 ?  284  GLN A O     1 
ATOM   1190 C  CB    . GLN A 1  156 ? 19.637  9.810   -4.219  1.00 14.29 ?  284  GLN A CB    1 
ATOM   1191 C  CG    . GLN A 1  156 ? 20.500  9.129   -3.184  1.00 17.42 ?  284  GLN A CG    1 
ATOM   1192 N  N     . ASP A 1  157 ? 16.700  9.348   -3.260  1.00 12.37 ?  285  ASP A N     1 
ATOM   1193 C  CA    . ASP A 1  157 ? 15.725  8.974   -2.235  1.00 11.43 ?  285  ASP A CA    1 
ATOM   1194 C  C     . ASP A 1  157 ? 14.788  7.880   -2.749  1.00 12.25 ?  285  ASP A C     1 
ATOM   1195 O  O     . ASP A 1  157 ? 14.444  6.950   -2.011  1.00 12.47 ?  285  ASP A O     1 
ATOM   1196 C  CB    . ASP A 1  157 ? 14.911  10.184  -1.812  1.00 13.35 ?  285  ASP A CB    1 
ATOM   1197 C  CG    . ASP A 1  157 ? 15.582  11.013  -0.713  1.00 17.80 ?  285  ASP A CG    1 
ATOM   1198 O  OD1   . ASP A 1  157 ? 16.726  10.734  -0.296  1.00 17.95 ?  285  ASP A OD1   1 
ATOM   1199 O  OD2   . ASP A 1  157 ? 14.928  11.952  -0.238  1.00 15.42 ?  285  ASP A OD2   1 
ATOM   1200 N  N     . LEU A 1  158 ? 14.341  8.001   -3.994  1.00 10.89 ?  286  LEU A N     1 
ATOM   1201 C  CA    . LEU A 1  158 ? 13.393  7.030   -4.550  1.00 11.04 ?  286  LEU A CA    1 
ATOM   1202 C  C     . LEU A 1  158 ? 14.029  5.674   -4.796  1.00 11.73 ?  286  LEU A C     1 
ATOM   1203 O  O     . LEU A 1  158 ? 13.305  4.693   -5.011  1.00 12.98 ?  286  LEU A O     1 
ATOM   1204 C  CB    . LEU A 1  158 ? 12.786  7.549   -5.832  1.00 11.16 ?  286  LEU A CB    1 
ATOM   1205 C  CG    . LEU A 1  158 ? 11.987  8.865   -5.701  1.00 13.72 ?  286  LEU A CG    1 
ATOM   1206 C  CD1   . LEU A 1  158 ? 11.287  9.186   -7.012  1.00 13.88 ?  286  LEU A CD1   1 
ATOM   1207 C  CD2   . LEU A 1  158 ? 11.036  8.891   -4.542  1.00 13.36 ?  286  LEU A CD2   1 
ATOM   1208 N  N     . SER A 1  159 ? 15.344  5.590   -4.739  1.00 12.78 ?  287  SER A N     1 
ATOM   1209 C  CA    A SER A 1  159 ? 16.028  4.310   -4.858  0.32 13.57 ?  287  SER A CA    1 
ATOM   1210 C  CA    B SER A 1  159 ? 16.054  4.321   -4.854  0.68 13.80 ?  287  SER A CA    1 
ATOM   1211 C  C     . SER A 1  159 ? 16.150  3.586   -3.526  1.00 14.12 ?  287  SER A C     1 
ATOM   1212 O  O     . SER A 1  159 ? 16.549  2.412   -3.509  1.00 17.01 ?  287  SER A O     1 
ATOM   1213 C  CB    A SER A 1  159 ? 17.424  4.515   -5.463  0.32 14.74 ?  287  SER A CB    1 
ATOM   1214 C  CB    B SER A 1  159 ? 17.476  4.555   -5.416  0.68 14.70 ?  287  SER A CB    1 
ATOM   1215 O  OG    A SER A 1  159 ? 17.326  5.012   -6.783  0.32 15.87 ?  287  SER A OG    1 
ATOM   1216 O  OG    B SER A 1  159 ? 18.400  4.940   -4.401  0.68 17.51 ?  287  SER A OG    1 
ATOM   1217 N  N     . THR A 1  160 ? 15.821  4.234   -2.417  1.00 14.84 ?  288  THR A N     1 
ATOM   1218 C  CA    A THR A 1  160 ? 15.877  3.626   -1.093  0.49 17.03 ?  288  THR A CA    1 
ATOM   1219 C  CA    B THR A 1  160 ? 15.900  3.562   -1.136  0.51 16.98 ?  288  THR A CA    1 
ATOM   1220 C  C     . THR A 1  160 ? 14.552  2.936   -0.817  1.00 16.97 ?  288  THR A C     1 
ATOM   1221 O  O     . THR A 1  160 ? 13.510  3.564   -1.021  1.00 16.88 ?  288  THR A O     1 
ATOM   1222 C  CB    A THR A 1  160 ? 16.106  4.682   -0.020  0.49 18.18 ?  288  THR A CB    1 
ATOM   1223 C  CB    B THR A 1  160 ? 16.297  4.508   -0.022  0.51 18.92 ?  288  THR A CB    1 
ATOM   1224 O  OG1   A THR A 1  160 ? 17.124  5.602   -0.438  0.49 20.53 ?  288  THR A OG1   1 
ATOM   1225 O  OG1   B THR A 1  160 ? 15.249  5.448   0.193   0.51 17.29 ?  288  THR A OG1   1 
ATOM   1226 C  CG2   A THR A 1  160 ? 16.504  4.031   1.288   0.49 20.62 ?  288  THR A CG2   1 
ATOM   1227 C  CG2   B THR A 1  160 ? 17.577  5.243   -0.370  0.51 20.43 ?  288  THR A CG2   1 
ATOM   1228 N  N     A PRO A 1  161 ? 14.542  1.704   -0.320  0.45 16.15 ?  289  PRO A N     1 
ATOM   1229 N  N     B PRO A 1  161 ? 14.523  1.682   -0.377  0.55 15.89 ?  289  PRO A N     1 
ATOM   1230 C  CA    A PRO A 1  161 ? 13.266  1.028   -0.072  0.45 16.48 ?  289  PRO A CA    1 
ATOM   1231 C  CA    B PRO A 1  161 ? 13.239  1.025   -0.126  0.55 16.65 ?  289  PRO A CA    1 
ATOM   1232 C  C     A PRO A 1  161 ? 12.400  1.779   0.933   0.45 14.78 ?  289  PRO A C     1 
ATOM   1233 C  C     B PRO A 1  161 ? 12.400  1.733   0.932   0.55 14.63 ?  289  PRO A C     1 
ATOM   1234 O  O     A PRO A 1  161 ? 12.882  2.310   1.936   0.45 15.79 ?  289  PRO A O     1 
ATOM   1235 O  O     B PRO A 1  161 ? 12.894  2.178   1.969   0.55 16.34 ?  289  PRO A O     1 
ATOM   1236 C  CB    A PRO A 1  161 ? 13.691  -0.345  0.462   0.45 16.10 ?  289  PRO A CB    1 
ATOM   1237 C  CB    B PRO A 1  161 ? 13.653  -0.377  0.325   0.55 16.49 ?  289  PRO A CB    1 
ATOM   1238 C  CG    A PRO A 1  161 ? 15.096  -0.175  0.930   0.45 16.93 ?  289  PRO A CG    1 
ATOM   1239 C  CG    B PRO A 1  161 ? 14.957  -0.613  -0.368  0.55 15.88 ?  289  PRO A CG    1 
ATOM   1240 C  CD    A PRO A 1  161 ? 15.696  0.866   0.050   0.45 17.23 ?  289  PRO A CD    1 
ATOM   1241 C  CD    B PRO A 1  161 ? 15.642  0.720   -0.344  0.55 17.78 ?  289  PRO A CD    1 
ATOM   1242 N  N     . VAL A 1  162 ? 11.103  1.827   0.644   1.00 12.55 ?  290  VAL A N     1 
ATOM   1243 C  CA    . VAL A 1  162 ? 10.120  2.250   1.622   1.00 11.28 ?  290  VAL A CA    1 
ATOM   1244 C  C     . VAL A 1  162 ? 9.912   1.112   2.601   1.00 12.14 ?  290  VAL A C     1 
ATOM   1245 O  O     . VAL A 1  162 ? 9.734   -0.032  2.190   1.00 11.77 ?  290  VAL A O     1 
ATOM   1246 C  CB    . VAL A 1  162 ? 8.778   2.592   0.944   1.00 11.81 ?  290  VAL A CB    1 
ATOM   1247 C  CG1   . VAL A 1  162 ? 7.811   3.110   1.967   1.00 14.35 ?  290  VAL A CG1   1 
ATOM   1248 C  CG2   . VAL A 1  162 ? 8.981   3.568   -0.233  1.00 13.27 ?  290  VAL A CG2   1 
ATOM   1249 N  N     . LEU A 1  163 ? 9.884   1.420   3.890   1.00 13.88 ?  291  LEU A N     1 
ATOM   1250 C  CA    . LEU A 1  163 ? 9.753   0.383   4.906   1.00 13.41 ?  291  LEU A CA    1 
ATOM   1251 C  C     . LEU A 1  163 ? 8.316   0.277   5.367   1.00 15.74 ?  291  LEU A C     1 
ATOM   1252 O  O     . LEU A 1  163 ? 7.585   1.269   5.415   1.00 14.15 ?  291  LEU A O     1 
ATOM   1253 C  CB    . LEU A 1  163 ? 10.653  0.671   6.107   1.00 16.18 ?  291  LEU A CB    1 
ATOM   1254 C  CG    . LEU A 1  163 ? 12.134  0.767   5.728   1.00 17.91 ?  291  LEU A CG    1 
ATOM   1255 C  CD1   . LEU A 1  163 ? 12.957  0.911   7.007   1.00 21.26 ?  291  LEU A CD1   1 
ATOM   1256 C  CD2   . LEU A 1  163 ? 12.639  -0.410  4.932   1.00 19.23 ?  291  LEU A CD2   1 
ATOM   1257 N  N     . ARG A 1  164 ? 7.894   -0.952  5.686   1.00 22.51 ?  292  ARG A N     1 
ATOM   1258 C  CA    . ARG A 1  164 ? 6.551   -1.122  6.233   1.00 24.58 ?  292  ARG A CA    1 
ATOM   1259 C  C     . ARG A 1  164 ? 6.370   -0.256  7.468   1.00 23.94 ?  292  ARG A C     1 
ATOM   1260 O  O     . ARG A 1  164 ? 5.260   0.207   7.750   1.00 25.05 ?  292  ARG A O     1 
ATOM   1261 C  CB    . ARG A 1  164 ? 6.282   -2.600  6.548   1.00 24.96 ?  292  ARG A CB    1 
ATOM   1262 C  CG    . ARG A 1  164 ? 4.855   -2.911  7.029   1.00 26.49 ?  292  ARG A CG    1 
ATOM   1263 C  CD    . ARG A 1  164 ? 3.800   -2.495  6.006   1.00 29.20 ?  292  ARG A CD    1 
ATOM   1264 N  NE    . ARG A 1  164 ? 2.431   -2.801  6.431   1.00 29.96 ?  292  ARG A NE    1 
ATOM   1265 C  CZ    . ARG A 1  164 ? 1.694   -2.006  7.202   1.00 30.21 ?  292  ARG A CZ    1 
ATOM   1266 N  NH1   . ARG A 1  164 ? 2.195   -0.863  7.647   1.00 31.33 ?  292  ARG A NH1   1 
ATOM   1267 N  NH2   . ARG A 1  164 ? 0.457   -2.356  7.534   1.00 30.86 ?  292  ARG A NH2   1 
ATOM   1268 N  N     . SER A 1  165 ? 7.464   0.017   8.184   1.00 30.01 ?  293  SER A N     1 
ATOM   1269 C  CA    . SER A 1  165 ? 7.421   0.937   9.313   1.00 27.99 ?  293  SER A CA    1 
ATOM   1270 C  C     . SER A 1  165 ? 7.089   2.362   8.881   1.00 31.69 ?  293  SER A C     1 
ATOM   1271 O  O     . SER A 1  165 ? 6.540   3.133   9.676   1.00 35.66 ?  293  SER A O     1 
ATOM   1272 C  CB    . SER A 1  165 ? 8.761   0.900   10.056  1.00 27.73 ?  293  SER A CB    1 
ATOM   1273 N  N     . ASP A 1  166 ? 7.426   2.740   7.640   1.00 28.19 ?  294  ASP A N     1 
ATOM   1274 C  CA    . ASP A 1  166 ? 7.085   4.068   7.126   1.00 21.95 ?  294  ASP A CA    1 
ATOM   1275 C  C     . ASP A 1  166 ? 5.606   4.200   6.781   1.00 28.52 ?  294  ASP A C     1 
ATOM   1276 O  O     . ASP A 1  166 ? 5.080   5.318   6.766   1.00 27.45 ?  294  ASP A O     1 
ATOM   1277 C  CB    . ASP A 1  166 ? 7.876   4.391   5.849   1.00 26.74 ?  294  ASP A CB    1 
ATOM   1278 C  CG    . ASP A 1  166 ? 9.375   4.462   6.068   1.00 29.72 ?  294  ASP A CG    1 
ATOM   1279 O  OD1   . ASP A 1  166 ? 9.806   4.841   7.177   1.00 30.63 ?  294  ASP A OD1   1 
ATOM   1280 O  OD2   . ASP A 1  166 ? 10.122  4.151   5.108   1.00 24.98 ?  294  ASP A OD2   1 
ATOM   1281 N  N     . VAL A 1  167 ? 4.936   3.087   6.485   1.00 22.02 ?  295  VAL A N     1 
ATOM   1282 C  CA    . VAL A 1  167 ? 3.647   3.144   5.798   1.00 17.39 ?  295  VAL A CA    1 
ATOM   1283 C  C     . VAL A 1  167 ? 2.564   3.681   6.719   1.00 16.07 ?  295  VAL A C     1 
ATOM   1284 O  O     . VAL A 1  167 ? 1.649   4.387   6.271   1.00 17.02 ?  295  VAL A O     1 
ATOM   1285 C  CB    . VAL A 1  167 ? 3.308   1.738   5.260   1.00 13.94 ?  295  VAL A CB    1 
ATOM   1286 C  CG1   . VAL A 1  167 ? 1.823   1.627   4.899   1.00 15.39 ?  295  VAL A CG1   1 
ATOM   1287 C  CG2   . VAL A 1  167 ? 4.178   1.386   4.059   1.00 15.45 ?  295  VAL A CG2   1 
ATOM   1288 N  N     . ASP A 1  168 ? 2.607   3.305   8.003   1.00 19.27 ?  296  ASP A N     1 
ATOM   1289 C  CA    . ASP A 1  168 ? 1.600   3.751   8.964   1.00 20.32 ?  296  ASP A CA    1 
ATOM   1290 C  C     . ASP A 1  168 ? 1.551   5.273   9.062   1.00 20.71 ?  296  ASP A C     1 
ATOM   1291 O  O     . ASP A 1  168 ? 0.468   5.872   9.062   1.00 19.96 ?  296  ASP A O     1 
ATOM   1292 C  CB    . ASP A 1  168 ? 1.898   3.132   10.332  1.00 26.30 ?  296  ASP A CB    1 
ATOM   1293 N  N     . ALA A 1  169 ? 2.718   5.913   9.143   1.00 27.00 ?  297  ALA A N     1 
ATOM   1294 C  CA    . ALA A 1  169 ? 2.758   7.368   9.252   1.00 27.35 ?  297  ALA A CA    1 
ATOM   1295 C  C     . ALA A 1  169 ? 2.161   8.025   8.019   1.00 23.58 ?  297  ALA A C     1 
ATOM   1296 O  O     . ALA A 1  169 ? 1.437   9.026   8.124   1.00 24.48 ?  297  ALA A O     1 
ATOM   1297 C  CB    . ALA A 1  169 ? 4.199   7.837   9.452   1.00 29.24 ?  297  ALA A CB    1 
ATOM   1298 N  N     A LEU A 1  170 ? 2.476   7.510   6.828   0.64 20.62 ?  298  LEU A N     1 
ATOM   1299 N  N     B LEU A 1  170 ? 2.415   7.438   6.852   0.36 19.98 ?  298  LEU A N     1 
ATOM   1300 C  CA    A LEU A 1  170 ? 1.911   8.093   5.618   0.64 17.23 ?  298  LEU A CA    1 
ATOM   1301 C  CA    B LEU A 1  170 ? 1.965   7.986   5.583   0.36 17.47 ?  298  LEU A CA    1 
ATOM   1302 C  C     A LEU A 1  170 ? 0.401   7.914   5.602   0.64 17.45 ?  298  LEU A C     1 
ATOM   1303 C  C     B LEU A 1  170 ? 0.470   7.783   5.382   0.36 17.24 ?  298  LEU A C     1 
ATOM   1304 O  O     A LEU A 1  170 ? -0.345  8.855   5.293   0.64 16.17 ?  298  LEU A O     1 
ATOM   1305 O  O     B LEU A 1  170 ? -0.189  8.579   4.702   0.36 17.60 ?  298  LEU A O     1 
ATOM   1306 C  CB    A LEU A 1  170 ? 2.538   7.480   4.359   0.64 17.29 ?  298  LEU A CB    1 
ATOM   1307 C  CB    B LEU A 1  170 ? 2.745   7.308   4.467   0.36 18.19 ?  298  LEU A CB    1 
ATOM   1308 C  CG    A LEU A 1  170 ? 3.956   7.957   4.002   0.64 17.04 ?  298  LEU A CG    1 
ATOM   1309 C  CG    B LEU A 1  170 ? 2.864   7.941   3.096   0.36 16.94 ?  298  LEU A CG    1 
ATOM   1310 C  CD1   A LEU A 1  170 ? 4.657   7.013   3.031   0.64 17.97 ?  298  LEU A CD1   1 
ATOM   1311 C  CD1   B LEU A 1  170 ? 3.243   9.405   3.174   0.36 18.35 ?  298  LEU A CD1   1 
ATOM   1312 C  CD2   A LEU A 1  170 ? 3.914   9.364   3.425   0.64 19.12 ?  298  LEU A CD2   1 
ATOM   1313 C  CD2   B LEU A 1  170 ? 3.929   7.164   2.360   0.36 18.14 ?  298  LEU A CD2   1 
ATOM   1314 N  N     . GLN A 1  171 ? -0.074  6.713   5.947   1.00 14.12 ?  299  GLN A N     1 
ATOM   1315 C  CA    . GLN A 1  171 ? -1.506  6.480   5.853   1.00 11.79 ?  299  GLN A CA    1 
ATOM   1316 C  C     . GLN A 1  171 ? -2.263  7.449   6.747   1.00 14.82 ?  299  GLN A C     1 
ATOM   1317 O  O     . GLN A 1  171 ? -3.345  7.928   6.378   1.00 14.67 ?  299  GLN A O     1 
ATOM   1318 C  CB    . GLN A 1  171 ? -1.841  5.035   6.207   1.00 12.63 ?  299  GLN A CB    1 
ATOM   1319 C  CG    . GLN A 1  171 ? -3.315  4.737   5.957   1.00 13.14 ?  299  GLN A CG    1 
ATOM   1320 C  CD    . GLN A 1  171 ? -3.615  3.258   5.807   1.00 18.91 ?  299  GLN A CD    1 
ATOM   1321 O  OE1   . GLN A 1  171 ? -2.714  2.432   5.728   1.00 16.20 ?  299  GLN A OE1   1 
ATOM   1322 N  NE2   . GLN A 1  171 ? -4.898  2.926   5.751   1.00 19.27 ?  299  GLN A NE2   1 
ATOM   1323 N  N     . GLN A 1  172 ? -1.685  7.792   7.901   1.00 16.61 ?  300  GLN A N     1 
ATOM   1324 C  CA    . GLN A 1  172 ? -2.347  8.725   8.803   1.00 17.43 ?  300  GLN A CA    1 
ATOM   1325 C  C     . GLN A 1  172 ? -2.468  10.114  8.187   1.00 16.89 ?  300  GLN A C     1 
ATOM   1326 O  O     . GLN A 1  172 ? -3.516  10.759  8.315   1.00 17.88 ?  300  GLN A O     1 
ATOM   1327 C  CB    . GLN A 1  172 ? -1.603  8.780   10.135  1.00 21.56 ?  300  GLN A CB    1 
ATOM   1328 C  CG    . GLN A 1  172 ? -1.861  7.567   11.015  1.00 26.72 ?  300  GLN A CG    1 
ATOM   1329 N  N     . VAL A 1  173 ? -1.419  10.598  7.512   1.00 18.97 ?  301  VAL A N     1 
ATOM   1330 C  CA    . VAL A 1  173 ? -1.528  11.942  6.950   1.00 21.30 ?  301  VAL A CA    1 
ATOM   1331 C  C     . VAL A 1  173 ? -2.463  11.942  5.746   1.00 19.42 ?  301  VAL A C     1 
ATOM   1332 O  O     . VAL A 1  173 ? -3.195  12.915  5.527   1.00 18.54 ?  301  VAL A O     1 
ATOM   1333 C  CB    . VAL A 1  173 ? -0.144  12.535  6.607   1.00 23.61 ?  301  VAL A CB    1 
ATOM   1334 C  CG1   . VAL A 1  173 ? 0.767   12.515  7.832   1.00 26.66 ?  301  VAL A CG1   1 
ATOM   1335 C  CG2   . VAL A 1  173 ? 0.496   11.823  5.439   1.00 21.88 ?  301  VAL A CG2   1 
ATOM   1336 N  N     . VAL A 1  174 ? -2.485  10.856  4.965   1.00 13.11 ?  302  VAL A N     1 
ATOM   1337 C  CA    . VAL A 1  174 ? -3.443  10.767  3.866   1.00 11.21 ?  302  VAL A CA    1 
ATOM   1338 C  C     . VAL A 1  174 ? -4.871  10.742  4.408   1.00 15.23 ?  302  VAL A C     1 
ATOM   1339 O  O     . VAL A 1  174 ? -5.752  11.450  3.903   1.00 14.06 ?  302  VAL A O     1 
ATOM   1340 C  CB    . VAL A 1  174 ? -3.132  9.546   2.984   1.00 11.41 ?  302  VAL A CB    1 
ATOM   1341 C  CG1   . VAL A 1  174 ? -4.219  9.342   1.949   1.00 12.91 ?  302  VAL A CG1   1 
ATOM   1342 C  CG2   . VAL A 1  174 ? -1.790  9.746   2.283   1.00 13.61 ?  302  VAL A CG2   1 
ATOM   1343 N  N     . GLU A 1  175 ? -5.114  9.962   5.466   1.00 13.53 ?  303  GLU A N     1 
ATOM   1344 C  CA    . GLU A 1  175 ? -6.447  9.922   6.058   1.00 14.02 ?  303  GLU A CA    1 
ATOM   1345 C  C     . GLU A 1  175 ? -6.885  11.284  6.567   1.00 14.85 ?  303  GLU A C     1 
ATOM   1346 O  O     . GLU A 1  175 ? -8.073  11.616  6.499   1.00 15.55 ?  303  GLU A O     1 
ATOM   1347 C  CB    . GLU A 1  175 ? -6.487  8.891   7.172   1.00 13.31 ?  303  GLU A CB    1 
ATOM   1348 C  CG    . GLU A 1  175 ? -6.517  7.501   6.635   1.00 14.36 ?  303  GLU A CG    1 
ATOM   1349 C  CD    . GLU A 1  175 ? -6.371  6.413   7.671   1.00 22.65 ?  303  GLU A CD    1 
ATOM   1350 O  OE1   . GLU A 1  175 ? -5.961  6.705   8.815   1.00 25.71 ?  303  GLU A OE1   1 
ATOM   1351 O  OE2   . GLU A 1  175 ? -6.670  5.240   7.342   1.00 22.01 ?  303  GLU A OE2   1 
ATOM   1352 N  N     . GLU A 1  176 ? -5.967  12.061  7.135   1.00 14.43 ?  304  GLU A N     1 
ATOM   1353 C  CA    . GLU A 1  176 ? -6.347  13.381  7.629   1.00 15.83 ?  304  GLU A CA    1 
ATOM   1354 C  C     . GLU A 1  176 ? -6.840  14.262  6.494   1.00 16.87 ?  304  GLU A C     1 
ATOM   1355 O  O     . GLU A 1  176 ? -7.898  14.887  6.600   1.00 17.60 ?  304  GLU A O     1 
ATOM   1356 C  CB    . GLU A 1  176 ? -5.171  14.035  8.353   1.00 17.97 ?  304  GLU A CB    1 
ATOM   1357 C  CG    . GLU A 1  176 ? -5.513  15.436  8.895   1.00 22.12 ?  304  GLU A CG    1 
ATOM   1358 N  N     . ALA A 1  177 ? -6.091  14.306  5.382   1.00 14.98 ?  305  ALA A N     1 
ATOM   1359 C  CA    . ALA A 1  177 ? -6.495  15.102  4.234   1.00 13.39 ?  305  ALA A CA    1 
ATOM   1360 C  C     . ALA A 1  177 ? -7.796  14.581  3.640   1.00 14.23 ?  305  ALA A C     1 
ATOM   1361 O  O     . ALA A 1  177 ? -8.660  15.366  3.231   1.00 15.10 ?  305  ALA A O     1 
ATOM   1362 C  CB    . ALA A 1  177 ? -5.387  15.098  3.182   1.00 14.56 ?  305  ALA A CB    1 
ATOM   1363 N  N     . VAL A 1  178 ? -7.934  13.254  3.558   1.00 12.12 ?  306  VAL A N     1 
ATOM   1364 C  CA    . VAL A 1  178 ? -9.134  12.646  2.985   1.00 12.15 ?  306  VAL A CA    1 
ATOM   1365 C  C     . VAL A 1  178 ? -10.350 12.975  3.835   1.00 14.37 ?  306  VAL A C     1 
ATOM   1366 O  O     . VAL A 1  178 ? -11.426 13.253  3.300   1.00 14.56 ?  306  VAL A O     1 
ATOM   1367 C  CB    . VAL A 1  178 ? -8.940  11.124  2.845   1.00 10.79 ?  306  VAL A CB    1 
ATOM   1368 C  CG1   . VAL A 1  178 ? -10.260 10.413  2.595   1.00 12.95 ?  306  VAL A CG1   1 
ATOM   1369 C  CG2   . VAL A 1  178 ? -7.997  10.793  1.712   1.00 10.26 ?  306  VAL A CG2   1 
ATOM   1370 N  N     . GLY A 1  179 ? -10.192 12.954  5.161   1.00 14.74 ?  307  GLY A N     1 
ATOM   1371 C  CA    . GLY A 1  179 ? -11.306 13.259  6.053   1.00 15.05 ?  307  GLY A CA    1 
ATOM   1372 C  C     . GLY A 1  179 ? -11.785 14.689  5.955   1.00 18.91 ?  307  GLY A C     1 
ATOM   1373 O  O     . GLY A 1  179 ? -12.981 14.952  6.121   1.00 20.90 ?  307  GLY A O     1 
ATOM   1374 N  N     . GLN A 1  180 ? -10.873 15.636  5.700   1.00 15.55 ?  308  GLN A N     1 
ATOM   1375 C  CA    . GLN A 1  180 ? -11.295 17.018  5.491   1.00 16.03 ?  308  GLN A CA    1 
ATOM   1376 C  C     . GLN A 1  180 ? -11.930 17.178  4.126   1.00 17.02 ?  308  GLN A C     1 
ATOM   1377 O  O     . GLN A 1  180 ? -12.933 17.892  3.975   1.00 21.32 ?  308  GLN A O     1 
ATOM   1378 C  CB    . GLN A 1  180 ? -10.102 17.968  5.662   1.00 18.41 ?  308  GLN A CB    1 
ATOM   1379 C  CG    . GLN A 1  180 ? -9.547  17.986  7.075   1.00 20.06 ?  308  GLN A CG    1 
ATOM   1380 C  CD    . GLN A 1  180 ? -8.256  18.773  7.209   1.00 22.35 ?  308  GLN A CD    1 
ATOM   1381 O  OE1   . GLN A 1  180 ? -7.918  19.601  6.357   1.00 25.72 ?  308  GLN A OE1   1 
ATOM   1382 N  NE2   . GLN A 1  180 ? -7.520  18.508  8.281   1.00 25.69 ?  308  GLN A NE2   1 
ATOM   1383 N  N     . ALA A 1  181 ? -11.405 16.460  3.127   1.00 15.81 ?  309  ALA A N     1 
ATOM   1384 C  CA    . ALA A 1  181 ? -11.939 16.580  1.778   1.00 15.51 ?  309  ALA A CA    1 
ATOM   1385 C  C     . ALA A 1  181 ? -13.327 15.967  1.687   1.00 14.35 ?  309  ALA A C     1 
ATOM   1386 O  O     . ALA A 1  181 ? -14.195 16.490  0.976   1.00 16.81 ?  309  ALA A O     1 
ATOM   1387 C  CB    . ALA A 1  181 ? -10.984 15.915  0.786   1.00 14.77 ?  309  ALA A CB    1 
ATOM   1388 N  N     . LEU A 1  182 ? -13.551 14.852  2.371   1.00 12.41 ?  310  LEU A N     1 
ATOM   1389 C  CA    . LEU A 1  182 ? -14.871 14.214  2.321   1.00 12.52 ?  310  LEU A CA    1 
ATOM   1390 C  C     . LEU A 1  182 ? -15.062 13.343  3.555   1.00 12.64 ?  310  LEU A C     1 
ATOM   1391 O  O     . LEU A 1  182 ? -14.603 12.192  3.608   1.00 11.94 ?  310  LEU A O     1 
ATOM   1392 C  CB    . LEU A 1  182 ? -15.038 13.398  1.043   1.00 11.75 ?  310  LEU A CB    1 
ATOM   1393 C  CG    . LEU A 1  182 ? -16.367 12.666  0.856   1.00 11.89 ?  310  LEU A CG    1 
ATOM   1394 C  CD1   . LEU A 1  182 ? -17.528 13.649  0.665   1.00 13.58 ?  310  LEU A CD1   1 
ATOM   1395 C  CD2   . LEU A 1  182 ? -16.246 11.720  -0.320  1.00 11.44 ?  310  LEU A CD2   1 
ATOM   1396 N  N     . PRO A 1  183 ? -15.687 13.861  4.600   1.00 13.61 ?  311  PRO A N     1 
ATOM   1397 C  CA    . PRO A 1  183 ? -15.908 13.050  5.794   1.00 13.91 ?  311  PRO A CA    1 
ATOM   1398 C  C     . PRO A 1  183 ? -16.591 11.731  5.465   1.00 13.43 ?  311  PRO A C     1 
ATOM   1399 O  O     . PRO A 1  183 ? -17.515 11.666  4.657   1.00 13.42 ?  311  PRO A O     1 
ATOM   1400 C  CB    . PRO A 1  183 ? -16.780 13.961  6.673   1.00 15.21 ?  311  PRO A CB    1 
ATOM   1401 C  CG    . PRO A 1  183 ? -16.333 15.373  6.261   1.00 15.54 ?  311  PRO A CG    1 
ATOM   1402 C  CD    . PRO A 1  183 ? -16.043 15.283  4.788   1.00 14.60 ?  311  PRO A CD    1 
ATOM   1403 N  N     . GLY A 1  184 ? -16.068 10.660  6.058   1.00 13.23 ?  312  GLY A N     1 
ATOM   1404 C  CA    . GLY A 1  184 ? -16.577 9.333   5.831   1.00 13.64 ?  312  GLY A CA    1 
ATOM   1405 C  C     . GLY A 1  184 ? -15.829 8.555   4.765   1.00 13.33 ?  312  GLY A C     1 
ATOM   1406 O  O     . GLY A 1  184 ? -16.018 7.333   4.668   1.00 13.45 ?  312  GLY A O     1 
ATOM   1407 N  N     . ALA A 1  185 ? -15.005 9.225   3.974   1.00 12.15 ?  313  ALA A N     1 
ATOM   1408 C  CA    . ALA A 1  185 ? -14.191 8.529   2.981   1.00 11.11 ?  313  ALA A CA    1 
ATOM   1409 C  C     . ALA A 1  185 ? -13.113 7.721   3.684   1.00 11.43 ?  313  ALA A C     1 
ATOM   1410 O  O     . ALA A 1  185 ? -12.609 8.100   4.754   1.00 14.89 ?  313  ALA A O     1 
ATOM   1411 C  CB    . ALA A 1  185 ? -13.575 9.523   2.002   1.00 11.22 ?  313  ALA A CB    1 
ATOM   1412 N  N     . THR A 1  186 ? -12.754 6.593   3.071   1.00 11.47 ?  314  THR A N     1 
ATOM   1413 C  CA    . THR A 1  186 ? -11.830 5.646   3.670   1.00 11.88 ?  314  THR A CA    1 
ATOM   1414 C  C     . THR A 1  186 ? -10.590 5.503   2.805   1.00 11.49 ?  314  THR A C     1 
ATOM   1415 O  O     . THR A 1  186 ? -10.613 5.784   1.608   1.00 11.03 ?  314  THR A O     1 
ATOM   1416 C  CB    . THR A 1  186 ? -12.467 4.282   3.853   1.00 11.76 ?  314  THR A CB    1 
ATOM   1417 O  OG1   . THR A 1  186 ? -12.887 3.747   2.599   1.00 13.00 ?  314  THR A OG1   1 
ATOM   1418 C  CG2   . THR A 1  186 ? -13.671 4.382   4.784   1.00 15.16 ?  314  THR A CG2   1 
ATOM   1419 N  N     . VAL A 1  187 ? -9.510  5.088   3.452   1.00 9.39  ?  315  VAL A N     1 
ATOM   1420 C  CA    . VAL A 1  187 ? -8.208  4.891   2.815   1.00 7.90  ?  315  VAL A CA    1 
ATOM   1421 C  C     . VAL A 1  187 ? -7.808  3.448   3.078   1.00 8.61  ?  315  VAL A C     1 
ATOM   1422 O  O     . VAL A 1  187 ? -7.718  3.030   4.244   1.00 11.51 ?  315  VAL A O     1 
ATOM   1423 C  CB    . VAL A 1  187 ? -7.140  5.852   3.358   1.00 8.09  ?  315  VAL A CB    1 
ATOM   1424 C  CG1   . VAL A 1  187 ? -5.798  5.560   2.722   1.00 9.17  ?  315  VAL A CG1   1 
ATOM   1425 C  CG2   . VAL A 1  187 ? -7.551  7.308   3.119   1.00 10.11 ?  315  VAL A CG2   1 
ATOM   1426 N  N     . THR A 1  188 ? -7.568  2.684   2.007   1.00 6.52  ?  316  THR A N     1 
ATOM   1427 C  CA    . THR A 1  188 ? -7.131  1.292   2.096   1.00 6.64  ?  316  THR A CA    1 
ATOM   1428 C  C     . THR A 1  188 ? -5.727  1.126   1.506   1.00 6.35  ?  316  THR A C     1 
ATOM   1429 O  O     . THR A 1  188 ? -5.463  1.557   0.379   1.00 6.57  ?  316  THR A O     1 
ATOM   1430 C  CB    . THR A 1  188 ? -8.124  0.382   1.362   1.00 8.13  ?  316  THR A CB    1 
ATOM   1431 O  OG1   . THR A 1  188 ? -9.423  0.557   1.955   1.00 10.86 ?  316  THR A OG1   1 
ATOM   1432 C  CG2   . THR A 1  188 ? -7.703  -1.086  1.469   1.00 10.21 ?  316  THR A CG2   1 
ATOM   1433 N  N     . LEU A 1  189 ? -4.834  0.483   2.265   1.00 7.35  ?  317  LEU A N     1 
ATOM   1434 C  CA    . LEU A 1  189 ? -3.513  0.136   1.756   1.00 5.73  ?  317  LEU A CA    1 
ATOM   1435 C  C     . LEU A 1  189 ? -3.622  -0.975  0.713   1.00 6.56  ?  317  LEU A C     1 
ATOM   1436 O  O     . LEU A 1  189 ? -4.250  -2.022  0.967   1.00 8.24  ?  317  LEU A O     1 
ATOM   1437 C  CB    . LEU A 1  189 ? -2.635  -0.295  2.923   1.00 7.36  ?  317  LEU A CB    1 
ATOM   1438 C  CG    . LEU A 1  189 ? -1.222  -0.713  2.578   1.00 7.76  ?  317  LEU A CG    1 
ATOM   1439 C  CD1   . LEU A 1  189 ? -0.412  0.442   1.989   1.00 8.17  ?  317  LEU A CD1   1 
ATOM   1440 C  CD2   . LEU A 1  189 ? -0.576  -1.250  3.867   1.00 10.40 ?  317  LEU A CD2   1 
ATOM   1441 N  N     A THR A 1  190 ? -3.044  -0.749  -0.468  0.44 5.10  ?  318  THR A N     1 
ATOM   1442 N  N     B THR A 1  190 ? -3.033  -0.764  -0.457  0.56 5.46  ?  318  THR A N     1 
ATOM   1443 C  CA    A THR A 1  190 ? -3.056  -1.776  -1.506  0.44 4.46  ?  318  THR A CA    1 
ATOM   1444 C  CA    B THR A 1  190 ? -3.061  -1.779  -1.505  0.56 4.46  ?  318  THR A CA    1 
ATOM   1445 C  C     A THR A 1  190 ? -1.633  -2.088  -1.947  0.44 4.77  ?  318  THR A C     1 
ATOM   1446 C  C     B THR A 1  190 ? -1.623  -1.978  -1.984  0.56 4.96  ?  318  THR A C     1 
ATOM   1447 O  O     A THR A 1  190 ? -0.710  -2.011  -1.128  0.44 4.98  ?  318  THR A O     1 
ATOM   1448 O  O     B THR A 1  190 ? -0.665  -1.733  -1.242  0.56 6.20  ?  318  THR A O     1 
ATOM   1449 C  CB    A THR A 1  190 ? -3.944  -1.364  -2.681  0.44 5.64  ?  318  THR A CB    1 
ATOM   1450 C  CB    B THR A 1  190 ? -4.113  -1.400  -2.558  0.56 4.98  ?  318  THR A CB    1 
ATOM   1451 O  OG1   A THR A 1  190 ? -3.373  -0.244  -3.385  0.44 7.13  ?  318  THR A OG1   1 
ATOM   1452 O  OG1   B THR A 1  190 ? -4.223  -2.435  -3.533  0.56 4.94  ?  318  THR A OG1   1 
ATOM   1453 C  CG2   A THR A 1  190 ? -5.329  -0.995  -2.187  0.44 5.10  ?  318  THR A CG2   1 
ATOM   1454 C  CG2   B THR A 1  190 ? -3.789  -0.079  -3.264  0.56 7.41  ?  318  THR A CG2   1 
ATOM   1455 N  N     . GLY A 1  191 ? -1.450  -2.485  -3.205  1.00 5.06  ?  319  GLY A N     1 
ATOM   1456 C  CA    . GLY A 1  191 ? -0.133  -2.811  -3.725  1.00 5.04  ?  319  GLY A CA    1 
ATOM   1457 C  C     . GLY A 1  191 ? 0.625   -3.849  -2.915  1.00 4.80  ?  319  GLY A C     1 
ATOM   1458 O  O     . GLY A 1  191 ? 0.064   -4.678  -2.189  1.00 5.19  ?  319  GLY A O     1 
ATOM   1459 N  N     . GLY A 1  192 ? 1.953   -3.773  -3.020  1.00 4.26  ?  320  GLY A N     1 
ATOM   1460 C  CA    . GLY A 1  192 ? 2.797   -4.814  -2.468  1.00 4.45  ?  320  GLY A CA    1 
ATOM   1461 C  C     . GLY A 1  192 ? 2.701   -4.956  -0.972  1.00 4.73  ?  320  GLY A C     1 
ATOM   1462 O  O     . GLY A 1  192 ? 2.822   -6.070  -0.448  1.00 5.68  ?  320  GLY A O     1 
ATOM   1463 N  N     . PHE A 1  193 ? 2.483   -3.843  -0.254  1.00 5.37  ?  321  PHE A N     1 
ATOM   1464 C  CA    . PHE A 1  193 ? 2.385   -3.959  1.196   1.00 6.78  ?  321  PHE A CA    1 
ATOM   1465 C  C     . PHE A 1  193 ? 1.158   -4.771  1.597   1.00 6.92  ?  321  PHE A C     1 
ATOM   1466 O  O     . PHE A 1  193 ? 1.205   -5.527  2.577   1.00 8.04  ?  321  PHE A O     1 
ATOM   1467 C  CB    . PHE A 1  193 ? 2.417   -2.565  1.833   1.00 5.77  ?  321  PHE A CB    1 
ATOM   1468 C  CG    . PHE A 1  193 ? 3.803   -1.938  1.832   1.00 6.57  ?  321  PHE A CG    1 
ATOM   1469 C  CD1   . PHE A 1  193 ? 4.818   -2.428  2.654   1.00 7.47  ?  321  PHE A CD1   1 
ATOM   1470 C  CD2   . PHE A 1  193 ? 4.095   -0.862  1.027   1.00 6.93  ?  321  PHE A CD2   1 
ATOM   1471 C  CE1   . PHE A 1  193 ? 6.063   -1.849  2.661   1.00 9.34  ?  321  PHE A CE1   1 
ATOM   1472 C  CE2   . PHE A 1  193 ? 5.351   -0.286  1.018   1.00 7.10  ?  321  PHE A CE2   1 
ATOM   1473 C  CZ    . PHE A 1  193 ? 6.329   -0.779  1.836   1.00 8.95  ?  321  PHE A CZ    1 
ATOM   1474 N  N     . ARG A 1  194 ? 0.065   -4.670  0.838   1.00 5.83  ?  322  ARG A N     1 
ATOM   1475 C  CA    . ARG A 1  194 ? -1.093  -5.495  1.167   1.00 5.56  ?  322  ARG A CA    1 
ATOM   1476 C  C     . ARG A 1  194 ? -0.812  -6.979  0.927   1.00 6.80  ?  322  ARG A C     1 
ATOM   1477 O  O     . ARG A 1  194 ? -1.423  -7.837  1.579   1.00 7.64  ?  322  ARG A O     1 
ATOM   1478 C  CB    . ARG A 1  194 ? -2.323  -5.041  0.377   1.00 5.82  ?  322  ARG A CB    1 
ATOM   1479 C  CG    . ARG A 1  194 ? -3.582  -5.834  0.751   1.00 6.13  ?  322  ARG A CG    1 
ATOM   1480 C  CD    . ARG A 1  194 ? -4.851  -5.254  0.136   1.00 5.93  ?  322  ARG A CD    1 
ATOM   1481 N  NE    . ARG A 1  194 ? -6.001  -6.040  0.594   1.00 7.63  ?  322  ARG A NE    1 
ATOM   1482 C  CZ    . ARG A 1  194 ? -6.759  -6.809  -0.183  1.00 8.24  ?  322  ARG A CZ    1 
ATOM   1483 N  NH1   . ARG A 1  194 ? -6.545  -6.884  -1.486  1.00 7.12  ?  322  ARG A NH1   1 
ATOM   1484 N  NH2   . ARG A 1  194 ? -7.751  -7.503  0.357   1.00 9.36  ?  322  ARG A NH2   1 
ATOM   1485 N  N     . ARG A 1  195 ? 0.111   -7.301  0.022   1.00 6.20  ?  323  ARG A N     1 
ATOM   1486 C  CA    . ARG A 1  195 ? 0.514   -8.689  -0.201  1.00 6.89  ?  323  ARG A CA    1 
ATOM   1487 C  C     . ARG A 1  195 ? 1.526   -9.193  0.821   1.00 8.76  ?  323  ARG A C     1 
ATOM   1488 O  O     . ARG A 1  195 ? 1.998   -10.326 0.685   1.00 9.25  ?  323  ARG A O     1 
ATOM   1489 C  CB    . ARG A 1  195 ? 1.097   -8.851  -1.608  1.00 5.57  ?  323  ARG A CB    1 
ATOM   1490 C  CG    . ARG A 1  195 ? 0.159   -8.397  -2.732  1.00 5.73  ?  323  ARG A CG    1 
ATOM   1491 C  CD    . ARG A 1  195 ? 0.594   -8.980  -4.089  1.00 5.72  ?  323  ARG A CD    1 
ATOM   1492 N  NE    . ARG A 1  195 ? 1.997   -8.688  -4.377  1.00 6.14  ?  323  ARG A NE    1 
ATOM   1493 C  CZ    . ARG A 1  195 ? 2.431   -7.547  -4.908  1.00 5.24  ?  323  ARG A CZ    1 
ATOM   1494 N  NH1   . ARG A 1  195 ? 1.565   -6.590  -5.237  1.00 5.41  ?  323  ARG A NH1   1 
ATOM   1495 N  NH2   . ARG A 1  195 ? 3.728   -7.363  -5.125  1.00 6.83  ?  323  ARG A NH2   1 
ATOM   1496 N  N     . GLY A 1  196 ? 1.883   -8.387  1.818   1.00 7.67  ?  324  GLY A N     1 
ATOM   1497 C  CA    . GLY A 1  196 ? 2.790   -8.807  2.863   1.00 7.86  ?  324  GLY A CA    1 
ATOM   1498 C  C     . GLY A 1  196 ? 4.228   -8.374  2.699   1.00 8.58  ?  324  GLY A C     1 
ATOM   1499 O  O     . GLY A 1  196 ? 5.061   -8.744  3.540   1.00 10.01 ?  324  GLY A O     1 
ATOM   1500 N  N     . LYS A 1  197 ? 4.555   -7.605  1.661   1.00 7.99  ?  325  LYS A N     1 
ATOM   1501 C  CA    . LYS A 1  197 ? 5.936   -7.163  1.505   1.00 8.30  ?  325  LYS A CA    1 
ATOM   1502 C  C     . LYS A 1  197 ? 6.371   -6.322  2.697   1.00 9.60  ?  325  LYS A C     1 
ATOM   1503 O  O     . LYS A 1  197 ? 5.590   -5.563  3.275   1.00 10.40 ?  325  LYS A O     1 
ATOM   1504 C  CB    . LYS A 1  197 ? 6.146   -6.377  0.210   1.00 8.95  ?  325  LYS A CB    1 
ATOM   1505 C  CG    . LYS A 1  197 ? 5.967   -7.174  -1.052  1.00 8.65  ?  325  LYS A CG    1 
ATOM   1506 C  CD    . LYS A 1  197 ? 6.226   -6.350  -2.368  1.00 10.06 ?  325  LYS A CD    1 
ATOM   1507 C  CE    . LYS A 1  197 ? 7.689   -6.056  -2.575  1.00 11.56 ?  325  LYS A CE    1 
ATOM   1508 N  NZ    . LYS A 1  197 ? 7.953   -5.320  -3.844  1.00 16.09 ?  325  LYS A NZ    1 
ATOM   1509 N  N     . LEU A 1  198 ? 7.650   -6.448  3.042   1.00 10.85 ?  326  LEU A N     1 
ATOM   1510 C  CA    . LEU A 1  198 ? 8.221   -5.644  4.118   1.00 12.42 ?  326  LEU A CA    1 
ATOM   1511 C  C     . LEU A 1  198 ? 8.863   -4.357  3.615   1.00 12.90 ?  326  LEU A C     1 
ATOM   1512 O  O     . LEU A 1  198 ? 9.182   -3.476  4.430   1.00 13.65 ?  326  LEU A O     1 
ATOM   1513 C  CB    . LEU A 1  198 ? 9.270   -6.461  4.877   1.00 15.26 ?  326  LEU A CB    1 
ATOM   1514 C  CG    . LEU A 1  198 ? 8.717   -7.742  5.501   1.00 19.21 ?  326  LEU A CG    1 
ATOM   1515 C  CD1   . LEU A 1  198 ? 9.796   -8.387  6.338   1.00 24.42 ?  326  LEU A CD1   1 
ATOM   1516 C  CD2   . LEU A 1  198 ? 7.488   -7.489  6.334   1.00 19.09 ?  326  LEU A CD2   1 
ATOM   1517 N  N     . GLN A 1  199 ? 9.073   -4.242  2.311   1.00 12.84 ?  327  GLN A N     1 
ATOM   1518 C  CA    . GLN A 1  199 ? 9.635   -3.054  1.691   1.00 12.77 ?  327  GLN A CA    1 
ATOM   1519 C  C     . GLN A 1  199 ? 8.890   -2.822  0.384   1.00 13.86 ?  327  GLN A C     1 
ATOM   1520 O  O     . GLN A 1  199 ? 8.199   -3.710  -0.127  1.00 14.08 ?  327  GLN A O     1 
ATOM   1521 C  CB    . GLN A 1  199 ? 11.129  -3.202  1.380   1.00 16.88 ?  327  GLN A CB    1 
ATOM   1522 C  CG    . GLN A 1  199 ? 12.070  -3.458  2.540   1.00 22.70 ?  327  GLN A CG    1 
ATOM   1523 C  CD    . GLN A 1  199 ? 13.533  -3.590  2.064   1.00 23.63 ?  327  GLN A CD    1 
ATOM   1524 O  OE1   . GLN A 1  199 ? 13.798  -3.842  0.880   1.00 24.14 ?  327  GLN A OE1   1 
ATOM   1525 N  NE2   . GLN A 1  199 ? 14.477  -3.413  2.984   1.00 29.73 ?  327  GLN A NE2   1 
ATOM   1526 N  N     . GLY A 1  200 ? 9.076   -1.642  -0.187  1.00 11.42 ?  328  GLY A N     1 
ATOM   1527 C  CA    . GLY A 1  200 ? 8.430   -1.344  -1.446  1.00 9.93  ?  328  GLY A CA    1 
ATOM   1528 C  C     . GLY A 1  200 ? 9.095   -0.184  -2.145  1.00 10.31 ?  328  GLY A C     1 
ATOM   1529 O  O     . GLY A 1  200 ? 9.899   0.542   -1.557  1.00 10.88 ?  328  GLY A O     1 
ATOM   1530 N  N     . HIS A 1  201 ? 8.780   -0.034  -3.433  1.00 8.21  ?  329  HIS A N     1 
ATOM   1531 C  CA    . HIS A 1  201 ? 9.244   1.116   -4.186  1.00 8.08  ?  329  HIS A CA    1 
ATOM   1532 C  C     . HIS A 1  201 ? 8.353   2.330   -3.983  1.00 8.22  ?  329  HIS A C     1 
ATOM   1533 O  O     . HIS A 1  201 ? 8.778   3.466   -4.267  1.00 9.06  ?  329  HIS A O     1 
ATOM   1534 C  CB    . HIS A 1  201 ? 9.394   0.751   -5.676  1.00 8.74  ?  329  HIS A CB    1 
ATOM   1535 C  CG    . HIS A 1  201 ? 8.388   1.357   -6.598  0.85 9.73  ?  329  HIS A CG    1 
ATOM   1536 N  ND1   . HIS A 1  201 ? 7.089   0.902   -6.729  0.49 7.24  ?  329  HIS A ND1   1 
ATOM   1537 C  CD2   . HIS A 1  201 ? 8.511   2.379   -7.482  0.72 10.12 ?  329  HIS A CD2   1 
ATOM   1538 C  CE1   . HIS A 1  201 ? 6.452   1.632   -7.621  0.89 9.24  ?  329  HIS A CE1   1 
ATOM   1539 N  NE2   . HIS A 1  201 ? 7.301   2.519   -8.117  0.68 10.58 ?  329  HIS A NE2   1 
ATOM   1540 N  N     . ASP A 1  202 ? 7.155   2.118   -3.451  1.00 6.88  ?  330  ASP A N     1 
ATOM   1541 C  CA    . ASP A 1  202 ? 6.188   3.183   -3.239  1.00 6.62  ?  330  ASP A CA    1 
ATOM   1542 C  C     . ASP A 1  202 ? 5.174   2.676   -2.220  1.00 5.48  ?  330  ASP A C     1 
ATOM   1543 O  O     . ASP A 1  202 ? 5.274   1.552   -1.714  1.00 6.54  ?  330  ASP A O     1 
ATOM   1544 C  CB    . ASP A 1  202 ? 5.539   3.632   -4.571  1.00 6.48  ?  330  ASP A CB    1 
ATOM   1545 C  CG    . ASP A 1  202 ? 4.549   2.631   -5.138  1.00 7.93  ?  330  ASP A CG    1 
ATOM   1546 O  OD1   . ASP A 1  202 ? 4.391   1.529   -4.565  1.00 5.88  ?  330  ASP A OD1   1 
ATOM   1547 O  OD2   . ASP A 1  202 ? 3.935   2.949   -6.175  1.00 7.05  ?  330  ASP A OD2   1 
ATOM   1548 N  N     . VAL A 1  203 ? 4.203   3.529   -1.897  1.00 5.97  ?  331  VAL A N     1 
ATOM   1549 C  CA    . VAL A 1  203 ? 3.020   3.128   -1.147  1.00 5.38  ?  331  VAL A CA    1 
ATOM   1550 C  C     . VAL A 1  203 ? 1.805   3.400   -2.024  1.00 6.06  ?  331  VAL A C     1 
ATOM   1551 O  O     . VAL A 1  203 ? 1.667   4.503   -2.556  1.00 6.42  ?  331  VAL A O     1 
ATOM   1552 C  CB    . VAL A 1  203 ? 2.903   3.873   0.193   1.00 7.38  ?  331  VAL A CB    1 
ATOM   1553 C  CG1   . VAL A 1  203 ? 1.822   3.241   1.053   1.00 8.05  ?  331  VAL A CG1   1 
ATOM   1554 C  CG2   . VAL A 1  203 ? 4.256   3.846   0.913   1.00 8.85  ?  331  VAL A CG2   1 
ATOM   1555 N  N     . ASP A 1  204 ? 0.916   2.413   -2.136  1.00 5.34  ?  332  ASP A N     1 
ATOM   1556 C  CA    . ASP A 1  204 ? -0.295  2.485   -2.945  1.00 4.67  ?  332  ASP A CA    1 
ATOM   1557 C  C     . ASP A 1  204 ? -1.530  2.503   -2.056  1.00 5.70  ?  332  ASP A C     1 
ATOM   1558 O  O     . ASP A 1  204 ? -1.710  1.606   -1.229  1.00 5.51  ?  332  ASP A O     1 
ATOM   1559 C  CB    . ASP A 1  204 ? -0.386  1.282   -3.903  1.00 5.28  ?  332  ASP A CB    1 
ATOM   1560 C  CG    . ASP A 1  204 ? 0.888   1.112   -4.716  1.00 6.12  ?  332  ASP A CG    1 
ATOM   1561 O  OD1   . ASP A 1  204 ? 1.072   1.893   -5.690  1.00 5.98  ?  332  ASP A OD1   1 
ATOM   1562 O  OD2   . ASP A 1  204 ? 1.723   0.211   -4.394  1.00 5.27  ?  332  ASP A OD2   1 
ATOM   1563 N  N     . PHE A 1  205 ? -2.387  3.501   -2.253  1.00 5.22  ?  333  PHE A N     1 
ATOM   1564 C  CA    . PHE A 1  205 ? -3.629  3.642   -1.503  1.00 5.43  ?  333  PHE A CA    1 
ATOM   1565 C  C     . PHE A 1  205 ? -4.845  3.728   -2.415  1.00 7.42  ?  333  PHE A C     1 
ATOM   1566 O  O     . PHE A 1  205 ? -4.801  4.305   -3.515  1.00 8.20  ?  333  PHE A O     1 
ATOM   1567 C  CB    . PHE A 1  205 ? -3.632  4.896   -0.620  1.00 7.60  ?  333  PHE A CB    1 
ATOM   1568 C  CG    . PHE A 1  205 ? -2.596  4.909   0.472   1.00 7.47  ?  333  PHE A CG    1 
ATOM   1569 C  CD1   . PHE A 1  205 ? -2.698  4.059   1.561   1.00 6.56  ?  333  PHE A CD1   1 
ATOM   1570 C  CD2   . PHE A 1  205 ? -1.557  5.825   0.447   1.00 8.04  ?  333  PHE A CD2   1 
ATOM   1571 C  CE1   . PHE A 1  205 ? -1.802  4.093   2.596   1.00 7.27  ?  333  PHE A CE1   1 
ATOM   1572 C  CE2   . PHE A 1  205 ? -0.614  5.848   1.493   1.00 8.23  ?  333  PHE A CE2   1 
ATOM   1573 C  CZ    . PHE A 1  205 ? -0.757  4.979   2.574   1.00 8.09  ?  333  PHE A CZ    1 
ATOM   1574 N  N     . LEU A 1  206 ? -5.960  3.169   -1.926  1.00 5.48  ?  334  LEU A N     1 
ATOM   1575 C  CA    . LEU A 1  206 ? -7.237  3.167   -2.620  1.00 5.81  ?  334  LEU A CA    1 
ATOM   1576 C  C     . LEU A 1  206 ? -8.263  3.854   -1.727  1.00 6.67  ?  334  LEU A C     1 
ATOM   1577 O  O     . LEU A 1  206 ? -8.425  3.469   -0.560  1.00 7.22  ?  334  LEU A O     1 
ATOM   1578 C  CB    . LEU A 1  206 ? -7.684  1.757   -2.932  1.00 6.26  ?  334  LEU A CB    1 
ATOM   1579 C  CG    . LEU A 1  206 ? -9.056  1.596   -3.556  1.00 6.80  ?  334  LEU A CG    1 
ATOM   1580 C  CD1   . LEU A 1  206 ? -9.222  2.255   -4.906  1.00 8.07  ?  334  LEU A CD1   1 
ATOM   1581 C  CD2   . LEU A 1  206 ? -9.326  0.059   -3.721  1.00 8.99  ?  334  LEU A CD2   1 
ATOM   1582 N  N     . ILE A 1  207 ? -8.950  4.845   -2.273  1.00 6.05  ?  335  ILE A N     1 
ATOM   1583 C  CA    . ILE A 1  207 ? -9.860  5.718   -1.535  1.00 6.60  ?  335  ILE A CA    1 
ATOM   1584 C  C     . ILE A 1  207 ? -11.274 5.522   -2.074  1.00 7.78  ?  335  ILE A C     1 
ATOM   1585 O  O     . ILE A 1  207 ? -11.471 5.457   -3.291  1.00 6.99  ?  335  ILE A O     1 
ATOM   1586 C  CB    . ILE A 1  207 ? -9.403  7.193   -1.678  1.00 7.13  ?  335  ILE A CB    1 
ATOM   1587 C  CG1   . ILE A 1  207 ? -8.004  7.393   -1.083  1.00 7.75  ?  335  ILE A CG1   1 
ATOM   1588 C  CG2   . ILE A 1  207 ? -10.396 8.140   -1.015  1.00 9.01  ?  335  ILE A CG2   1 
ATOM   1589 C  CD1   . ILE A 1  207 ? -7.340  8.699   -1.516  1.00 8.85  ?  335  ILE A CD1   1 
ATOM   1590 N  N     . THR A 1  208 ? -12.269 5.428   -1.174  1.00 7.89  ?  336  THR A N     1 
ATOM   1591 C  CA    . THR A 1  208 ? -13.662 5.327   -1.602  1.00 8.56  ?  336  THR A CA    1 
ATOM   1592 C  C     . THR A 1  208 ? -14.526 5.988   -0.523  1.00 8.74  ?  336  THR A C     1 
ATOM   1593 O  O     . THR A 1  208 ? -14.022 6.500   0.482   1.00 9.46  ?  336  THR A O     1 
ATOM   1594 C  CB    . THR A 1  208 ? -14.082 3.878   -1.874  1.00 9.36  ?  336  THR A CB    1 
ATOM   1595 O  OG1   . THR A 1  208 ? -15.349 3.849   -2.558  1.00 10.84 ?  336  THR A OG1   1 
ATOM   1596 C  CG2   . THR A 1  208 ? -14.152 3.086   -0.587  1.00 10.77 ?  336  THR A CG2   1 
ATOM   1597 N  N     . HIS A 1  209 ? -15.840 5.930   -0.715  1.00 9.44  ?  337  HIS A N     1 
ATOM   1598 C  CA    . HIS A 1  209 ? -16.787 6.458   0.266   1.00 10.17 ?  337  HIS A CA    1 
ATOM   1599 C  C     . HIS A 1  209 ? -17.977 5.514   0.236   1.00 12.02 ?  337  HIS A C     1 
ATOM   1600 O  O     . HIS A 1  209 ? -18.344 5.045   -0.840  1.00 12.20 ?  337  HIS A O     1 
ATOM   1601 C  CB    . HIS A 1  209 ? -17.224 7.888   -0.078  1.00 10.77 ?  337  HIS A CB    1 
ATOM   1602 C  CG    . HIS A 1  209 ? -18.069 8.519   0.982   1.00 12.30 ?  337  HIS A CG    1 
ATOM   1603 N  ND1   . HIS A 1  209 ? -19.408 8.227   1.123   1.00 13.93 ?  337  HIS A ND1   1 
ATOM   1604 C  CD2   . HIS A 1  209 ? -17.775 9.426   1.940   1.00 11.77 ?  337  HIS A CD2   1 
ATOM   1605 C  CE1   . HIS A 1  209 ? -19.898 8.913   2.141   1.00 15.30 ?  337  HIS A CE1   1 
ATOM   1606 N  NE2   . HIS A 1  209 ? -18.931 9.656   2.649   1.00 14.26 ?  337  HIS A NE2   1 
ATOM   1607 N  N     . PRO A 1  210 ? -18.616 5.233   1.384   1.00 14.15 ?  338  PRO A N     1 
ATOM   1608 C  CA    . PRO A 1  210 ? -19.680 4.209   1.388   1.00 16.14 ?  338  PRO A CA    1 
ATOM   1609 C  C     . PRO A 1  210 ? -20.933 4.594   0.622   1.00 17.67 ?  338  PRO A C     1 
ATOM   1610 O  O     . PRO A 1  210 ? -21.725 3.700   0.286   1.00 18.97 ?  338  PRO A O     1 
ATOM   1611 C  CB    . PRO A 1  210 ? -19.980 4.014   2.881   1.00 17.83 ?  338  PRO A CB    1 
ATOM   1612 C  CG    . PRO A 1  210 ? -19.415 5.213   3.555   1.00 17.65 ?  338  PRO A CG    1 
ATOM   1613 C  CD    . PRO A 1  210 ? -18.238 5.653   2.736   1.00 14.70 ?  338  PRO A CD    1 
ATOM   1614 N  N     A LYS A 1  211 ? -21.160 5.877   0.351   0.74 13.93 ?  339  LYS A N     1 
ATOM   1615 N  N     B LYS A 1  211 ? -21.145 5.869   0.332   0.26 15.01 ?  339  LYS A N     1 
ATOM   1616 C  CA    A LYS A 1  211 ? -22.336 6.335   -0.390  0.74 16.63 ?  339  LYS A CA    1 
ATOM   1617 C  CA    B LYS A 1  211 ? -22.325 6.321   -0.396  0.26 16.82 ?  339  LYS A CA    1 
ATOM   1618 C  C     A LYS A 1  211 ? -21.948 6.543   -1.851  0.74 18.25 ?  339  LYS A C     1 
ATOM   1619 C  C     B LYS A 1  211 ? -21.943 6.537   -1.854  0.26 17.51 ?  339  LYS A C     1 
ATOM   1620 O  O     A LYS A 1  211 ? -21.183 7.460   -2.179  0.74 16.26 ?  339  LYS A O     1 
ATOM   1621 O  O     B LYS A 1  211 ? -21.174 7.451   -2.177  0.26 16.67 ?  339  LYS A O     1 
ATOM   1622 C  CB    A LYS A 1  211 ? -22.900 7.620   0.215   0.74 19.29 ?  339  LYS A CB    1 
ATOM   1623 C  CB    B LYS A 1  211 ? -22.885 7.593   0.230   0.26 18.21 ?  339  LYS A CB    1 
ATOM   1624 C  CG    A LYS A 1  211 ? -24.108 8.181   -0.538  0.74 20.02 ?  339  LYS A CG    1 
ATOM   1625 C  CG    B LYS A 1  211 ? -23.392 7.366   1.630   0.26 16.44 ?  339  LYS A CG    1 
ATOM   1626 N  N     . GLU A 1  212 ? -22.478 5.689   -2.729  1.00 17.53 ?  340  GLU A N     1 
ATOM   1627 C  CA    . GLU A 1  212 ? -22.174 5.773   -4.147  1.00 16.14 ?  340  GLU A CA    1 
ATOM   1628 C  C     . GLU A 1  212 ? -22.379 7.183   -4.684  1.00 18.41 ?  340  GLU A C     1 
ATOM   1629 O  O     . GLU A 1  212 ? -23.433 7.803   -4.484  1.00 19.76 ?  340  GLU A O     1 
ATOM   1630 C  CB    . GLU A 1  212 ? -23.045 4.780   -4.929  1.00 18.25 ?  340  GLU A CB    1 
ATOM   1631 C  CG    . GLU A 1  212 ? -22.738 4.713   -6.416  1.00 18.67 ?  340  GLU A CG    1 
ATOM   1632 C  CD    . GLU A 1  212 ? -21.621 3.747   -6.761  1.00 21.44 ?  340  GLU A CD    1 
ATOM   1633 O  OE1   . GLU A 1  212 ? -21.128 3.093   -5.839  1.00 21.62 ?  340  GLU A OE1   1 
ATOM   1634 O  OE2   . GLU A 1  212 ? -21.269 3.646   -7.953  1.00 21.81 ?  340  GLU A OE2   1 
ATOM   1635 N  N     . GLY A 1  213 ? -21.373 7.678   -5.384  1.00 17.41 ?  341  GLY A N     1 
ATOM   1636 C  CA    . GLY A 1  213 ? -21.406 8.967   -6.018  1.00 17.94 ?  341  GLY A CA    1 
ATOM   1637 C  C     . GLY A 1  213 ? -20.712 10.068  -5.239  1.00 16.89 ?  341  GLY A C     1 
ATOM   1638 O  O     . GLY A 1  213 ? -20.309 11.069  -5.835  1.00 17.04 ?  341  GLY A O     1 
ATOM   1639 N  N     . GLN A 1  214 ? -20.558 9.897   -3.934  1.00 13.74 ?  342  GLN A N     1 
ATOM   1640 C  CA    . GLN A 1  214 ? -19.939 10.921  -3.115  1.00 13.68 ?  342  GLN A CA    1 
ATOM   1641 C  C     . GLN A 1  214 ? -18.463 11.070  -3.445  1.00 13.37 ?  342  GLN A C     1 
ATOM   1642 O  O     . GLN A 1  214 ? -17.887 12.131  -3.211  1.00 14.34 ?  342  GLN A O     1 
ATOM   1643 C  CB    . GLN A 1  214 ? -20.139 10.595  -1.636  1.00 14.45 ?  342  GLN A CB    1 
ATOM   1644 C  CG    . GLN A 1  214 ? -21.548 10.825  -1.104  1.00 15.66 ?  342  GLN A CG    1 
ATOM   1645 C  CD    . GLN A 1  214 ? -21.986 12.271  -1.273  1.00 19.86 ?  342  GLN A CD    1 
ATOM   1646 O  OE1   . GLN A 1  214 ? -21.457 13.172  -0.617  1.00 18.63 ?  342  GLN A OE1   1 
ATOM   1647 N  NE2   . GLN A 1  214 ? -22.909 12.502  -2.193  1.00 18.06 ?  342  GLN A NE2   1 
ATOM   1648 N  N     . GLU A 1  215 ? -17.854 10.025  -3.996  1.00 14.64 ?  343  GLU A N     1 
ATOM   1649 C  CA    . GLU A 1  215 ? -16.430 10.074  -4.303  1.00 13.34 ?  343  GLU A CA    1 
ATOM   1650 C  C     . GLU A 1  215 ? -16.114 10.913  -5.532  1.00 12.80 ?  343  GLU A C     1 
ATOM   1651 O  O     . GLU A 1  215 ? -14.937 11.209  -5.757  1.00 13.21 ?  343  GLU A O     1 
ATOM   1652 C  CB    . GLU A 1  215 ? -15.897 8.635   -4.486  1.00 14.71 ?  343  GLU A CB    1 
ATOM   1653 C  CG    . GLU A 1  215 ? -16.133 8.024   -5.842  1.00 16.59 ?  343  GLU A CG    1 
ATOM   1654 C  CD    . GLU A 1  215 ? -17.596 7.871   -6.221  1.00 17.91 ?  343  GLU A CD    1 
ATOM   1655 O  OE1   . GLU A 1  215 ? -18.465 7.719   -5.329  1.00 15.70 ?  343  GLU A OE1   1 
ATOM   1656 O  OE2   . GLU A 1  215 ? -17.876 7.915   -7.425  1.00 21.11 ?  343  GLU A OE2   1 
ATOM   1657 N  N     . ALA A 1  216 ? -17.112 11.312  -6.325  1.00 12.97 ?  344  ALA A N     1 
ATOM   1658 C  CA    . ALA A 1  216 ? -16.859 12.117  -7.510  1.00 14.85 ?  344  ALA A CA    1 
ATOM   1659 C  C     . ALA A 1  216 ? -16.182 13.419  -7.111  1.00 14.94 ?  344  ALA A C     1 
ATOM   1660 O  O     . ALA A 1  216 ? -16.580 14.058  -6.130  1.00 14.46 ?  344  ALA A O     1 
ATOM   1661 C  CB    . ALA A 1  216 ? -18.161 12.412  -8.250  1.00 18.94 ?  344  ALA A CB    1 
ATOM   1662 N  N     . GLY A 1  217 ? -15.130 13.777  -7.842  1.00 15.00 ?  345  GLY A N     1 
ATOM   1663 C  CA    . GLY A 1  217 ? -14.405 15.013  -7.596  1.00 16.47 ?  345  GLY A CA    1 
ATOM   1664 C  C     . GLY A 1  217 ? -13.491 15.011  -6.396  1.00 13.31 ?  345  GLY A C     1 
ATOM   1665 O  O     . GLY A 1  217 ? -12.947 16.066  -6.051  1.00 14.09 ?  345  GLY A O     1 
ATOM   1666 N  N     . LEU A 1  218 ? -13.258 13.848  -5.775  1.00 11.25 ?  346  LEU A N     1 
ATOM   1667 C  CA    . LEU A 1  218 ? -12.571 13.793  -4.501  1.00 10.25 ?  346  LEU A CA    1 
ATOM   1668 C  C     . LEU A 1  218 ? -11.070 14.015  -4.634  1.00 10.16 ?  346  LEU A C     1 
ATOM   1669 O  O     . LEU A 1  218 ? -10.467 14.693  -3.799  1.00 11.90 ?  346  LEU A O     1 
ATOM   1670 C  CB    . LEU A 1  218 ? -12.840 12.452  -3.837  1.00 10.57 ?  346  LEU A CB    1 
ATOM   1671 C  CG    . LEU A 1  218 ? -12.174 12.204  -2.494  1.00 12.24 ?  346  LEU A CG    1 
ATOM   1672 C  CD1   . LEU A 1  218 ? -12.449 13.326  -1.502  1.00 13.84 ?  346  LEU A CD1   1 
ATOM   1673 C  CD2   . LEU A 1  218 ? -12.645 10.868  -1.915  1.00 13.13 ?  346  LEU A CD2   1 
ATOM   1674 N  N     . LEU A 1  219 ? -10.432 13.415  -5.632  1.00 10.94 ?  347  LEU A N     1 
ATOM   1675 C  CA    . LEU A 1  219 ? -8.977  13.414  -5.597  1.00 10.17 ?  347  LEU A CA    1 
ATOM   1676 C  C     . LEU A 1  219 ? -8.381  14.813  -5.706  1.00 10.05 ?  347  LEU A C     1 
ATOM   1677 O  O     . LEU A 1  219 ? -7.425  15.099  -4.965  1.00 11.44 ?  347  LEU A O     1 
ATOM   1678 C  CB    . LEU A 1  219 ? -8.427  12.475  -6.671  1.00 12.08 ?  347  LEU A CB    1 
ATOM   1679 C  CG    . LEU A 1  219 ? -6.967  12.065  -6.466  1.00 12.18 ?  347  LEU A CG    1 
ATOM   1680 C  CD1   . LEU A 1  219 ? -6.636  11.627  -5.042  1.00 12.22 ?  347  LEU A CD1   1 
ATOM   1681 C  CD2   . LEU A 1  219 ? -6.617  10.938  -7.441  1.00 14.75 ?  347  LEU A CD2   1 
ATOM   1682 N  N     . PRO A 1  220 ? -8.900  15.728  -6.528  1.00 12.41 ?  348  PRO A N     1 
ATOM   1683 C  CA    . PRO A 1  220 ? -8.362  17.096  -6.500  1.00 14.22 ?  348  PRO A CA    1 
ATOM   1684 C  C     . PRO A 1  220 ? -8.438  17.727  -5.135  1.00 12.78 ?  348  PRO A C     1 
ATOM   1685 O  O     . PRO A 1  220 ? -7.533  18.465  -4.740  1.00 14.74 ?  348  PRO A O     1 
ATOM   1686 C  CB    . PRO A 1  220 ? -9.240  17.838  -7.515  1.00 14.85 ?  348  PRO A CB    1 
ATOM   1687 C  CG    . PRO A 1  220 ? -9.740  16.777  -8.432  1.00 18.02 ?  348  PRO A CG    1 
ATOM   1688 C  CD    . PRO A 1  220 ? -9.889  15.543  -7.605  1.00 14.78 ?  348  PRO A CD    1 
ATOM   1689 N  N     . ARG A 1  221 ? -9.523  17.474  -4.401  1.00 12.17 ?  349  ARG A N     1 
ATOM   1690 C  CA    . ARG A 1  221 ? -9.668  18.058  -3.075  1.00 12.53 ?  349  ARG A CA    1 
ATOM   1691 C  C     . ARG A 1  221 ? -8.638  17.499  -2.103  1.00 11.65 ?  349  ARG A C     1 
ATOM   1692 O  O     . ARG A 1  221 ? -8.123  18.217  -1.248  1.00 12.69 ?  349  ARG A O     1 
ATOM   1693 C  CB    . ARG A 1  221 ? -11.085 17.818  -2.563  1.00 12.30 ?  349  ARG A CB    1 
ATOM   1694 C  CG    . ARG A 1  221 ? -12.115 18.574  -3.385  1.00 12.99 ?  349  ARG A CG    1 
ATOM   1695 C  CD    . ARG A 1  221 ? -13.557 18.234  -2.998  1.00 13.94 ?  349  ARG A CD    1 
ATOM   1696 N  NE    . ARG A 1  221 ? -13.773 18.287  -1.561  1.00 13.52 ?  349  ARG A NE    1 
ATOM   1697 C  CZ    . ARG A 1  221 ? -13.965 19.411  -0.867  1.00 14.49 ?  349  ARG A CZ    1 
ATOM   1698 N  NH1   . ARG A 1  221 ? -13.969 20.578  -1.498  1.00 15.22 ?  349  ARG A NH1   1 
ATOM   1699 N  NH2   . ARG A 1  221 ? -14.134 19.367  0.440   1.00 14.82 ?  349  ARG A NH2   1 
ATOM   1700 N  N     . VAL A 1  222 ? -8.336  16.202  -2.217  1.00 12.77 ?  350  VAL A N     1 
ATOM   1701 C  CA    . VAL A 1  222 ? -7.315  15.580  -1.394  1.00 10.36 ?  350  VAL A CA    1 
ATOM   1702 C  C     . VAL A 1  222 ? -5.952  16.152  -1.743  1.00 11.85 ?  350  VAL A C     1 
ATOM   1703 O  O     . VAL A 1  222 ? -5.175  16.527  -0.865  1.00 12.88 ?  350  VAL A O     1 
ATOM   1704 C  CB    . VAL A 1  222 ? -7.350  14.048  -1.596  1.00 10.14 ?  350  VAL A CB    1 
ATOM   1705 C  CG1   . VAL A 1  222 ? -6.211  13.366  -0.883  1.00 11.38 ?  350  VAL A CG1   1 
ATOM   1706 C  CG2   . VAL A 1  222 ? -8.639  13.472  -1.113  1.00 11.51 ?  350  VAL A CG2   1 
ATOM   1707 N  N     . MET A 1  223 ? -5.659  16.257  -3.028  1.00 14.16 ?  351  MET A N     1 
ATOM   1708 C  CA    . MET A 1  223 ? -4.317  16.689  -3.402  1.00 15.49 ?  351  MET A CA    1 
ATOM   1709 C  C     . MET A 1  223 ? -4.063  18.127  -2.987  1.00 17.31 ?  351  MET A C     1 
ATOM   1710 O  O     . MET A 1  223 ? -2.958  18.456  -2.549  1.00 18.42 ?  351  MET A O     1 
ATOM   1711 C  CB    . MET A 1  223 ? -4.086  16.524  -4.899  1.00 18.04 ?  351  MET A CB    1 
ATOM   1712 C  CG    . MET A 1  223 ? -4.037  15.075  -5.415  1.00 17.01 ?  351  MET A CG    1 
ATOM   1713 S  SD    . MET A 1  223 ? -2.949  14.050  -4.425  1.00 17.69 ?  351  MET A SD    1 
ATOM   1714 C  CE    . MET A 1  223 ? -1.422  14.970  -4.603  1.00 20.38 ?  351  MET A CE    1 
ATOM   1715 N  N     A CYS A 1  224 ? -5.083  18.989  -3.104  0.57 16.44 ?  352  CYS A N     1 
ATOM   1716 N  N     B CYS A 1  224 ? -5.063  19.006  -3.087  0.43 16.58 ?  352  CYS A N     1 
ATOM   1717 C  CA    A CYS A 1  224 ? -4.925  20.387  -2.710  0.57 19.62 ?  352  CYS A CA    1 
ATOM   1718 C  CA    B CYS A 1  224 ? -4.798  20.393  -2.713  0.43 19.60 ?  352  CYS A CA    1 
ATOM   1719 C  C     A CYS A 1  224 ? -4.616  20.506  -1.226  0.57 19.01 ?  352  CYS A C     1 
ATOM   1720 C  C     B CYS A 1  224 ? -4.624  20.543  -1.204  0.43 19.05 ?  352  CYS A C     1 
ATOM   1721 O  O     A CYS A 1  224 ? -3.772  21.312  -0.822  0.57 20.36 ?  352  CYS A O     1 
ATOM   1722 O  O     B CYS A 1  224 ? -3.880  21.422  -0.758  0.43 21.37 ?  352  CYS A O     1 
ATOM   1723 C  CB    A CYS A 1  224 ? -6.183  21.179  -3.065  0.57 22.14 ?  352  CYS A CB    1 
ATOM   1724 C  CB    B CYS A 1  224 ? -5.900  21.314  -3.232  0.43 22.88 ?  352  CYS A CB    1 
ATOM   1725 S  SG    A CYS A 1  224 ? -6.314  21.539  -4.833  0.57 28.88 ?  352  CYS A SG    1 
ATOM   1726 S  SG    B CYS A 1  224 ? -7.422  21.250  -2.314  0.43 25.26 ?  352  CYS A SG    1 
ATOM   1727 N  N     . ARG A 1  225 ? -5.268  19.686  -0.404  1.00 15.23 ?  353  ARG A N     1 
ATOM   1728 C  CA    . ARG A 1  225 ? -5.056  19.716  1.030   1.00 15.42 ?  353  ARG A CA    1 
ATOM   1729 C  C     . ARG A 1  225 ? -3.675  19.173  1.404   1.00 16.07 ?  353  ARG A C     1 
ATOM   1730 O  O     . ARG A 1  225 ? -3.001  19.720  2.286   1.00 18.77 ?  353  ARG A O     1 
ATOM   1731 C  CB    . ARG A 1  225 ? -6.174  18.938  1.707   1.00 16.06 ?  353  ARG A CB    1 
ATOM   1732 C  CG    . ARG A 1  225 ? -7.468  19.786  1.759   1.00 17.25 ?  353  ARG A CG    1 
ATOM   1733 C  CD    . ARG A 1  225 ? -8.723  19.000  2.046   1.00 15.92 ?  353  ARG A CD    1 
ATOM   1734 N  NE    . ARG A 1  225 ? -9.809  19.982  2.138   1.00 16.14 ?  353  ARG A NE    1 
ATOM   1735 C  CZ    . ARG A 1  225 ? -10.389 20.570  1.090   1.00 17.77 ?  353  ARG A CZ    1 
ATOM   1736 N  NH1   . ARG A 1  225 ? -10.070 20.243  -0.158  1.00 15.97 ?  353  ARG A NH1   1 
ATOM   1737 N  NH2   . ARG A 1  225 ? -11.311 21.513  1.296   1.00 16.91 ?  353  ARG A NH2   1 
ATOM   1738 N  N     . LEU A 1  226 ? -3.223  18.112  0.735   1.00 15.47 ?  354  LEU A N     1 
ATOM   1739 C  CA    . LEU A 1  226 ? -1.876  17.623  1.003   1.00 13.91 ?  354  LEU A CA    1 
ATOM   1740 C  C     . LEU A 1  226 ? -0.820  18.633  0.568   1.00 15.61 ?  354  LEU A C     1 
ATOM   1741 O  O     . LEU A 1  226 ? 0.216   18.785  1.241   1.00 15.93 ?  354  LEU A O     1 
ATOM   1742 C  CB    . LEU A 1  226 ? -1.659  16.286  0.294   1.00 12.57 ?  354  LEU A CB    1 
ATOM   1743 C  CG    . LEU A 1  226 ? -2.426  15.072  0.807   1.00 12.80 ?  354  LEU A CG    1 
ATOM   1744 C  CD1   . LEU A 1  226 ? -2.354  13.991  -0.252  1.00 12.06 ?  354  LEU A CD1   1 
ATOM   1745 C  CD2   . LEU A 1  226 ? -1.889  14.597  2.126   1.00 16.70 ?  354  LEU A CD2   1 
ATOM   1746 N  N     . GLN A 1  227 ? -1.051  19.318  -0.547  1.00 16.49 ?  355  GLN A N     1 
ATOM   1747 C  CA    . GLN A 1  227 ? -0.113  20.331  -1.014  1.00 18.41 ?  355  GLN A CA    1 
ATOM   1748 C  C     . GLN A 1  227 ? -0.066  21.514  -0.056  1.00 18.64 ?  355  GLN A C     1 
ATOM   1749 O  O     . GLN A 1  227 ? 1.019   22.025  0.249   1.00 20.83 ?  355  GLN A O     1 
ATOM   1750 C  CB    . GLN A 1  227 ? -0.488  20.785  -2.428  1.00 20.06 ?  355  GLN A CB    1 
ATOM   1751 C  CG    . GLN A 1  227 ? 0.517   21.749  -3.052  1.00 25.40 ?  355  GLN A CG    1 
ATOM   1752 N  N     . ASP A 1  228 ? -1.217  21.920  0.478   1.00 22.61 ?  356  ASP A N     1 
ATOM   1753 C  CA    . ASP A 1  228 ? -1.244  23.003  1.463   1.00 25.36 ?  356  ASP A CA    1 
ATOM   1754 C  C     . ASP A 1  228 ? -0.464  22.650  2.721   1.00 28.72 ?  356  ASP A C     1 
ATOM   1755 O  O     . ASP A 1  228 ? 0.148   23.534  3.331   1.00 32.86 ?  356  ASP A O     1 
ATOM   1756 C  CB    . ASP A 1  228 ? -2.690  23.343  1.833   1.00 25.17 ?  356  ASP A CB    1 
ATOM   1757 N  N     . GLN A 1  229 ? -0.485  21.382  3.143   1.00 22.39 ?  357  GLN A N     1 
ATOM   1758 C  CA    . GLN A 1  229 ? 0.240   20.980  4.334   1.00 21.59 ?  357  GLN A CA    1 
ATOM   1759 C  C     . GLN A 1  229 ? 1.736   20.806  4.097   1.00 21.49 ?  357  GLN A C     1 
ATOM   1760 O  O     . GLN A 1  229 ? 2.441   20.407  5.028   1.00 25.01 ?  357  GLN A O     1 
ATOM   1761 C  CB    . GLN A 1  229 ? -0.313  19.682  4.901   1.00 23.00 ?  357  GLN A CB    1 
ATOM   1762 C  CG    . GLN A 1  229 ? -1.740  19.789  5.411   1.00 27.36 ?  357  GLN A CG    1 
ATOM   1763 C  CD    . GLN A 1  229 ? -2.223  18.503  6.045   1.00 31.35 ?  357  GLN A CD    1 
ATOM   1764 N  N     . GLY A 1  230 ? 2.228   21.081  2.890   1.00 19.29 ?  358  GLY A N     1 
ATOM   1765 C  CA    . GLY A 1  230 ? 3.653   21.018  2.633   1.00 17.87 ?  358  GLY A CA    1 
ATOM   1766 C  C     . GLY A 1  230 ? 4.192   19.628  2.403   1.00 17.20 ?  358  GLY A C     1 
ATOM   1767 O  O     . GLY A 1  230 ? 5.403   19.422  2.454   1.00 17.89 ?  358  GLY A O     1 
ATOM   1768 N  N     . LEU A 1  231 ? 3.323   18.665  2.147   1.00 15.50 ?  359  LEU A N     1 
ATOM   1769 C  CA    . LEU A 1  231 ? 3.721   17.266  2.052   1.00 13.86 ?  359  LEU A CA    1 
ATOM   1770 C  C     . LEU A 1  231 ? 3.993   16.797  0.634   1.00 14.49 ?  359  LEU A C     1 
ATOM   1771 O  O     . LEU A 1  231 ? 4.525   15.689  0.458   1.00 15.42 ?  359  LEU A O     1 
ATOM   1772 C  CB    . LEU A 1  231 ? 2.626   16.389  2.652   1.00 14.68 ?  359  LEU A CB    1 
ATOM   1773 C  CG    . LEU A 1  231 ? 2.446   16.593  4.144   1.00 19.14 ?  359  LEU A CG    1 
ATOM   1774 C  CD1   . LEU A 1  231 ? 1.196   15.895  4.603   1.00 23.64 ?  359  LEU A CD1   1 
ATOM   1775 C  CD2   . LEU A 1  231 ? 3.653   16.072  4.890   1.00 22.80 ?  359  LEU A CD2   1 
ATOM   1776 N  N     . ILE A 1  232 ? 3.649   17.565  -0.380  1.00 13.65 ?  360  ILE A N     1 
ATOM   1777 C  CA    . ILE A 1  232 ? 3.778   17.134  -1.757  1.00 13.06 ?  360  ILE A CA    1 
ATOM   1778 C  C     . ILE A 1  232 ? 4.998   17.794  -2.368  1.00 15.49 ?  360  ILE A C     1 
ATOM   1779 O  O     . ILE A 1  232 ? 5.035   19.018  -2.556  1.00 17.63 ?  360  ILE A O     1 
ATOM   1780 C  CB    . ILE A 1  232 ? 2.528   17.448  -2.585  1.00 15.25 ?  360  ILE A CB    1 
ATOM   1781 C  CG1   . ILE A 1  232 ? 1.297   16.809  -1.945  1.00 14.44 ?  360  ILE A CG1   1 
ATOM   1782 C  CG2   . ILE A 1  232 ? 2.698   16.956  -4.025  1.00 15.65 ?  360  ILE A CG2   1 
ATOM   1783 C  CD1   . ILE A 1  232 ? 1.383   15.271  -1.820  1.00 14.09 ?  360  ILE A CD1   1 
ATOM   1784 N  N     . LEU A 1  233 ? 5.977   16.975  -2.712  1.00 12.67 ?  361  LEU A N     1 
ATOM   1785 C  CA    . LEU A 1  233 ? 7.146   17.435  -3.443  1.00 14.72 ?  361  LEU A CA    1 
ATOM   1786 C  C     . LEU A 1  233 ? 6.925   17.467  -4.947  1.00 14.92 ?  361  LEU A C     1 
ATOM   1787 O  O     . LEU A 1  233 ? 7.536   18.294  -5.629  1.00 17.69 ?  361  LEU A O     1 
ATOM   1788 C  CB    . LEU A 1  233 ? 8.342   16.532  -3.123  1.00 13.11 ?  361  LEU A CB    1 
ATOM   1789 C  CG    . LEU A 1  233 ? 8.860   16.592  -1.682  1.00 13.71 ?  361  LEU A CG    1 
ATOM   1790 C  CD1   . LEU A 1  233 ? 9.678   15.412  -1.251  1.00 15.29 ?  361  LEU A CD1   1 
ATOM   1791 C  CD2   . LEU A 1  233 ? 9.714   17.870  -1.539  1.00 15.49 ?  361  LEU A CD2   1 
ATOM   1792 N  N     . TYR A 1  234 ? 6.090   16.570  -5.481  1.00 16.12 ?  362  TYR A N     1 
ATOM   1793 C  CA    . TYR A 1  234 ? 5.740   16.541  -6.885  1.00 15.95 ?  362  TYR A CA    1 
ATOM   1794 C  C     . TYR A 1  234 ? 4.378   15.887  -7.073  1.00 16.12 ?  362  TYR A C     1 
ATOM   1795 O  O     . TYR A 1  234 ? 4.085   14.862  -6.457  1.00 14.56 ?  362  TYR A O     1 
ATOM   1796 C  CB    . TYR A 1  234 ? 6.763   15.758  -7.723  1.00 18.88 ?  362  TYR A CB    1 
ATOM   1797 C  CG    . TYR A 1  234 ? 6.290   15.539  -9.142  1.00 19.36 ?  362  TYR A CG    1 
ATOM   1798 C  CD1   . TYR A 1  234 ? 6.496   16.503  -10.116 1.00 24.57 ?  362  TYR A CD1   1 
ATOM   1799 C  CD2   . TYR A 1  234 ? 5.589   14.394  -9.493  1.00 22.35 ?  362  TYR A CD2   1 
ATOM   1800 C  CE1   . TYR A 1  234 ? 6.036   16.318  -11.406 1.00 24.03 ?  362  TYR A CE1   1 
ATOM   1801 C  CE2   . TYR A 1  234 ? 5.118   14.207  -10.774 1.00 24.69 ?  362  TYR A CE2   1 
ATOM   1802 C  CZ    . TYR A 1  234 ? 5.352   15.178  -11.723 1.00 26.63 ?  362  TYR A CZ    1 
ATOM   1803 O  OH    . TYR A 1  234 ? 4.886   14.985  -13.000 1.00 35.20 ?  362  TYR A OH    1 
ATOM   1804 N  N     A HIS A 1  235 ? 3.534   16.504  -7.896  0.57 16.61 ?  363  HIS A N     1 
ATOM   1805 N  N     B HIS A 1  235 ? 3.561   16.497  -7.929  0.43 16.83 ?  363  HIS A N     1 
ATOM   1806 C  CA    A HIS A 1  235 ? 2.340   15.838  -8.399  0.57 17.43 ?  363  HIS A CA    1 
ATOM   1807 C  CA    B HIS A 1  235 ? 2.303   15.917  -8.376  0.43 17.58 ?  363  HIS A CA    1 
ATOM   1808 C  C     A HIS A 1  235 ? 2.026   16.410  -9.773  0.57 19.38 ?  363  HIS A C     1 
ATOM   1809 C  C     B HIS A 1  235 ? 2.037   16.417  -9.789  0.43 19.44 ?  363  HIS A C     1 
ATOM   1810 O  O     A HIS A 1  235 ? 2.540   17.462  -10.156 0.57 21.98 ?  363  HIS A O     1 
ATOM   1811 O  O     B HIS A 1  235 ? 2.605   17.419  -10.224 0.43 21.66 ?  363  HIS A O     1 
ATOM   1812 C  CB    A HIS A 1  235 ? 1.149   15.996  -7.441  0.57 17.52 ?  363  HIS A CB    1 
ATOM   1813 C  CB    B HIS A 1  235 ? 1.157   16.278  -7.420  0.43 17.43 ?  363  HIS A CB    1 
ATOM   1814 C  CG    A HIS A 1  235 ? 0.772   17.420  -7.170  0.57 17.81 ?  363  HIS A CG    1 
ATOM   1815 C  CG    B HIS A 1  235 ? -0.203  15.951  -7.951  0.43 16.50 ?  363  HIS A CG    1 
ATOM   1816 N  N     . GLN A 1  236 ? 1.168   15.704  -10.511 1.00 23.60 ?  364  GLN A N     1 
ATOM   1817 C  CA    . GLN A 1  236 ? 0.855   16.073  -11.891 1.00 29.90 ?  364  GLN A CA    1 
ATOM   1818 C  C     . GLN A 1  236 ? 0.061   17.373  -12.023 1.00 32.65 ?  364  GLN A C     1 
ATOM   1819 O  O     . GLN A 1  236 ? -0.114  17.849  -13.148 1.00 36.50 ?  364  GLN A O     1 
ATOM   1820 C  CB    . GLN A 1  236 ? 0.074   14.935  -12.561 1.00 29.86 ?  364  GLN A CB    1 
ATOM   1821 N  N     . HIS A 1  237 ? -0.419  17.961  -10.933 1.00 38.32 ?  365  HIS A N     1 
ATOM   1822 C  CA    . HIS A 1  237 ? -1.255  19.161  -11.030 1.00 39.48 ?  365  HIS A CA    1 
ATOM   1823 C  C     . HIS A 1  237 ? -0.816  20.296  -10.096 1.00 41.53 ?  365  HIS A C     1 
ATOM   1824 O  O     . HIS A 1  237 ? 0.172   20.185  -9.371  1.00 42.35 ?  365  HIS A O     1 
ATOM   1825 C  CB    . HIS A 1  237 ? -2.711  18.798  -10.738 1.00 41.39 ?  365  HIS A CB    1 
ATOM   1826 C  CG    . HIS A 1  237 ? -3.294  17.828  -11.718 1.00 42.71 ?  365  HIS A CG    1 
ATOM   1827 N  ND1   . HIS A 1  237 ? -3.492  16.497  -11.422 1.00 41.93 ?  365  HIS A ND1   1 
ATOM   1828 C  CD2   . HIS A 1  237 ? -3.707  17.996  -12.996 1.00 42.82 ?  365  HIS A CD2   1 
ATOM   1829 C  CE1   . HIS A 1  237 ? -4.006  15.887  -12.475 1.00 40.77 ?  365  HIS A CE1   1 
ATOM   1830 N  NE2   . HIS A 1  237 ? -4.150  16.774  -13.442 1.00 41.62 ?  365  HIS A NE2   1 
ATOM   1831 N  N     . ALA A 1  256 ? -9.910  17.427  -13.138 1.00 36.87 ?  384  ALA A N     1 
ATOM   1832 C  CA    . ALA A 1  256 ? -10.638 16.214  -12.781 1.00 33.06 ?  384  ALA A CA    1 
ATOM   1833 C  C     . ALA A 1  256 ? -9.778  14.988  -13.052 1.00 34.01 ?  384  ALA A C     1 
ATOM   1834 O  O     . ALA A 1  256 ? -9.396  14.741  -14.196 1.00 35.40 ?  384  ALA A O     1 
ATOM   1835 C  CB    . ALA A 1  256 ? -11.947 16.120  -13.558 1.00 30.69 ?  384  ALA A CB    1 
ATOM   1836 N  N     . PHE A 1  257 ? -9.474  14.227  -12.000 1.00 22.82 ?  385  PHE A N     1 
ATOM   1837 C  CA    . PHE A 1  257 ? -8.675  13.014  -12.139 1.00 18.82 ?  385  PHE A CA    1 
ATOM   1838 C  C     . PHE A 1  257 ? -9.061  12.052  -11.027 1.00 17.99 ?  385  PHE A C     1 
ATOM   1839 O  O     . PHE A 1  257 ? -9.694  12.444  -10.042 1.00 19.78 ?  385  PHE A O     1 
ATOM   1840 C  CB    . PHE A 1  257 ? -7.172  13.338  -12.123 1.00 20.91 ?  385  PHE A CB    1 
ATOM   1841 C  CG    . PHE A 1  257 ? -6.741  14.245  -10.992 1.00 23.15 ?  385  PHE A CG    1 
ATOM   1842 C  CD1   . PHE A 1  257 ? -6.968  15.610  -11.046 1.00 26.68 ?  385  PHE A CD1   1 
ATOM   1843 C  CD2   . PHE A 1  257 ? -6.059  13.739  -9.896  1.00 23.11 ?  385  PHE A CD2   1 
ATOM   1844 C  CE1   . PHE A 1  257 ? -6.546  16.442  -10.013 1.00 24.71 ?  385  PHE A CE1   1 
ATOM   1845 C  CE2   . PHE A 1  257 ? -5.649  14.577  -8.862  1.00 19.22 ?  385  PHE A CE2   1 
ATOM   1846 C  CZ    . PHE A 1  257 ? -5.886  15.916  -8.924  1.00 20.57 ?  385  PHE A CZ    1 
ATOM   1847 N  N     . GLU A 1  258 ? -8.662  10.774  -11.195 1.00 15.89 ?  386  GLU A N     1 
ATOM   1848 C  CA    . GLU A 1  258 ? -8.959  9.724   -10.231 1.00 16.01 ?  386  GLU A CA    1 
ATOM   1849 C  C     . GLU A 1  258 ? -7.746  8.886   -9.855  1.00 14.81 ?  386  GLU A C     1 
ATOM   1850 O  O     . GLU A 1  258 ? -7.860  8.005   -8.996  1.00 13.34 ?  386  GLU A O     1 
ATOM   1851 C  CB    . GLU A 1  258 ? -10.044 8.790   -10.762 1.00 18.25 ?  386  GLU A CB    1 
ATOM   1852 C  CG    . GLU A 1  258 ? -9.637  7.882   -11.920 1.00 19.38 ?  386  GLU A CG    1 
ATOM   1853 C  CD    . GLU A 1  258 ? -10.846 7.393   -12.728 1.00 29.88 ?  386  GLU A CD    1 
ATOM   1854 O  OE1   . GLU A 1  258 ? -11.766 8.210   -12.950 1.00 34.12 ?  386  GLU A OE1   1 
ATOM   1855 O  OE2   . GLU A 1  258 ? -10.894 6.197   -13.127 1.00 27.59 ?  386  GLU A OE2   1 
ATOM   1856 N  N     . ARG A 1  259 ? -6.599  9.115   -10.487 1.00 12.57 ?  387  ARG A N     1 
ATOM   1857 C  CA    . ARG A 1  259 ? -5.347  8.492   -10.080 1.00 9.24  ?  387  ARG A CA    1 
ATOM   1858 C  C     . ARG A 1  259 ? -4.314  9.598   -9.960  1.00 10.34 ?  387  ARG A C     1 
ATOM   1859 O  O     . ARG A 1  259 ? -4.301  10.517  -10.783 1.00 11.70 ?  387  ARG A O     1 
ATOM   1860 C  CB    . ARG A 1  259 ? -4.842  7.450   -11.093 1.00 10.16 ?  387  ARG A CB    1 
ATOM   1861 C  CG    . ARG A 1  259 ? -5.820  6.395   -11.463 1.00 10.96 ?  387  ARG A CG    1 
ATOM   1862 C  CD    . ARG A 1  259 ? -5.234  5.465   -12.457 1.00 11.25 ?  387  ARG A CD    1 
ATOM   1863 N  NE    . ARG A 1  259 ? -6.230  4.496   -12.898 1.00 12.55 ?  387  ARG A NE    1 
ATOM   1864 C  CZ    . ARG A 1  259 ? -6.031  3.578   -13.834 1.00 12.41 ?  387  ARG A CZ    1 
ATOM   1865 N  NH1   . ARG A 1  259 ? -4.872  3.466   -14.454 1.00 14.36 ?  387  ARG A NH1   1 
ATOM   1866 N  NH2   . ARG A 1  259 ? -7.017  2.744   -14.144 1.00 17.11 ?  387  ARG A NH2   1 
ATOM   1867 N  N     A SER A 1  260 ? -3.505  9.541   -8.915  0.64 8.80  ?  388  SER A N     1 
ATOM   1868 N  N     B SER A 1  260 ? -3.472  9.546   -8.928  0.36 8.85  ?  388  SER A N     1 
ATOM   1869 C  CA    A SER A 1  260 ? -2.403  10.471  -8.714  0.64 9.66  ?  388  SER A CA    1 
ATOM   1870 C  CA    B SER A 1  260 ? -2.400  10.526  -8.754  0.36 9.82  ?  388  SER A CA    1 
ATOM   1871 C  C     A SER A 1  260 ? -1.131  9.673   -8.458  0.64 10.93 ?  388  SER A C     1 
ATOM   1872 C  C     B SER A 1  260 ? -1.105  9.840   -8.332  0.36 9.83  ?  388  SER A C     1 
ATOM   1873 O  O     A SER A 1  260 ? -1.142  8.690   -7.714  0.64 9.36  ?  388  SER A O     1 
ATOM   1874 O  O     B SER A 1  260 ? -1.067  9.136   -7.316  0.36 8.56  ?  388  SER A O     1 
ATOM   1875 C  CB    A SER A 1  260 ? -2.699  11.437  -7.547  0.64 12.90 ?  388  SER A CB    1 
ATOM   1876 C  CB    B SER A 1  260 ? -2.772  11.599  -7.720  0.36 12.96 ?  388  SER A CB    1 
ATOM   1877 O  OG    A SER A 1  260 ? -1.630  12.340  -7.319  0.64 17.91 ?  388  SER A OG    1 
ATOM   1878 O  OG    B SER A 1  260 ? -2.825  11.057  -6.417  0.36 13.53 ?  388  SER A OG    1 
ATOM   1879 N  N     . PHE A 1  261 ? -0.040  10.071  -9.109  1.00 12.03 ?  389  PHE A N     1 
ATOM   1880 C  CA    . PHE A 1  261 ? 1.282   9.482   -8.886  1.00 12.84 ?  389  PHE A CA    1 
ATOM   1881 C  C     . PHE A 1  261 ? 2.168   10.584  -8.355  1.00 13.80 ?  389  PHE A C     1 
ATOM   1882 O  O     . PHE A 1  261 ? 2.611   11.443  -9.125  1.00 15.98 ?  389  PHE A O     1 
ATOM   1883 C  CB    . PHE A 1  261 ? 1.874   8.917   -10.169 1.00 13.81 ?  389  PHE A CB    1 
ATOM   1884 C  CG    . PHE A 1  261 ? 0.878   8.285   -11.052 1.00 16.16 ?  389  PHE A CG    1 
ATOM   1885 C  CD1   . PHE A 1  261 ? 0.174   7.183   -10.621 1.00 16.40 ?  389  PHE A CD1   1 
ATOM   1886 C  CD2   . PHE A 1  261 ? 0.640   8.795   -12.319 1.00 19.22 ?  389  PHE A CD2   1 
ATOM   1887 C  CE1   . PHE A 1  261 ? -0.761  6.587   -11.451 1.00 17.93 ?  389  PHE A CE1   1 
ATOM   1888 C  CE2   . PHE A 1  261 ? -0.286  8.206   -13.137 1.00 20.48 ?  389  PHE A CE2   1 
ATOM   1889 C  CZ    . PHE A 1  261 ? -0.983  7.107   -12.699 1.00 16.81 ?  389  PHE A CZ    1 
ATOM   1890 N  N     A CYS A 1  262 ? 2.448   10.600  -7.070  0.46 10.44 ?  390  CYS A N     1 
ATOM   1891 N  N     B CYS A 1  262 ? 2.386   10.589  -7.045  0.54 10.17 ?  390  CYS A N     1 
ATOM   1892 C  CA    A CYS A 1  262 ? 3.110   11.764  -6.521  0.46 11.38 ?  390  CYS A CA    1 
ATOM   1893 C  CA    B CYS A 1  262 ? 3.008   11.692  -6.325  0.54 11.87 ?  390  CYS A CA    1 
ATOM   1894 C  C     A CYS A 1  262 ? 4.313   11.360  -5.674  0.46 9.37  ?  390  CYS A C     1 
ATOM   1895 C  C     B CYS A 1  262 ? 4.397   11.332  -5.803  0.54 9.78  ?  390  CYS A C     1 
ATOM   1896 O  O     A CYS A 1  262 ? 4.544   10.190  -5.333  0.46 9.53  ?  390  CYS A O     1 
ATOM   1897 O  O     B CYS A 1  262 ? 4.812   10.166  -5.750  0.54 8.51  ?  390  CYS A O     1 
ATOM   1898 C  CB    A CYS A 1  262 ? 2.124   12.604  -5.710  0.46 13.11 ?  390  CYS A CB    1 
ATOM   1899 C  CB    B CYS A 1  262 ? 2.167   12.105  -5.117  0.54 12.76 ?  390  CYS A CB    1 
ATOM   1900 S  SG    A CYS A 1  262 ? 1.859   11.959  -4.068  0.46 14.13 ?  390  CYS A SG    1 
ATOM   1901 S  SG    B CYS A 1  262 ? 0.397   12.208  -5.342  0.54 15.41 ?  390  CYS A SG    1 
ATOM   1902 N  N     . ILE A 1  263 ? 5.095   12.378  -5.350  1.00 10.10 ?  391  ILE A N     1 
ATOM   1903 C  CA    . ILE A 1  263 ? 6.256   12.251  -4.482  1.00 10.53 ?  391  ILE A CA    1 
ATOM   1904 C  C     . ILE A 1  263 ? 5.947   13.055  -3.224  1.00 11.46 ?  391  ILE A C     1 
ATOM   1905 O  O     . ILE A 1  263 ? 5.624   14.251  -3.313  1.00 11.45 ?  391  ILE A O     1 
ATOM   1906 C  CB    . ILE A 1  263 ? 7.541   12.741  -5.181  1.00 11.75 ?  391  ILE A CB    1 
ATOM   1907 C  CG1   . ILE A 1  263 ? 7.736   12.018  -6.514  1.00 12.27 ?  391  ILE A CG1   1 
ATOM   1908 C  CG2   . ILE A 1  263 ? 8.764   12.561  -4.264  1.00 12.83 ?  391  ILE A CG2   1 
ATOM   1909 C  CD1   . ILE A 1  263 ? 8.977   12.477  -7.334  1.00 13.29 ?  391  ILE A CD1   1 
ATOM   1910 N  N     . PHE A 1  264 ? 5.991   12.390  -2.078  1.00 12.19 ?  392  PHE A N     1 
ATOM   1911 C  CA    . PHE A 1  264 ? 5.643   12.882  -0.755  1.00 13.53 ?  392  PHE A CA    1 
ATOM   1912 C  C     . PHE A 1  264 ? 6.904   13.139  0.056   1.00 14.31 ?  392  PHE A C     1 
ATOM   1913 O  O     . PHE A 1  264 ? 7.894   12.426  -0.064  1.00 12.86 ?  392  PHE A O     1 
ATOM   1914 C  CB    . PHE A 1  264 ? 4.850   11.840  0.049   1.00 13.43 ?  392  PHE A CB    1 
ATOM   1915 C  CG    . PHE A 1  264 ? 3.357   12.000  0.075   1.00 15.70 ?  392  PHE A CG    1 
ATOM   1916 C  CD1   . PHE A 1  264 ? 2.626   11.861  -1.069  1.00 17.37 ?  392  PHE A CD1   1 
ATOM   1917 C  CD2   . PHE A 1  264 ? 2.698   12.157  1.279   1.00 22.12 ?  392  PHE A CD2   1 
ATOM   1918 C  CE1   . PHE A 1  264 ? 1.227   11.939  -1.037  1.00 19.95 ?  392  PHE A CE1   1 
ATOM   1919 C  CE2   . PHE A 1  264 ? 1.326   12.238  1.327   1.00 21.25 ?  392  PHE A CE2   1 
ATOM   1920 C  CZ    . PHE A 1  264 ? 0.592   12.111  0.165   1.00 20.52 ?  392  PHE A CZ    1 
ATOM   1921 N  N     . ARG A 1  265 ? 6.802   14.107  0.953   1.00 14.03 ?  393  ARG A N     1 
ATOM   1922 C  CA    . ARG A 1  265 ? 7.795   14.375  1.972   1.00 15.48 ?  393  ARG A CA    1 
ATOM   1923 C  C     . ARG A 1  265 ? 7.478   13.535  3.210   1.00 18.57 ?  393  ARG A C     1 
ATOM   1924 O  O     . ARG A 1  265 ? 6.470   13.772  3.884   1.00 21.56 ?  393  ARG A O     1 
ATOM   1925 C  CB    . ARG A 1  265 ? 7.744   15.868  2.260   1.00 19.87 ?  393  ARG A CB    1 
ATOM   1926 C  CG    . ARG A 1  265 ? 8.799   16.406  3.094   1.00 24.85 ?  393  ARG A CG    1 
ATOM   1927 C  CD    . ARG A 1  265 ? 8.652   17.898  3.003   1.00 23.72 ?  393  ARG A CD    1 
ATOM   1928 N  NE    . ARG A 1  265 ? 9.481   18.533  3.975   1.00 24.58 ?  393  ARG A NE    1 
ATOM   1929 C  CZ    . ARG A 1  265 ? 10.287  19.546  3.727   1.00 20.41 ?  393  ARG A CZ    1 
ATOM   1930 N  NH1   . ARG A 1  265 ? 10.362  20.079  2.506   1.00 21.23 ?  393  ARG A NH1   1 
ATOM   1931 N  NH2   . ARG A 1  265 ? 10.992  20.042  4.720   1.00 27.91 ?  393  ARG A NH2   1 
ATOM   1932 N  N     . LEU A 1  266 ? 8.323   12.552  3.503   1.00 18.32 ?  394  LEU A N     1 
ATOM   1933 C  CA    . LEU A 1  266 ? 8.138   11.687  4.650   1.00 20.21 ?  394  LEU A CA    1 
ATOM   1934 C  C     . LEU A 1  266 ? 9.111   12.061  5.760   1.00 22.99 ?  394  LEU A C     1 
ATOM   1935 O  O     . LEU A 1  266 ? 10.332  12.045  5.522   1.00 20.44 ?  394  LEU A O     1 
ATOM   1936 C  CB    . LEU A 1  266 ? 8.343   10.236  4.249   1.00 21.48 ?  394  LEU A CB    1 
ATOM   1937 C  CG    . LEU A 1  266 ? 8.107   9.215   5.363   1.00 27.29 ?  394  LEU A CG    1 
ATOM   1938 C  CD1   . LEU A 1  266 ? 6.681   9.318   5.872   1.00 27.54 ?  394  LEU A CD1   1 
ATOM   1939 C  CD2   . LEU A 1  266 ? 8.381   7.822   4.870   1.00 27.47 ?  394  LEU A CD2   1 
ATOM   1940 N  N     . PRO A 1  267 ? 8.645   12.354  6.980   1.00 37.38 ?  395  PRO A N     1 
ATOM   1941 C  CA    . PRO A 1  267 ? 9.577   12.727  8.054   1.00 37.63 ?  395  PRO A CA    1 
ATOM   1942 C  C     . PRO A 1  267 ? 10.532  11.605  8.433   1.00 36.16 ?  395  PRO A C     1 
ATOM   1943 O  O     . PRO A 1  267 ? 10.202  10.418  8.367   1.00 39.61 ?  395  PRO A O     1 
ATOM   1944 C  CB    . PRO A 1  267 ? 8.645   13.082  9.220   1.00 37.87 ?  395  PRO A CB    1 
ATOM   1945 C  CG    . PRO A 1  267 ? 7.368   13.488  8.571   1.00 39.70 ?  395  PRO A CG    1 
ATOM   1946 C  CD    . PRO A 1  267 ? 7.244   12.571  7.385   1.00 38.80 ?  395  PRO A CD    1 
ATOM   1947 N  N     . GLN A 1  268 ? 11.734  12.010  8.827   1.00 28.61 ?  396  GLN A N     1 
ATOM   1948 C  CA    . GLN A 1  268 ? 12.818  11.153  9.277   1.00 29.81 ?  396  GLN A CA    1 
ATOM   1949 C  C     . GLN A 1  268 ? 13.446  11.831  10.487  1.00 35.11 ?  396  GLN A C     1 
ATOM   1950 O  O     . GLN A 1  268 ? 13.235  13.027  10.709  1.00 37.13 ?  396  GLN A O     1 
ATOM   1951 C  CB    . GLN A 1  268 ? 13.896  10.949  8.199   1.00 32.02 ?  396  GLN A CB    1 
ATOM   1952 C  CG    . GLN A 1  268 ? 13.436  10.309  6.886   1.00 29.00 ?  396  GLN A CG    1 
ATOM   1953 C  CD    . GLN A 1  268 ? 13.511  8.799   6.916   1.00 32.27 ?  396  GLN A CD    1 
ATOM   1954 O  OE1   . GLN A 1  268 ? 14.500  8.205   6.485   1.00 36.13 ?  396  GLN A OE1   1 
ATOM   1955 N  NE2   . GLN A 1  268 ? 12.464  8.168   7.432   1.00 31.16 ?  396  GLN A NE2   1 
ATOM   1956 N  N     . PRO A 1  269 ? 14.230  11.101  11.273  1.00 40.51 ?  397  PRO A N     1 
ATOM   1957 C  CA    . PRO A 1  269 ? 14.938  11.741  12.394  1.00 40.30 ?  397  PRO A CA    1 
ATOM   1958 C  C     . PRO A 1  269 ? 15.771  12.949  11.976  1.00 39.64 ?  397  PRO A C     1 
ATOM   1959 O  O     . PRO A 1  269 ? 16.805  12.808  11.313  1.00 44.48 ?  397  PRO A O     1 
ATOM   1960 C  CB    . PRO A 1  269 ? 15.821  10.610  12.931  1.00 40.64 ?  397  PRO A CB    1 
ATOM   1961 C  CG    . PRO A 1  269 ? 15.080  9.366   12.591  1.00 39.08 ?  397  PRO A CG    1 
ATOM   1962 C  CD    . PRO A 1  269 ? 14.397  9.639   11.275  1.00 37.93 ?  397  PRO A CD    1 
ATOM   1963 N  N     . GLY A 1  270 ? 15.335  14.145  12.367  1.00 31.58 ?  410  GLY A N     1 
ATOM   1964 C  CA    . GLY A 1  270 ? 16.070  15.357  12.066  1.00 32.27 ?  410  GLY A CA    1 
ATOM   1965 C  C     . GLY A 1  270 ? 15.954  15.842  10.639  1.00 30.76 ?  410  GLY A C     1 
ATOM   1966 O  O     . GLY A 1  270 ? 16.571  16.861  10.289  1.00 33.03 ?  410  GLY A O     1 
ATOM   1967 N  N     . SER A 1  271 ? 15.182  15.161  9.800   1.00 26.65 ?  411  SER A N     1 
ATOM   1968 C  CA    . SER A 1  271 ? 15.110  15.530  8.399   1.00 21.16 ?  411  SER A CA    1 
ATOM   1969 C  C     . SER A 1  271 ? 13.895  14.867  7.747   1.00 22.96 ?  411  SER A C     1 
ATOM   1970 O  O     . SER A 1  271 ? 12.851  14.734  8.385   1.00 23.31 ?  411  SER A O     1 
ATOM   1971 C  CB    . SER A 1  271 ? 16.402  15.132  7.708   1.00 24.00 ?  411  SER A CB    1 
ATOM   1972 O  OG    . SER A 1  271 ? 16.454  15.672  6.428   1.00 23.32 ?  411  SER A OG    1 
ATOM   1973 N  N     . TRP A 1  272 ? 14.018  14.461  6.490   1.00 18.44 ?  412  TRP A N     1 
ATOM   1974 C  CA    . TRP A 1  272 ? 12.915  13.822  5.773   1.00 16.20 ?  412  TRP A CA    1 
ATOM   1975 C  C     . TRP A 1  272 ? 13.478  13.145  4.535   1.00 15.42 ?  412  TRP A C     1 
ATOM   1976 O  O     . TRP A 1  272 ? 14.642  13.330  4.169   1.00 16.00 ?  412  TRP A O     1 
ATOM   1977 C  CB    . TRP A 1  272 ? 11.851  14.839  5.384   1.00 16.10 ?  412  TRP A CB    1 
ATOM   1978 C  CG    . TRP A 1  272 ? 12.391  16.036  4.678   1.00 16.81 ?  412  TRP A CG    1 
ATOM   1979 C  CD1   . TRP A 1  272 ? 12.839  17.187  5.261   1.00 18.18 ?  412  TRP A CD1   1 
ATOM   1980 C  CD2   . TRP A 1  272 ? 12.546  16.218  3.268   1.00 16.36 ?  412  TRP A CD2   1 
ATOM   1981 N  NE1   . TRP A 1  272 ? 13.258  18.072  4.309   1.00 18.59 ?  412  TRP A NE1   1 
ATOM   1982 C  CE2   . TRP A 1  272 ? 13.078  17.516  3.070   1.00 17.50 ?  412  TRP A CE2   1 
ATOM   1983 C  CE3   . TRP A 1  272 ? 12.268  15.423  2.151   1.00 16.10 ?  412  TRP A CE3   1 
ATOM   1984 C  CZ2   . TRP A 1  272 ? 13.338  18.022  1.813   1.00 17.54 ?  412  TRP A CZ2   1 
ATOM   1985 C  CZ3   . TRP A 1  272 ? 12.533  15.925  0.903   1.00 16.97 ?  412  TRP A CZ3   1 
ATOM   1986 C  CH2   . TRP A 1  272 ? 13.055  17.222  0.742   1.00 16.42 ?  412  TRP A CH2   1 
ATOM   1987 N  N     . LYS A 1  273 ? 12.635  12.339  3.886   1.00 14.82 ?  413  LYS A N     1 
ATOM   1988 C  CA    . LYS A 1  273 ? 13.000  11.730  2.619   1.00 15.52 ?  413  LYS A CA    1 
ATOM   1989 C  C     . LYS A 1  273 ? 11.804  11.757  1.676   1.00 13.94 ?  413  LYS A C     1 
ATOM   1990 O  O     . LYS A 1  273 ? 10.642  11.763  2.102   1.00 14.12 ?  413  LYS A O     1 
ATOM   1991 C  CB    . LYS A 1  273 ? 13.502  10.282  2.781   1.00 17.06 ?  413  LYS A CB    1 
ATOM   1992 C  CG    . LYS A 1  273 ? 12.475  9.304   3.264   1.00 15.55 ?  413  LYS A CG    1 
ATOM   1993 C  CD    . LYS A 1  273 ? 13.034  7.893   3.327   1.00 18.80 ?  413  LYS A CD    1 
ATOM   1994 C  CE    . LYS A 1  273 ? 11.978  6.941   3.875   1.00 22.11 ?  413  LYS A CE    1 
ATOM   1995 N  NZ    . LYS A 1  273 ? 12.355  5.504   3.722   1.00 23.48 ?  413  LYS A NZ    1 
ATOM   1996 N  N     . ALA A 1  274 ? 12.112  11.773  0.394   1.00 12.51 ?  414  ALA A N     1 
ATOM   1997 C  CA    . ALA A 1  274 ? 11.101  11.704  -0.638  1.00 11.73 ?  414  ALA A CA    1 
ATOM   1998 C  C     . ALA A 1  274 ? 10.655  10.258  -0.824  1.00 10.73 ?  414  ALA A C     1 
ATOM   1999 O  O     . ALA A 1  274 ? 11.492  9.350   -0.877  1.00 11.38 ?  414  ALA A O     1 
ATOM   2000 C  CB    . ALA A 1  274 ? 11.655  12.248  -1.939  1.00 13.37 ?  414  ALA A CB    1 
ATOM   2001 N  N     . VAL A 1  275 ? 9.340   10.056  -0.945  1.00 9.82  ?  415  VAL A N     1 
ATOM   2002 C  CA    A VAL A 1  275 ? 8.723   8.738   -1.125  0.58 9.43  ?  415  VAL A CA    1 
ATOM   2003 C  CA    B VAL A 1  275 ? 8.806   8.730   -1.215  0.42 9.10  ?  415  VAL A CA    1 
ATOM   2004 C  C     . VAL A 1  275 ? 7.682   8.829   -2.230  1.00 8.81  ?  415  VAL A C     1 
ATOM   2005 O  O     . VAL A 1  275 ? 6.886   9.773   -2.243  1.00 10.73 ?  415  VAL A O     1 
ATOM   2006 C  CB    A VAL A 1  275 ? 8.048   8.258   0.180   0.58 9.70  ?  415  VAL A CB    1 
ATOM   2007 C  CB    B VAL A 1  275 ? 8.324   8.024   0.065   0.42 9.53  ?  415  VAL A CB    1 
ATOM   2008 C  CG1   A VAL A 1  275 ? 7.391   6.886   -0.008  0.58 8.55  ?  415  VAL A CG1   1 
ATOM   2009 C  CG1   B VAL A 1  275 ? 9.503   7.754   0.994   0.42 10.31 ?  415  VAL A CG1   1 
ATOM   2010 C  CG2   A VAL A 1  275 ? 9.038   8.223   1.306   0.58 10.37 ?  415  VAL A CG2   1 
ATOM   2011 C  CG2   B VAL A 1  275 ? 7.234   8.827   0.751   0.42 9.89  ?  415  VAL A CG2   1 
ATOM   2012 N  N     . ARG A 1  276 ? 7.632   7.836   -3.098  1.00 7.59  ?  416  ARG A N     1 
ATOM   2013 C  CA    . ARG A 1  276 ? 6.555   7.724   -4.075  1.00 7.13  ?  416  ARG A CA    1 
ATOM   2014 C  C     . ARG A 1  276 ? 5.266   7.211   -3.424  1.00 6.66  ?  416  ARG A C     1 
ATOM   2015 O  O     . ARG A 1  276 ? 5.270   6.206   -2.694  1.00 6.39  ?  416  ARG A O     1 
ATOM   2016 C  CB    . ARG A 1  276 ? 6.997   6.795   -5.205  1.00 7.00  ?  416  ARG A CB    1 
ATOM   2017 C  CG    . ARG A 1  276 ? 7.894   7.453   -6.254  1.00 8.32  ?  416  ARG A CG    1 
ATOM   2018 C  CD    . ARG A 1  276 ? 7.082   8.167   -7.324  1.00 9.24  ?  416  ARG A CD    1 
ATOM   2019 N  NE    . ARG A 1  276 ? 6.285   7.195   -8.061  1.00 10.39 ?  416  ARG A NE    1 
ATOM   2020 C  CZ    . ARG A 1  276 ? 4.969   7.012   -7.955  1.00 10.33 ?  416  ARG A CZ    1 
ATOM   2021 N  NH1   . ARG A 1  276 ? 4.201   7.783   -7.200  1.00 8.61  ?  416  ARG A NH1   1 
ATOM   2022 N  NH2   . ARG A 1  276 ? 4.408   6.041   -8.645  1.00 10.40 ?  416  ARG A NH2   1 
ATOM   2023 N  N     . VAL A 1  277 ? 4.164   7.894   -3.711  1.00 8.18  ?  417  VAL A N     1 
ATOM   2024 C  CA    . VAL A 1  277 ? 2.853   7.528   -3.198  1.00 7.33  ?  417  VAL A CA    1 
ATOM   2025 C  C     . VAL A 1  277 ? 1.858   7.589   -4.345  1.00 8.62  ?  417  VAL A C     1 
ATOM   2026 O  O     . VAL A 1  277 ? 1.813   8.564   -5.099  1.00 8.95  ?  417  VAL A O     1 
ATOM   2027 C  CB    . VAL A 1  277 ? 2.420   8.439   -2.037  1.00 7.36  ?  417  VAL A CB    1 
ATOM   2028 C  CG1   . VAL A 1  277 ? 0.975   8.063   -1.584  1.00 9.24  ?  417  VAL A CG1   1 
ATOM   2029 C  CG2   . VAL A 1  277 ? 3.397   8.362   -0.917  1.00 7.79  ?  417  VAL A CG2   1 
ATOM   2030 N  N     . ASP A 1  278 ? 1.082   6.528   -4.502  1.00 7.52  ?  418  ASP A N     1 
ATOM   2031 C  CA    . ASP A 1  278 ? 0.025   6.461   -5.497  1.00 6.94  ?  418  ASP A CA    1 
ATOM   2032 C  C     . ASP A 1  278 ? -1.324  6.484   -4.792  1.00 7.81  ?  418  ASP A C     1 
ATOM   2033 O  O     . ASP A 1  278 ? -1.519  5.777   -3.799  1.00 8.44  ?  418  ASP A O     1 
ATOM   2034 C  CB    . ASP A 1  278 ? 0.133   5.210   -6.345  1.00 7.78  ?  418  ASP A CB    1 
ATOM   2035 C  CG    . ASP A 1  278 ? 1.341   5.236   -7.225  1.00 10.12 ?  418  ASP A CG    1 
ATOM   2036 O  OD1   . ASP A 1  278 ? 1.756   6.375   -7.588  1.00 11.36 ?  418  ASP A OD1   1 
ATOM   2037 O  OD2   . ASP A 1  278 ? 1.880   4.161   -7.559  1.00 10.21 ?  418  ASP A OD2   1 
ATOM   2038 N  N     . LEU A 1  279 ? -2.239  7.290   -5.313  1.00 7.22  ?  419  LEU A N     1 
ATOM   2039 C  CA    . LEU A 1  279 ? -3.598  7.414   -4.810  1.00 7.77  ?  419  LEU A CA    1 
ATOM   2040 C  C     . LEU A 1  279 ? -4.567  7.126   -5.940  1.00 9.41  ?  419  LEU A C     1 
ATOM   2041 O  O     . LEU A 1  279 ? -4.425  7.660   -7.053  1.00 9.64  ?  419  LEU A O     1 
ATOM   2042 C  CB    . LEU A 1  279 ? -3.875  8.826   -4.258  1.00 8.55  ?  419  LEU A CB    1 
ATOM   2043 C  CG    . LEU A 1  279 ? -2.943  9.321   -3.157  1.00 9.61  ?  419  LEU A CG    1 
ATOM   2044 C  CD1   . LEU A 1  279 ? -3.398  10.733  -2.771  1.00 14.11 ?  419  LEU A CD1   1 
ATOM   2045 C  CD2   . LEU A 1  279 ? -2.937  8.450   -1.967  1.00 11.80 ?  419  LEU A CD2   1 
ATOM   2046 N  N     A VAL A 1  280 ? -5.543  6.273   -5.676  0.34 5.87  ?  420  VAL A N     1 
ATOM   2047 N  N     B VAL A 1  280 ? -5.580  6.303   -5.650  0.66 6.40  ?  420  VAL A N     1 
ATOM   2048 C  CA    A VAL A 1  280 ? -6.625  6.059   -6.621  0.34 6.20  ?  420  VAL A CA    1 
ATOM   2049 C  CA    B VAL A 1  280 ? -6.630  5.951   -6.604  0.66 6.61  ?  420  VAL A CA    1 
ATOM   2050 C  C     A VAL A 1  280 ? -7.932  6.207   -5.863  0.34 5.99  ?  420  VAL A C     1 
ATOM   2051 C  C     B VAL A 1  280 ? -7.976  6.076   -5.904  0.66 5.96  ?  420  VAL A C     1 
ATOM   2052 O  O     A VAL A 1  280 ? -8.016  5.920   -4.666  0.34 6.04  ?  420  VAL A O     1 
ATOM   2053 O  O     B VAL A 1  280 ? -8.148  5.559   -4.802  0.66 6.77  ?  420  VAL A O     1 
ATOM   2054 C  CB    A VAL A 1  280 ? -6.522  4.687   -7.329  0.34 7.31  ?  420  VAL A CB    1 
ATOM   2055 C  CB    B VAL A 1  280 ? -6.447  4.524   -7.150  0.66 7.05  ?  420  VAL A CB    1 
ATOM   2056 C  CG1   A VAL A 1  280 ? -6.380  3.569   -6.320  0.34 6.06  ?  420  VAL A CG1   1 
ATOM   2057 C  CG1   B VAL A 1  280 ? -7.639  4.107   -8.031  0.66 8.46  ?  420  VAL A CG1   1 
ATOM   2058 C  CG2   A VAL A 1  280 ? -7.706  4.452   -8.277  0.34 6.78  ?  420  VAL A CG2   1 
ATOM   2059 C  CG2   B VAL A 1  280 ? -5.135  4.428   -7.947  0.66 8.39  ?  420  VAL A CG2   1 
ATOM   2060 N  N     . VAL A 1  281 ? -8.938  6.714   -6.567  1.00 6.93  ?  421  VAL A N     1 
ATOM   2061 C  CA    . VAL A 1  281 ? -10.295 6.840   -6.061  1.00 7.80  ?  421  VAL A CA    1 
ATOM   2062 C  C     . VAL A 1  281 ? -11.195 5.953   -6.906  1.00 8.97  ?  421  VAL A C     1 
ATOM   2063 O  O     . VAL A 1  281 ? -11.118 5.971   -8.142  1.00 11.18 ?  421  VAL A O     1 
ATOM   2064 C  CB    . VAL A 1  281 ? -10.774 8.304   -6.106  1.00 7.87  ?  421  VAL A CB    1 
ATOM   2065 C  CG1   . VAL A 1  281 ? -12.256 8.387   -5.707  1.00 10.53 ?  421  VAL A CG1   1 
ATOM   2066 C  CG2   . VAL A 1  281 ? -9.951  9.164   -5.179  1.00 10.32 ?  421  VAL A CG2   1 
ATOM   2067 N  N     . ALA A 1  282 ? -12.082 5.212   -6.253  1.00 6.85  ?  422  ALA A N     1 
ATOM   2068 C  CA    . ALA A 1  282 ? -13.071 4.401   -6.928  1.00 7.58  ?  422  ALA A CA    1 
ATOM   2069 C  C     . ALA A 1  282 ? -14.412 4.539   -6.228  1.00 7.94  ?  422  ALA A C     1 
ATOM   2070 O  O     . ALA A 1  282 ? -14.467 4.725   -5.006  1.00 9.41  ?  422  ALA A O     1 
ATOM   2071 C  CB    . ALA A 1  282 ? -12.673 2.918   -6.919  1.00 9.62  ?  422  ALA A CB    1 
ATOM   2072 N  N     . PRO A 1  283 ? -15.503 4.474   -6.980  1.00 9.40  ?  423  PRO A N     1 
ATOM   2073 C  CA    . PRO A 1  283 ? -16.823 4.366   -6.344  1.00 10.64 ?  423  PRO A CA    1 
ATOM   2074 C  C     . PRO A 1  283 ? -16.978 3.045   -5.607  1.00 11.90 ?  423  PRO A C     1 
ATOM   2075 O  O     . PRO A 1  283 ? -16.381 2.026   -5.968  1.00 11.45 ?  423  PRO A O     1 
ATOM   2076 C  CB    . PRO A 1  283 ? -17.793 4.456   -7.523  1.00 13.07 ?  423  PRO A CB    1 
ATOM   2077 C  CG    . PRO A 1  283 ? -17.029 4.077   -8.693  1.00 15.42 ?  423  PRO A CG    1 
ATOM   2078 C  CD    . PRO A 1  283 ? -15.584 4.426   -8.439  1.00 11.45 ?  423  PRO A CD    1 
ATOM   2079 N  N     . VAL A 1  284 ? -17.782 3.059   -4.548  1.00 10.44 ?  424  VAL A N     1 
ATOM   2080 C  CA    . VAL A 1  284 ? -17.867 1.863   -3.730  1.00 10.99 ?  424  VAL A CA    1 
ATOM   2081 C  C     . VAL A 1  284 ? -18.407 0.674   -4.535  1.00 10.67 ?  424  VAL A C     1 
ATOM   2082 O  O     . VAL A 1  284 ? -18.007 -0.468  -4.282  1.00 10.55 ?  424  VAL A O     1 
ATOM   2083 C  CB    . VAL A 1  284 ? -18.666 2.126   -2.430  1.00 13.14 ?  424  VAL A CB    1 
ATOM   2084 C  CG1   . VAL A 1  284 ? -20.124 2.415   -2.692  1.00 14.44 ?  424  VAL A CG1   1 
ATOM   2085 C  CG2   . VAL A 1  284 ? -18.511 0.955   -1.479  1.00 16.15 ?  424  VAL A CG2   1 
ATOM   2086 N  N     . SER A 1  285 ? -19.236 0.912   -5.556  1.00 13.40 ?  425  SER A N     1 
ATOM   2087 C  CA    . SER A 1  285 ? -19.724 -0.195  -6.379  1.00 13.34 ?  425  SER A CA    1 
ATOM   2088 C  C     . SER A 1  285 ? -18.587 -0.918  -7.088  1.00 13.74 ?  425  SER A C     1 
ATOM   2089 O  O     . SER A 1  285 ? -18.691 -2.114  -7.392  1.00 15.80 ?  425  SER A O     1 
ATOM   2090 C  CB    . SER A 1  285 ? -20.720 0.322   -7.420  1.00 16.25 ?  425  SER A CB    1 
ATOM   2091 O  OG    . SER A 1  285 ? -20.100 1.273   -8.274  1.00 16.18 ?  425  SER A OG    1 
ATOM   2092 N  N     . GLN A 1  286 ? -17.503 -0.215  -7.375  1.00 10.67 ?  426  GLN A N     1 
ATOM   2093 C  CA    . GLN A 1  286 ? -16.351 -0.772  -8.078  1.00 9.88  ?  426  GLN A CA    1 
ATOM   2094 C  C     . GLN A 1  286 ? -15.228 -1.154  -7.133  1.00 8.93  ?  426  GLN A C     1 
ATOM   2095 O  O     . GLN A 1  286 ? -14.208 -1.679  -7.590  1.00 9.55  ?  426  GLN A O     1 
ATOM   2096 C  CB    . GLN A 1  286 ? -15.791 0.234   -9.077  1.00 11.10 ?  426  GLN A CB    1 
ATOM   2097 C  CG    . GLN A 1  286 ? -16.753 0.560   -10.180 1.00 12.31 ?  426  GLN A CG    1 
ATOM   2098 C  CD    . GLN A 1  286 ? -16.237 1.593   -11.135 1.00 13.97 ?  426  GLN A CD    1 
ATOM   2099 O  OE1   . GLN A 1  286 ? -15.080 2.033   -11.083 1.00 14.61 ?  426  GLN A OE1   1 
ATOM   2100 N  NE2   . GLN A 1  286 ? -17.117 2.019   -12.022 1.00 18.04 ?  426  GLN A NE2   1 
ATOM   2101 N  N     . PHE A 1  287 ? -15.381 -0.884  -5.838  1.00 9.69  ?  427  PHE A N     1 
ATOM   2102 C  CA    . PHE A 1  287 ? -14.254 -1.054  -4.933  1.00 8.85  ?  427  PHE A CA    1 
ATOM   2103 C  C     . PHE A 1  287 ? -13.665 -2.455  -4.958  1.00 8.28  ?  427  PHE A C     1 
ATOM   2104 O  O     . PHE A 1  287 ? -12.432 -2.563  -4.917  1.00 7.39  ?  427  PHE A O     1 
ATOM   2105 C  CB    . PHE A 1  287 ? -14.678 -0.627  -3.525  1.00 11.80 ?  427  PHE A CB    1 
ATOM   2106 C  CG    . PHE A 1  287 ? -13.624 -0.836  -2.484  1.00 9.97  ?  427  PHE A CG    1 
ATOM   2107 C  CD1   . PHE A 1  287 ? -12.673 0.133   -2.223  1.00 11.28 ?  427  PHE A CD1   1 
ATOM   2108 C  CD2   . PHE A 1  287 ? -13.593 -1.999  -1.775  1.00 9.86  ?  427  PHE A CD2   1 
ATOM   2109 C  CE1   . PHE A 1  287 ? -11.706 -0.074  -1.233  1.00 10.20 ?  427  PHE A CE1   1 
ATOM   2110 C  CE2   . PHE A 1  287 ? -12.631 -2.220  -0.815  1.00 10.66 ?  427  PHE A CE2   1 
ATOM   2111 C  CZ    . PHE A 1  287 ? -11.684 -1.257  -0.548  1.00 9.83  ?  427  PHE A CZ    1 
ATOM   2112 N  N     . PRO A 1  288 ? -14.436 -3.542  -4.979  1.00 7.07  ?  428  PRO A N     1 
ATOM   2113 C  CA    . PRO A 1  288 ? -13.807 -4.872  -5.041  1.00 7.72  ?  428  PRO A CA    1 
ATOM   2114 C  C     . PRO A 1  288 ? -12.929 -5.056  -6.258  1.00 6.70  ?  428  PRO A C     1 
ATOM   2115 O  O     . PRO A 1  288 ? -11.855 -5.667  -6.182  1.00 6.30  ?  428  PRO A O     1 
ATOM   2116 C  CB    . PRO A 1  288 ? -15.012 -5.828  -5.054  1.00 9.05  ?  428  PRO A CB    1 
ATOM   2117 C  CG    . PRO A 1  288 ? -16.123 -5.046  -4.435  1.00 11.49 ?  428  PRO A CG    1 
ATOM   2118 C  CD    . PRO A 1  288 ? -15.899 -3.612  -4.843  1.00 8.98  ?  428  PRO A CD    1 
ATOM   2119 N  N     . PHE A 1  289 ? -13.347 -4.514  -7.393  1.00 6.55  ?  429  PHE A N     1 
ATOM   2120 C  CA    . PHE A 1  289 ? -12.554 -4.649  -8.602  1.00 6.32  ?  429  PHE A CA    1 
ATOM   2121 C  C     . PHE A 1  289 ? -11.296 -3.802  -8.509  1.00 6.32  ?  429  PHE A C     1 
ATOM   2122 O  O     . PHE A 1  289 ? -10.220 -4.190  -8.989  1.00 6.08  ?  429  PHE A O     1 
ATOM   2123 C  CB    . PHE A 1  289 ? -13.383 -4.223  -9.820  1.00 6.44  ?  429  PHE A CB    1 
ATOM   2124 C  CG    . PHE A 1  289 ? -14.584 -5.088  -10.038 1.00 6.97  ?  429  PHE A CG    1 
ATOM   2125 C  CD1   . PHE A 1  289 ? -14.444 -6.308  -10.621 1.00 7.03  ?  429  PHE A CD1   1 
ATOM   2126 C  CD2   . PHE A 1  289 ? -15.843 -4.678  -9.624  1.00 10.02 ?  429  PHE A CD2   1 
ATOM   2127 C  CE1   . PHE A 1  289 ? -15.552 -7.128  -10.794 1.00 8.10  ?  429  PHE A CE1   1 
ATOM   2128 C  CE2   . PHE A 1  289 ? -16.921 -5.497  -9.794  1.00 10.64 ?  429  PHE A CE2   1 
ATOM   2129 C  CZ    . PHE A 1  289 ? -16.776 -6.702  -10.377 1.00 9.65  ?  429  PHE A CZ    1 
ATOM   2130 N  N     . ALA A 1  290 ? -11.421 -2.618  -7.925  1.00 7.13  ?  430  ALA A N     1 
ATOM   2131 C  CA    . ALA A 1  290 ? -10.253 -1.752  -7.802  1.00 6.53  ?  430  ALA A CA    1 
ATOM   2132 C  C     . ALA A 1  290 ? -9.261  -2.327  -6.799  1.00 6.50  ?  430  ALA A C     1 
ATOM   2133 O  O     . ALA A 1  290 ? -8.032  -2.311  -7.020  1.00 6.13  ?  430  ALA A O     1 
ATOM   2134 C  CB    . ALA A 1  290 ? -10.688 -0.352  -7.380  1.00 8.29  ?  430  ALA A CB    1 
ATOM   2135 N  N     . LEU A 1  291 ? -9.772  -2.841  -5.678  1.00 6.39  ?  431  LEU A N     1 
ATOM   2136 C  CA    . LEU A 1  291 ? -8.911  -3.469  -4.689  1.00 5.10  ?  431  LEU A CA    1 
ATOM   2137 C  C     . LEU A 1  291 ? -8.172  -4.650  -5.297  1.00 5.52  ?  431  LEU A C     1 
ATOM   2138 O  O     . LEU A 1  291 ? -6.957  -4.787  -5.124  1.00 5.71  ?  431  LEU A O     1 
ATOM   2139 C  CB    . LEU A 1  291 ? -9.739  -3.896  -3.479  1.00 6.13  ?  431  LEU A CB    1 
ATOM   2140 C  CG    . LEU A 1  291 ? -8.917  -4.486  -2.353  1.00 7.55  ?  431  LEU A CG    1 
ATOM   2141 C  CD1   . LEU A 1  291 ? -7.954  -3.491  -1.770  1.00 7.26  ?  431  LEU A CD1   1 
ATOM   2142 C  CD2   . LEU A 1  291 ? -9.880  -4.971  -1.286  1.00 7.36  ?  431  LEU A CD2   1 
ATOM   2143 N  N     . LEU A 1  292 ? -8.865  -5.464  -6.074  1.00 5.62  ?  432  LEU A N     1 
ATOM   2144 C  CA    . LEU A 1  292 ? -8.220  -6.593  -6.715  1.00 5.56  ?  432  LEU A CA    1 
ATOM   2145 C  C     . LEU A 1  292 ? -7.144  -6.113  -7.674  1.00 4.78  ?  432  LEU A C     1 
ATOM   2146 O  O     . LEU A 1  292 ? -5.994  -6.579  -7.638  1.00 6.25  ?  432  LEU A O     1 
ATOM   2147 C  CB    . LEU A 1  292 ? -9.291  -7.411  -7.432  1.00 6.83  ?  432  LEU A CB    1 
ATOM   2148 C  CG    . LEU A 1  292 ? -8.818  -8.646  -8.180  1.00 7.02  ?  432  LEU A CG    1 
ATOM   2149 C  CD1   . LEU A 1  292 ? -8.243  -9.657  -7.225  1.00 7.40  ?  432  LEU A CD1   1 
ATOM   2150 C  CD2   . LEU A 1  292 ? -9.972  -9.238  -8.968  1.00 7.95  ?  432  LEU A CD2   1 
ATOM   2151 N  N     . ALA A 1  293 ? -7.490  -5.140  -8.522  1.00 5.58  ?  433  ALA A N     1 
ATOM   2152 C  CA    . ALA A 1  293 ? -6.575  -4.671  -9.557  1.00 5.72  ?  433  ALA A CA    1 
ATOM   2153 C  C     . ALA A 1  293 ? -5.325  -4.041  -8.976  1.00 6.25  ?  433  ALA A C     1 
ATOM   2154 O  O     . ALA A 1  293 ? -4.223  -4.220  -9.519  1.00 7.90  ?  433  ALA A O     1 
ATOM   2155 C  CB    . ALA A 1  293 ? -7.286  -3.656  -10.454 1.00 6.30  ?  433  ALA A CB    1 
ATOM   2156 N  N     . TRP A 1  294 ? -5.463  -3.283  -7.901  1.00 5.94  ?  434  TRP A N     1 
ATOM   2157 C  CA    . TRP A 1  294 ? -4.321  -2.536  -7.384  1.00 5.41  ?  434  TRP A CA    1 
ATOM   2158 C  C     . TRP A 1  294 ? -3.551  -3.290  -6.304  1.00 5.61  ?  434  TRP A C     1 
ATOM   2159 O  O     . TRP A 1  294 ? -2.489  -2.818  -5.890  1.00 6.31  ?  434  TRP A O     1 
ATOM   2160 C  CB    . TRP A 1  294 ? -4.772  -1.152  -6.869  1.00 6.77  ?  434  TRP A CB    1 
ATOM   2161 C  CG    . TRP A 1  294 ? -5.367  -0.315  -7.995  1.00 8.07  ?  434  TRP A CG    1 
ATOM   2162 C  CD1   . TRP A 1  294 ? -6.631  0.161   -8.065  1.00 9.28  ?  434  TRP A CD1   1 
ATOM   2163 C  CD2   . TRP A 1  294 ? -4.742  0.044   -9.234  1.00 13.29 ?  434  TRP A CD2   1 
ATOM   2164 N  NE1   . TRP A 1  294 ? -6.834  0.831   -9.239  1.00 12.08 ?  434  TRP A NE1   1 
ATOM   2165 C  CE2   . TRP A 1  294 ? -5.690  0.775   -9.980  1.00 16.69 ?  434  TRP A CE2   1 
ATOM   2166 C  CE3   . TRP A 1  294 ? -3.479  -0.172  -9.783  1.00 18.40 ?  434  TRP A CE3   1 
ATOM   2167 C  CZ2   . TRP A 1  294 ? -5.415  1.290   -11.243 1.00 21.91 ?  434  TRP A CZ2   1 
ATOM   2168 C  CZ3   . TRP A 1  294 ? -3.211  0.341   -11.045 1.00 25.63 ?  434  TRP A CZ3   1 
ATOM   2169 C  CH2   . TRP A 1  294 ? -4.172  1.066   -11.755 1.00 22.86 ?  434  TRP A CH2   1 
ATOM   2170 N  N     . THR A 1  295 ? -4.030  -4.456  -5.849  1.00 4.62  ?  435  THR A N     1 
ATOM   2171 C  CA    . THR A 1  295 ? -3.273  -5.277  -4.900  1.00 4.32  ?  435  THR A CA    1 
ATOM   2172 C  C     . THR A 1  295 ? -2.225  -6.123  -5.610  1.00 5.30  ?  435  THR A C     1 
ATOM   2173 O  O     . THR A 1  295 ? -1.182  -6.435  -5.022  1.00 7.00  ?  435  THR A O     1 
ATOM   2174 C  CB    . THR A 1  295 ? -4.249  -6.129  -4.077  1.00 5.17  ?  435  THR A CB    1 
ATOM   2175 O  OG1   . THR A 1  295 ? -5.033  -5.261  -3.261  1.00 6.47  ?  435  THR A OG1   1 
ATOM   2176 C  CG2   . THR A 1  295 ? -3.524  -7.096  -3.181  1.00 6.38  ?  435  THR A CG2   1 
ATOM   2177 N  N     . GLY A 1  296 ? -2.471  -6.492  -6.851  1.00 5.68  ?  436  GLY A N     1 
ATOM   2178 C  CA    . GLY A 1  296 ? -1.454  -7.172  -7.659  1.00 5.69  ?  436  GLY A CA    1 
ATOM   2179 C  C     . GLY A 1  296 ? -1.264  -8.650  -7.291  1.00 5.52  ?  436  GLY A C     1 
ATOM   2180 O  O     . GLY A 1  296 ? -2.219  -9.286  -6.774  1.00 6.86  ?  436  GLY A O     1 
ATOM   2181 N  N     . SER A 1  297 ? -0.085  -9.221  -7.543  1.00 4.27  ?  437  SER A N     1 
ATOM   2182 C  CA    . SER A 1  297 ? 1.011   -8.595  -8.243  1.00 5.44  ?  437  SER A CA    1 
ATOM   2183 C  C     . SER A 1  297 ? 0.645   -8.237  -9.685  1.00 5.80  ?  437  SER A C     1 
ATOM   2184 O  O     . SER A 1  297 ? -0.415  -8.630  -10.182 1.00 5.98  ?  437  SER A O     1 
ATOM   2185 C  CB    . SER A 1  297 ? 2.204   -9.520  -8.236  1.00 6.16  ?  437  SER A CB    1 
ATOM   2186 O  OG    . SER A 1  297 ? 1.948   -10.616 -9.135  1.00 6.35  ?  437  SER A OG    1 
ATOM   2187 N  N     . LYS A 1  298 ? 1.532   -7.467  -10.327 1.00 5.76  ?  438  LYS A N     1 
ATOM   2188 C  CA    . LYS A 1  298 ? 1.354   -7.119  -11.734 1.00 4.66  ?  438  LYS A CA    1 
ATOM   2189 C  C     . LYS A 1  298 ? 1.145   -8.372  -12.586 1.00 6.43  ?  438  LYS A C     1 
ATOM   2190 O  O     . LYS A 1  298 ? 0.190   -8.462  -13.371 1.00 6.39  ?  438  LYS A O     1 
ATOM   2191 C  CB    . LYS A 1  298 ? 2.562   -6.330  -12.212 1.00 6.72  ?  438  LYS A CB    1 
ATOM   2192 C  CG    . LYS A 1  298 ? 2.518   -5.992  -13.680 1.00 11.13 ?  438  LYS A CG    1 
ATOM   2193 C  CD    . LYS A 1  298 ? 3.701   -5.104  -14.047 1.00 14.69 ?  438  LYS A CD    1 
ATOM   2194 C  CE    . LYS A 1  298 ? 3.751   -4.828  -15.540 1.00 17.74 ?  438  LYS A CE    1 
ATOM   2195 N  NZ    . LYS A 1  298 ? 4.592   -3.602  -15.847 1.00 20.11 ?  438  LYS A NZ    1 
ATOM   2196 N  N     . LEU A 1  299 ? 2.030   -9.356  -12.452 1.00 6.59  ?  439  LEU A N     1 
ATOM   2197 C  CA    . LEU A 1  299 ? 1.855   -10.578 -13.225 1.00 6.45  ?  439  LEU A CA    1 
ATOM   2198 C  C     . LEU A 1  299 ? 0.563   -11.290 -12.850 1.00 6.32  ?  439  LEU A C     1 
ATOM   2199 O  O     . LEU A 1  299 ? -0.139  -11.797 -13.725 1.00 6.53  ?  439  LEU A O     1 
ATOM   2200 C  CB    . LEU A 1  299 ? 3.046   -11.510 -13.036 1.00 7.80  ?  439  LEU A CB    1 
ATOM   2201 C  CG    . LEU A 1  299 ? 2.927   -12.838 -13.796 1.00 8.47  ?  439  LEU A CG    1 
ATOM   2202 C  CD1   . LEU A 1  299 ? 2.828   -12.572 -15.283 1.00 9.67  ?  439  LEU A CD1   1 
ATOM   2203 C  CD2   . LEU A 1  299 ? 4.075   -13.789 -13.472 1.00 9.78  ?  439  LEU A CD2   1 
ATOM   2204 N  N     . PHE A 1  300 ? 0.211   -11.333 -11.554 1.00 6.44  ?  440  PHE A N     1 
ATOM   2205 C  CA    . PHE A 1  300 ? -1.041  -11.979 -11.166 1.00 5.87  ?  440  PHE A CA    1 
ATOM   2206 C  C     . PHE A 1  300 ? -2.230  -11.346 -11.893 1.00 6.66  ?  440  PHE A C     1 
ATOM   2207 O  O     . PHE A 1  300 ? -3.125  -12.054 -12.370 1.00 7.79  ?  440  PHE A O     1 
ATOM   2208 C  CB    . PHE A 1  300 ? -1.225  -11.899 -9.637  1.00 6.31  ?  440  PHE A CB    1 
ATOM   2209 C  CG    . PHE A 1  300 ? -2.372  -12.688 -9.117  1.00 6.90  ?  440  PHE A CG    1 
ATOM   2210 C  CD1   . PHE A 1  300 ? -3.633  -12.161 -9.117  1.00 7.83  ?  440  PHE A CD1   1 
ATOM   2211 C  CD2   . PHE A 1  300 ? -2.187  -13.982 -8.648  1.00 8.63  ?  440  PHE A CD2   1 
ATOM   2212 C  CE1   . PHE A 1  300 ? -4.714  -12.899 -8.629  1.00 7.67  ?  440  PHE A CE1   1 
ATOM   2213 C  CE2   . PHE A 1  300 ? -3.255  -14.700 -8.161  1.00 10.03 ?  440  PHE A CE2   1 
ATOM   2214 C  CZ    . PHE A 1  300 ? -4.510  -14.162 -8.164  1.00 8.73  ?  440  PHE A CZ    1 
ATOM   2215 N  N     . GLN A 1  301 ? -2.279  -10.015 -11.957 1.00 6.67  ?  441  GLN A N     1 
ATOM   2216 C  CA    . GLN A 1  301 ? -3.415  -9.348  -12.588 1.00 7.06  ?  441  GLN A CA    1 
ATOM   2217 C  C     . GLN A 1  301 ? -3.435  -9.569  -14.096 1.00 7.13  ?  441  GLN A C     1 
ATOM   2218 O  O     . GLN A 1  301 ? -4.509  -9.748  -14.666 1.00 7.40  ?  441  GLN A O     1 
ATOM   2219 C  CB    . GLN A 1  301 ? -3.413  -7.859  -12.276 1.00 9.07  ?  441  GLN A CB    1 
ATOM   2220 C  CG    . GLN A 1  301 ? -3.669  -7.555  -10.789 1.00 9.73  ?  441  GLN A CG    1 
ATOM   2221 C  CD    . GLN A 1  301 ? -4.936  -8.167  -10.285 1.00 11.53 ?  441  GLN A CD    1 
ATOM   2222 O  OE1   . GLN A 1  301 ? -5.993  -7.997  -10.879 1.00 11.59 ?  441  GLN A OE1   1 
ATOM   2223 N  NE2   . GLN A 1  301 ? -4.839  -8.939  -9.208  1.00 13.87 ?  441  GLN A NE2   1 
ATOM   2224 N  N     . ARG A 1  302 ? -2.272  -9.544  -14.745 1.00 6.70  ?  442  ARG A N     1 
ATOM   2225 C  CA    . ARG A 1  302 ? -2.232  -9.843  -16.173 1.00 6.89  ?  442  ARG A CA    1 
ATOM   2226 C  C     . ARG A 1  302 ? -2.753  -11.247 -16.443 1.00 7.09  ?  442  ARG A C     1 
ATOM   2227 O  O     . ARG A 1  302 ? -3.564  -11.456 -17.354 1.00 9.05  ?  442  ARG A O     1 
ATOM   2228 C  CB    . ARG A 1  302 ? -0.815  -9.691  -16.705 1.00 8.25  ?  442  ARG A CB    1 
ATOM   2229 C  CG    . ARG A 1  302 ? -0.321  -8.281  -16.704 1.00 9.19  ?  442  ARG A CG    1 
ATOM   2230 C  CD    . ARG A 1  302 ? 1.143   -8.176  -17.080 1.00 10.38 ?  442  ARG A CD    1 
ATOM   2231 N  NE    . ARG A 1  302 ? 1.306   -8.367  -18.521 1.00 10.88 ?  442  ARG A NE    1 
ATOM   2232 C  CZ    . ARG A 1  302 ? 2.324   -7.893  -19.229 1.00 15.18 ?  442  ARG A CZ    1 
ATOM   2233 N  NH1   . ARG A 1  302 ? 3.332   -7.247  -18.638 1.00 15.15 ?  442  ARG A NH1   1 
ATOM   2234 N  NH2   . ARG A 1  302 ? 2.327   -8.055  -20.546 1.00 12.92 ?  442  ARG A NH2   1 
ATOM   2235 N  N     . GLU A 1  303 ? -2.339  -12.212 -15.622 1.00 7.42  ?  443  GLU A N     1 
ATOM   2236 C  CA    . GLU A 1  303 ? -2.764  -13.589 -15.790 1.00 7.89  ?  443  GLU A CA    1 
ATOM   2237 C  C     . GLU A 1  303 ? -4.246  -13.743 -15.498 1.00 9.09  ?  443  GLU A C     1 
ATOM   2238 O  O     . GLU A 1  303 ? -4.958  -14.478 -16.204 1.00 9.70  ?  443  GLU A O     1 
ATOM   2239 C  CB    . GLU A 1  303 ? -1.927  -14.482 -14.883 1.00 10.21 ?  443  GLU A CB    1 
ATOM   2240 C  CG    . GLU A 1  303 ? -0.475  -14.544 -15.271 1.00 9.96  ?  443  GLU A CG    1 
ATOM   2241 C  CD    . GLU A 1  303 ? -0.251  -15.567 -16.369 1.00 18.34 ?  443  GLU A CD    1 
ATOM   2242 O  OE1   . GLU A 1  303 ? -0.380  -16.786 -16.095 1.00 15.95 ?  443  GLU A OE1   1 
ATOM   2243 O  OE2   . GLU A 1  303 ? 0.030   -15.133 -17.487 1.00 16.28 ?  443  GLU A OE2   1 
ATOM   2244 N  N     . LEU A 1  304 ? -4.745  -13.053 -14.463 1.00 7.46  ?  444  LEU A N     1 
ATOM   2245 C  CA    . LEU A 1  304 ? -6.168  -13.114 -14.133 1.00 6.25  ?  444  LEU A CA    1 
ATOM   2246 C  C     . LEU A 1  304 ? -7.023  -12.541 -15.252 1.00 7.83  ?  444  LEU A C     1 
ATOM   2247 O  O     . LEU A 1  304 ? -8.082  -13.102 -15.587 1.00 8.78  ?  444  LEU A O     1 
ATOM   2248 C  CB    . LEU A 1  304 ? -6.435  -12.363 -12.830 1.00 8.19  ?  444  LEU A CB    1 
ATOM   2249 C  CG    . LEU A 1  304 ? -7.844  -12.424 -12.276 1.00 9.33  ?  444  LEU A CG    1 
ATOM   2250 C  CD1   . LEU A 1  304 ? -8.172  -13.842 -11.898 1.00 10.07 ?  444  LEU A CD1   1 
ATOM   2251 C  CD2   . LEU A 1  304 ? -7.968  -11.522 -11.047 1.00 9.94  ?  444  LEU A CD2   1 
ATOM   2252 N  N     . ARG A 1  305 ? -6.601  -11.411 -15.823 1.00 8.42  ?  445  ARG A N     1 
ATOM   2253 C  CA    . ARG A 1  305 ? -7.329  -10.804 -16.925 1.00 7.99  ?  445  ARG A CA    1 
ATOM   2254 C  C     . ARG A 1  305 ? -7.251  -11.694 -18.164 1.00 10.28 ?  445  ARG A C     1 
ATOM   2255 O  O     . ARG A 1  305 ? -8.237  -11.835 -18.895 1.00 10.48 ?  445  ARG A O     1 
ATOM   2256 C  CB    . ARG A 1  305 ? -6.763  -9.414  -17.187 1.00 8.23  ?  445  ARG A CB    1 
ATOM   2257 C  CG    . ARG A 1  305 ? -7.103  -8.428  -16.068 1.00 8.12  ?  445  ARG A CG    1 
ATOM   2258 C  CD    . ARG A 1  305 ? -6.270  -7.204  -16.111 1.00 8.14  ?  445  ARG A CD    1 
ATOM   2259 N  NE    . ARG A 1  305 ? -6.666  -6.368  -14.987 1.00 8.95  ?  445  ARG A NE    1 
ATOM   2260 C  CZ    . ARG A 1  305 ? -6.396  -5.075  -14.856 1.00 10.71 ?  445  ARG A CZ    1 
ATOM   2261 N  NH1   . ARG A 1  305 ? -5.636  -4.440  -15.734 1.00 10.55 ?  445  ARG A NH1   1 
ATOM   2262 N  NH2   . ARG A 1  305 ? -6.821  -4.437  -13.771 1.00 10.02 ?  445  ARG A NH2   1 
ATOM   2263 N  N     . ARG A 1  306 ? -6.105  -12.332 -18.387 1.00 8.77  ?  446  ARG A N     1 
ATOM   2264 C  CA    . ARG A 1  306 ? -5.986  -13.253 -19.518 1.00 9.40  ?  446  ARG A CA    1 
ATOM   2265 C  C     . ARG A 1  306 ? -6.885  -14.459 -19.316 1.00 10.52 ?  446  ARG A C     1 
ATOM   2266 O  O     . ARG A 1  306 ? -7.610  -14.870 -20.240 1.00 12.00 ?  446  ARG A O     1 
ATOM   2267 C  CB    . ARG A 1  306 ? -4.536  -13.687 -19.685 1.00 10.04 ?  446  ARG A CB    1 
ATOM   2268 C  CG    . ARG A 1  306 ? -4.258  -14.551 -20.899 1.00 11.61 ?  446  ARG A CG    1 
ATOM   2269 C  CD    . ARG A 1  306 ? -2.771  -14.722 -21.086 1.00 13.73 ?  446  ARG A CD    1 
ATOM   2270 N  NE    . ARG A 1  306 ? -2.062  -15.505 -20.071 1.00 13.79 ?  446  ARG A NE    1 
ATOM   2271 C  CZ    . ARG A 1  306 ? -1.779  -16.805 -20.174 1.00 18.36 ?  446  ARG A CZ    1 
ATOM   2272 N  NH1   . ARG A 1  306 ? -2.220  -17.508 -21.216 1.00 19.43 ?  446  ARG A NH1   1 
ATOM   2273 N  NH2   . ARG A 1  306 ? -1.074  -17.425 -19.228 1.00 17.56 ?  446  ARG A NH2   1 
ATOM   2274 N  N     . PHE A 1  307 ? -6.884  -15.008 -18.099 1.00 9.70  ?  447  PHE A N     1 
ATOM   2275 C  CA    . PHE A 1  307 ? -7.739  -16.141 -17.765 1.00 9.71  ?  447  PHE A CA    1 
ATOM   2276 C  C     . PHE A 1  307 ? -9.205  -15.795 -17.976 1.00 12.39 ?  447  PHE A C     1 
ATOM   2277 O  O     . PHE A 1  307 ? -9.961  -16.555 -18.604 1.00 13.06 ?  447  PHE A O     1 
ATOM   2278 C  CB    . PHE A 1  307 ? -7.484  -16.564 -16.310 1.00 9.67  ?  447  PHE A CB    1 
ATOM   2279 C  CG    . PHE A 1  307 ? -8.379  -17.668 -15.836 1.00 12.11 ?  447  PHE A CG    1 
ATOM   2280 C  CD1   . PHE A 1  307 ? -8.024  -18.989 -16.038 1.00 13.85 ?  447  PHE A CD1   1 
ATOM   2281 C  CD2   . PHE A 1  307 ? -9.570  -17.391 -15.219 1.00 12.12 ?  447  PHE A CD2   1 
ATOM   2282 C  CE1   . PHE A 1  307 ? -8.844  -20.012 -15.612 1.00 14.32 ?  447  PHE A CE1   1 
ATOM   2283 C  CE2   . PHE A 1  307 ? -10.397 -18.412 -14.785 1.00 14.18 ?  447  PHE A CE2   1 
ATOM   2284 C  CZ    . PHE A 1  307 ? -10.037 -19.723 -14.994 1.00 15.09 ?  447  PHE A CZ    1 
ATOM   2285 N  N     A SER A 1  308 ? -9.635  -14.670 -17.417 0.72 10.10 ?  448  SER A N     1 
ATOM   2286 N  N     B SER A 1  308 ? -9.637  -14.634 -17.481 0.28 9.85  ?  448  SER A N     1 
ATOM   2287 C  CA    A SER A 1  308 ? -11.013 -14.240 -17.552 0.72 10.01 ?  448  SER A CA    1 
ATOM   2288 C  CA    B SER A 1  308 ? -11.054 -14.298 -17.557 0.28 10.09 ?  448  SER A CA    1 
ATOM   2289 C  C     A SER A 1  308 ? -11.434 -14.234 -19.015 0.72 11.74 ?  448  SER A C     1 
ATOM   2290 C  C     B SER A 1  308 ? -11.503 -14.131 -19.005 0.28 11.62 ?  448  SER A C     1 
ATOM   2291 O  O     A SER A 1  308 ? -12.455 -14.833 -19.383 0.72 12.50 ?  448  SER A O     1 
ATOM   2292 O  O     B SER A 1  308 ? -12.630 -14.508 -19.356 0.28 12.57 ?  448  SER A O     1 
ATOM   2293 C  CB    A SER A 1  308 ? -11.152 -12.856 -16.922 0.72 9.81  ?  448  SER A CB    1 
ATOM   2294 C  CB    B SER A 1  308 ? -11.343 -13.032 -16.749 0.28 9.73  ?  448  SER A CB    1 
ATOM   2295 O  OG    A SER A 1  308 ? -12.494 -12.438 -16.925 0.72 11.24 ?  448  SER A OG    1 
ATOM   2296 O  OG    B SER A 1  308 ? -10.873 -11.875 -17.415 0.28 9.33  ?  448  SER A OG    1 
ATOM   2297 N  N     . ARG A 1  309 ? -10.642 -13.576 -19.864 1.00 13.08 ?  449  ARG A N     1 
ATOM   2298 C  CA    . ARG A 1  309 ? -11.039 -13.358 -21.259 1.00 14.53 ?  449  ARG A CA    1 
ATOM   2299 C  C     . ARG A 1  309 ? -10.932 -14.642 -22.070 1.00 15.33 ?  449  ARG A C     1 
ATOM   2300 O  O     . ARG A 1  309 ? -11.864 -14.997 -22.807 1.00 17.59 ?  449  ARG A O     1 
ATOM   2301 C  CB    . ARG A 1  309 ? -10.191 -12.248 -21.889 1.00 15.61 ?  449  ARG A CB    1 
ATOM   2302 C  CG    . ARG A 1  309 ? -10.397 -12.051 -23.381 1.00 18.39 ?  449  ARG A CG    1 
ATOM   2303 C  CD    . ARG A 1  309 ? -9.521  -10.916 -23.929 1.00 17.79 ?  449  ARG A CD    1 
ATOM   2304 N  NE    . ARG A 1  309 ? -9.951  -9.591  -23.510 1.00 18.96 ?  449  ARG A NE    1 
ATOM   2305 C  CZ    . ARG A 1  309 ? -10.790 -8.809  -24.184 1.00 22.35 ?  449  ARG A CZ    1 
ATOM   2306 N  NH1   . ARG A 1  309 ? -11.320 -9.210  -25.325 1.00 25.51 ?  449  ARG A NH1   1 
ATOM   2307 N  NH2   . ARG A 1  309 ? -11.099 -7.614  -23.708 1.00 27.01 ?  449  ARG A NH2   1 
ATOM   2308 N  N     . LYS A 1  310 ? -9.824  -15.374 -21.930 1.00 14.29 ?  450  LYS A N     1 
ATOM   2309 C  CA    . LYS A 1  310 ? -9.591  -16.532 -22.787 1.00 15.98 ?  450  LYS A CA    1 
ATOM   2310 C  C     . LYS A 1  310 ? -10.320 -17.784 -22.306 1.00 17.35 ?  450  LYS A C     1 
ATOM   2311 O  O     . LYS A 1  310 ? -10.768 -18.583 -23.134 1.00 20.60 ?  450  LYS A O     1 
ATOM   2312 C  CB    . LYS A 1  310 ? -8.091  -16.806 -22.899 1.00 17.43 ?  450  LYS A CB    1 
ATOM   2313 C  CG    . LYS A 1  310 ? -7.281  -15.613 -23.403 1.00 20.36 ?  450  LYS A CG    1 
ATOM   2314 C  CD    . LYS A 1  310 ? -7.812  -15.082 -24.735 1.00 23.29 ?  450  LYS A CD    1 
ATOM   2315 C  CE    . LYS A 1  310 ? -6.947  -13.935 -25.254 1.00 23.26 ?  450  LYS A CE    1 
ATOM   2316 N  NZ    . LYS A 1  310 ? -7.468  -13.378 -26.541 1.00 23.70 ?  450  LYS A NZ    1 
ATOM   2317 N  N     . GLU A 1  311 ? -10.457 -17.982 -20.993 1.00 15.85 ?  451  GLU A N     1 
ATOM   2318 C  CA    . GLU A 1  311 ? -11.099 -19.190 -20.483 1.00 15.79 ?  451  GLU A CA    1 
ATOM   2319 C  C     . GLU A 1  311 ? -12.573 -19.004 -20.152 1.00 19.67 ?  451  GLU A C     1 
ATOM   2320 O  O     . GLU A 1  311 ? -13.350 -19.955 -20.296 1.00 20.83 ?  451  GLU A O     1 
ATOM   2321 C  CB    . GLU A 1  311 ? -10.374 -19.702 -19.230 1.00 16.77 ?  451  GLU A CB    1 
ATOM   2322 C  CG    . GLU A 1  311 ? -8.883  -19.958 -19.420 1.00 17.77 ?  451  GLU A CG    1 
ATOM   2323 C  CD    . GLU A 1  311 ? -8.578  -20.985 -20.496 1.00 23.33 ?  451  GLU A CD    1 
ATOM   2324 O  OE1   . GLU A 1  311 ? -9.384  -21.922 -20.692 1.00 22.09 ?  451  GLU A OE1   1 
ATOM   2325 O  OE2   . GLU A 1  311 ? -7.522  -20.848 -21.151 1.00 21.62 ?  451  GLU A OE2   1 
ATOM   2326 N  N     . LYS A 1  312 ? -12.983 -17.812 -19.715 1.00 17.43 ?  452  LYS A N     1 
ATOM   2327 C  CA    . LYS A 1  312 ? -14.357 -17.581 -19.290 1.00 17.01 ?  452  LYS A CA    1 
ATOM   2328 C  C     . LYS A 1  312 ? -15.138 -16.650 -20.208 1.00 18.39 ?  452  LYS A C     1 
ATOM   2329 O  O     . LYS A 1  312 ? -16.353 -16.514 -20.030 1.00 20.50 ?  452  LYS A O     1 
ATOM   2330 C  CB    . LYS A 1  312 ? -14.375 -17.021 -17.860 1.00 17.18 ?  452  LYS A CB    1 
ATOM   2331 C  CG    . LYS A 1  312 ? -13.653 -17.911 -16.850 1.00 15.83 ?  452  LYS A CG    1 
ATOM   2332 C  CD    . LYS A 1  312 ? -14.351 -19.260 -16.741 1.00 19.15 ?  452  LYS A CD    1 
ATOM   2333 C  CE    . LYS A 1  312 ? -13.588 -20.212 -15.838 1.00 22.35 ?  452  LYS A CE    1 
ATOM   2334 N  NZ    . LYS A 1  312 ? -14.334 -21.488 -15.642 1.00 26.21 ?  452  LYS A NZ    1 
ATOM   2335 N  N     . GLY A 1  313 ? -14.487 -16.014 -21.180 1.00 16.05 ?  453  GLY A N     1 
ATOM   2336 C  CA    . GLY A 1  313 ? -15.177 -15.104 -22.066 1.00 17.01 ?  453  GLY A CA    1 
ATOM   2337 C  C     . GLY A 1  313 ? -15.651 -13.824 -21.420 1.00 17.77 ?  453  GLY A C     1 
ATOM   2338 O  O     . GLY A 1  313 ? -16.592 -13.202 -21.914 1.00 18.85 ?  453  GLY A O     1 
ATOM   2339 N  N     . LEU A 1  314 ? -15.019 -13.409 -20.325 1.00 15.09 ?  454  LEU A N     1 
ATOM   2340 C  CA    . LEU A 1  314 ? -15.422 -12.242 -19.559 1.00 14.45 ?  454  LEU A CA    1 
ATOM   2341 C  C     . LEU A 1  314 ? -14.256 -11.270 -19.522 1.00 15.02 ?  454  LEU A C     1 
ATOM   2342 O  O     . LEU A 1  314 ? -13.094 -11.685 -19.466 1.00 14.16 ?  454  LEU A O     1 
ATOM   2343 C  CB    . LEU A 1  314 ? -15.820 -12.631 -18.132 1.00 14.99 ?  454  LEU A CB    1 
ATOM   2344 C  CG    . LEU A 1  314 ? -16.923 -13.676 -17.961 1.00 16.72 ?  454  LEU A CG    1 
ATOM   2345 C  CD1   . LEU A 1  314 ? -17.189 -13.983 -16.517 1.00 16.63 ?  454  LEU A CD1   1 
ATOM   2346 C  CD2   . LEU A 1  314 ? -18.197 -13.174 -18.625 1.00 18.57 ?  454  LEU A CD2   1 
ATOM   2347 N  N     . TRP A 1  315 ? -14.570 -9.983  -19.539 1.00 13.22 ?  455  TRP A N     1 
ATOM   2348 C  CA    . TRP A 1  315 ? -13.576 -8.923  -19.666 1.00 12.32 ?  455  TRP A CA    1 
ATOM   2349 C  C     . TRP A 1  315 ? -13.403 -8.257  -18.300 1.00 11.06 ?  455  TRP A C     1 
ATOM   2350 O  O     . TRP A 1  315 ? -14.348 -7.646  -17.791 1.00 11.54 ?  455  TRP A O     1 
ATOM   2351 C  CB    . TRP A 1  315 ? -13.998 -7.893  -20.713 1.00 13.73 ?  455  TRP A CB    1 
ATOM   2352 C  CG    . TRP A 1  315 ? -14.182 -8.483  -22.063 1.00 15.47 ?  455  TRP A CG    1 
ATOM   2353 C  CD1   . TRP A 1  315 ? -13.856 -9.746  -22.454 1.00 17.05 ?  455  TRP A CD1   1 
ATOM   2354 C  CD2   . TRP A 1  315 ? -14.739 -7.832  -23.204 1.00 19.75 ?  455  TRP A CD2   1 
ATOM   2355 N  NE1   . TRP A 1  315 ? -14.173 -9.927  -23.790 1.00 20.47 ?  455  TRP A NE1   1 
ATOM   2356 C  CE2   . TRP A 1  315 ? -14.713 -8.763  -24.267 1.00 18.65 ?  455  TRP A CE2   1 
ATOM   2357 C  CE3   . TRP A 1  315 ? -15.243 -6.551  -23.436 1.00 23.02 ?  455  TRP A CE3   1 
ATOM   2358 C  CZ2   . TRP A 1  315 ? -15.189 -8.449  -25.543 1.00 23.14 ?  455  TRP A CZ2   1 
ATOM   2359 C  CZ3   . TRP A 1  315 ? -15.718 -6.241  -24.706 1.00 24.31 ?  455  TRP A CZ3   1 
ATOM   2360 C  CH2   . TRP A 1  315 ? -15.679 -7.186  -25.740 1.00 24.80 ?  455  TRP A CH2   1 
ATOM   2361 N  N     . LEU A 1  316 ? -12.201 -8.375  -17.712 1.00 10.21 ?  456  LEU A N     1 
ATOM   2362 C  CA    . LEU A 1  316 ? -11.912 -7.869  -16.368 1.00 9.20  ?  456  LEU A CA    1 
ATOM   2363 C  C     . LEU A 1  316 ? -11.037 -6.628  -16.418 1.00 10.14 ?  456  LEU A C     1 
ATOM   2364 O  O     . LEU A 1  316 ? -10.039 -6.585  -17.138 1.00 10.31 ?  456  LEU A O     1 
ATOM   2365 C  CB    . LEU A 1  316 ? -11.212 -8.958  -15.557 1.00 7.59  ?  456  LEU A CB    1 
ATOM   2366 C  CG    . LEU A 1  316 ? -10.818 -8.605  -14.126 1.00 6.96  ?  456  LEU A CG    1 
ATOM   2367 C  CD1   . LEU A 1  316 ? -12.058 -8.335  -13.277 1.00 7.68  ?  456  LEU A CD1   1 
ATOM   2368 C  CD2   . LEU A 1  316 ? -9.966  -9.703  -13.551 1.00 8.43  ?  456  LEU A CD2   1 
ATOM   2369 N  N     . ASN A 1  317 ? -11.388 -5.620  -15.622 1.00 8.65  ?  457  ASN A N     1 
ATOM   2370 C  CA    . ASN A 1  317 ? -10.513 -4.463  -15.434 1.00 8.15  ?  457  ASN A CA    1 
ATOM   2371 C  C     . ASN A 1  317 ? -10.747 -3.933  -14.030 1.00 8.19  ?  457  ASN A C     1 
ATOM   2372 O  O     . ASN A 1  317 ? -11.422 -4.575  -13.219 1.00 8.33  ?  457  ASN A O     1 
ATOM   2373 C  CB    . ASN A 1  317 ? -10.705 -3.424  -16.549 1.00 9.24  ?  457  ASN A CB    1 
ATOM   2374 C  CG    . ASN A 1  317 ? -12.053 -2.745  -16.505 1.00 10.03 ?  457  ASN A CG    1 
ATOM   2375 O  OD1   . ASN A 1  317 ? -12.767 -2.761  -15.508 1.00 10.43 ?  457  ASN A OD1   1 
ATOM   2376 N  ND2   . ASN A 1  317 ? -12.427 -2.143  -17.637 1.00 13.42 ?  457  ASN A ND2   1 
ATOM   2377 N  N     . SER A 1  318 ? -10.132 -2.793  -13.716 1.00 8.78  ?  458  SER A N     1 
ATOM   2378 C  CA    . SER A 1  318 ? -10.221 -2.265  -12.355 1.00 8.05  ?  458  SER A CA    1 
ATOM   2379 C  C     . SER A 1  318 ? -11.564 -1.654  -12.023 1.00 9.30  ?  458  SER A C     1 
ATOM   2380 O  O     . SER A 1  318 ? -11.776 -1.268  -10.860 1.00 9.95  ?  458  SER A O     1 
ATOM   2381 C  CB    . SER A 1  318 ? -9.143  -1.222  -12.101 1.00 10.14 ?  458  SER A CB    1 
ATOM   2382 O  OG    . SER A 1  318 ? -9.451  -0.014  -12.793 1.00 11.89 ?  458  SER A OG    1 
ATOM   2383 N  N     . HIS A 1  319 ? -12.489 -1.627  -12.981 1.00 10.46 ?  459  HIS A N     1 
ATOM   2384 C  CA    . HIS A 1  319 ? -13.821 -1.097  -12.765 1.00 12.30 ?  459  HIS A CA    1 
ATOM   2385 C  C     . HIS A 1  319 ? -14.914 -2.149  -12.686 1.00 11.85 ?  459  HIS A C     1 
ATOM   2386 O  O     . HIS A 1  319 ? -16.006 -1.831  -12.205 1.00 13.45 ?  459  HIS A O     1 
ATOM   2387 C  CB    . HIS A 1  319 ? -14.206 -0.135  -13.899 1.00 11.97 ?  459  HIS A CB    1 
ATOM   2388 C  CG    . HIS A 1  319 ? -13.195 0.923   -14.199 1.00 14.41 ?  459  HIS A CG    1 
ATOM   2389 N  ND1   . HIS A 1  319 ? -12.665 1.758   -13.238 1.00 17.67 ?  459  HIS A ND1   1 
ATOM   2390 C  CD2   . HIS A 1  319 ? -12.644 1.301   -15.373 1.00 19.20 ?  459  HIS A CD2   1 
ATOM   2391 C  CE1   . HIS A 1  319 ? -11.814 2.595   -13.812 1.00 20.06 ?  459  HIS A CE1   1 
ATOM   2392 N  NE2   . HIS A 1  319 ? -11.785 2.338   -15.107 1.00 20.35 ?  459  HIS A NE2   1 
ATOM   2393 N  N     . GLY A 1  320 ? -14.692 -3.358  -13.185 1.00 10.04 ?  460  GLY A N     1 
ATOM   2394 C  CA    . GLY A 1  320 ? -15.770 -4.320  -13.271 1.00 10.37 ?  460  GLY A CA    1 
ATOM   2395 C  C     . GLY A 1  320 ? -15.379 -5.523  -14.102 1.00 9.33  ?  460  GLY A C     1 
ATOM   2396 O  O     . GLY A 1  320 ? -14.228 -5.674  -14.545 1.00 9.70  ?  460  GLY A O     1 
ATOM   2397 N  N     . LEU A 1  321 ? -16.370 -6.398  -14.281 1.00 11.33 ?  461  LEU A N     1 
ATOM   2398 C  CA    . LEU A 1  321 ? -16.232 -7.657  -15.001 1.00 12.18 ?  461  LEU A CA    1 
ATOM   2399 C  C     . LEU A 1  321 ? -17.418 -7.737  -15.948 1.00 13.74 ?  461  LEU A C     1 
ATOM   2400 O  O     . LEU A 1  321 ? -18.561 -7.801  -15.492 1.00 14.08 ?  461  LEU A O     1 
ATOM   2401 C  CB    . LEU A 1  321 ? -16.221 -8.847  -14.048 1.00 11.19 ?  461  LEU A CB    1 
ATOM   2402 C  CG    . LEU A 1  321 ? -16.065 -10.258 -14.627 1.00 11.83 ?  461  LEU A CG    1 
ATOM   2403 C  CD1   . LEU A 1  321 ? -14.748 -10.429 -15.381 1.00 12.89 ?  461  LEU A CD1   1 
ATOM   2404 C  CD2   . LEU A 1  321 ? -16.157 -11.273 -13.513 1.00 13.84 ?  461  LEU A CD2   1 
ATOM   2405 N  N     . PHE A 1  322 ? -17.140 -7.740  -17.247 1.00 13.34 ?  462  PHE A N     1 
ATOM   2406 C  CA    . PHE A 1  322 ? -18.156 -7.549  -18.281 1.00 14.51 ?  462  PHE A CA    1 
ATOM   2407 C  C     . PHE A 1  322 ? -18.386 -8.848  -19.039 1.00 16.49 ?  462  PHE A C     1 
ATOM   2408 O  O     . PHE A 1  322 ? -17.433 -9.491  -19.479 1.00 15.48 ?  462  PHE A O     1 
ATOM   2409 C  CB    . PHE A 1  322 ? -17.703 -6.441  -19.216 1.00 15.77 ?  462  PHE A CB    1 
ATOM   2410 C  CG    . PHE A 1  322 ? -18.694 -6.060  -20.269 1.00 20.35 ?  462  PHE A CG    1 
ATOM   2411 C  CD1   . PHE A 1  322 ? -19.879 -5.431  -19.944 1.00 20.53 ?  462  PHE A CD1   1 
ATOM   2412 C  CD2   . PHE A 1  322 ? -18.395 -6.285  -21.596 1.00 21.01 ?  462  PHE A CD2   1 
ATOM   2413 C  CE1   . PHE A 1  322 ? -20.769 -5.055  -20.931 1.00 23.04 ?  462  PHE A CE1   1 
ATOM   2414 C  CE2   . PHE A 1  322 ? -19.283 -5.906  -22.593 1.00 24.52 ?  462  PHE A CE2   1 
ATOM   2415 C  CZ    . PHE A 1  322 ? -20.469 -5.295  -22.248 1.00 23.48 ?  462  PHE A CZ    1 
ATOM   2416 N  N     . ASP A 1  323 ? -19.659 -9.230  -19.184 1.00 18.45 ?  463  ASP A N     1 
ATOM   2417 C  CA    . ASP A 1  323 ? -20.056 -10.321 -20.059 1.00 19.68 ?  463  ASP A CA    1 
ATOM   2418 C  C     . ASP A 1  323 ? -20.438 -9.715  -21.401 1.00 21.99 ?  463  ASP A C     1 
ATOM   2419 O  O     . ASP A 1  323 ? -21.493 -9.065  -21.496 1.00 23.88 ?  463  ASP A O     1 
ATOM   2420 C  CB    . ASP A 1  323 ? -21.228 -11.084 -19.452 1.00 20.32 ?  463  ASP A CB    1 
ATOM   2421 C  CG    . ASP A 1  323 ? -21.692 -12.250 -20.318 1.00 28.10 ?  463  ASP A CG    1 
ATOM   2422 O  OD1   . ASP A 1  323 ? -21.374 -12.267 -21.518 1.00 29.20 ?  463  ASP A OD1   1 
ATOM   2423 O  OD2   . ASP A 1  323 ? -22.377 -13.136 -19.779 1.00 31.94 ?  463  ASP A OD2   1 
ATOM   2424 N  N     . PRO A 1  324 ? -19.616 -9.858  -22.444 1.00 22.77 ?  464  PRO A N     1 
ATOM   2425 C  CA    . PRO A 1  324 ? -19.885 -9.161  -23.707 1.00 25.53 ?  464  PRO A CA    1 
ATOM   2426 C  C     . PRO A 1  324 ? -20.997 -9.792  -24.522 1.00 28.92 ?  464  PRO A C     1 
ATOM   2427 O  O     . PRO A 1  324 ? -21.435 -9.179  -25.505 1.00 32.95 ?  464  PRO A O     1 
ATOM   2428 C  CB    . PRO A 1  324 ? -18.544 -9.253  -24.440 1.00 27.49 ?  464  PRO A CB    1 
ATOM   2429 C  CG    . PRO A 1  324 ? -17.973 -10.539 -23.972 1.00 25.25 ?  464  PRO A CG    1 
ATOM   2430 C  CD    . PRO A 1  324 ? -18.411 -10.703 -22.533 1.00 23.28 ?  464  PRO A CD    1 
ATOM   2431 N  N     . GLU A 1  325 ? -21.462 -10.983 -24.143 1.00 29.58 ?  465  GLU A N     1 
ATOM   2432 C  CA    . GLU A 1  325 ? -22.605 -11.603 -24.811 1.00 31.09 ?  465  GLU A CA    1 
ATOM   2433 C  C     . GLU A 1  325 ? -23.922 -11.076 -24.244 1.00 36.04 ?  465  GLU A C     1 
ATOM   2434 O  O     . GLU A 1  325 ? -24.786 -10.616 -24.998 1.00 38.12 ?  465  GLU A O     1 
ATOM   2435 C  CB    . GLU A 1  325 ? -22.526 -13.126 -24.683 1.00 29.08 ?  465  GLU A CB    1 
ATOM   2436 N  N     . GLN A 1  326 ? -24.096 -11.133 -22.918 1.00 35.79 ?  466  GLN A N     1 
ATOM   2437 C  CA    . GLN A 1  326 ? -25.271 -10.530 -22.293 1.00 33.53 ?  466  GLN A CA    1 
ATOM   2438 C  C     . GLN A 1  326 ? -25.186 -9.012  -22.228 1.00 32.50 ?  466  GLN A C     1 
ATOM   2439 O  O     . GLN A 1  326 ? -26.212 -8.354  -22.022 1.00 33.67 ?  466  GLN A O     1 
ATOM   2440 C  CB    . GLN A 1  326 ? -25.471 -11.057 -20.875 1.00 34.63 ?  466  GLN A CB    1 
ATOM   2441 C  CG    . GLN A 1  326 ? -25.762 -12.536 -20.777 1.00 38.28 ?  466  GLN A CG    1 
ATOM   2442 C  CD    . GLN A 1  326 ? -26.116 -12.957 -19.361 1.00 40.45 ?  466  GLN A CD    1 
ATOM   2443 O  OE1   . GLN A 1  326 ? -25.996 -12.171 -18.414 1.00 43.61 ?  466  GLN A OE1   1 
ATOM   2444 N  NE2   . GLN A 1  326 ? -26.562 -14.201 -19.208 1.00 41.27 ?  466  GLN A NE2   1 
ATOM   2445 N  N     A LYS A 1  327 ? -23.993 -8.442  -22.375 0.29 29.28 ?  467  LYS A N     1 
ATOM   2446 N  N     B LYS A 1  327 ? -23.998 -8.441  -22.408 0.71 29.43 ?  467  LYS A N     1 
ATOM   2447 C  CA    A LYS A 1  327 ? -23.801 -6.999  -22.244 0.29 28.76 ?  467  LYS A CA    1 
ATOM   2448 C  CA    B LYS A 1  327 ? -23.789 -7.005  -22.234 0.71 28.33 ?  467  LYS A CA    1 
ATOM   2449 C  C     A LYS A 1  327 ? -24.135 -6.530  -20.828 0.29 28.59 ?  467  LYS A C     1 
ATOM   2450 C  C     B LYS A 1  327 ? -24.201 -6.572  -20.826 0.71 29.24 ?  467  LYS A C     1 
ATOM   2451 O  O     A LYS A 1  327 ? -24.752 -5.482  -20.628 0.29 29.18 ?  467  LYS A O     1 
ATOM   2452 O  O     B LYS A 1  327 ? -24.937 -5.604  -20.630 0.71 30.07 ?  467  LYS A O     1 
ATOM   2453 C  CB    A LYS A 1  327 ? -24.633 -6.244  -23.285 0.29 30.71 ?  467  LYS A CB    1 
ATOM   2454 C  CB    B LYS A 1  327 ? -24.535 -6.210  -23.310 0.71 31.05 ?  467  LYS A CB    1 
ATOM   2455 C  CG    A LYS A 1  327 ? -24.056 -4.895  -23.673 0.29 29.93 ?  467  LYS A CG    1 
ATOM   2456 C  CG    B LYS A 1  327 ? -23.958 -6.391  -24.710 0.71 31.72 ?  467  LYS A CG    1 
ATOM   2457 N  N     . THR A 1  328 ? -23.712 -7.311  -19.833 1.00 24.66 ?  468  THR A N     1 
ATOM   2458 C  CA    . THR A 1  328 ? -23.982 -7.027  -18.435 1.00 21.59 ?  468  THR A CA    1 
ATOM   2459 C  C     . THR A 1  328 ? -22.680 -7.004  -17.646 1.00 20.15 ?  468  THR A C     1 
ATOM   2460 O  O     . THR A 1  328 ? -21.719 -7.697  -17.991 1.00 20.59 ?  468  THR A O     1 
ATOM   2461 C  CB    . THR A 1  328 ? -24.897 -8.057  -17.824 1.00 23.84 ?  468  THR A CB    1 
ATOM   2462 O  OG1   . THR A 1  328 ? -24.353 -9.351  -18.061 1.00 25.91 ?  468  THR A OG1   1 
ATOM   2463 C  CG2   . THR A 1  328 ? -26.276 -7.991  -18.449 1.00 26.35 ?  468  THR A CG2   1 
ATOM   2464 N  N     . PHE A 1  329 ? -22.681 -6.210  -16.582 1.00 19.23 ?  469  PHE A N     1 
ATOM   2465 C  CA    . PHE A 1  329 ? -21.607 -6.176  -15.589 1.00 16.47 ?  469  PHE A CA    1 
ATOM   2466 C  C     . PHE A 1  329 ? -21.973 -6.996  -14.361 1.00 18.51 ?  469  PHE A C     1 
ATOM   2467 O  O     . PHE A 1  329 ? -23.112 -6.948  -13.892 1.00 22.64 ?  469  PHE A O     1 
ATOM   2468 C  CB    . PHE A 1  329 ? -21.335 -4.733  -15.170 1.00 17.64 ?  469  PHE A CB    1 
ATOM   2469 C  CG    . PHE A 1  329 ? -20.637 -3.929  -16.214 1.00 21.56 ?  469  PHE A CG    1 
ATOM   2470 C  CD1   . PHE A 1  329 ? -19.255 -3.954  -16.307 1.00 19.26 ?  469  PHE A CD1   1 
ATOM   2471 C  CD2   . PHE A 1  329 ? -21.349 -3.150  -17.118 1.00 21.89 ?  469  PHE A CD2   1 
ATOM   2472 C  CE1   . PHE A 1  329 ? -18.599 -3.221  -17.270 1.00 18.60 ?  469  PHE A CE1   1 
ATOM   2473 C  CE2   . PHE A 1  329 ? -20.695 -2.415  -18.076 1.00 22.09 ?  469  PHE A CE2   1 
ATOM   2474 C  CZ    . PHE A 1  329 ? -19.324 -2.447  -18.156 1.00 21.28 ?  469  PHE A CZ    1 
ATOM   2475 N  N     A PHE A 1  330 ? -21.008 -7.755  -13.842 0.44 16.90 ?  470  PHE A N     1 
ATOM   2476 N  N     B PHE A 1  330 ? -20.984 -7.709  -13.805 0.56 16.44 ?  470  PHE A N     1 
ATOM   2477 C  CA    A PHE A 1  330 ? -21.216 -8.491  -12.606 0.44 17.68 ?  470  PHE A CA    1 
ATOM   2478 C  CA    B PHE A 1  330 ? -21.174 -8.507  -12.596 0.56 17.76 ?  470  PHE A CA    1 
ATOM   2479 C  C     A PHE A 1  330 ? -21.132 -7.540  -11.421 0.44 18.28 ?  470  PHE A C     1 
ATOM   2480 C  C     B PHE A 1  330 ? -21.047 -7.641  -11.348 0.56 18.58 ?  470  PHE A C     1 
ATOM   2481 O  O     A PHE A 1  330 ? -20.259 -6.670  -11.364 0.44 20.21 ?  470  PHE A O     1 
ATOM   2482 O  O     B PHE A 1  330 ? -20.032 -6.968  -11.151 0.56 18.70 ?  470  PHE A O     1 
ATOM   2483 C  CB    A PHE A 1  330 ? -20.181 -9.610  -12.470 0.44 17.40 ?  470  PHE A CB    1 
ATOM   2484 C  CB    B PHE A 1  330 ? -20.141 -9.637  -12.548 0.56 17.47 ?  470  PHE A CB    1 
ATOM   2485 C  CG    A PHE A 1  330 ? -20.304 -10.674 -13.529 0.44 18.33 ?  470  PHE A CG    1 
ATOM   2486 C  CG    B PHE A 1  330 ? -20.099 -10.371 -11.235 0.56 16.67 ?  470  PHE A CG    1 
ATOM   2487 C  CD1   A PHE A 1  330 ? -19.760 -10.478 -14.790 0.44 18.31 ?  470  PHE A CD1   1 
ATOM   2488 C  CD1   B PHE A 1  330 ? -21.167 -11.140 -10.824 0.56 18.91 ?  470  PHE A CD1   1 
ATOM   2489 C  CD2   A PHE A 1  330 ? -20.966 -11.866 -13.271 0.44 20.33 ?  470  PHE A CD2   1 
ATOM   2490 C  CD2   B PHE A 1  330 ? -18.985 -10.294 -10.416 0.56 16.73 ?  470  PHE A CD2   1 
ATOM   2491 C  CE1   A PHE A 1  330 ? -19.865 -11.442 -15.772 0.44 19.38 ?  470  PHE A CE1   1 
ATOM   2492 C  CE1   B PHE A 1  330 ? -21.125 -11.815 -9.616  0.56 18.02 ?  470  PHE A CE1   1 
ATOM   2493 C  CE2   A PHE A 1  330 ? -21.082 -12.837 -14.258 0.44 21.16 ?  470  PHE A CE2   1 
ATOM   2494 C  CE2   B PHE A 1  330 ? -18.939 -10.965 -9.219  0.56 16.06 ?  470  PHE A CE2   1 
ATOM   2495 C  CZ    A PHE A 1  330 ? -20.530 -12.623 -15.512 0.44 19.48 ?  470  PHE A CZ    1 
ATOM   2496 C  CZ    B PHE A 1  330 ? -20.010 -11.723 -8.814  0.56 16.74 ?  470  PHE A CZ    1 
ATOM   2497 N  N     . GLN A 1  331 ? -22.049 -7.699  -10.478 1.00 17.79 ?  471  GLN A N     1 
ATOM   2498 C  CA    . GLN A 1  331 ? -22.083 -6.864  -9.286  1.00 18.19 ?  471  GLN A CA    1 
ATOM   2499 C  C     . GLN A 1  331 ? -21.386 -7.643  -8.177  1.00 24.78 ?  471  GLN A C     1 
ATOM   2500 O  O     . GLN A 1  331 ? -21.931 -8.614  -7.645  1.00 35.83 ?  471  GLN A O     1 
ATOM   2501 C  CB    . GLN A 1  331 ? -23.511 -6.484  -8.897  1.00 24.57 ?  471  GLN A CB    1 
ATOM   2502 C  CG    . GLN A 1  331 ? -24.252 -5.705  -9.977  1.00 29.93 ?  471  GLN A CG    1 
ATOM   2503 C  CD    . GLN A 1  331 ? -23.492 -4.471  -10.434 1.00 36.76 ?  471  GLN A CD    1 
ATOM   2504 O  OE1   . GLN A 1  331 ? -22.944 -3.729  -9.618  1.00 41.95 ?  471  GLN A OE1   1 
ATOM   2505 N  NE2   . GLN A 1  331 ? -23.439 -4.258  -11.749 1.00 35.91 ?  471  GLN A NE2   1 
ATOM   2506 N  N     . ALA A 1  332 ? -20.173 -7.242  -7.859  1.00 16.10 ?  472  ALA A N     1 
ATOM   2507 C  CA    . ALA A 1  332 ? -19.399 -7.868  -6.798  1.00 13.37 ?  472  ALA A CA    1 
ATOM   2508 C  C     . ALA A 1  332 ? -19.437 -7.026  -5.538  1.00 14.14 ?  472  ALA A C     1 
ATOM   2509 O  O     . ALA A 1  332 ? -19.291 -5.803  -5.587  1.00 14.81 ?  472  ALA A O     1 
ATOM   2510 C  CB    . ALA A 1  332 ? -17.944 -8.054  -7.221  1.00 12.35 ?  472  ALA A CB    1 
ATOM   2511 N  N     . ALA A 1  333 ? -19.544 -7.696  -4.388  1.00 13.60 ?  473  ALA A N     1 
ATOM   2512 C  CA    . ALA A 1  333 ? -19.436 -7.029  -3.111  1.00 12.91 ?  473  ALA A CA    1 
ATOM   2513 C  C     . ALA A 1  333 ? -18.122 -7.298  -2.394  1.00 13.62 ?  473  ALA A C     1 
ATOM   2514 O  O     . ALA A 1  333 ? -17.852 -6.673  -1.358  1.00 13.84 ?  473  ALA A O     1 
ATOM   2515 C  CB    . ALA A 1  333 ? -20.604 -7.441  -2.201  1.00 16.39 ?  473  ALA A CB    1 
ATOM   2516 N  N     . SER A 1  334 ? -17.282 -8.165  -2.953  1.00 10.32 ?  474  SER A N     1 
ATOM   2517 C  CA    . SER A 1  334 ? -16.025 -8.543  -2.325  1.00 9.71  ?  474  SER A CA    1 
ATOM   2518 C  C     . SER A 1  334 ? -15.123 -9.136  -3.382  1.00 8.81  ?  474  SER A C     1 
ATOM   2519 O  O     . SER A 1  334 ? -15.582 -9.555  -4.437  1.00 7.66  ?  474  SER A O     1 
ATOM   2520 C  CB    . SER A 1  334 ? -16.233 -9.587  -1.219  1.00 9.19  ?  474  SER A CB    1 
ATOM   2521 O  OG    . SER A 1  334 ? -16.762 -10.785 -1.786  1.00 10.19 ?  474  SER A OG    1 
ATOM   2522 N  N     . GLU A 1  335 ? -13.819 -9.179  -3.074  1.00 8.45  ?  475  GLU A N     1 
ATOM   2523 C  CA    . GLU A 1  335 ? -12.894 -9.928  -3.916  1.00 7.93  ?  475  GLU A CA    1 
ATOM   2524 C  C     . GLU A 1  335 ? -13.314 -11.390 -4.003  1.00 8.32  ?  475  GLU A C     1 
ATOM   2525 O  O     . GLU A 1  335 ? -13.188 -12.013 -5.059  1.00 8.69  ?  475  GLU A O     1 
ATOM   2526 C  CB    . GLU A 1  335 ? -11.462 -9.827  -3.384  1.00 7.18  ?  475  GLU A CB    1 
ATOM   2527 C  CG    . GLU A 1  335 ? -10.832 -8.433  -3.408  1.00 8.47  ?  475  GLU A CG    1 
ATOM   2528 C  CD    . GLU A 1  335 ? -9.383  -8.447  -2.929  1.00 8.25  ?  475  GLU A CD    1 
ATOM   2529 O  OE1   . GLU A 1  335 ? -9.084  -9.015  -1.851  1.00 10.33 ?  475  GLU A OE1   1 
ATOM   2530 O  OE2   . GLU A 1  335 ? -8.538  -7.873  -3.648  1.00 8.99  ?  475  GLU A OE2   1 
ATOM   2531 N  N     . GLU A 1  336 ? -13.774 -11.964 -2.889  1.00 8.40  ?  476  GLU A N     1 
ATOM   2532 C  CA    . GLU A 1  336 ? -14.243 -13.346 -2.924  1.00 9.13  ?  476  GLU A CA    1 
ATOM   2533 C  C     . GLU A 1  336 ? -15.293 -13.545 -4.006  1.00 9.76  ?  476  GLU A C     1 
ATOM   2534 O  O     . GLU A 1  336 ? -15.268 -14.562 -4.712  1.00 10.29 ?  476  GLU A O     1 
ATOM   2535 C  CB    . GLU A 1  336 ? -14.801 -13.758 -1.561  1.00 10.59 ?  476  GLU A CB    1 
ATOM   2536 C  CG    . GLU A 1  336 ? -13.760 -13.929 -0.468  1.00 11.28 ?  476  GLU A CG    1 
ATOM   2537 C  CD    . GLU A 1  336 ? -14.338 -14.590 0.789   1.00 12.29 ?  476  GLU A CD    1 
ATOM   2538 O  OE1   . GLU A 1  336 ? -14.309 -13.971 1.877   1.00 14.49 ?  476  GLU A OE1   1 
ATOM   2539 O  OE2   . GLU A 1  336 ? -14.830 -15.737 0.685   1.00 13.61 ?  476  GLU A OE2   1 
ATOM   2540 N  N     . ASP A 1  337 ? -16.233 -12.595 -4.137  1.00 10.31 ?  477  ASP A N     1 
ATOM   2541 C  CA    . ASP A 1  337 ? -17.248 -12.666 -5.187  1.00 10.64 ?  477  ASP A CA    1 
ATOM   2542 C  C     . ASP A 1  337 ? -16.603 -12.805 -6.556  1.00 9.98  ?  477  ASP A C     1 
ATOM   2543 O  O     . ASP A 1  337 ? -17.079 -13.569 -7.401  1.00 10.94 ?  477  ASP A O     1 
ATOM   2544 C  CB    . ASP A 1  337 ? -18.119 -11.409 -5.197  1.00 12.05 ?  477  ASP A CB    1 
ATOM   2545 C  CG    . ASP A 1  337 ? -19.450 -11.572 -4.503  1.00 15.16 ?  477  ASP A CG    1 
ATOM   2546 O  OD1   . ASP A 1  337 ? -19.804 -12.689 -4.056  1.00 16.41 ?  477  ASP A OD1   1 
ATOM   2547 O  OD2   . ASP A 1  337 ? -20.153 -10.535 -4.434  1.00 16.06 ?  477  ASP A OD2   1 
ATOM   2548 N  N     . ILE A 1  338 ? -15.542 -12.037 -6.809  1.00 8.54  ?  478  ILE A N     1 
ATOM   2549 C  CA    . ILE A 1  338 ? -14.939 -12.030 -8.136  1.00 7.70  ?  478  ILE A CA    1 
ATOM   2550 C  C     . ILE A 1  338 ? -14.286 -13.373 -8.449  1.00 8.73  ?  478  ILE A C     1 
ATOM   2551 O  O     . ILE A 1  338 ? -14.413 -13.885 -9.564  1.00 9.58  ?  478  ILE A O     1 
ATOM   2552 C  CB    . ILE A 1  338 ? -13.922 -10.880 -8.275  1.00 7.83  ?  478  ILE A CB    1 
ATOM   2553 C  CG1   . ILE A 1  338 ? -14.614 -9.536  -7.989  1.00 8.94  ?  478  ILE A CG1   1 
ATOM   2554 C  CG2   . ILE A 1  338 ? -13.307 -10.914 -9.661  1.00 9.29  ?  478  ILE A CG2   1 
ATOM   2555 C  CD1   . ILE A 1  338 ? -13.685 -8.313  -7.839  1.00 8.87  ?  478  ILE A CD1   1 
ATOM   2556 N  N     . PHE A 1  339 ? -13.488 -13.909 -7.521  1.00 9.51  ?  479  PHE A N     1 
ATOM   2557 C  CA    . PHE A 1  339 ? -12.906 -15.232 -7.726  1.00 8.58  ?  479  PHE A CA    1 
ATOM   2558 C  C     . PHE A 1  339 ? -14.010 -16.257 -8.002  1.00 10.02 ?  479  PHE A C     1 
ATOM   2559 O  O     . PHE A 1  339 ? -13.873 -17.103 -8.899  1.00 11.14 ?  479  PHE A O     1 
ATOM   2560 C  CB    . PHE A 1  339 ? -12.066 -15.636 -6.521  1.00 8.50  ?  479  PHE A CB    1 
ATOM   2561 C  CG    . PHE A 1  339 ? -10.709 -15.025 -6.493  1.00 8.77  ?  479  PHE A CG    1 
ATOM   2562 C  CD1   . PHE A 1  339 ? -10.493 -13.797 -5.877  1.00 9.81  ?  479  PHE A CD1   1 
ATOM   2563 C  CD2   . PHE A 1  339 ? -9.634  -15.711 -7.005  1.00 9.45  ?  479  PHE A CD2   1 
ATOM   2564 C  CE1   . PHE A 1  339 ? -9.210  -13.230 -5.821  1.00 10.57 ?  479  PHE A CE1   1 
ATOM   2565 C  CE2   . PHE A 1  339 ? -8.341  -15.154 -6.957  1.00 10.50 ?  479  PHE A CE2   1 
ATOM   2566 C  CZ    . PHE A 1  339 ? -8.142  -13.912 -6.341  1.00 9.31  ?  479  PHE A CZ    1 
ATOM   2567 N  N     . ARG A 1  340 ? -15.113 -16.190 -7.245  1.00 9.91  ?  480  ARG A N     1 
ATOM   2568 C  CA    . ARG A 1  340 ? -16.198 -17.152 -7.461  1.00 11.13 ?  480  ARG A CA    1 
ATOM   2569 C  C     . ARG A 1  340 ? -16.838 -16.989 -8.839  1.00 12.55 ?  480  ARG A C     1 
ATOM   2570 O  O     . ARG A 1  340 ? -17.160 -17.994 -9.490  1.00 13.84 ?  480  ARG A O     1 
ATOM   2571 C  CB    . ARG A 1  340 ? -17.266 -17.028 -6.367  1.00 12.51 ?  480  ARG A CB    1 
ATOM   2572 C  CG    . ARG A 1  340 ? -16.829 -17.536 -5.041  1.00 14.15 ?  480  ARG A CG    1 
ATOM   2573 C  CD    . ARG A 1  340 ? -17.984 -17.588 -4.028  1.00 15.47 ?  480  ARG A CD    1 
ATOM   2574 N  NE    . ARG A 1  340 ? -18.448 -16.269 -3.618  1.00 15.01 ?  480  ARG A NE    1 
ATOM   2575 C  CZ    . ARG A 1  340 ? -18.190 -15.699 -2.440  1.00 12.74 ?  480  ARG A CZ    1 
ATOM   2576 N  NH1   . ARG A 1  340 ? -17.441 -16.301 -1.534  1.00 14.00 ?  480  ARG A NH1   1 
ATOM   2577 N  NH2   . ARG A 1  340 ? -18.658 -14.483 -2.196  1.00 13.62 ?  480  ARG A NH2   1 
ATOM   2578 N  N     A HIS A 1  341 ? -17.100 -15.745 -9.256  0.36 13.99 ?  481  HIS A N     1 
ATOM   2579 N  N     B HIS A 1  341 ? -17.002 -15.761 -9.318  0.64 13.79 ?  481  HIS A N     1 
ATOM   2580 C  CA    A HIS A 1  341 ? -17.585 -15.486 -10.608 0.36 14.46 ?  481  HIS A CA    1 
ATOM   2581 C  CA    B HIS A 1  341 ? -17.612 -15.555 -10.628 0.64 14.33 ?  481  HIS A CA    1 
ATOM   2582 C  C     A HIS A 1  341 ? -16.741 -16.250 -11.622 0.36 14.28 ?  481  HIS A C     1 
ATOM   2583 C  C     B HIS A 1  341 ? -16.723 -16.068 -11.753 0.64 14.41 ?  481  HIS A C     1 
ATOM   2584 O  O     A HIS A 1  341 ? -17.267 -16.978 -12.474 0.36 15.63 ?  481  HIS A O     1 
ATOM   2585 O  O     B HIS A 1  341 ? -17.218 -16.398 -12.842 0.64 14.96 ?  481  HIS A O     1 
ATOM   2586 C  CB    A HIS A 1  341 ? -17.545 -13.984 -10.919 0.36 14.87 ?  481  HIS A CB    1 
ATOM   2587 C  CB    B HIS A 1  341 ? -17.906 -14.090 -10.848 0.64 15.05 ?  481  HIS A CB    1 
ATOM   2588 C  CG    A HIS A 1  341 ? -18.572 -13.166 -10.190 0.36 16.28 ?  481  HIS A CG    1 
ATOM   2589 C  CG    B HIS A 1  341 ? -18.954 -13.856 -11.880 0.64 18.17 ?  481  HIS A CG    1 
ATOM   2590 N  ND1   A HIS A 1  341 ? -19.811 -13.657 -9.840  0.36 17.58 ?  481  HIS A ND1   1 
ATOM   2591 N  ND1   B HIS A 1  341 ? -20.271 -14.203 -11.679 0.64 19.96 ?  481  HIS A ND1   1 
ATOM   2592 C  CD2   A HIS A 1  341 ? -18.547 -11.879 -9.767  0.36 15.15 ?  481  HIS A CD2   1 
ATOM   2593 C  CD2   B HIS A 1  341 ? -18.880 -13.347 -13.130 0.64 19.47 ?  481  HIS A CD2   1 
ATOM   2594 C  CE1   A HIS A 1  341 ? -20.501 -12.713 -9.227  0.36 17.23 ?  481  HIS A CE1   1 
ATOM   2595 C  CE1   B HIS A 1  341 ? -20.970 -13.895 -12.758 0.64 19.76 ?  481  HIS A CE1   1 
ATOM   2596 N  NE2   A HIS A 1  341 ? -19.755 -11.626 -9.165  0.36 16.38 ?  481  HIS A NE2   1 
ATOM   2597 N  NE2   B HIS A 1  341 ? -20.151 -13.373 -13.652 0.64 18.76 ?  481  HIS A NE2   1 
ATOM   2598 N  N     . LEU A 1  342 ? -15.418 -16.097 -11.527 1.00 12.95 ?  482  LEU A N     1 
ATOM   2599 C  CA    . LEU A 1  342 ? -14.466 -16.660 -12.473 1.00 12.04 ?  482  LEU A CA    1 
ATOM   2600 C  C     . LEU A 1  342 ? -14.188 -18.135 -12.259 1.00 14.28 ?  482  LEU A C     1 
ATOM   2601 O  O     . LEU A 1  342 ? -13.364 -18.695 -12.990 1.00 15.11 ?  482  LEU A O     1 
ATOM   2602 C  CB    . LEU A 1  342 ? -13.155 -15.873 -12.389 1.00 11.49 ?  482  LEU A CB    1 
ATOM   2603 C  CG    . LEU A 1  342 ? -13.291 -14.427 -12.812 1.00 11.61 ?  482  LEU A CG    1 
ATOM   2604 C  CD1   . LEU A 1  342 ? -12.014 -13.683 -12.511 1.00 12.37 ?  482  LEU A CD1   1 
ATOM   2605 C  CD2   . LEU A 1  342 ? -13.630 -14.329 -14.276 1.00 14.60 ?  482  LEU A CD2   1 
ATOM   2606 N  N     . GLY A 1  343 ? -14.851 -18.790 -11.311 1.00 14.08 ?  483  GLY A N     1 
ATOM   2607 C  CA    . GLY A 1  343 ? -14.624 -20.210 -11.106 1.00 15.71 ?  483  GLY A CA    1 
ATOM   2608 C  C     . GLY A 1  343 ? -13.255 -20.536 -10.545 1.00 16.25 ?  483  GLY A C     1 
ATOM   2609 O  O     . GLY A 1  343 ? -12.714 -21.617 -10.811 1.00 17.87 ?  483  GLY A O     1 
ATOM   2610 N  N     . LEU A 1  344 ? -12.674 -19.625 -9.773  1.00 13.01 ?  484  LEU A N     1 
ATOM   2611 C  CA    . LEU A 1  344 ? -11.348 -19.793 -9.206  1.00 12.11 ?  484  LEU A CA    1 
ATOM   2612 C  C     . LEU A 1  344 ? -11.419 -19.896 -7.692  1.00 14.35 ?  484  LEU A C     1 
ATOM   2613 O  O     . LEU A 1  344 ? -12.229 -19.225 -7.054  1.00 15.20 ?  484  LEU A O     1 
ATOM   2614 C  CB    . LEU A 1  344 ? -10.449 -18.596 -9.554  1.00 11.44 ?  484  LEU A CB    1 
ATOM   2615 C  CG    . LEU A 1  344 ? -10.062 -18.356 -11.002 1.00 12.72 ?  484  LEU A CG    1 
ATOM   2616 C  CD1   . LEU A 1  344 ? -9.459  -16.946 -11.164 1.00 12.24 ?  484  LEU A CD1   1 
ATOM   2617 C  CD2   . LEU A 1  344 ? -9.081  -19.396 -11.480 1.00 13.87 ?  484  LEU A CD2   1 
ATOM   2618 N  N     A GLU A 1  345 ? -10.570 -20.739 -7.117  0.54 14.51 ?  485  GLU A N     1 
ATOM   2619 N  N     B GLU A 1  345 ? -10.558 -20.730 -7.121  0.46 14.58 ?  485  GLU A N     1 
ATOM   2620 C  CA    A GLU A 1  345 ? -10.429 -20.761 -5.670  0.54 15.39 ?  485  GLU A CA    1 
ATOM   2621 C  CA    B GLU A 1  345 ? -10.404 -20.764 -5.675  0.46 15.27 ?  485  GLU A CA    1 
ATOM   2622 C  C     A GLU A 1  345 ? -9.874  -19.422 -5.200  0.54 13.84 ?  485  GLU A C     1 
ATOM   2623 C  C     B GLU A 1  345 ? -9.863  -19.424 -5.195  0.46 13.88 ?  485  GLU A C     1 
ATOM   2624 O  O     A GLU A 1  345 ? -8.946  -18.870 -5.799  0.54 13.13 ?  485  GLU A O     1 
ATOM   2625 O  O     B GLU A 1  345 ? -8.927  -18.873 -5.783  0.46 13.10 ?  485  GLU A O     1 
ATOM   2626 C  CB    A GLU A 1  345 ? -9.506  -21.899 -5.234  0.54 15.11 ?  485  GLU A CB    1 
ATOM   2627 C  CB    B GLU A 1  345 ? -9.458  -21.894 -5.269  0.46 14.86 ?  485  GLU A CB    1 
ATOM   2628 C  CG    A GLU A 1  345 ? -10.064 -23.294 -5.513  0.54 16.51 ?  485  GLU A CG    1 
ATOM   2629 C  CG    B GLU A 1  345 ? -9.323  -22.076 -3.771  0.46 15.39 ?  485  GLU A CG    1 
ATOM   2630 N  N     . TYR A 1  346 ? -10.453 -18.900 -4.124  1.00 13.95 ?  486  TYR A N     1 
ATOM   2631 C  CA    . TYR A 1  346 ? -9.993  -17.635 -3.566  1.00 12.12 ?  486  TYR A CA    1 
ATOM   2632 C  C     . TYR A 1  346 ? -8.543  -17.712 -3.110  1.00 13.11 ?  486  TYR A C     1 
ATOM   2633 O  O     . TYR A 1  346 ? -8.119  -18.675 -2.466  1.00 14.78 ?  486  TYR A O     1 
ATOM   2634 C  CB    . TYR A 1  346 ? -10.865 -17.229 -2.390  1.00 13.95 ?  486  TYR A CB    1 
ATOM   2635 C  CG    . TYR A 1  346 ? -10.403 -15.951 -1.750  1.00 13.18 ?  486  TYR A CG    1 
ATOM   2636 C  CD1   . TYR A 1  346 ? -10.590 -14.720 -2.378  1.00 13.99 ?  486  TYR A CD1   1 
ATOM   2637 C  CD2   . TYR A 1  346 ? -9.761  -15.975 -0.540  1.00 13.64 ?  486  TYR A CD2   1 
ATOM   2638 C  CE1   . TYR A 1  346 ? -10.155 -13.567 -1.778  1.00 12.90 ?  486  TYR A CE1   1 
ATOM   2639 C  CE2   . TYR A 1  346 ? -9.311  -14.823 0.057   1.00 15.88 ?  486  TYR A CE2   1 
ATOM   2640 C  CZ    . TYR A 1  346 ? -9.515  -13.627 -0.553  1.00 15.52 ?  486  TYR A CZ    1 
ATOM   2641 O  OH    . TYR A 1  346 ? -9.030  -12.479 0.062   1.00 17.02 ?  486  TYR A OH    1 
ATOM   2642 N  N     . LEU A 1  347 ? -7.785  -16.666 -3.432  1.00 10.72 ?  487  LEU A N     1 
ATOM   2643 C  CA    . LEU A 1  347 ? -6.429  -16.493 -2.935  1.00 9.75  ?  487  LEU A CA    1 
ATOM   2644 C  C     . LEU A 1  347 ? -6.354  -15.201 -2.141  1.00 8.50  ?  487  LEU A C     1 
ATOM   2645 O  O     . LEU A 1  347 ? -6.695  -14.134 -2.679  1.00 9.16  ?  487  LEU A O     1 
ATOM   2646 C  CB    . LEU A 1  347 ? -5.450  -16.454 -4.113  1.00 9.58  ?  487  LEU A CB    1 
ATOM   2647 C  CG    . LEU A 1  347 ? -5.289  -17.775 -4.877  1.00 10.66 ?  487  LEU A CG    1 
ATOM   2648 C  CD1   . LEU A 1  347 ? -4.490  -17.553 -6.130  1.00 12.51 ?  487  LEU A CD1   1 
ATOM   2649 C  CD2   . LEU A 1  347 ? -4.608  -18.833 -3.992  1.00 13.44 ?  487  LEU A CD2   1 
ATOM   2650 N  N     . PRO A 1  348 ? -5.955  -15.232 -0.885  1.00 9.00  ?  488  PRO A N     1 
ATOM   2651 C  CA    . PRO A 1  348 ? -5.717  -13.985 -0.154  1.00 9.08  ?  488  PRO A CA    1 
ATOM   2652 C  C     . PRO A 1  348 ? -4.552  -13.239 -0.772  1.00 8.59  ?  488  PRO A C     1 
ATOM   2653 O  O     . PRO A 1  348 ? -3.780  -13.816 -1.555  1.00 8.92  ?  488  PRO A O     1 
ATOM   2654 C  CB    . PRO A 1  348 ? -5.390  -14.452 1.268   1.00 10.63 ?  488  PRO A CB    1 
ATOM   2655 C  CG    . PRO A 1  348 ? -4.837  -15.807 1.078   1.00 12.25 ?  488  PRO A CG    1 
ATOM   2656 C  CD    . PRO A 1  348 ? -5.559  -16.416 -0.108  1.00 10.82 ?  488  PRO A CD    1 
ATOM   2657 N  N     . PRO A 1  349 ? -4.410  -11.940 -0.466  1.00 8.22  ?  489  PRO A N     1 
ATOM   2658 C  CA    . PRO A 1  349 ? -3.356  -11.136 -1.115  1.00 7.84  ?  489  PRO A CA    1 
ATOM   2659 C  C     . PRO A 1  349 ? -1.957  -11.698 -0.966  1.00 7.14  ?  489  PRO A C     1 
ATOM   2660 O  O     . PRO A 1  349 ? -1.131  -11.596 -1.881  1.00 8.21  ?  489  PRO A O     1 
ATOM   2661 C  CB    . PRO A 1  349 ? -3.481  -9.783  -0.400  1.00 7.55  ?  489  PRO A CB    1 
ATOM   2662 C  CG    . PRO A 1  349 ? -4.888  -9.707  0.015   1.00 9.28  ?  489  PRO A CG    1 
ATOM   2663 C  CD    . PRO A 1  349 ? -5.328  -11.124 0.337   1.00 8.85  ?  489  PRO A CD    1 
ATOM   2664 N  N     . GLU A 1  350 ? -1.683  -12.294 0.192   1.00 9.08  ?  490  GLU A N     1 
ATOM   2665 C  CA    A GLU A 1  350 ? -0.366  -12.863 0.455   0.35 9.35  ?  490  GLU A CA    1 
ATOM   2666 C  CA    B GLU A 1  350 ? -0.379  -12.883 0.474   0.65 9.29  ?  490  GLU A CA    1 
ATOM   2667 C  C     . GLU A 1  350 ? -0.039  -14.054 -0.441  1.00 9.93  ?  490  GLU A C     1 
ATOM   2668 O  O     . GLU A 1  350 ? 1.128   -14.449 -0.515  1.00 10.90 ?  490  GLU A O     1 
ATOM   2669 C  CB    A GLU A 1  350 ? -0.278  -13.268 1.931   0.35 11.98 ?  490  GLU A CB    1 
ATOM   2670 C  CB    B GLU A 1  350 ? -0.333  -13.334 1.945   0.65 12.75 ?  490  GLU A CB    1 
ATOM   2671 C  CG    A GLU A 1  350 ? -1.257  -14.363 2.291   0.35 11.52 ?  490  GLU A CG    1 
ATOM   2672 C  CG    B GLU A 1  350 ? -0.477  -12.196 2.939   0.65 13.89 ?  490  GLU A CG    1 
ATOM   2673 C  CD    A GLU A 1  350 ? -1.819  -14.255 3.693   0.35 15.85 ?  490  GLU A CD    1 
ATOM   2674 C  CD    B GLU A 1  350 ? -1.931  -11.861 3.309   0.65 17.21 ?  490  GLU A CD    1 
ATOM   2675 O  OE1   A GLU A 1  350 ? -1.254  -13.503 4.517   0.35 20.25 ?  490  GLU A OE1   1 
ATOM   2676 O  OE1   B GLU A 1  350 ? -2.893  -12.420 2.714   0.65 9.70  ?  490  GLU A OE1   1 
ATOM   2677 O  OE2   A GLU A 1  350 ? -2.835  -14.932 3.968   0.35 13.22 ?  490  GLU A OE2   1 
ATOM   2678 O  OE2   B GLU A 1  350 ? -2.097  -11.008 4.213   0.65 20.65 ?  490  GLU A OE2   1 
ATOM   2679 N  N     . GLN A 1  351 ? -1.019  -14.619 -1.144  1.00 7.13  ?  491  GLN A N     1 
ATOM   2680 C  CA    . GLN A 1  351 ? -0.797  -15.706 -2.090  1.00 8.17  ?  491  GLN A CA    1 
ATOM   2681 C  C     . GLN A 1  351 ? -0.958  -15.271 -3.544  1.00 7.36  ?  491  GLN A C     1 
ATOM   2682 O  O     . GLN A 1  351 ? -1.094  -16.109 -4.433  1.00 8.19  ?  491  GLN A O     1 
ATOM   2683 C  CB    . GLN A 1  351 ? -1.741  -16.871 -1.755  1.00 9.84  ?  491  GLN A CB    1 
ATOM   2684 C  CG    . GLN A 1  351 ? -1.555  -17.435 -0.359  1.00 10.61 ?  491  GLN A CG    1 
ATOM   2685 C  CD    . GLN A 1  351 ? -0.188  -18.016 -0.124  1.00 13.08 ?  491  GLN A CD    1 
ATOM   2686 O  OE1   . GLN A 1  351 ? 0.500   -18.458 -1.056  1.00 13.25 ?  491  GLN A OE1   1 
ATOM   2687 N  NE2   . GLN A 1  351 ? 0.214   -18.040 1.137   1.00 15.53 ?  491  GLN A NE2   1 
ATOM   2688 N  N     . ARG A 1  352 ? -0.918  -13.958 -3.812  1.00 6.85  ?  492  ARG A N     1 
ATOM   2689 C  CA    . ARG A 1  352 ? -0.975  -13.391 -5.161  1.00 5.53  ?  492  ARG A CA    1 
ATOM   2690 C  C     . ARG A 1  352 ? 0.372   -12.832 -5.618  1.00 6.26  ?  492  ARG A C     1 
ATOM   2691 O  O     . ARG A 1  352 ? 0.436   -11.954 -6.493  1.00 7.56  ?  492  ARG A O     1 
ATOM   2692 C  CB    . ARG A 1  352 ? -2.040  -12.297 -5.205  1.00 5.28  ?  492  ARG A CB    1 
ATOM   2693 C  CG    . ARG A 1  352 ? -3.422  -12.753 -4.772  1.00 6.26  ?  492  ARG A CG    1 
ATOM   2694 C  CD    . ARG A 1  352 ? -4.417  -11.627 -4.901  1.00 5.66  ?  492  ARG A CD    1 
ATOM   2695 N  NE    . ARG A 1  352 ? -5.588  -11.878 -4.063  1.00 6.42  ?  492  ARG A NE    1 
ATOM   2696 C  CZ    . ARG A 1  352 ? -6.456  -10.960 -3.666  1.00 6.74  ?  492  ARG A CZ    1 
ATOM   2697 N  NH1   . ARG A 1  352 ? -6.345  -9.698  -4.052  1.00 5.77  ?  492  ARG A NH1   1 
ATOM   2698 N  NH2   . ARG A 1  352 ? -7.447  -11.318 -2.846  1.00 7.49  ?  492  ARG A NH2   1 
ATOM   2699 N  N     . ASN A 1  353 ? 1.465   -13.334 -5.039  1.00 8.00  ?  493  ASN A N     1 
ATOM   2700 C  CA    . ASN A 1  353 ? 2.812   -12.838 -5.311  1.00 8.84  ?  493  ASN A CA    1 
ATOM   2701 C  C     . ASN A 1  353 ? 3.442   -13.540 -6.502  1.00 11.13 ?  493  ASN A C     1 
ATOM   2702 O  O     . ASN A 1  353 ? 4.580   -14.030 -6.450  1.00 13.08 ?  493  ASN A O     1 
ATOM   2703 C  CB    . ASN A 1  353 ? 3.660   -12.982 -4.052  1.00 9.73  ?  493  ASN A CB    1 
ATOM   2704 C  CG    . ASN A 1  353 ? 3.317   -11.949 -3.015  1.00 9.61  ?  493  ASN A CG    1 
ATOM   2705 O  OD1   . ASN A 1  353 ? 3.553   -10.768 -3.202  1.00 9.89  ?  493  ASN A OD1   1 
ATOM   2706 N  ND2   . ASN A 1  353 ? 2.762   -12.392 -1.885  1.00 10.82 ?  493  ASN A ND2   1 
ATOM   2707 N  N     . ALA A 1  354 ? 2.700   -13.591 -7.590  1.00 11.62 ?  494  ALA A N     1 
ATOM   2708 C  CA    . ALA A 1  354 ? 3.216   -14.195 -8.805  1.00 13.92 ?  494  ALA A CA    1 
ATOM   2709 C  C     . ALA A 1  354 ? 4.345   -13.375 -9.400  1.00 19.33 ?  494  ALA A C     1 
ATOM   2710 O  O     . ALA A 1  354 ? 4.335   -12.126 -9.384  1.00 15.45 ?  494  ALA A O     1 
ATOM   2711 C  CB    . ALA A 1  354 ? 2.109   -14.373 -9.842  1.00 11.08 ?  494  ALA A CB    1 
ATOM   2712 O  OXT   . ALA A 1  354 ? 5.309   -13.977 -9.919  1.00 19.14 ?  494  ALA A OXT   1 
ATOM   2713 O  "O5'" . DC  B 2  1   ? 3.051   -18.449 -38.360 1.00 27.28 ?  1    DC  T "O5'" 1 
ATOM   2714 C  "C5'" . DC  B 2  1   ? 1.932   -18.647 -39.209 1.00 26.73 ?  1    DC  T "C5'" 1 
ATOM   2715 C  "C4'" . DC  B 2  1   ? 0.668   -18.841 -38.399 1.00 26.42 ?  1    DC  T "C4'" 1 
ATOM   2716 O  "O4'" . DC  B 2  1   ? 0.796   -20.036 -37.621 1.00 26.70 ?  1    DC  T "O4'" 1 
ATOM   2717 C  "C3'" . DC  B 2  1   ? 0.379   -17.739 -37.392 1.00 22.73 ?  1    DC  T "C3'" 1 
ATOM   2718 O  "O3'" . DC  B 2  1   ? -0.474  -16.802 -37.956 1.00 23.16 ?  1    DC  T "O3'" 1 
ATOM   2719 C  "C2'" . DC  B 2  1   ? -0.265  -18.451 -36.219 1.00 24.86 ?  1    DC  T "C2'" 1 
ATOM   2720 C  "C1'" . DC  B 2  1   ? 0.100   -19.907 -36.404 1.00 27.30 ?  1    DC  T "C1'" 1 
ATOM   2721 N  N1    . DC  B 2  1   ? 0.962   -20.486 -35.364 1.00 21.65 ?  1    DC  T N1    1 
ATOM   2722 C  C2    . DC  B 2  1   ? 0.400   -20.930 -34.170 1.00 20.84 ?  1    DC  T C2    1 
ATOM   2723 O  O2    . DC  B 2  1   ? -0.799  -20.749 -33.970 1.00 21.50 ?  1    DC  T O2    1 
ATOM   2724 N  N3    . DC  B 2  1   ? 1.185   -21.542 -33.269 1.00 20.16 ?  1    DC  T N3    1 
ATOM   2725 C  C4    . DC  B 2  1   ? 2.468   -21.728 -33.532 1.00 20.27 ?  1    DC  T C4    1 
ATOM   2726 N  N4    . DC  B 2  1   ? 3.201   -22.353 -32.627 1.00 19.65 ?  1    DC  T N4    1 
ATOM   2727 C  C5    . DC  B 2  1   ? 3.063   -21.275 -34.734 1.00 21.07 ?  1    DC  T C5    1 
ATOM   2728 C  C6    . DC  B 2  1   ? 2.274   -20.687 -35.625 1.00 21.92 ?  1    DC  T C6    1 
ATOM   2729 P  P     . DG  B 2  2   ? -0.456  -15.311 -37.385 1.00 25.97 ?  2    DG  T P     1 
ATOM   2730 O  OP1   . DG  B 2  2   ? -1.108  -14.480 -38.426 1.00 32.81 ?  2    DG  T OP1   1 
ATOM   2731 O  OP2   . DG  B 2  2   ? 0.888   -14.975 -36.869 1.00 23.52 ?  2    DG  T OP2   1 
ATOM   2732 O  "O5'" . DG  B 2  2   ? -1.382  -15.401 -36.103 1.00 23.14 ?  2    DG  T "O5'" 1 
ATOM   2733 C  "C5'" . DG  B 2  2   ? -2.696  -15.881 -36.241 1.00 22.31 ?  2    DG  T "C5'" 1 
ATOM   2734 C  "C4'" . DG  B 2  2   ? -3.398  -15.833 -34.917 1.00 21.60 ?  2    DG  T "C4'" 1 
ATOM   2735 O  "O4'" . DG  B 2  2   ? -2.735  -16.721 -33.975 1.00 21.34 ?  2    DG  T "O4'" 1 
ATOM   2736 C  "C3'" . DG  B 2  2   ? -3.396  -14.475 -34.246 1.00 21.30 ?  2    DG  T "C3'" 1 
ATOM   2737 O  "O3'" . DG  B 2  2   ? -4.590  -14.365 -33.494 1.00 21.01 ?  2    DG  T "O3'" 1 
ATOM   2738 C  "C2'" . DG  B 2  2   ? -2.121  -14.525 -33.396 1.00 20.28 ?  2    DG  T "C2'" 1 
ATOM   2739 C  "C1'" . DG  B 2  2   ? -2.099  -15.978 -32.946 1.00 20.92 ?  2    DG  T "C1'" 1 
ATOM   2740 N  N9    . DG  B 2  2   ? -0.779  -16.575 -32.748 1.00 19.71 ?  2    DG  T N9    1 
ATOM   2741 C  C8    . DG  B 2  2   ? 0.324   -16.457 -33.548 1.00 20.52 ?  2    DG  T C8    1 
ATOM   2742 N  N7    . DG  B 2  2   ? 1.347   -17.170 -33.136 1.00 20.30 ?  2    DG  T N7    1 
ATOM   2743 C  C5    . DG  B 2  2   ? 0.878   -17.809 -31.997 1.00 18.42 ?  2    DG  T C5    1 
ATOM   2744 C  C6    . DG  B 2  2   ? 1.533   -18.712 -31.107 1.00 17.29 ?  2    DG  T C6    1 
ATOM   2745 O  O6    . DG  B 2  2   ? 2.697   -19.158 -31.175 1.00 18.77 ?  2    DG  T O6    1 
ATOM   2746 N  N1    . DG  B 2  2   ? 0.684   -19.131 -30.089 1.00 16.77 ?  2    DG  T N1    1 
ATOM   2747 C  C2    . DG  B 2  2   ? -0.620  -18.715 -29.931 1.00 16.99 ?  2    DG  T C2    1 
ATOM   2748 N  N2    . DG  B 2  2   ? -1.285  -19.210 -28.878 1.00 17.30 ?  2    DG  T N2    1 
ATOM   2749 N  N3    . DG  B 2  2   ? -1.230  -17.870 -30.745 1.00 17.58 ?  2    DG  T N3    1 
ATOM   2750 C  C4    . DG  B 2  2   ? -0.428  -17.458 -31.746 1.00 17.78 ?  2    DG  T C4    1 
ATOM   2751 P  P     . DG  B 2  3   ? -5.030  -12.995 -32.794 1.00 23.27 ?  3    DG  T P     1 
ATOM   2752 O  OP1   . DG  B 2  3   ? -6.494  -13.135 -32.644 1.00 24.61 ?  3    DG  T OP1   1 
ATOM   2753 O  OP2   . DG  B 2  3   ? -4.324  -11.853 -33.404 1.00 23.97 ?  3    DG  T OP2   1 
ATOM   2754 O  "O5'" . DG  B 2  3   ? -4.345  -13.124 -31.335 1.00 19.79 ?  3    DG  T "O5'" 1 
ATOM   2755 C  "C5'" . DG  B 2  3   ? -4.822  -14.092 -30.476 1.00 19.51 ?  3    DG  T "C5'" 1 
ATOM   2756 C  "C4'" . DG  B 2  3   ? -3.963  -14.139 -29.255 1.00 18.21 ?  3    DG  T "C4'" 1 
ATOM   2757 O  "O4'" . DG  B 2  3   ? -2.719  -14.781 -29.588 1.00 19.20 ?  3    DG  T "O4'" 1 
ATOM   2758 C  "C3'" . DG  B 2  3   ? -3.585  -12.770 -28.710 1.00 19.10 ?  3    DG  T "C3'" 1 
ATOM   2759 O  "O3'" . DG  B 2  3   ? -4.336  -12.530 -27.527 1.00 18.30 ?  3    DG  T "O3'" 1 
ATOM   2760 C  "C2'" . DG  B 2  3   ? -2.062  -12.843 -28.455 1.00 18.43 ?  3    DG  T "C2'" 1 
ATOM   2761 C  "C1'" . DG  B 2  3   ? -1.739  -14.312 -28.674 1.00 19.26 ?  3    DG  T "C1'" 1 
ATOM   2762 N  N9    . DG  B 2  3   ? -0.417  -14.577 -29.238 1.00 17.78 ?  3    DG  T N9    1 
ATOM   2763 C  C8    . DG  B 2  3   ? 0.128   -14.053 -30.386 1.00 18.41 ?  3    DG  T C8    1 
ATOM   2764 N  N7    . DG  B 2  3   ? 1.337   -14.504 -30.645 1.00 17.89 ?  3    DG  T N7    1 
ATOM   2765 C  C5    . DG  B 2  3   ? 1.589   -15.390 -29.612 1.00 16.91 ?  3    DG  T C5    1 
ATOM   2766 C  C6    . DG  B 2  3   ? 2.729   -16.177 -29.346 1.00 16.93 ?  3    DG  T C6    1 
ATOM   2767 O  O6    . DG  B 2  3   ? 3.779   -16.266 -30.017 1.00 16.72 ?  3    DG  T O6    1 
ATOM   2768 N  N1    . DG  B 2  3   ? 2.586   -16.921 -28.187 1.00 15.02 ?  3    DG  T N1    1 
ATOM   2769 C  C2    . DG  B 2  3   ? 1.493   -16.909 -27.374 1.00 16.81 ?  3    DG  T C2    1 
ATOM   2770 N  N2    . DG  B 2  3   ? 1.548   -17.710 -26.304 1.00 15.93 ?  3    DG  T N2    1 
ATOM   2771 N  N3    . DG  B 2  3   ? 0.404   -16.197 -27.613 1.00 15.37 ?  3    DG  T N3    1 
ATOM   2772 C  C4    . DG  B 2  3   ? 0.528   -15.445 -28.735 1.00 16.47 ?  3    DG  T C4    1 
ATOM   2773 P  P     . DC  B 2  4   ? -4.314  -11.101 -26.806 1.00 16.51 ?  4    DC  T P     1 
ATOM   2774 O  OP1   . DC  B 2  4   ? -5.558  -11.122 -26.025 1.00 18.75 ?  4    DC  T OP1   1 
ATOM   2775 O  OP2   . DC  B 2  4   ? -3.964  -10.004 -27.690 1.00 17.48 ?  4    DC  T OP2   1 
ATOM   2776 O  "O5'" . DC  B 2  4   ? -3.074  -11.257 -25.794 1.00 14.66 ?  4    DC  T "O5'" 1 
ATOM   2777 C  "C5'" . DC  B 2  4   ? -3.115  -12.208 -24.813 1.00 12.90 ?  4    DC  T "C5'" 1 
ATOM   2778 C  "C4'" . DC  B 2  4   ? -1.740  -12.342 -24.186 1.00 13.32 ?  4    DC  T "C4'" 1 
ATOM   2779 O  "O4'" . DC  B 2  4   ? -0.796  -12.863 -25.175 1.00 14.27 ?  4    DC  T "O4'" 1 
ATOM   2780 C  "C3'" . DC  B 2  4   ? -1.139  -11.024 -23.679 1.00 12.77 ?  4    DC  T "C3'" 1 
ATOM   2781 O  "O3'" . DC  B 2  4   ? -0.806  -11.134 -22.276 1.00 12.09 ?  4    DC  T "O3'" 1 
ATOM   2782 C  "C2'" . DC  B 2  4   ? 0.094   -10.821 -24.554 1.00 12.37 ?  4    DC  T "C2'" 1 
ATOM   2783 C  "C1'" . DC  B 2  4   ? 0.438   -12.253 -24.940 1.00 12.64 ?  4    DC  T "C1'" 1 
ATOM   2784 N  N1    . DC  B 2  4   ? 1.324   -12.375 -26.133 1.00 11.94 ?  4    DC  T N1    1 
ATOM   2785 C  C2    . DC  B 2  4   ? 2.346   -13.325 -26.116 1.00 12.18 ?  4    DC  T C2    1 
ATOM   2786 O  O2    . DC  B 2  4   ? 2.470   -14.076 -25.138 1.00 13.32 ?  4    DC  T O2    1 
ATOM   2787 N  N3    . DC  B 2  4   ? 3.162   -13.428 -27.199 1.00 12.62 ?  4    DC  T N3    1 
ATOM   2788 C  C4    . DC  B 2  4   ? 2.985   -12.635 -28.246 1.00 14.67 ?  4    DC  T C4    1 
ATOM   2789 N  N4    . DC  B 2  4   ? 3.842   -12.770 -29.276 1.00 17.13 ?  4    DC  T N4    1 
ATOM   2790 C  C5    . DC  B 2  4   ? 1.947   -11.661 -28.297 1.00 15.18 ?  4    DC  T C5    1 
ATOM   2791 C  C6    . DC  B 2  4   ? 1.144   -11.558 -27.220 1.00 14.51 ?  4    DC  T C6    1 
ATOM   2792 P  P     . DA  B 2  5   ? -0.729  -9.806  -21.373 1.00 10.08 ?  5    DA  T P     1 
ATOM   2793 O  OP1   . DA  B 2  5   ? -0.028  -8.719  -22.041 1.00 10.28 ?  5    DA  T OP1   1 
ATOM   2794 O  OP2   . DA  B 2  5   ? -0.305  -10.324 -20.069 1.00 8.66  ?  5    DA  T OP2   1 
ATOM   2795 O  "O5'" . DA  B 2  5   ? -2.257  -9.339  -21.333 1.00 9.86  ?  5    DA  T "O5'" 1 
ATOM   2796 C  "C5'" . DA  B 2  5   ? -3.160  -10.100 -20.551 1.00 9.17  ?  5    DA  T "C5'" 1 
ATOM   2797 C  "C4'" . DA  B 2  5   ? -4.272  -9.232  -19.985 1.00 10.58 ?  5    DA  T "C4'" 1 
ATOM   2798 O  "O4'" . DA  B 2  5   ? -3.743  -8.286  -19.022 1.00 9.42  ?  5    DA  T "O4'" 1 
ATOM   2799 C  "C3'" . DA  B 2  5   ? -5.022  -8.392  -21.004 1.00 11.40 ?  5    DA  T "C3'" 1 
ATOM   2800 O  "O3'" . DA  B 2  5   ? -6.391  -8.342  -20.620 1.00 11.76 ?  5    DA  T "O3'" 1 
ATOM   2801 C  "C2'" . DA  B 2  5   ? -4.309  -7.046  -20.948 1.00 9.84  ?  5    DA  T "C2'" 1 
ATOM   2802 C  "C1'" . DA  B 2  5   ? -3.863  -6.965  -19.498 1.00 9.72  ?  5    DA  T "C1'" 1 
ATOM   2803 N  N9    . DA  B 2  5   ? -2.600  -6.284  -19.281 1.00 9.87  ?  5    DA  T N9    1 
ATOM   2804 C  C8    . DA  B 2  5   ? -1.489  -6.301  -20.075 1.00 10.12 ?  5    DA  T C8    1 
ATOM   2805 N  N7    . DA  B 2  5   ? -0.482  -5.601  -19.601 1.00 9.92  ?  5    DA  T N7    1 
ATOM   2806 C  C5    . DA  B 2  5   ? -0.958  -5.139  -18.384 1.00 8.30  ?  5    DA  T C5    1 
ATOM   2807 C  C6    . DA  B 2  5   ? -0.360  -4.384  -17.387 1.00 8.97  ?  5    DA  T C6    1 
ATOM   2808 N  N6    . DA  B 2  5   ? 0.890   -3.920  -17.463 1.00 9.80  ?  5    DA  T N6    1 
ATOM   2809 N  N1    . DA  B 2  5   ? -1.112  -4.113  -16.291 1.00 8.85  ?  5    DA  T N1    1 
ATOM   2810 C  C2    . DA  B 2  5   ? -2.353  -4.583  -16.212 1.00 9.05  ?  5    DA  T C2    1 
ATOM   2811 N  N3    . DA  B 2  5   ? -3.025  -5.328  -17.082 1.00 9.12  ?  5    DA  T N3    1 
ATOM   2812 C  C4    . DA  B 2  5   ? -2.255  -5.552  -18.171 1.00 9.17  ?  5    DA  T C4    1 
ATOM   2813 P  P     . DT  B 2  6   ? -7.476  -7.544  -21.505 1.00 14.37 ?  6    DT  T P     1 
ATOM   2814 O  OP1   . DT  B 2  6   ? -8.795  -8.129  -21.209 1.00 16.37 ?  6    DT  T OP1   1 
ATOM   2815 O  OP2   . DT  B 2  6   ? -7.038  -7.452  -22.923 1.00 15.49 ?  6    DT  T OP2   1 
ATOM   2816 O  "O5'" . DT  B 2  6   ? -7.423  -6.097  -20.937 1.00 13.89 ?  6    DT  T "O5'" 1 
ATOM   2817 C  "C5'" . DT  B 2  6   ? -7.852  -5.869  -19.586 1.00 14.42 ?  6    DT  T "C5'" 1 
ATOM   2818 C  "C4'" . DT  B 2  6   ? -7.513  -4.482  -19.129 1.00 13.14 ?  6    DT  T "C4'" 1 
ATOM   2819 O  "O4'" . DT  B 2  6   ? -6.099  -4.334  -18.995 1.00 14.32 ?  6    DT  T "O4'" 1 
ATOM   2820 C  "C3'" . DT  B 2  6   ? -7.928  -3.361  -20.100 1.00 16.78 ?  6    DT  T "C3'" 1 
ATOM   2821 O  "O3'" . DT  B 2  6   ? -9.137  -2.811  -19.708 1.00 16.58 ?  6    DT  T "O3'" 1 
ATOM   2822 C  "C2'" . DT  B 2  6   ? -6.791  -2.356  -20.000 1.00 16.26 ?  6    DT  T "C2'" 1 
ATOM   2823 C  "C1'" . DT  B 2  6   ? -5.869  -2.971  -18.953 1.00 15.27 ?  6    DT  T "C1'" 1 
ATOM   2824 N  N1    . DT  B 2  6   ? -4.480  -2.710  -19.191 1.00 13.84 ?  6    DT  T N1    1 
ATOM   2825 C  C2    . DT  B 2  6   ? -3.783  -2.090  -18.215 1.00 16.39 ?  6    DT  T C2    1 
ATOM   2826 O  O2    . DT  B 2  6   ? -4.279  -1.790  -17.150 1.00 17.36 ?  6    DT  T O2    1 
ATOM   2827 N  N3    . DT  B 2  6   ? -2.498  -1.840  -18.512 1.00 13.53 ?  6    DT  T N3    1 
ATOM   2828 C  C4    . DT  B 2  6   ? -1.837  -2.141  -19.683 1.00 12.11 ?  6    DT  T C4    1 
ATOM   2829 O  O4    . DT  B 2  6   ? -0.661  -1.881  -19.856 1.00 16.06 ?  6    DT  T O4    1 
ATOM   2830 C  C5    . DT  B 2  6   ? -2.641  -2.812  -20.693 1.00 12.43 ?  6    DT  T C5    1 
ATOM   2831 C  C7    . DT  B 2  6   ? -2.056  -3.201  -22.020 1.00 13.57 ?  6    DT  T C7    1 
ATOM   2832 C  C6    . DT  B 2  6   ? -3.911  -3.053  -20.398 1.00 12.71 ?  6    DT  T C6    1 
ATOM   2833 P  P     . DA  B 2  7   ? -9.888  -1.693  -20.591 1.00 16.23 ?  7    DA  T P     1 
ATOM   2834 O  OP1   . DA  B 2  7   ? -11.317 -1.842  -20.294 1.00 17.55 ?  7    DA  T OP1   1 
ATOM   2835 O  OP2   . DA  B 2  7   ? -9.411  -1.710  -21.995 1.00 17.13 ?  7    DA  T OP2   1 
ATOM   2836 O  "O5'" . DA  B 2  7   ? -9.369  -0.338  -19.950 1.00 16.69 ?  7    DA  T "O5'" 1 
ATOM   2837 C  "C5'" . DA  B 2  7   ? -9.685  -0.111  -18.609 1.00 16.74 ?  7    DA  T "C5'" 1 
ATOM   2838 C  "C4'" . DA  B 2  7   ? -8.848  0.971   -18.060 1.00 19.44 ?  7    DA  T "C4'" 1 
ATOM   2839 O  "O4'" . DA  B 2  7   ? -7.462  0.661   -18.285 1.00 20.29 ?  7    DA  T "O4'" 1 
ATOM   2840 C  "C3'" . DA  B 2  7   ? -9.100  2.323   -18.701 1.00 22.97 ?  7    DA  T "C3'" 1 
ATOM   2841 O  "O3'" . DA  B 2  7   ? -9.741  3.132   -17.755 1.00 26.56 ?  7    DA  T "O3'" 1 
ATOM   2842 C  "C2'" . DA  B 2  7   ? -7.709  2.825   -19.092 1.00 25.31 ?  7    DA  T "C2'" 1 
ATOM   2843 C  "C1'" . DA  B 2  7   ? -6.772  1.861   -18.363 1.00 21.72 ?  7    DA  T "C1'" 1 
ATOM   2844 N  N9    . DA  B 2  7   ? -5.491  1.630   -19.028 1.00 20.50 ?  7    DA  T N9    1 
ATOM   2845 C  C8    . DA  B 2  7   ? -5.266  1.036   -20.234 1.00 17.58 ?  7    DA  T C8    1 
ATOM   2846 N  N7    . DA  B 2  7   ? -3.991  0.974   -20.567 1.00 17.39 ?  7    DA  T N7    1 
ATOM   2847 C  C5    . DA  B 2  7   ? -3.350  1.565   -19.486 1.00 13.78 ?  7    DA  T C5    1 
ATOM   2848 C  C6    . DA  B 2  7   ? -2.000  1.834   -19.220 1.00 13.43 ?  7    DA  T C6    1 
ATOM   2849 N  N6    . DA  B 2  7   ? -1.016  1.514   -20.045 1.00 14.24 ?  7    DA  T N6    1 
ATOM   2850 N  N1    . DA  B 2  7   ? -1.712  2.443   -18.056 1.00 13.24 ?  7    DA  T N1    1 
ATOM   2851 C  C2    . DA  B 2  7   ? -2.699  2.769   -17.228 1.00 14.14 ?  7    DA  T C2    1 
ATOM   2852 N  N3    . DA  B 2  7   ? -4.004  2.578   -17.375 1.00 18.48 ?  7    DA  T N3    1 
ATOM   2853 C  C4    . DA  B 2  7   ? -4.261  1.971   -18.538 1.00 16.78 ?  7    DA  T C4    1 
ATOM   2854 P  P     . DC  B 2  8   ? -10.308 4.576   -18.124 1.00 20.49 ?  8    DC  T P     1 
ATOM   2855 O  OP1   . DC  B 2  8   ? -11.548 4.635   -17.322 1.00 23.61 ?  8    DC  T OP1   1 
ATOM   2856 O  OP2   . DC  B 2  8   ? -10.281 4.915   -19.553 1.00 21.35 ?  8    DC  T OP2   1 
ATOM   2857 O  "O5'" . DC  B 2  8   ? -9.324  5.562   -17.366 1.00 17.30 ?  8    DC  T "O5'" 1 
ATOM   2858 C  "C5'" . DC  B 2  8   ? -9.055  5.320   -16.022 1.00 15.09 ?  8    DC  T "C5'" 1 
ATOM   2859 C  "C4'" . DC  B 2  8   ? -7.839  6.086   -15.572 1.00 13.50 ?  8    DC  T "C4'" 1 
ATOM   2860 O  "O4'" . DC  B 2  8   ? -6.670  5.552   -16.241 1.00 14.04 ?  8    DC  T "O4'" 1 
ATOM   2861 C  "C3'" . DC  B 2  8   ? -7.844  7.579   -15.863 1.00 12.85 ?  8    DC  T "C3'" 1 
ATOM   2862 O  "O3'" . DC  B 2  8   ? -7.330  8.253   -14.712 1.00 13.71 ?  8    DC  T "O3'" 1 
ATOM   2863 C  "C2'" . DC  B 2  8   ? -6.936  7.699   -17.088 1.00 13.91 ?  8    DC  T "C2'" 1 
ATOM   2864 C  "C1'" . DC  B 2  8   ? -5.914  6.630   -16.786 1.00 13.69 ?  8    DC  T "C1'" 1 
ATOM   2865 N  N1    . DC  B 2  8   ? -5.149  6.125   -17.951 1.00 12.51 ?  8    DC  T N1    1 
ATOM   2866 C  C2    . DC  B 2  8   ? -3.744  6.194   -17.945 1.00 11.57 ?  8    DC  T C2    1 
ATOM   2867 O  O2    . DC  B 2  8   ? -3.162  6.697   -16.976 1.00 12.62 ?  8    DC  T O2    1 
ATOM   2868 N  N3    . DC  B 2  8   ? -3.065  5.698   -19.001 1.00 12.38 ?  8    DC  T N3    1 
ATOM   2869 C  C4    . DC  B 2  8   ? -3.729  5.158   -20.027 1.00 13.27 ?  8    DC  T C4    1 
ATOM   2870 N  N4    . DC  B 2  8   ? -3.018  4.689   -21.053 1.00 15.52 ?  8    DC  T N4    1 
ATOM   2871 C  C5    . DC  B 2  8   ? -5.146  5.075   -20.047 1.00 14.94 ?  8    DC  T C5    1 
ATOM   2872 C  C6    . DC  B 2  8   ? -5.810  5.572   -19.006 1.00 15.54 ?  8    DC  T C6    1 
ATOM   2873 P  P     . DG  B 2  9   ? -6.988  9.815   -14.692 1.00 13.16 ?  9    DG  T P     1 
ATOM   2874 O  OP1   . DG  B 2  9   ? -7.073  10.221  -13.263 1.00 13.62 ?  9    DG  T OP1   1 
ATOM   2875 O  OP2   . DG  B 2  9   ? -7.810  10.484  -15.743 1.00 15.61 ?  9    DG  T OP2   1 
ATOM   2876 O  "O5'" . DG  B 2  9   ? -5.448  9.888   -15.181 1.00 12.42 ?  9    DG  T "O5'" 1 
ATOM   2877 C  "C5'" . DG  B 2  9   ? -4.370  9.665   -14.260 1.00 10.74 ?  9    DG  T "C5'" 1 
ATOM   2878 C  "C4'" . DG  B 2  9   ? -3.240  10.671  -14.436 1.00 11.17 ?  9    DG  T "C4'" 1 
ATOM   2879 O  "O4'" . DG  B 2  9   ? -2.428  10.320  -15.593 1.00 13.16 ?  9    DG  T "O4'" 1 
ATOM   2880 C  "C3'" . DG  B 2  9   ? -3.683  12.106  -14.664 1.00 14.73 ?  9    DG  T "C3'" 1 
ATOM   2881 O  "O3'" . DG  B 2  9   ? -2.769  13.005  -14.060 1.00 16.12 ?  9    DG  T "O3'" 1 
ATOM   2882 C  "C2'" . DG  B 2  9   ? -3.703  12.237  -16.188 1.00 12.75 ?  9    DG  T "C2'" 1 
ATOM   2883 C  "C1'" . DG  B 2  9   ? -2.574  11.314  -16.629 1.00 11.31 ?  9    DG  T "C1'" 1 
ATOM   2884 N  N9    . DG  B 2  9   ? -2.791  10.564  -17.860 1.00 11.54 ?  9    DG  T N9    1 
ATOM   2885 C  C8    . DG  B 2  9   ? -3.918  9.865   -18.215 1.00 13.52 ?  9    DG  T C8    1 
ATOM   2886 N  N7    . DG  B 2  9   ? -3.786  9.187   -19.321 1.00 12.39 ?  9    DG  T N7    1 
ATOM   2887 C  C5    . DG  B 2  9   ? -2.458  9.420   -19.696 1.00 9.93  ?  9    DG  T C5    1 
ATOM   2888 C  C6    . DG  B 2  9   ? -1.727  8.951   -20.807 1.00 11.31 ?  9    DG  T C6    1 
ATOM   2889 O  O6    . DG  B 2  9   ? -2.086  8.199   -21.715 1.00 12.80 ?  9    DG  T O6    1 
ATOM   2890 N  N1    . DG  B 2  9   ? -0.424  9.435   -20.797 1.00 11.00 ?  9    DG  T N1    1 
ATOM   2891 C  C2    . DG  B 2  9   ? 0.097   10.241  -19.845 1.00 10.90 ?  9    DG  T C2    1 
ATOM   2892 N  N2    . DG  B 2  9   ? 1.380   10.612  -20.020 1.00 12.33 ?  9    DG  T N2    1 
ATOM   2893 N  N3    . DG  B 2  9   ? -0.569  10.692  -18.816 1.00 10.17 ?  9    DG  T N3    1 
ATOM   2894 C  C4    . DG  B 2  9   ? -1.842  10.242  -18.799 1.00 10.45 ?  9    DG  T C4    1 
ATOM   2895 O  "O5'" . DC  C 3  1   ? 5.619   6.347   -26.400 1.00 21.51 ?  1    DC  P "O5'" 1 
ATOM   2896 C  "C5'" . DC  C 3  1   ? 6.689   7.258   -26.360 1.00 17.70 ?  1    DC  P "C5'" 1 
ATOM   2897 C  "C4'" . DC  C 3  1   ? 6.476   8.300   -25.297 1.00 15.63 ?  1    DC  P "C4'" 1 
ATOM   2898 O  "O4'" . DC  C 3  1   ? 5.203   8.985   -25.490 1.00 17.55 ?  1    DC  P "O4'" 1 
ATOM   2899 C  "C3'" . DC  C 3  1   ? 6.382   7.745   -23.887 1.00 15.73 ?  1    DC  P "C3'" 1 
ATOM   2900 O  "O3'" . DC  C 3  1   ? 7.674   7.467   -23.367 1.00 16.46 ?  1    DC  P "O3'" 1 
ATOM   2901 C  "C2'" . DC  C 3  1   ? 5.689   8.867   -23.168 1.00 14.60 ?  1    DC  P "C2'" 1 
ATOM   2902 C  "C1'" . DC  C 3  1   ? 4.664   9.314   -24.209 1.00 15.70 ?  1    DC  P "C1'" 1 
ATOM   2903 N  N1    . DC  C 3  1   ? 3.363   8.665   -24.067 1.00 14.97 ?  1    DC  P N1    1 
ATOM   2904 C  C2    . DC  C 3  1   ? 2.509   9.107   -23.074 1.00 12.31 ?  1    DC  P C2    1 
ATOM   2905 O  O2    . DC  C 3  1   ? 2.899   10.000  -22.323 1.00 14.71 ?  1    DC  P O2    1 
ATOM   2906 N  N3    . DC  C 3  1   ? 1.298   8.543   -22.959 1.00 12.95 ?  1    DC  P N3    1 
ATOM   2907 C  C4    . DC  C 3  1   ? 0.942   7.555   -23.777 1.00 14.35 ?  1    DC  P C4    1 
ATOM   2908 N  N4    . DC  C 3  1   ? -0.279  7.026   -23.623 1.00 14.51 ?  1    DC  P N4    1 
ATOM   2909 C  C5    . DC  C 3  1   ? 1.802   7.084   -24.804 1.00 15.41 ?  1    DC  P C5    1 
ATOM   2910 C  C6    . DC  C 3  1   ? 3.003   7.657   -24.906 1.00 14.61 ?  1    DC  P C6    1 
ATOM   2911 P  P     . DG  C 3  2   ? 7.859   6.289   -22.286 1.00 19.82 ?  2    DG  P P     1 
ATOM   2912 O  OP1   . DG  C 3  2   ? 9.300   6.266   -22.024 1.00 14.35 ?  2    DG  P OP1   1 
ATOM   2913 O  OP2   . DG  C 3  2   ? 7.205   5.061   -22.751 1.00 14.95 ?  2    DG  P OP2   1 
ATOM   2914 O  "O5'" . DG  C 3  2   ? 7.101   6.827   -20.980 1.00 13.84 ?  2    DG  P "O5'" 1 
ATOM   2915 C  "C5'" . DG  C 3  2   ? 7.620   7.923   -20.255 1.00 12.41 ?  2    DG  P "C5'" 1 
ATOM   2916 C  "C4'" . DG  C 3  2   ? 6.636   8.383   -19.216 1.00 11.42 ?  2    DG  P "C4'" 1 
ATOM   2917 O  "O4'" . DG  C 3  2   ? 5.399   8.768   -19.861 1.00 14.02 ?  2    DG  P "O4'" 1 
ATOM   2918 C  "C3'" . DG  C 3  2   ? 6.219   7.328   -18.203 1.00 10.56 ?  2    DG  P "C3'" 1 
ATOM   2919 O  "O3'" . DG  C 3  2   ? 7.143   7.230   -17.156 1.00 11.89 ?  2    DG  P "O3'" 1 
ATOM   2920 C  "C2'" . DG  C 3  2   ? 4.890   7.888   -17.730 1.00 11.74 ?  2    DG  P "C2'" 1 
ATOM   2921 C  "C1'" . DG  C 3  2   ? 4.301   8.441   -18.998 1.00 11.83 ?  2    DG  P "C1'" 1 
ATOM   2922 N  N9    . DG  C 3  2   ? 3.438   7.493   -19.666 1.00 11.37 ?  2    DG  P N9    1 
ATOM   2923 C  C8    . DG  C 3  2   ? 3.730   6.728   -20.769 1.00 11.01 ?  2    DG  P C8    1 
ATOM   2924 N  N7    . DG  C 3  2   ? 2.753   5.964   -21.140 1.00 11.64 ?  2    DG  P N7    1 
ATOM   2925 C  C5    . DG  C 3  2   ? 1.737   6.251   -20.229 1.00 10.27 ?  2    DG  P C5    1 
ATOM   2926 C  C6    . DG  C 3  2   ? 0.413   5.738   -20.133 1.00 9.62  ?  2    DG  P C6    1 
ATOM   2927 O  O6    . DG  C 3  2   ? -0.157  4.914   -20.870 1.00 11.89 ?  2    DG  P O6    1 
ATOM   2928 N  N1    . DG  C 3  2   ? -0.276  6.323   -19.066 1.00 9.81  ?  2    DG  P N1    1 
ATOM   2929 C  C2    . DG  C 3  2   ? 0.254   7.240   -18.193 1.00 8.92  ?  2    DG  P C2    1 
ATOM   2930 N  N2    . DG  C 3  2   ? -0.550  7.679   -17.213 1.00 9.81  ?  2    DG  P N2    1 
ATOM   2931 N  N3    . DG  C 3  2   ? 1.484   7.720   -18.282 1.00 10.30 ?  2    DG  P N3    1 
ATOM   2932 C  C4    . DG  C 3  2   ? 2.152   7.188   -19.321 1.00 9.97  ?  2    DG  P C4    1 
ATOM   2933 P  P     . DT  C 3  3   ? 7.256   5.896   -16.273 1.00 14.30 ?  3    DT  P P     1 
ATOM   2934 O  OP1   . DT  C 3  3   ? 8.340   6.093   -15.296 1.00 11.56 ?  3    DT  P OP1   1 
ATOM   2935 O  OP2   . DT  C 3  3   ? 7.203   4.693   -17.118 1.00 10.64 ?  3    DT  P OP2   1 
ATOM   2936 O  "O5'" . DT  C 3  3   ? 5.849   5.842   -15.467 1.00 11.16 ?  3    DT  P "O5'" 1 
ATOM   2937 C  "C5'" . DT  C 3  3   ? 5.507   6.876   -14.586 1.00 11.19 ?  3    DT  P "C5'" 1 
ATOM   2938 C  "C4'" . DT  C 3  3   ? 4.099   6.677   -14.075 1.00 11.45 ?  3    DT  P "C4'" 1 
ATOM   2939 O  "O4'" . DT  C 3  3   ? 3.154   6.799   -15.148 1.00 11.53 ?  3    DT  P "O4'" 1 
ATOM   2940 C  "C3'" . DT  C 3  3   ? 3.846   5.323   -13.518 1.00 11.00 ?  3    DT  P "C3'" 1 
ATOM   2941 O  "O3'" . DT  C 3  3   ? 4.335   5.261   -12.251 1.00 12.88 ?  3    DT  P "O3'" 1 
ATOM   2942 C  "C2'" . DT  C 3  3   ? 2.336   5.212   -13.596 1.00 10.76 ?  3    DT  P "C2'" 1 
ATOM   2943 C  "C1'" . DT  C 3  3   ? 2.069   5.885   -14.917 1.00 9.77  ?  3    DT  P "C1'" 1 
ATOM   2944 N  N1    . DT  C 3  3   ? 1.988   4.938   -16.056 1.00 9.87  ?  3    DT  P N1    1 
ATOM   2945 C  C2    . DT  C 3  3   ? 0.781   4.340   -16.302 1.00 8.85  ?  3    DT  P C2    1 
ATOM   2946 O  O2    . DT  C 3  3   ? -0.177  4.532   -15.606 1.00 10.68 ?  3    DT  P O2    1 
ATOM   2947 N  N3    . DT  C 3  3   ? 0.765   3.496   -17.374 1.00 10.28 ?  3    DT  P N3    1 
ATOM   2948 C  C4    . DT  C 3  3   ? 1.802   3.187   -18.202 1.00 9.60  ?  3    DT  P C4    1 
ATOM   2949 O  O4    . DT  C 3  3   ? 1.671   2.419   -19.153 1.00 12.64 ?  3    DT  P O4    1 
ATOM   2950 C  C5    . DT  C 3  3   ? 3.057   3.852   -17.904 1.00 9.84  ?  3    DT  P C5    1 
ATOM   2951 C  C7    . DT  C 3  3   ? 4.274   3.596   -18.739 1.00 11.43 ?  3    DT  P C7    1 
ATOM   2952 C  C6    . DT  C 3  3   ? 3.086   4.688   -16.843 1.00 9.72  ?  3    DT  P C6    1 
ATOM   2953 P  P     A DA  C 3  4   ? 4.557   3.830   -11.594 0.79 14.15 ?  4    DA  P P     1 
ATOM   2954 O  OP1   A DA  C 3  4   ? 5.161   3.973   -10.246 0.79 12.64 ?  4    DA  P OP1   1 
ATOM   2955 O  OP2   A DA  C 3  4   ? 5.154   2.869   -12.561 0.79 11.50 ?  4    DA  P OP2   1 
ATOM   2956 O  "O5'" A DA  C 3  4   ? 3.047   3.322   -11.375 0.79 13.39 ?  4    DA  P "O5'" 1 
ATOM   2957 C  "C5'" A DA  C 3  4   ? 2.099   4.098   -10.582 0.79 12.06 ?  4    DA  P "C5'" 1 
ATOM   2958 C  "C4'" A DA  C 3  4   ? 0.787   3.344   -10.432 0.79 11.34 ?  4    DA  P "C4'" 1 
ATOM   2959 O  "O4'" A DA  C 3  4   ? 0.112   3.329   -11.706 0.79 12.04 ?  4    DA  P "O4'" 1 
ATOM   2960 C  "C3'" A DA  C 3  4   ? 0.946   1.885   -10.024 0.79 9.14  ?  4    DA  P "C3'" 1 
ATOM   2961 O  "O3'" A DA  C 3  4   ? 0.838   1.752   -8.581  0.79 8.43  ?  4    DA  P "O3'" 1 
ATOM   2962 C  "C2'" A DA  C 3  4   ? -0.190  1.175   -10.736 0.79 11.24 ?  4    DA  P "C2'" 1 
ATOM   2963 C  "C1'" A DA  C 3  4   ? -0.463  2.059   -11.953 0.79 12.62 ?  4    DA  P "C1'" 1 
ATOM   2964 N  N9    A DA  C 3  4   ? 0.064   1.538   -13.221 0.79 13.35 ?  4    DA  P N9    1 
ATOM   2965 C  C8    A DA  C 3  4   ? 1.345   1.649   -13.698 0.79 9.74  ?  4    DA  P C8    1 
ATOM   2966 N  N7    A DA  C 3  4   ? 1.522   1.107   -14.875 0.79 10.13 ?  4    DA  P N7    1 
ATOM   2967 C  C5    A DA  C 3  4   ? 0.278   0.615   -15.214 0.79 12.21 ?  4    DA  P C5    1 
ATOM   2968 C  C6    A DA  C 3  4   ? -0.197  -0.075  -16.349 0.79 8.89  ?  4    DA  P C6    1 
ATOM   2969 N  N6    A DA  C 3  4   ? 0.565   -0.399  -17.407 0.79 8.64  ?  4    DA  P N6    1 
ATOM   2970 N  N1    A DA  C 3  4   ? -1.499  -0.423  -16.361 0.79 13.38 ?  4    DA  P N1    1 
ATOM   2971 C  C2    A DA  C 3  4   ? -2.267  -0.108  -15.313 0.79 14.14 ?  4    DA  P C2    1 
ATOM   2972 N  N3    A DA  C 3  4   ? -1.937  0.531   -14.191 0.79 12.29 ?  4    DA  P N3    1 
ATOM   2973 C  C4    A DA  C 3  4   ? -0.639  0.873   -14.206 0.79 12.76 ?  4    DA  P C4    1 
ATOM   2974 O  OP3   . DG  D 4  1   ? 14.279  -18.797 -26.907 1.00 20.26 ?  1    DG  D OP3   1 
ATOM   2975 P  P     . DG  D 4  1   ? 13.667  -17.540 -27.408 1.00 16.93 ?  1    DG  D P     1 
ATOM   2976 O  OP1   . DG  D 4  1   ? 14.637  -16.433 -27.276 1.00 18.28 ?  1    DG  D OP1   1 
ATOM   2977 O  OP2   . DG  D 4  1   ? 13.077  -17.790 -28.743 1.00 19.93 ?  1    DG  D OP2   1 
ATOM   2978 O  "O5'" . DG  D 4  1   ? 12.402  -17.219 -26.483 1.00 18.17 ?  1    DG  D "O5'" 1 
ATOM   2979 C  "C5'" . DG  D 4  1   ? 12.559  -17.071 -25.073 1.00 17.76 ?  1    DG  D "C5'" 1 
ATOM   2980 C  "C4'" . DG  D 4  1   ? 11.490  -17.854 -24.333 1.00 16.08 ?  1    DG  D "C4'" 1 
ATOM   2981 O  "O4'" . DG  D 4  1   ? 10.174  -17.268 -24.571 1.00 14.39 ?  1    DG  D "O4'" 1 
ATOM   2982 C  "C3'" . DG  D 4  1   ? 11.370  -19.304 -24.752 1.00 15.83 ?  1    DG  D "C3'" 1 
ATOM   2983 O  "O3'" . DG  D 4  1   ? 11.033  -20.080 -23.620 1.00 15.97 ?  1    DG  D "O3'" 1 
ATOM   2984 C  "C2'" . DG  D 4  1   ? 10.272  -19.278 -25.821 1.00 14.44 ?  1    DG  D "C2'" 1 
ATOM   2985 C  "C1'" . DG  D 4  1   ? 9.373   -18.121 -25.377 1.00 14.30 ?  1    DG  D "C1'" 1 
ATOM   2986 N  N9    . DG  D 4  1   ? 8.820   -17.284 -26.456 1.00 14.59 ?  1    DG  D N9    1 
ATOM   2987 C  C8    . DG  D 4  1   ? 9.440   -16.899 -27.623 1.00 14.90 ?  1    DG  D C8    1 
ATOM   2988 N  N7    . DG  D 4  1   ? 8.718   -16.088 -28.355 1.00 16.14 ?  1    DG  D N7    1 
ATOM   2989 C  C5    . DG  D 4  1   ? 7.558   -15.902 -27.606 1.00 14.66 ?  1    DG  D C5    1 
ATOM   2990 C  C6    . DG  D 4  1   ? 6.405   -15.128 -27.882 1.00 14.25 ?  1    DG  D C6    1 
ATOM   2991 O  O6    . DG  D 4  1   ? 6.177   -14.409 -28.866 1.00 16.04 ?  1    DG  D O6    1 
ATOM   2992 N  N1    . DG  D 4  1   ? 5.466   -15.222 -26.862 1.00 12.60 ?  1    DG  D N1    1 
ATOM   2993 C  C2    . DG  D 4  1   ? 5.615   -15.959 -25.719 1.00 12.10 ?  1    DG  D C2    1 
ATOM   2994 N  N2    . DG  D 4  1   ? 4.595   -15.917 -24.856 1.00 12.04 ?  1    DG  D N2    1 
ATOM   2995 N  N3    . DG  D 4  1   ? 6.683   -16.702 -25.448 1.00 12.69 ?  1    DG  D N3    1 
ATOM   2996 C  C4    . DG  D 4  1   ? 7.614   -16.619 -26.434 1.00 12.57 ?  1    DG  D C4    1 
ATOM   2997 P  P     . DC  D 4  2   ? 11.134  -21.676 -23.638 1.00 17.28 ?  2    DC  D P     1 
ATOM   2998 O  OP1   . DC  D 4  2   ? 11.599  -22.085 -22.281 1.00 18.02 ?  2    DC  D OP1   1 
ATOM   2999 O  OP2   . DC  D 4  2   ? 11.832  -22.122 -24.852 1.00 20.32 ?  2    DC  D OP2   1 
ATOM   3000 O  "O5'" . DC  D 4  2   ? 9.621   -22.128 -23.748 1.00 17.29 ?  2    DC  D "O5'" 1 
ATOM   3001 C  "C5'" . DC  D 4  2   ? 8.763   -21.781 -22.684 1.00 16.66 ?  2    DC  D "C5'" 1 
ATOM   3002 C  "C4'" . DC  D 4  2   ? 7.334   -21.558 -23.147 1.00 14.93 ?  2    DC  D "C4'" 1 
ATOM   3003 O  "O4'" . DC  D 4  2   ? 7.277   -20.660 -24.255 1.00 14.76 ?  2    DC  D "O4'" 1 
ATOM   3004 C  "C3'" . DC  D 4  2   ? 6.582   -22.803 -23.614 1.00 16.05 ?  2    DC  D "C3'" 1 
ATOM   3005 O  "O3'" . DC  D 4  2   ? 5.844   -23.320 -22.507 1.00 15.89 ?  2    DC  D "O3'" 1 
ATOM   3006 C  "C2'" . DC  D 4  2   ? 5.689   -22.287 -24.762 1.00 18.37 ?  2    DC  D "C2'" 1 
ATOM   3007 C  "C1'" . DC  D 4  2   ? 5.972   -20.786 -24.777 1.00 16.52 ?  2    DC  D "C1'" 1 
ATOM   3008 N  N1    . DC  D 4  2   ? 5.927   -20.118 -26.112 1.00 15.58 ?  2    DC  D N1    1 
ATOM   3009 C  C2    . DC  D 4  2   ? 4.856   -19.271 -26.432 1.00 14.08 ?  2    DC  D C2    1 
ATOM   3010 O  O2    . DC  D 4  2   ? 3.941   -19.127 -25.619 1.00 14.86 ?  2    DC  D O2    1 
ATOM   3011 N  N3    . DC  D 4  2   ? 4.857   -18.635 -27.626 1.00 14.28 ?  2    DC  D N3    1 
ATOM   3012 C  C4    . DC  D 4  2   ? 5.858   -18.825 -28.487 1.00 16.87 ?  2    DC  D C4    1 
ATOM   3013 N  N4    . DC  D 4  2   ? 5.806   -18.182 -29.662 1.00 17.91 ?  2    DC  D N4    1 
ATOM   3014 C  C5    . DC  D 4  2   ? 6.961   -19.672 -28.180 1.00 16.45 ?  2    DC  D C5    1 
ATOM   3015 C  C6    . DC  D 4  2   ? 6.953   -20.301 -27.005 1.00 17.89 ?  2    DC  D C6    1 
ATOM   3016 P  P     A DC  D 4  3   ? 5.065   -24.722 -22.520 0.38 15.17 ?  3    DC  D P     1 
ATOM   3017 P  P     B DC  D 4  3   ? 4.756   -24.481 -22.745 0.62 14.38 ?  3    DC  D P     1 
ATOM   3018 O  OP1   A DC  D 4  3   ? 5.048   -25.240 -21.137 0.38 13.54 ?  3    DC  D OP1   1 
ATOM   3019 O  OP1   B DC  D 4  3   ? 4.528   -25.148 -21.458 0.62 13.90 ?  3    DC  D OP1   1 
ATOM   3020 O  OP2   A DC  D 4  3   ? 5.635   -25.582 -23.595 0.38 17.74 ?  3    DC  D OP2   1 
ATOM   3021 O  OP2   B DC  D 4  3   ? 5.110   -25.310 -23.956 0.62 16.03 ?  3    DC  D OP2   1 
ATOM   3022 O  "O5'" A DC  D 4  3   ? 3.573   -24.315 -22.932 0.38 13.81 ?  3    DC  D "O5'" 1 
ATOM   3023 O  "O5'" B DC  D 4  3   ? 3.463   -23.705 -23.178 0.62 14.64 ?  3    DC  D "O5'" 1 
ATOM   3024 C  "C5'" A DC  D 4  3   ? 2.831   -23.378 -22.127 0.38 15.69 ?  3    DC  D "C5'" 1 
ATOM   3025 C  "C5'" B DC  D 4  3   ? 2.830   -22.859 -22.264 0.62 15.20 ?  3    DC  D "C5'" 1 
ATOM   3026 C  "C4'" A DC  D 4  3   ? 1.442   -23.125 -22.697 0.38 16.60 ?  3    DC  D "C4'" 1 
ATOM   3027 C  "C4'" B DC  D 4  3   ? 1.420   -22.630 -22.713 0.62 15.89 ?  3    DC  D "C4'" 1 
ATOM   3028 O  "O4'" A DC  D 4  3   ? 1.570   -22.215 -23.809 0.38 16.92 ?  3    DC  D "O4'" 1 
ATOM   3029 O  "O4'" B DC  D 4  3   ? 1.451   -21.873 -23.953 0.62 17.75 ?  3    DC  D "O4'" 1 
ATOM   3030 C  "C3'" A DC  D 4  3   ? 0.723   -24.373 -23.221 0.38 19.09 ?  3    DC  D "C3'" 1 
ATOM   3031 C  "C3'" B DC  D 4  3   ? 0.663   -23.920 -22.996 0.62 18.20 ?  3    DC  D "C3'" 1 
ATOM   3032 O  "O3'" A DC  D 4  3   ? -0.363  -24.809 -22.302 0.38 22.55 ?  3    DC  D "O3'" 1 
ATOM   3033 O  "O3'" B DC  D 4  3   ? -0.613  -23.899 -22.353 0.62 19.91 ?  3    DC  D "O3'" 1 
ATOM   3034 C  "C2'" A DC  D 4  3   ? 0.226   -24.001 -24.632 0.38 18.81 ?  3    DC  D "C2'" 1 
ATOM   3035 C  "C2'" B DC  D 4  3   ? 0.599   -23.991 -24.540 0.62 18.25 ?  3    DC  D "C2'" 1 
ATOM   3036 C  "C1'" A DC  D 4  3   ? 0.691   -22.570 -24.866 0.38 16.93 ?  3    DC  D "C1'" 1 
ATOM   3037 C  "C1'" B DC  D 4  3   ? 0.725   -22.541 -24.982 0.62 16.89 ?  3    DC  D "C1'" 1 
ATOM   3038 N  N1    A DC  D 4  3   ? 1.464   -22.344 -26.125 0.38 16.22 ?  3    DC  D N1    1 
ATOM   3039 N  N1    B DC  D 4  3   ? 1.499   -22.267 -26.268 0.62 16.37 ?  3    DC  D N1    1 
ATOM   3040 C  C2    A DC  D 4  3   ? 1.014   -21.408 -27.073 0.38 17.12 ?  3    DC  D C2    1 
ATOM   3041 C  C2    B DC  D 4  3   ? 1.008   -21.312 -27.185 0.62 16.92 ?  3    DC  D C2    1 
ATOM   3042 O  O2    A DC  D 4  3   ? -0.063  -20.828 -26.886 0.38 16.93 ?  3    DC  D O2    1 
ATOM   3043 O  O2    B DC  D 4  3   ? -0.082  -20.773 -26.956 0.62 17.24 ?  3    DC  D O2    1 
ATOM   3044 N  N3    A DC  D 4  3   ? 1.771   -21.177 -28.174 0.38 15.89 ?  3    DC  D N3    1 
ATOM   3045 N  N3    B DC  D 4  3   ? 1.746   -21.003 -28.288 0.62 15.91 ?  3    DC  D N3    1 
ATOM   3046 C  C4    A DC  D 4  3   ? 2.931   -21.819 -28.333 0.38 16.10 ?  3    DC  D C4    1 
ATOM   3047 C  C4    B DC  D 4  3   ? 2.923   -21.602 -28.487 0.62 16.12 ?  3    DC  D C4    1 
ATOM   3048 N  N4    A DC  D 4  3   ? 3.652   -21.554 -29.424 0.38 16.72 ?  3    DC  D N4    1 
ATOM   3049 N  N4    B DC  D 4  3   ? 3.623   -21.267 -29.573 0.62 16.72 ?  3    DC  D N4    1 
ATOM   3050 C  C5    A DC  D 4  3   ? 3.404   -22.764 -27.375 0.38 15.73 ?  3    DC  D C5    1 
ATOM   3051 C  C5    B DC  D 4  3   ? 3.440   -22.567 -27.563 0.62 15.78 ?  3    DC  D C5    1 
ATOM   3052 C  C6    A DC  D 4  3   ? 2.651   -22.984 -26.298 0.38 16.84 ?  3    DC  D C6    1 
ATOM   3053 C  C6    B DC  D 4  3   ? 2.706   -22.859 -26.482 0.62 16.65 ?  3    DC  D C6    1 
ATOM   3054 P  P     A DG  D 4  4   ? -1.716  -23.952 -22.071 0.38 19.73 ?  4    DG  D P     1 
ATOM   3055 P  P     B DG  D 4  4   ? -1.554  -25.221 -22.343 0.62 21.38 ?  4    DG  D P     1 
ATOM   3056 O  OP1   A DG  D 4  4   ? -1.296  -22.556 -22.180 0.38 17.21 ?  4    DG  D OP1   1 
ATOM   3057 O  OP1   B DG  D 4  4   ? -2.329  -25.223 -21.119 0.62 20.99 ?  4    DG  D OP1   1 
ATOM   3058 O  OP2   A DG  D 4  4   ? -2.441  -24.483 -20.907 0.38 22.91 ?  4    DG  D OP2   1 
ATOM   3059 O  OP2   B DG  D 4  4   ? -0.778  -26.433 -22.704 0.62 24.28 ?  4    DG  D OP2   1 
ATOM   3060 O  "O5'" A DG  D 4  4   ? -2.618  -24.271 -23.361 0.38 20.30 ?  4    DG  D "O5'" 1 
ATOM   3061 O  "O5'" B DG  D 4  4   ? -2.536  -24.964 -23.585 0.62 20.91 ?  4    DG  D "O5'" 1 
ATOM   3062 C  "C5'" A DG  D 4  4   ? -3.503  -23.293 -23.872 0.38 19.95 ?  4    DG  D "C5'" 1 
ATOM   3063 C  "C5'" B DG  D 4  4   ? -3.165  -23.686 -23.734 0.62 18.84 ?  4    DG  D "C5'" 1 
ATOM   3064 C  "C4'" A DG  D 4  4   ? -4.051  -23.731 -25.221 0.38 20.03 ?  4    DG  D "C4'" 1 
ATOM   3065 C  "C4'" B DG  D 4  4   ? -3.909  -23.587 -25.067 0.62 20.50 ?  4    DG  D "C4'" 1 
ATOM   3066 O  "O4'" A DG  D 4  4   ? -3.074  -23.425 -26.260 0.38 20.82 ?  4    DG  D "O4'" 1 
ATOM   3067 O  "O4'" B DG  D 4  4   ? -2.952  -23.301 -26.123 0.62 20.44 ?  4    DG  D "O4'" 1 
ATOM   3068 C  "C3'" A DG  D 4  4   ? -4.335  -25.239 -25.338 0.38 20.25 ?  4    DG  D "C3'" 1 
ATOM   3069 C  "C3'" B DG  D 4  4   ? -4.648  -24.857 -25.500 0.62 20.66 ?  4    DG  D "C3'" 1 
ATOM   3070 O  "O3'" A DG  D 4  4   ? -5.638  -25.477 -25.873 0.38 19.81 ?  4    DG  D "O3'" 1 
ATOM   3071 O  "O3'" B DG  D 4  4   ? -5.931  -24.543 -26.059 0.62 19.58 ?  4    DG  D "O3'" 1 
ATOM   3072 C  "C2'" A DG  D 4  4   ? -3.235  -25.738 -26.270 0.38 20.62 ?  4    DG  D "C2'" 1 
ATOM   3073 C  "C2'" B DG  D 4  4   ? -3.718  -25.477 -26.533 0.62 20.94 ?  4    DG  D "C2'" 1 
ATOM   3074 C  "C1'" A DG  D 4  4   ? -2.998  -24.520 -27.144 0.38 20.43 ?  4    DG  D "C1'" 1 
ATOM   3075 C  "C1'" B DG  D 4  4   ? -3.083  -24.254 -27.165 0.62 19.95 ?  4    DG  D "C1'" 1 
ATOM   3076 N  N9    A DG  D 4  4   ? -1.706  -24.501 -27.854 0.38 18.51 ?  4    DG  D N9    1 
ATOM   3077 N  N9    B DG  D 4  4   ? -1.761  -24.489 -27.744 0.62 18.22 ?  4    DG  D N9    1 
ATOM   3078 C  C8    A DG  D 4  4   ? -0.596  -25.257 -27.586 0.38 17.94 ?  4    DG  D C8    1 
ATOM   3079 C  C8    B DG  D 4  4   ? -0.812  -25.375 -27.317 0.62 17.67 ?  4    DG  D C8    1 
ATOM   3080 N  N7    A DG  D 4  4   ? 0.402   -25.033 -28.400 0.38 18.18 ?  4    DG  D N7    1 
ATOM   3081 N  N7    B DG  D 4  4   ? 0.285   -25.353 -28.034 0.62 17.94 ?  4    DG  D N7    1 
ATOM   3082 C  C5    A DG  D 4  4   ? -0.084  -24.076 -29.280 0.38 18.19 ?  4    DG  D C5    1 
ATOM   3083 C  C5    B DG  D 4  4   ? 0.027   -24.385 -28.998 0.62 18.09 ?  4    DG  D C5    1 
ATOM   3084 C  C6    A DG  D 4  4   ? 0.543   -23.457 -30.388 0.38 18.67 ?  4    DG  D C6    1 
ATOM   3085 C  C6    B DG  D 4  4   ? 0.826   -23.931 -30.076 0.62 18.58 ?  4    DG  D C6    1 
ATOM   3086 O  O6    A DG  D 4  4   ? 1.709   -23.634 -30.830 0.38 18.91 ?  4    DG  D O6    1 
ATOM   3087 O  O6    B DG  D 4  4   ? 1.985   -24.269 -30.376 0.62 18.78 ?  4    DG  D O6    1 
ATOM   3088 N  N1    A DG  D 4  4   ? -0.314  -22.550 -31.018 0.38 18.95 ?  4    DG  D N1    1 
ATOM   3089 N  N1    B DG  D 4  4   ? 0.181   -22.936 -30.818 0.62 18.85 ?  4    DG  D N1    1 
ATOM   3090 C  C2    A DG  D 4  4   ? -1.610  -22.276 -30.615 0.38 18.78 ?  4    DG  D C2    1 
ATOM   3091 C  C2    B DG  D 4  4   ? -1.083  -22.475 -30.569 0.62 18.71 ?  4    DG  D C2    1 
ATOM   3092 N  N2    A DG  D 4  4   ? -2.284  -21.372 -31.343 0.38 19.16 ?  4    DG  D N2    1 
ATOM   3093 N  N2    B DG  D 4  4   ? -1.542  -21.523 -31.399 0.62 19.10 ?  4    DG  D N2    1 
ATOM   3094 N  N3    A DG  D 4  4   ? -2.207  -22.858 -29.574 0.38 18.33 ?  4    DG  D N3    1 
ATOM   3095 N  N3    B DG  D 4  4   ? -1.845  -22.899 -29.558 0.62 18.26 ?  4    DG  D N3    1 
ATOM   3096 C  C4    A DG  D 4  4   ? -1.388  -23.741 -28.961 0.38 18.06 ?  4    DG  D C4    1 
ATOM   3097 C  C4    B DG  D 4  4   ? -1.229  -23.851 -28.831 0.62 17.98 ?  4    DG  D C4    1 
HETATM 3098 P  PA    . 2KH E 5  .   ? 3.313   -0.912  -8.118  1.00 4.96  ?  701  2KH A PA    1 
HETATM 3099 O  O1A   . 2KH E 5  .   ? 4.077   -0.460  -9.337  1.00 9.29  ?  701  2KH A O1A   1 
HETATM 3100 O  O2A   . 2KH E 5  .   ? 3.214   0.033   -6.972  1.00 6.15  ?  701  2KH A O2A   1 
HETATM 3101 N  N3A   . 2KH E 5  .   ? 3.942   -2.382  -7.669  1.00 7.14  ?  701  2KH A N3A   1 
HETATM 3102 O  "O5'" . 2KH E 5  .   ? 1.823   -1.146  -8.647  1.00 6.36  ?  701  2KH A "O5'" 1 
HETATM 3103 P  PB    . 2KH E 5  .   ? 3.830   -3.159  -6.195  1.00 5.39  ?  701  2KH A PB    1 
HETATM 3104 O  O1B   . 2KH E 5  .   ? 3.135   -2.277  -5.193  1.00 5.71  ?  701  2KH A O1B   1 
HETATM 3105 O  O2B   . 2KH E 5  .   ? 3.227   -4.537  -6.384  1.00 9.87  ?  701  2KH A O2B   1 
HETATM 3106 O  O3B   . 2KH E 5  .   ? 5.324   -3.383  -5.685  1.00 5.09  ?  701  2KH A O3B   1 
HETATM 3107 P  PG    . 2KH E 5  .   ? 6.382   -2.188  -5.396  1.00 9.01  ?  701  2KH A PG    1 
HETATM 3108 O  O1G   . 2KH E 5  .   ? 7.116   -2.569  -4.141  1.00 11.27 ?  701  2KH A O1G   1 
HETATM 3109 O  O2G   . 2KH E 5  .   ? 7.347   -2.209  -6.579  1.00 10.30 ?  701  2KH A O2G   1 
HETATM 3110 O  O3G   . 2KH E 5  .   ? 5.626   -0.874  -5.328  1.00 6.23  ?  701  2KH A O3G   1 
HETATM 3111 C  "C5'" . 2KH E 5  .   ? 0.794   -1.448  -7.698  1.00 7.92  ?  701  2KH A "C5'" 1 
HETATM 3112 C  "C4'" . 2KH E 5  .   ? -0.197  -2.410  -8.298  1.00 7.17  ?  701  2KH A "C4'" 1 
HETATM 3113 O  "O4'" . 2KH E 5  .   ? -0.760  -1.831  -9.508  1.00 5.88  ?  701  2KH A "O4'" 1 
HETATM 3114 C  "C1'" . 2KH E 5  .   ? -1.053  -2.847  -10.443 1.00 4.71  ?  701  2KH A "C1'" 1 
HETATM 3115 C  "C2'" . 2KH E 5  .   ? -0.701  -4.175  -9.757  1.00 9.32  ?  701  2KH A "C2'" 1 
HETATM 3116 O  "O2'" . 2KH E 5  .   ? -1.825  -4.577  -8.991  1.00 9.42  ?  701  2KH A "O2'" 1 
HETATM 3117 C  "C3'" . 2KH E 5  .   ? 0.377   -3.724  -8.789  1.00 7.84  ?  701  2KH A "C3'" 1 
HETATM 3118 O  "O3'" . 2KH E 5  .   ? 0.608   -4.650  -7.736  1.00 7.67  ?  701  2KH A "O3'" 1 
HETATM 3119 N  N1    . 2KH E 5  .   ? -0.248  -2.664  -11.669 1.00 7.57  ?  701  2KH A N1    1 
HETATM 3120 C  C6    . 2KH E 5  .   ? 0.966   -2.016  -11.675 1.00 9.22  ?  701  2KH A C6    1 
HETATM 3121 C  C2    . 2KH E 5  .   ? -0.767  -3.207  -12.824 1.00 12.25 ?  701  2KH A C2    1 
HETATM 3122 O  O2    . 2KH E 5  .   ? -1.839  -3.789  -12.829 1.00 12.51 ?  701  2KH A O2    1 
HETATM 3123 N  N3    . 2KH E 5  .   ? 0.003   -3.036  -13.950 1.00 10.24 ?  701  2KH A N3    1 
HETATM 3124 C  C4    . 2KH E 5  .   ? 1.233   -2.412  -14.022 1.00 9.00  ?  701  2KH A C4    1 
HETATM 3125 O  O4    . 2KH E 5  .   ? 1.827   -2.344  -15.100 1.00 10.80 ?  701  2KH A O4    1 
HETATM 3126 C  C5    . 2KH E 5  .   ? 1.705   -1.880  -12.783 1.00 7.34  ?  701  2KH A C5    1 
HETATM 3127 MG MG    . MG  F 6  .   ? 2.439   2.171   -7.184  1.00 5.30  2  702  MG  A MG    1 
HETATM 3128 MG MG    . MG  G 6  .   ? 3.655   -0.317  -4.892  1.00 4.98  2  703  MG  A MG    1 
HETATM 3129 NA NA    . NA  H 7  .   ? 10.489  4.788   -15.043 1.00 11.95 1  704  NA  A NA    1 
HETATM 3130 CL CL    . CL  I 8  .   ? -4.625  -2.132  -13.098 0.83 44.69 -1 705  CL  A CL    1 
HETATM 3131 C  C1    . EDO J 9  .   ? 10.776  -30.341 -6.887  0.79 23.75 ?  706  EDO A C1    1 
HETATM 3132 O  O1    . EDO J 9  .   ? 9.851   -31.307 -7.401  0.79 28.50 ?  706  EDO A O1    1 
HETATM 3133 C  C2    . EDO J 9  .   ? 10.043  -29.020 -6.664  0.79 18.75 ?  706  EDO A C2    1 
HETATM 3134 O  O2    . EDO J 9  .   ? 9.005   -29.168 -5.694  0.79 20.46 ?  706  EDO A O2    1 
HETATM 3135 N  N1    . EPE K 10 .   ? 13.902  -8.021  1.899   0.76 34.30 ?  707  EPE A N1    1 
HETATM 3136 N  N4    . EPE K 10 .   ? 16.686  -7.344  1.896   0.76 33.30 ?  707  EPE A N4    1 
HETATM 3137 C  C5    . EPE K 10 .   ? 16.107  -8.112  0.813   0.76 29.58 ?  707  EPE A C5    1 
HETATM 3138 C  C6    . EPE K 10 .   ? 14.626  -7.807  0.632   0.76 29.72 ?  707  EPE A C6    1 
HETATM 3139 C  C9    . EPE K 10 .   ? 12.521  -7.504  1.832   0.76 30.23 ?  707  EPE A C9    1 
HETATM 3140 C  C10   . EPE K 10 .   ? 11.808  -8.086  0.619   0.76 25.73 ?  707  EPE A C10   1 
HETATM 3141 S  S     . EPE K 10 .   ? 10.012  -7.861  0.614   0.76 19.93 ?  707  EPE A S     1 
HETATM 3142 O  O1S   . EPE K 10 .   ? 9.742   -6.436  0.492   0.76 29.59 ?  707  EPE A O1S   1 
HETATM 3143 O  O2S   . EPE K 10 .   ? 9.529   -8.561  -0.576  0.76 31.27 ?  707  EPE A O2S   1 
HETATM 3144 O  O3S   . EPE K 10 .   ? 9.425   -8.399  1.818   0.76 14.98 ?  707  EPE A O3S   1 
HETATM 3145 O  O     . HOH L 11 .   ? 13.037  -3.957  -1.253  1.00 43.65 ?  801  HOH A O     1 
HETATM 3146 O  O     . HOH L 11 .   ? 11.377  19.192  -9.890  1.00 39.63 ?  802  HOH A O     1 
HETATM 3147 O  O     . HOH L 11 .   ? 10.371  9.119   -25.845 1.00 40.41 ?  803  HOH A O     1 
HETATM 3148 O  O     . HOH L 11 .   ? 18.059  4.292   -11.718 0.78 32.47 ?  804  HOH A O     1 
HETATM 3149 O  O     . HOH L 11 .   ? 15.293  5.653   -7.890  1.00 35.78 ?  805  HOH A O     1 
HETATM 3150 O  O     . HOH L 11 .   ? -10.741 -6.126  -21.834 0.51 21.25 ?  806  HOH A O     1 
HETATM 3151 O  O     . HOH L 11 .   ? 28.124  8.943   -21.370 1.00 43.04 ?  807  HOH A O     1 
HETATM 3152 O  O     . HOH L 11 .   ? 18.312  -26.179 -6.069  1.00 46.60 ?  808  HOH A O     1 
HETATM 3153 O  O     . HOH L 11 .   ? 25.804  4.080   -16.641 0.86 39.20 ?  809  HOH A O     1 
HETATM 3154 O  O     . HOH L 11 .   ? -1.703  0.609   6.980   0.81 35.53 ?  810  HOH A O     1 
HETATM 3155 O  O     . HOH L 11 .   ? -5.038  -15.413 4.908   1.00 36.32 ?  811  HOH A O     1 
HETATM 3156 O  O     . HOH L 11 .   ? 8.089   -5.044  -24.119 0.70 33.64 ?  812  HOH A O     1 
HETATM 3157 O  O     . HOH L 11 .   ? 14.893  2.196   3.436   1.00 43.53 ?  813  HOH A O     1 
HETATM 3158 O  O     . HOH L 11 .   ? 23.773  -5.618  -13.852 1.00 40.69 ?  814  HOH A O     1 
HETATM 3159 O  O     . HOH L 11 .   ? 13.180  -30.648 -3.554  1.00 32.86 ?  815  HOH A O     1 
HETATM 3160 O  O     . HOH L 11 .   ? 8.004   -11.929 -7.027  1.00 46.68 ?  816  HOH A O     1 
HETATM 3161 O  O     . HOH L 11 .   ? 13.752  -10.658 -9.519  1.00 30.21 ?  817  HOH A O     1 
HETATM 3162 O  O     . HOH L 11 .   ? -22.106 -13.583 -3.651  1.00 40.71 ?  818  HOH A O     1 
HETATM 3163 O  O     A HOH L 11 .   ? -20.851 5.642   -9.411  0.45 21.31 ?  819  HOH A O     1 
HETATM 3164 O  O     B HOH L 11 .   ? -20.192 7.373   -8.834  0.55 23.07 ?  819  HOH A O     1 
HETATM 3165 O  O     A HOH L 11 .   ? -10.239 -10.283 0.104   0.50 12.92 ?  820  HOH A O     1 
HETATM 3166 O  O     B HOH L 11 .   ? -11.021 -8.784  -0.062  0.50 20.01 ?  820  HOH A O     1 
HETATM 3167 O  O     . HOH L 11 .   ? -13.786 -19.030 -5.079  1.00 30.41 ?  821  HOH A O     1 
HETATM 3168 O  O     . HOH L 11 .   ? 12.021  5.117   1.228   1.00 21.13 ?  822  HOH A O     1 
HETATM 3169 O  O     . HOH L 11 .   ? -6.374  8.417   10.658  0.63 25.31 ?  823  HOH A O     1 
HETATM 3170 O  O     . HOH L 11 .   ? 15.080  -1.433  -11.820 1.00 34.55 ?  824  HOH A O     1 
HETATM 3171 O  O     . HOH L 11 .   ? 1.457   -18.541 -15.820 1.00 28.61 ?  825  HOH A O     1 
HETATM 3172 O  O     . HOH L 11 .   ? -1.802  -17.158 3.201   1.00 37.20 ?  826  HOH A O     1 
HETATM 3173 O  O     . HOH L 11 .   ? 10.170  -9.598  -2.845  1.00 42.98 ?  827  HOH A O     1 
HETATM 3174 O  O     . HOH L 11 .   ? -17.037 5.610   6.291   1.00 19.28 ?  828  HOH A O     1 
HETATM 3175 O  O     . HOH L 11 .   ? 21.285  -28.582 -22.281 1.00 48.86 ?  829  HOH A O     1 
HETATM 3176 O  O     . HOH L 11 .   ? 17.039  -14.670 -23.215 1.00 24.42 ?  830  HOH A O     1 
HETATM 3177 O  O     . HOH L 11 .   ? 2.795   -18.690 -9.676  1.00 16.77 ?  831  HOH A O     1 
HETATM 3178 O  O     A HOH L 11 .   ? -8.838  -0.350  -15.306 0.52 5.49  ?  832  HOH A O     1 
HETATM 3179 O  O     B HOH L 11 .   ? -8.027  -1.556  -15.587 0.48 4.57  ?  832  HOH A O     1 
HETATM 3180 O  O     . HOH L 11 .   ? -18.739 -5.362  -13.039 1.00 12.05 ?  833  HOH A O     1 
HETATM 3181 O  O     . HOH L 11 .   ? 22.057  -0.377  -13.803 1.00 25.96 ?  834  HOH A O     1 
HETATM 3182 O  O     . HOH L 11 .   ? 14.708  1.044   -30.848 1.00 42.14 ?  835  HOH A O     1 
HETATM 3183 O  O     . HOH L 11 .   ? 12.147  13.858  -22.367 1.00 28.91 ?  836  HOH A O     1 
HETATM 3184 O  O     A HOH L 11 .   ? 4.311   0.140   -11.885 0.79 15.64 ?  837  HOH A O     1 
HETATM 3185 O  O     . HOH L 11 .   ? 9.788   -10.836 2.743   1.00 34.86 ?  838  HOH A O     1 
HETATM 3186 O  O     . HOH L 11 .   ? 7.789   -27.677 -22.509 0.78 35.88 ?  839  HOH A O     1 
HETATM 3187 O  O     . HOH L 11 .   ? 1.593   -0.362  -1.204  1.00 6.73  ?  840  HOH A O     1 
HETATM 3188 O  O     . HOH L 11 .   ? -21.086 -15.898 -9.257  1.00 42.35 ?  841  HOH A O     1 
HETATM 3189 O  O     . HOH L 11 .   ? -13.730 -11.417 2.239   1.00 16.40 ?  842  HOH A O     1 
HETATM 3190 O  O     . HOH L 11 .   ? 12.430  5.171   7.273   1.00 40.67 ?  843  HOH A O     1 
HETATM 3191 O  O     . HOH L 11 .   ? 13.167  6.142   -9.146  1.00 22.48 ?  844  HOH A O     1 
HETATM 3192 O  O     . HOH L 11 .   ? 6.063   -26.520 0.915   1.00 20.29 ?  845  HOH A O     1 
HETATM 3193 O  O     . HOH L 11 .   ? -20.469 -4.051  -7.756  1.00 21.94 ?  846  HOH A O     1 
HETATM 3194 O  O     . HOH L 11 .   ? -9.179  21.255  4.698   1.00 18.35 ?  847  HOH A O     1 
HETATM 3195 O  O     . HOH L 11 .   ? 4.839   -10.282 5.701   1.00 31.49 ?  848  HOH A O     1 
HETATM 3196 O  O     . HOH L 11 .   ? -19.813 -17.177 -13.229 1.00 44.50 ?  849  HOH A O     1 
HETATM 3197 O  O     . HOH L 11 .   ? 3.120   -14.753 1.231   1.00 13.92 ?  850  HOH A O     1 
HETATM 3198 O  O     . HOH L 11 .   ? -14.120 -17.796 -0.857  1.00 19.97 ?  851  HOH A O     1 
HETATM 3199 O  O     . HOH L 11 .   ? 27.887  -8.664  -21.699 1.00 31.84 ?  852  HOH A O     1 
HETATM 3200 O  O     . HOH L 11 .   ? -16.757 -17.984 -14.947 1.00 41.67 ?  853  HOH A O     1 
HETATM 3201 O  O     . HOH L 11 .   ? 14.564  4.768   5.053   1.00 44.57 ?  854  HOH A O     1 
HETATM 3202 O  O     . HOH L 11 .   ? 23.746  -19.820 -20.861 1.00 39.21 ?  855  HOH A O     1 
HETATM 3203 O  O     . HOH L 11 .   ? 10.210  18.556  -5.573  1.00 15.47 ?  856  HOH A O     1 
HETATM 3204 O  O     . HOH L 11 .   ? 9.917   10.870  -22.648 1.00 27.58 ?  857  HOH A O     1 
HETATM 3205 O  O     . HOH L 11 .   ? -9.087  4.433   -12.200 1.00 21.62 ?  858  HOH A O     1 
HETATM 3206 O  O     . HOH L 11 .   ? 5.414   -9.682  -4.814  1.00 12.31 ?  859  HOH A O     1 
HETATM 3207 O  O     . HOH L 11 .   ? 17.099  10.860  -31.223 0.80 37.93 ?  860  HOH A O     1 
HETATM 3208 O  O     . HOH L 11 .   ? 6.579   15.266  6.127   1.00 43.80 ?  861  HOH A O     1 
HETATM 3209 O  O     . HOH L 11 .   ? 14.114  -1.053  -26.909 1.00 28.93 ?  862  HOH A O     1 
HETATM 3210 O  O     . HOH L 11 .   ? 10.274  -12.320 -1.746  1.00 41.51 ?  863  HOH A O     1 
HETATM 3211 O  O     . HOH L 11 .   ? 28.287  1.691   -25.984 0.74 32.48 ?  864  HOH A O     1 
HETATM 3212 O  O     . HOH L 11 .   ? -10.721 -1.363  3.347   1.00 22.43 ?  865  HOH A O     1 
HETATM 3213 O  O     . HOH L 11 .   ? -4.449  -17.637 -22.744 1.00 29.99 ?  866  HOH A O     1 
HETATM 3214 O  O     . HOH L 11 .   ? -5.024  -3.161  3.304   1.00 16.94 ?  867  HOH A O     1 
HETATM 3215 O  O     . HOH L 11 .   ? -13.115 -22.660 -13.521 1.00 35.77 ?  868  HOH A O     1 
HETATM 3216 O  O     . HOH L 11 .   ? -9.483  14.395  8.749   1.00 32.07 ?  869  HOH A O     1 
HETATM 3217 O  O     . HOH L 11 .   ? 16.298  -24.167 -6.160  1.00 21.87 ?  870  HOH A O     1 
HETATM 3218 O  O     A HOH L 11 .   ? -18.561 -2.740  -12.050 0.59 11.05 ?  871  HOH A O     1 
HETATM 3219 O  O     B HOH L 11 .   ? -20.529 -2.673  -10.622 0.41 19.48 ?  871  HOH A O     1 
HETATM 3220 O  O     . HOH L 11 .   ? -10.763 2.706   0.960   1.00 10.56 ?  872  HOH A O     1 
HETATM 3221 O  O     . HOH L 11 .   ? 5.416   -2.873  -2.038  1.00 9.62  ?  873  HOH A O     1 
HETATM 3222 O  O     . HOH L 11 .   ? 7.131   -4.457  -8.101  1.00 28.53 ?  874  HOH A O     1 
HETATM 3223 O  O     . HOH L 11 .   ? -8.146  -12.393 2.637   1.00 33.72 ?  875  HOH A O     1 
HETATM 3224 O  O     . HOH L 11 .   ? 1.480   -23.173 -5.048  1.00 18.78 ?  876  HOH A O     1 
HETATM 3225 O  O     . HOH L 11 .   ? 12.545  -13.818 -8.018  0.62 24.01 ?  877  HOH A O     1 
HETATM 3226 O  O     . HOH L 11 .   ? 3.188   -5.474  4.577   1.00 13.29 ?  878  HOH A O     1 
HETATM 3227 O  O     . HOH L 11 .   ? 1.638   -20.909 -0.641  1.00 19.29 ?  879  HOH A O     1 
HETATM 3228 O  O     . HOH L 11 .   ? 5.793   -22.049 -2.963  1.00 12.49 ?  880  HOH A O     1 
HETATM 3229 O  O     . HOH L 11 .   ? -14.110 12.443  -10.008 1.00 43.39 ?  881  HOH A O     1 
HETATM 3230 O  O     . HOH L 11 .   ? 13.293  8.580   -10.127 1.00 16.24 ?  882  HOH A O     1 
HETATM 3231 O  O     . HOH L 11 .   ? 7.723   -13.411 -12.395 1.00 19.40 ?  883  HOH A O     1 
HETATM 3232 O  O     . HOH L 11 .   ? -25.920 7.082   -3.579  1.00 40.16 ?  884  HOH A O     1 
HETATM 3233 O  O     . HOH L 11 .   ? 12.002  -29.235 -19.090 1.00 32.47 ?  885  HOH A O     1 
HETATM 3234 O  O     . HOH L 11 .   ? -19.170 13.717  3.894   1.00 21.80 ?  886  HOH A O     1 
HETATM 3235 O  O     . HOH L 11 .   ? 9.196   -2.978  -23.726 1.00 34.91 ?  887  HOH A O     1 
HETATM 3236 O  O     . HOH L 11 .   ? 10.038  -2.603  -6.206  1.00 47.31 ?  888  HOH A O     1 
HETATM 3237 O  O     . HOH L 11 .   ? 20.137  -16.011 -9.538  1.00 22.44 ?  889  HOH A O     1 
HETATM 3238 O  O     . HOH L 11 .   ? -0.605  -16.639 -7.469  1.00 12.81 ?  890  HOH A O     1 
HETATM 3239 O  O     . HOH L 11 .   ? 16.953  -27.304 -22.782 1.00 35.52 ?  891  HOH A O     1 
HETATM 3240 O  O     . HOH L 11 .   ? 6.654   -20.169 1.451   1.00 26.96 ?  892  HOH A O     1 
HETATM 3241 O  O     . HOH L 11 .   ? -17.267 -20.506 -8.375  1.00 33.90 ?  893  HOH A O     1 
HETATM 3242 O  O     . HOH L 11 .   ? 17.844  -28.283 -20.494 1.00 47.10 ?  894  HOH A O     1 
HETATM 3243 O  O     . HOH L 11 .   ? -15.369 -2.994  -16.371 1.00 25.09 ?  895  HOH A O     1 
HETATM 3244 O  O     . HOH L 11 .   ? 10.779  4.306   -6.033  1.00 15.28 ?  896  HOH A O     1 
HETATM 3245 O  O     . HOH L 11 .   ? -5.572  15.239  -15.230 1.00 30.33 ?  897  HOH A O     1 
HETATM 3246 O  O     . HOH L 11 .   ? -4.890  -8.728  -6.318  1.00 7.92  ?  898  HOH A O     1 
HETATM 3247 O  O     . HOH L 11 .   ? 12.964  4.445   -28.464 1.00 33.18 ?  899  HOH A O     1 
HETATM 3248 O  O     . HOH L 11 .   ? 18.765  12.269  -6.393  1.00 22.65 ?  900  HOH A O     1 
HETATM 3249 O  O     . HOH L 11 .   ? -18.571 5.583   -3.539  1.00 13.58 ?  901  HOH A O     1 
HETATM 3250 O  O     . HOH L 11 .   ? 4.007   -0.651  -2.797  1.00 5.60  ?  902  HOH A O     1 
HETATM 3251 O  O     . HOH L 11 .   ? -0.102  -9.289  5.063   1.00 42.75 ?  903  HOH A O     1 
HETATM 3252 O  O     . HOH L 11 .   ? -14.456 20.157  3.073   1.00 16.90 ?  904  HOH A O     1 
HETATM 3253 O  O     . HOH L 11 .   ? 19.989  -6.700  -12.065 1.00 32.96 ?  905  HOH A O     1 
HETATM 3254 O  O     . HOH L 11 .   ? -21.518 1.121   1.279   1.00 27.98 ?  906  HOH A O     1 
HETATM 3255 O  O     . HOH L 11 .   ? 4.400   -3.877  -9.959  1.00 24.77 ?  907  HOH A O     1 
HETATM 3256 O  O     A HOH L 11 .   ? -13.622 9.590   6.864   0.42 22.21 ?  908  HOH A O     1 
HETATM 3257 O  O     B HOH L 11 .   ? -13.735 7.733   7.537   0.58 25.70 ?  908  HOH A O     1 
HETATM 3258 O  O     . HOH L 11 .   ? 2.026   10.566  10.358  0.58 22.63 ?  909  HOH A O     1 
HETATM 3259 O  O     . HOH L 11 .   ? -3.437  -8.587  3.339   1.00 31.38 ?  910  HOH A O     1 
HETATM 3260 O  O     . HOH L 11 .   ? -7.056  -19.880 -7.573  1.00 14.77 ?  911  HOH A O     1 
HETATM 3261 O  O     . HOH L 11 .   ? 6.903   -14.411 -4.707  1.00 15.63 ?  912  HOH A O     1 
HETATM 3262 O  O     . HOH L 11 .   ? -13.957 -16.749 -3.607  1.00 18.42 ?  913  HOH A O     1 
HETATM 3263 O  O     . HOH L 11 .   ? 9.315   -22.470 -4.418  1.00 9.72  ?  914  HOH A O     1 
HETATM 3264 O  O     . HOH L 11 .   ? -9.011  1.849   -10.636 1.00 21.39 ?  915  HOH A O     1 
HETATM 3265 O  O     . HOH L 11 .   ? 12.287  2.611   -3.473  1.00 23.89 ?  916  HOH A O     1 
HETATM 3266 O  O     . HOH L 11 .   ? -21.782 12.115  -7.950  1.00 39.10 ?  917  HOH A O     1 
HETATM 3267 O  O     . HOH L 11 .   ? -10.191 10.054  7.403   0.41 15.22 ?  918  HOH A O     1 
HETATM 3268 O  O     . HOH L 11 .   ? 23.629  -16.738 -13.465 1.00 20.26 ?  919  HOH A O     1 
HETATM 3269 O  O     . HOH L 11 .   ? 17.917  -4.401  -25.129 1.00 26.05 ?  920  HOH A O     1 
HETATM 3270 O  O     . HOH L 11 .   ? -7.939  -6.688  -12.389 1.00 10.50 ?  921  HOH A O     1 
HETATM 3271 O  O     . HOH L 11 .   ? -5.317  -11.828 3.962   1.00 38.43 ?  922  HOH A O     1 
HETATM 3272 O  O     . HOH L 11 .   ? 12.019  -16.257 -1.507  1.00 12.26 ?  923  HOH A O     1 
HETATM 3273 O  O     . HOH L 11 .   ? 21.314  10.867  -7.910  1.00 34.44 ?  924  HOH A O     1 
HETATM 3274 O  O     . HOH L 11 .   ? 25.703  -3.901  -24.301 1.00 27.19 ?  925  HOH A O     1 
HETATM 3275 O  O     . HOH L 11 .   ? 6.392   -11.365 -11.114 1.00 26.52 ?  926  HOH A O     1 
HETATM 3276 O  O     . HOH L 11 .   ? 16.205  -12.040 -22.507 1.00 17.39 ?  927  HOH A O     1 
HETATM 3277 O  O     . HOH L 11 .   ? 9.575   -2.853  7.127   1.00 39.28 ?  928  HOH A O     1 
HETATM 3278 O  O     . HOH L 11 .   ? 4.287   -18.572 -21.777 1.00 16.32 ?  929  HOH A O     1 
HETATM 3279 O  O     . HOH L 11 .   ? 8.915   -28.716 -19.017 1.00 43.74 ?  930  HOH A O     1 
HETATM 3280 O  O     . HOH L 11 .   ? -16.571 -18.905 -0.978  1.00 20.94 ?  931  HOH A O     1 
HETATM 3281 O  O     . HOH L 11 .   ? -9.539  -19.860 -0.362  1.00 41.36 ?  932  HOH A O     1 
HETATM 3282 O  O     . HOH L 11 .   ? -10.226 -12.906 -26.686 0.65 22.71 ?  933  HOH A O     1 
HETATM 3283 O  O     . HOH L 11 .   ? 7.732   12.115  -18.483 1.00 25.18 ?  934  HOH A O     1 
HETATM 3284 O  O     . HOH L 11 .   ? -24.212 10.430  -3.871  1.00 23.74 ?  935  HOH A O     1 
HETATM 3285 O  O     . HOH L 11 .   ? -20.430 -15.479 -5.444  1.00 33.64 ?  936  HOH A O     1 
HETATM 3286 O  O     . HOH L 11 .   ? 6.812   -1.100  -9.265  1.00 20.98 ?  937  HOH A O     1 
HETATM 3287 O  O     . HOH L 11 .   ? 15.118  -8.418  -12.709 1.00 34.36 ?  938  HOH A O     1 
HETATM 3288 O  O     . HOH L 11 .   ? -12.528 1.340   -10.126 1.00 17.93 ?  939  HOH A O     1 
HETATM 3289 O  O     . HOH L 11 .   ? -4.348  -24.602 -16.009 0.77 35.25 ?  940  HOH A O     1 
HETATM 3290 O  O     . HOH L 11 .   ? 1.578   24.032  5.704   1.00 46.20 ?  941  HOH A O     1 
HETATM 3291 O  O     B HOH L 11 .   ? 0.838   1.752   -8.577  0.21 8.84  ?  942  HOH A O     1 
HETATM 3292 O  O     . HOH L 11 .   ? -2.657  15.634  6.041   1.00 30.77 ?  943  HOH A O     1 
HETATM 3293 O  O     . HOH L 11 .   ? 5.644   -10.688 -7.338  1.00 17.60 ?  944  HOH A O     1 
HETATM 3294 O  O     . HOH L 11 .   ? 11.756  6.541   -1.244  1.00 14.57 ?  945  HOH A O     1 
HETATM 3295 O  O     . HOH L 11 .   ? -10.332 -6.136  -11.125 1.00 8.40  ?  946  HOH A O     1 
HETATM 3296 O  O     . HOH L 11 .   ? 9.929   19.205  -12.022 1.00 31.83 ?  947  HOH A O     1 
HETATM 3297 O  O     . HOH L 11 .   ? -20.963 12.858  2.159   1.00 29.89 ?  948  HOH A O     1 
HETATM 3298 O  O     . HOH L 11 .   ? 9.634   5.795   -2.889  1.00 11.56 ?  949  HOH A O     1 
HETATM 3299 O  O     . HOH L 11 .   ? 14.528  13.648  -24.454 1.00 34.39 ?  950  HOH A O     1 
HETATM 3300 O  O     . HOH L 11 .   ? -14.258 -12.194 -25.499 1.00 36.09 ?  951  HOH A O     1 
HETATM 3301 O  O     . HOH L 11 .   ? -10.566 21.935  -2.385  1.00 34.30 ?  952  HOH A O     1 
HETATM 3302 O  O     . HOH L 11 .   ? -10.815 3.921   -10.085 1.00 35.75 ?  953  HOH A O     1 
HETATM 3303 O  O     . HOH L 11 .   ? 3.628   -6.190  -8.663  1.00 10.08 ?  954  HOH A O     1 
HETATM 3304 O  O     . HOH L 11 .   ? 28.526  -4.324  -22.875 1.00 32.81 ?  955  HOH A O     1 
HETATM 3305 O  O     . HOH L 11 .   ? -14.643 -4.823  -18.043 1.00 23.88 ?  956  HOH A O     1 
HETATM 3306 O  O     . HOH L 11 .   ? 11.138  -14.327 -5.884  1.00 22.33 ?  957  HOH A O     1 
HETATM 3307 O  O     . HOH L 11 .   ? -12.288 -14.548 3.805   1.00 21.85 ?  958  HOH A O     1 
HETATM 3308 O  O     . HOH L 11 .   ? 20.988  8.210   -7.420  1.00 33.32 ?  959  HOH A O     1 
HETATM 3309 O  O     . HOH L 11 .   ? -24.401 -9.229  -11.019 1.00 34.38 ?  960  HOH A O     1 
HETATM 3310 O  O     A HOH L 11 .   ? -9.969  8.517   5.765   0.67 19.09 ?  961  HOH A O     1 
HETATM 3311 O  O     B HOH L 11 .   ? -10.391 7.322   7.308   0.33 18.59 ?  961  HOH A O     1 
HETATM 3312 O  O     . HOH L 11 .   ? -7.309  13.445  -15.659 1.00 30.84 ?  962  HOH A O     1 
HETATM 3313 O  O     . HOH L 11 .   ? -19.992 1.451   -11.131 1.00 36.29 ?  963  HOH A O     1 
HETATM 3314 O  O     . HOH L 11 .   ? 16.049  -10.682 -10.949 1.00 24.39 ?  964  HOH A O     1 
HETATM 3315 O  O     . HOH L 11 .   ? -17.964 -17.437 -17.840 1.00 40.16 ?  965  HOH A O     1 
HETATM 3316 O  O     . HOH L 11 .   ? -9.593  5.155   6.322   1.00 17.88 ?  966  HOH A O     1 
HETATM 3317 O  O     . HOH L 11 .   ? 3.257   -12.240 2.422   1.00 21.63 ?  967  HOH A O     1 
HETATM 3318 O  O     . HOH L 11 .   ? 17.737  0.305   -30.216 1.00 44.41 ?  968  HOH A O     1 
HETATM 3319 O  O     . HOH L 11 .   ? 24.892  4.294   -28.308 1.00 39.20 ?  969  HOH A O     1 
HETATM 3320 O  O     . HOH L 11 .   ? -25.011 -4.561  -16.125 1.00 26.76 ?  970  HOH A O     1 
HETATM 3321 O  O     A HOH L 11 .   ? -6.860  -5.047  3.171   0.67 18.09 ?  971  HOH A O     1 
HETATM 3322 O  O     B HOH L 11 .   ? -8.421  -4.377  3.481   0.33 17.69 ?  971  HOH A O     1 
HETATM 3323 O  O     . HOH L 11 .   ? -8.356  0.845   6.037   1.00 40.71 ?  972  HOH A O     1 
HETATM 3324 O  O     . HOH L 11 .   ? 2.456   -28.359 -18.567 0.87 38.79 ?  973  HOH A O     1 
HETATM 3325 O  O     . HOH L 11 .   ? 10.921  -25.402 -26.233 1.00 32.36 ?  974  HOH A O     1 
HETATM 3326 O  O     . HOH L 11 .   ? -14.266 11.003  8.309   1.00 34.16 ?  975  HOH A O     1 
HETATM 3327 O  O     . HOH L 11 .   ? 3.340   20.530  -0.651  1.00 20.01 ?  976  HOH A O     1 
HETATM 3328 O  O     . HOH L 11 .   ? 18.809  16.338  -10.776 1.00 33.16 ?  977  HOH A O     1 
HETATM 3329 O  O     . HOH L 11 .   ? -20.414 -6.549  -26.199 1.00 39.54 ?  978  HOH A O     1 
HETATM 3330 O  O     A HOH L 11 .   ? -11.549 11.895  -7.872  0.77 14.45 ?  979  HOH A O     1 
HETATM 3331 O  O     B HOH L 11 .   ? -13.534 10.553  -8.298  0.23 11.72 ?  979  HOH A O     1 
HETATM 3332 O  O     . HOH L 11 .   ? -5.664  -0.477  4.881   1.00 17.84 ?  980  HOH A O     1 
HETATM 3333 O  O     . HOH L 11 .   ? -16.478 3.527   -14.429 1.00 44.22 ?  981  HOH A O     1 
HETATM 3334 O  O     . HOH L 11 .   ? 28.507  6.722   -25.100 0.89 35.13 ?  982  HOH A O     1 
HETATM 3335 O  O     . HOH L 11 .   ? 8.273   1.190   -20.273 1.00 23.08 ?  983  HOH A O     1 
HETATM 3336 O  O     . HOH L 11 .   ? 7.804   5.167   -9.502  1.00 16.04 ?  984  HOH A O     1 
HETATM 3337 O  O     . HOH L 11 .   ? -19.802 -14.605 -22.271 1.00 46.04 ?  985  HOH A O     1 
HETATM 3338 O  O     . HOH L 11 .   ? 6.829   18.640  -18.887 1.00 27.08 ?  986  HOH A O     1 
HETATM 3339 O  O     . HOH L 11 .   ? -15.540 -4.967  -0.798  1.00 37.65 ?  987  HOH A O     1 
HETATM 3340 O  O     . HOH L 11 .   ? 6.448   -6.278  -6.165  1.00 16.83 ?  988  HOH A O     1 
HETATM 3341 O  O     . HOH L 11 .   ? -4.052  4.974   10.204  1.00 41.11 ?  989  HOH A O     1 
HETATM 3342 O  O     . HOH L 11 .   ? 23.945  -6.189  -25.027 0.91 40.09 ?  990  HOH A O     1 
HETATM 3343 O  O     . HOH L 11 .   ? -12.744 22.161  3.777   1.00 16.27 ?  991  HOH A O     1 
HETATM 3344 O  O     . HOH L 11 .   ? 11.050  3.254   -10.673 0.77 38.19 ?  992  HOH A O     1 
HETATM 3345 O  O     . HOH L 11 .   ? 15.827  -6.467  -10.950 1.00 48.40 ?  993  HOH A O     1 
HETATM 3346 O  O     . HOH L 11 .   ? 4.614   -9.187  -11.059 1.00 12.34 ?  994  HOH A O     1 
HETATM 3347 O  O     . HOH L 11 .   ? 5.832   -15.954 2.215   1.00 36.24 ?  995  HOH A O     1 
HETATM 3348 O  O     . HOH L 11 .   ? -7.287  -15.631 -28.427 1.00 48.80 ?  996  HOH A O     1 
HETATM 3349 O  O     . HOH L 11 .   ? -20.317 10.143  5.202   1.00 39.02 ?  997  HOH A O     1 
HETATM 3350 O  O     . HOH L 11 .   ? -11.888 -4.780  -23.925 0.64 28.39 ?  998  HOH A O     1 
HETATM 3351 O  O     . HOH L 11 .   ? 22.773  4.433   -31.919 0.83 40.30 ?  999  HOH A O     1 
HETATM 3352 O  O     . HOH L 11 .   ? 20.965  -20.036 -21.925 1.00 43.58 ?  1000 HOH A O     1 
HETATM 3353 O  O     . HOH L 11 .   ? -12.375 -20.660 -2.692  1.00 36.78 ?  1001 HOH A O     1 
HETATM 3354 O  O     . HOH L 11 .   ? -8.034  -7.998  3.280   1.00 36.87 ?  1002 HOH A O     1 
HETATM 3355 O  O     . HOH L 11 .   ? 13.311  -31.348 -17.934 1.00 40.56 ?  1003 HOH A O     1 
HETATM 3356 O  O     . HOH L 11 .   ? -19.234 -3.144  -3.827  1.00 23.39 ?  1004 HOH A O     1 
HETATM 3357 O  O     . HOH L 11 .   ? -8.381  -22.010 -8.712  1.00 20.25 ?  1005 HOH A O     1 
HETATM 3358 O  O     . HOH L 11 .   ? 11.530  -9.211  -14.582 1.00 43.08 ?  1006 HOH A O     1 
HETATM 3359 O  O     . HOH L 11 .   ? 17.385  -34.911 -13.733 1.00 41.52 ?  1007 HOH A O     1 
HETATM 3360 O  O     . HOH L 11 .   ? -1.314  -20.328 -19.934 1.00 42.36 ?  1008 HOH A O     1 
HETATM 3361 O  O     . HOH L 11 .   ? 18.279  -5.994  -22.901 0.73 23.72 ?  1009 HOH A O     1 
HETATM 3362 O  O     . HOH L 11 .   ? 10.655  -5.443  -2.550  1.00 48.38 ?  1010 HOH A O     1 
HETATM 3363 O  O     . HOH L 11 .   ? -23.257 -15.952 -20.325 1.00 42.02 ?  1011 HOH A O     1 
HETATM 3364 O  O     . HOH L 11 .   ? -13.466 7.569   -9.116  0.69 27.60 ?  1012 HOH A O     1 
HETATM 3365 O  O     . HOH L 11 .   ? 11.765  -4.732  -18.783 1.00 25.43 ?  1013 HOH A O     1 
HETATM 3366 O  O     . HOH L 11 .   ? 5.813   -22.397 -0.111  1.00 22.35 ?  1014 HOH A O     1 
HETATM 3367 O  O     . HOH L 11 .   ? -23.994 3.311   -1.671  1.00 36.37 ?  1015 HOH A O     1 
HETATM 3368 O  O     . HOH L 11 .   ? -0.232  12.255  -11.180 1.00 26.73 ?  1016 HOH A O     1 
HETATM 3369 O  O     . HOH L 11 .   ? 5.591   -5.401  -19.516 1.00 36.80 ?  1017 HOH A O     1 
HETATM 3370 O  O     . HOH L 11 .   ? 20.254  -12.531 -24.008 1.00 37.70 ?  1018 HOH A O     1 
HETATM 3371 O  O     . HOH L 11 .   ? 14.986  -9.899  -26.576 0.98 41.17 ?  1019 HOH A O     1 
HETATM 3372 O  O     . HOH L 11 .   ? -12.991 -10.542 -0.298  1.00 14.64 ?  1020 HOH A O     1 
HETATM 3373 O  O     . HOH L 11 .   ? 22.476  -16.277 -11.040 1.00 29.01 ?  1021 HOH A O     1 
HETATM 3374 O  O     . HOH L 11 .   ? -13.124 -7.112  -0.920  1.00 16.17 ?  1022 HOH A O     1 
HETATM 3375 O  O     . HOH L 11 .   ? 10.308  -5.584  -5.789  1.00 47.03 ?  1023 HOH A O     1 
HETATM 3376 O  O     . HOH L 11 .   ? 17.048  -21.330 -6.333  1.00 19.35 ?  1024 HOH A O     1 
HETATM 3377 O  O     A HOH L 11 .   ? -4.031  1.940   -5.441  0.59 16.74 ?  1025 HOH A O     1 
HETATM 3378 O  O     B HOH L 11 .   ? -2.781  3.347   -5.526  0.41 8.62  ?  1025 HOH A O     1 
HETATM 3379 O  O     . HOH L 11 .   ? 24.680  7.296   -13.108 1.00 27.23 ?  1026 HOH A O     1 
HETATM 3380 O  O     . HOH L 11 .   ? 2.598   -19.663 2.237   1.00 40.95 ?  1027 HOH A O     1 
HETATM 3381 O  O     . HOH L 11 .   ? 20.143  -31.802 -13.174 1.00 40.35 ?  1028 HOH A O     1 
HETATM 3382 O  O     . HOH L 11 .   ? 25.805  9.854   -12.782 1.00 38.42 ?  1029 HOH A O     1 
HETATM 3383 O  O     . HOH L 11 .   ? 6.116   -23.968 2.123   1.00 35.89 ?  1030 HOH A O     1 
HETATM 3384 O  O     . HOH L 11 .   ? 5.844   16.375  -17.251 1.00 19.81 ?  1031 HOH A O     1 
HETATM 3385 O  O     . HOH L 11 .   ? 20.531  0.270   -11.725 1.00 39.07 ?  1032 HOH A O     1 
HETATM 3386 O  O     . HOH L 11 .   ? 17.880  19.701  10.203  1.00 29.28 ?  1033 HOH A O     1 
HETATM 3387 O  O     . HOH L 11 .   ? -0.433  -19.500 -22.858 1.00 42.84 ?  1034 HOH A O     1 
HETATM 3388 O  O     . HOH L 11 .   ? -23.154 1.091   -4.484  1.00 34.93 ?  1035 HOH A O     1 
HETATM 3389 O  O     . HOH L 11 .   ? -16.398 -20.326 -21.060 1.00 46.16 ?  1036 HOH A O     1 
HETATM 3390 O  O     . HOH L 11 .   ? -9.746  -17.972 -26.066 0.80 36.24 ?  1037 HOH A O     1 
HETATM 3391 O  O     . HOH L 11 .   ? 10.691  0.673   -14.248 1.00 39.97 ?  1038 HOH A O     1 
HETATM 3392 O  O     . HOH L 11 .   ? 22.011  -7.859  -11.497 0.86 33.63 ?  1039 HOH A O     1 
HETATM 3393 O  O     . HOH L 11 .   ? 12.532  17.881  8.778   1.00 32.39 ?  1040 HOH A O     1 
HETATM 3394 O  O     . HOH L 11 .   ? -16.925 -20.483 -14.056 1.00 42.71 ?  1041 HOH A O     1 
HETATM 3395 O  O     . HOH L 11 .   ? -13.125 4.774   -11.325 1.00 48.32 ?  1042 HOH A O     1 
HETATM 3396 O  O     . HOH L 11 .   ? -5.812  -7.518  3.438   1.00 42.54 ?  1043 HOH A O     1 
HETATM 3397 O  O     . HOH L 11 .   ? -15.295 -0.667  -17.723 1.00 34.25 ?  1044 HOH A O     1 
HETATM 3398 O  O     . HOH L 11 .   ? 10.236  18.413  7.425   1.00 32.17 ?  1045 HOH A O     1 
HETATM 3399 O  O     . HOH L 11 .   ? -6.560  -21.400 -3.313  1.00 39.69 ?  1046 HOH A O     1 
HETATM 3400 O  O     A HOH L 11 .   ? 4.741   -8.291  -15.893 0.71 20.41 ?  1047 HOH A O     1 
HETATM 3401 O  O     B HOH L 11 .   ? 5.667   -8.488  -13.947 0.29 11.66 ?  1047 HOH A O     1 
HETATM 3402 O  O     A HOH L 11 .   ? -10.075 -23.051 -12.839 0.48 24.32 ?  1048 HOH A O     1 
HETATM 3403 O  O     B HOH L 11 .   ? -8.609  -23.158 -11.362 0.52 19.24 ?  1048 HOH A O     1 
HETATM 3404 O  O     . HOH L 11 .   ? -5.536  -21.609 -5.979  1.00 18.99 ?  1049 HOH A O     1 
HETATM 3405 O  O     . HOH L 11 .   ? 8.247   -10.260 -10.158 1.00 39.41 ?  1050 HOH A O     1 
HETATM 3406 O  O     . HOH L 11 .   ? -0.332  -26.997 -17.401 1.00 43.70 ?  1051 HOH A O     1 
HETATM 3407 O  O     . HOH L 11 .   ? -11.522 11.578  -13.147 1.00 42.17 ?  1052 HOH A O     1 
HETATM 3408 O  O     . HOH L 11 .   ? 9.005   -1.014  -26.022 1.00 39.89 ?  1053 HOH A O     1 
HETATM 3409 O  O     . HOH L 11 .   ? 11.554  -14.005 -2.886  1.00 42.79 ?  1054 HOH A O     1 
HETATM 3410 O  O     . HOH L 11 .   ? -3.582  -0.730  6.709   1.00 38.41 ?  1055 HOH A O     1 
HETATM 3411 O  O     A HOH L 11 .   ? -7.489  -23.591 -17.486 0.63 25.37 ?  1056 HOH A O     1 
HETATM 3412 O  O     B HOH L 11 .   ? -6.146  -23.769 -18.221 0.37 21.82 ?  1056 HOH A O     1 
HETATM 3413 O  O     . HOH L 11 .   ? 14.365  -10.040 -6.712  1.00 38.03 ?  1057 HOH A O     1 
HETATM 3414 O  O     . HOH L 11 .   ? 2.912   -22.414 -2.568  1.00 23.70 ?  1058 HOH A O     1 
HETATM 3415 O  O     . HOH L 11 .   ? 7.014   -6.043  -16.744 1.00 38.09 ?  1059 HOH A O     1 
HETATM 3416 O  O     . HOH L 11 .   ? 11.244  -11.541 0.433   1.00 45.30 ?  1060 HOH A O     1 
HETATM 3417 O  O     . HOH L 11 .   ? 11.592  -2.283  -3.013  1.00 31.20 ?  1061 HOH A O     1 
HETATM 3418 O  O     . HOH L 11 .   ? -3.641  -15.943 -24.164 1.00 37.70 ?  1062 HOH A O     1 
HETATM 3419 O  O     . HOH L 11 .   ? 8.076   -8.898  -4.431  1.00 33.32 ?  1063 HOH A O     1 
HETATM 3420 O  O     . HOH L 11 .   ? 10.089  0.783   -17.965 1.00 42.10 ?  1064 HOH A O     1 
HETATM 3421 O  O     . HOH L 11 .   ? 3.206   -16.983 3.022   1.00 39.66 ?  1065 HOH A O     1 
HETATM 3422 O  O     . HOH L 11 .   ? -16.625 14.834  -11.065 1.00 47.32 ?  1066 HOH A O     1 
HETATM 3423 O  O     . HOH L 11 .   ? -15.158 -18.809 -23.538 1.00 39.99 ?  1067 HOH A O     1 
HETATM 3424 O  O     . HOH L 11 .   ? 19.018  -17.199 -3.190  1.00 43.97 ?  1068 HOH A O     1 
HETATM 3425 O  O     . HOH L 11 .   ? -23.168 11.770  2.452   0.84 42.02 ?  1069 HOH A O     1 
HETATM 3426 O  O     . HOH L 11 .   ? 13.718  15.241  -26.258 0.79 34.30 ?  1070 HOH A O     1 
HETATM 3427 O  O     . HOH L 11 .   ? -5.056  -11.563 6.552   1.00 44.67 ?  1071 HOH A O     1 
HETATM 3428 O  O     . HOH L 11 .   ? -6.851  -25.388 -11.385 0.81 38.76 ?  1072 HOH A O     1 
HETATM 3429 O  O     . HOH L 11 .   ? 19.814  -21.380 -7.255  1.00 45.72 ?  1073 HOH A O     1 
HETATM 3430 O  O     . HOH L 11 .   ? 5.331   14.505  -18.817 1.00 49.46 ?  1074 HOH A O     1 
HETATM 3431 O  O     . HOH L 11 .   ? 9.006   16.204  7.661   1.00 39.13 ?  1075 HOH A O     1 
HETATM 3432 O  O     B HOH L 11 .   ? 4.262   -0.890  -18.671 0.85 27.34 ?  1076 HOH A O     1 
HETATM 3433 O  O     . HOH L 11 .   ? 23.367  2.494   -29.510 1.00 39.61 ?  1077 HOH A O     1 
HETATM 3434 O  O     . HOH L 11 .   ? -15.003 5.871   8.225   0.95 38.28 ?  1078 HOH A O     1 
HETATM 3435 O  O     . HOH L 11 .   ? 2.328   -11.754 5.027   1.00 38.10 ?  1079 HOH A O     1 
HETATM 3436 O  O     . HOH L 11 .   ? 5.722   -8.112  -8.593  1.00 29.79 ?  1080 HOH A O     1 
HETATM 3437 O  O     . HOH L 11 .   ? 20.011  -19.672 -3.822  1.00 46.37 ?  1081 HOH A O     1 
HETATM 3438 O  O     . HOH L 11 .   ? 3.172   -7.016  6.782   1.00 43.14 ?  1082 HOH A O     1 
HETATM 3439 O  O     . HOH L 11 .   ? 10.559  5.464   -8.487  1.00 21.97 ?  1083 HOH A O     1 
HETATM 3440 O  O     A HOH L 11 .   ? 9.841   -8.013  -16.043 0.61 20.14 ?  1084 HOH A O     1 
HETATM 3441 O  O     B HOH L 11 .   ? 10.749  -5.965  -16.445 0.39 19.68 ?  1084 HOH A O     1 
HETATM 3442 O  O     . HOH L 11 .   ? 18.234  -7.073  -10.164 0.62 25.89 ?  1085 HOH A O     1 
HETATM 3443 O  O     . HOH L 11 .   ? -14.965 -3.975  -20.420 1.00 40.65 ?  1086 HOH A O     1 
HETATM 3444 O  O     . HOH L 11 .   ? 22.363  -31.029 -12.008 1.00 45.28 ?  1087 HOH A O     1 
HETATM 3445 O  O     . HOH L 11 .   ? 15.405  -30.269 -1.595  0.49 22.19 ?  1088 HOH A O     1 
HETATM 3446 O  O     . HOH L 11 .   ? -19.377 6.344   7.175   1.00 39.02 ?  1089 HOH A O     1 
HETATM 3447 O  O     . HOH L 11 .   ? -3.743  -19.392 2.244   1.00 43.43 ?  1090 HOH A O     1 
HETATM 3448 O  O     . HOH L 11 .   ? 8.030   -11.823 4.312   1.00 40.03 ?  1091 HOH A O     1 
HETATM 3449 O  O     . HOH L 11 .   ? 18.067  -24.083 -3.923  0.81 35.79 ?  1092 HOH A O     1 
HETATM 3450 O  O     . HOH L 11 .   ? 19.865  -7.739  -23.291 1.00 38.39 ?  1093 HOH A O     1 
HETATM 3451 O  O     . HOH L 11 .   ? -22.124 -0.547  -0.835  1.00 40.23 ?  1094 HOH A O     1 
HETATM 3452 O  O     . HOH L 11 .   ? -10.206 -3.832  2.144   1.00 30.05 ?  1095 HOH A O     1 
HETATM 3453 O  O     . HOH L 11 .   ? 11.222  -0.440  -27.257 1.00 40.84 ?  1096 HOH A O     1 
HETATM 3454 O  O     . HOH L 11 .   ? -11.206 -7.703  3.180   1.00 40.85 ?  1097 HOH A O     1 
HETATM 3455 O  O     A HOH L 11 .   ? -16.012 -1.655  -20.285 0.36 19.76 ?  1098 HOH A O     1 
HETATM 3456 O  O     B HOH L 11 .   ? -17.457 -2.713  -21.426 0.64 31.93 ?  1098 HOH A O     1 
HETATM 3457 O  O     . HOH L 11 .   ? 22.668  -3.048  -13.423 1.00 44.29 ?  1099 HOH A O     1 
HETATM 3458 O  O     A HOH L 11 .   ? -12.759 -19.688 0.029   0.38 12.80 ?  1100 HOH A O     1 
HETATM 3459 O  O     B HOH L 11 .   ? -11.803 -18.969 1.232   0.62 23.17 ?  1100 HOH A O     1 
HETATM 3460 O  O     . HOH L 11 .   ? 15.297  -29.165 -23.116 0.77 37.49 ?  1101 HOH A O     1 
HETATM 3461 O  O     . HOH L 11 .   ? -8.109  -17.094 2.624   1.00 40.24 ?  1102 HOH A O     1 
HETATM 3462 O  O     . HOH L 11 .   ? 18.490  -10.484 -23.682 1.00 41.48 ?  1103 HOH A O     1 
HETATM 3463 O  O     . HOH L 11 .   ? -2.839  -4.540  4.460   1.00 28.58 ?  1104 HOH A O     1 
HETATM 3464 O  O     . HOH L 11 .   ? -17.106 2.939   5.229   1.00 30.71 ?  1105 HOH A O     1 
HETATM 3465 O  O     A HOH L 11 .   ? 17.718  -9.497  -9.470  0.70 28.15 ?  1106 HOH A O     1 
HETATM 3466 O  O     . HOH L 11 .   ? 4.100   14.475  7.757   1.00 39.96 ?  1107 HOH A O     1 
HETATM 3467 O  O     . HOH L 11 .   ? 20.529  -24.228 -6.872  1.00 39.27 ?  1108 HOH A O     1 
HETATM 3468 O  O     . HOH L 11 .   ? 7.997   -1.443  -21.272 0.67 30.25 ?  1109 HOH A O     1 
HETATM 3469 O  O     . HOH L 11 .   ? -4.760  -21.860 -1.477  1.00 52.13 ?  1110 HOH A O     1 
HETATM 3470 O  O     . HOH L 11 .   ? 13.328  -12.695 1.241   1.00 44.95 ?  1111 HOH A O     1 
HETATM 3471 O  O     . HOH L 11 .   ? -18.896 0.338   2.243   1.00 34.06 ?  1112 HOH A O     1 
HETATM 3472 O  O     . HOH L 11 .   ? -0.147  -24.959 -3.680  1.00 38.98 ?  1113 HOH A O     1 
HETATM 3473 O  O     A HOH L 11 .   ? 18.114  18.212  -13.229 0.52 23.64 ?  1114 HOH A O     1 
HETATM 3474 O  O     B HOH L 11 .   ? 16.732  16.995  -12.752 0.48 18.20 ?  1114 HOH A O     1 
HETATM 3475 O  O     . HOH L 11 .   ? -0.650  16.569  7.620   1.00 40.97 ?  1115 HOH A O     1 
HETATM 3476 O  O     . HOH L 11 .   ? 10.160  -36.454 -6.065  0.88 40.87 ?  1116 HOH A O     1 
HETATM 3477 O  O     . HOH L 11 .   ? -3.860  -24.977 -3.531  1.00 46.65 ?  1117 HOH A O     1 
HETATM 3478 O  O     . HOH L 11 .   ? -12.472 -5.464  1.516   1.00 39.93 ?  1118 HOH A O     1 
HETATM 3479 O  O     . HOH L 11 .   ? 1.945   16.086  8.460   1.00 49.22 ?  1119 HOH A O     1 
HETATM 3480 O  O     . HOH M 11 .   ? 3.202   -15.813 -37.214 1.00 38.74 ?  101  HOH T O     1 
HETATM 3481 O  O     . HOH M 11 .   ? -12.992 -0.009  -20.713 0.72 29.45 ?  102  HOH T O     1 
HETATM 3482 O  O     . HOH M 11 .   ? -0.760  -7.128  -23.865 1.00 29.81 ?  103  HOH T O     1 
HETATM 3483 O  O     . HOH M 11 .   ? 2.661   -13.698 -32.680 1.00 28.46 ?  104  HOH T O     1 
HETATM 3484 O  O     . HOH M 11 .   ? 1.428   -13.189 -35.115 1.00 36.93 ?  105  HOH T O     1 
HETATM 3485 O  O     . HOH M 11 .   ? -7.394  -5.232  -24.201 0.68 25.93 ?  106  HOH T O     1 
HETATM 3486 O  O     . HOH M 11 .   ? 4.713   -15.582 -32.331 1.00 34.26 ?  107  HOH T O     1 
HETATM 3487 O  O     . HOH M 11 .   ? -3.230  -19.821 -34.215 1.00 42.34 ?  108  HOH T O     1 
HETATM 3488 O  O     . HOH M 11 .   ? 1.189   -1.344  -21.644 1.00 43.31 ?  109  HOH T O     1 
HETATM 3489 O  O     . HOH M 11 .   ? 4.764   -18.570 -32.721 1.00 24.42 ?  110  HOH T O     1 
HETATM 3490 O  O     . HOH M 11 .   ? -5.251  -9.389  -29.930 1.00 41.44 ?  111  HOH T O     1 
HETATM 3491 O  O     . HOH M 11 .   ? -12.947 6.546   -16.058 1.00 45.19 ?  112  HOH T O     1 
HETATM 3492 O  O     . HOH M 11 .   ? -0.529  -12.859 -19.201 1.00 14.75 ?  113  HOH T O     1 
HETATM 3493 O  O     . HOH M 11 .   ? -2.928  12.896  -11.378 1.00 20.38 ?  114  HOH T O     1 
HETATM 3494 O  O     . HOH M 11 .   ? -12.435 -4.269  -20.661 1.00 32.68 ?  115  HOH T O     1 
HETATM 3495 O  O     . HOH M 11 .   ? -7.399  11.086  -18.346 1.00 34.78 ?  116  HOH T O     1 
HETATM 3496 O  O     . HOH M 11 .   ? -5.992  8.748   -20.831 1.00 27.91 ?  117  HOH T O     1 
HETATM 3497 O  O     . HOH M 11 .   ? -7.346  -0.091  -22.813 1.00 24.64 ?  118  HOH T O     1 
HETATM 3498 O  O     . HOH M 11 .   ? -9.448  -4.019  -23.491 1.00 42.98 ?  119  HOH T O     1 
HETATM 3499 O  O     . HOH M 11 .   ? -2.710  5.292   -14.626 1.00 16.15 ?  120  HOH T O     1 
HETATM 3500 O  O     . HOH M 11 .   ? -4.439  7.322   -22.907 1.00 31.53 ?  121  HOH T O     1 
HETATM 3501 O  O     . HOH M 11 .   ? -10.029 -9.569  -19.176 1.00 11.70 ?  122  HOH T O     1 
HETATM 3502 O  O     . HOH M 11 .   ? -10.183 11.835  -15.203 1.00 50.38 ?  123  HOH T O     1 
HETATM 3503 O  O     . HOH M 11 .   ? 0.505   -15.468 -23.720 1.00 12.39 ?  124  HOH T O     1 
HETATM 3504 O  O     . HOH M 11 .   ? -1.298  -9.189  -27.940 1.00 34.04 ?  125  HOH T O     1 
HETATM 3505 O  O     . HOH M 11 .   ? -3.266  0.114   -23.143 1.00 34.78 ?  126  HOH T O     1 
HETATM 3506 O  O     . HOH M 11 .   ? 3.586   -11.357 -31.696 1.00 27.37 ?  127  HOH T O     1 
HETATM 3507 O  O     . HOH M 11 .   ? 1.858   -4.452  -20.699 1.00 35.66 ?  128  HOH T O     1 
HETATM 3508 O  O     . HOH M 11 .   ? -1.342  -16.752 -25.455 1.00 30.11 ?  129  HOH T O     1 
HETATM 3509 O  O     . HOH M 11 .   ? -7.463  -15.717 -33.414 1.00 35.27 ?  130  HOH T O     1 
HETATM 3510 O  O     . HOH M 11 .   ? 3.745   -16.979 -34.757 1.00 41.61 ?  131  HOH T O     1 
HETATM 3511 O  O     . HOH M 11 .   ? -4.551  3.688   -23.320 1.00 40.08 ?  132  HOH T O     1 
HETATM 3512 O  O     . HOH M 11 .   ? -4.197  -18.006 -30.728 1.00 31.28 ?  133  HOH T O     1 
HETATM 3513 O  O     . HOH M 11 .   ? -0.688  0.851   -22.930 1.00 39.70 ?  134  HOH T O     1 
HETATM 3514 O  O     . HOH M 11 .   ? 6.082   -23.088 -32.828 1.00 41.70 ?  135  HOH T O     1 
HETATM 3515 O  O     . HOH M 11 .   ? -4.636  -7.146  -26.916 1.00 40.77 ?  136  HOH T O     1 
HETATM 3516 O  O     . HOH M 11 .   ? 3.334   12.036  -18.052 0.83 37.49 ?  137  HOH T O     1 
HETATM 3517 O  O     . HOH M 11 .   ? 3.635   -3.592  -19.077 1.00 36.80 ?  138  HOH T O     1 
HETATM 3518 O  O     A HOH M 11 .   ? -5.937  -11.369 -22.794 0.62 20.48 ?  139  HOH T O     1 
HETATM 3519 O  O     B HOH M 11 .   ? -5.715  -9.727  -24.016 0.38 14.17 ?  139  HOH T O     1 
HETATM 3520 O  O     . HOH M 11 .   ? -5.348  -4.318  -23.392 1.00 26.46 ?  140  HOH T O     1 
HETATM 3521 O  O     . HOH M 11 .   ? -5.870  -17.933 -32.471 1.00 44.26 ?  141  HOH T O     1 
HETATM 3522 O  O     . HOH M 11 .   ? -5.471  -13.434 -36.999 1.00 33.20 ?  142  HOH T O     1 
HETATM 3523 O  O     . HOH M 11 .   ? -3.476  -7.029  -24.593 1.00 36.71 ?  143  HOH T O     1 
HETATM 3524 O  O     . HOH M 11 .   ? -5.186  -1.492  -23.915 1.00 42.64 ?  144  HOH T O     1 
HETATM 3525 O  O     . HOH M 11 .   ? 0.519   -7.913  -26.619 0.76 36.37 ?  145  HOH T O     1 
HETATM 3526 O  O     A HOH N 11 .   ? 3.590   0.597   -15.698 0.79 27.54 ?  101  HOH P O     1 
HETATM 3527 O  O     . HOH N 11 .   ? 8.080   2.654   -23.020 1.00 22.53 ?  102  HOH P O     1 
HETATM 3528 O  O     A HOH N 11 .   ? 2.764   0.711   -20.748 0.58 21.39 ?  103  HOH P O     1 
HETATM 3529 O  O     B HOH N 11 .   ? 3.669   1.810   -22.105 0.42 22.22 ?  103  HOH P O     1 
HETATM 3530 O  O     . HOH N 11 .   ? 5.248   4.373   -24.438 1.00 31.91 ?  104  HOH P O     1 
HETATM 3531 O  O     . HOH N 11 .   ? 3.612   2.229   -8.875  1.00 10.93 ?  105  HOH P O     1 
HETATM 3532 O  O     . HOH N 11 .   ? 0.511   3.429   -23.044 1.00 23.13 ?  106  HOH P O     1 
HETATM 3533 O  O     . HOH N 11 .   ? 4.787   11.781  -21.456 1.00 18.53 ?  107  HOH P O     1 
HETATM 3534 O  O     . HOH N 11 .   ? 2.971   3.944   -22.975 1.00 30.94 ?  108  HOH P O     1 
HETATM 3535 O  O     . HOH N 11 .   ? -1.276  4.820   -25.137 1.00 42.00 ?  109  HOH P O     1 
HETATM 3536 O  O     . HOH N 11 .   ? 5.407   5.417   -29.156 1.00 44.89 ?  110  HOH P O     1 
HETATM 3537 O  O     A HOH N 11 .   ? 9.202   2.808   -16.015 0.62 19.97 ?  111  HOH P O     1 
HETATM 3538 O  O     B HOH N 11 .   ? 8.284   2.229   -17.526 0.38 15.45 ?  111  HOH P O     1 
HETATM 3539 O  O     . HOH N 11 .   ? 2.331   9.669   -16.199 1.00 32.47 ?  112  HOH P O     1 
HETATM 3540 O  O     . HOH N 11 .   ? -1.954  2.325   -7.653  1.00 32.79 ?  113  HOH P O     1 
HETATM 3541 O  O     . HOH N 11 .   ? 9.664   4.161   -12.923 1.00 22.32 ?  114  HOH P O     1 
HETATM 3542 O  O     . HOH N 11 .   ? 7.430   11.376  -21.076 1.00 21.21 ?  115  HOH P O     1 
HETATM 3543 O  O     . HOH O 11 .   ? -0.657  -27.524 -24.653 1.00 42.70 ?  101  HOH D O     1 
HETATM 3544 O  O     . HOH O 11 .   ? 6.277   -27.119 -20.396 1.00 37.80 ?  102  HOH D O     1 
HETATM 3545 O  O     . HOH O 11 .   ? -4.568  -20.746 -31.436 0.66 25.97 ?  103  HOH D O     1 
HETATM 3546 O  O     . HOH O 11 .   ? 2.625   -26.558 -20.762 1.00 29.85 ?  104  HOH D O     1 
HETATM 3547 O  O     . HOH O 11 .   ? 4.114   -25.484 -29.981 1.00 32.13 ?  105  HOH D O     1 
HETATM 3548 O  O     . HOH O 11 .   ? 2.388   -26.721 -27.629 1.00 26.62 ?  106  HOH D O     1 
HETATM 3549 O  O     . HOH O 11 .   ? 7.062   -14.682 -31.247 1.00 42.99 ?  107  HOH D O     1 
HETATM 3550 O  O     . HOH O 11 .   ? 5.258   -25.349 -26.548 1.00 39.75 ?  108  HOH D O     1 
HETATM 3551 O  O     . HOH O 11 .   ? -1.601  -19.499 -25.175 1.00 34.86 ?  109  HOH D O     1 
HETATM 3552 O  O     . HOH O 11 .   ? 11.104  -19.522 -29.464 1.00 42.97 ?  110  HOH D O     1 
HETATM 3553 O  O     . HOH O 11 .   ? -4.416  -21.384 -28.731 1.00 29.52 ?  111  HOH D O     1 
HETATM 3554 O  O     B HOH O 11 .   ? -3.140  -22.574 -20.740 0.62 28.69 ?  112  HOH D O     1 
HETATM 3555 O  O     . HOH O 11 .   ? 13.108  -21.524 -27.282 1.00 33.30 ?  113  HOH D O     1 
HETATM 3556 O  O     . HOH O 11 .   ? 6.002   -23.002 -29.991 1.00 29.49 ?  114  HOH D O     1 
HETATM 3557 O  O     . HOH O 11 .   ? 2.167   -19.167 -23.313 1.00 23.22 ?  115  HOH D O     1 
HETATM 3558 O  O     B HOH O 11 .   ? 0.317   -25.778 -19.865 0.62 31.18 ?  116  HOH D O     1 
HETATM 3559 O  O     . HOH O 11 .   ? 8.216   -18.648 -31.429 0.84 34.63 ?  117  HOH D O     1 
HETATM 3560 O  O     . HOH O 11 .   ? 9.525   -23.021 -27.104 1.00 38.83 ?  118  HOH D O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . MET A 10  ? 0.3997 0.2723 0.4188 -0.0057 -0.0289 -0.0406 138 MET A N     
2    C CA    . MET A 10  ? 0.3410 0.2305 0.3575 -0.0019 -0.0264 -0.0405 138 MET A CA    
3    C C     . MET A 10  ? 0.3233 0.2210 0.3392 -0.0052 -0.0299 -0.0465 138 MET A C     
4    O O     . MET A 10  ? 0.3377 0.2323 0.3461 -0.0031 -0.0317 -0.0532 138 MET A O     
5    C CB    . MET A 10  ? 0.3523 0.2412 0.3608 0.0078  -0.0237 -0.0429 138 MET A CB    
6    C CG    . MET A 10  ? 0.3509 0.2554 0.3553 0.0116  -0.0214 -0.0434 138 MET A CG    
7    S SD    . MET A 10  ? 0.3564 0.2743 0.3631 0.0119  -0.0174 -0.0345 138 MET A SD    
8    C CE    . MET A 10  ? 0.3333 0.2432 0.3404 0.0161  -0.0155 -0.0286 138 MET A CE    
9    N N     A PRO A 11  ? 0.2822 0.1939 0.3046 -0.0097 -0.0294 -0.0421 139 PRO A N     
10   N N     B PRO A 11  ? 0.2826 0.1943 0.3049 -0.0097 -0.0294 -0.0422 139 PRO A N     
11   C CA    A PRO A 11  ? 0.2881 0.2090 0.3106 -0.0121 -0.0332 -0.0466 139 PRO A CA    
12   C CA    B PRO A 11  ? 0.2866 0.2072 0.3090 -0.0121 -0.0333 -0.0468 139 PRO A CA    
13   C C     A PRO A 11  ? 0.2664 0.1931 0.2787 -0.0051 -0.0321 -0.0508 139 PRO A C     
14   C C     B PRO A 11  ? 0.2668 0.1935 0.2792 -0.0052 -0.0321 -0.0508 139 PRO A C     
15   O O     A PRO A 11  ? 0.2634 0.1919 0.2712 0.0007  -0.0278 -0.0486 139 PRO A O     
16   O O     B PRO A 11  ? 0.2621 0.1908 0.2701 0.0005  -0.0277 -0.0484 139 PRO A O     
17   C CB    A PRO A 11  ? 0.2837 0.2194 0.3163 -0.0163 -0.0313 -0.0394 139 PRO A CB    
18   C CB    B PRO A 11  ? 0.2821 0.2172 0.3149 -0.0167 -0.0317 -0.0397 139 PRO A CB    
19   C CG    A PRO A 11  ? 0.2718 0.2028 0.3104 -0.0189 -0.0278 -0.0319 139 PRO A CG    
20   C CG    B PRO A 11  ? 0.2469 0.1835 0.2794 -0.0133 -0.0255 -0.0325 139 PRO A CG    
21   C CD    A PRO A 11  ? 0.2860 0.2049 0.3161 -0.0127 -0.0256 -0.0327 139 PRO A CD    
22   C CD    B PRO A 11  ? 0.2837 0.2043 0.3127 -0.0116 -0.0251 -0.0329 139 PRO A CD    
23   N N     . ALA A 12  ? 0.2505 0.1810 0.2595 -0.0062 -0.0366 -0.0564 140 ALA A N     
24   C CA    . ALA A 12  ? 0.2315 0.1663 0.2298 -0.0002 -0.0356 -0.0599 140 ALA A CA    
25   C C     . ALA A 12  ? 0.2176 0.1660 0.2166 0.0018  -0.0330 -0.0551 140 ALA A C     
26   O O     . ALA A 12  ? 0.2577 0.2090 0.2490 0.0068  -0.0307 -0.0556 140 ALA A O     
27   C CB    . ALA A 12  ? 0.2858 0.2206 0.2776 -0.0017 -0.0397 -0.0650 140 ALA A CB    
28   N N     . TYR A 13  ? 0.1806 0.1373 0.1888 -0.0018 -0.0330 -0.0500 141 TYR A N     
29   C CA    . TYR A 13  ? 0.1683 0.1359 0.1768 0.0008  -0.0306 -0.0457 141 TYR A CA    
30   C C     . TYR A 13  ? 0.1748 0.1430 0.1859 0.0023  -0.0252 -0.0399 141 TYR A C     
31   O O     . TYR A 13  ? 0.1758 0.1417 0.1934 -0.0006 -0.0238 -0.0367 141 TYR A O     
32   C CB    . TYR A 13  ? 0.1659 0.1440 0.1826 -0.0025 -0.0339 -0.0441 141 TYR A CB    
33   C CG    . TYR A 13  ? 0.1526 0.1335 0.1663 -0.0036 -0.0402 -0.0490 141 TYR A CG    
34   C CD1   . TYR A 13  ? 0.1867 0.1627 0.2028 -0.0089 -0.0459 -0.0537 141 TYR A CD1   
35   C CD2   . TYR A 13  ? 0.1817 0.1695 0.1899 0.0002  -0.0413 -0.0486 141 TYR A CD2   
36   C CE1   . TYR A 13  ? 0.2112 0.1902 0.2234 -0.0102 -0.0527 -0.0586 141 TYR A CE1   
37   C CE2   . TYR A 13  ? 0.1925 0.1836 0.1970 -0.0006 -0.0477 -0.0523 141 TYR A CE2   
38   C CZ    . TYR A 13  ? 0.2047 0.1919 0.2108 -0.0058 -0.0535 -0.0576 141 TYR A CZ    
39   O OH    . TYR A 13  ? 0.2640 0.2548 0.2649 -0.0065 -0.0607 -0.0617 141 TYR A OH    
40   N N     . ALA A 14  ? 0.1557 0.1269 0.1613 0.0065  -0.0226 -0.0380 142 ALA A N     
41   C CA    . ALA A 14  ? 0.1533 0.1242 0.1589 0.0082  -0.0185 -0.0334 142 ALA A CA    
42   C C     . ALA A 14  ? 0.1783 0.1556 0.1909 0.0067  -0.0166 -0.0291 142 ALA A C     
43   O O     . ALA A 14  ? 0.1770 0.1531 0.1901 0.0070  -0.0132 -0.0253 142 ALA A O     
44   C CB    . ALA A 14  ? 0.1634 0.1354 0.1617 0.0120  -0.0173 -0.0329 142 ALA A CB    
45   N N     . CYS A 15  ? 0.1491 0.1342 0.1668 0.0057  -0.0185 -0.0294 143 CYS A N     
46   C CA    . CYS A 15  ? 0.1454 0.1392 0.1710 0.0051  -0.0159 -0.0250 143 CYS A CA    
47   C C     . CYS A 15  ? 0.1674 0.1620 0.2028 -0.0006 -0.0155 -0.0223 143 CYS A C     
48   O O     . CYS A 15  ? 0.1868 0.1903 0.2300 -0.0015 -0.0122 -0.0175 143 CYS A O     
49   C CB    . CYS A 15  ? 0.1603 0.1641 0.1901 0.0067  -0.0183 -0.0254 143 CYS A CB    
50   S SG    . CYS A 15  ? 0.1708 0.1764 0.2046 0.0021  -0.0258 -0.0299 143 CYS A SG    
51   N N     . GLN A 16  ? 0.1516 0.1369 0.1868 -0.0043 -0.0184 -0.0250 144 GLN A N     
52   C CA    . GLN A 16  ? 0.1535 0.1363 0.1976 -0.0106 -0.0186 -0.0222 144 GLN A CA    
53   C C     . GLN A 16  ? 0.1805 0.1542 0.2212 -0.0100 -0.0148 -0.0183 144 GLN A C     
54   O O     . GLN A 16  ? 0.2052 0.1740 0.2522 -0.0152 -0.0148 -0.0151 144 GLN A O     
55   C CB    . GLN A 16  ? 0.1680 0.1434 0.2135 -0.0153 -0.0251 -0.0280 144 GLN A CB    
56   C CG    . GLN A 16  ? 0.1785 0.1636 0.2287 -0.0173 -0.0303 -0.0311 144 GLN A CG    
57   C CD    . GLN A 16  ? 0.2253 0.2012 0.2735 -0.0215 -0.0374 -0.0381 144 GLN A CD    
58   O OE1   . GLN A 16  ? 0.2196 0.1848 0.2561 -0.0178 -0.0385 -0.0437 144 GLN A OE1   
59   N NE2   . GLN A 16  ? 0.2639 0.2442 0.3233 -0.0292 -0.0424 -0.0379 144 GLN A NE2   
60   N N     . ARG A 17  ? 0.2028 0.1740 0.2339 -0.0041 -0.0120 -0.0181 145 ARG A N     
61   C CA    . ARG A 17  ? 0.2169 0.1801 0.2443 -0.0030 -0.0094 -0.0143 145 ARG A CA    
62   C C     . ARG A 17  ? 0.1850 0.1527 0.2051 0.0020  -0.0056 -0.0115 145 ARG A C     
63   O O     . ARG A 17  ? 0.2013 0.1729 0.2165 0.0055  -0.0061 -0.0147 145 ARG A O     
64   C CB    . ARG A 17  ? 0.2376 0.1888 0.2598 -0.0012 -0.0121 -0.0187 145 ARG A CB    
65   C CG    . ARG A 17  ? 0.2449 0.1980 0.2595 0.0038  -0.0130 -0.0233 145 ARG A CG    
66   C CD    . ARG A 17  ? 0.2888 0.2344 0.3003 0.0051  -0.0159 -0.0294 145 ARG A CD    
67   N NE    . ARG A 17  ? 0.2799 0.2297 0.2848 0.0095  -0.0156 -0.0318 145 ARG A NE    
68   C CZ    . ARG A 17  ? 0.2889 0.2391 0.2898 0.0109  -0.0175 -0.0371 145 ARG A CZ    
69   N NH1   . ARG A 17  ? 0.2764 0.2223 0.2780 0.0087  -0.0207 -0.0419 145 ARG A NH1   
70   N NH2   . ARG A 17  ? 0.2912 0.2461 0.2871 0.0142  -0.0165 -0.0373 145 ARG A NH2   
71   N N     . PRO A 18  ? 0.1402 0.1064 0.1584 0.0024  -0.0022 -0.0057 146 PRO A N     
72   C CA    . PRO A 18  ? 0.1346 0.1031 0.1434 0.0073  0.0003  -0.0040 146 PRO A CA    
73   C C     . PRO A 18  ? 0.1422 0.1047 0.1437 0.0106  -0.0026 -0.0074 146 PRO A C     
74   O O     . PRO A 18  ? 0.1653 0.1208 0.1678 0.0104  -0.0045 -0.0080 146 PRO A O     
75   C CB    . PRO A 18  ? 0.1882 0.1559 0.1963 0.0064  0.0040  0.0036  146 PRO A CB    
76   C CG    . PRO A 18  ? 0.2074 0.1718 0.2258 0.0004  0.0036  0.0065  146 PRO A CG    
77   C CD    . PRO A 18  ? 0.1691 0.1306 0.1930 -0.0019 -0.0010 0.0000  146 PRO A CD    
78   N N     . THR A 19  ? 0.1385 0.1039 0.1332 0.0138  -0.0029 -0.0098 147 THR A N     
79   C CA    . THR A 19  ? 0.1413 0.1034 0.1302 0.0162  -0.0055 -0.0118 147 THR A CA    
80   C C     . THR A 19  ? 0.1408 0.1037 0.1208 0.0186  -0.0050 -0.0100 147 THR A C     
81   O O     . THR A 19  ? 0.1458 0.1109 0.1216 0.0199  -0.0045 -0.0121 147 THR A O     
82   C CB    . THR A 19  ? 0.1434 0.1068 0.1329 0.0163  -0.0079 -0.0168 147 THR A CB    
83   O OG1   . THR A 19  ? 0.1532 0.1163 0.1491 0.0141  -0.0086 -0.0192 147 THR A OG1   
84   C CG2   . THR A 19  ? 0.1530 0.1145 0.1401 0.0178  -0.0100 -0.0178 147 THR A CG2   
85   N N     . PRO A 20  ? 0.1387 0.0992 0.1148 0.0196  -0.0054 -0.0064 148 PRO A N     
86   C CA    . PRO A 20  ? 0.1458 0.1065 0.1115 0.0218  -0.0058 -0.0053 148 PRO A CA    
87   C C     . PRO A 20  ? 0.1510 0.1112 0.1130 0.0221  -0.0102 -0.0090 148 PRO A C     
88   O O     . PRO A 20  ? 0.1512 0.1120 0.1189 0.0212  -0.0123 -0.0110 148 PRO A O     
89   C CB    . PRO A 20  ? 0.1752 0.1338 0.1388 0.0225  -0.0057 0.0005  148 PRO A CB    
90   C CG    . PRO A 20  ? 0.1671 0.1228 0.1400 0.0216  -0.0072 0.0007  148 PRO A CG    
91   C CD    . PRO A 20  ? 0.1460 0.1024 0.1264 0.0194  -0.0061 -0.0034 148 PRO A CD    
92   N N     . LEU A 21  ? 0.1699 0.1289 0.1217 0.0234  -0.0117 -0.0097 149 LEU A N     
93   C CA    . LEU A 21  ? 0.1634 0.1211 0.1119 0.0223  -0.0166 -0.0129 149 LEU A CA    
94   C C     . LEU A 21  ? 0.1831 0.1433 0.1350 0.0216  -0.0205 -0.0106 149 LEU A C     
95   O O     . LEU A 21  ? 0.1857 0.1485 0.1430 0.0198  -0.0232 -0.0120 149 LEU A O     
96   C CB    . LEU A 21  ? 0.1891 0.1427 0.1245 0.0237  -0.0180 -0.0150 149 LEU A CB    
97   C CG    . LEU A 21  ? 0.2154 0.1657 0.1467 0.0214  -0.0241 -0.0183 149 LEU A CG    
98   C CD1   . LEU A 21  ? 0.2104 0.1603 0.1487 0.0192  -0.0244 -0.0207 149 LEU A CD1   
99   C CD2   . LEU A 21  ? 0.2557 0.1992 0.1718 0.0233  -0.0257 -0.0214 149 LEU A CD2   
100  N N     . THR A 22  ? 0.1770 0.1376 0.1266 0.0232  -0.0205 -0.0063 150 THR A N     
101  C CA    . THR A 22  ? 0.1687 0.1326 0.1226 0.0239  -0.0242 -0.0032 150 THR A CA    
102  C C     . THR A 22  ? 0.1587 0.1216 0.1203 0.0257  -0.0210 0.0004  150 THR A C     
103  O O     . THR A 22  ? 0.1887 0.1481 0.1493 0.0258  -0.0169 0.0024  150 THR A O     
104  C CB    . THR A 22  ? 0.1884 0.1526 0.1321 0.0248  -0.0286 -0.0005 150 THR A CB    
105  O OG1   . THR A 22  ? 0.2277 0.1887 0.1638 0.0270  -0.0250 0.0031  150 THR A OG1   
106  C CG2   . THR A 22  ? 0.2352 0.1979 0.1703 0.0225  -0.0329 -0.0050 150 THR A CG2   
107  N N     . HIS A 23  ? 0.1408 0.1066 0.1105 0.0272  -0.0228 0.0014  151 HIS A N     
108  C CA    . HIS A 23  ? 0.1313 0.0935 0.1083 0.0292  -0.0201 0.0029  151 HIS A CA    
109  C C     . HIS A 23  ? 0.1409 0.1062 0.1236 0.0332  -0.0228 0.0058  151 HIS A C     
110  O O     . HIS A 23  ? 0.1527 0.1234 0.1331 0.0342  -0.0270 0.0086  151 HIS A O     
111  C CB    . HIS A 23  ? 0.1256 0.0865 0.1078 0.0276  -0.0173 -0.0022 151 HIS A CB    
112  C CG    . HIS A 23  ? 0.1175 0.0847 0.1031 0.0271  -0.0187 -0.0059 151 HIS A CG    
113  N ND1   . HIS A 23  ? 0.1268 0.0974 0.1194 0.0301  -0.0187 -0.0065 151 HIS A ND1   
114  C CD2   . HIS A 23  ? 0.1261 0.0966 0.1090 0.0242  -0.0199 -0.0086 151 HIS A CD2   
115  C CE1   . HIS A 23  ? 0.1364 0.1139 0.1309 0.0285  -0.0194 -0.0088 151 HIS A CE1   
116  N NE2   . HIS A 23  ? 0.1344 0.1112 0.1231 0.0245  -0.0206 -0.0098 151 HIS A NE2   
117  N N     . HIS A 24  ? 0.1346 0.0960 0.1244 0.0360  -0.0207 0.0053  152 HIS A N     
118  C CA    . HIS A 24  ? 0.1404 0.1026 0.1356 0.0417  -0.0223 0.0088  152 HIS A CA    
119  C C     . HIS A 24  ? 0.1359 0.1041 0.1393 0.0449  -0.0216 0.0050  152 HIS A C     
120  O O     . HIS A 24  ? 0.1415 0.1101 0.1506 0.0512  -0.0219 0.0070  152 HIS A O     
121  C CB    . HIS A 24  ? 0.1505 0.1001 0.1457 0.0438  -0.0204 0.0122  152 HIS A CB    
122  C CG    . HIS A 24  ? 0.1570 0.1017 0.1447 0.0400  -0.0193 0.0163  152 HIS A CG    
123  N ND1   . HIS A 24  ? 0.1756 0.1237 0.1562 0.0405  -0.0218 0.0219  152 HIS A ND1   
124  C CD2   . HIS A 24  ? 0.1683 0.1075 0.1544 0.0355  -0.0159 0.0155  152 HIS A CD2   
125  C CE1   . HIS A 24  ? 0.2073 0.1514 0.1812 0.0372  -0.0191 0.0245  152 HIS A CE1   
126  N NE2   . HIS A 24  ? 0.1938 0.1333 0.1721 0.0339  -0.0153 0.0210  152 HIS A NE2   
127  N N     . ASN A 25  ? 0.1274 0.1006 0.1314 0.0416  -0.0203 0.0000  153 ASN A N     
128  C CA    . ASN A 25  ? 0.1244 0.1042 0.1349 0.0446  -0.0185 -0.0033 153 ASN A CA    
129  C C     . ASN A 25  ? 0.1179 0.1092 0.1293 0.0403  -0.0196 -0.0044 153 ASN A C     
130  O O     . ASN A 25  ? 0.1252 0.1202 0.1384 0.0398  -0.0170 -0.0080 153 ASN A O     
131  C CB    . ASN A 25  ? 0.1265 0.0969 0.1361 0.0454  -0.0149 -0.0086 153 ASN A CB    
132  C CG    . ASN A 25  ? 0.1376 0.0963 0.1484 0.0505  -0.0143 -0.0077 153 ASN A CG    
133  O OD1   . ASN A 25  ? 0.1475 0.1081 0.1632 0.0576  -0.0139 -0.0070 153 ASN A OD1   
134  N ND2   . ASN A 25  ? 0.1479 0.0949 0.1549 0.0471  -0.0142 -0.0068 153 ASN A ND2   
135  N N     . THR A 26  ? 0.1264 0.1231 0.1362 0.0372  -0.0239 -0.0011 154 THR A N     
136  C CA    . THR A 26  ? 0.1109 0.1145 0.1200 0.0314  -0.0260 -0.0020 154 THR A CA    
137  C C     . THR A 26  ? 0.1219 0.1384 0.1404 0.0322  -0.0246 -0.0019 154 THR A C     
138  O O     . THR A 26  ? 0.1376 0.1558 0.1554 0.0284  -0.0229 -0.0041 154 THR A O     
139  C CB    . THR A 26  ? 0.1304 0.1363 0.1357 0.0286  -0.0320 0.0012  154 THR A CB    
140  O OG1   . THR A 26  ? 0.1530 0.1480 0.1488 0.0291  -0.0319 0.0016  154 THR A OG1   
141  C CG2   . THR A 26  ? 0.1561 0.1645 0.1587 0.0218  -0.0350 -0.0005 154 THR A CG2   
142  N N     . GLY A 27  ? 0.1334 0.1597 0.1609 0.0375  -0.0249 0.0014  155 GLY A N     
143  C CA    . GLY A 27  ? 0.1592 0.2006 0.1969 0.0388  -0.0226 0.0024  155 GLY A CA    
144  C C     . GLY A 27  ? 0.1573 0.1959 0.1936 0.0418  -0.0161 -0.0021 155 GLY A C     
145  O O     . GLY A 27  ? 0.1563 0.2036 0.1951 0.0392  -0.0136 -0.0023 155 GLY A O     
146  N N     . LEU A 28  ? 0.1254 0.1511 0.1568 0.0468  -0.0135 -0.0056 156 LEU A N     
147  C CA    . LEU A 28  ? 0.1456 0.1674 0.1740 0.0498  -0.0083 -0.0108 156 LEU A CA    
148  C C     . LEU A 28  ? 0.1345 0.1519 0.1556 0.0427  -0.0081 -0.0135 156 LEU A C     
149  O O     . LEU A 28  ? 0.1250 0.1477 0.1451 0.0425  -0.0048 -0.0153 156 LEU A O     
150  C CB    . LEU A 28  ? 0.1452 0.1520 0.1699 0.0555  -0.0071 -0.0142 156 LEU A CB    
151  C CG    . LEU A 28  ? 0.1613 0.1687 0.1922 0.0643  -0.0070 -0.0118 156 LEU A CG    
152  C CD1   . LEU A 28  ? 0.1642 0.1525 0.1898 0.0679  -0.0064 -0.0155 156 LEU A CD1   
153  C CD2   . LEU A 28  ? 0.1543 0.1771 0.1932 0.0716  -0.0030 -0.0117 156 LEU A CD2   
154  N N     . SER A 29  ? 0.1251 0.1333 0.1405 0.0375  -0.0114 -0.0134 157 SER A N     
155  C CA    A SER A 29  ? 0.1074 0.1112 0.1163 0.0320  -0.0114 -0.0158 157 SER A CA    
156  C CA    B SER A 29  ? 0.1127 0.1164 0.1216 0.0319  -0.0114 -0.0158 157 SER A CA    
157  C C     . SER A 29  ? 0.1145 0.1282 0.1255 0.0272  -0.0122 -0.0131 157 SER A C     
158  O O     . SER A 29  ? 0.1246 0.1385 0.1323 0.0250  -0.0105 -0.0145 157 SER A O     
159  C CB    A SER A 29  ? 0.1285 0.1218 0.1316 0.0286  -0.0140 -0.0160 157 SER A CB    
160  C CB    B SER A 29  ? 0.1277 0.1212 0.1309 0.0285  -0.0141 -0.0158 157 SER A CB    
161  O OG    A SER A 29  ? 0.1483 0.1438 0.1515 0.0263  -0.0178 -0.0123 157 SER A OG    
162  O OG    B SER A 29  ? 0.1170 0.1008 0.1184 0.0310  -0.0130 -0.0178 157 SER A OG    
163  N N     . GLU A 30  ? 0.1086 0.1304 0.1251 0.0251  -0.0155 -0.0088 158 GLU A N     
164  C CA    A GLU A 30  ? 0.1385 0.1692 0.1584 0.0192  -0.0170 -0.0056 158 GLU A CA    
165  C CA    B GLU A 30  ? 0.1377 0.1686 0.1578 0.0192  -0.0171 -0.0056 158 GLU A CA    
166  C C     . GLU A 30  ? 0.1305 0.1732 0.1559 0.0212  -0.0119 -0.0044 158 GLU A C     
167  O O     . GLU A 30  ? 0.1215 0.1666 0.1455 0.0164  -0.0110 -0.0030 158 GLU A O     
168  C CB    A GLU A 30  ? 0.1333 0.1716 0.1594 0.0165  -0.0224 -0.0014 158 GLU A CB    
169  C CB    B GLU A 30  ? 0.1496 0.1886 0.1763 0.0168  -0.0223 -0.0013 158 GLU A CB    
170  C CG    A GLU A 30  ? 0.2875 0.3159 0.3058 0.0102  -0.0282 -0.0020 158 GLU A CG    
171  C CG    B GLU A 30  ? 0.0990 0.1437 0.1284 0.0082  -0.0262 0.0019  158 GLU A CG    
172  C CD    A GLU A 30  ? 0.3917 0.4215 0.4105 0.0099  -0.0341 0.0000  158 GLU A CD    
173  C CD    B GLU A 30  ? 0.2972 0.3603 0.3389 0.0070  -0.0237 0.0067  158 GLU A CD    
174  O OE1   A GLU A 30  ? 0.4193 0.4622 0.4482 0.0121  -0.0353 0.0037  158 GLU A OE1   
175  O OE1   B GLU A 30  ? 0.2399 0.3140 0.2892 0.0139  -0.0195 0.0077  158 GLU A OE1   
176  O OE2   A GLU A 30  ? 0.3311 0.3498 0.3399 0.0078  -0.0377 -0.0020 158 GLU A OE2   
177  O OE2   B GLU A 30  ? 0.2078 0.2741 0.2517 -0.0009 -0.0258 0.0097  158 GLU A OE2   
178  N N     . ALA A 31  ? 0.1138 0.1631 0.1444 0.0287  -0.0082 -0.0049 159 ALA A N     
179  C CA    . ALA A 31  ? 0.1130 0.1748 0.1478 0.0323  -0.0023 -0.0041 159 ALA A CA    
180  C C     . ALA A 31  ? 0.1226 0.1763 0.1469 0.0325  0.0012  -0.0085 159 ALA A C     
181  O O     . ALA A 31  ? 0.1325 0.1939 0.1561 0.0300  0.0041  -0.0062 159 ALA A O     
182  C CB    . ALA A 31  ? 0.1307 0.1985 0.1716 0.0424  0.0010  -0.0050 159 ALA A CB    
183  N N     . LEU A 32  ? 0.1275 0.1661 0.1436 0.0352  0.0005  -0.0141 160 LEU A N     
184  C CA    . LEU A 32  ? 0.1281 0.1594 0.1344 0.0351  0.0024  -0.0185 160 LEU A CA    
185  C C     . LEU A 32  ? 0.1343 0.1632 0.1364 0.0274  -0.0001 -0.0161 160 LEU A C     
186  O O     . LEU A 32  ? 0.1399 0.1698 0.1361 0.0267  0.0020  -0.0165 160 LEU A O     
187  C CB    . LEU A 32  ? 0.1216 0.1379 0.1223 0.0380  0.0010  -0.0244 160 LEU A CB    
188  C CG    . LEU A 32  ? 0.1372 0.1519 0.1397 0.0464  0.0036  -0.0278 160 LEU A CG    
189  C CD1   . LEU A 32  ? 0.1475 0.1463 0.1470 0.0472  0.0009  -0.0316 160 LEU A CD1   
190  C CD2   . LEU A 32  ? 0.1627 0.1812 0.1598 0.0516  0.0085  -0.0318 160 LEU A CD2   
191  N N     . GLU A 33  ? 0.1206 0.1457 0.1247 0.0222  -0.0047 -0.0135 161 GLU A N     
192  C CA    . GLU A 33  ? 0.1177 0.1385 0.1176 0.0157  -0.0073 -0.0115 161 GLU A CA    
193  C C     . GLU A 33  ? 0.1371 0.1690 0.1413 0.0114  -0.0061 -0.0056 161 GLU A C     
194  O O     . GLU A 33  ? 0.1380 0.1664 0.1372 0.0075  -0.0065 -0.0038 161 GLU A O     
195  C CB    . GLU A 33  ? 0.1372 0.1492 0.1360 0.0124  -0.0124 -0.0115 161 GLU A CB    
196  C CG    . GLU A 33  ? 0.1577 0.1591 0.1512 0.0155  -0.0125 -0.0162 161 GLU A CG    
197  C CD    . GLU A 33  ? 0.3037 0.2972 0.2948 0.0139  -0.0160 -0.0165 161 GLU A CD    
198  O OE1   . GLU A 33  ? 0.2822 0.2776 0.2752 0.0113  -0.0190 -0.0140 161 GLU A OE1   
199  O OE2   . GLU A 33  ? 0.2925 0.2786 0.2798 0.0153  -0.0157 -0.0194 161 GLU A OE2   
200  N N     . ILE A 34  ? 0.1037 0.1497 0.1177 0.0121  -0.0043 -0.0020 162 ILE A N     
201  C CA    . ILE A 34  ? 0.1041 0.1632 0.1236 0.0079  -0.0020 0.0044  162 ILE A CA    
202  C C     . ILE A 34  ? 0.1196 0.1819 0.1324 0.0115  0.0041  0.0038  162 ILE A C     
203  O O     . ILE A 34  ? 0.1313 0.1954 0.1414 0.0066  0.0051  0.0084  162 ILE A O     
204  C CB    . ILE A 34  ? 0.1129 0.1899 0.1463 0.0089  -0.0008 0.0088  162 ILE A CB    
205  C CG1   . ILE A 34  ? 0.1546 0.2296 0.1939 0.0038  -0.0082 0.0104  162 ILE A CG1   
206  C CG2   . ILE A 34  ? 0.1344 0.2284 0.1746 0.0055  0.0038  0.0159  162 ILE A CG2   
207  C CD1   . ILE A 34  ? 0.2102 0.2820 0.2500 -0.0068 -0.0134 0.0146  162 ILE A CD1   
208  N N     . LEU A 35  ? 0.1156 0.1779 0.1247 0.0200  0.0080  -0.0017 163 LEU A N     
209  C CA    . LEU A 35  ? 0.1395 0.2039 0.1397 0.0242  0.0133  -0.0036 163 LEU A CA    
210  C C     . LEU A 35  ? 0.1488 0.1998 0.1374 0.0211  0.0103  -0.0057 163 LEU A C     
211  O O     . LEU A 35  ? 0.1439 0.1979 0.1255 0.0205  0.0129  -0.0033 163 LEU A O     
212  C CB    . LEU A 35  ? 0.1298 0.1937 0.1274 0.0340  0.0168  -0.0105 163 LEU A CB    
213  C CG    . LEU A 35  ? 0.1383 0.2166 0.1478 0.0394  0.0205  -0.0084 163 LEU A CG    
214  C CD1   . LEU A 35  ? 0.1517 0.2254 0.1567 0.0501  0.0238  -0.0161 163 LEU A CD1   
215  C CD2   . LEU A 35  ? 0.1428 0.2417 0.1592 0.0379  0.0261  -0.0007 163 LEU A CD2   
216  N N     . ALA A 36  ? 0.1287 0.1660 0.1154 0.0195  0.0049  -0.0093 164 ALA A N     
217  C CA    . ALA A 36  ? 0.1333 0.1595 0.1111 0.0171  0.0017  -0.0107 164 ALA A CA    
218  C C     . ALA A 36  ? 0.1312 0.1577 0.1087 0.0105  0.0002  -0.0037 164 ALA A C     
219  O O     . ALA A 36  ? 0.1368 0.1613 0.1066 0.0098  0.0006  -0.0019 164 ALA A O     
220  C CB    . ALA A 36  ? 0.1223 0.1365 0.1001 0.0170  -0.0029 -0.0151 164 ALA A CB    
221  N N     . GLU A 37  ? 0.1501 0.1783 0.1358 0.0054  -0.0021 0.0005  165 GLU A N     
222  C CA    . GLU A 37  ? 0.1537 0.1800 0.1399 -0.0019 -0.0043 0.0071  165 GLU A CA    
223  C C     . GLU A 37  ? 0.1699 0.2083 0.1560 -0.0033 0.0008  0.0137  165 GLU A C     
224  O O     . GLU A 37  ? 0.1666 0.2003 0.1466 -0.0065 0.0004  0.0181  165 GLU A O     
225  C CB    . GLU A 37  ? 0.1632 0.1899 0.1583 -0.0074 -0.0084 0.0094  165 GLU A CB    
226  C CG    . GLU A 37  ? 0.2134 0.2350 0.2096 -0.0160 -0.0123 0.0153  165 GLU A CG    
227  C CD    . GLU A 37  ? 0.3033 0.3247 0.3072 -0.0212 -0.0176 0.0159  165 GLU A CD    
228  O OE1   . GLU A 37  ? 0.2671 0.2995 0.2788 -0.0187 -0.0168 0.0148  165 GLU A OE1   
229  O OE2   . GLU A 37  ? 0.3419 0.3514 0.3433 -0.0274 -0.0230 0.0173  165 GLU A OE2   
230  N N     . ALA A 38  ? 0.1428 0.1970 0.1352 0.0000  0.0062  0.0146  166 ALA A N     
231  C CA    . ALA A 38  ? 0.1708 0.2393 0.1634 -0.0006 0.0125  0.0213  166 ALA A CA    
232  C C     . ALA A 38  ? 0.1768 0.2412 0.1548 0.0042  0.0152  0.0190  166 ALA A C     
233  O O     . ALA A 38  ? 0.1862 0.2547 0.1594 0.0013  0.0179  0.0259  166 ALA A O     
234  C CB    . ALA A 38  ? 0.1750 0.2621 0.1771 0.0043  0.0184  0.0217  166 ALA A CB    
235  N N     . ALA A 39  ? 0.1703 0.2266 0.1409 0.0110  0.0141  0.0098  167 ALA A N     
236  C CA    . ALA A 39  ? 0.1767 0.2283 0.1330 0.0149  0.0148  0.0069  167 ALA A CA    
237  C C     . ALA A 39  ? 0.1964 0.2372 0.1468 0.0097  0.0100  0.0112  167 ALA A C     
238  O O     . ALA A 39  ? 0.2140 0.2563 0.1547 0.0100  0.0116  0.0151  167 ALA A O     
239  C CB    . ALA A 39  ? 0.1829 0.2266 0.1344 0.0213  0.0129  -0.0039 167 ALA A CB    
240  N N     . GLY A 40  ? 0.1808 0.2105 0.1363 0.0057  0.0042  0.0108  168 GLY A N     
241  C CA    . GLY A 40  ? 0.2045 0.2227 0.1550 0.0018  -0.0003 0.0149  168 GLY A CA    
242  C C     . GLY A 40  ? 0.2053 0.2273 0.1568 -0.0045 0.0014  0.0256  168 GLY A C     
243  O O     . GLY A 40  ? 0.2248 0.2408 0.1684 -0.0057 0.0001  0.0306  168 GLY A O     
244  N N     . PHE A 41  ? 0.1967 0.2290 0.1589 -0.0090 0.0041  0.0301  169 PHE A N     
245  C CA    . PHE A 41  ? 0.2127 0.2500 0.1777 -0.0164 0.0059  0.0413  169 PHE A CA    
246  C C     . PHE A 41  ? 0.2521 0.3002 0.2081 -0.0134 0.0125  0.0464  169 PHE A C     
247  O O     . PHE A 41  ? 0.2601 0.3081 0.2136 -0.0189 0.0135  0.0565  169 PHE A O     
248  C CB    . PHE A 41  ? 0.2014 0.2512 0.1817 -0.0220 0.0074  0.0452  169 PHE A CB    
249  C CG    . PHE A 41  ? 0.1967 0.2356 0.1844 -0.0268 0.0000  0.0422  169 PHE A CG    
250  C CD1   . PHE A 41  ? 0.2041 0.2224 0.1852 -0.0280 -0.0066 0.0391  169 PHE A CD1   
251  C CD2   . PHE A 41  ? 0.1947 0.2452 0.1957 -0.0295 -0.0001 0.0425  169 PHE A CD2   
252  C CE1   . PHE A 41  ? 0.2157 0.2243 0.2015 -0.0317 -0.0129 0.0358  169 PHE A CE1   
253  C CE2   . PHE A 41  ? 0.2132 0.2544 0.2195 -0.0340 -0.0073 0.0397  169 PHE A CE2   
254  C CZ    . PHE A 41  ? 0.2026 0.2225 0.2004 -0.0350 -0.0134 0.0360  169 PHE A CZ    
255  N N     . GLU A 42  ? 0.2504 0.3066 0.2003 -0.0048 0.0168  0.0397  170 GLU A N     
256  C CA    . GLU A 42  ? 0.2924 0.3585 0.2307 -0.0005 0.0231  0.0426  170 GLU A CA    
257  C C     . GLU A 42  ? 0.3333 0.3878 0.2555 0.0037  0.0192  0.0392  170 GLU A C     
258  O O     . GLU A 42  ? 0.3651 0.4263 0.2746 0.0081  0.0233  0.0405  170 GLU A O     
259  C CB    . GLU A 42  ? 0.3041 0.3847 0.2428 0.0075  0.0299  0.0363  170 GLU A CB    
260  C CG    . GLU A 42  ? 0.3401 0.4371 0.2951 0.0052  0.0349  0.0406  170 GLU A CG    
261  N N     . GLY A 43  ? 0.3252 0.3637 0.2474 0.0030  0.0115  0.0349  171 GLY A N     
262  C CA    . GLY A 43  ? 0.3467 0.3762 0.2562 0.0072  0.0070  0.0316  171 GLY A CA    
263  C C     . GLY A 43  ? 0.3238 0.3540 0.2278 0.0145  0.0061  0.0199  171 GLY A C     
264  O O     . GLY A 43  ? 0.3307 0.3567 0.2234 0.0180  0.0025  0.0173  171 GLY A O     
265  N N     . SER A 44  ? 0.2641 0.2985 0.1757 0.0167  0.0084  0.0128  172 SER A N     
266  C CA    . SER A 44  ? 0.2785 0.3119 0.1844 0.0231  0.0076  0.0018  172 SER A CA    
267  C C     . SER A 44  ? 0.2666 0.2892 0.1802 0.0224  0.0014  -0.0048 172 SER A C     
268  O O     . SER A 44  ? 0.2458 0.2682 0.1685 0.0229  0.0023  -0.0092 172 SER A O     
269  C CB    . SER A 44  ? 0.3489 0.3930 0.2563 0.0275  0.0146  -0.0018 172 SER A CB    
270  O OG    . SER A 44  ? 0.4311 0.4708 0.3310 0.0335  0.0129  -0.0128 172 SER A OG    
271  N N     . GLU A 45  ? 0.2568 0.2715 0.1660 0.0221  -0.0046 -0.0053 173 GLU A N     
272  C CA    . GLU A 45  ? 0.2566 0.2626 0.1730 0.0215  -0.0100 -0.0102 173 GLU A CA    
273  C C     . GLU A 45  ? 0.2309 0.2363 0.1486 0.0246  -0.0105 -0.0199 173 GLU A C     
274  O O     . GLU A 45  ? 0.2245 0.2256 0.1514 0.0236  -0.0120 -0.0232 173 GLU A O     
275  C CB    . GLU A 45  ? 0.3104 0.3109 0.2219 0.0218  -0.0158 -0.0085 173 GLU A CB    
276  C CG    . GLU A 45  ? 0.4204 0.4141 0.3360 0.0188  -0.0178 -0.0012 173 GLU A CG    
277  C CD    . GLU A 45  ? 0.4643 0.4529 0.3912 0.0164  -0.0179 -0.0029 173 GLU A CD    
278  O OE1   . GLU A 45  ? 0.4971 0.4832 0.4289 0.0179  -0.0203 -0.0088 173 GLU A OE1   
279  O OE2   . GLU A 45  ? 0.4685 0.4563 0.3993 0.0126  -0.0157 0.0020  173 GLU A OE2   
280  N N     . GLY A 46  ? 0.2146 0.2233 0.1220 0.0283  -0.0098 -0.0247 174 GLY A N     
281  C CA    . GLY A 46  ? 0.2017 0.2070 0.1092 0.0309  -0.0111 -0.0344 174 GLY A CA    
282  C C     . GLY A 46  ? 0.1882 0.1946 0.1039 0.0322  -0.0062 -0.0363 174 GLY A C     
283  O O     . GLY A 46  ? 0.1977 0.1983 0.1207 0.0319  -0.0081 -0.0409 174 GLY A O     
284  N N     A ARG A 47  ? 0.1768 0.1917 0.0916 0.0338  0.0002  -0.0320 175 ARG A N     
285  N N     B ARG A 47  ? 0.1782 0.1930 0.0934 0.0336  0.0001  -0.0319 175 ARG A N     
286  C CA    A ARG A 47  ? 0.1811 0.1994 0.1052 0.0355  0.0046  -0.0326 175 ARG A CA    
287  C CA    B ARG A 47  ? 0.1810 0.1987 0.1053 0.0355  0.0044  -0.0330 175 ARG A CA    
288  C C     A ARG A 47  ? 0.1643 0.1791 0.1016 0.0308  0.0021  -0.0290 175 ARG A C     
289  C C     B ARG A 47  ? 0.1653 0.1807 0.1029 0.0308  0.0025  -0.0287 175 ARG A C     
290  O O     A ARG A 47  ? 0.1583 0.1697 0.1027 0.0320  0.0018  -0.0325 175 ARG A O     
291  O O     B ARG A 47  ? 0.1602 0.1736 0.1056 0.0320  0.0028  -0.0314 175 ARG A O     
292  C CB    A ARG A 47  ? 0.1873 0.2188 0.1104 0.0375  0.0120  -0.0270 175 ARG A CB    
293  C CB    B ARG A 47  ? 0.1843 0.2147 0.1064 0.0387  0.0120  -0.0290 175 ARG A CB    
294  C CG    A ARG A 47  ? 0.2012 0.2374 0.1094 0.0436  0.0160  -0.0307 175 ARG A CG    
295  C CG    B ARG A 47  ? 0.1889 0.2212 0.0967 0.0457  0.0151  -0.0355 175 ARG A CG    
296  C CD    A ARG A 47  ? 0.2084 0.2605 0.1172 0.0453  0.0246  -0.0234 175 ARG A CD    
297  C CD    B ARG A 47  ? 0.2059 0.2531 0.1098 0.0482  0.0232  -0.0292 175 ARG A CD    
298  N NE    A ARG A 47  ? 0.2434 0.3023 0.1601 0.0509  0.0301  -0.0261 175 ARG A NE    
299  N NE    B ARG A 47  ? 0.2623 0.3127 0.1531 0.0569  0.0281  -0.0361 175 ARG A NE    
300  C CZ    A ARG A 47  ? 0.2505 0.3189 0.1828 0.0487  0.0329  -0.0198 175 ARG A CZ    
301  C CZ    B ARG A 47  ? 0.2744 0.3202 0.1505 0.0582  0.0260  -0.0395 175 ARG A CZ    
302  N NH1   A ARG A 47  ? 0.2029 0.2739 0.1443 0.0401  0.0307  -0.0107 175 ARG A NH1   
303  N NH1   B ARG A 47  ? 0.2775 0.3183 0.1464 0.0538  0.0198  -0.0377 175 ARG A NH1   
304  N NH2   A ARG A 47  ? 0.2233 0.2982 0.1620 0.0554  0.0376  -0.0228 175 ARG A NH2   
305  N NH2   B ARG A 47  ? 0.2616 0.3073 0.1316 0.0634  0.0296  -0.0445 175 ARG A NH2   
306  N N     . LEU A 48  ? 0.1426 0.1571 0.0820 0.0257  0.0002  -0.0222 176 LEU A N     
307  C CA    . LEU A 48  ? 0.1345 0.1443 0.0836 0.0216  -0.0026 -0.0197 176 LEU A CA    
308  C C     . LEU A 48  ? 0.1425 0.1437 0.0941 0.0225  -0.0065 -0.0258 176 LEU A C     
309  O O     . LEU A 48  ? 0.1415 0.1404 0.1005 0.0221  -0.0067 -0.0268 176 LEU A O     
310  C CB    . LEU A 48  ? 0.1417 0.1485 0.0898 0.0170  -0.0051 -0.0130 176 LEU A CB    
311  C CG    . LEU A 48  ? 0.1501 0.1493 0.1049 0.0134  -0.0087 -0.0116 176 LEU A CG    
312  C CD1   . LEU A 48  ? 0.1884 0.1860 0.1428 0.0088  -0.0095 -0.0042 176 LEU A CD1   
313  C CD2   . LEU A 48  ? 0.1609 0.1517 0.1143 0.0148  -0.0128 -0.0158 176 LEU A CD2   
314  N N     . LEU A 49  ? 0.1526 0.1498 0.0980 0.0234  -0.0097 -0.0294 177 LEU A N     
315  C CA    . LEU A 49  ? 0.1433 0.1340 0.0926 0.0232  -0.0132 -0.0342 177 LEU A CA    
316  C C     . LEU A 49  ? 0.1497 0.1383 0.1017 0.0256  -0.0117 -0.0396 177 LEU A C     
317  O O     . LEU A 49  ? 0.1375 0.1217 0.0965 0.0246  -0.0127 -0.0404 177 LEU A O     
318  C CB    . LEU A 49  ? 0.1507 0.1400 0.0944 0.0233  -0.0176 -0.0367 177 LEU A CB    
319  C CG    . LEU A 49  ? 0.1777 0.1661 0.1221 0.0217  -0.0206 -0.0320 177 LEU A CG    
320  C CD1   . LEU A 49  ? 0.1840 0.1737 0.1224 0.0227  -0.0250 -0.0343 177 LEU A CD1   
321  C CD2   . LEU A 49  ? 0.1782 0.1628 0.1319 0.0202  -0.0217 -0.0317 177 LEU A CD2   
322  N N     . THR A 50  ? 0.1561 0.1471 0.1019 0.0295  -0.0090 -0.0431 178 THR A N     
323  C CA    . THR A 50  ? 0.1403 0.1266 0.0880 0.0327  -0.0079 -0.0486 178 THR A CA    
324  C C     . THR A 50  ? 0.1493 0.1379 0.1063 0.0334  -0.0049 -0.0450 178 THR A C     
325  O O     . THR A 50  ? 0.1513 0.1335 0.1139 0.0336  -0.0061 -0.0468 178 THR A O     
326  C CB    . THR A 50  ? 0.1816 0.1691 0.1190 0.0380  -0.0054 -0.0540 178 THR A CB    
327  O OG1   . THR A 50  ? 0.1930 0.1749 0.1231 0.0367  -0.0103 -0.0590 178 THR A OG1   
328  C CG2   . THR A 50  ? 0.1879 0.1715 0.1279 0.0433  -0.0025 -0.0583 178 THR A CG2   
329  N N     . PHE A 51  ? 0.1493 0.1472 0.1088 0.0330  -0.0017 -0.0391 179 PHE A N     
330  C CA    . PHE A 51  ? 0.1439 0.1455 0.1128 0.0333  0.0000  -0.0355 179 PHE A CA    
331  C C     . PHE A 51  ? 0.1481 0.1440 0.1224 0.0288  -0.0039 -0.0332 179 PHE A C     
332  O O     . PHE A 51  ? 0.1384 0.1321 0.1184 0.0298  -0.0042 -0.0329 179 PHE A O     
333  C CB    . PHE A 51  ? 0.1482 0.1625 0.1200 0.0327  0.0036  -0.0293 179 PHE A CB    
334  C CG    . PHE A 51  ? 0.1524 0.1754 0.1211 0.0388  0.0093  -0.0309 179 PHE A CG    
335  C CD1   . PHE A 51  ? 0.1759 0.1974 0.1463 0.0456  0.0115  -0.0356 179 PHE A CD1   
336  C CD2   . PHE A 51  ? 0.1658 0.1983 0.1297 0.0383  0.0128  -0.0271 179 PHE A CD2   
337  C CE1   . PHE A 51  ? 0.1899 0.2195 0.1565 0.0528  0.0174  -0.0377 179 PHE A CE1   
338  C CE2   . PHE A 51  ? 0.1914 0.2335 0.1517 0.0448  0.0191  -0.0284 179 PHE A CE2   
339  C CZ    . PHE A 51  ? 0.1745 0.2152 0.1361 0.0524  0.0215  -0.0340 179 PHE A CZ    
340  N N     . CYS A 52  ? 0.1406 0.1339 0.1124 0.0247  -0.0066 -0.0314 180 CYS A N     
341  C CA    . CYS A 52  ? 0.1392 0.1270 0.1144 0.0217  -0.0096 -0.0300 180 CYS A CA    
342  C C     . CYS A 52  ? 0.1301 0.1111 0.1070 0.0227  -0.0109 -0.0340 180 CYS A C     
343  O O     . CYS A 52  ? 0.1406 0.1185 0.1216 0.0220  -0.0115 -0.0326 180 CYS A O     
344  C CB    . CYS A 52  ? 0.1536 0.1393 0.1252 0.0189  -0.0119 -0.0281 180 CYS A CB    
345  S SG    . CYS A 52  ? 0.2101 0.1991 0.1812 0.0156  -0.0118 -0.0220 180 CYS A SG    
346  N N     . ARG A 53  ? 0.1183 0.0966 0.0915 0.0237  -0.0117 -0.0385 181 ARG A N     
347  C CA    . ARG A 53  ? 0.1223 0.0937 0.0980 0.0233  -0.0135 -0.0419 181 ARG A CA    
348  C C     . ARG A 53  ? 0.1260 0.0935 0.1049 0.0262  -0.0118 -0.0429 181 ARG A C     
349  O O     . ARG A 53  ? 0.1304 0.0925 0.1137 0.0249  -0.0126 -0.0419 181 ARG A O     
350  C CB    . ARG A 53  ? 0.1246 0.0937 0.0956 0.0231  -0.0161 -0.0471 181 ARG A CB    
351  C CG    . ARG A 53  ? 0.1291 0.1018 0.0985 0.0206  -0.0188 -0.0456 181 ARG A CG    
352  C CD    . ARG A 53  ? 0.1412 0.1136 0.1039 0.0210  -0.0218 -0.0506 181 ARG A CD    
353  N NE    . ARG A 53  ? 0.1574 0.1341 0.1188 0.0194  -0.0251 -0.0488 181 ARG A NE    
354  C CZ    . ARG A 53  ? 0.1511 0.1296 0.1050 0.0200  -0.0283 -0.0516 181 ARG A CZ    
355  N NH1   . ARG A 53  ? 0.1761 0.1522 0.1221 0.0220  -0.0279 -0.0566 181 ARG A NH1   
356  N NH2   . ARG A 53  ? 0.1785 0.1615 0.1323 0.0192  -0.0317 -0.0489 181 ARG A NH2   
357  N N     . ALA A 54  ? 0.1247 0.0953 0.1014 0.0305  -0.0091 -0.0442 182 ALA A N     
358  C CA    . ALA A 54  ? 0.1309 0.0982 0.1111 0.0348  -0.0074 -0.0448 182 ALA A CA    
359  C C     . ALA A 54  ? 0.1236 0.0939 0.1103 0.0338  -0.0073 -0.0387 182 ALA A C     
360  O O     . ALA A 54  ? 0.1376 0.1016 0.1277 0.0348  -0.0080 -0.0378 182 ALA A O     
361  C CB    . ALA A 54  ? 0.1467 0.1198 0.1237 0.0407  -0.0037 -0.0469 182 ALA A CB    
362  N N     . ALA A 55  ? 0.1259 0.1050 0.1136 0.0315  -0.0070 -0.0345 183 ALA A N     
363  C CA    . ALA A 55  ? 0.1245 0.1059 0.1166 0.0299  -0.0082 -0.0295 183 ALA A CA    
364  C C     . ALA A 55  ? 0.1346 0.1080 0.1264 0.0272  -0.0103 -0.0289 183 ALA A C     
365  O O     . ALA A 55  ? 0.1279 0.0991 0.1222 0.0280  -0.0109 -0.0261 183 ALA A O     
366  C CB    . ALA A 55  ? 0.1348 0.1238 0.1267 0.0263  -0.0088 -0.0259 183 ALA A CB    
367  N N     . SER A 56  ? 0.1062 0.0766 0.0951 0.0243  -0.0112 -0.0308 184 SER A N     
368  C CA    A SER A 56  ? 0.1163 0.0822 0.1059 0.0217  -0.0122 -0.0296 184 SER A CA    
369  C CA    B SER A 56  ? 0.1202 0.0861 0.1099 0.0218  -0.0122 -0.0294 184 SER A CA    
370  C C     . SER A 56  ? 0.1330 0.0917 0.1256 0.0224  -0.0121 -0.0302 184 SER A C     
371  O O     . SER A 56  ? 0.1390 0.0950 0.1331 0.0212  -0.0120 -0.0268 184 SER A O     
372  C CB    A SER A 56  ? 0.1396 0.1062 0.1273 0.0194  -0.0132 -0.0313 184 SER A CB    
373  C CB    B SER A 56  ? 0.1464 0.1132 0.1342 0.0193  -0.0132 -0.0308 184 SER A CB    
374  O OG    A SER A 56  ? 0.1011 0.0660 0.0907 0.0175  -0.0134 -0.0297 184 SER A OG    
375  O OG    B SER A 56  ? 0.2203 0.1845 0.2087 0.0188  -0.0140 -0.0346 184 SER A OG    
376  N N     . VAL A 57  ? 0.1265 0.0811 0.1188 0.0242  -0.0121 -0.0344 185 VAL A N     
377  C CA    . VAL A 57  ? 0.1346 0.0795 0.1295 0.0248  -0.0126 -0.0352 185 VAL A CA    
378  C C     . VAL A 57  ? 0.1531 0.0965 0.1502 0.0278  -0.0117 -0.0305 185 VAL A C     
379  O O     . VAL A 57  ? 0.1564 0.0935 0.1558 0.0264  -0.0119 -0.0271 185 VAL A O     
380  C CB    . VAL A 57  ? 0.1494 0.0887 0.1414 0.0276  -0.0130 -0.0418 185 VAL A CB    
381  C CG1   . VAL A 57  ? 0.1858 0.1126 0.1796 0.0299  -0.0135 -0.0427 185 VAL A CG1   
382  C CG2   . VAL A 57  ? 0.1679 0.1066 0.1576 0.0237  -0.0155 -0.0463 185 VAL A CG2   
383  N N     . LEU A 58  ? 0.1393 0.0896 0.1364 0.0317  -0.0107 -0.0295 186 LEU A N     
384  C CA    . LEU A 58  ? 0.1354 0.0863 0.1352 0.0351  -0.0107 -0.0248 186 LEU A CA    
385  C C     . LEU A 58  ? 0.1551 0.1078 0.1541 0.0318  -0.0118 -0.0194 186 LEU A C     
386  O O     . LEU A 58  ? 0.1523 0.1012 0.1521 0.0333  -0.0124 -0.0149 186 LEU A O     
387  C CB    . LEU A 58  ? 0.1590 0.1203 0.1609 0.0393  -0.0098 -0.0244 186 LEU A CB    
388  C CG    . LEU A 58  ? 0.1575 0.1187 0.1592 0.0446  -0.0075 -0.0295 186 LEU A CG    
389  C CD1   . LEU A 58  ? 0.1878 0.1623 0.1936 0.0488  -0.0057 -0.0274 186 LEU A CD1   
390  C CD2   . LEU A 58  ? 0.1924 0.1401 0.1943 0.0490  -0.0075 -0.0317 186 LEU A CD2   
391  N N     . LYS A 59  ? 0.1405 0.0982 0.1367 0.0279  -0.0121 -0.0196 187 LYS A N     
392  C CA    . LYS A 59  ? 0.1237 0.0821 0.1168 0.0256  -0.0128 -0.0157 187 LYS A CA    
393  C C     . LYS A 59  ? 0.1376 0.0895 0.1311 0.0238  -0.0116 -0.0135 187 LYS A C     
394  O O     . LYS A 59  ? 0.1682 0.1199 0.1587 0.0234  -0.0114 -0.0090 187 LYS A O     
395  C CB    . LYS A 59  ? 0.1274 0.0903 0.1171 0.0227  -0.0132 -0.0174 187 LYS A CB    
396  C CG    . LYS A 59  ? 0.1239 0.0930 0.1137 0.0228  -0.0143 -0.0186 187 LYS A CG    
397  C CD    . LYS A 59  ? 0.1524 0.1226 0.1381 0.0200  -0.0151 -0.0197 187 LYS A CD    
398  C CE    . LYS A 59  ? 0.1949 0.1704 0.1815 0.0191  -0.0158 -0.0201 187 LYS A CE    
399  N NZ    . LYS A 59  ? 0.2191 0.1931 0.2014 0.0165  -0.0169 -0.0208 187 LYS A NZ    
400  N N     . ALA A 60  ? 0.1366 0.0838 0.1332 0.0221  -0.0110 -0.0164 188 ALA A N     
401  C CA    . ALA A 60  ? 0.1573 0.0992 0.1564 0.0188  -0.0100 -0.0140 188 ALA A CA    
402  C C     . ALA A 60  ? 0.1656 0.0979 0.1670 0.0201  -0.0102 -0.0107 188 ALA A C     
403  O O     . ALA A 60  ? 0.1875 0.1154 0.1914 0.0167  -0.0093 -0.0067 188 ALA A O     
404  C CB    . ALA A 60  ? 0.1650 0.1065 0.1673 0.0154  -0.0107 -0.0187 188 ALA A CB    
405  N N     . LEU A 61  ? 0.1575 0.0870 0.1587 0.0251  -0.0112 -0.0116 189 LEU A N     
406  C CA    . LEU A 61  ? 0.1720 0.0906 0.1753 0.0276  -0.0116 -0.0086 189 LEU A CA    
407  C C     . LEU A 61  ? 0.1780 0.0968 0.1793 0.0281  -0.0113 0.0000  189 LEU A C     
408  O O     . LEU A 61  ? 0.1659 0.0939 0.1633 0.0290  -0.0115 0.0022  189 LEU A O     
409  C CB    . LEU A 61  ? 0.1777 0.0948 0.1817 0.0345  -0.0123 -0.0120 189 LEU A CB    
410  C CG    . LEU A 61  ? 0.1730 0.0869 0.1769 0.0355  -0.0124 -0.0205 189 LEU A CG    
411  C CD1   . LEU A 61  ? 0.1963 0.1128 0.2006 0.0436  -0.0117 -0.0229 189 LEU A CD1   
412  C CD2   . LEU A 61  ? 0.2282 0.1270 0.2334 0.0325  -0.0136 -0.0226 189 LEU A CD2   
413  N N     . PRO A 62  ? 0.1763 0.0838 0.1791 0.0278  -0.0113 0.0050  190 PRO A N     
414  C CA    . PRO A 62  ? 0.1756 0.0831 0.1752 0.0281  -0.0107 0.0141  190 PRO A CA    
415  C C     . PRO A 62  ? 0.1876 0.0955 0.1853 0.0351  -0.0129 0.0179  190 PRO A C     
416  O O     . PRO A 62  ? 0.1975 0.1064 0.1907 0.0358  -0.0131 0.0256  190 PRO A O     
417  C CB    . PRO A 62  ? 0.2120 0.1065 0.2151 0.0238  -0.0098 0.0186  190 PRO A CB    
418  C CG    . PRO A 62  ? 0.2255 0.1089 0.2329 0.0252  -0.0117 0.0115  190 PRO A CG    
419  C CD    . PRO A 62  ? 0.2012 0.0950 0.2083 0.0255  -0.0119 0.0025  190 PRO A CD    
420  N N     . SER A 63  ? 0.1967 0.1052 0.1975 0.0407  -0.0144 0.0131  191 SER A N     
421  C CA    . SER A 63  ? 0.1902 0.1015 0.1917 0.0481  -0.0166 0.0169  191 SER A CA    
422  C C     . SER A 63  ? 0.1841 0.1031 0.1899 0.0529  -0.0169 0.0102  191 SER A C     
423  O O     . SER A 63  ? 0.1866 0.1062 0.1933 0.0505  -0.0153 0.0028  191 SER A O     
424  C CB    . SER A 63  ? 0.2350 0.1309 0.2380 0.0520  -0.0173 0.0227  191 SER A CB    
425  O OG    . SER A 63  ? 0.2680 0.1519 0.2748 0.0536  -0.0166 0.0164  191 SER A OG    
426  N N     . PRO A 64  ? 0.1753 0.1024 0.1841 0.0596  -0.0189 0.0130  192 PRO A N     
427  C CA    . PRO A 64  ? 0.1690 0.1069 0.1833 0.0641  -0.0183 0.0078  192 PRO A CA    
428  C C     . PRO A 64  ? 0.1800 0.1076 0.1970 0.0696  -0.0159 0.0020  192 PRO A C     
429  O O     . PRO A 64  ? 0.1925 0.1047 0.2097 0.0737  -0.0162 0.0038  192 PRO A O     
430  C CB    . PRO A 64  ? 0.1707 0.1199 0.1891 0.0700  -0.0215 0.0139  192 PRO A CB    
431  C CG    . PRO A 64  ? 0.1737 0.1212 0.1858 0.0663  -0.0245 0.0210  192 PRO A CG    
432  C CD    . PRO A 64  ? 0.1812 0.1116 0.1885 0.0625  -0.0221 0.0216  192 PRO A CD    
433  N N     . VAL A 65  ? 0.1725 0.1073 0.1905 0.0698  -0.0136 -0.0050 193 VAL A N     
434  C CA    . VAL A 65  ? 0.1824 0.1114 0.2020 0.0773  -0.0111 -0.0111 193 VAL A CA    
435  C C     . VAL A 65  ? 0.1873 0.1269 0.2143 0.0864  -0.0105 -0.0074 193 VAL A C     
436  O O     . VAL A 65  ? 0.2046 0.1629 0.2366 0.0880  -0.0112 -0.0049 193 VAL A O     
437  C CB    . VAL A 65  ? 0.1745 0.1102 0.1917 0.0748  -0.0084 -0.0188 193 VAL A CB    
438  C CG1   . VAL A 65  ? 0.1858 0.1193 0.2032 0.0807  -0.0044 -0.0243 193 VAL A CG1   
439  C CG2   . VAL A 65  ? 0.1798 0.1066 0.1912 0.0656  -0.0091 -0.0219 193 VAL A CG2   
440  N N     . THR A 66  ? 0.2361 0.1649 0.2652 0.0911  -0.0093 -0.0067 194 THR A N     
441  C CA    . THR A 66  ? 0.2697 0.2076 0.3071 0.0999  -0.0086 -0.0034 194 THR A CA    
442  C C     . THR A 66  ? 0.2799 0.2148 0.3186 0.1056  -0.0039 -0.0101 194 THR A C     
443  O O     . THR A 66  ? 0.2929 0.2403 0.3393 0.1132  -0.0023 -0.0088 194 THR A O     
444  C CB    . THR A 66  ? 0.3044 0.2326 0.3439 0.1023  -0.0118 0.0045  194 THR A CB    
445  O OG1   . THR A 66  ? 0.3568 0.2626 0.3920 0.1003  -0.0107 0.0022  194 THR A OG1   
446  C CG2   . THR A 66  ? 0.3353 0.2671 0.3715 0.0973  -0.0165 0.0118  194 THR A CG2   
447  N N     . THR A 67  ? 0.3061 0.2258 0.3375 0.1022  -0.0019 -0.0172 195 THR A N     
448  C CA    . THR A 67  ? 0.3465 0.2610 0.3765 0.1077  0.0021  -0.0242 195 THR A CA    
449  C C     . THR A 67  ? 0.3319 0.2439 0.3530 0.1021  0.0039  -0.0325 195 THR A C     
450  O O     . THR A 67  ? 0.3114 0.2170 0.3274 0.0935  0.0015  -0.0332 195 THR A O     
451  C CB    . THR A 67  ? 0.3803 0.2733 0.4099 0.1103  0.0014  -0.0242 195 THR A CB    
452  O OG1   . THR A 67  ? 0.4372 0.3123 0.4595 0.1015  -0.0005 -0.0263 195 THR A OG1   
453  C CG2   . THR A 67  ? 0.4014 0.2951 0.4388 0.1145  -0.0016 -0.0146 195 THR A CG2   
454  N N     . LEU A 68  ? 0.3367 0.2544 0.3560 0.1074  0.0081  -0.0385 196 LEU A N     
455  C CA    . LEU A 68  ? 0.3634 0.2803 0.3734 0.1028  0.0097  -0.0460 196 LEU A CA    
456  C C     . LEU A 68  ? 0.3845 0.2797 0.3865 0.0964  0.0070  -0.0508 196 LEU A C     
457  O O     . LEU A 68  ? 0.3847 0.2788 0.3800 0.0891  0.0057  -0.0546 196 LEU A O     
458  C CB    . LEU A 68  ? 0.3846 0.3099 0.3927 0.1107  0.0150  -0.0511 196 LEU A CB    
459  C CG    . LEU A 68  ? 0.4165 0.3478 0.4154 0.1069  0.0169  -0.0568 196 LEU A CG    
460  C CD1   . LEU A 68  ? 0.3802 0.3307 0.3829 0.1030  0.0168  -0.0518 196 LEU A CD1   
461  C CD2   . LEU A 68  ? 0.4404 0.3762 0.4351 0.1152  0.0223  -0.0623 196 LEU A CD2   
462  N N     . SER A 69  ? 0.3839 0.2621 0.3872 0.0987  0.0060  -0.0504 197 SER A N     
463  C CA    . SER A 69  ? 0.4236 0.2813 0.4202 0.0922  0.0034  -0.0549 197 SER A CA    
464  C C     . SER A 69  ? 0.4071 0.2625 0.4035 0.0814  -0.0005 -0.0511 197 SER A C     
465  O O     . SER A 69  ? 0.4108 0.2551 0.4019 0.0740  -0.0029 -0.0553 197 SER A O     
466  C CB    . SER A 69  ? 0.4383 0.2777 0.4374 0.0969  0.0030  -0.0540 197 SER A CB    
467  O OG    . SER A 69  ? 0.4854 0.3252 0.4925 0.0977  0.0014  -0.0443 197 SER A OG    
468  N N     . GLN A 70  ? 0.3568 0.2232 0.3590 0.0805  -0.0015 -0.0434 198 GLN A N     
469  C CA    . GLN A 70  ? 0.3365 0.2021 0.3386 0.0711  -0.0047 -0.0396 198 GLN A CA    
470  C C     . GLN A 70  ? 0.3121 0.1865 0.3095 0.0651  -0.0052 -0.0444 198 GLN A C     
471  O O     . GLN A 70  ? 0.3239 0.1958 0.3208 0.0569  -0.0080 -0.0431 198 GLN A O     
472  C CB    . GLN A 70  ? 0.3269 0.2019 0.3349 0.0729  -0.0058 -0.0306 198 GLN A CB    
473  C CG    . GLN A 70  ? 0.3690 0.2334 0.3812 0.0772  -0.0065 -0.0241 198 GLN A CG    
474  C CD    . GLN A 70  ? 0.4003 0.2758 0.4177 0.0809  -0.0079 -0.0150 198 GLN A CD    
475  O OE1   . GLN A 70  ? 0.3413 0.2344 0.3610 0.0835  -0.0076 -0.0146 198 GLN A OE1   
476  N NE2   . GLN A 70  ? 0.4197 0.2850 0.4388 0.0809  -0.0098 -0.0074 198 GLN A NE2   
477  N N     . LEU A 71  ? 0.2858 0.1706 0.2800 0.0690  -0.0026 -0.0495 199 LEU A N     
478  C CA    . LEU A 71  ? 0.2995 0.1913 0.2883 0.0636  -0.0031 -0.0538 199 LEU A CA    
479  C C     . LEU A 71  ? 0.3485 0.2280 0.3302 0.0592  -0.0049 -0.0608 199 LEU A C     
480  O O     . LEU A 71  ? 0.3109 0.1945 0.2886 0.0535  -0.0067 -0.0636 199 LEU A O     
481  C CB    . LEU A 71  ? 0.2970 0.2052 0.2845 0.0693  0.0006  -0.0554 199 LEU A CB    
482  C CG    . LEU A 71  ? 0.2694 0.1929 0.2642 0.0729  0.0018  -0.0490 199 LEU A CG    
483  C CD1   . LEU A 71  ? 0.2896 0.2291 0.2831 0.0776  0.0058  -0.0508 199 LEU A CD1   
484  C CD2   . LEU A 71  ? 0.2428 0.1697 0.2397 0.0659  -0.0017 -0.0448 199 LEU A CD2   
485  N N     . GLN A 72  ? 0.3887 0.2529 0.3689 0.0618  -0.0050 -0.0636 200 GLN A N     
486  C CA    . GLN A 72  ? 0.3871 0.2394 0.3601 0.0579  -0.0072 -0.0711 200 GLN A CA    
487  C C     . GLN A 72  ? 0.3769 0.2248 0.3511 0.0469  -0.0121 -0.0699 200 GLN A C     
488  O O     . GLN A 72  ? 0.4467 0.2895 0.4273 0.0429  -0.0137 -0.0638 200 GLN A O     
489  C CB    . GLN A 72  ? 0.4628 0.2974 0.4345 0.0626  -0.0067 -0.0741 200 GLN A CB    
490  C CG    . GLN A 72  ? 0.4849 0.3239 0.4549 0.0741  -0.0018 -0.0770 200 GLN A CG    
491  N N     . GLY A 73  ? 0.3993 0.2502 0.3678 0.0421  -0.0145 -0.0751 201 GLY A N     
492  C CA    . GLY A 73  ? 0.4138 0.2631 0.3849 0.0319  -0.0194 -0.0742 201 GLY A CA    
493  C C     . GLY A 73  ? 0.4047 0.2688 0.3810 0.0285  -0.0196 -0.0686 201 GLY A C     
494  O O     . GLY A 73  ? 0.4553 0.3208 0.4347 0.0206  -0.0235 -0.0679 201 GLY A O     
495  N N     . LEU A 74  ? 0.3257 0.2011 0.3038 0.0342  -0.0158 -0.0647 202 LEU A N     
496  C CA    . LEU A 74  ? 0.2757 0.1642 0.2575 0.0310  -0.0163 -0.0605 202 LEU A CA    
497  C C     . LEU A 74  ? 0.2564 0.1550 0.2326 0.0298  -0.0170 -0.0644 202 LEU A C     
498  O O     . LEU A 74  ? 0.2797 0.1814 0.2493 0.0348  -0.0147 -0.0681 202 LEU A O     
499  C CB    . LEU A 74  ? 0.2605 0.1576 0.2458 0.0368  -0.0129 -0.0553 202 LEU A CB    
500  C CG    . LEU A 74  ? 0.2783 0.1681 0.2695 0.0383  -0.0127 -0.0494 202 LEU A CG    
501  C CD1   . LEU A 74  ? 0.2715 0.1726 0.2655 0.0440  -0.0105 -0.0449 202 LEU A CD1   
502  C CD2   . LEU A 74  ? 0.2917 0.1757 0.2874 0.0307  -0.0157 -0.0457 202 LEU A CD2   
503  N N     . PRO A 75  ? 0.2292 0.1337 0.2078 0.0237  -0.0198 -0.0630 203 PRO A N     
504  C CA    . PRO A 75  ? 0.2358 0.1499 0.2090 0.0229  -0.0208 -0.0657 203 PRO A CA    
505  C C     . PRO A 75  ? 0.2393 0.1650 0.2102 0.0281  -0.0169 -0.0635 203 PRO A C     
506  O O     . PRO A 75  ? 0.2184 0.1478 0.1943 0.0301  -0.0147 -0.0590 203 PRO A O     
507  C CB    . PRO A 75  ? 0.2613 0.1790 0.2404 0.0159  -0.0248 -0.0637 203 PRO A CB    
508  C CG    . PRO A 75  ? 0.2543 0.1690 0.2417 0.0147  -0.0238 -0.0584 203 PRO A CG    
509  C CD    . PRO A 75  ? 0.2489 0.1521 0.2359 0.0180  -0.0220 -0.0584 203 PRO A CD    
510  N N     . HIS A 76  ? 0.2245 0.1557 0.1876 0.0302  -0.0163 -0.0667 204 HIS A N     
511  C CA    . HIS A 76  ? 0.2032 0.1460 0.1630 0.0341  -0.0130 -0.0649 204 HIS A CA    
512  C C     . HIS A 76  ? 0.2192 0.1641 0.1789 0.0414  -0.0079 -0.0646 204 HIS A C     
513  O O     . HIS A 76  ? 0.2346 0.1903 0.1933 0.0448  -0.0046 -0.0625 204 HIS A O     
514  C CB    . HIS A 76  ? 0.1921 0.1420 0.1572 0.0311  -0.0138 -0.0599 204 HIS A CB    
515  C CG    . HIS A 76  ? 0.2038 0.1533 0.1704 0.0251  -0.0183 -0.0600 204 HIS A CG    
516  N ND1   . HIS A 76  ? 0.2005 0.1534 0.1608 0.0238  -0.0209 -0.0623 204 HIS A ND1   
517  C CD2   . HIS A 76  ? 0.2345 0.1811 0.2084 0.0206  -0.0210 -0.0581 204 HIS A CD2   
518  C CE1   . HIS A 76  ? 0.2223 0.1753 0.1871 0.0188  -0.0252 -0.0620 204 HIS A CE1   
519  N NE2   . HIS A 76  ? 0.2432 0.1927 0.2166 0.0168  -0.0251 -0.0595 204 HIS A NE2   
520  N N     . PHE A 77  ? 0.2362 0.1716 0.1971 0.0442  -0.0071 -0.0666 205 PHE A N     
521  C CA    . PHE A 77  ? 0.2269 0.1648 0.1883 0.0523  -0.0022 -0.0667 205 PHE A CA    
522  C C     . PHE A 77  ? 0.2691 0.2021 0.2213 0.0561  -0.0007 -0.0730 205 PHE A C     
523  O O     . PHE A 77  ? 0.3701 0.2896 0.3205 0.0554  -0.0027 -0.0769 205 PHE A O     
524  C CB    . PHE A 77  ? 0.2296 0.1606 0.1991 0.0541  -0.0022 -0.0636 205 PHE A CB    
525  C CG    . PHE A 77  ? 0.1967 0.1365 0.1738 0.0540  -0.0020 -0.0573 205 PHE A CG    
526  C CD1   . PHE A 77  ? 0.1901 0.1422 0.1706 0.0602  0.0017  -0.0547 205 PHE A CD1   
527  C CD2   . PHE A 77  ? 0.2065 0.1436 0.1872 0.0476  -0.0055 -0.0543 205 PHE A CD2   
528  C CE1   . PHE A 77  ? 0.1831 0.1437 0.1702 0.0600  0.0011  -0.0495 205 PHE A CE1   
529  C CE2   . PHE A 77  ? 0.1962 0.1406 0.1823 0.0477  -0.0057 -0.0493 205 PHE A CE2   
530  C CZ    . PHE A 77  ? 0.1881 0.1446 0.1774 0.0526  -0.0027 -0.0462 205 PHE A CZ    
531  N N     . GLY A 78  ? 0.2385 0.1824 0.1849 0.0601  0.0029  -0.0738 206 GLY A N     
532  C CA    . GLY A 78  ? 0.2405 0.1820 0.1775 0.0653  0.0056  -0.0794 206 GLY A CA    
533  C C     . GLY A 78  ? 0.2756 0.2275 0.2153 0.0742  0.0125  -0.0774 206 GLY A C     
534  O O     . GLY A 78  ? 0.2662 0.2227 0.2163 0.0764  0.0140  -0.0726 206 GLY A O     
535  N N     . GLU A 79  ? 0.2893 0.2464 0.2200 0.0794  0.0166  -0.0807 207 GLU A N     
536  C CA    . GLU A 79  ? 0.2900 0.2574 0.2241 0.0885  0.0237  -0.0792 207 GLU A CA    
537  C C     . GLU A 79  ? 0.2782 0.2645 0.2225 0.0891  0.0271  -0.0709 207 GLU A C     
538  O O     . GLU A 79  ? 0.2879 0.2811 0.2426 0.0942  0.0302  -0.0673 207 GLU A O     
539  C CB    . GLU A 79  ? 0.3342 0.3052 0.2556 0.0937  0.0280  -0.0838 207 GLU A CB    
540  C CG    . GLU A 79  ? 0.3685 0.3503 0.2936 0.1038  0.0358  -0.0827 207 GLU A CG    
541  N N     . HIS A 80  ? 0.2625 0.2576 0.2044 0.0838  0.0262  -0.0676 208 HIS A N     
542  C CA    . HIS A 80  ? 0.2493 0.2637 0.2001 0.0841  0.0300  -0.0599 208 HIS A CA    
543  C C     . HIS A 80  ? 0.2487 0.2620 0.2121 0.0815  0.0264  -0.0559 208 HIS A C     
544  O O     . HIS A 80  ? 0.2328 0.2579 0.2077 0.0854  0.0294  -0.0510 208 HIS A O     
545  C CB    . HIS A 80  ? 0.2449 0.2676 0.1882 0.0793  0.0302  -0.0575 208 HIS A CB    
546  C CG    . HIS A 80  ? 0.2728 0.3177 0.2232 0.0800  0.0361  -0.0492 208 HIS A CG    
547  N ND1   . HIS A 80  ? 0.2681 0.3244 0.2109 0.0784  0.0398  -0.0455 208 HIS A ND1   
548  C CD2   . HIS A 80  ? 0.2753 0.3343 0.2407 0.0813  0.0387  -0.0428 208 HIS A CD2   
549  C CE1   . HIS A 80  ? 0.2812 0.3572 0.2351 0.0771  0.0445  -0.0365 208 HIS A CE1   
550  N NE2   . HIS A 80  ? 0.2659 0.3433 0.2346 0.0775  0.0430  -0.0343 208 HIS A NE2   
551  N N     . SER A 81  ? 0.2269 0.2274 0.1890 0.0748  0.0200  -0.0575 209 SER A N     
552  C CA    A SER A 81  ? 0.1924 0.1916 0.1650 0.0725  0.0166  -0.0537 209 SER A CA    
553  C CA    B SER A 81  ? 0.1864 0.1858 0.1591 0.0725  0.0167  -0.0536 209 SER A CA    
554  C C     . SER A 81  ? 0.2291 0.2217 0.2087 0.0772  0.0167  -0.0534 209 SER A C     
555  O O     . SER A 81  ? 0.2208 0.2197 0.2108 0.0789  0.0162  -0.0484 209 SER A O     
556  C CB    A SER A 81  ? 0.2173 0.2040 0.1868 0.0643  0.0102  -0.0552 209 SER A CB    
557  C CB    B SER A 81  ? 0.2175 0.2049 0.1873 0.0643  0.0103  -0.0549 209 SER A CB    
558  O OG    A SER A 81  ? 0.1863 0.1792 0.1503 0.0591  0.0097  -0.0537 209 SER A OG    
559  O OG    B SER A 81  ? 0.2489 0.2209 0.2128 0.0621  0.0073  -0.0599 209 SER A OG    
560  N N     . SER A 82  ? 0.2306 0.2105 0.2045 0.0798  0.0169  -0.0586 210 SER A N     
561  C CA    . SER A 82  ? 0.2593 0.2318 0.2391 0.0849  0.0172  -0.0583 210 SER A CA    
562  C C     . SER A 82  ? 0.2573 0.2463 0.2449 0.0933  0.0228  -0.0546 210 SER A C     
563  O O     . SER A 82  ? 0.2625 0.2534 0.2602 0.0970  0.0224  -0.0505 210 SER A O     
564  C CB    . SER A 82  ? 0.2876 0.2425 0.2592 0.0860  0.0164  -0.0653 210 SER A CB    
565  O OG    . SER A 82  ? 0.2843 0.2252 0.2521 0.0777  0.0108  -0.0675 210 SER A OG    
566  N N     . ARG A 83  ? 0.2530 0.2552 0.2367 0.0963  0.0281  -0.0553 211 ARG A N     
567  C CA    . ARG A 83  ? 0.2570 0.2782 0.2497 0.1036  0.0340  -0.0509 211 ARG A CA    
568  C C     . ARG A 83  ? 0.2353 0.2736 0.2419 0.1014  0.0331  -0.0423 211 ARG A C     
569  O O     . ARG A 83  ? 0.2453 0.2942 0.2641 0.1062  0.0344  -0.0375 211 ARG A O     
570  C CB    . ARG A 83  ? 0.2357 0.2687 0.2209 0.1059  0.0401  -0.0522 211 ARG A CB    
571  C CG    . ARG A 83  ? 0.2984 0.3530 0.2934 0.1130  0.0471  -0.0472 211 ARG A CG    
572  C CD    . ARG A 83  ? 0.3598 0.4289 0.3478 0.1131  0.0533  -0.0461 211 ARG A CD    
573  N N     . VAL A 84  ? 0.2086 0.2502 0.2139 0.0942  0.0304  -0.0403 212 VAL A N     
574  C CA    . VAL A 84  ? 0.2124 0.2685 0.2304 0.0900  0.0282  -0.0323 212 VAL A CA    
575  C C     . VAL A 84  ? 0.1963 0.2441 0.2218 0.0913  0.0231  -0.0302 212 VAL A C     
576  O O     . VAL A 84  ? 0.1953 0.2574 0.2338 0.0927  0.0226  -0.0235 212 VAL A O     
577  C CB    . VAL A 84  ? 0.2013 0.2539 0.2140 0.0774  0.0241  -0.0303 212 VAL A CB    
578  C CG1   . VAL A 84  ? 0.1995 0.2604 0.2232 0.0690  0.0195  -0.0221 212 VAL A CG1   
579  C CG2   . VAL A 84  ? 0.2300 0.2922 0.2356 0.0763  0.0290  -0.0305 212 VAL A CG2   
580  N N     . VAL A 85  ? 0.1844 0.2100 0.2022 0.0900  0.0189  -0.0352 213 VAL A N     
581  C CA    . VAL A 85  ? 0.1820 0.1982 0.2053 0.0910  0.0143  -0.0325 213 VAL A CA    
582  C C     . VAL A 85  ? 0.1981 0.2168 0.2280 0.0992  0.0169  -0.0308 213 VAL A C     
583  O O     . VAL A 85  ? 0.2202 0.2458 0.2603 0.1016  0.0146  -0.0247 213 VAL A O     
584  C CB    . VAL A 85  ? 0.2066 0.1988 0.2207 0.0859  0.0102  -0.0369 213 VAL A CB    
585  C CG1   . VAL A 85  ? 0.2198 0.2008 0.2382 0.0875  0.0068  -0.0335 213 VAL A CG1   
586  C CG2   . VAL A 85  ? 0.2171 0.2085 0.2278 0.0751  0.0067  -0.0356 213 VAL A CG2   
587  N N     . GLN A 86  ? 0.1937 0.2070 0.2176 0.1037  0.0214  -0.0363 214 GLN A N     
588  C CA    . GLN A 86  ? 0.2020 0.2166 0.2316 0.1126  0.0242  -0.0359 214 GLN A CA    
589  C C     . GLN A 86  ? 0.2232 0.2635 0.2673 0.1163  0.0264  -0.0284 214 GLN A C     
590  O O     . GLN A 86  ? 0.2311 0.2745 0.2850 0.1210  0.0248  -0.0240 214 GLN A O     
591  C CB    . GLN A 86  ? 0.2424 0.2506 0.2623 0.1170  0.0292  -0.0435 214 GLN A CB    
592  C CG    . GLN A 86  ? 0.2888 0.2989 0.3141 0.1275  0.0330  -0.0441 214 GLN A CG    
593  C CD    . GLN A 86  ? 0.3970 0.4037 0.4117 0.1325  0.0384  -0.0517 214 GLN A CD    
594  O OE1   . GLN A 86  ? 0.4345 0.4347 0.4370 0.1277  0.0384  -0.0568 214 GLN A OE1   
595  N NE2   . GLN A 86  ? 0.4209 0.4325 0.4401 0.1425  0.0428  -0.0523 214 GLN A NE2   
596  N N     . GLU A 87  ? 0.2178 0.2775 0.2641 0.1137  0.0298  -0.0262 215 GLU A N     
597  C CA    . GLU A 87  ? 0.2168 0.3032 0.2784 0.1154  0.0319  -0.0183 215 GLU A CA    
598  C C     . GLU A 87  ? 0.2034 0.2970 0.2761 0.1109  0.0250  -0.0109 215 GLU A C     
599  O O     . GLU A 87  ? 0.2114 0.3189 0.2973 0.1138  0.0238  -0.0049 215 GLU A O     
600  C CB    . GLU A 87  ? 0.2413 0.3460 0.3025 0.1119  0.0372  -0.0166 215 GLU A CB    
601  C CG    . GLU A 87  ? 0.2840 0.3867 0.3357 0.1179  0.0445  -0.0224 215 GLU A CG    
602  C CD    . GLU A 87  ? 0.3622 0.4835 0.4127 0.1145  0.0502  -0.0194 215 GLU A CD    
603  O OE1   . GLU A 87  ? 0.3484 0.4895 0.4105 0.1082  0.0497  -0.0112 215 GLU A OE1   
604  O OE2   . GLU A 87  ? 0.4180 0.5338 0.4557 0.1177  0.0551  -0.0250 215 GLU A OE2   
605  N N     . LEU A 88  ? 0.1730 0.2576 0.2401 0.1038  0.0200  -0.0113 216 LEU A N     
606  C CA    . LEU A 88  ? 0.1546 0.2434 0.2293 0.0990  0.0126  -0.0048 216 LEU A CA    
607  C C     . LEU A 88  ? 0.1992 0.2762 0.2758 0.1050  0.0091  -0.0035 216 LEU A C     
608  O O     . LEU A 88  ? 0.2144 0.3027 0.3014 0.1049  0.0045  0.0034  216 LEU A O     
609  C CB    . LEU A 88  ? 0.1543 0.2286 0.2183 0.0862  0.0079  -0.0063 216 LEU A CB    
610  C CG    . LEU A 88  ? 0.1812 0.2675 0.2449 0.0774  0.0096  -0.0049 216 LEU A CG    
611  C CD1   . LEU A 88  ? 0.1777 0.2466 0.2283 0.0684  0.0070  -0.0088 216 LEU A CD1   
612  C CD2   . LEU A 88  ? 0.2158 0.3221 0.2926 0.0710  0.0058  0.0034  216 LEU A CD2   
613  N N     . LEU A 89  ? 0.2085 0.2625 0.2750 0.1086  0.0105  -0.0096 217 LEU A N     
614  C CA    . LEU A 89  ? 0.2201 0.2612 0.2883 0.1130  0.0073  -0.0076 217 LEU A CA    
615  C C     . LEU A 89  ? 0.2504 0.3045 0.3299 0.1215  0.0098  -0.0047 217 LEU A C     
616  O O     . LEU A 89  ? 0.3077 0.3632 0.3945 0.1245  0.0056  0.0008  217 LEU A O     
617  C CB    . LEU A 89  ? 0.2646 0.2783 0.3206 0.1133  0.0081  -0.0144 217 LEU A CB    
618  C CG    . LEU A 89  ? 0.2673 0.2656 0.3127 0.1049  0.0049  -0.0171 217 LEU A CG    
619  C CD1   . LEU A 89  ? 0.2626 0.2376 0.2983 0.1043  0.0062  -0.0238 217 LEU A CD1   
620  C CD2   . LEU A 89  ? 0.2529 0.2488 0.3003 0.1016  -0.0014 -0.0103 217 LEU A CD2   
621  N N     . GLU A 90  ? 0.2260 0.2897 0.3065 0.1256  0.0165  -0.0082 218 GLU A N     
622  C CA    . GLU A 90  ? 0.2447 0.3195 0.3350 0.1348  0.0199  -0.0067 218 GLU A CA    
623  C C     . GLU A 90  ? 0.3147 0.4193 0.4212 0.1337  0.0190  0.0015  218 GLU A C     
624  O O     . GLU A 90  ? 0.3282 0.4420 0.4459 0.1398  0.0178  0.0057  218 GLU A O     
625  C CB    . GLU A 90  ? 0.2820 0.3541 0.3652 0.1402  0.0278  -0.0140 218 GLU A CB    
626  N N     . HIS A 91  ? 0.3037 0.4238 0.4124 0.1256  0.0193  0.0040  219 HIS A N     
627  C CA    . HIS A 91  ? 0.2893 0.4385 0.4139 0.1226  0.0189  0.0117  219 HIS A CA    
628  C C     . HIS A 91  ? 0.2727 0.4308 0.4020 0.1116  0.0113  0.0175  219 HIS A C     
629  O O     . HIS A 91  ? 0.3141 0.4953 0.4573 0.1070  0.0092  0.0242  219 HIS A O     
630  C CB    . HIS A 91  ? 0.3237 0.4883 0.4492 0.1227  0.0275  0.0105  219 HIS A CB    
631  C CG    . HIS A 91  ? 0.3735 0.5314 0.4937 0.1336  0.0349  0.0046  219 HIS A CG    
632  N ND1   . HIS A 91  ? 0.3911 0.5349 0.4956 0.1351  0.0404  -0.0033 219 HIS A ND1   
633  C CD2   . HIS A 91  ? 0.3749 0.5377 0.5027 0.1437  0.0373  0.0050  219 HIS A CD2   
634  C CE1   . HIS A 91  ? 0.3989 0.5388 0.5011 0.1454  0.0457  -0.0077 219 HIS A CE1   
635  N NE2   . HIS A 91  ? 0.4339 0.5852 0.5504 0.1511  0.0443  -0.0027 219 HIS A NE2   
636  N N     . GLY A 92  ? 0.2467 0.3873 0.3649 0.1066  0.0069  0.0152  220 GLY A N     
637  C CA    . GLY A 92  ? 0.2488 0.3959 0.3692 0.0962  -0.0005 0.0198  220 GLY A CA    
638  C C     . GLY A 92  ? 0.2437 0.4036 0.3654 0.0876  0.0018  0.0206  220 GLY A C     
639  O O     . GLY A 92  ? 0.2334 0.3931 0.3540 0.0752  -0.0048 0.0232  220 GLY A O     
640  N N     . VAL A 93  ? 0.2566 0.4200 0.3757 0.0906  0.0106  0.0172  221 VAL A N     
641  C CA    . VAL A 93  ? 0.2635 0.4392 0.3837 0.0819  0.0137  0.0191  221 VAL A CA    
642  C C     . VAL A 93  ? 0.2519 0.4204 0.3606 0.0884  0.0230  0.0124  221 VAL A C     
643  O O     . VAL A 93  ? 0.2460 0.4068 0.3507 0.0981  0.0275  0.0079  221 VAL A O     
644  C CB    . VAL A 93  ? 0.2907 0.4952 0.4296 0.0780  0.0140  0.0277  221 VAL A CB    
645  C CG1   . VAL A 93  ? 0.3017 0.5131 0.4456 0.0889  0.0206  0.0270  221 VAL A CG1   
646  C CG2   . VAL A 93  ? 0.3146 0.5326 0.4562 0.0681  0.0171  0.0314  221 VAL A CG2   
647  N N     . CYS A 94  ? 0.1915 0.3539 0.2901 0.0792  0.0242  0.0108  222 CYS A N     
648  C CA    . CYS A 94  ? 0.1848 0.3425 0.2713 0.0837  0.0322  0.0051  222 CYS A CA    
649  C C     . CYS A 94  ? 0.2000 0.3806 0.2934 0.0784  0.0376  0.0117  222 CYS A C     
650  O O     . CYS A 94  ? 0.1896 0.3729 0.2853 0.0654  0.0333  0.0169  222 CYS A O     
651  C CB    . CYS A 94  ? 0.1861 0.3174 0.2541 0.0778  0.0289  -0.0017 222 CYS A CB    
652  S SG    . CYS A 94  ? 0.2389 0.3661 0.2910 0.0806  0.0367  -0.0076 222 CYS A SG    
653  N N     . GLU A 95  ? 0.1673 0.3592 0.2614 0.0865  0.0462  0.0114  223 GLU A N     
654  C CA    . GLU A 95  ? 0.1690 0.3836 0.2710 0.0810  0.0515  0.0193  223 GLU A CA    
655  C C     . GLU A 95  ? 0.1589 0.3717 0.2510 0.0728  0.0532  0.0204  223 GLU A C     
656  O O     . GLU A 95  ? 0.1618 0.3883 0.2628 0.0615  0.0522  0.0292  223 GLU A O     
657  C CB    . GLU A 95  ? 0.2123 0.4337 0.3123 0.0907  0.0600  0.0176  223 GLU A CB    
658  C CG    . GLU A 95  ? 0.2865 0.5328 0.3963 0.0856  0.0657  0.0269  223 GLU A CG    
659  N N     . GLU A 96  ? 0.1580 0.3484 0.2300 0.0760  0.0538  0.0113  224 GLU A N     
660  C CA    . GLU A 96  ? 0.1675 0.3486 0.2265 0.0665  0.0529  0.0118  224 GLU A CA    
661  C C     . GLU A 96  ? 0.1578 0.3305 0.2208 0.0521  0.0432  0.0163  224 GLU A C     
662  O O     . GLU A 96  ? 0.1654 0.3429 0.2289 0.0420  0.0428  0.0228  224 GLU A O     
663  C CB    . GLU A 96  ? 0.1775 0.3350 0.2151 0.0719  0.0529  0.0009  224 GLU A CB    
664  C CG    . GLU A 96  ? 0.2238 0.3743 0.2484 0.0635  0.0523  0.0022  224 GLU A CG    
665  C CD    . GLU A 96  ? 0.2813 0.4090 0.2864 0.0667  0.0500  -0.0081 224 GLU A CD    
666  O OE1   . GLU A 96  ? 0.2865 0.4011 0.2883 0.0739  0.0481  -0.0164 224 GLU A OE1   
667  O OE2   . GLU A 96  ? 0.3039 0.4268 0.2974 0.0617  0.0497  -0.0073 224 GLU A OE2   
668  N N     . VAL A 97  ? 0.1260 0.2850 0.1908 0.0514  0.0354  0.0129  225 VAL A N     
669  C CA    . VAL A 97  ? 0.1188 0.2686 0.1854 0.0391  0.0262  0.0159  225 VAL A CA    
670  C C     . VAL A 97  ? 0.1185 0.2889 0.2022 0.0307  0.0245  0.0259  225 VAL A C     
671  O O     . VAL A 97  ? 0.1126 0.2800 0.1962 0.0190  0.0202  0.0304  225 VAL A O     
672  C CB    . VAL A 97  ? 0.1391 0.2728 0.2040 0.0415  0.0194  0.0107  225 VAL A CB    
673  C CG1   . VAL A 97  ? 0.1317 0.2577 0.1982 0.0303  0.0102  0.0135  225 VAL A CG1   
674  C CG2   . VAL A 97  ? 0.1338 0.2461 0.1826 0.0473  0.0202  0.0014  225 VAL A CG2   
675  N N     . GLU A 98  ? 0.1600 0.3515 0.2595 0.0364  0.0272  0.0298  226 GLU A N     
676  C CA    . GLU A 98  ? 0.1688 0.3821 0.2869 0.0275  0.0246  0.0398  226 GLU A CA    
677  C C     . GLU A 98  ? 0.1487 0.3765 0.2695 0.0212  0.0310  0.0470  226 GLU A C     
678  O O     . GLU A 98  ? 0.1722 0.4060 0.3015 0.0080  0.0263  0.0546  226 GLU A O     
679  C CB    . GLU A 98  ? 0.1639 0.3987 0.2997 0.0361  0.0260  0.0427  226 GLU A CB    
680  C CG    . GLU A 98  ? 0.1891 0.4100 0.3234 0.0408  0.0183  0.0377  226 GLU A CG    
681  C CD    . GLU A 98  ? 0.2670 0.4729 0.3973 0.0281  0.0069  0.0380  226 GLU A CD    
682  O OE1   . GLU A 98  ? 0.2992 0.5182 0.4415 0.0171  0.0019  0.0451  226 GLU A OE1   
683  O OE2   . GLU A 98  ? 0.2911 0.4722 0.4063 0.0290  0.0030  0.0310  226 GLU A OE2   
684  N N     . ARG A 99  ? 0.1555 0.3871 0.2675 0.0300  0.0413  0.0448  227 ARG A N     
685  C CA    . ARG A 99  ? 0.1674 0.4112 0.2785 0.0246  0.0482  0.0521  227 ARG A CA    
686  C C     . ARG A 99  ? 0.1739 0.3972 0.2728 0.0123  0.0423  0.0529  227 ARG A C     
687  O O     . ARG A 99  ? 0.1850 0.4169 0.2909 0.0008  0.0417  0.0624  227 ARG A O     
688  C CB    . ARG A 99  ? 0.1950 0.4433 0.2945 0.0382  0.0597  0.0475  227 ARG A CB    
689  C CG    . ARG A 99  ? 0.2647 0.5250 0.3601 0.0346  0.0678  0.0548  227 ARG A CG    
690  C CD    . ARG A 99  ? 0.2758 0.5377 0.3602 0.0481  0.0768  0.0493  227 ARG A CD    
691  N NE    . ARG A 99  ? 0.3274 0.5682 0.3898 0.0573  0.0777  0.0375  227 ARG A NE    
692  C CZ    . ARG A 99  ? 0.3628 0.5913 0.4198 0.0687  0.0769  0.0269  227 ARG A CZ    
693  N NH1   . ARG A 99  ? 0.3492 0.5848 0.4205 0.0737  0.0757  0.0268  227 ARG A NH1   
694  N NH2   . ARG A 99  ? 0.3770 0.5845 0.4136 0.0745  0.0764  0.0165  227 ARG A NH2   
695  N N     . VAL A 100 ? 0.1336 0.3298 0.2153 0.0145  0.0375  0.0435  228 VAL A N     
696  C CA    . VAL A 100 ? 0.1477 0.3237 0.2187 0.0042  0.0311  0.0439  228 VAL A CA    
697  C C     . VAL A 100 ? 0.1288 0.3038 0.2116 -0.0082 0.0218  0.0491  228 VAL A C     
698  O O     . VAL A 100 ? 0.1736 0.3463 0.2572 -0.0194 0.0193  0.0558  228 VAL A O     
699  C CB    . VAL A 100 ? 0.1728 0.3228 0.2263 0.0095  0.0275  0.0329  228 VAL A CB    
700  C CG1   . VAL A 100 ? 0.1918 0.3222 0.2366 -0.0001 0.0204  0.0334  228 VAL A CG1   
701  C CG2   . VAL A 100 ? 0.1865 0.3351 0.2264 0.0196  0.0351  0.0276  228 VAL A CG2   
702  N N     . ARG A 101 ? 0.1815 0.3565 0.2722 -0.0064 0.0161  0.0460  229 ARG A N     
703  C CA    . ARG A 101 ? 0.2071 0.3773 0.3051 -0.0174 0.0057  0.0486  229 ARG A CA    
704  C C     . ARG A 101 ? 0.2328 0.4213 0.3465 -0.0291 0.0049  0.0597  229 ARG A C     
705  O O     . ARG A 101 ? 0.3041 0.4819 0.4177 -0.0412 -0.0030 0.0624  229 ARG A O     
706  C CB    . ARG A 101 ? 0.2221 0.3962 0.3280 -0.0122 0.0009  0.0452  229 ARG A CB    
707  C CG    . ARG A 101 ? 0.2555 0.4070 0.3477 -0.0063 -0.0031 0.0358  229 ARG A CG    
708  C CD    . ARG A 101 ? 0.2499 0.4067 0.3515 -0.0052 -0.0099 0.0358  229 ARG A CD    
709  N NE    . ARG A 101 ? 0.3130 0.4593 0.4074 0.0057  -0.0094 0.0289  229 ARG A NE    
710  C CZ    . ARG A 101 ? 0.3441 0.4687 0.4256 0.0055  -0.0144 0.0231  229 ARG A CZ    
711  N NH1   . ARG A 101 ? 0.3299 0.4405 0.4034 -0.0037 -0.0200 0.0224  229 ARG A NH1   
712  N NH2   . ARG A 101 ? 0.3448 0.4614 0.4214 0.0148  -0.0133 0.0183  229 ARG A NH2   
713  N N     A ARG A 102 ? 0.1925 0.4088 0.3204 -0.0258 0.0129  0.0664  230 ARG A N     
714  N N     B ARG A 102 ? 0.1962 0.4126 0.3242 -0.0259 0.0129  0.0664  230 ARG A N     
715  C CA    A ARG A 102 ? 0.2010 0.4388 0.3474 -0.0376 0.0125  0.0783  230 ARG A CA    
716  C CA    B ARG A 102 ? 0.2051 0.4428 0.3513 -0.0377 0.0125  0.0783  230 ARG A CA    
717  C C     A ARG A 102 ? 0.2307 0.4733 0.3732 -0.0422 0.0205  0.0858  230 ARG A C     
718  C C     B ARG A 102 ? 0.2285 0.4703 0.3704 -0.0422 0.0204  0.0856  230 ARG A C     
719  O O     A ARG A 102 ? 0.2512 0.5125 0.4088 -0.0518 0.0218  0.0968  230 ARG A O     
720  O O     B ARG A 102 ? 0.2509 0.5111 0.4077 -0.0522 0.0217  0.0968  230 ARG A O     
721  C CB    A ARG A 102 ? 0.2252 0.4950 0.3933 -0.0321 0.0162  0.0830  230 ARG A CB    
722  C CB    B ARG A 102 ? 0.2207 0.4909 0.3890 -0.0323 0.0163  0.0832  230 ARG A CB    
723  C CG    A ARG A 102 ? 0.2204 0.5027 0.3852 -0.0167 0.0292  0.0810  230 ARG A CG    
724  C CG    B ARG A 102 ? 0.2212 0.5030 0.3859 -0.0161 0.0290  0.0805  230 ARG A CG    
725  C CD    A ARG A 102 ? 0.2414 0.5429 0.4207 -0.0099 0.0312  0.0829  230 ARG A CD    
726  C CD    B ARG A 102 ? 0.2293 0.5277 0.4073 -0.0079 0.0299  0.0807  230 ARG A CD    
727  N NE    A ARG A 102 ? 0.2275 0.5344 0.4001 0.0066  0.0423  0.0782  230 ARG A NE    
728  N NE    B ARG A 102 ? 0.2263 0.5295 0.3976 0.0087  0.0409  0.0757  230 ARG A NE    
729  C CZ    A ARG A 102 ? 0.2072 0.5106 0.3779 0.0201  0.0430  0.0706  230 ARG A CZ    
730  C CZ    B ARG A 102 ? 0.2154 0.5272 0.3819 0.0124  0.0513  0.0785  230 ARG A CZ    
731  N NH1   A ARG A 102 ? 0.1741 0.4713 0.3499 0.0198  0.0336  0.0676  230 ARG A NH1   
732  N NH1   B ARG A 102 ? 0.2169 0.5347 0.3858 0.0007  0.0526  0.0873  230 ARG A NH1   
733  N NH2   A ARG A 102 ? 0.2504 0.5549 0.4126 0.0339  0.0526  0.0658  230 ARG A NH2   
734  N NH2   B ARG A 102 ? 0.2226 0.5349 0.3806 0.0277  0.0598  0.0723  230 ARG A NH2   
735  N N     A SER A 103 ? 0.1541 0.3797 0.2762 -0.0358 0.0253  0.0805  231 SER A N     
736  N N     B SER A 103 ? 0.1582 0.3831 0.2796 -0.0354 0.0253  0.0801  231 SER A N     
737  C CA    A SER A 103 ? 0.1656 0.3948 0.2815 -0.0395 0.0325  0.0879  231 SER A CA    
738  C CA    B SER A 103 ? 0.1641 0.3903 0.2781 -0.0393 0.0320  0.0871  231 SER A CA    
739  C C     A SER A 103 ? 0.1857 0.3976 0.2990 -0.0549 0.0246  0.0936  231 SER A C     
740  C C     B SER A 103 ? 0.1822 0.3943 0.2966 -0.0555 0.0240  0.0938  231 SER A C     
741  O O     A SER A 103 ? 0.1863 0.3730 0.2911 -0.0583 0.0148  0.0870  231 SER A O     
742  O O     B SER A 103 ? 0.1814 0.3703 0.2898 -0.0603 0.0135  0.0881  231 SER A O     
743  C CB    A SER A 103 ? 0.1684 0.3852 0.2625 -0.0273 0.0392  0.0801  231 SER A CB    
744  C CB    B SER A 103 ? 0.1737 0.3823 0.2644 -0.0285 0.0365  0.0783  231 SER A CB    
745  O OG    A SER A 103 ? 0.1424 0.3286 0.2198 -0.0285 0.0316  0.0724  231 SER A OG    
746  O OG    B SER A 103 ? 0.1907 0.3923 0.2702 -0.0338 0.0393  0.0842  231 SER A OG    
747  N N     . GLU A 104 ? 0.1816 0.3195 0.3238 0.0233  0.0951  -0.0015 232 GLU A N     
748  C CA    . GLU A 104 ? 0.1741 0.3099 0.3186 0.0133  0.0982  0.0031  232 GLU A CA    
749  C C     . GLU A 104 ? 0.1721 0.2879 0.2934 0.0115  0.0953  0.0095  232 GLU A C     
750  O O     . GLU A 104 ? 0.1825 0.2921 0.3030 0.0065  0.0908  0.0128  232 GLU A O     
751  C CB    . GLU A 104 ? 0.2032 0.3475 0.3540 0.0072  0.1114  0.0030  232 GLU A CB    
752  C CG    . GLU A 104 ? 0.2331 0.3736 0.3863 -0.0037 0.1136  0.0066  232 GLU A CG    
753  C CD    . GLU A 104 ? 0.3119 0.4568 0.4661 -0.0105 0.1246  0.0066  232 GLU A CD    
754  O OE1   . GLU A 104 ? 0.3644 0.5130 0.5130 -0.0067 0.1311  0.0052  232 GLU A OE1   
755  O OE2   . GLU A 104 ? 0.3046 0.4485 0.4647 -0.0196 0.1269  0.0078  232 GLU A OE2   
756  N N     . ARG A 105 ? 0.1879 0.2945 0.2906 0.0161  0.0973  0.0104  233 ARG A N     
757  C CA    . ARG A 105 ? 0.2075 0.2983 0.2886 0.0157  0.0939  0.0148  233 ARG A CA    
758  C C     . ARG A 105 ? 0.1924 0.2771 0.2723 0.0163  0.0815  0.0142  233 ARG A C     
759  O O     . ARG A 105 ? 0.1826 0.2601 0.2567 0.0126  0.0776  0.0179  233 ARG A O     
760  C CB    . ARG A 105 ? 0.2241 0.3095 0.2878 0.0213  0.0973  0.0133  233 ARG A CB    
761  C CG    . ARG A 105 ? 0.2660 0.3384 0.3085 0.0228  0.0916  0.0149  233 ARG A CG    
762  C CD    . ARG A 105 ? 0.2724 0.3377 0.3020 0.0199  0.0957  0.0213  233 ARG A CD    
763  N NE    . ARG A 105 ? 0.2568 0.3131 0.2673 0.0229  0.0891  0.0212  233 ARG A NE    
764  C CZ    . ARG A 105 ? 0.2737 0.3222 0.2682 0.0235  0.0901  0.0261  233 ARG A CZ    
765  N NH1   . ARG A 105 ? 0.3056 0.3505 0.2987 0.0206  0.0986  0.0325  233 ARG A NH1   
766  N NH2   . ARG A 105 ? 0.2683 0.3122 0.2476 0.0272  0.0829  0.0241  233 ARG A NH2   
767  N N     . TYR A 106 ? 0.1690 0.2555 0.2532 0.0213  0.0758  0.0096  234 TYR A N     
768  C CA    . TYR A 106 ? 0.1489 0.2281 0.2302 0.0216  0.0654  0.0092  234 TYR A CA    
769  C C     . TYR A 106 ? 0.1348 0.2186 0.2287 0.0170  0.0612  0.0111  234 TYR A C     
770  O O     . TYR A 106 ? 0.1440 0.2208 0.2319 0.0138  0.0558  0.0133  234 TYR A O     
771  C CB    . TYR A 106 ? 0.1709 0.2486 0.2533 0.0283  0.0615  0.0046  234 TYR A CB    
772  C CG    . TYR A 106 ? 0.1679 0.2372 0.2472 0.0283  0.0523  0.0046  234 TYR A CG    
773  C CD1   . TYR A 106 ? 0.1866 0.2431 0.2505 0.0270  0.0493  0.0042  234 TYR A CD1   
774  C CD2   . TYR A 106 ? 0.1756 0.2507 0.2673 0.0294  0.0472  0.0043  234 TYR A CD2   
775  C CE1   . TYR A 106 ? 0.1746 0.2230 0.2352 0.0260  0.0425  0.0042  234 TYR A CE1   
776  C CE2   . TYR A 106 ? 0.1758 0.2421 0.2624 0.0296  0.0396  0.0048  234 TYR A CE2   
777  C CZ    . TYR A 106 ? 0.1993 0.2517 0.2702 0.0275  0.0379  0.0050  234 TYR A CZ    
778  O OH    . TYR A 106 ? 0.2384 0.2817 0.3038 0.0269  0.0319  0.0055  234 TYR A OH    
779  N N     . GLN A 107 ? 0.1429 0.2400 0.2552 0.0165  0.0634  0.0090  235 GLN A N     
780  C CA    . GLN A 107 ? 0.1413 0.2442 0.2668 0.0125  0.0586  0.0090  235 GLN A CA    
781  C C     . GLN A 107 ? 0.1486 0.2460 0.2705 0.0047  0.0616  0.0135  235 GLN A C     
782  O O     . GLN A 107 ? 0.1394 0.2330 0.2619 0.0018  0.0553  0.0146  235 GLN A O     
783  C CB    . GLN A 107 ? 0.1568 0.2783 0.3044 0.0135  0.0608  0.0040  235 GLN A CB    
784  C CG    . GLN A 107 ? 0.2042 0.3302 0.3552 0.0233  0.0550  -0.0005 235 GLN A CG    
785  C CD    . GLN A 107 ? 0.2839 0.4316 0.4580 0.0260  0.0562  -0.0068 235 GLN A CD    
786  O OE1   . GLN A 107 ? 0.3223 0.4759 0.4995 0.0352  0.0551  -0.0109 235 GLN A OE1   
787  N NE2   . GLN A 107 ? 0.2674 0.4274 0.4580 0.0183  0.0584  -0.0084 235 GLN A NE2   
788  N N     . THR A 108 ? 0.1499 0.2448 0.2660 0.0020  0.0714  0.0165  236 THR A N     
789  C CA    . THR A 108 ? 0.1280 0.2142 0.2379 -0.0042 0.0750  0.0216  236 THR A CA    
790  C C     . THR A 108 ? 0.1410 0.2132 0.2311 -0.0020 0.0692  0.0250  236 THR A C     
791  O O     . THR A 108 ? 0.1514 0.2169 0.2390 -0.0051 0.0659  0.0275  236 THR A O     
792  C CB    . THR A 108 ? 0.1588 0.2443 0.2655 -0.0071 0.0882  0.0244  236 THR A CB    
793  O OG1   . THR A 108 ? 0.1778 0.2797 0.3059 -0.0098 0.0941  0.0197  236 THR A OG1   
794  C CG2   . THR A 108 ? 0.1656 0.2389 0.2648 -0.0130 0.0925  0.0301  236 THR A CG2   
795  N N     . MET A 109 ? 0.1543 0.2226 0.2307 0.0034  0.0681  0.0242  237 MET A N     
796  C CA    . MET A 109 ? 0.1561 0.2146 0.2157 0.0054  0.0622  0.0254  237 MET A CA    
797  C C     . MET A 109 ? 0.1447 0.2031 0.2094 0.0045  0.0524  0.0233  237 MET A C     
798  O O     . MET A 109 ? 0.1552 0.2081 0.2133 0.0035  0.0479  0.0249  237 MET A O     
799  C CB    . MET A 109 ? 0.1427 0.1992 0.1893 0.0105  0.0628  0.0228  237 MET A CB    
800  C CG    . MET A 109 ? 0.1831 0.2377 0.2187 0.0124  0.0720  0.0253  237 MET A CG    
801  S SD    . MET A 109 ? 0.1940 0.2376 0.2112 0.0128  0.0734  0.0316  237 MET A SD    
802  C CE    . MET A 109 ? 0.1914 0.2330 0.1944 0.0175  0.0631  0.0270  237 MET A CE    
803  N N     . LYS A 110 ? 0.1263 0.1905 0.2017 0.0058  0.0491  0.0197  238 LYS A N     
804  C CA    . LYS A 110 ? 0.1275 0.1907 0.2064 0.0051  0.0407  0.0182  238 LYS A CA    
805  C C     . LYS A 110 ? 0.1379 0.2028 0.2252 0.0006  0.0390  0.0201  238 LYS A C     
806  O O     . LYS A 110 ? 0.1524 0.2127 0.2351 -0.0008 0.0337  0.0206  238 LYS A O     
807  C CB    . LYS A 110 ? 0.1256 0.1933 0.2126 0.0088  0.0380  0.0148  238 LYS A CB    
808  C CG    . LYS A 110 ? 0.1766 0.2406 0.2629 0.0090  0.0298  0.0137  238 LYS A CG    
809  C CD    . LYS A 110 ? 0.2582 0.3211 0.3452 0.0148  0.0272  0.0111  238 LYS A CD    
810  C CE    . LYS A 110 ? 0.2871 0.3428 0.3686 0.0151  0.0203  0.0109  238 LYS A CE    
811  N NZ    . LYS A 110 ? 0.2873 0.3324 0.3547 0.0116  0.0199  0.0111  238 LYS A NZ    
812  N N     . LEU A 111 ? 0.1335 0.2055 0.2338 -0.0022 0.0441  0.0203  239 LEU A N     
813  C CA    . LEU A 111 ? 0.1508 0.2237 0.2602 -0.0076 0.0434  0.0210  239 LEU A CA    
814  C C     . LEU A 111 ? 0.1770 0.2380 0.2733 -0.0095 0.0448  0.0254  239 LEU A C     
815  O O     . LEU A 111 ? 0.1770 0.2342 0.2734 -0.0114 0.0397  0.0255  239 LEU A O     
816  C CB    . LEU A 111 ? 0.1470 0.2298 0.2727 -0.0115 0.0508  0.0194  239 LEU A CB    
817  C CG    . LEU A 111 ? 0.1652 0.2477 0.3006 -0.0188 0.0525  0.0194  239 LEU A CG    
818  C CD1   . LEU A 111 ? 0.1953 0.2834 0.3399 -0.0187 0.0424  0.0153  239 LEU A CD1   
819  C CD2   . LEU A 111 ? 0.1958 0.2879 0.3466 -0.0243 0.0625  0.0175  239 LEU A CD2   
820  N N     . PHE A 112 ? 0.1205 0.1752 0.2047 -0.0082 0.0515  0.0289  240 PHE A N     
821  C CA    . PHE A 112 ? 0.1307 0.1732 0.2007 -0.0081 0.0529  0.0335  240 PHE A CA    
822  C C     . PHE A 112 ? 0.1309 0.1700 0.1891 -0.0038 0.0443  0.0325  240 PHE A C     
823  O O     . PHE A 112 ? 0.1399 0.1727 0.1935 -0.0038 0.0409  0.0338  240 PHE A O     
824  C CB    . PHE A 112 ? 0.1410 0.1773 0.1986 -0.0065 0.0625  0.0378  240 PHE A CB    
825  C CG    . PHE A 112 ? 0.1545 0.1914 0.2218 -0.0125 0.0734  0.0396  240 PHE A CG    
826  C CD1   . PHE A 112 ? 0.1765 0.2189 0.2626 -0.0193 0.0738  0.0371  240 PHE A CD1   
827  C CD2   . PHE A 112 ? 0.1709 0.2032 0.2277 -0.0116 0.0837  0.0433  240 PHE A CD2   
828  C CE1   . PHE A 112 ? 0.1788 0.2232 0.2755 -0.0262 0.0849  0.0375  240 PHE A CE1   
829  C CE2   . PHE A 112 ? 0.1756 0.2083 0.2411 -0.0183 0.0956  0.0447  240 PHE A CE2   
830  C CZ    . PHE A 112 ? 0.1729 0.2121 0.2592 -0.0261 0.0963  0.0416  240 PHE A CZ    
831  N N     . THR A 113 ? 0.1350 0.1780 0.1885 -0.0003 0.0411  0.0293  241 THR A N     
832  C CA    . THR A 113 ? 0.1427 0.1840 0.1862 0.0024  0.0341  0.0271  241 THR A CA    
833  C C     . THR A 113 ? 0.1458 0.1894 0.1973 0.0000  0.0272  0.0246  241 THR A C     
834  O O     . THR A 113 ? 0.1678 0.2103 0.2129 0.0011  0.0221  0.0229  241 THR A O     
835  C CB    . THR A 113 ? 0.1525 0.1965 0.1894 0.0052  0.0334  0.0233  241 THR A CB    
836  O OG1   . THR A 113 ? 0.1317 0.1796 0.1785 0.0041  0.0334  0.0207  241 THR A OG1   
837  C CG2   . THR A 113 ? 0.1590 0.2006 0.1843 0.0087  0.0394  0.0251  241 THR A CG2   
838  N N     . GLN A 114 ? 0.1882 0.2359 0.2531 -0.0028 0.0267  0.0237  242 GLN A N     
839  C CA    . GLN A 114 ? 0.1836 0.2329 0.2546 -0.0046 0.0205  0.0216  242 GLN A CA    
840  C C     . GLN A 114 ? 0.2109 0.2560 0.2821 -0.0064 0.0193  0.0233  242 GLN A C     
841  O O     . GLN A 114 ? 0.2173 0.2630 0.2906 -0.0073 0.0137  0.0212  242 GLN A O     
842  C CB    . GLN A 114 ? 0.2273 0.2830 0.3120 -0.0057 0.0197  0.0198  242 GLN A CB    
843  C CG    . GLN A 114 ? 0.3164 0.3738 0.3997 -0.0026 0.0185  0.0177  242 GLN A CG    
844  C CD    . GLN A 114 ? 0.3447 0.4098 0.4411 -0.0013 0.0178  0.0158  242 GLN A CD    
845  O OE1   . GLN A 114 ? 0.3288 0.4004 0.4375 -0.0038 0.0191  0.0153  242 GLN A OE1   
846  N NE2   . GLN A 114 ? 0.3548 0.4189 0.4484 0.0029  0.0158  0.0141  242 GLN A NE2   
847  N N     . ILE A 115 ? 0.1428 0.1822 0.2108 -0.0068 0.0249  0.0270  243 ILE A N     
848  C CA    . ILE A 115 ? 0.1322 0.1639 0.1984 -0.0079 0.0245  0.0289  243 ILE A CA    
849  C C     . ILE A 115 ? 0.1778 0.2058 0.2306 -0.0030 0.0197  0.0286  243 ILE A C     
850  O O     . ILE A 115 ? 0.1483 0.1757 0.1898 0.0013  0.0206  0.0294  243 ILE A O     
851  C CB    . ILE A 115 ? 0.1635 0.1866 0.2271 -0.0097 0.0334  0.0336  243 ILE A CB    
852  C CG1   . ILE A 115 ? 0.1446 0.1751 0.2239 -0.0151 0.0389  0.0324  243 ILE A CG1   
853  C CG2   . ILE A 115 ? 0.1718 0.1831 0.2318 -0.0107 0.0336  0.0357  243 ILE A CG2   
854  C CD1   . ILE A 115 ? 0.1917 0.2143 0.2681 -0.0180 0.0501  0.0369  243 ILE A CD1   
855  N N     . PHE A 116 ? 0.1329 0.1596 0.1872 -0.0032 0.0146  0.0267  244 PHE A N     
856  C CA    . PHE A 116 ? 0.1349 0.1597 0.1783 0.0021  0.0102  0.0256  244 PHE A CA    
857  C C     . PHE A 116 ? 0.1526 0.1657 0.1831 0.0069  0.0141  0.0306  244 PHE A C     
858  O O     . PHE A 116 ? 0.1644 0.1664 0.1953 0.0051  0.0181  0.0342  244 PHE A O     
859  C CB    . PHE A 116 ? 0.1305 0.1562 0.1792 0.0009  0.0048  0.0224  244 PHE A CB    
860  C CG    . PHE A 116 ? 0.1270 0.1530 0.1667 0.0067  0.0001  0.0201  244 PHE A CG    
861  C CD1   . PHE A 116 ? 0.1325 0.1687 0.1690 0.0088  -0.0034 0.0157  244 PHE A CD1   
862  C CD2   . PHE A 116 ? 0.1731 0.1897 0.2088 0.0098  -0.0007 0.0213  244 PHE A CD2   
863  C CE1   . PHE A 116 ? 0.1375 0.1777 0.1683 0.0142  -0.0078 0.0120  244 PHE A CE1   
864  C CE2   . PHE A 116 ? 0.2198 0.2385 0.2483 0.0165  -0.0057 0.0183  244 PHE A CE2   
865  C CZ    . PHE A 116 ? 0.1862 0.2185 0.2131 0.0187  -0.0094 0.0134  244 PHE A CZ    
866  N N     . GLY A 117 ? 0.1405 0.1555 0.1588 0.0130  0.0132  0.0306  245 GLY A N     
867  C CA    . GLY A 117 ? 0.1582 0.1620 0.1602 0.0198  0.0162  0.0354  245 GLY A CA    
868  C C     . GLY A 117 ? 0.1587 0.1602 0.1540 0.0202  0.0231  0.0391  245 GLY A C     
869  O O     . GLY A 117 ? 0.1773 0.1688 0.1556 0.0268  0.0259  0.0436  245 GLY A O     
870  N N     . VAL A 118 ? 0.1472 0.1573 0.1534 0.0145  0.0255  0.0371  246 VAL A N     
871  C CA    . VAL A 118 ? 0.1539 0.1636 0.1553 0.0147  0.0323  0.0395  246 VAL A CA    
872  C C     . VAL A 118 ? 0.1437 0.1655 0.1459 0.0158  0.0284  0.0337  246 VAL A C     
873  O O     . VAL A 118 ? 0.1322 0.1619 0.1471 0.0113  0.0255  0.0295  246 VAL A O     
874  C CB    . VAL A 118 ? 0.1520 0.1610 0.1668 0.0072  0.0398  0.0417  246 VAL A CB    
875  C CG1   . VAL A 118 ? 0.1664 0.1759 0.1758 0.0080  0.0476  0.0437  246 VAL A CG1   
876  C CG2   . VAL A 118 ? 0.1747 0.1719 0.1917 0.0037  0.0440  0.0458  246 VAL A CG2   
877  N N     . GLY A 119 ? 0.1670 0.1890 0.1548 0.0218  0.0289  0.0333  247 GLY A N     
878  C CA    . GLY A 119 ? 0.1531 0.1846 0.1405 0.0223  0.0269  0.0274  247 GLY A CA    
879  C C     . GLY A 119 ? 0.1823 0.2125 0.1669 0.0220  0.0345  0.0293  247 GLY A C     
880  O O     . GLY A 119 ? 0.1627 0.1860 0.1476 0.0206  0.0420  0.0352  247 GLY A O     
881  N N     . VAL A 120 ? 0.1851 0.2220 0.1670 0.0232  0.0331  0.0236  248 VAL A N     
882  C CA    . VAL A 120 ? 0.1974 0.2339 0.1766 0.0237  0.0400  0.0241  248 VAL A CA    
883  C C     . VAL A 120 ? 0.1988 0.2275 0.1617 0.0289  0.0461  0.0301  248 VAL A C     
884  O O     . VAL A 120 ? 0.2015 0.2266 0.1657 0.0271  0.0550  0.0344  248 VAL A O     
885  C CB    . VAL A 120 ? 0.1943 0.2375 0.1709 0.0245  0.0370  0.0159  248 VAL A CB    
886  C CG1   . VAL A 120 ? 0.2013 0.2435 0.1719 0.0267  0.0441  0.0160  248 VAL A CG1   
887  C CG2   . VAL A 120 ? 0.2417 0.2882 0.2329 0.0187  0.0338  0.0116  248 VAL A CG2   
888  N N     . LYS A 121 ? 0.2205 0.2468 0.1671 0.0360  0.0419  0.0303  249 LYS A N     
889  C CA    . LYS A 121 ? 0.2402 0.2565 0.1667 0.0425  0.0478  0.0366  249 LYS A CA    
890  C C     . LYS A 121 ? 0.2593 0.2625 0.1872 0.0391  0.0561  0.0460  249 LYS A C     
891  O O     . LYS A 121 ? 0.2836 0.2793 0.2036 0.0389  0.0664  0.0513  249 LYS A O     
892  C CB    . LYS A 121 ? 0.2827 0.2990 0.1908 0.0525  0.0401  0.0348  249 LYS A CB    
893  C CG    . LYS A 121 ? 0.3389 0.3690 0.2444 0.0554  0.0336  0.0244  249 LYS A CG    
894  C CD    . LYS A 121 ? 0.3960 0.4287 0.2820 0.0669  0.0262  0.0215  249 LYS A CD    
895  C CE    . LYS A 121 ? 0.3892 0.4368 0.2733 0.0688  0.0206  0.0097  249 LYS A CE    
896  N NZ    . LYS A 121 ? 0.4451 0.5044 0.3502 0.0596  0.0161  0.0007  249 LYS A NZ    
897  N N     . THR A 122 ? 0.2221 0.2223 0.1598 0.0357  0.0527  0.0474  250 THR A N     
898  C CA    . THR A 122 ? 0.2280 0.2152 0.1683 0.0310  0.0608  0.0549  250 THR A CA    
899  C C     . THR A 122 ? 0.2138 0.2066 0.1727 0.0218  0.0689  0.0546  250 THR A C     
900  O O     . THR A 122 ? 0.2280 0.2125 0.1845 0.0185  0.0801  0.0600  250 THR A O     
901  C CB    . THR A 122 ? 0.2375 0.2212 0.1851 0.0295  0.0546  0.0550  250 THR A CB    
902  O OG1   . THR A 122 ? 0.2459 0.2249 0.1755 0.0396  0.0477  0.0552  250 THR A OG1   
903  C CG2   . THR A 122 ? 0.2496 0.2192 0.2008 0.0234  0.0634  0.0615  250 THR A CG2   
904  N N     . ALA A 123 ? 0.2031 0.2099 0.1804 0.0178  0.0636  0.0480  251 ALA A N     
905  C CA    . ALA A 123 ? 0.1837 0.1983 0.1795 0.0110  0.0693  0.0463  251 ALA A CA    
906  C C     . ALA A 123 ? 0.2197 0.2348 0.2084 0.0126  0.0790  0.0476  251 ALA A C     
907  O O     . ALA A 123 ? 0.2062 0.2225 0.2047 0.0073  0.0885  0.0494  251 ALA A O     
908  C CB    . ALA A 123 ? 0.1776 0.2045 0.1878 0.0097  0.0612  0.0392  251 ALA A CB    
909  N N     . ASP A 124 ? 0.2010 0.2169 0.1741 0.0194  0.0767  0.0456  252 ASP A N     
910  C CA    . ASP A 124 ? 0.2271 0.2436 0.1915 0.0218  0.0854  0.0460  252 ASP A CA    
911  C C     . ASP A 124 ? 0.2427 0.2460 0.1926 0.0219  0.0967  0.0544  252 ASP A C     
912  O O     . ASP A 124 ? 0.2661 0.2705 0.2193 0.0186  0.1081  0.0561  252 ASP A O     
913  C CB    . ASP A 124 ? 0.2314 0.2510 0.1806 0.0293  0.0794  0.0411  252 ASP A CB    
914  C CG    . ASP A 124 ? 0.2759 0.2950 0.2121 0.0331  0.0881  0.0413  252 ASP A CG    
915  O OD1   . ASP A 124 ? 0.2767 0.3034 0.2253 0.0303  0.0933  0.0382  252 ASP A OD1   
916  O OD2   . ASP A 124 ? 0.3325 0.3442 0.2454 0.0400  0.0893  0.0442  252 ASP A OD2   
917  N N     A ARG A 125 ? 0.2707 0.2608 0.2042 0.0259  0.0942  0.0596  253 ARG A N     
918  N N     B ARG A 125 ? 0.2745 0.2644 0.2075 0.0260  0.0943  0.0597  253 ARG A N     
919  C CA    A ARG A 125 ? 0.3056 0.2783 0.2217 0.0264  0.1057  0.0687  253 ARG A CA    
920  C CA    B ARG A 125 ? 0.3076 0.2804 0.2239 0.0262  0.1060  0.0687  253 ARG A CA    
921  C C     A ARG A 125 ? 0.3021 0.2724 0.2365 0.0151  0.1161  0.0715  253 ARG A C     
922  C C     B ARG A 125 ? 0.3028 0.2741 0.2384 0.0148  0.1163  0.0711  253 ARG A C     
923  O O     A ARG A 125 ? 0.3133 0.2773 0.2428 0.0114  0.1301  0.0758  253 ARG A O     
924  O O     B ARG A 125 ? 0.3148 0.2815 0.2473 0.0109  0.1302  0.0749  253 ARG A O     
925  C CB    A ARG A 125 ? 0.3430 0.3006 0.2382 0.0342  0.0996  0.0734  253 ARG A CB    
926  C CB    B ARG A 125 ? 0.3473 0.3041 0.2426 0.0336  0.1009  0.0739  253 ARG A CB    
927  C CG    A ARG A 125 ? 0.3809 0.3153 0.2538 0.0358  0.1115  0.0839  253 ARG A CG    
928  C CG    B ARG A 125 ? 0.3783 0.3123 0.2564 0.0326  0.1140  0.0844  253 ARG A CG    
929  C CD    A ARG A 125 ? 0.4127 0.3321 0.2600 0.0476  0.1041  0.0881  253 ARG A CD    
930  C CD    B ARG A 125 ? 0.4127 0.3277 0.2635 0.0433  0.1096  0.0904  253 ARG A CD    
931  N NE    A ARG A 125 ? 0.3956 0.3169 0.2555 0.0467  0.0935  0.0854  253 ARG A NE    
932  N NE    B ARG A 125 ? 0.3940 0.3062 0.2553 0.0418  0.1011  0.0894  253 ARG A NE    
933  C CZ    A ARG A 125 ? 0.3933 0.3035 0.2632 0.0392  0.0975  0.0889  253 ARG A CZ    
934  C CZ    B ARG A 125 ? 0.3842 0.3071 0.2487 0.0480  0.0862  0.0833  253 ARG A CZ    
935  N NH1   A ARG A 125 ? 0.3969 0.2938 0.2672 0.0307  0.1124  0.0950  253 ARG A NH1   
936  N NH1   B ARG A 125 ? 0.3886 0.3260 0.2475 0.0554  0.0779  0.0771  253 ARG A NH1   
937  N NH2   A ARG A 125 ? 0.3933 0.3063 0.2733 0.0395  0.0871  0.0854  253 ARG A NH2   
938  N NH2   B ARG A 125 ? 0.3854 0.3049 0.2591 0.0462  0.0802  0.0827  253 ARG A NH2   
939  N N     . TRP A 126 ? 0.2727 0.2491 0.2287 0.0089  0.1098  0.0681  254 TRP A N     
940  C CA    . TRP A 126 ? 0.2700 0.2478 0.2467 -0.0022 0.1179  0.0683  254 TRP A CA    
941  C C     . TRP A 126 ? 0.2611 0.2558 0.2557 -0.0070 0.1249  0.0635  254 TRP A C     
942  O O     . TRP A 126 ? 0.2639 0.2586 0.2671 -0.0147 0.1360  0.0642  254 TRP A O     
943  C CB    . TRP A 126 ? 0.2346 0.2178 0.2296 -0.0060 0.1075  0.0642  254 TRP A CB    
944  C CG    . TRP A 126 ? 0.2661 0.2316 0.2468 -0.0030 0.1032  0.0689  254 TRP A CG    
945  C CD1   . TRP A 126 ? 0.3191 0.2631 0.2741 0.0019  0.1090  0.0769  254 TRP A CD1   
946  C CD2   . TRP A 126 ? 0.2494 0.2168 0.2398 -0.0037 0.0924  0.0657  254 TRP A CD2   
947  N NE1   . TRP A 126 ? 0.3155 0.2480 0.2644 0.0048  0.1020  0.0786  254 TRP A NE1   
948  C CE2   . TRP A 126 ? 0.2651 0.2125 0.2362 0.0010  0.0920  0.0715  254 TRP A CE2   
949  C CE3   . TRP A 126 ? 0.2278 0.2109 0.2396 -0.0070 0.0832  0.0586  254 TRP A CE3   
950  C CZ2   . TRP A 126 ? 0.2832 0.2276 0.2577 0.0022  0.0827  0.0697  254 TRP A CZ2   
951  C CZ3   . TRP A 126 ? 0.2312 0.2109 0.2454 -0.0065 0.0744  0.0572  254 TRP A CZ3   
952  C CH2   . TRP A 126 ? 0.2595 0.2208 0.2560 -0.0021 0.0743  0.0624  254 TRP A CH2   
953  N N     . TYR A 127 ? 0.2455 0.2549 0.2461 -0.0023 0.1171  0.0572  255 TYR A N     
954  C CA    . TYR A 127 ? 0.2284 0.2533 0.2437 -0.0043 0.1229  0.0523  255 TYR A CA    
955  C C     . TYR A 127 ? 0.2556 0.2747 0.2558 -0.0035 0.1368  0.0563  255 TYR A C     
956  O O     . TYR A 127 ? 0.2670 0.2938 0.2802 -0.0096 0.1436  0.0533  255 TYR A O     
957  C CB    . TYR A 127 ? 0.2308 0.2669 0.2493 0.0020  0.1121  0.0456  255 TYR A CB    
958  C CG    . TYR A 127 ? 0.2367 0.2887 0.2727 0.0011  0.1163  0.0397  255 TYR A CG    
959  C CD1   . TYR A 127 ? 0.2126 0.2776 0.2737 -0.0029 0.1126  0.0349  255 TYR A CD1   
960  C CD2   . TYR A 127 ? 0.2622 0.3167 0.2889 0.0053  0.1238  0.0387  255 TYR A CD2   
961  C CE1   . TYR A 127 ? 0.2423 0.3226 0.3195 -0.0020 0.1157  0.0291  255 TYR A CE1   
962  C CE2   . TYR A 127 ? 0.2474 0.3171 0.2909 0.0055  0.1277  0.0327  255 TYR A CE2   
963  C CZ    . TYR A 127 ? 0.2501 0.3327 0.3190 0.0022  0.1234  0.0280  255 TYR A CZ    
964  O OH    . TYR A 127 ? 0.2722 0.3711 0.3586 0.0041  0.1258  0.0215  255 TYR A OH    
965  N N     . ARG A 128 ? 0.2971 0.3033 0.2691 0.0044  0.1368  0.0609  256 ARG A N     
966  C CA    . ARG A 128 ? 0.3324 0.3323 0.2875 0.0061  0.1454  0.0630  256 ARG A CA    
967  C C     . ARG A 128 ? 0.3895 0.3765 0.3425 -0.0016 0.1543  0.0680  256 ARG A C     
968  O O     . ARG A 128 ? 0.4378 0.4251 0.3883 -0.0046 0.1635  0.0681  256 ARG A O     
969  C CB    . ARG A 128 ? 0.3796 0.3695 0.3043 0.0175  0.1414  0.0658  256 ARG A CB    
970  C CG    . ARG A 128 ? 0.3907 0.3942 0.3167 0.0242  0.1336  0.0587  256 ARG A CG    
971  C CD    . ARG A 128 ? 0.4159 0.4124 0.3123 0.0351  0.1293  0.0592  256 ARG A CD    
972  N NE    . ARG A 128 ? 0.4619 0.4529 0.3489 0.0402  0.1163  0.0595  256 ARG A NE    
973  C CZ    . ARG A 128 ? 0.4950 0.4700 0.3623 0.0443  0.1166  0.0671  256 ARG A CZ    
974  N NH1   . ARG A 128 ? 0.5001 0.4603 0.3557 0.0426  0.1273  0.0745  256 ARG A NH1   
975  N NH2   . ARG A 128 ? 0.5065 0.4805 0.3682 0.0498  0.1037  0.0654  256 ARG A NH2   
976  N N     . GLU A 129 ? 0.3649 0.3405 0.3190 -0.0051 0.1520  0.0717  257 GLU A N     
977  C CA    . GLU A 129 ? 0.3912 0.3536 0.3455 -0.0135 0.1601  0.0754  257 GLU A CA    
978  C C     . GLU A 129 ? 0.4161 0.3947 0.4016 -0.0255 0.1643  0.0690  257 GLU A C     
979  O O     . GLU A 129 ? 0.4640 0.4342 0.4524 -0.0338 0.1718  0.0705  257 GLU A O     
980  C CB    . GLU A 129 ? 0.4213 0.3652 0.3657 -0.0122 0.1553  0.0807  257 GLU A CB    
981  C CG    . GLU A 129 ? 0.4611 0.3876 0.3725 0.0004  0.1512  0.0872  257 GLU A CG    
982  C CD    . GLU A 129 ? 0.5508 0.4611 0.4536 0.0034  0.1449  0.0914  257 GLU A CD    
983  O OE1   . GLU A 129 ? 0.5365 0.4479 0.4587 -0.0051 0.1443  0.0895  257 GLU A OE1   
984  O OE2   . GLU A 129 ? 0.6309 0.5283 0.5076 0.0150  0.1397  0.0958  257 GLU A OE2   
985  N N     . GLY A 130 ? 0.3204 0.3218 0.3286 -0.0259 0.1593  0.0614  258 GLY A N     
986  C CA    . GLY A 130 ? 0.2962 0.3160 0.3334 -0.0350 0.1615  0.0541  258 GLY A CA    
987  C C     . GLY A 130 ? 0.3071 0.3344 0.3659 -0.0396 0.1532  0.0499  258 GLY A C     
988  O O     . GLY A 130 ? 0.3010 0.3454 0.3842 -0.0461 0.1533  0.0429  258 GLY A O     
989  N N     . LEU A 131 ? 0.2702 0.2867 0.3210 -0.0359 0.1455  0.0534  259 LEU A N     
990  C CA    . LEU A 131 ? 0.2673 0.2900 0.3373 -0.0403 0.1376  0.0494  259 LEU A CA    
991  C C     . LEU A 131 ? 0.2483 0.2932 0.3375 -0.0365 0.1287  0.0423  259 LEU A C     
992  O O     . LEU A 131 ? 0.2359 0.2846 0.3174 -0.0285 0.1264  0.0427  259 LEU A O     
993  C CB    . LEU A 131 ? 0.2854 0.2888 0.3395 -0.0370 0.1329  0.0557  259 LEU A CB    
994  C CG    . LEU A 131 ? 0.2973 0.2753 0.3298 -0.0388 0.1405  0.0631  259 LEU A CG    
995  C CD1   . LEU A 131 ? 0.3419 0.3012 0.3516 -0.0304 0.1355  0.0701  259 LEU A CD1   
996  C CD2   . LEU A 131 ? 0.3437 0.3196 0.3917 -0.0500 0.1437  0.0598  259 LEU A CD2   
997  N N     . ARG A 132 ? 0.2134 0.2726 0.3266 -0.0418 0.1235  0.0353  260 ARG A N     
998  C CA    . ARG A 132 ? 0.1884 0.2680 0.3194 -0.0375 0.1147  0.0282  260 ARG A CA    
999  C C     . ARG A 132 ? 0.2101 0.2956 0.3558 -0.0391 0.1039  0.0241  260 ARG A C     
1000 O O     . ARG A 132 ? 0.2055 0.3018 0.3590 -0.0330 0.0953  0.0206  260 ARG A O     
1001 C CB    . ARG A 132 ? 0.1916 0.2904 0.3387 -0.0393 0.1186  0.0213  260 ARG A CB    
1002 C CG    . ARG A 132 ? 0.2193 0.3166 0.3541 -0.0363 0.1282  0.0237  260 ARG A CG    
1003 C CD    . ARG A 132 ? 0.2152 0.3125 0.3396 -0.0259 0.1245  0.0247  260 ARG A CD    
1004 N NE    . ARG A 132 ? 0.2303 0.3278 0.3434 -0.0225 0.1330  0.0255  260 ARG A NE    
1005 C CZ    . ARG A 132 ? 0.2343 0.3153 0.3232 -0.0210 0.1396  0.0322  260 ARG A CZ    
1006 N NH1   . ARG A 132 ? 0.2421 0.3045 0.3150 -0.0219 0.1389  0.0392  260 ARG A NH1   
1007 N NH2   . ARG A 132 ? 0.2636 0.3467 0.3432 -0.0177 0.1466  0.0318  260 ARG A NH2   
1008 N N     . THR A 133 ? 0.2332 0.3110 0.3819 -0.0465 0.1041  0.0242  261 THR A N     
1009 C CA    . THR A 133 ? 0.2219 0.3069 0.3851 -0.0483 0.0939  0.0189  261 THR A CA    
1010 C C     . THR A 133 ? 0.2068 0.2726 0.3593 -0.0508 0.0925  0.0239  261 THR A C     
1011 O O     . THR A 133 ? 0.2366 0.2832 0.3720 -0.0523 0.1004  0.0309  261 THR A O     
1012 C CB    . THR A 133 ? 0.2313 0.3310 0.4140 -0.0554 0.0944  0.0108  261 THR A CB    
1013 O OG1   . THR A 133 ? 0.2965 0.3823 0.4743 -0.0643 0.1034  0.0133  261 THR A OG1   
1014 C CG2   . THR A 133 ? 0.2369 0.3551 0.4296 -0.0529 0.0975  0.0063  261 THR A CG2   
1015 N N     . LEU A 134 ? 0.2069 0.2777 0.3687 -0.0504 0.0820  0.0200  262 LEU A N     
1016 C CA    . LEU A 134 ? 0.2105 0.2647 0.3644 -0.0524 0.0799  0.0235  262 LEU A CA    
1017 C C     . LEU A 134 ? 0.2537 0.2960 0.4068 -0.0613 0.0875  0.0233  262 LEU A C     
1018 O O     . LEU A 134 ? 0.2929 0.3132 0.4303 -0.0621 0.0919  0.0298  262 LEU A O     
1019 C CB    . LEU A 134 ? 0.2131 0.2761 0.3753 -0.0497 0.0659  0.0179  262 LEU A CB    
1020 C CG    . LEU A 134 ? 0.2188 0.2881 0.3735 -0.0397 0.0558  0.0179  262 LEU A CG    
1021 C CD1   . LEU A 134 ? 0.2440 0.3186 0.4042 -0.0379 0.0438  0.0132  262 LEU A CD1   
1022 C CD2   . LEU A 134 ? 0.2128 0.2668 0.3432 -0.0336 0.0563  0.0251  262 LEU A CD2   
1023 N N     . ASP A 135 ? 0.2976 0.3535 0.4665 -0.0675 0.0894  0.0161  263 ASP A N     
1024 C CA    . ASP A 135 ? 0.3414 0.3862 0.5104 -0.0768 0.0977  0.0155  263 ASP A CA    
1025 C C     . ASP A 135 ? 0.3684 0.3949 0.5187 -0.0778 0.1106  0.0239  263 ASP A C     
1026 O O     . ASP A 135 ? 0.3992 0.4044 0.5381 -0.0823 0.1172  0.0280  263 ASP A O     
1027 C CB    . ASP A 135 ? 0.3446 0.4109 0.5359 -0.0828 0.0970  0.0055  263 ASP A CB    
1028 C CG    . ASP A 135 ? 0.4147 0.4935 0.6204 -0.0827 0.0848  -0.0027 263 ASP A CG    
1029 O OD1   . ASP A 135 ? 0.4583 0.5253 0.6568 -0.0808 0.0789  -0.0007 263 ASP A OD1   
1030 O OD2   . ASP A 135 ? 0.4693 0.5696 0.6928 -0.0838 0.0809  -0.0112 263 ASP A OD2   
1031 N N     . ASP A 136 ? 0.2996 0.3325 0.4444 -0.0726 0.1141  0.0268  264 ASP A N     
1032 C CA    . ASP A 136 ? 0.3008 0.3151 0.4237 -0.0713 0.1251  0.0354  264 ASP A CA    
1033 C C     . ASP A 136 ? 0.3139 0.3024 0.4131 -0.0663 0.1245  0.0443  264 ASP A C     
1034 O O     . ASP A 136 ? 0.3621 0.3284 0.4423 -0.0672 0.1329  0.0508  264 ASP A O     
1035 C CB    . ASP A 136 ? 0.2886 0.3139 0.4074 -0.0646 0.1270  0.0368  264 ASP A CB    
1036 C CG    . ASP A 136 ? 0.3474 0.3956 0.4860 -0.0685 0.1299  0.0292  264 ASP A CG    
1037 O OD1   . ASP A 136 ? 0.3710 0.4236 0.5227 -0.0774 0.1338  0.0244  264 ASP A OD1   
1038 O OD2   . ASP A 136 ? 0.3221 0.3838 0.4626 -0.0623 0.1286  0.0278  264 ASP A OD2   
1039 N N     . LEU A 137 ? 0.2821 0.2729 0.3809 -0.0599 0.1145  0.0448  265 LEU A N     
1040 C CA    . LEU A 137 ? 0.3048 0.2731 0.3815 -0.0537 0.1130  0.0528  265 LEU A CA    
1041 C C     . LEU A 137 ? 0.3460 0.2984 0.4228 -0.0593 0.1129  0.0522  265 LEU A C     
1042 O O     . LEU A 137 ? 0.3894 0.3165 0.4440 -0.0560 0.1165  0.0593  265 LEU A O     
1043 C CB    . LEU A 137 ? 0.2604 0.2391 0.3359 -0.0443 0.0991  0.0513  265 LEU A CB    
1044 C CG    . LEU A 137 ? 0.2688 0.2628 0.3430 -0.0377 0.0962  0.0501  265 LEU A CG    
1045 C CD1   . LEU A 137 ? 0.2558 0.2594 0.3301 -0.0302 0.0810  0.0464  265 LEU A CD1   
1046 C CD2   . LEU A 137 ? 0.3128 0.2932 0.3623 -0.0318 0.1035  0.0576  265 LEU A CD2   
1047 N N     . ARG A 138 ? 0.3513 0.3179 0.4513 -0.0666 0.1080  0.0432  266 ARG A N     
1048 C CA    . ARG A 138 ? 0.3719 0.3252 0.4738 -0.0722 0.1073  0.0409  266 ARG A CA    
1049 C C     . ARG A 138 ? 0.4173 0.3533 0.5108 -0.0792 0.1191  0.0431  266 ARG A C     
1050 O O     . ARG A 138 ? 0.4679 0.3827 0.5523 -0.0813 0.1210  0.0449  266 ARG A O     
1051 C CB    . ARG A 138 ? 0.3172 0.2927 0.4455 -0.0775 0.0986  0.0297  266 ARG A CB    
1052 C CG    . ARG A 138 ? 0.3187 0.3079 0.4538 -0.0706 0.0863  0.0276  266 ARG A CG    
1053 C CD    . ARG A 138 ? 0.3195 0.3278 0.4761 -0.0744 0.0769  0.0167  266 ARG A CD    
1054 N NE    . ARG A 138 ? 0.3401 0.3565 0.4994 -0.0677 0.0650  0.0154  266 ARG A NE    
1055 C CZ    . ARG A 138 ? 0.3196 0.3586 0.4916 -0.0642 0.0560  0.0096  266 ARG A CZ    
1056 N NH1   . ARG A 138 ? 0.2737 0.3300 0.4572 -0.0659 0.0570  0.0043  266 ARG A NH1   
1057 N NH2   . ARG A 138 ? 0.2985 0.3403 0.4635 -0.0563 0.0441  0.0089  266 ARG A NH2   
1058 N N     . GLU A 139 ? 0.4457 0.3899 0.5420 -0.0825 0.1273  0.0429  267 GLU A N     
1059 C CA    . GLU A 139 ? 0.4843 0.4135 0.5742 -0.0900 0.1396  0.0446  267 GLU A CA    
1060 C C     . GLU A 139 ? 0.5438 0.4423 0.6013 -0.0835 0.1465  0.0561  267 GLU A C     
1061 O O     . GLU A 139 ? 0.5957 0.4746 0.6434 -0.0887 0.1560  0.0588  267 GLU A O     
1062 C CB    . GLU A 139 ? 0.4484 0.3976 0.5524 -0.0954 0.1463  0.0403  267 GLU A CB    
1063 N N     . GLN A 140 ? 0.5498 0.4439 0.5899 -0.0717 0.1419  0.0627  268 GLN A N     
1064 C CA    . GLN A 140 ? 0.5761 0.4429 0.5832 -0.0626 0.1462  0.0733  268 GLN A CA    
1065 C C     . GLN A 140 ? 0.6002 0.4564 0.5936 -0.0516 0.1360  0.0771  268 GLN A C     
1066 O O     . GLN A 140 ? 0.6180 0.4732 0.5945 -0.0401 0.1321  0.0823  268 GLN A O     
1067 C CB    . GLN A 140 ? 0.5756 0.4480 0.5712 -0.0572 0.1511  0.0774  268 GLN A CB    
1068 N N     . PRO A 141 ? 0.6099 0.4585 0.6098 -0.0545 0.1313  0.0741  269 PRO A N     
1069 C CA    . PRO A 141 ? 0.6006 0.4431 0.5914 -0.0442 0.1207  0.0763  269 PRO A CA    
1070 C C     . PRO A 141 ? 0.6599 0.4768 0.6166 -0.0306 0.1205  0.0856  269 PRO A C     
1071 O O     . PRO A 141 ? 0.7081 0.5220 0.6549 -0.0195 0.1111  0.0876  269 PRO A O     
1072 C CB    . PRO A 141 ? 0.5815 0.4212 0.5881 -0.0519 0.1173  0.0697  269 PRO A CB    
1073 C CG    . PRO A 141 ? 0.6041 0.4336 0.6128 -0.0626 0.1279  0.0683  269 PRO A CG    
1074 C CD    . PRO A 141 ? 0.6127 0.4563 0.6262 -0.0666 0.1357  0.0685  269 PRO A CD    
1075 N N     . GLN A 142 ? 0.6902 0.4896 0.6287 -0.0303 0.1301  0.0908  270 GLN A N     
1076 C CA    . GLN A 142 ? 0.7254 0.5021 0.6303 -0.0156 0.1290  0.0990  270 GLN A CA    
1077 C C     . GLN A 142 ? 0.7157 0.5048 0.6090 -0.0029 0.1223  0.1017  270 GLN A C     
1078 O O     . GLN A 142 ? 0.7908 0.5696 0.6611 0.0121  0.1152  0.1057  270 GLN A O     
1079 C CB    . GLN A 142 ? 0.7284 0.4848 0.6169 -0.0185 0.1417  0.1039  270 GLN A CB    
1080 N N     . LYS A 143 ? 0.6530 0.4656 0.5622 -0.0081 0.1238  0.0986  271 LYS A N     
1081 C CA    . LYS A 143 ? 0.6373 0.4626 0.5363 0.0028  0.1183  0.1003  271 LYS A CA    
1082 C C     . LYS A 143 ? 0.5889 0.4314 0.4983 0.0082  0.1049  0.0961  271 LYS A C     
1083 O O     . LYS A 143 ? 0.6218 0.4814 0.5279 0.0161  0.0972  0.0935  271 LYS A O     
1084 C CB    . LYS A 143 ? 0.6530 0.4963 0.5642 -0.0045 0.1256  0.0980  271 LYS A CB    
1085 N N     . LEU A 144 ? 0.4184 0.2626 0.3433 0.0041  0.0985  0.0911  272 LEU A N     
1086 C CA    . LEU A 144 ? 0.3655 0.2334 0.3059 0.0074  0.0830  0.0826  272 LEU A CA    
1087 C C     . LEU A 144 ? 0.3636 0.2216 0.2877 0.0202  0.0730  0.0831  272 LEU A C     
1088 O O     . LEU A 144 ? 0.4095 0.2429 0.3215 0.0221  0.0765  0.0875  272 LEU A O     
1089 C CB    . LEU A 144 ? 0.3529 0.2334 0.3229 -0.0053 0.0816  0.0752  272 LEU A CB    
1090 C CG    . LEU A 144 ? 0.3472 0.2400 0.3371 -0.0179 0.0907  0.0728  272 LEU A CG    
1091 C CD1   . LEU A 144 ? 0.3603 0.2629 0.3767 -0.0288 0.0885  0.0653  272 LEU A CD1   
1092 C CD2   . LEU A 144 ? 0.3267 0.2425 0.3218 -0.0144 0.0862  0.0698  272 LEU A CD2   
1093 N N     . THR A 145 ? 0.3234 0.2010 0.2485 0.0285  0.0607  0.0779  273 THR A N     
1094 C CA    . THR A 145 ? 0.3247 0.2005 0.2418 0.0393  0.0498  0.0754  273 THR A CA    
1095 C C     . THR A 145 ? 0.3384 0.2182 0.2754 0.0318  0.0457  0.0696  273 THR A C     
1096 O O     . THR A 145 ? 0.3395 0.2295 0.2982 0.0194  0.0485  0.0660  273 THR A O     
1097 C CB    . THR A 145 ? 0.3239 0.2228 0.2405 0.0479  0.0386  0.0695  273 THR A CB    
1098 O OG1   . THR A 145 ? 0.2879 0.2108 0.2294 0.0384  0.0348  0.0620  273 THR A OG1   
1099 C CG2   . THR A 145 ? 0.3263 0.2247 0.2247 0.0549  0.0417  0.0735  273 THR A CG2   
1100 N N     . GLN A 146 ? 0.3848 0.2568 0.3138 0.0406  0.0387  0.0682  274 GLN A N     
1101 C CA    . GLN A 146 ? 0.3541 0.2303 0.3002 0.0349  0.0340  0.0619  274 GLN A CA    
1102 C C     . GLN A 146 ? 0.3128 0.2190 0.2810 0.0291  0.0266  0.0535  274 GLN A C     
1103 O O     . GLN A 146 ? 0.3235 0.2365 0.3104 0.0192  0.0263  0.0489  274 GLN A O     
1104 C CB    . GLN A 146 ? 0.3977 0.2631 0.3302 0.0475  0.0269  0.0610  274 GLN A CB    
1105 N N     . GLN A 147 ? 0.2548 0.1784 0.2200 0.0353  0.0208  0.0511  275 GLN A N     
1106 C CA    . GLN A 147 ? 0.2352 0.1838 0.2180 0.0300  0.0151  0.0439  275 GLN A CA    
1107 C C     . GLN A 147 ? 0.2443 0.1988 0.2418 0.0184  0.0214  0.0444  275 GLN A C     
1108 O O     . GLN A 147 ? 0.2312 0.1977 0.2460 0.0111  0.0187  0.0394  275 GLN A O     
1109 C CB    . GLN A 147 ? 0.2534 0.2165 0.2284 0.0381  0.0096  0.0412  275 GLN A CB    
1110 C CG    . GLN A 147 ? 0.2645 0.2504 0.2546 0.0329  0.0046  0.0338  275 GLN A CG    
1111 C CD    . GLN A 147 ? 0.3256 0.3252 0.3085 0.0396  0.0000  0.0300  275 GLN A CD    
1112 O OE1   . GLN A 147 ? 0.3281 0.3246 0.2998 0.0434  0.0031  0.0333  275 GLN A OE1   
1113 N NE2   . GLN A 147 ? 0.2923 0.3074 0.2816 0.0405  -0.0069 0.0223  275 GLN A NE2   
1114 N N     . GLN A 148 ? 0.2203 0.1668 0.2102 0.0175  0.0298  0.0502  276 GLN A N     
1115 C CA    . GLN A 148 ? 0.1942 0.1470 0.1983 0.0074  0.0365  0.0502  276 GLN A CA    
1116 C C     . GLN A 148 ? 0.1963 0.1426 0.2143 -0.0023 0.0408  0.0493  276 GLN A C     
1117 O O     . GLN A 148 ? 0.1812 0.1406 0.2180 -0.0104 0.0413  0.0452  276 GLN A O     
1118 C CB    . GLN A 148 ? 0.2309 0.1757 0.2221 0.0090  0.0456  0.0565  276 GLN A CB    
1119 C CG    . GLN A 148 ? 0.2053 0.1612 0.1867 0.0167  0.0414  0.0554  276 GLN A CG    
1120 C CD    . GLN A 148 ? 0.2278 0.1718 0.1893 0.0218  0.0492  0.0621  276 GLN A CD    
1121 O OE1   . GLN A 148 ? 0.2498 0.1749 0.2024 0.0200  0.0585  0.0687  276 GLN A OE1   
1122 N NE2   . GLN A 148 ? 0.2246 0.1787 0.1779 0.0280  0.0458  0.0602  276 GLN A NE2   
1123 N N     . LYS A 149 ? 0.2447 0.1706 0.2537 -0.0014 0.0439  0.0525  277 LYS A N     
1124 C CA    . LYS A 149 ? 0.2505 0.1703 0.2737 -0.0116 0.0479  0.0500  277 LYS A CA    
1125 C C     . LYS A 149 ? 0.2241 0.1607 0.2643 -0.0142 0.0381  0.0416  277 LYS A C     
1126 O O     . LYS A 149 ? 0.2142 0.1606 0.2734 -0.0233 0.0390  0.0368  277 LYS A O     
1127 C CB    . LYS A 149 ? 0.2680 0.1593 0.2758 -0.0095 0.0530  0.0547  277 LYS A CB    
1128 C CG    . LYS A 149 ? 0.3527 0.2229 0.3420 -0.0083 0.0650  0.0638  277 LYS A CG    
1129 C CD    . LYS A 149 ? 0.3893 0.2273 0.3608 -0.0052 0.0699  0.0689  277 LYS A CD    
1130 C CE    . LYS A 149 ? 0.4408 0.2540 0.3905 -0.0042 0.0833  0.0791  277 LYS A CE    
1131 N NZ    . LYS A 149 ? 0.5091 0.2863 0.4384 -0.0010 0.0895  0.0850  277 LYS A NZ    
1132 N N     . ALA A 150 ? 0.2217 0.1631 0.2552 -0.0056 0.0286  0.0393  278 ALA A N     
1133 C CA    . ALA A 150 ? 0.2276 0.1845 0.2740 -0.0072 0.0198  0.0318  278 ALA A CA    
1134 C C     . ALA A 150 ? 0.1990 0.1764 0.2583 -0.0112 0.0177  0.0287  278 ALA A C     
1135 O O     . ALA A 150 ? 0.1698 0.1574 0.2440 -0.0167 0.0146  0.0235  278 ALA A O     
1136 C CB    . ALA A 150 ? 0.2197 0.1786 0.2555 0.0027  0.0117  0.0299  278 ALA A CB    
1137 N N     . GLY A 151 ? 0.1472 0.1303 0.1999 -0.0076 0.0189  0.0315  279 GLY A N     
1138 C CA    . GLY A 151 ? 0.1570 0.1565 0.2200 -0.0104 0.0177  0.0289  279 GLY A CA    
1139 C C     . GLY A 151 ? 0.1429 0.1461 0.2211 -0.0185 0.0230  0.0280  279 GLY A C     
1140 O O     . GLY A 151 ? 0.1290 0.1456 0.2199 -0.0211 0.0193  0.0236  279 GLY A O     
1141 N N     A LEU A 152 ? 0.1438 0.1353 0.2206 -0.0222 0.0319  0.0318  280 LEU A N     
1142 N N     B LEU A 152 ? 0.1437 0.1354 0.2203 -0.0221 0.0320  0.0320  280 LEU A N     
1143 C CA    A LEU A 152 ? 0.1442 0.1412 0.2372 -0.0308 0.0383  0.0299  280 LEU A CA    
1144 C CA    B LEU A 152 ? 0.1438 0.1412 0.2372 -0.0308 0.0381  0.0298  280 LEU A CA    
1145 C C     A LEU A 152 ? 0.1418 0.1415 0.2500 -0.0372 0.0353  0.0237  280 LEU A C     
1146 C C     B LEU A 152 ? 0.1402 0.1409 0.2483 -0.0366 0.0342  0.0234  280 LEU A C     
1147 O O     A LEU A 152 ? 0.1324 0.1472 0.2585 -0.0422 0.0344  0.0182  280 LEU A O     
1148 O O     B LEU A 152 ? 0.1290 0.1456 0.2542 -0.0406 0.0318  0.0177  280 LEU A O     
1149 C CB    A LEU A 152 ? 0.1655 0.1478 0.2506 -0.0336 0.0505  0.0360  280 LEU A CB    
1150 C CB    B LEU A 152 ? 0.1654 0.1480 0.2525 -0.0345 0.0505  0.0354  280 LEU A CB    
1151 C CG    A LEU A 152 ? 0.1690 0.1582 0.2700 -0.0427 0.0600  0.0343  280 LEU A CG    
1152 C CG    B LEU A 152 ? 0.1811 0.1668 0.2638 -0.0336 0.0582  0.0394  280 LEU A CG    
1153 C CD1   A LEU A 152 ? 0.1612 0.1716 0.2728 -0.0411 0.0575  0.0312  280 LEU A CD1   
1154 C CD1   B LEU A 152 ? 0.1999 0.1681 0.2762 -0.0390 0.0717  0.0448  280 LEU A CD1   
1155 C CD2   A LEU A 152 ? 0.2045 0.1754 0.2914 -0.0443 0.0729  0.0419  280 LEU A CD2   
1156 C CD2   B LEU A 152 ? 0.1615 0.1689 0.2636 -0.0371 0.0574  0.0340  280 LEU A CD2   
1157 N N     . GLN A 153 ? 0.1513 0.1372 0.2523 -0.0363 0.0333  0.0237  281 GLN A N     
1158 C CA    . GLN A 153 ? 0.1662 0.1543 0.2804 -0.0419 0.0296  0.0168  281 GLN A CA    
1159 C C     . GLN A 153 ? 0.1301 0.1369 0.2526 -0.0393 0.0190  0.0108  281 GLN A C     
1160 O O     . GLN A 153 ? 0.1268 0.1457 0.2657 -0.0444 0.0162  0.0040  281 GLN A O     
1161 C CB    . GLN A 153 ? 0.1655 0.1335 0.2678 -0.0398 0.0293  0.0181  281 GLN A CB    
1162 C CG    . GLN A 153 ? 0.2091 0.1550 0.3058 -0.0451 0.0409  0.0225  281 GLN A CG    
1163 C CD    . GLN A 153 ? 0.3470 0.2690 0.4257 -0.0393 0.0407  0.0259  281 GLN A CD    
1164 O OE1   . GLN A 153 ? 0.4850 0.3886 0.5635 -0.0451 0.0469  0.0253  281 GLN A OE1   
1165 N NE2   . GLN A 153 ? 0.2987 0.2208 0.3623 -0.0276 0.0340  0.0287  281 GLN A NE2   
1166 N N     . HIS A 154 ? 0.1215 0.1312 0.2326 -0.0315 0.0131  0.0127  282 HIS A N     
1167 C CA    . HIS A 154 ? 0.1068 0.1302 0.2219 -0.0289 0.0042  0.0080  282 HIS A CA    
1168 C C     . HIS A 154 ? 0.1001 0.1369 0.2194 -0.0275 0.0033  0.0082  282 HIS A C     
1169 O O     . HIS A 154 ? 0.0866 0.1315 0.2049 -0.0244 -0.0032 0.0057  282 HIS A O     
1170 C CB    . HIS A 154 ? 0.1055 0.1245 0.2069 -0.0224 -0.0009 0.0086  282 HIS A CB    
1171 C CG    . HIS A 154 ? 0.1163 0.1233 0.2142 -0.0223 -0.0017 0.0070  282 HIS A CG    
1172 N ND1   . HIS A 154 ? 0.1185 0.1273 0.2258 -0.0263 -0.0052 0.0008  282 HIS A ND1   
1173 C CD2   . HIS A 154 ? 0.1356 0.1278 0.2211 -0.0181 0.0004  0.0104  282 HIS A CD2   
1174 C CE1   . HIS A 154 ? 0.1495 0.1445 0.2505 -0.0249 -0.0049 0.0003  282 HIS A CE1   
1175 N NE2   . HIS A 154 ? 0.1372 0.1213 0.2246 -0.0195 -0.0015 0.0063  282 HIS A NE2   
1176 N N     . HIS A 155 ? 0.1127 0.1507 0.2355 -0.0295 0.0103  0.0111  283 HIS A N     
1177 C CA    . HIS A 155 ? 0.1104 0.1586 0.2341 -0.0265 0.0100  0.0118  283 HIS A CA    
1178 C C     . HIS A 155 ? 0.0814 0.1433 0.2160 -0.0259 0.0034  0.0063  283 HIS A C     
1179 O O     . HIS A 155 ? 0.0856 0.1517 0.2148 -0.0211 -0.0004 0.0065  283 HIS A O     
1180 C CB    . HIS A 155 ? 0.1111 0.1596 0.2390 -0.0292 0.0191  0.0145  283 HIS A CB    
1181 C CG    . HIS A 155 ? 0.1265 0.1840 0.2546 -0.0254 0.0194  0.0150  283 HIS A CG    
1182 N ND1   . HIS A 155 ? 0.1386 0.2102 0.2812 -0.0258 0.0181  0.0107  283 HIS A ND1   
1183 C CD2   . HIS A 155 ? 0.2095 0.2638 0.3250 -0.0207 0.0207  0.0186  283 HIS A CD2   
1184 C CE1   . HIS A 155 ? 0.1874 0.2622 0.3254 -0.0211 0.0189  0.0121  283 HIS A CE1   
1185 N NE2   . HIS A 155 ? 0.2009 0.2653 0.3229 -0.0187 0.0207  0.0167  283 HIS A NE2   
1186 N N     . GLN A 156 ? 0.0824 0.1510 0.2317 -0.0304 0.0021  0.0008  284 GLN A N     
1187 C CA    . GLN A 156 ? 0.0977 0.1806 0.2566 -0.0281 -0.0050 -0.0049 284 GLN A CA    
1188 C C     . GLN A 156 ? 0.0902 0.1708 0.2376 -0.0230 -0.0131 -0.0054 284 GLN A C     
1189 O O     . GLN A 156 ? 0.0833 0.1686 0.2264 -0.0176 -0.0173 -0.0054 284 GLN A O     
1190 C CB    . GLN A 156 ? 0.0912 0.1832 0.2686 -0.0343 -0.0054 -0.0122 284 GLN A CB    
1191 C CG    . GLN A 156 ? 0.1229 0.2309 0.3081 -0.0302 -0.0132 -0.0187 284 GLN A CG    
1192 N N     . ASP A 157 ? 0.0855 0.1577 0.2268 -0.0245 -0.0149 -0.0058 285 ASP A N     
1193 C CA    . ASP A 157 ? 0.0778 0.1484 0.2081 -0.0203 -0.0213 -0.0067 285 ASP A CA    
1194 C C     . ASP A 157 ? 0.0943 0.1603 0.2107 -0.0163 -0.0198 -0.0016 285 ASP A C     
1195 O O     . ASP A 157 ? 0.0992 0.1666 0.2082 -0.0128 -0.0236 -0.0020 285 ASP A O     
1196 C CB    . ASP A 157 ? 0.1060 0.1687 0.2326 -0.0222 -0.0225 -0.0084 285 ASP A CB    
1197 C CG    . ASP A 157 ? 0.1571 0.2250 0.2942 -0.0250 -0.0271 -0.0157 285 ASP A CG    
1198 O OD1   . ASP A 157 ? 0.1512 0.2307 0.3001 -0.0258 -0.0297 -0.0201 285 ASP A OD1   
1199 O OD2   . ASP A 157 ? 0.1304 0.1915 0.2639 -0.0259 -0.0286 -0.0180 285 ASP A OD2   
1200 N N     . LEU A 158 ? 0.0808 0.1405 0.1925 -0.0169 -0.0141 0.0027  286 LEU A N     
1201 C CA    . LEU A 158 ? 0.0878 0.1444 0.1874 -0.0139 -0.0128 0.0058  286 LEU A CA    
1202 C C     . LEU A 158 ? 0.0951 0.1557 0.1950 -0.0118 -0.0118 0.0069  286 LEU A C     
1203 O O     . LEU A 158 ? 0.1151 0.1728 0.2052 -0.0098 -0.0112 0.0083  286 LEU A O     
1204 C CB    . LEU A 158 ? 0.0933 0.1433 0.1872 -0.0139 -0.0079 0.0093  286 LEU A CB    
1205 C CG    . LEU A 158 ? 0.1292 0.1726 0.2195 -0.0139 -0.0087 0.0088  286 LEU A CG    
1206 C CD1   . LEU A 158 ? 0.1366 0.1731 0.2175 -0.0112 -0.0048 0.0126  286 LEU A CD1   
1207 C CD2   . LEU A 158 ? 0.1254 0.1706 0.2115 -0.0125 -0.0142 0.0051  286 LEU A CD2   
1208 N N     . SER A 159 ? 0.1023 0.1696 0.2136 -0.0120 -0.0117 0.0055  287 SER A N     
1209 C CA    A SER A 159 ? 0.1109 0.1821 0.2226 -0.0082 -0.0116 0.0058  287 SER A CA    
1210 C CA    B SER A 159 ? 0.1137 0.1851 0.2257 -0.0082 -0.0116 0.0058  287 SER A CA    
1211 C C     . SER A 159 ? 0.1185 0.1915 0.2266 -0.0040 -0.0182 0.0036  287 SER A C     
1212 O O     . SER A 159 ? 0.1565 0.2291 0.2608 0.0007  -0.0186 0.0044  287 SER A O     
1213 C CB    A SER A 159 ? 0.1179 0.1979 0.2444 -0.0094 -0.0082 0.0045  287 SER A CB    
1214 C CB    B SER A 159 ? 0.1170 0.1974 0.2443 -0.0095 -0.0084 0.0042  287 SER A CB    
1215 O OG    A SER A 159 ? 0.1337 0.2095 0.2599 -0.0126 -0.0008 0.0077  287 SER A OG    
1216 O OG    B SER A 159 ? 0.1449 0.2356 0.2847 -0.0095 -0.0135 -0.0010 287 SER A OG    
1217 N N     . THR A 160 ? 0.1277 0.2012 0.2350 -0.0048 -0.0231 0.0010  288 THR A N     
1218 C CA    A THR A 160 ? 0.1575 0.2313 0.2582 -0.0002 -0.0292 -0.0008 288 THR A CA    
1219 C CA    B THR A 160 ? 0.1569 0.2307 0.2576 0.0000  -0.0290 -0.0006 288 THR A CA    
1220 C C     . THR A 160 ? 0.1661 0.2291 0.2495 0.0002  -0.0280 0.0020  288 THR A C     
1221 O O     . THR A 160 ? 0.1671 0.2270 0.2474 -0.0037 -0.0259 0.0022  288 THR A O     
1222 C CB    A THR A 160 ? 0.1680 0.2477 0.2751 -0.0014 -0.0348 -0.0057 288 THR A CB    
1223 C CB    B THR A 160 ? 0.1768 0.2575 0.2845 -0.0004 -0.0351 -0.0058 288 THR A CB    
1224 O OG1   A THR A 160 ? 0.1887 0.2777 0.3137 -0.0050 -0.0339 -0.0093 288 THR A OG1   
1225 O OG1   B THR A 160 ? 0.1592 0.2348 0.2629 -0.0046 -0.0345 -0.0062 288 THR A OG1   
1226 C CG2   A THR A 160 ? 0.2001 0.2822 0.3010 0.0051  -0.0418 -0.0080 288 THR A CG2   
1227 C CG2   B THR A 160 ? 0.1855 0.2780 0.3127 -0.0029 -0.0351 -0.0099 288 THR A CG2   
1228 N N     A PRO A 161 ? 0.1616 0.2185 0.2335 0.0047  -0.0288 0.0037  289 PRO A N     
1229 N N     B PRO A 161 ? 0.1584 0.2152 0.2303 0.0046  -0.0285 0.0038  289 PRO A N     
1230 C CA    A PRO A 161 ? 0.1746 0.2208 0.2307 0.0031  -0.0259 0.0057  289 PRO A CA    
1231 C CA    B PRO A 161 ? 0.1769 0.2229 0.2330 0.0029  -0.0256 0.0058  289 PRO A CA    
1232 C C     A PRO A 161 ? 0.1546 0.2008 0.2060 0.0008  -0.0281 0.0035  289 PRO A C     
1233 C C     B PRO A 161 ? 0.1530 0.1989 0.2040 0.0009  -0.0280 0.0036  289 PRO A C     
1234 O O     A PRO A 161 ? 0.1653 0.2159 0.2187 0.0032  -0.0336 0.0010  289 PRO A O     
1235 O O     B PRO A 161 ? 0.1730 0.2228 0.2251 0.0036  -0.0335 0.0013  289 PRO A O     
1236 C CB    A PRO A 161 ? 0.1767 0.2141 0.2207 0.0091  -0.0265 0.0079  289 PRO A CB    
1237 C CB    B PRO A 161 ? 0.1818 0.2189 0.2260 0.0087  -0.0259 0.0081  289 PRO A CB    
1238 C CG    A PRO A 161 ? 0.1814 0.2276 0.2342 0.0155  -0.0328 0.0060  289 PRO A CG    
1239 C CG    B PRO A 161 ? 0.1682 0.2118 0.2234 0.0130  -0.0268 0.0080  289 PRO A CG    
1240 C CD    A PRO A 161 ? 0.1744 0.2334 0.2468 0.0118  -0.0322 0.0035  289 PRO A CD    
1241 C CD    B PRO A 161 ? 0.1817 0.2397 0.2543 0.0112  -0.0303 0.0043  289 PRO A CD    
1242 N N     . VAL A 162 ? 0.1255 0.1557 0.1958 -0.0219 -0.0385 -0.0091 290 VAL A N     
1243 C CA    . VAL A 162 ? 0.1155 0.1425 0.1704 -0.0226 -0.0410 -0.0137 290 VAL A CA    
1244 C C     . VAL A 162 ? 0.1309 0.1592 0.1709 -0.0216 -0.0466 -0.0125 290 VAL A C     
1245 O O     . VAL A 162 ? 0.1273 0.1561 0.1637 -0.0197 -0.0444 -0.0071 290 VAL A O     
1246 C CB    . VAL A 162 ? 0.1265 0.1494 0.1728 -0.0215 -0.0328 -0.0125 290 VAL A CB    
1247 C CG1   . VAL A 162 ? 0.1641 0.1843 0.1970 -0.0221 -0.0344 -0.0179 290 VAL A CG1   
1248 C CG2   . VAL A 162 ? 0.1408 0.1622 0.2012 -0.0216 -0.0263 -0.0109 290 VAL A CG2   
1249 N N     . LEU A 163 ? 0.1564 0.1847 0.1862 -0.0221 -0.0518 -0.0172 291 LEU A N     
1250 C CA    . LEU A 163 ? 0.1550 0.1847 0.1697 -0.0205 -0.0559 -0.0149 291 LEU A CA    
1251 C C     . LEU A 163 ? 0.1918 0.2183 0.1878 -0.0204 -0.0532 -0.0154 291 LEU A C     
1252 O O     . LEU A 163 ? 0.1738 0.1976 0.1663 -0.0215 -0.0505 -0.0207 291 LEU A O     
1253 C CB    . LEU A 163 ? 0.1896 0.2225 0.2026 -0.0208 -0.0627 -0.0188 291 LEU A CB    
1254 C CG    . LEU A 163 ? 0.2041 0.2401 0.2364 -0.0211 -0.0654 -0.0181 291 LEU A CG    
1255 C CD1   . LEU A 163 ? 0.2464 0.2861 0.2753 -0.0212 -0.0735 -0.0216 291 LEU A CD1   
1256 C CD2   . LEU A 163 ? 0.2175 0.2549 0.2585 -0.0190 -0.0640 -0.0111 291 LEU A CD2   
1257 N N     . ARG A 164 ? 0.2813 0.3077 0.2664 -0.0187 -0.0529 -0.0095 292 ARG A N     
1258 C CA    . ARG A 164 ? 0.3142 0.3381 0.2817 -0.0186 -0.0488 -0.0090 292 ARG A CA    
1259 C C     . ARG A 164 ? 0.3098 0.3337 0.2659 -0.0181 -0.0510 -0.0162 292 ARG A C     
1260 O O     . ARG A 164 ? 0.3282 0.3498 0.2739 -0.0183 -0.0461 -0.0191 292 ARG A O     
1261 C CB    . ARG A 164 ? 0.3217 0.3452 0.2814 -0.0168 -0.0482 -0.0010 292 ARG A CB    
1262 C CG    . ARG A 164 ? 0.3469 0.3684 0.2912 -0.0168 -0.0421 0.0010  292 ARG A CG    
1263 C CD    . ARG A 164 ? 0.3799 0.4002 0.3294 -0.0178 -0.0341 -0.0005 292 ARG A CD    
1264 N NE    . ARG A 164 ? 0.3934 0.4128 0.3320 -0.0178 -0.0277 0.0013  292 ARG A NE    
1265 C CZ    . ARG A 164 ? 0.4001 0.4196 0.3281 -0.0179 -0.0247 -0.0035 292 ARG A CZ    
1266 N NH1   . ARG A 164 ? 0.4147 0.4344 0.3411 -0.0181 -0.0283 -0.0112 292 ARG A NH1   
1267 N NH2   . ARG A 164 ? 0.4109 0.4304 0.3314 -0.0178 -0.0178 -0.0012 292 ARG A NH2   
1268 N N     . SER A 165 ? 0.3844 0.4123 0.3437 -0.0176 -0.0576 -0.0197 293 SER A N     
1269 C CA    . SER A 165 ? 0.3610 0.3914 0.3111 -0.0185 -0.0598 -0.0276 293 SER A CA    
1270 C C     . SER A 165 ? 0.4080 0.4325 0.3637 -0.0226 -0.0571 -0.0341 293 SER A C     
1271 O O     . SER A 165 ? 0.4640 0.4828 0.4080 -0.0231 -0.0567 -0.0397 293 SER A O     
1272 C CB    . SER A 165 ? 0.3549 0.3903 0.3085 -0.0196 -0.0678 -0.0281 293 SER A CB    
1273 N N     . ASP A 166 ? 0.3578 0.3811 0.3322 -0.0230 -0.0553 -0.0337 294 ASP A N     
1274 C CA    . ASP A 166 ? 0.2771 0.2959 0.2610 -0.0241 -0.0518 -0.0399 294 ASP A CA    
1275 C C     . ASP A 166 ? 0.3635 0.3800 0.3401 -0.0227 -0.0445 -0.0411 294 ASP A C     
1276 O O     . ASP A 166 ? 0.3500 0.3632 0.3298 -0.0229 -0.0410 -0.0473 294 ASP A O     
1277 C CB    . ASP A 166 ? 0.3300 0.3493 0.3368 -0.0249 -0.0506 -0.0375 294 ASP A CB    
1278 C CG    . ASP A 166 ? 0.3627 0.3853 0.3812 -0.0260 -0.0560 -0.0373 294 ASP A CG    
1279 O OD1   . ASP A 166 ? 0.3758 0.3992 0.3887 -0.0268 -0.0612 -0.0422 294 ASP A OD1   
1280 O OD2   . ASP A 166 ? 0.2969 0.3215 0.3308 -0.0259 -0.0548 -0.0324 294 ASP A OD2   
1281 N N     . VAL A 167 ? 0.2835 0.3009 0.2523 -0.0213 -0.0401 -0.0332 295 VAL A N     
1282 C CA    . VAL A 167 ? 0.2256 0.2412 0.1938 -0.0202 -0.0311 -0.0309 295 VAL A CA    
1283 C C     . VAL A 167 ? 0.2137 0.2280 0.1689 -0.0195 -0.0275 -0.0367 295 VAL A C     
1284 O O     . VAL A 167 ? 0.2249 0.2372 0.1846 -0.0187 -0.0212 -0.0389 295 VAL A O     
1285 C CB    . VAL A 167 ? 0.1824 0.1995 0.1479 -0.0193 -0.0284 -0.0218 295 VAL A CB    
1286 C CG1   . VAL A 167 ? 0.2022 0.2186 0.1640 -0.0183 -0.0204 -0.0201 295 VAL A CG1   
1287 C CG2   . VAL A 167 ? 0.1963 0.2142 0.1766 -0.0193 -0.0293 -0.0171 295 VAL A CG2   
1288 N N     . ASP A 168 ? 0.2593 0.2751 0.1977 -0.0193 -0.0310 -0.0388 296 ASP A N     
1289 C CA    . ASP A 168 ? 0.2778 0.2915 0.2029 -0.0177 -0.0262 -0.0434 296 ASP A CA    
1290 C C     . ASP A 168 ? 0.2814 0.2917 0.2136 -0.0178 -0.0257 -0.0535 296 ASP A C     
1291 O O     . ASP A 168 ? 0.2726 0.2817 0.2042 -0.0166 -0.0186 -0.0575 296 ASP A O     
1292 C CB    . ASP A 168 ? 0.3598 0.3723 0.2673 -0.0159 -0.0304 -0.0415 296 ASP A CB    
1293 N N     . ALA A 169 ? 0.3589 0.3672 0.2998 -0.0192 -0.0328 -0.0574 297 ALA A N     
1294 C CA    . ALA A 169 ? 0.3618 0.3658 0.3117 -0.0196 -0.0325 -0.0664 297 ALA A CA    
1295 C C     . ALA A 169 ? 0.3087 0.3118 0.2755 -0.0196 -0.0263 -0.0671 297 ALA A C     
1296 O O     . ALA A 169 ? 0.3202 0.3197 0.2903 -0.0185 -0.0217 -0.0732 297 ALA A O     
1297 C CB    . ALA A 169 ? 0.3828 0.3860 0.3423 -0.0220 -0.0408 -0.0688 297 ALA A CB    
1298 N N     A LEU A 170 ? 0.2668 0.2718 0.2450 -0.0204 -0.0257 -0.0597 298 LEU A N     
1299 N N     B LEU A 170 ? 0.2590 0.2642 0.2360 -0.0203 -0.0255 -0.0594 298 LEU A N     
1300 C CA    A LEU A 170 ? 0.2199 0.2221 0.2126 -0.0195 -0.0193 -0.0561 298 LEU A CA    
1301 C CA    B LEU A 170 ? 0.2229 0.2255 0.2154 -0.0195 -0.0195 -0.0553 298 LEU A CA    
1302 C C     A LEU A 170 ? 0.2252 0.2279 0.2101 -0.0170 -0.0117 -0.0546 298 LEU A C     
1303 C C     B LEU A 170 ? 0.2218 0.2248 0.2082 -0.0171 -0.0117 -0.0528 298 LEU A C     
1304 O O     A LEU A 170 ? 0.2072 0.2069 0.2001 -0.0155 -0.0069 -0.0576 298 LEU A O     
1305 O O     B LEU A 170 ? 0.2239 0.2242 0.2207 -0.0156 -0.0069 -0.0528 298 LEU A O     
1306 C CB    A LEU A 170 ? 0.2166 0.2205 0.2198 -0.0199 -0.0193 -0.0463 298 LEU A CB    
1307 C CB    B LEU A 170 ? 0.2282 0.2327 0.2302 -0.0202 -0.0207 -0.0461 298 LEU A CB    
1308 C CG    A LEU A 170 ? 0.2085 0.2117 0.2273 -0.0221 -0.0242 -0.0468 298 LEU A CG    
1309 C CG    B LEU A 170 ? 0.2075 0.2096 0.2268 -0.0198 -0.0168 -0.0414 298 LEU A CG    
1310 C CD1   A LEU A 170 ? 0.2173 0.2238 0.2417 -0.0222 -0.0243 -0.0375 298 LEU A CD1   
1311 C CD1   B LEU A 170 ? 0.2221 0.2194 0.2556 -0.0209 -0.0174 -0.0479 298 LEU A CD1   
1312 C CD2   A LEU A 170 ? 0.2309 0.2289 0.2665 -0.0223 -0.0209 -0.0494 298 LEU A CD2   
1313 C CD2   B LEU A 170 ? 0.2196 0.2247 0.2450 -0.0207 -0.0191 -0.0344 298 LEU A CD2   
1314 N N     . GLN A 171 ? 0.1862 0.1928 0.1574 -0.0165 -0.0105 -0.0498 299 GLN A N     
1315 C CA    . GLN A 171 ? 0.1575 0.1655 0.1248 -0.0146 -0.0030 -0.0478 299 GLN A CA    
1316 C C     . GLN A 171 ? 0.1980 0.2042 0.1611 -0.0132 0.0009  -0.0572 299 GLN A C     
1317 O O     . GLN A 171 ? 0.1939 0.1997 0.1636 -0.0112 0.0071  -0.0578 299 GLN A O     
1318 C CB    . GLN A 171 ? 0.1710 0.1830 0.1257 -0.0148 -0.0021 -0.0413 299 GLN A CB    
1319 C CG    . GLN A 171 ? 0.1766 0.1908 0.1318 -0.0133 0.0056  -0.0385 299 GLN A CG    
1320 C CD    . GLN A 171 ? 0.2502 0.2677 0.2006 -0.0140 0.0066  -0.0301 299 GLN A CD    
1321 O OE1   . GLN A 171 ? 0.2167 0.2343 0.1645 -0.0152 0.0017  -0.0256 299 GLN A OE1   
1322 N NE2   . GLN A 171 ? 0.2536 0.2737 0.2051 -0.0132 0.0131  -0.0280 299 GLN A NE2   
1323 N N     . GLN A 172 ? 0.2244 0.2296 0.1772 -0.0140 -0.0032 -0.0654 300 GLN A N     
1324 C CA    . GLN A 172 ? 0.2371 0.2398 0.1853 -0.0121 0.0005  -0.0745 300 GLN A CA    
1325 C C     . GLN A 172 ? 0.2257 0.2234 0.1926 -0.0114 0.0022  -0.0805 300 GLN A C     
1326 O O     . GLN A 172 ? 0.2376 0.2340 0.2077 -0.0089 0.0087  -0.0841 300 GLN A O     
1327 C CB    . GLN A 172 ? 0.2949 0.2956 0.2287 -0.0121 -0.0055 -0.0782 300 GLN A CB    
1328 C CG    . GLN A 172 ? 0.3660 0.3698 0.2794 -0.0112 -0.0047 -0.0724 300 GLN A CG    
1329 N N     . VAL A 173 ? 0.2483 0.2431 0.2294 -0.0134 -0.0032 -0.0805 301 VAL A N     
1330 C CA    . VAL A 173 ? 0.2735 0.2623 0.2736 -0.0126 -0.0012 -0.0844 301 VAL A CA    
1331 C C     . VAL A 173 ? 0.2459 0.2350 0.2570 -0.0103 0.0051  -0.0760 301 VAL A C     
1332 O O     . VAL A 173 ? 0.2323 0.2177 0.2544 -0.0080 0.0095  -0.0792 301 VAL A O     
1333 C CB    . VAL A 173 ? 0.2991 0.2846 0.3132 -0.0153 -0.0078 -0.0844 301 VAL A CB    
1334 C CG1   . VAL A 173 ? 0.3413 0.3274 0.3443 -0.0167 -0.0148 -0.0891 301 VAL A CG1   
1335 C CG2   . VAL A 173 ? 0.2739 0.2616 0.2958 -0.0168 -0.0094 -0.0740 301 VAL A CG2   
1336 N N     . VAL A 174 ? 0.1654 0.1589 0.1739 -0.0105 0.0050  -0.0651 302 VAL A N     
1337 C CA    . VAL A 174 ? 0.1382 0.1330 0.1547 -0.0080 0.0099  -0.0573 302 VAL A CA    
1338 C C     . VAL A 174 ? 0.1898 0.1872 0.2015 -0.0054 0.0161  -0.0605 302 VAL A C     
1339 O O     . VAL A 174 ? 0.1717 0.1678 0.1949 -0.0025 0.0202  -0.0603 302 VAL A O     
1340 C CB    . VAL A 174 ? 0.1404 0.1394 0.1538 -0.0088 0.0079  -0.0468 302 VAL A CB    
1341 C CG1   . VAL A 174 ? 0.1566 0.1581 0.1758 -0.0061 0.0118  -0.0400 302 VAL A CG1   
1342 C CG2   . VAL A 174 ? 0.1662 0.1628 0.1882 -0.0107 0.0036  -0.0433 302 VAL A CG2   
1343 N N     . GLU A 175 ? 0.1726 0.1738 0.1679 -0.0062 0.0172  -0.0632 303 GLU A N     
1344 C CA    . GLU A 175 ? 0.1791 0.1835 0.1703 -0.0039 0.0245  -0.0662 303 GLU A CA    
1345 C C     . GLU A 175 ? 0.1887 0.1888 0.1868 -0.0015 0.0281  -0.0767 303 GLU A C     
1346 O O     . GLU A 175 ? 0.1947 0.1964 0.1998 0.0015  0.0347  -0.0778 303 GLU A O     
1347 C CB    . GLU A 175 ? 0.1753 0.1839 0.1466 -0.0052 0.0255  -0.0666 303 GLU A CB    
1348 C CG    . GLU A 175 ? 0.1882 0.2012 0.1562 -0.0067 0.0244  -0.0559 303 GLU A CG    
1349 C CD    . GLU A 175 ? 0.2984 0.3146 0.2477 -0.0082 0.0246  -0.0540 303 GLU A CD    
1350 O OE1   . GLU A 175 ? 0.3421 0.3570 0.2777 -0.0084 0.0236  -0.0609 303 GLU A OE1   
1351 O OE2   . GLU A 175 ? 0.2896 0.3092 0.2376 -0.0092 0.0256  -0.0456 303 GLU A OE2   
1352 N N     . GLU A 176 ? 0.1855 0.1803 0.1824 -0.0027 0.0239  -0.0851 304 GLU A N     
1353 C CA    . GLU A 176 ? 0.2023 0.1923 0.2067 -0.0004 0.0260  -0.0924 304 GLU A CA    
1354 C C     . GLU A 176 ? 0.2091 0.1956 0.2361 0.0019  0.0286  -0.0901 304 GLU A C     
1355 O O     . GLU A 176 ? 0.2161 0.2025 0.2503 0.0052  0.0339  -0.0919 304 GLU A O     
1356 C CB    . GLU A 176 ? 0.2321 0.2173 0.2333 -0.0025 0.0192  -0.0989 304 GLU A CB    
1357 C CG    . GLU A 176 ? 0.2838 0.2637 0.2929 -0.0004 0.0211  -0.1073 304 GLU A CG    
1358 N N     . ALA A 177 ? 0.1825 0.1660 0.2209 0.0006  0.0248  -0.0844 305 ALA A N     
1359 C CA    . ALA A 177 ? 0.1569 0.1368 0.2153 0.0033  0.0266  -0.0787 305 ALA A CA    
1360 C C     . ALA A 177 ? 0.1647 0.1507 0.2251 0.0066  0.0310  -0.0714 305 ALA A C     
1361 O O     . ALA A 177 ? 0.1715 0.1558 0.2464 0.0104  0.0346  -0.0712 305 ALA A O     
1362 C CB    . ALA A 177 ? 0.1700 0.1472 0.2360 0.0010  0.0215  -0.0699 305 ALA A CB    
1363 N N     . VAL A 178 ? 0.1398 0.1330 0.1877 0.0051  0.0303  -0.0653 306 VAL A N     
1364 C CA    . VAL A 178 ? 0.1370 0.1369 0.1880 0.0075  0.0335  -0.0588 306 VAL A CA    
1365 C C     . VAL A 178 ? 0.1634 0.1659 0.2164 0.0103  0.0407  -0.0660 306 VAL A C     
1366 O O     . VAL A 178 ? 0.1607 0.1659 0.2268 0.0139  0.0438  -0.0634 306 VAL A O     
1367 C CB    . VAL A 178 ? 0.1220 0.1281 0.1600 0.0047  0.0312  -0.0521 306 VAL A CB    
1368 C CG1   . VAL A 178 ? 0.1459 0.1595 0.1867 0.0065  0.0349  -0.0481 306 VAL A CG1   
1369 C CG2   . VAL A 178 ? 0.1152 0.1199 0.1548 0.0033  0.0254  -0.0438 306 VAL A CG2   
1370 N N     . GLY A 179 ? 0.1727 0.1748 0.2127 0.0090  0.0434  -0.0753 307 GLY A N     
1371 C CA    . GLY A 179 ? 0.1762 0.1809 0.2148 0.0113  0.0495  -0.0795 307 GLY A CA    
1372 C C     . GLY A 179 ? 0.2215 0.2212 0.2759 0.0146  0.0509  -0.0833 307 GLY A C     
1373 O O     . GLY A 179 ? 0.2432 0.2462 0.3046 0.0176  0.0559  -0.0835 307 GLY A O     
1374 N N     . GLN A 180 ? 0.1792 0.1710 0.2406 0.0140  0.0464  -0.0861 308 GLN A N     
1375 C CA    . GLN A 180 ? 0.1814 0.1679 0.2598 0.0169  0.0475  -0.0883 308 GLN A CA    
1376 C C     . GLN A 180 ? 0.1877 0.1752 0.2838 0.0199  0.0473  -0.0789 308 GLN A C     
1377 O O     . GLN A 180 ? 0.2379 0.2257 0.3466 0.0234  0.0501  -0.0784 308 GLN A O     
1378 C CB    . GLN A 180 ? 0.2132 0.1911 0.2950 0.0147  0.0427  -0.0933 308 GLN A CB    
1379 C CG    . GLN A 180 ? 0.2401 0.2170 0.3050 0.0126  0.0417  -0.1034 308 GLN A CG    
1380 C CD    . GLN A 180 ? 0.2701 0.2400 0.3390 0.0098  0.0357  -0.1078 308 GLN A CD    
1381 O OE1   . GLN A 180 ? 0.3085 0.2732 0.3956 0.0098  0.0338  -0.1044 308 GLN A OE1   
1382 N NE2   . GLN A 180 ? 0.3180 0.2879 0.3701 0.0074  0.0323  -0.1146 308 GLN A NE2   
1383 N N     . ALA A 181 ? 0.1718 0.1606 0.2682 0.0190  0.0438  -0.0709 309 ALA A N     
1384 C CA    . ALA A 181 ? 0.1629 0.1529 0.2736 0.0223  0.0423  -0.0608 309 ALA A CA    
1385 C C     . ALA A 181 ? 0.1444 0.1437 0.2572 0.0248  0.0453  -0.0579 309 ALA A C     
1386 O O     . ALA A 181 ? 0.1706 0.1711 0.2971 0.0285  0.0448  -0.0527 309 ALA A O     
1387 C CB    . ALA A 181 ? 0.1546 0.1442 0.2622 0.0207  0.0376  -0.0526 309 ALA A CB    
1388 N N     . LEU A 182 ? 0.1219 0.1280 0.2218 0.0226  0.0480  -0.0603 310 LEU A N     
1389 C CA    . LEU A 182 ? 0.1189 0.1343 0.2225 0.0242  0.0509  -0.0571 310 LEU A CA    
1390 C C     . LEU A 182 ? 0.1240 0.1441 0.2121 0.0213  0.0559  -0.0618 310 LEU A C     
1391 O O     . LEU A 182 ? 0.1178 0.1416 0.1944 0.0181  0.0551  -0.0594 310 LEU A O     
1392 C CB    . LEU A 182 ? 0.1054 0.1266 0.2144 0.0249  0.0465  -0.0476 310 LEU A CB    
1393 C CG    . LEU A 182 ? 0.1018 0.1330 0.2168 0.0259  0.0477  -0.0440 310 LEU A CG    
1394 C CD1   . LEU A 182 ? 0.1179 0.1495 0.2487 0.0301  0.0486  -0.0437 310 LEU A CD1   
1395 C CD2   . LEU A 182 ? 0.0938 0.1304 0.2103 0.0256  0.0419  -0.0361 310 LEU A CD2   
1396 N N     . PRO A 183 ? 0.1370 0.1568 0.2234 0.0224  0.0612  -0.0681 311 PRO A N     
1397 C CA    . PRO A 183 ? 0.1447 0.1688 0.2150 0.0203  0.0663  -0.0710 311 PRO A CA    
1398 C C     . PRO A 183 ? 0.1354 0.1686 0.2063 0.0190  0.0677  -0.0637 311 PRO A C     
1399 O O     . PRO A 183 ? 0.1283 0.1665 0.2151 0.0209  0.0671  -0.0589 311 PRO A O     
1400 C CB    . PRO A 183 ? 0.1601 0.1835 0.2344 0.0234  0.0723  -0.0775 311 PRO A CB    
1401 C CG    . PRO A 183 ? 0.1633 0.1781 0.2489 0.0254  0.0687  -0.0813 311 PRO A CG    
1402 C CD    . PRO A 183 ? 0.1476 0.1619 0.2452 0.0256  0.0626  -0.0731 311 PRO A CD    
1403 N N     . GLY A 184 ? 0.1379 0.1730 0.1918 0.0154  0.0685  -0.0625 312 GLY A N     
1404 C CA    . GLY A 184 ? 0.1405 0.1833 0.1945 0.0132  0.0697  -0.0555 312 GLY A CA    
1405 C C     . GLY A 184 ? 0.1362 0.1797 0.1907 0.0108  0.0633  -0.0499 312 GLY A C     
1406 O O     . GLY A 184 ? 0.1368 0.1855 0.1888 0.0081  0.0636  -0.0446 312 GLY A O     
1407 N N     . ALA A 185 ? 0.1216 0.1600 0.1802 0.0118  0.0580  -0.0509 313 ALA A N     
1408 C CA    . ALA A 185 ? 0.1099 0.1473 0.1651 0.0095  0.0498  -0.0438 313 ALA A CA    
1409 C C     . ALA A 185 ? 0.1214 0.1562 0.1568 0.0053  0.0482  -0.0435 313 ALA A C     
1410 O O     . ALA A 185 ? 0.1703 0.2015 0.1941 0.0046  0.0506  -0.0498 313 ALA A O     
1411 C CB    . ALA A 185 ? 0.1108 0.1419 0.1735 0.0117  0.0438  -0.0424 313 ALA A CB    
1412 N N     . THR A 186 ? 0.1224 0.1591 0.1542 0.0027  0.0434  -0.0366 314 THR A N     
1413 C CA    . THR A 186 ? 0.1337 0.1688 0.1489 -0.0010 0.0416  -0.0348 314 THR A CA    
1414 C C     . THR A 186 ? 0.1311 0.1619 0.1436 -0.0022 0.0334  -0.0312 314 THR A C     
1415 O O     . THR A 186 ? 0.1221 0.1526 0.1445 -0.0006 0.0296  -0.0281 314 THR A O     
1416 C CB    . THR A 186 ? 0.1307 0.1716 0.1447 -0.0033 0.0444  -0.0298 314 THR A CB    
1417 O OG1   . THR A 186 ? 0.1412 0.1854 0.1675 -0.0031 0.0402  -0.0248 314 THR A OG1   
1418 C CG2   . THR A 186 ? 0.1710 0.2169 0.1880 -0.0023 0.0541  -0.0328 314 THR A CG2   
1419 N N     . VAL A 187 ? 0.1100 0.1379 0.1090 -0.0048 0.0309  -0.0315 315 VAL A N     
1420 C CA    . VAL A 187 ? 0.0932 0.1175 0.0896 -0.0061 0.0240  -0.0285 315 VAL A CA    
1421 C C     . VAL A 187 ? 0.1047 0.1307 0.0919 -0.0088 0.0222  -0.0237 315 VAL A C     
1422 O O     . VAL A 187 ? 0.1451 0.1715 0.1207 -0.0102 0.0243  -0.0248 315 VAL A O     
1423 C CB    . VAL A 187 ? 0.0988 0.1177 0.0909 -0.0065 0.0215  -0.0340 315 VAL A CB    
1424 C CG1   . VAL A 187 ? 0.1134 0.1298 0.1051 -0.0081 0.0151  -0.0304 315 VAL A CG1   
1425 C CG2   . VAL A 187 ? 0.1216 0.1374 0.1250 -0.0037 0.0236  -0.0389 315 VAL A CG2   
1426 N N     . THR A 188 ? 0.0764 0.1032 0.0681 -0.0093 0.0185  -0.0184 316 THR A N     
1427 C CA    . THR A 188 ? 0.0796 0.1071 0.0655 -0.0116 0.0164  -0.0137 316 THR A CA    
1428 C C     . THR A 188 ? 0.0775 0.1019 0.0620 -0.0121 0.0104  -0.0119 316 THR A C     
1429 O O     . THR A 188 ? 0.0782 0.1018 0.0696 -0.0107 0.0083  -0.0112 316 THR A O     
1430 C CB    . THR A 188 ? 0.0944 0.1260 0.0887 -0.0117 0.0174  -0.0102 316 THR A CB    
1431 O OG1   . THR A 188 ? 0.1264 0.1618 0.1246 -0.0114 0.0236  -0.0118 316 THR A OG1   
1432 C CG2   . THR A 188 ? 0.1221 0.1533 0.1125 -0.0141 0.0155  -0.0056 316 THR A CG2   
1433 N N     . LEU A 189 ? 0.0935 0.1165 0.0692 -0.0138 0.0080  -0.0106 317 LEU A N     
1434 C CA    . LEU A 189 ? 0.0735 0.0946 0.0498 -0.0143 0.0028  -0.0085 317 LEU A CA    
1435 C C     . LEU A 189 ? 0.0818 0.1040 0.0633 -0.0142 0.0018  -0.0041 317 LEU A C     
1436 O O     . LEU A 189 ? 0.1029 0.1264 0.0836 -0.0153 0.0033  -0.0015 317 LEU A O     
1437 C CB    . LEU A 189 ? 0.0977 0.1178 0.0641 -0.0158 -0.0002 -0.0081 317 LEU A CB    
1438 C CG    . LEU A 189 ? 0.1024 0.1214 0.0710 -0.0162 -0.0058 -0.0060 317 LEU A CG    
1439 C CD1   . LEU A 189 ? 0.1056 0.1232 0.0817 -0.0157 -0.0077 -0.0092 317 LEU A CD1   
1440 C CD2   . LEU A 189 ? 0.1394 0.1582 0.0974 -0.0172 -0.0093 -0.0049 317 LEU A CD2   
1441 N N     A THR A 190 ? 0.0616 0.0831 0.0489 -0.0130 -0.0003 -0.0035 318 THR A N     
1442 N N     B THR A 190 ? 0.0662 0.0878 0.0535 -0.0130 -0.0004 -0.0035 318 THR A N     
1443 C CA    A THR A 190 ? 0.0521 0.0745 0.0431 -0.0124 -0.0016 -0.0009 318 THR A CA    
1444 C CA    B THR A 190 ? 0.0521 0.0745 0.0431 -0.0124 -0.0016 -0.0009 318 THR A CA    
1445 C C     A THR A 190 ? 0.0562 0.0771 0.0481 -0.0122 -0.0045 0.0005  318 THR A C     
1446 C C     B THR A 190 ? 0.0585 0.0794 0.0505 -0.0121 -0.0044 0.0004  318 THR A C     
1447 O O     A THR A 190 ? 0.0601 0.0798 0.0494 -0.0133 -0.0065 0.0006  318 THR A O     
1448 O O     B THR A 190 ? 0.0753 0.0949 0.0653 -0.0131 -0.0063 0.0001  318 THR A O     
1449 C CB    A THR A 190 ? 0.0645 0.0889 0.0609 -0.0103 -0.0006 -0.0015 318 THR A CB    
1450 C CB    B THR A 190 ? 0.0561 0.0807 0.0525 -0.0105 -0.0003 -0.0016 318 THR A CB    
1451 O OG1   A THR A 190 ? 0.0831 0.1063 0.0815 -0.0084 -0.0008 -0.0016 318 THR A OG1   
1452 O OG1   B THR A 190 ? 0.0544 0.0801 0.0532 -0.0099 -0.0021 -0.0006 318 THR A OG1   
1453 C CG2   A THR A 190 ? 0.0562 0.0830 0.0547 -0.0103 0.0023  -0.0031 318 THR A CG2   
1454 C CG2   B THR A 190 ? 0.0864 0.1100 0.0852 -0.0083 -0.0001 -0.0022 318 THR A CG2   
1455 N N     . GLY A 191 ? 0.0585 0.0798 0.0539 -0.0106 -0.0050 0.0014  319 GLY A N     
1456 C CA    . GLY A 191 ? 0.0579 0.0783 0.0553 -0.0099 -0.0064 0.0026  319 GLY A CA    
1457 C C     . GLY A 191 ? 0.0553 0.0747 0.0523 -0.0114 -0.0089 0.0041  319 GLY A C     
1458 O O     . GLY A 191 ? 0.0612 0.0802 0.0558 -0.0127 -0.0093 0.0052  319 GLY A O     
1459 N N     . GLY A 192 ? 0.0474 0.0666 0.0480 -0.0110 -0.0104 0.0048  320 GLY A N     
1460 C CA    . GLY A 192 ? 0.0494 0.0681 0.0518 -0.0114 -0.0133 0.0068  320 GLY A CA    
1461 C C     . GLY A 192 ? 0.0551 0.0731 0.0516 -0.0133 -0.0160 0.0080  320 GLY A C     
1462 O O     . GLY A 192 ? 0.0677 0.0846 0.0635 -0.0136 -0.0179 0.0110  320 GLY A O     
1463 N N     . PHE A 193 ? 0.0645 0.0830 0.0565 -0.0143 -0.0161 0.0058  321 PHE A N     
1464 C CA    . PHE A 193 ? 0.0853 0.1035 0.0688 -0.0156 -0.0184 0.0064  321 PHE A CA    
1465 C C     . PHE A 193 ? 0.0892 0.1068 0.0669 -0.0162 -0.0154 0.0089  321 PHE A C     
1466 O O     . PHE A 193 ? 0.1057 0.1225 0.0773 -0.0169 -0.0169 0.0126  321 PHE A O     
1467 C CB    . PHE A 193 ? 0.0736 0.0922 0.0535 -0.0163 -0.0189 0.0018  321 PHE A CB    
1468 C CG    . PHE A 193 ? 0.0812 0.1005 0.0680 -0.0165 -0.0234 -0.0001 321 PHE A CG    
1469 C CD1   . PHE A 193 ? 0.0926 0.1130 0.0783 -0.0168 -0.0296 0.0012  321 PHE A CD1   
1470 C CD2   . PHE A 193 ? 0.0828 0.1020 0.0784 -0.0164 -0.0215 -0.0027 321 PHE A CD2   
1471 C CE1   . PHE A 193 ? 0.1127 0.1347 0.1075 -0.0173 -0.0340 -0.0010 321 PHE A CE1   
1472 C CE2   . PHE A 193 ? 0.0817 0.1018 0.0865 -0.0170 -0.0249 -0.0042 321 PHE A CE2   
1473 C CZ    . PHE A 193 ? 0.1044 0.1263 0.1095 -0.0176 -0.0314 -0.0038 321 PHE A CZ    
1474 N N     . ARG A 194 ? 0.0743 0.0923 0.0548 -0.0160 -0.0112 0.0077  322 ARG A N     
1475 C CA    . ARG A 194 ? 0.0715 0.0894 0.0503 -0.0170 -0.0081 0.0101  322 ARG A CA    
1476 C C     . ARG A 194 ? 0.0863 0.1023 0.0698 -0.0172 -0.0096 0.0142  322 ARG A C     
1477 O O     . ARG A 194 ? 0.0977 0.1127 0.0797 -0.0186 -0.0079 0.0181  322 ARG A O     
1478 C CB    . ARG A 194 ? 0.0727 0.0925 0.0560 -0.0167 -0.0044 0.0073  322 ARG A CB    
1479 C CG    . ARG A 194 ? 0.0759 0.0966 0.0605 -0.0182 -0.0009 0.0095  322 ARG A CG    
1480 C CD    . ARG A 194 ? 0.0703 0.0942 0.0607 -0.0177 0.0021  0.0064  322 ARG A CD    
1481 N NE    . ARG A 194 ? 0.0901 0.1154 0.0843 -0.0196 0.0059  0.0086  322 ARG A NE    
1482 C CZ    . ARG A 194 ? 0.0939 0.1206 0.0985 -0.0202 0.0057  0.0084  322 ARG A CZ    
1483 N NH1   . ARG A 194 ? 0.0781 0.1048 0.0877 -0.0187 0.0018  0.0055  322 ARG A NH1   
1484 N NH2   . ARG A 194 ? 0.1059 0.1340 0.1159 -0.0225 0.0097  0.0110  322 ARG A NH2   
1485 N N     . ARG A 195 ? 0.0768 0.0920 0.0668 -0.0159 -0.0122 0.0136  323 ARG A N     
1486 C CA    . ARG A 195 ? 0.0844 0.0971 0.0804 -0.0156 -0.0138 0.0167  323 ARG A CA    
1487 C C     . ARG A 195 ? 0.1093 0.1206 0.1028 -0.0155 -0.0176 0.0214  323 ARG A C     
1488 O O     . ARG A 195 ? 0.1143 0.1230 0.1142 -0.0148 -0.0193 0.0244  323 ARG A O     
1489 C CB    . ARG A 195 ? 0.0650 0.0779 0.0687 -0.0135 -0.0143 0.0134  323 ARG A CB    
1490 C CG    . ARG A 195 ? 0.0661 0.0807 0.0708 -0.0129 -0.0118 0.0091  323 ARG A CG    
1491 C CD    . ARG A 195 ? 0.0644 0.0785 0.0747 -0.0107 -0.0121 0.0061  323 ARG A CD    
1492 N NE    . ARG A 195 ? 0.0689 0.0834 0.0809 -0.0088 -0.0127 0.0063  323 ARG A NE    
1493 C CZ    . ARG A 195 ? 0.0573 0.0741 0.0676 -0.0076 -0.0112 0.0051  323 ARG A CZ    
1494 N NH1   . ARG A 195 ? 0.0604 0.0787 0.0664 -0.0076 -0.0096 0.0038  323 ARG A NH1   
1495 N NH2   . ARG A 195 ? 0.0758 0.0934 0.0904 -0.0063 -0.0112 0.0057  323 ARG A NH2   
1496 N N     . GLY A 196 ? 0.0978 0.1106 0.0828 -0.0158 -0.0195 0.0217  324 GLY A N     
1497 C CA    . GLY A 196 ? 0.1018 0.1140 0.0828 -0.0154 -0.0244 0.0261  324 GLY A CA    
1498 C C     . GLY A 196 ? 0.1085 0.1226 0.0949 -0.0141 -0.0296 0.0243  324 GLY A C     
1499 O O     . GLY A 196 ? 0.1272 0.1415 0.1118 -0.0134 -0.0351 0.0280  324 GLY A O     
1500 N N     . LYS A 197 ? 0.0981 0.1138 0.0917 -0.0136 -0.0281 0.0194  325 LYS A N     
1501 C CA    . LYS A 197 ? 0.0986 0.1168 0.1001 -0.0127 -0.0322 0.0180  325 LYS A CA    
1502 C C     . LYS A 197 ? 0.1167 0.1368 0.1113 -0.0137 -0.0373 0.0166  325 LYS A C     
1503 O O     . LYS A 197 ? 0.1304 0.1502 0.1147 -0.0149 -0.0357 0.0140  325 LYS A O     
1504 C CB    . LYS A 197 ? 0.1037 0.1232 0.1132 -0.0121 -0.0283 0.0139  325 LYS A CB    
1505 C CG    . LYS A 197 ? 0.0983 0.1166 0.1140 -0.0105 -0.0244 0.0140  325 LYS A CG    
1506 C CD    . LYS A 197 ? 0.1137 0.1338 0.1348 -0.0093 -0.0201 0.0108  325 LYS A CD    
1507 C CE    . LYS A 197 ? 0.1281 0.1509 0.1601 -0.0085 -0.0213 0.0110  325 LYS A CE    
1508 N NZ    . LYS A 197 ? 0.1834 0.2078 0.2203 -0.0072 -0.0158 0.0095  325 LYS A NZ    
1509 N N     . LEU A 198 ? 0.1296 0.1519 0.1309 -0.0129 -0.0436 0.0176  326 LEU A N     
1510 C CA    . LEU A 198 ? 0.1503 0.1750 0.1466 -0.0138 -0.0502 0.0150  326 LEU A CA    
1511 C C     . LEU A 198 ? 0.1521 0.1793 0.1588 -0.0149 -0.0503 0.0090  326 LEU A C     
1512 O O     . LEU A 198 ? 0.1622 0.1906 0.1656 -0.0155 -0.0538 0.0043  326 LEU A O     
1513 C CB    . LEU A 198 ? 0.1850 0.2107 0.1839 -0.0116 -0.0560 0.0185  326 LEU A CB    
1514 C CG    . LEU A 198 ? 0.2393 0.2618 0.2289 -0.0103 -0.0559 0.0256  326 LEU A CG    
1515 C CD1   . LEU A 198 ? 0.3041 0.3279 0.2957 -0.0079 -0.0622 0.0288  326 LEU A CD1   
1516 C CD2   . LEU A 198 ? 0.2445 0.2652 0.2158 -0.0114 -0.0529 0.0257  326 LEU A CD2   
1517 N N     . GLN A 199 ? 0.1471 0.1745 0.1662 -0.0144 -0.0450 0.0086  327 GLN A N     
1518 C CA    . GLN A 199 ? 0.1418 0.1710 0.1724 -0.0154 -0.0433 0.0046  327 GLN A CA    
1519 C C     . GLN A 199 ? 0.1559 0.1830 0.1875 -0.0147 -0.0344 0.0048  327 GLN A C     
1520 O O     . GLN A 199 ? 0.1609 0.1862 0.1877 -0.0134 -0.0308 0.0073  327 GLN A O     
1521 C CB    . GLN A 199 ? 0.1865 0.2198 0.2350 -0.0148 -0.0466 0.0055  327 GLN A CB    
1522 C CG    . GLN A 199 ? 0.2598 0.2948 0.3081 -0.0141 -0.0538 0.0051  327 GLN A CG    
1523 C CD    . GLN A 199 ? 0.2640 0.3025 0.3312 -0.0130 -0.0542 0.0058  327 GLN A CD    
1524 O OE1   . GLN A 199 ? 0.2665 0.3057 0.3451 -0.0120 -0.0487 0.0076  327 GLN A OE1   
1525 N NE2   . GLN A 199 ? 0.3395 0.3804 0.4097 -0.0130 -0.0606 0.0041  327 GLN A NE2   
1526 N N     . GLY A 200 ? 0.1226 0.1500 0.1615 -0.0156 -0.0313 0.0022  328 GLY A N     
1527 C CA    . GLY A 200 ? 0.1041 0.1300 0.1432 -0.0144 -0.0235 0.0032  328 GLY A CA    
1528 C C     . GLY A 200 ? 0.1045 0.1311 0.1561 -0.0150 -0.0202 0.0027  328 GLY A C     
1529 O O     . GLY A 200 ? 0.1082 0.1362 0.1690 -0.0170 -0.0240 0.0003  328 GLY A O     
1530 N N     . HIS A 201 ? 0.0779 0.1038 0.1302 -0.0132 -0.0132 0.0051  329 HIS A N     
1531 C CA    . HIS A 201 ? 0.0728 0.0987 0.1357 -0.0135 -0.0084 0.0063  329 HIS A CA    
1532 C C     . HIS A 201 ? 0.0769 0.0992 0.1361 -0.0145 -0.0073 0.0045  329 HIS A C     
1533 O O     . HIS A 201 ? 0.0844 0.1055 0.1544 -0.0156 -0.0048 0.0051  329 HIS A O     
1534 C CB    . HIS A 201 ? 0.0803 0.1074 0.1443 -0.0105 -0.0010 0.0105  329 HIS A CB    
1535 C CG    . HIS A 201 ? 0.0964 0.1210 0.1523 -0.0087 0.0043  0.0126  329 HIS A CG    
1536 N ND1   . HIS A 201 ? 0.0700 0.0930 0.1121 -0.0072 0.0037  0.0117  329 HIS A ND1   
1537 C CD2   . HIS A 201 ? 0.1001 0.1237 0.1608 -0.0079 0.0102  0.0162  329 HIS A CD2   
1538 C CE1   . HIS A 201 ? 0.0971 0.1186 0.1355 -0.0053 0.0080  0.0142  329 HIS A CE1   
1539 N NE2   . HIS A 201 ? 0.1105 0.1321 0.1593 -0.0055 0.0123  0.0176  329 HIS A NE2   
1540 N N     . ASP A 202 ? 0.0651 0.0854 0.1110 -0.0143 -0.0090 0.0024  330 ASP A N     
1541 C CA    . ASP A 202 ? 0.0640 0.0810 0.1066 -0.0146 -0.0077 0.0003  330 ASP A CA    
1542 C C     . ASP A 202 ? 0.0540 0.0705 0.0838 -0.0149 -0.0108 -0.0030 330 ASP A C     
1543 O O     . ASP A 202 ? 0.0688 0.0870 0.0926 -0.0151 -0.0138 -0.0026 330 ASP A O     
1544 C CB    . ASP A 202 ? 0.0628 0.0785 0.1049 -0.0120 -0.0014 0.0045  330 ASP A CB    
1545 C CG    . ASP A 202 ? 0.0847 0.1015 0.1152 -0.0095 -0.0003 0.0060  330 ASP A CG    
1546 O OD1   . ASP A 202 ? 0.0602 0.0784 0.0847 -0.0101 -0.0035 0.0045  330 ASP A OD1   
1547 O OD2   . ASP A 202 ? 0.0745 0.0908 0.1026 -0.0070 0.0033  0.0090  330 ASP A OD2   
1548 N N     . VAL A 203 ? 0.0622 0.0762 0.0886 -0.0149 -0.0094 -0.0057 331 VAL A N     
1549 C CA    . VAL A 203 ? 0.0585 0.0725 0.0733 -0.0147 -0.0097 -0.0080 331 VAL A CA    
1550 C C     . VAL A 203 ? 0.0678 0.0811 0.0814 -0.0124 -0.0052 -0.0060 331 VAL A C     
1551 O O     . VAL A 203 ? 0.0708 0.0820 0.0910 -0.0115 -0.0027 -0.0057 331 VAL A O     
1552 C CB    . VAL A 203 ? 0.0855 0.0979 0.0971 -0.0163 -0.0123 -0.0143 331 VAL A CB    
1553 C CG1   . VAL A 203 ? 0.0980 0.1114 0.0966 -0.0161 -0.0117 -0.0157 331 VAL A CG1   
1554 C CG2   . VAL A 203 ? 0.1025 0.1159 0.1178 -0.0184 -0.0182 -0.0167 331 VAL A CG2   
1555 N N     . ASP A 204 ? 0.0604 0.0756 0.0668 -0.0115 -0.0045 -0.0046 332 ASP A N     
1556 C CA    . ASP A 204 ? 0.0519 0.0679 0.0577 -0.0093 -0.0017 -0.0031 332 ASP A CA    
1557 C C     . ASP A 204 ? 0.0661 0.0828 0.0676 -0.0097 -0.0006 -0.0061 332 ASP A C     
1558 O O     . ASP A 204 ? 0.0653 0.0832 0.0607 -0.0111 -0.0014 -0.0066 332 ASP A O     
1559 C CB    . ASP A 204 ? 0.0596 0.0778 0.0632 -0.0081 -0.0019 0.0001  332 ASP A CB    
1560 C CG    . ASP A 204 ? 0.0691 0.0872 0.0763 -0.0075 -0.0019 0.0027  332 ASP A CG    
1561 O OD1   . ASP A 204 ? 0.0664 0.0839 0.0771 -0.0056 0.0005  0.0051  332 ASP A OD1   
1562 O OD2   . ASP A 204 ? 0.0581 0.0769 0.0653 -0.0086 -0.0039 0.0029  332 ASP A OD2   
1563 N N     . PHE A 205 ? 0.0590 0.0750 0.0643 -0.0080 0.0018  -0.0073 333 PHE A N     
1564 C CA    . PHE A 205 ? 0.0619 0.0792 0.0654 -0.0078 0.0042  -0.0104 333 PHE A CA    
1565 C C     . PHE A 205 ? 0.0845 0.1044 0.0930 -0.0051 0.0057  -0.0084 333 PHE A C     
1566 O O     . PHE A 205 ? 0.0930 0.1121 0.1063 -0.0028 0.0053  -0.0056 333 PHE A O     
1567 C CB    . PHE A 205 ? 0.0897 0.1040 0.0951 -0.0079 0.0056  -0.0157 333 PHE A CB    
1568 C CG    . PHE A 205 ? 0.0904 0.1030 0.0904 -0.0104 0.0031  -0.0193 333 PHE A CG    
1569 C CD1   . PHE A 205 ? 0.0819 0.0963 0.0712 -0.0119 0.0025  -0.0206 333 PHE A CD1   
1570 C CD2   . PHE A 205 ? 0.0968 0.1059 0.1029 -0.0112 0.0010  -0.0215 333 PHE A CD2   
1571 C CE1   . PHE A 205 ? 0.0934 0.1067 0.0762 -0.0137 -0.0009 -0.0241 333 PHE A CE1   
1572 C CE2   . PHE A 205 ? 0.1010 0.1092 0.1027 -0.0135 -0.0028 -0.0258 333 PHE A CE2   
1573 C CZ    . PHE A 205 ? 0.1026 0.1131 0.0916 -0.0145 -0.0041 -0.0272 333 PHE A CZ    
1574 N N     . LEU A 206 ? 0.0592 0.0824 0.0668 -0.0054 0.0075  -0.0096 334 LEU A N     
1575 C CA    . LEU A 206 ? 0.0598 0.0868 0.0740 -0.0032 0.0082  -0.0086 334 LEU A CA    
1576 C C     . LEU A 206 ? 0.0690 0.0973 0.0871 -0.0026 0.0125  -0.0124 334 LEU A C     
1577 O O     . LEU A 206 ? 0.0775 0.1064 0.0904 -0.0046 0.0154  -0.0148 334 LEU A O     
1578 C CB    . LEU A 206 ? 0.0646 0.0954 0.0779 -0.0044 0.0067  -0.0068 334 LEU A CB    
1579 C CG    . LEU A 206 ? 0.0669 0.1028 0.0886 -0.0027 0.0064  -0.0067 334 LEU A CG    
1580 C CD1   . LEU A 206 ? 0.0815 0.1181 0.1072 0.0011  0.0032  -0.0047 334 LEU A CD1   
1581 C CD2   . LEU A 206 ? 0.0936 0.1323 0.1155 -0.0050 0.0047  -0.0059 334 LEU A CD2   
1582 N N     . ILE A 207 ? 0.0581 0.0867 0.0851 0.0007  0.0132  -0.0125 335 ILE A N     
1583 C CA    . ILE A 207 ? 0.0628 0.0920 0.0961 0.0022  0.0177  -0.0167 335 ILE A CA    
1584 C C     . ILE A 207 ? 0.0720 0.1076 0.1158 0.0045  0.0181  -0.0154 335 ILE A C     
1585 O O     . ILE A 207 ? 0.0600 0.0974 0.1082 0.0067  0.0138  -0.0115 335 ILE A O     
1586 C CB    . ILE A 207 ? 0.0697 0.0931 0.1081 0.0044  0.0179  -0.0182 335 ILE A CB    
1587 C CG1   . ILE A 207 ? 0.0820 0.0999 0.1127 0.0017  0.0169  -0.0204 335 ILE A CG1   
1588 C CG2   . ILE A 207 ? 0.0905 0.1142 0.1375 0.0068  0.0227  -0.0232 335 ILE A CG2   
1589 C CD1   . ILE A 207 ? 0.0955 0.1073 0.1337 0.0031  0.0162  -0.0203 335 ILE A CD1   
1590 N N     . THR A 208 ? 0.0707 0.1103 0.1187 0.0042  0.0233  -0.0187 336 THR A N     
1591 C CA    . THR A 208 ? 0.0724 0.1189 0.1340 0.0064  0.0240  -0.0180 336 THR A CA    
1592 C C     . THR A 208 ? 0.0718 0.1202 0.1399 0.0076  0.0317  -0.0230 336 THR A C     
1593 O O     . THR A 208 ? 0.0852 0.1291 0.1453 0.0068  0.0358  -0.0273 336 THR A O     
1594 C CB    . THR A 208 ? 0.0804 0.1325 0.1429 0.0037  0.0221  -0.0156 336 THR A CB    
1595 O OG1   . THR A 208 ? 0.0915 0.1508 0.1696 0.0060  0.0203  -0.0149 336 THR A OG1   
1596 C CG2   . THR A 208 ? 0.1000 0.1530 0.1562 -0.0001 0.0281  -0.0169 336 THR A CG2   
1597 N N     . HIS A 209 ? 0.0733 0.1290 0.1563 0.0094  0.0335  -0.0230 337 HIS A N     
1598 C CA    . HIS A 209 ? 0.0787 0.1376 0.1700 0.0109  0.0421  -0.0278 337 HIS A CA    
1599 C C     . HIS A 209 ? 0.0949 0.1635 0.1984 0.0097  0.0443  -0.0261 337 HIS A C     
1600 O O     . HIS A 209 ? 0.0928 0.1657 0.2052 0.0102  0.0375  -0.0225 337 HIS A O     
1601 C CB    . HIS A 209 ? 0.0825 0.1399 0.1870 0.0162  0.0423  -0.0299 337 HIS A CB    
1602 C CG    . HIS A 209 ? 0.1004 0.1581 0.2088 0.0176  0.0500  -0.0349 337 HIS A CG    
1603 N ND1   . HIS A 209 ? 0.1153 0.1797 0.2343 0.0182  0.0525  -0.0338 337 HIS A ND1   
1604 C CD2   . HIS A 209 ? 0.0978 0.1493 0.1999 0.0185  0.0549  -0.0408 337 HIS A CD2   
1605 C CE1   . HIS A 209 ? 0.1332 0.1961 0.2520 0.0195  0.0594  -0.0385 337 HIS A CE1   
1606 N NE2   . HIS A 209 ? 0.1263 0.1812 0.2343 0.0198  0.0606  -0.0431 337 HIS A NE2   
1607 N N     . PRO A 210 ? 0.1220 0.1925 0.2233 0.0081  0.0521  -0.0277 338 PRO A N     
1608 C CA    . PRO A 210 ? 0.1417 0.2192 0.2524 0.0060  0.0531  -0.0244 338 PRO A CA    
1609 C C     . PRO A 210 ? 0.1528 0.2358 0.2829 0.0091  0.0497  -0.0238 338 PRO A C     
1610 O O     . PRO A 210 ? 0.1640 0.2528 0.3039 0.0072  0.0477  -0.0213 338 PRO A O     
1611 C CB    . PRO A 210 ? 0.1662 0.2433 0.2680 0.0044  0.0629  -0.0257 338 PRO A CB    
1612 C CG    . PRO A 210 ? 0.1693 0.2403 0.2609 0.0070  0.0662  -0.0311 338 PRO A CG    
1613 C CD    . PRO A 210 ? 0.1351 0.2008 0.2224 0.0076  0.0593  -0.0318 338 PRO A CD    
1614 N N     A LYS A 211 ? 0.1041 0.1851 0.2403 0.0137  0.0487  -0.0259 339 LYS A N     
1615 N N     B LYS A 211 ? 0.1177 0.1986 0.2538 0.0137  0.0485  -0.0259 339 LYS A N     
1616 C CA    A LYS A 211 ? 0.1306 0.2165 0.2847 0.0172  0.0448  -0.0249 339 LYS A CA    
1617 C CA    B LYS A 211 ? 0.1331 0.2190 0.2870 0.0171  0.0448  -0.0249 339 LYS A CA    
1618 C C     A LYS A 211 ? 0.1503 0.2359 0.3074 0.0197  0.0340  -0.0218 339 LYS A C     
1619 C C     B LYS A 211 ? 0.1409 0.2265 0.2980 0.0197  0.0340  -0.0218 339 LYS A C     
1620 O O     A LYS A 211 ? 0.1285 0.2082 0.2810 0.0226  0.0319  -0.0217 339 LYS A O     
1621 O O     B LYS A 211 ? 0.1337 0.2134 0.2861 0.0225  0.0319  -0.0217 339 LYS A O     
1622 C CB    A LYS A 211 ? 0.1631 0.2469 0.3229 0.0210  0.0503  -0.0285 339 LYS A CB    
1623 C CB    B LYS A 211 ? 0.1495 0.2333 0.3090 0.0209  0.0504  -0.0285 339 LYS A CB    
1624 C CG    A LYS A 211 ? 0.1644 0.2531 0.3432 0.0249  0.0463  -0.0272 339 LYS A CG    
1625 C CG    B LYS A 211 ? 0.1277 0.2131 0.2839 0.0190  0.0610  -0.0315 339 LYS A CG    
1626 N N     . GLU A 212 ? 0.1367 0.2284 0.3011 0.0187  0.0271  -0.0191 340 GLU A N     
1627 C CA    . GLU A 212 ? 0.1188 0.2110 0.2834 0.0213  0.0162  -0.0160 340 GLU A CA    
1628 C C     . GLU A 212 ? 0.1466 0.2362 0.3166 0.0273  0.0135  -0.0145 340 GLU A C     
1629 O O     . GLU A 212 ? 0.1587 0.2510 0.3410 0.0298  0.0156  -0.0154 340 GLU A O     
1630 C CB    . GLU A 212 ? 0.1402 0.2397 0.3134 0.0199  0.0092  -0.0148 340 GLU A CB    
1631 C CG    . GLU A 212 ? 0.1464 0.2469 0.3161 0.0226  -0.0026 -0.0120 340 GLU A CG    
1632 C CD    . GLU A 212 ? 0.1867 0.2848 0.3431 0.0194  -0.0061 -0.0118 340 GLU A CD    
1633 O OE1   . GLU A 212 ? 0.1914 0.2873 0.3429 0.0149  0.0004  -0.0134 340 GLU A OE1   
1634 O OE2   . GLU A 212 ? 0.1935 0.2917 0.3437 0.0216  -0.0153 -0.0098 340 GLU A OE2   
1635 N N     . GLY A 213 ? 0.1385 0.2228 0.3001 0.0297  0.0089  -0.0118 341 GLY A N     
1636 C CA    . GLY A 213 ? 0.1453 0.2258 0.3106 0.0353  0.0057  -0.0087 341 GLY A CA    
1637 C C     . GLY A 213 ? 0.1361 0.2074 0.2982 0.0363  0.0126  -0.0107 341 GLY A C     
1638 O O     . GLY A 213 ? 0.1400 0.2054 0.3021 0.0402  0.0098  -0.0071 341 GLY A O     
1639 N N     . GLN A 214 ? 0.0980 0.1676 0.2566 0.0329  0.0215  -0.0163 342 GLN A N     
1640 C CA    . GLN A 214 ? 0.1013 0.1622 0.2561 0.0335  0.0277  -0.0201 342 GLN A CA    
1641 C C     . GLN A 214 ? 0.1035 0.1571 0.2474 0.0329  0.0255  -0.0184 342 GLN A C     
1642 O O     . GLN A 214 ? 0.1188 0.1638 0.2622 0.0344  0.0276  -0.0198 342 GLN A O     
1643 C CB    . GLN A 214 ? 0.1124 0.1739 0.2626 0.0300  0.0370  -0.0267 342 GLN A CB    
1644 C CG    . GLN A 214 ? 0.1221 0.1886 0.2842 0.0313  0.0416  -0.0290 342 GLN A CG    
1645 C CD    . GLN A 214 ? 0.1731 0.2353 0.3462 0.0362  0.0415  -0.0298 342 GLN A CD    
1646 O OE1   . GLN A 214 ? 0.1614 0.2159 0.3306 0.0368  0.0457  -0.0341 342 GLN A OE1   
1647 N NE2   . GLN A 214 ? 0.1442 0.2111 0.3309 0.0396  0.0360  -0.0255 342 GLN A NE2   
1648 N N     . GLU A 215 ? 0.1212 0.1777 0.2572 0.0306  0.0211  -0.0154 343 GLU A N     
1649 C CA    . GLU A 215 ? 0.1131 0.1610 0.2328 0.0285  0.0185  -0.0127 343 GLU A CA    
1650 C C     . GLU A 215 ? 0.1068 0.1506 0.2291 0.0329  0.0127  -0.0057 343 GLU A C     
1651 O O     . GLU A 215 ? 0.1179 0.1540 0.2301 0.0317  0.0121  -0.0032 343 GLU A O     
1652 C CB    . GLU A 215 ? 0.1343 0.1848 0.2400 0.0237  0.0154  -0.0113 343 GLU A CB    
1653 C CG    . GLU A 215 ? 0.1564 0.2119 0.2621 0.0253  0.0070  -0.0059 343 GLU A CG    
1654 C CD    . GLU A 215 ? 0.1643 0.2295 0.2867 0.0282  0.0042  -0.0059 343 GLU A CD    
1655 O OE1   . GLU A 215 ? 0.1310 0.2013 0.2643 0.0272  0.0098  -0.0103 343 GLU A OE1   
1656 O OE2   . GLU A 215 ? 0.2030 0.2713 0.3278 0.0318  -0.0036 -0.0015 343 GLU A OE2   
1657 N N     . ALA A 216 ? 0.1027 0.1515 0.2387 0.0382  0.0087  -0.0019 344 ALA A N     
1658 C CA    . ALA A 216 ? 0.1273 0.1722 0.2646 0.0431  0.0033  0.0063  344 ALA A CA    
1659 C C     . ALA A 216 ? 0.1315 0.1652 0.2710 0.0439  0.0080  0.0062  344 ALA A C     
1660 O O     . ALA A 216 ? 0.1239 0.1548 0.2705 0.0433  0.0137  -0.0002 344 ALA A O     
1661 C CB    . ALA A 216 ? 0.1744 0.2249 0.3203 0.0472  -0.0020 0.0094  344 ALA A CB    
1662 N N     . GLY A 217 ? 0.1370 0.1638 0.2690 0.0445  0.0060  0.0129  345 GLY A N     
1663 C CA    . GLY A 217 ? 0.1579 0.1736 0.2941 0.0448  0.0099  0.0136  345 GLY A CA    
1664 C C     . GLY A 217 ? 0.1213 0.1314 0.2530 0.0395  0.0156  0.0052  345 GLY A C     
1665 O O     . GLY A 217 ? 0.1319 0.1329 0.2706 0.0396  0.0188  0.0037  345 GLY A O     
1666 N N     . LEU A 218 ? 0.0980 0.1126 0.2170 0.0345  0.0162  -0.0002 346 LEU A N     
1667 C CA    . LEU A 218 ? 0.0886 0.0993 0.2017 0.0297  0.0208  -0.0089 346 LEU A CA    
1668 C C     . LEU A 218 ? 0.0925 0.0955 0.1981 0.0265  0.0201  -0.0069 346 LEU A C     
1669 O O     . LEU A 218 ? 0.1159 0.1122 0.2240 0.0245  0.0230  -0.0131 346 LEU A O     
1670 C CB    . LEU A 218 ? 0.0936 0.1118 0.1961 0.0258  0.0215  -0.0134 346 LEU A CB    
1671 C CG    . LEU A 218 ? 0.1190 0.1344 0.2116 0.0211  0.0254  -0.0216 346 LEU A CG    
1672 C CD1   . LEU A 218 ? 0.1379 0.1486 0.2392 0.0226  0.0308  -0.0299 346 LEU A CD1   
1673 C CD2   . LEU A 218 ? 0.1306 0.1538 0.2146 0.0182  0.0267  -0.0238 346 LEU A CD2   
1674 N N     . LEU A 219 ? 0.1049 0.1092 0.2015 0.0258  0.0163  0.0007  347 LEU A N     
1675 C CA    . LEU A 219 ? 0.0993 0.0980 0.1891 0.0220  0.0165  0.0015  347 LEU A CA    
1676 C C     . LEU A 219 ? 0.0969 0.0862 0.1987 0.0231  0.0186  0.0034  347 LEU A C     
1677 O O     . LEU A 219 ? 0.1160 0.1003 0.2183 0.0192  0.0201  -0.0020 347 LEU A O     
1678 C CB    . LEU A 219 ? 0.1261 0.1285 0.2045 0.0215  0.0131  0.0090  347 LEU A CB    
1679 C CG    . LEU A 219 ? 0.1310 0.1306 0.2014 0.0169  0.0135  0.0084  347 LEU A CG    
1680 C CD1   . LEU A 219 ? 0.1328 0.1325 0.1990 0.0123  0.0145  -0.0012 347 LEU A CD1   
1681 C CD2   . LEU A 219 ? 0.1658 0.1703 0.2244 0.0169  0.0108  0.0139  347 LEU A CD2   
1682 N N     . PRO A 220 ? 0.1240 0.1105 0.2371 0.0281  0.0186  0.0105  348 PRO A N     
1683 C CA    . PRO A 220 ? 0.1456 0.1219 0.2729 0.0287  0.0213  0.0118  348 PRO A CA    
1684 C C     . PRO A 220 ? 0.1260 0.0976 0.2619 0.0268  0.0243  -0.0007 348 PRO A C     
1685 O O     . PRO A 220 ? 0.1512 0.1147 0.2943 0.0241  0.0258  -0.0040 348 PRO A O     
1686 C CB    . PRO A 220 ? 0.1507 0.1264 0.2870 0.0349  0.0202  0.0213  348 PRO A CB    
1687 C CG    . PRO A 220 ? 0.1917 0.1765 0.3164 0.0376  0.0161  0.0279  348 PRO A CG    
1688 C CD    . PRO A 220 ? 0.1520 0.1441 0.2653 0.0334  0.0154  0.0186  348 PRO A CD    
1689 N N     . ARG A 221 ? 0.1166 0.0932 0.2525 0.0282  0.0254  -0.0083 349 ARG A N     
1690 C CA    . ARG A 221 ? 0.1208 0.0936 0.2618 0.0268  0.0288  -0.0210 349 ARG A CA    
1691 C C     . ARG A 221 ? 0.1139 0.0861 0.2426 0.0209  0.0285  -0.0294 349 ARG A C     
1692 O O     . ARG A 221 ? 0.1276 0.0934 0.2610 0.0188  0.0298  -0.0385 349 ARG A O     
1693 C CB    . ARG A 221 ? 0.1153 0.0953 0.2567 0.0293  0.0308  -0.0258 349 ARG A CB    
1694 C CG    . ARG A 221 ? 0.1200 0.1008 0.2729 0.0339  0.0297  -0.0185 349 ARG A CG    
1695 C CD    . ARG A 221 ? 0.1286 0.1176 0.2836 0.0364  0.0313  -0.0221 349 ARG A CD    
1696 N NE    . ARG A 221 ? 0.1242 0.1134 0.2762 0.0341  0.0362  -0.0345 349 ARG A NE    
1697 C CZ    . ARG A 221 ? 0.1357 0.1194 0.2953 0.0344  0.0391  -0.0410 349 ARG A CZ    
1698 N NH1   . ARG A 221 ? 0.1428 0.1202 0.3153 0.0366  0.0377  -0.0362 349 ARG A NH1   
1699 N NH2   . ARG A 221 ? 0.1417 0.1262 0.2952 0.0326  0.0434  -0.0521 349 ARG A NH2   
1700 N N     . VAL A 222 ? 0.1311 0.1104 0.2436 0.0181  0.0261  -0.0266 350 VAL A N     
1701 C CA    . VAL A 222 ? 0.1046 0.0842 0.2047 0.0127  0.0246  -0.0325 350 VAL A CA    
1702 C C     . VAL A 222 ? 0.1239 0.0966 0.2299 0.0101  0.0227  -0.0299 350 VAL A C     
1703 O O     . VAL A 222 ? 0.1379 0.1064 0.2449 0.0068  0.0220  -0.0384 350 VAL A O     
1704 C CB    . VAL A 222 ? 0.1043 0.0925 0.1886 0.0110  0.0224  -0.0283 350 VAL A CB    
1705 C CG1   . VAL A 222 ? 0.1239 0.1123 0.1962 0.0060  0.0201  -0.0323 350 VAL A CG1   
1706 C CG2   . VAL A 222 ? 0.1206 0.1156 0.2012 0.0126  0.0248  -0.0315 350 VAL A CG2   
1707 N N     . MET A 223 ? 0.1519 0.1237 0.2625 0.0116  0.0221  -0.0184 351 MET A N     
1708 C CA    . MET A 223 ? 0.1684 0.1348 0.2853 0.0087  0.0214  -0.0148 351 MET A CA    
1709 C C     . MET A 223 ? 0.1887 0.1453 0.3238 0.0085  0.0232  -0.0199 351 MET A C     
1710 O O     . MET A 223 ? 0.2023 0.1547 0.3429 0.0043  0.0220  -0.0244 351 MET A O     
1711 C CB    . MET A 223 ? 0.2005 0.1680 0.3171 0.0110  0.0217  -0.0006 351 MET A CB    
1712 C CG    . MET A 223 ? 0.1902 0.1664 0.2897 0.0105  0.0195  0.0038  351 MET A CG    
1713 S SD    . MET A 223 ? 0.2014 0.1808 0.2901 0.0045  0.0170  -0.0039 351 MET A SD    
1714 C CE    . MET A 223 ? 0.2330 0.2054 0.3359 0.0013  0.0180  -0.0018 351 MET A CE    
1715 N N     A CYS A 224 ? 0.1752 0.1288 0.3208 0.0128  0.0255  -0.0197 352 CYS A N     
1716 N N     B CYS A 224 ? 0.1769 0.1304 0.3226 0.0127  0.0255  -0.0198 352 CYS A N     
1717 C CA    A CYS A 224 ? 0.2126 0.1612 0.3716 0.0117  0.0263  -0.0238 352 CYS A CA    
1718 C CA    B CYS A 224 ? 0.2123 0.1607 0.3715 0.0112  0.0262  -0.0237 352 CYS A CA    
1719 C C     A CYS A 224 ? 0.2062 0.1543 0.3618 0.0082  0.0251  -0.0391 352 CYS A C     
1720 C C     B CYS A 224 ? 0.2066 0.1547 0.3626 0.0082  0.0252  -0.0394 352 CYS A C     
1721 O O     A CYS A 224 ? 0.2216 0.1664 0.3856 0.0050  0.0239  -0.0434 352 CYS A O     
1722 O O     B CYS A 224 ? 0.2342 0.1787 0.3990 0.0053  0.0241  -0.0442 352 CYS A O     
1723 C CB    A CYS A 224 ? 0.2418 0.1901 0.4092 0.0165  0.0283  -0.0205 352 CYS A CB    
1724 C CB    B CYS A 224 ? 0.2510 0.1982 0.4202 0.0159  0.0282  -0.0187 352 CYS A CB    
1725 S SG    A CYS A 224 ? 0.3256 0.2734 0.4985 0.0203  0.0287  -0.0019 352 CYS A SG    
1726 S SG    B CYS A 224 ? 0.2809 0.2317 0.4473 0.0192  0.0298  -0.0286 352 CYS A SG    
1727 N N     . ARG A 225 ? 0.1612 0.1137 0.3037 0.0088  0.0254  -0.0472 353 ARG A N     
1728 C CA    . ARG A 225 ? 0.1661 0.1193 0.3006 0.0060  0.0242  -0.0610 353 ARG A CA    
1729 C C     . ARG A 225 ? 0.1766 0.1302 0.3038 0.0010  0.0197  -0.0638 353 ARG A C     
1730 O O     . ARG A 225 ? 0.2110 0.1633 0.3389 -0.0018 0.0169  -0.0722 353 ARG A O     
1731 C CB    . ARG A 225 ? 0.1766 0.1357 0.2977 0.0083  0.0268  -0.0664 353 ARG A CB    
1732 C CG    . ARG A 225 ? 0.1887 0.1475 0.3192 0.0126  0.0308  -0.0674 353 ARG A CG    
1733 C CD    . ARG A 225 ? 0.1723 0.1384 0.2941 0.0155  0.0343  -0.0685 353 ARG A CD    
1734 N NE    . ARG A 225 ? 0.1715 0.1366 0.3050 0.0192  0.0376  -0.0700 353 ARG A NE    
1735 C CZ    . ARG A 225 ? 0.1879 0.1516 0.3359 0.0226  0.0378  -0.0610 353 ARG A CZ    
1736 N NH1   . ARG A 225 ? 0.1640 0.1277 0.3150 0.0234  0.0352  -0.0493 353 ARG A NH1   
1737 N NH2   . ARG A 225 ? 0.1737 0.1362 0.3326 0.0256  0.0404  -0.0635 353 ARG A NH2   
1738 N N     . LEU A 226 ? 0.1703 0.1262 0.2914 -0.0002 0.0184  -0.0568 354 LEU A N     
1739 C CA    . LEU A 226 ? 0.1517 0.1088 0.2682 -0.0051 0.0137  -0.0582 354 LEU A CA    
1740 C C     . LEU A 226 ? 0.1688 0.1224 0.3020 -0.0071 0.0126  -0.0544 354 LEU A C     
1741 O O     . LEU A 226 ? 0.1724 0.1268 0.3062 -0.0107 0.0083  -0.0601 354 LEU A O     
1742 C CB    . LEU A 226 ? 0.1364 0.1007 0.2404 -0.0056 0.0127  -0.0481 354 LEU A CB    
1743 C CG    . LEU A 226 ? 0.1433 0.1156 0.2276 -0.0047 0.0126  -0.0495 354 LEU A CG    
1744 C CD1   . LEU A 226 ? 0.1343 0.1122 0.2117 -0.0042 0.0122  -0.0377 354 LEU A CD1   
1745 C CD2   . LEU A 226 ? 0.1961 0.1705 0.2679 -0.0079 0.0088  -0.0594 354 LEU A CD2   
1746 N N     . GLN A 227 ? 0.1765 0.1268 0.3230 -0.0047 0.0162  -0.0442 355 GLN A N     
1747 C CA    . GLN A 227 ? 0.1962 0.1439 0.3594 -0.0063 0.0164  -0.0396 355 GLN A CA    
1748 C C     . GLN A 227 ? 0.1969 0.1416 0.3696 -0.0071 0.0152  -0.0502 355 GLN A C     
1749 O O     . GLN A 227 ? 0.2218 0.1661 0.4035 -0.0102 0.0126  -0.0534 355 GLN A O     
1750 C CB    . GLN A 227 ? 0.2147 0.1604 0.3870 -0.0030 0.0209  -0.0254 355 GLN A CB    
1751 C CG    . GLN A 227 ? 0.2774 0.2213 0.4663 -0.0045 0.0224  -0.0188 355 GLN A CG    
1752 N N     . ASP A 228 ? 0.2484 0.1915 0.4191 -0.0042 0.0170  -0.0565 356 ASP A N     
1753 C CA    . ASP A 228 ? 0.2817 0.2219 0.4599 -0.0047 0.0161  -0.0677 356 ASP A CA    
1754 C C     . ASP A 228 ? 0.3272 0.2697 0.4946 -0.0081 0.0107  -0.0795 356 ASP A C     
1755 O O     . ASP A 228 ? 0.3772 0.3173 0.5539 -0.0099 0.0082  -0.0869 356 ASP A O     
1756 C CB    . ASP A 228 ? 0.2804 0.2195 0.4563 -0.0007 0.0195  -0.0722 356 ASP A CB    
1757 N N     . GLN A 229 ? 0.2520 0.1992 0.3998 -0.0089 0.0086  -0.0815 357 GLN A N     
1758 C CA    . GLN A 229 ? 0.2451 0.1951 0.3802 -0.0117 0.0029  -0.0913 357 GLN A CA    
1759 C C     . GLN A 229 ? 0.2411 0.1928 0.3826 -0.0155 -0.0020 -0.0881 357 GLN A C     
1760 O O     . GLN A 229 ? 0.2881 0.2427 0.4193 -0.0178 -0.0078 -0.0949 357 GLN A O     
1761 C CB    . GLN A 229 ? 0.2691 0.2242 0.3806 -0.0110 0.0025  -0.0936 357 GLN A CB    
1762 C CG    . GLN A 229 ? 0.3270 0.2821 0.4303 -0.0073 0.0074  -0.0986 357 GLN A CG    
1763 C CD    . GLN A 229 ? 0.3834 0.3443 0.4634 -0.0068 0.0076  -0.1004 357 GLN A CD    
1764 N N     . GLY A 230 ? 0.2084 0.1587 0.3660 -0.0159 0.0004  -0.0773 358 GLY A N     
1765 C CA    . GLY A 230 ? 0.1867 0.1391 0.3531 -0.0192 -0.0031 -0.0739 358 GLY A CA    
1766 C C     . GLY A 230 ? 0.1805 0.1385 0.3346 -0.0207 -0.0055 -0.0689 358 GLY A C     
1767 O O     . GLY A 230 ? 0.1867 0.1477 0.3454 -0.0234 -0.0094 -0.0681 358 GLY A O     
1768 N N     . LEU A 231 ? 0.1631 0.1228 0.3028 -0.0191 -0.0034 -0.0657 359 LEU A N     
1769 C CA    . LEU A 231 ? 0.1450 0.1100 0.2717 -0.0206 -0.0060 -0.0621 359 LEU A CA    
1770 C C     . LEU A 231 ? 0.1505 0.1164 0.2837 -0.0204 -0.0022 -0.0490 359 LEU A C     
1771 O O     . LEU A 231 ? 0.1630 0.1339 0.2889 -0.0219 -0.0043 -0.0455 359 LEU A O     
1772 C CB    . LEU A 231 ? 0.1613 0.1284 0.2679 -0.0190 -0.0059 -0.0667 359 LEU A CB    
1773 C CG    . LEU A 231 ? 0.2217 0.1895 0.3161 -0.0190 -0.0095 -0.0787 359 LEU A CG    
1774 C CD1   . LEU A 231 ? 0.2840 0.2539 0.3605 -0.0167 -0.0067 -0.0817 359 LEU A CD1   
1775 C CD2   . LEU A 231 ? 0.2689 0.2409 0.3566 -0.0220 -0.0170 -0.0816 359 LEU A CD2   
1776 N N     . ILE A 232 ? 0.1371 0.0990 0.2827 -0.0182 0.0035  -0.0411 360 ILE A N     
1777 C CA    . ILE A 232 ? 0.1285 0.0912 0.2767 -0.0171 0.0080  -0.0277 360 ILE A CA    
1778 C C     . ILE A 232 ? 0.1538 0.1171 0.3179 -0.0182 0.0095  -0.0217 360 ILE A C     
1779 O O     . ILE A 232 ? 0.1772 0.1369 0.3557 -0.0174 0.0119  -0.0207 360 ILE A O     
1780 C CB    . ILE A 232 ? 0.1575 0.1163 0.3058 -0.0129 0.0133  -0.0208 360 ILE A CB    
1781 C CG1   . ILE A 232 ? 0.1519 0.1113 0.2854 -0.0110 0.0123  -0.0273 360 ILE A CG1   
1782 C CG2   . ILE A 232 ? 0.1623 0.1228 0.3095 -0.0111 0.0175  -0.0063 360 ILE A CG2   
1783 C CD1   . ILE A 232 ? 0.1511 0.1196 0.2646 -0.0116 0.0096  -0.0260 360 ILE A CD1   
1784 N N     . LEU A 233 ? 0.1169 0.0852 0.2793 -0.0199 0.0087  -0.0173 361 LEU A N     
1785 C CA    . LEU A 233 ? 0.1376 0.1074 0.3144 -0.0204 0.0115  -0.0104 361 LEU A CA    
1786 C C     . LEU A 233 ? 0.1399 0.1095 0.3174 -0.0172 0.0191  0.0035  361 LEU A C     
1787 O O     . LEU A 233 ? 0.1707 0.1395 0.3618 -0.0164 0.0233  0.0097  361 LEU A O     
1788 C CB    . LEU A 233 ? 0.1157 0.0916 0.2908 -0.0229 0.0075  -0.0123 361 LEU A CB    
1789 C CG    . LEU A 233 ? 0.1229 0.1000 0.2980 -0.0257 -0.0008 -0.0248 361 LEU A CG    
1790 C CD1   . LEU A 233 ? 0.1433 0.1268 0.3109 -0.0274 -0.0060 -0.0265 361 LEU A CD1   
1791 C CD2   . LEU A 233 ? 0.1393 0.1144 0.3350 -0.0267 -0.0009 -0.0271 361 LEU A CD2   
1792 N N     . TYR A 234 ? 0.1598 0.1303 0.3224 -0.0151 0.0209  0.0085  362 TYR A N     
1793 C CA    . TYR A 234 ? 0.1589 0.1295 0.3175 -0.0113 0.0272  0.0214  362 TYR A CA    
1794 C C     . TYR A 234 ? 0.1664 0.1360 0.3100 -0.0086 0.0271  0.0232  362 TYR A C     
1795 O O     . TYR A 234 ? 0.1496 0.1218 0.2819 -0.0100 0.0233  0.0175  362 TYR A O     
1796 C CB    . TYR A 234 ? 0.1951 0.1715 0.3506 -0.0111 0.0302  0.0284  362 TYR A CB    
1797 C CG    . TYR A 234 ? 0.2042 0.1818 0.3495 -0.0065 0.0360  0.0404  362 TYR A CG    
1798 C CD1   . TYR A 234 ? 0.2682 0.2445 0.4209 -0.0038 0.0415  0.0490  362 TYR A CD1   
1799 C CD2   . TYR A 234 ? 0.2471 0.2274 0.3747 -0.0046 0.0356  0.0428  362 TYR A CD2   
1800 C CE1   . TYR A 234 ? 0.2648 0.2427 0.4054 0.0009  0.0460  0.0594  362 TYR A CE1   
1801 C CE2   . TYR A 234 ? 0.2801 0.2621 0.3961 0.0002  0.0397  0.0526  362 TYR A CE2   
1802 C CZ    . TYR A 234 ? 0.3031 0.2840 0.4248 0.0030  0.0446  0.0606  362 TYR A CZ    
1803 O OH    . TYR A 234 ? 0.4155 0.3986 0.5234 0.0081  0.0477  0.0695  362 TYR A OH    
1804 N N     A HIS A 235 ? 0.1738 0.1406 0.3167 -0.0043 0.0306  0.0309  363 HIS A N     
1805 N N     B HIS A 235 ? 0.1766 0.1436 0.3194 -0.0042 0.0307  0.0312  363 HIS A N     
1806 C CA    A HIS A 235 ? 0.1890 0.1561 0.3173 -0.0002 0.0307  0.0355  363 HIS A CA    
1807 C CA    B HIS A 235 ? 0.1907 0.1575 0.3197 -0.0001 0.0307  0.0353  363 HIS A CA    
1808 C C     A HIS A 235 ? 0.2141 0.1818 0.3405 0.0048  0.0349  0.0477  363 HIS A C     
1809 C C     B HIS A 235 ? 0.2148 0.1825 0.3412 0.0048  0.0349  0.0478  363 HIS A C     
1810 O O     A HIS A 235 ? 0.2435 0.2098 0.3818 0.0048  0.0380  0.0515  363 HIS A O     
1811 O O     B HIS A 235 ? 0.2395 0.2062 0.3773 0.0048  0.0383  0.0520  363 HIS A O     
1812 C CB    A HIS A 235 ? 0.1915 0.1573 0.3169 0.0008  0.0267  0.0259  363 HIS A CB    
1813 C CB    B HIS A 235 ? 0.1897 0.1537 0.3188 0.0008  0.0272  0.0261  363 HIS A CB    
1814 C CG    A HIS A 235 ? 0.1923 0.1506 0.3339 0.0017  0.0281  0.0243  363 HIS A CG    
1815 C CG    B HIS A 235 ? 0.1810 0.1481 0.2980 0.0062  0.0265  0.0298  363 HIS A CG    
1816 N N     . GLN A 236 ? 0.2718 0.2422 0.3828 0.0092  0.0344  0.0535  364 GLN A N     
1817 C CA    . GLN A 236 ? 0.3530 0.3256 0.4575 0.0142  0.0372  0.0644  364 GLN A CA    
1818 C C     . GLN A 236 ? 0.3859 0.3543 0.5003 0.0169  0.0374  0.0670  364 GLN A C     
1819 O O     . GLN A 236 ? 0.4355 0.4050 0.5463 0.0206  0.0397  0.0763  364 GLN A O     
1820 C CB    . GLN A 236 ? 0.3574 0.3353 0.4419 0.0184  0.0347  0.0677  364 GLN A CB    
1821 N N     . HIS A 237 ? 0.4554 0.4191 0.5814 0.0152  0.0353  0.0587  365 HIS A N     
1822 C CA    . HIS A 237 ? 0.4680 0.4280 0.6039 0.0180  0.0355  0.0605  365 HIS A CA    
1823 C C     . HIS A 237 ? 0.4893 0.4438 0.6448 0.0142  0.0365  0.0531  365 HIS A C     
1824 O O     . HIS A 237 ? 0.4978 0.4520 0.6594 0.0094  0.0363  0.0463  365 HIS A O     
1825 C CB    . HIS A 237 ? 0.4941 0.4550 0.6236 0.0218  0.0314  0.0570  365 HIS A CB    
1826 C CG    . HIS A 237 ? 0.5146 0.4818 0.6263 0.0262  0.0291  0.0639  365 HIS A CG    
1827 N ND1   . HIS A 237 ? 0.5071 0.4789 0.6071 0.0264  0.0262  0.0599  365 HIS A ND1   
1828 C CD2   . HIS A 237 ? 0.5178 0.4879 0.6212 0.0307  0.0289  0.0740  365 HIS A CD2   
1829 C CE1   . HIS A 237 ? 0.4953 0.4731 0.5808 0.0306  0.0239  0.0665  365 HIS A CE1   
1830 N NE2   . HIS A 237 ? 0.5061 0.4828 0.5925 0.0333  0.0253  0.0747  365 HIS A NE2   
1831 N N     . ALA A 256 ? 0.4372 0.4255 0.5383 0.0494  0.0070  0.0665  384 ALA A N     
1832 C CA    . ALA A 256 ? 0.3875 0.3847 0.4838 0.0499  0.0028  0.0600  384 ALA A CA    
1833 C C     . ALA A 256 ? 0.4034 0.4043 0.4844 0.0477  0.0024  0.0605  384 ALA A C     
1834 O O     . ALA A 256 ? 0.4252 0.4276 0.4924 0.0491  0.0008  0.0675  384 ALA A O     
1835 C CB    . ALA A 256 ? 0.3559 0.3598 0.4503 0.0549  -0.0039 0.0625  384 ALA A CB    
1836 N N     . PHE A 257 ? 0.2613 0.2640 0.3418 0.0428  0.0040  0.0510  385 PHE A N     
1837 C CA    . PHE A 257 ? 0.2148 0.2210 0.2795 0.0389  0.0036  0.0486  385 PHE A CA    
1838 C C     . PHE A 257 ? 0.2029 0.2140 0.2668 0.0345  0.0028  0.0372  385 PHE A C     
1839 O O     . PHE A 257 ? 0.2221 0.2325 0.2967 0.0337  0.0043  0.0310  385 PHE A O     
1840 C CB    . PHE A 257 ? 0.2439 0.2433 0.3072 0.0355  0.0088  0.0515  385 PHE A CB    
1841 C CG    . PHE A 257 ? 0.2699 0.2619 0.3477 0.0321  0.0131  0.0463  385 PHE A CG    
1842 C CD1   . PHE A 257 ? 0.3120 0.2968 0.4047 0.0350  0.0153  0.0507  385 PHE A CD1   
1843 C CD2   . PHE A 257 ? 0.2700 0.2616 0.3465 0.0262  0.0145  0.0370  385 PHE A CD2   
1844 C CE1   . PHE A 257 ? 0.2849 0.2624 0.3915 0.0317  0.0188  0.0444  385 PHE A CE1   
1845 C CE2   . PHE A 257 ? 0.2190 0.2039 0.3075 0.0232  0.0173  0.0310  385 PHE A CE2   
1846 C CZ    . PHE A 257 ? 0.2333 0.2112 0.3370 0.0258  0.0195  0.0340  385 PHE A CZ    
1847 N N     . GLU A 258 ? 0.1790 0.1947 0.2299 0.0317  0.0010  0.0347  386 GLU A N     
1848 C CA    . GLU A 258 ? 0.1798 0.1999 0.2287 0.0275  0.0004  0.0257  386 GLU A CA    
1849 C C     . GLU A 258 ? 0.1681 0.1868 0.2079 0.0226  0.0021  0.0228  386 GLU A C     
1850 O O     . GLU A 258 ? 0.1493 0.1706 0.1868 0.0189  0.0020  0.0164  386 GLU A O     
1851 C CB    . GLU A 258 ? 0.2063 0.2349 0.2522 0.0294  -0.0051 0.0245  386 GLU A CB    
1852 C CG    . GLU A 258 ? 0.2242 0.2559 0.2564 0.0305  -0.0090 0.0276  386 GLU A CG    
1853 C CD    . GLU A 258 ? 0.3547 0.3942 0.3865 0.0342  -0.0161 0.0277  386 GLU A CD    
1854 O OE1   . GLU A 258 ? 0.4046 0.4458 0.4458 0.0384  -0.0183 0.0306  386 GLU A OE1   
1855 O OE2   . GLU A 258 ? 0.3267 0.3708 0.3506 0.0330  -0.0199 0.0243  386 GLU A OE2   
1856 N N     . ARG A 259 ? 0.1426 0.1575 0.1777 0.0226  0.0040  0.0281  387 ARG A N     
1857 C CA    . ARG A 259 ? 0.1025 0.1159 0.1326 0.0182  0.0059  0.0257  387 ARG A CA    
1858 C C     . ARG A 259 ? 0.1162 0.1228 0.1538 0.0172  0.0101  0.0289  387 ARG A C     
1859 O O     . ARG A 259 ? 0.1332 0.1368 0.1746 0.0206  0.0117  0.0364  387 ARG A O     
1860 C CB    . ARG A 259 ? 0.1170 0.1339 0.1350 0.0190  0.0045  0.0284  387 ARG A CB    
1861 C CG    . ARG A 259 ? 0.1272 0.1504 0.1390 0.0203  -0.0003 0.0255  387 ARG A CG    
1862 C CD    . ARG A 259 ? 0.1339 0.1594 0.1340 0.0214  -0.0014 0.0269  387 ARG A CD    
1863 N NE    . ARG A 259 ? 0.1499 0.1813 0.1454 0.0228  -0.0069 0.0233  387 ARG A NE    
1864 C CZ    . ARG A 259 ? 0.1507 0.1850 0.1358 0.0244  -0.0093 0.0225  387 ARG A CZ    
1865 N NH1   . ARG A 259 ? 0.1787 0.2110 0.1558 0.0251  -0.0058 0.0255  387 ARG A NH1   
1866 N NH2   . ARG A 259 ? 0.2090 0.2485 0.1926 0.0252  -0.0152 0.0180  387 ARG A NH2   
1867 N N     A SER A 260 ? 0.0964 0.1006 0.1373 0.0126  0.0114  0.0234  388 SER A N     
1868 N N     B SER A 260 ? 0.0971 0.1012 0.1379 0.0125  0.0115  0.0236  388 SER A N     
1869 C CA    A SER A 260 ? 0.1062 0.1045 0.1564 0.0106  0.0146  0.0250  388 SER A CA    
1870 C CA    B SER A 260 ? 0.1082 0.1063 0.1587 0.0107  0.0147  0.0254  388 SER A CA    
1871 C C     A SER A 260 ? 0.1230 0.1227 0.1697 0.0067  0.0147  0.0231  388 SER A C     
1872 C C     B SER A 260 ? 0.1087 0.1076 0.1571 0.0064  0.0149  0.0226  388 SER A C     
1873 O O     A SER A 260 ? 0.1041 0.1070 0.1446 0.0043  0.0121  0.0172  388 SER A O     
1874 O O     B SER A 260 ? 0.0931 0.0940 0.1380 0.0034  0.0124  0.0155  388 SER A O     
1875 C CB    A SER A 260 ? 0.1451 0.1388 0.2063 0.0090  0.0151  0.0185  388 SER A CB    
1876 C CB    B SER A 260 ? 0.1457 0.1388 0.2079 0.0097  0.0154  0.0198  388 SER A CB    
1877 O OG    A SER A 260 ? 0.2068 0.1945 0.2791 0.0065  0.0174  0.0188  388 SER A OG    
1878 O OG    B SER A 260 ? 0.1534 0.1482 0.2124 0.0062  0.0137  0.0103  388 SER A OG    
1879 N N     . PHE A 261 ? 0.1360 0.1335 0.1874 0.0064  0.0180  0.0289  389 PHE A N     
1880 C CA    . PHE A 261 ? 0.1455 0.1444 0.1980 0.0030  0.0186  0.0275  389 PHE A CA    
1881 C C     . PHE A 261 ? 0.1540 0.1478 0.2225 -0.0001 0.0204  0.0267  389 PHE A C     
1882 O O     . PHE A 261 ? 0.1798 0.1703 0.2570 0.0010  0.0249  0.0340  389 PHE A O     
1883 C CB    . PHE A 261 ? 0.1589 0.1608 0.2049 0.0053  0.0217  0.0347  389 PHE A CB    
1884 C CG    . PHE A 261 ? 0.1921 0.1975 0.2244 0.0096  0.0203  0.0371  389 PHE A CG    
1885 C CD1   . PHE A 261 ? 0.1967 0.2059 0.2204 0.0091  0.0157  0.0309  389 PHE A CD1   
1886 C CD2   . PHE A 261 ? 0.2323 0.2372 0.2606 0.0141  0.0232  0.0458  389 PHE A CD2   
1887 C CE1   . PHE A 261 ? 0.2185 0.2313 0.2316 0.0128  0.0135  0.0321  389 PHE A CE1   
1888 C CE2   . PHE A 261 ? 0.2515 0.2602 0.2667 0.0183  0.0204  0.0471  389 PHE A CE2   
1889 C CZ    . PHE A 261 ? 0.2058 0.2186 0.2144 0.0174  0.0153  0.0397  389 PHE A CZ    
1890 N N     A CYS A 262 ? 0.1103 0.1033 0.1831 -0.0039 0.0170  0.0180  390 CYS A N     
1891 N N     B CYS A 262 ? 0.1070 0.1000 0.1794 -0.0038 0.0169  0.0178  390 CYS A N     
1892 C CA    A CYS A 262 ? 0.1185 0.1062 0.2078 -0.0067 0.0177  0.0155  390 CYS A CA    
1893 C CA    B CYS A 262 ? 0.1250 0.1129 0.2130 -0.0069 0.0168  0.0139  390 CYS A CA    
1894 C C     A CYS A 262 ? 0.0906 0.0804 0.1848 -0.0112 0.0143  0.0096  390 CYS A C     
1895 C C     B CYS A 262 ? 0.0957 0.0858 0.1902 -0.0111 0.0147  0.0106  390 CYS A C     
1896 O O     A CYS A 262 ? 0.0943 0.0892 0.1785 -0.0120 0.0111  0.0071  390 CYS A O     
1897 O O     B CYS A 262 ? 0.0806 0.0759 0.1667 -0.0117 0.0127  0.0101  390 CYS A O     
1898 C CB    A CYS A 262 ? 0.1408 0.1241 0.2333 -0.0062 0.0162  0.0090  390 CYS A CB    
1899 C CB    B CYS A 262 ? 0.1373 0.1228 0.2247 -0.0076 0.0137  0.0044  390 CYS A CB    
1900 S SG    A CYS A 262 ? 0.1560 0.1418 0.2392 -0.0090 0.0105  -0.0036 390 CYS A SG    
1901 S SG    B CYS A 262 ? 0.1735 0.1590 0.2529 -0.0029 0.0146  0.0052  390 CYS A SG    
1902 N N     . ILE A 263 ? 0.0955 0.0811 0.2070 -0.0142 0.0146  0.0077  391 ILE A N     
1903 C CA    . ILE A 263 ? 0.0975 0.0849 0.2177 -0.0186 0.0102  0.0012  391 ILE A CA    
1904 C C     . ILE A 263 ? 0.1093 0.0923 0.2340 -0.0207 0.0056  -0.0098 391 ILE A C     
1905 O O     . ILE A 263 ? 0.1076 0.0844 0.2429 -0.0201 0.0081  -0.0102 391 ILE A O     
1906 C CB    . ILE A 263 ? 0.1075 0.0953 0.2437 -0.0195 0.0138  0.0071  391 ILE A CB    
1907 C CG1   . ILE A 263 ? 0.1148 0.1063 0.2452 -0.0168 0.0198  0.0178  391 ILE A CG1   
1908 C CG2   . ILE A 263 ? 0.1179 0.1092 0.2604 -0.0225 0.0078  0.0001  391 ILE A CG2   
1909 C CD1   . ILE A 263 ? 0.1235 0.1163 0.2651 -0.0158 0.0246  0.0238  391 ILE A CD1   
1910 N N     . PHE A 264 ? 0.1208 0.1070 0.2353 -0.0223 -0.0008 -0.0184 392 PHE A N     
1911 C CA    . PHE A 264 ? 0.1394 0.1231 0.2515 -0.0237 -0.0056 -0.0302 392 PHE A CA    
1912 C C     . PHE A 264 ? 0.1465 0.1321 0.2651 -0.0262 -0.0115 -0.0358 392 PHE A C     
1913 O O     . PHE A 264 ? 0.1260 0.1166 0.2458 -0.0273 -0.0139 -0.0327 392 PHE A O     
1914 C CB    . PHE A 264 ? 0.1443 0.1321 0.2340 -0.0223 -0.0086 -0.0341 392 PHE A CB    
1915 C CG    . PHE A 264 ? 0.1769 0.1627 0.2568 -0.0190 -0.0048 -0.0348 392 PHE A CG    
1916 C CD1   . PHE A 264 ? 0.1984 0.1844 0.2771 -0.0158 0.0005  -0.0259 392 PHE A CD1   
1917 C CD2   . PHE A 264 ? 0.2617 0.2467 0.3322 -0.0189 -0.0068 -0.0445 392 PHE A CD2   
1918 C CE1   . PHE A 264 ? 0.2336 0.2192 0.3052 -0.0126 0.0033  -0.0265 392 PHE A CE1   
1919 C CE2   . PHE A 264 ? 0.2533 0.2377 0.3165 -0.0158 -0.0026 -0.0451 392 PHE A CE2   
1920 C CZ    . PHE A 264 ? 0.2434 0.2283 0.3082 -0.0127 0.0021  -0.0360 392 PHE A CZ    
1921 N N     . ARG A 265 ? 0.1433 0.1254 0.2643 -0.0264 -0.0140 -0.0445 393 ARG A N     
1922 C CA    . ARG A 265 ? 0.1603 0.1443 0.2835 -0.0283 -0.0207 -0.0517 393 ARG A CA    
1923 C C     . ARG A 265 ? 0.2053 0.1924 0.3077 -0.0285 -0.0268 -0.0588 393 ARG A C     
1924 O O     . ARG A 265 ? 0.2478 0.2324 0.3391 -0.0273 -0.0263 -0.0652 393 ARG A O     
1925 C CB    . ARG A 265 ? 0.2134 0.1920 0.3495 -0.0282 -0.0197 -0.0572 393 ARG A CB    
1926 C CG    . ARG A 265 ? 0.2736 0.2532 0.4173 -0.0301 -0.0257 -0.0640 393 ARG A CG    
1927 C CD    . ARG A 265 ? 0.2557 0.2296 0.4160 -0.0298 -0.0228 -0.0671 393 ARG A CD    
1928 N NE    . ARG A 265 ? 0.2643 0.2384 0.4313 -0.0316 -0.0291 -0.0762 393 ARG A NE    
1929 C CZ    . ARG A 265 ? 0.2046 0.1771 0.3936 -0.0327 -0.0287 -0.0764 393 ARG A CZ    
1930 N NH1   . ARG A 265 ? 0.2102 0.1805 0.4160 -0.0319 -0.0215 -0.0669 393 ARG A NH1   
1931 N NH2   . ARG A 265 ? 0.2979 0.2709 0.4917 -0.0345 -0.0356 -0.0860 393 ARG A NH2   
1932 N N     . LEU A 266 ? 0.2021 0.1949 0.2991 -0.0296 -0.0319 -0.0571 394 LEU A N     
1933 C CA    . LEU A 266 ? 0.2317 0.2279 0.3084 -0.0295 -0.0377 -0.0616 394 LEU A CA    
1934 C C     . LEU A 266 ? 0.2663 0.2639 0.3434 -0.0309 -0.0452 -0.0683 394 LEU A C     
1935 O O     . LEU A 266 ? 0.2286 0.2291 0.3191 -0.0322 -0.0481 -0.0657 394 LEU A O     
1936 C CB    . LEU A 266 ? 0.2483 0.2500 0.3178 -0.0292 -0.0386 -0.0542 394 LEU A CB    
1937 C CG    . LEU A 266 ? 0.3279 0.3331 0.3757 -0.0286 -0.0439 -0.0564 394 LEU A CG    
1938 C CD1   . LEU A 266 ? 0.3374 0.3398 0.3692 -0.0270 -0.0407 -0.0608 394 LEU A CD1   
1939 C CD2   . LEU A 266 ? 0.3297 0.3400 0.3742 -0.0281 -0.0446 -0.0484 394 LEU A CD2   
1940 N N     . PRO A 267 ? 0.4539 0.4498 0.5166 -0.0306 -0.0485 -0.0767 395 PRO A N     
1941 C CA    . PRO A 267 ? 0.4566 0.4539 0.5192 -0.0321 -0.0563 -0.0836 395 PRO A CA    
1942 C C     . PRO A 267 ? 0.4378 0.4417 0.4945 -0.0328 -0.0629 -0.0797 395 PRO A C     
1943 O O     . PRO A 267 ? 0.4847 0.4918 0.5283 -0.0318 -0.0625 -0.0739 395 PRO A O     
1944 C CB    . PRO A 267 ? 0.4671 0.4611 0.5107 -0.0309 -0.0569 -0.0923 395 PRO A CB    
1945 C CG    . PRO A 267 ? 0.4913 0.4809 0.5360 -0.0289 -0.0483 -0.0916 395 PRO A CG    
1946 C CD    . PRO A 267 ? 0.4779 0.4701 0.5263 -0.0286 -0.0443 -0.0812 395 PRO A CD    
1947 N N     . GLN A 268 ? 0.3376 0.3437 0.4057 -0.0345 -0.0692 -0.0831 396 GLN A N     
1948 C CA    . GLN A 268 ? 0.3511 0.3638 0.4179 -0.0351 -0.0765 -0.0807 396 GLN A CA    
1949 C C     . GLN A 268 ? 0.4185 0.4316 0.4840 -0.0365 -0.0849 -0.0904 396 GLN A C     
1950 O O     . GLN A 268 ? 0.4436 0.4518 0.5154 -0.0371 -0.0842 -0.0982 396 GLN A O     
1951 C CB    . GLN A 268 ? 0.3704 0.3863 0.4599 -0.0356 -0.0751 -0.0737 396 GLN A CB    
1952 C CG    . GLN A 268 ? 0.3311 0.3469 0.4239 -0.0343 -0.0670 -0.0641 396 GLN A CG    
1953 C CD    . GLN A 268 ? 0.3747 0.3958 0.4557 -0.0330 -0.0689 -0.0576 396 GLN A CD    
1954 O OE1   . GLN A 268 ? 0.4183 0.4438 0.5105 -0.0328 -0.0702 -0.0526 396 GLN A OE1   
1955 N NE2   . GLN A 268 ? 0.3680 0.3886 0.4273 -0.0319 -0.0686 -0.0576 396 GLN A NE2   
1956 N N     . PRO A 269 ? 0.4873 0.5064 0.5456 -0.0368 -0.0931 -0.0902 397 PRO A N     
1957 C CA    . PRO A 269 ? 0.4843 0.5045 0.5425 -0.0382 -0.1022 -0.0997 397 PRO A CA    
1958 C C     . PRO A 269 ? 0.4673 0.4857 0.5532 -0.0400 -0.1029 -0.1045 397 PRO A C     
1959 O O     . PRO A 269 ? 0.5205 0.5425 0.6270 -0.0406 -0.1038 -0.0999 397 PRO A O     
1960 C CB    . PRO A 269 ? 0.4878 0.5162 0.5401 -0.0380 -0.1102 -0.0954 397 PRO A CB    
1961 C CG    . PRO A 269 ? 0.4727 0.5026 0.5098 -0.0360 -0.1053 -0.0860 397 PRO A CG    
1962 C CD    . PRO A 269 ? 0.4561 0.4811 0.5039 -0.0356 -0.0949 -0.0818 397 PRO A CD    
1963 N N     . GLY A 270 ? 0.3666 0.3792 0.4541 -0.0406 -0.1023 -0.1139 410 GLY A N     
1964 C CA    . GLY A 270 ? 0.3672 0.3776 0.4813 -0.0422 -0.1031 -0.1191 410 GLY A CA    
1965 C C     . GLY A 270 ? 0.3419 0.3488 0.4779 -0.0420 -0.0933 -0.1123 410 GLY A C     
1966 O O     . GLY A 270 ? 0.3633 0.3683 0.5235 -0.0433 -0.0929 -0.1151 410 GLY A O     
1967 N N     . SER A 271 ? 0.2926 0.2988 0.4212 -0.0405 -0.0855 -0.1033 411 SER A N     
1968 C CA    . SER A 271 ? 0.2176 0.2211 0.3654 -0.0401 -0.0763 -0.0957 411 SER A CA    
1969 C C     . SER A 271 ? 0.2459 0.2475 0.3790 -0.0382 -0.0686 -0.0887 411 SER A C     
1970 O O     . SER A 271 ? 0.2578 0.2572 0.3706 -0.0371 -0.0685 -0.0928 411 SER A O     
1971 C CB    . SER A 271 ? 0.2455 0.2541 0.4124 -0.0408 -0.0770 -0.0888 411 SER A CB    
1972 O OG    . SER A 271 ? 0.2314 0.2371 0.4177 -0.0406 -0.0682 -0.0821 411 SER A OG    
1973 N N     . TRP A 272 ? 0.1850 0.1876 0.3281 -0.0375 -0.0621 -0.0786 412 TRP A N     
1974 C CA    . TRP A 272 ? 0.1610 0.1622 0.2922 -0.0358 -0.0552 -0.0720 412 TRP A CA    
1975 C C     . TRP A 272 ? 0.1465 0.1510 0.2885 -0.0353 -0.0505 -0.0613 412 TRP A C     
1976 O O     . TRP A 272 ? 0.1470 0.1539 0.3069 -0.0361 -0.0511 -0.0589 412 TRP A O     
1977 C CB    . TRP A 272 ? 0.1610 0.1553 0.2955 -0.0349 -0.0485 -0.0738 412 TRP A CB    
1978 C CG    . TRP A 272 ? 0.1627 0.1538 0.3223 -0.0356 -0.0446 -0.0724 412 TRP A CG    
1979 C CD1   . TRP A 272 ? 0.1766 0.1652 0.3489 -0.0368 -0.0479 -0.0804 412 TRP A CD1   
1980 C CD2   . TRP A 272 ? 0.1522 0.1423 0.3271 -0.0349 -0.0365 -0.0623 412 TRP A CD2   
1981 N NE1   . TRP A 272 ? 0.1748 0.1609 0.3706 -0.0370 -0.0422 -0.0755 412 TRP A NE1   
1982 C CE2   . TRP A 272 ? 0.1603 0.1473 0.3574 -0.0357 -0.0349 -0.0640 412 TRP A CE2   
1983 C CE3   . TRP A 272 ? 0.1494 0.1411 0.3211 -0.0335 -0.0303 -0.0518 412 TRP A CE3   
1984 C CZ2   . TRP A 272 ? 0.1555 0.1408 0.3700 -0.0350 -0.0270 -0.0547 412 TRP A CZ2   
1985 C CZ3   . TRP A 272 ? 0.1557 0.1457 0.3435 -0.0328 -0.0226 -0.0431 412 TRP A CZ3   
1986 C CH2   . TRP A 272 ? 0.1428 0.1296 0.3514 -0.0334 -0.0207 -0.0442 412 TRP A CH2   
1987 N N     . LYS A 273 ? 0.1425 0.1471 0.2734 -0.0339 -0.0455 -0.0550 413 LYS A N     
1988 C CA    . LYS A 273 ? 0.1478 0.1548 0.2871 -0.0330 -0.0397 -0.0450 413 LYS A CA    
1989 C C     . LYS A 273 ? 0.1306 0.1339 0.2653 -0.0316 -0.0317 -0.0399 413 LYS A C     
1990 O O     . LYS A 273 ? 0.1383 0.1389 0.2593 -0.0310 -0.0317 -0.0436 413 LYS A O     
1991 C CB    . LYS A 273 ? 0.1680 0.1814 0.2987 -0.0325 -0.0437 -0.0415 413 LYS A CB    
1992 C CG    . LYS A 273 ? 0.1560 0.1703 0.2645 -0.0315 -0.0455 -0.0419 413 LYS A CG    
1993 C CD    . LYS A 273 ? 0.1970 0.2173 0.3000 -0.0306 -0.0489 -0.0373 413 LYS A CD    
1994 C CE    . LYS A 273 ? 0.2461 0.2669 0.3270 -0.0294 -0.0506 -0.0373 413 LYS A CE    
1995 N NZ    . LYS A 273 ? 0.2632 0.2889 0.3400 -0.0279 -0.0523 -0.0313 413 LYS A NZ    
1996 N N     . ALA A 274 ? 0.1086 0.1120 0.2546 -0.0308 -0.0246 -0.0312 414 ALA A N     
1997 C CA    . ALA A 274 ? 0.1009 0.1017 0.2429 -0.0291 -0.0170 -0.0247 414 ALA A CA    
1998 C C     . ALA A 274 ? 0.0918 0.0968 0.2192 -0.0283 -0.0174 -0.0214 414 ALA A C     
1999 O O     . ALA A 274 ? 0.0981 0.1083 0.2260 -0.0282 -0.0196 -0.0189 414 ALA A O     
2000 C CB    . ALA A 274 ? 0.1169 0.1167 0.2742 -0.0281 -0.0091 -0.0160 414 ALA A CB    
2001 N N     . VAL A 275 ? 0.0848 0.0876 0.2008 -0.0275 -0.0153 -0.0213 415 VAL A N     
2002 C CA    A VAL A 275 ? 0.0835 0.0900 0.1849 -0.0261 -0.0153 -0.0182 415 VAL A CA    
2003 C CA    B VAL A 275 ? 0.0788 0.0855 0.1814 -0.0261 -0.0149 -0.0176 415 VAL A CA    
2004 C C     . VAL A 275 ? 0.0787 0.0826 0.1735 -0.0228 -0.0074 -0.0114 415 VAL A C     
2005 O O     . VAL A 275 ? 0.1043 0.1032 0.2001 -0.0221 -0.0049 -0.0129 415 VAL A O     
2006 C CB    A VAL A 275 ? 0.0926 0.0996 0.1762 -0.0260 -0.0214 -0.0254 415 VAL A CB    
2007 C CB    B VAL A 275 ? 0.0896 0.0979 0.1746 -0.0261 -0.0217 -0.0240 415 VAL A CB    
2008 C CG1   A VAL A 275 ? 0.0828 0.0928 0.1490 -0.0234 -0.0202 -0.0207 415 VAL A CG1   
2009 C CG1   B VAL A 275 ? 0.0972 0.1091 0.1854 -0.0279 -0.0297 -0.0281 415 VAL A CG1   
2010 C CG2   A VAL A 275 ? 0.0997 0.1091 0.1851 -0.0281 -0.0297 -0.0315 415 VAL A CG2   
2011 C CG2   B VAL A 275 ? 0.0983 0.1019 0.1756 -0.0258 -0.0215 -0.0306 415 VAL A CG2   
2012 N N     . ARG A 276 ? 0.0644 0.0717 0.1522 -0.0204 -0.0041 -0.0047 416 ARG A N     
2013 C CA    . ARG A 276 ? 0.0623 0.0683 0.1404 -0.0168 0.0014  0.0007  416 ARG A CA    
2014 C C     . ARG A 276 ? 0.0617 0.0676 0.1237 -0.0156 -0.0010 -0.0031 416 ARG A C     
2015 O O     . ARG A 276 ? 0.0604 0.0692 0.1132 -0.0162 -0.0051 -0.0058 416 ARG A O     
2016 C CB    . ARG A 276 ? 0.0602 0.0700 0.1359 -0.0147 0.0051  0.0076  416 ARG A CB    
2017 C CG    . ARG A 276 ? 0.0723 0.0818 0.1620 -0.0145 0.0114  0.0141  416 ARG A CG    
2018 C CD    . ARG A 276 ? 0.0862 0.0923 0.1726 -0.0113 0.0174  0.0204  416 ARG A CD    
2019 N NE    . ARG A 276 ? 0.1055 0.1141 0.1751 -0.0076 0.0184  0.0230  416 ARG A NE    
2020 C CZ    . ARG A 276 ? 0.1090 0.1168 0.1666 -0.0057 0.0162  0.0212  416 ARG A CZ    
2021 N NH1   . ARG A 276 ? 0.0878 0.0922 0.1471 -0.0065 0.0140  0.0173  416 ARG A NH1   
2022 N NH2   . ARG A 276 ? 0.1132 0.1239 0.1581 -0.0028 0.0164  0.0227  416 ARG A NH2   
2023 N N     . VAL A 277 ? 0.0829 0.0856 0.1425 -0.0136 0.0020  -0.0025 417 VAL A N     
2024 C CA    . VAL A 277 ? 0.0760 0.0792 0.1234 -0.0122 0.0011  -0.0056 417 VAL A CA    
2025 C C     . VAL A 277 ? 0.0933 0.0965 0.1377 -0.0086 0.0050  0.0001  417 VAL A C     
2026 O O     . VAL A 277 ? 0.0959 0.0960 0.1482 -0.0070 0.0083  0.0041  417 VAL A O     
2027 C CB    . VAL A 277 ? 0.0770 0.0768 0.1260 -0.0135 -0.0005 -0.0134 417 VAL A CB    
2028 C CG1   . VAL A 277 ? 0.1041 0.1052 0.1417 -0.0117 0.0004  -0.0158 417 VAL A CG1   
2029 C CG2   . VAL A 277 ? 0.0819 0.0822 0.1320 -0.0168 -0.0057 -0.0196 417 VAL A CG2   
2030 N N     . ASP A 278 ? 0.0818 0.0884 0.1154 -0.0072 0.0044  0.0008  418 ASP A N     
2031 C CA    . ASP A 278 ? 0.0753 0.0831 0.1053 -0.0037 0.0063  0.0049  418 ASP A CA    
2032 C C     . ASP A 278 ? 0.0871 0.0957 0.1137 -0.0031 0.0057  0.0007  418 ASP A C     
2033 O O     . ASP A 278 ? 0.0965 0.1068 0.1174 -0.0051 0.0041  -0.0035 418 ASP A O     
2034 C CB    . ASP A 278 ? 0.0871 0.0988 0.1097 -0.0024 0.0058  0.0081  418 ASP A CB    
2035 C CG    . ASP A 278 ? 0.1156 0.1272 0.1417 -0.0020 0.0080  0.0127  418 ASP A CG    
2036 O OD1   . ASP A 278 ? 0.1296 0.1382 0.1639 -0.0016 0.0109  0.0159  418 ASP A OD1   
2037 O OD2   . ASP A 278 ? 0.1173 0.1315 0.1392 -0.0020 0.0075  0.0132  418 ASP A OD2   
2038 N N     . LEU A 279 ? 0.0787 0.0863 0.1094 -0.0002 0.0074  0.0026  419 LEU A N     
2039 C CA    . LEU A 279 ? 0.0852 0.0942 0.1157 0.0011  0.0078  -0.0007 419 LEU A CA    
2040 C C     . LEU A 279 ? 0.1052 0.1178 0.1347 0.0047  0.0072  0.0039  419 LEU A C     
2041 O O     . LEU A 279 ? 0.1077 0.1190 0.1394 0.0076  0.0075  0.0097  419 LEU A O     
2042 C CB    . LEU A 279 ? 0.0935 0.0979 0.1333 0.0018  0.0099  -0.0040 419 LEU A CB    
2043 C CG    . LEU A 279 ? 0.1075 0.1080 0.1496 -0.0016 0.0095  -0.0101 419 LEU A CG    
2044 C CD1   . LEU A 279 ? 0.1627 0.1581 0.2153 -0.0002 0.0117  -0.0140 419 LEU A CD1   
2045 C CD2   . LEU A 279 ? 0.1376 0.1408 0.1698 -0.0042 0.0080  -0.0157 419 LEU A CD2   
2046 N N     A VAL A 280 ? 0.0599 0.0771 0.0861 0.0047  0.0061  0.0016  420 VAL A N     
2047 N N     B VAL A 280 ? 0.0666 0.0837 0.0929 0.0047  0.0062  0.0015  420 VAL A N     
2048 C CA    A VAL A 280 ? 0.0623 0.0837 0.0896 0.0080  0.0043  0.0043  420 VAL A CA    
2049 C CA    B VAL A 280 ? 0.0676 0.0893 0.0944 0.0078  0.0042  0.0042  420 VAL A CA    
2050 C C     A VAL A 280 ? 0.0567 0.0809 0.0898 0.0084  0.0055  0.0004  420 VAL A C     
2051 C C     B VAL A 280 ? 0.0563 0.0811 0.0890 0.0083  0.0052  0.0004  420 VAL A C     
2052 O O     A VAL A 280 ? 0.0578 0.0822 0.0896 0.0055  0.0077  -0.0043 420 VAL A O     
2053 O O     B VAL A 280 ? 0.0668 0.0927 0.0976 0.0054  0.0070  -0.0039 420 VAL A O     
2054 C CB    A VAL A 280 ? 0.0775 0.1028 0.0973 0.0076  0.0013  0.0055  420 VAL A CB    
2055 C CB    B VAL A 280 ? 0.0745 0.0998 0.0936 0.0069  0.0014  0.0048  420 VAL A CB    
2056 C CG1   A VAL A 280 ? 0.0625 0.0890 0.0787 0.0036  0.0015  0.0015  420 VAL A CG1   
2057 C CG1   B VAL A 280 ? 0.0900 0.1207 0.1105 0.0098  -0.0019 0.0057  420 VAL A CG1   
2058 C CG2   A VAL A 280 ? 0.0686 0.0990 0.0900 0.0110  -0.0020 0.0070  420 VAL A CG2   
2059 C CG2   B VAL A 280 ? 0.0940 0.1169 0.1080 0.0071  0.0014  0.0085  420 VAL A CG2   
2060 N N     . VAL A 281 ? 0.0655 0.0923 0.1055 0.0123  0.0043  0.0027  421 VAL A N     
2061 C CA    . VAL A 281 ? 0.0722 0.1032 0.1208 0.0135  0.0055  -0.0005 421 VAL A CA    
2062 C C     . VAL A 281 ? 0.0843 0.1225 0.1342 0.0149  0.0010  0.0010  421 VAL A C     
2063 O O     . VAL A 281 ? 0.1128 0.1520 0.1601 0.0179  -0.0033 0.0055  421 VAL A O     
2064 C CB    . VAL A 281 ? 0.0704 0.0986 0.1299 0.0173  0.0073  0.0003  421 VAL A CB    
2065 C CG1   . VAL A 281 ? 0.0985 0.1325 0.1692 0.0192  0.0085  -0.0028 421 VAL A CG1   
2066 C CG2   . VAL A 281 ? 0.1037 0.1247 0.1638 0.0154  0.0113  -0.0032 421 VAL A CG2   
2067 N N     . ALA A 282 ? 0.0541 0.0975 0.1085 0.0129  0.0021  -0.0027 422 ALA A N     
2068 C CA    . ALA A 282 ? 0.0592 0.1099 0.1189 0.0138  -0.0023 -0.0025 422 ALA A CA    
2069 C C     . ALA A 282 ? 0.0572 0.1136 0.1310 0.0141  0.0007  -0.0056 422 ALA A C     
2070 O O     . ALA A 282 ? 0.0759 0.1308 0.1507 0.0120  0.0073  -0.0087 422 ALA A O     
2071 C CB    . ALA A 282 ? 0.0871 0.1389 0.1396 0.0098  -0.0040 -0.0038 422 ALA A CB    
2072 N N     . PRO A 283 ? 0.0697 0.1331 0.1544 0.0169  -0.0039 -0.0049 423 PRO A N     
2073 C CA    . PRO A 283 ? 0.0776 0.1481 0.1784 0.0166  -0.0009 -0.0079 423 PRO A CA    
2074 C C     . PRO A 283 ? 0.0928 0.1661 0.1934 0.0112  0.0022  -0.0105 423 PRO A C     
2075 O O     . PRO A 283 ? 0.0904 0.1623 0.1824 0.0084  -0.0012 -0.0101 423 PRO A O     
2076 C CB    . PRO A 283 ? 0.1021 0.1800 0.2144 0.0209  -0.0090 -0.0063 423 PRO A CB    
2077 C CG    . PRO A 283 ? 0.1372 0.2127 0.2360 0.0219  -0.0163 -0.0035 423 PRO A CG    
2078 C CD    . PRO A 283 ? 0.0955 0.1613 0.1782 0.0206  -0.0124 -0.0016 423 PRO A CD    
2079 N N     . VAL A 284 ? 0.1072 0.1348 0.1547 0.0537  0.0270  0.0130  424 VAL A N     
2080 C CA    . VAL A 284 ? 0.1101 0.1451 0.1622 0.0448  0.0301  0.0096  424 VAL A CA    
2081 C C     . VAL A 284 ? 0.0956 0.1490 0.1607 0.0410  0.0236  0.0089  424 VAL A C     
2082 O O     . VAL A 284 ? 0.0943 0.1483 0.1582 0.0321  0.0235  0.0073  424 VAL A O     
2083 C CB    . VAL A 284 ? 0.1345 0.1718 0.1929 0.0466  0.0401  0.0070  424 VAL A CB    
2084 C CG1   . VAL A 284 ? 0.1399 0.1934 0.2152 0.0522  0.0387  0.0058  424 VAL A CG1   
2085 C CG2   . VAL A 284 ? 0.1725 0.2117 0.2296 0.0369  0.0446  0.0051  424 VAL A CG2   
2086 N N     . SER A 285 ? 0.1218 0.1892 0.1982 0.0477  0.0172  0.0098  425 SER A N     
2087 C CA    . SER A 285 ? 0.1112 0.1963 0.1994 0.0435  0.0098  0.0076  425 SER A CA    
2088 C C     . SER A 285 ? 0.1236 0.2002 0.1983 0.0369  0.0042  0.0076  425 SER A C     
2089 O O     . SER A 285 ? 0.1447 0.2298 0.2257 0.0297  0.0008  0.0042  425 SER A O     
2090 C CB    . SER A 285 ? 0.1398 0.2390 0.2385 0.0518  0.0019  0.0080  425 SER A CB    
2091 O OG    . SER A 285 ? 0.1487 0.2347 0.2313 0.0583  -0.0027 0.0126  425 SER A OG    
2092 N N     . GLN A 286 ? 0.0962 0.1559 0.1533 0.0391  0.0038  0.0109  426 GLN A N     
2093 C CA    . GLN A 286 ? 0.0931 0.1449 0.1373 0.0341  -0.0004 0.0110  426 GLN A CA    
2094 C C     . GLN A 286 ? 0.0891 0.1268 0.1236 0.0268  0.0051  0.0103  426 GLN A C     
2095 O O     . GLN A 286 ? 0.1018 0.1337 0.1275 0.0226  0.0026  0.0101  426 GLN A O     
2096 C CB    . GLN A 286 ? 0.1159 0.1588 0.1471 0.0406  -0.0038 0.0156  426 GLN A CB    
2097 C CG    . GLN A 286 ? 0.1249 0.1810 0.1619 0.0488  -0.0112 0.0173  426 GLN A CG    
2098 C CD    . GLN A 286 ? 0.1546 0.1998 0.1765 0.0559  -0.0136 0.0234  426 GLN A CD    
2099 O OE1   . GLN A 286 ? 0.1732 0.2010 0.1810 0.0535  -0.0094 0.0260  426 GLN A OE1   
2100 N NE2   . GLN A 286 ? 0.2030 0.2553 0.2272 0.0612  -0.0193 0.0246  426 GLN A NE2   
2101 N N     . PHE A 287 ? 0.0998 0.1328 0.1354 0.0259  0.0124  0.0099  427 PHE A N     
2102 C CA    . PHE A 287 ? 0.0977 0.1171 0.1216 0.0206  0.0164  0.0096  427 PHE A CA    
2103 C C     . PHE A 287 ? 0.0904 0.1108 0.1135 0.0132  0.0142  0.0081  427 PHE A C     
2104 O O     . PHE A 287 ? 0.0858 0.0966 0.0983 0.0105  0.0135  0.0086  427 PHE A O     
2105 C CB    . PHE A 287 ? 0.1361 0.1519 0.1602 0.0211  0.0243  0.0087  427 PHE A CB    
2106 C CG    . PHE A 287 ? 0.1211 0.1249 0.1327 0.0160  0.0275  0.0080  427 PHE A CG    
2107 C CD1   . PHE A 287 ? 0.1461 0.1368 0.1457 0.0168  0.0282  0.0078  427 PHE A CD1   
2108 C CD2   . PHE A 287 ? 0.1190 0.1246 0.1309 0.0104  0.0294  0.0076  427 PHE A CD2   
2109 C CE1   . PHE A 287 ? 0.1388 0.1211 0.1277 0.0122  0.0297  0.0064  427 PHE A CE1   
2110 C CE2   . PHE A 287 ? 0.1367 0.1324 0.1362 0.0069  0.0311  0.0075  427 PHE A CE2   
2111 C CZ    . PHE A 287 ? 0.1333 0.1186 0.1216 0.0079  0.0306  0.0066  427 PHE A CZ    
2112 N N     . PRO A 288 ? 0.0679 0.0986 0.1021 0.0096  0.0137  0.0062  428 PRO A N     
2113 C CA    . PRO A 288 ? 0.0778 0.1057 0.1101 0.0031  0.0120  0.0049  428 PRO A CA    
2114 C C     . PRO A 288 ? 0.0676 0.0933 0.0935 0.0034  0.0057  0.0043  428 PRO A C     
2115 O O     . PRO A 288 ? 0.0675 0.0855 0.0862 0.0004  0.0054  0.0041  428 PRO A O     
2116 C CB    . PRO A 288 ? 0.0853 0.1252 0.1333 -0.0007 0.0126  0.0025  428 PRO A CB    
2117 C CG    . PRO A 288 ? 0.1106 0.1585 0.1676 0.0029  0.0175  0.0031  428 PRO A CG    
2118 C CD    . PRO A 288 ? 0.0821 0.1268 0.1323 0.0109  0.0155  0.0049  428 PRO A CD    
2119 N N     . PHE A 289 ? 0.0628 0.0956 0.0906 0.0078  0.0009  0.0041  429 PHE A N     
2120 C CA    . PHE A 289 ? 0.0631 0.0940 0.0829 0.0085  -0.0041 0.0035  429 PHE A CA    
2121 C C     . PHE A 289 ? 0.0714 0.0903 0.0785 0.0100  -0.0017 0.0067  429 PHE A C     
2122 O O     . PHE A 289 ? 0.0721 0.0865 0.0722 0.0081  -0.0027 0.0061  429 PHE A O     
2123 C CB    . PHE A 289 ? 0.0602 0.1018 0.0829 0.0136  -0.0101 0.0033  429 PHE A CB    
2124 C CG    . PHE A 289 ? 0.0571 0.1134 0.0944 0.0112  -0.0138 -0.0013 429 PHE A CG    
2125 C CD1   . PHE A 289 ? 0.0565 0.1154 0.0953 0.0059  -0.0175 -0.0064 429 PHE A CD1   
2126 C CD2   . PHE A 289 ? 0.0875 0.1550 0.1384 0.0139  -0.0130 -0.0011 429 PHE A CD2   
2127 C CE1   . PHE A 289 ? 0.0605 0.1327 0.1144 0.0020  -0.0207 -0.0116 429 PHE A CE1   
2128 C CE2   . PHE A 289 ? 0.0848 0.1676 0.1519 0.0103  -0.0161 -0.0059 429 PHE A CE2   
2129 C CZ    . PHE A 289 ? 0.0710 0.1559 0.1396 0.0039  -0.0201 -0.0112 429 PHE A CZ    
2130 N N     . ALA A 290 ? 0.0840 0.0979 0.0888 0.0134  0.0018  0.0095  430 ALA A N     
2131 C CA    . ALA A 290 ? 0.0839 0.0861 0.0782 0.0135  0.0043  0.0117  430 ALA A CA    
2132 C C     . ALA A 290 ? 0.0862 0.0828 0.0778 0.0081  0.0067  0.0102  430 ALA A C     
2133 O O     . ALA A 290 ? 0.0851 0.0770 0.0709 0.0060  0.0065  0.0102  430 ALA A O     
2134 C CB    . ALA A 290 ? 0.1085 0.1048 0.1015 0.0181  0.0078  0.0142  430 ALA A CB    
2135 N N     . LEU A 291 ? 0.0831 0.0808 0.0787 0.0062  0.0091  0.0090  431 LEU A N     
2136 C CA    . LEU A 291 ? 0.0698 0.0626 0.0614 0.0022  0.0104  0.0083  431 LEU A CA    
2137 C C     . LEU A 291 ? 0.0745 0.0688 0.0666 -0.0001 0.0071  0.0073  431 LEU A C     
2138 O O     . LEU A 291 ? 0.0797 0.0702 0.0672 -0.0014 0.0064  0.0072  431 LEU A O     
2139 C CB    . LEU A 291 ? 0.0818 0.0752 0.0760 0.0010  0.0142  0.0083  431 LEU A CB    
2140 C CG    . LEU A 291 ? 0.1041 0.0915 0.0912 -0.0018 0.0153  0.0087  431 LEU A CG    
2141 C CD1   . LEU A 291 ? 0.1057 0.0865 0.0838 -0.0016 0.0155  0.0080  431 LEU A CD1   
2142 C CD2   . LEU A 291 ? 0.1010 0.0890 0.0897 -0.0030 0.0202  0.0096  431 LEU A CD2   
2143 N N     . LEU A 292 ? 0.0716 0.0721 0.0699 -0.0005 0.0048  0.0059  432 LEU A N     
2144 C CA    . LEU A 292 ? 0.0709 0.0713 0.0693 -0.0022 0.0022  0.0039  432 LEU A CA    
2145 C C     . LEU A 292 ? 0.0633 0.0627 0.0557 -0.0006 0.0007  0.0038  432 LEU A C     
2146 O O     . LEU A 292 ? 0.0836 0.0803 0.0737 -0.0014 0.0007  0.0032  432 LEU A O     
2147 C CB    . LEU A 292 ? 0.0820 0.0893 0.0884 -0.0035 -0.0001 0.0010  432 LEU A CB    
2148 C CG    . LEU A 292 ? 0.0847 0.0908 0.0914 -0.0054 -0.0026 -0.0027 432 LEU A CG    
2149 C CD1   . LEU A 292 ? 0.0921 0.0901 0.0987 -0.0078 -0.0002 -0.0019 432 LEU A CD1   
2150 C CD2   . LEU A 292 ? 0.0912 0.1052 0.1058 -0.0072 -0.0058 -0.0070 432 LEU A CD2   
2151 N N     . ALA A 293 ? 0.0734 0.0752 0.0635 0.0022  0.0000  0.0049  433 ALA A N     
2152 C CA    . ALA A 293 ? 0.0779 0.0784 0.0612 0.0035  -0.0002 0.0056  433 ALA A CA    
2153 C C     . ALA A 293 ? 0.0874 0.0824 0.0676 0.0019  0.0029  0.0071  433 ALA A C     
2154 O O     . ALA A 293 ? 0.1090 0.1042 0.0870 0.0010  0.0037  0.0064  433 ALA A O     
2155 C CB    . ALA A 293 ? 0.0859 0.0881 0.0655 0.0076  -0.0012 0.0082  433 ALA A CB    
2156 N N     . TRP A 294 ? 0.0849 0.0755 0.0651 0.0013  0.0049  0.0084  434 TRP A N     
2157 C CA    . TRP A 294 ? 0.0806 0.0666 0.0583 -0.0011 0.0072  0.0087  434 TRP A CA    
2158 C C     . TRP A 294 ? 0.0823 0.0691 0.0619 -0.0035 0.0061  0.0067  434 TRP A C     
2159 O O     . TRP A 294 ? 0.0915 0.0774 0.0708 -0.0059 0.0066  0.0059  434 TRP A O     
2160 C CB    . TRP A 294 ? 0.1010 0.0801 0.0760 -0.0004 0.0099  0.0102  434 TRP A CB    
2161 C CG    . TRP A 294 ? 0.1193 0.0962 0.0913 0.0034  0.0108  0.0135  434 TRP A CG    
2162 C CD1   . TRP A 294 ? 0.1345 0.1111 0.1072 0.0079  0.0106  0.0152  434 TRP A CD1   
2163 C CD2   . TRP A 294 ? 0.1873 0.1630 0.1547 0.0037  0.0118  0.0159  434 TRP A CD2   
2164 N NE1   . TRP A 294 ? 0.1720 0.1466 0.1402 0.0118  0.0105  0.0190  434 TRP A NE1   
2165 C CE2   . TRP A 294 ? 0.2325 0.2057 0.1961 0.0090  0.0117  0.0197  434 TRP A CE2   
2166 C CE3   . TRP A 294 ? 0.2520 0.2289 0.2181 0.0005  0.0134  0.0154  434 TRP A CE3   
2167 C CZ2   . TRP A 294 ? 0.3021 0.2723 0.2579 0.0112  0.0129  0.0238  434 TRP A CZ2   
2168 C CZ3   . TRP A 294 ? 0.3465 0.3211 0.3061 0.0019  0.0158  0.0189  434 TRP A CZ3   
2169 C CH2   . TRP A 294 ? 0.3150 0.2855 0.2682 0.0072  0.0155  0.0235  434 TRP A CH2   
2170 N N     . THR A 295 ? 0.0683 0.0569 0.0503 -0.0031 0.0044  0.0062  435 THR A N     
2171 C CA    . THR A 295 ? 0.0645 0.0528 0.0467 -0.0040 0.0030  0.0056  435 THR A CA    
2172 C C     . THR A 295 ? 0.0747 0.0666 0.0601 -0.0033 0.0014  0.0043  435 THR A C     
2173 O O     . THR A 295 ? 0.0953 0.0888 0.0819 -0.0032 -0.0002 0.0040  435 THR A O     
2174 C CB    . THR A 295 ? 0.0760 0.0622 0.0583 -0.0038 0.0033  0.0067  435 THR A CB    
2175 O OG1   . THR A 295 ? 0.0944 0.0781 0.0736 -0.0041 0.0058  0.0074  435 THR A OG1   
2176 C CG2   . THR A 295 ? 0.0925 0.0767 0.0731 -0.0035 0.0017  0.0076  435 THR A CG2   
2177 N N     . GLY A 296 ? 0.0783 0.0723 0.0651 -0.0023 0.0016  0.0033  436 GLY A N     
2178 C CA    . GLY A 296 ? 0.0765 0.0739 0.0656 -0.0011 0.0014  0.0012  436 GLY A CA    
2179 C C     . GLY A 296 ? 0.0741 0.0696 0.0662 0.0006  -0.0003 0.0001  436 GLY A C     
2180 O O     . GLY A 296 ? 0.0926 0.0836 0.0846 0.0001  -0.0008 0.0008  436 GLY A O     
2181 N N     . SER A 297 ? 0.0561 0.0544 0.0517 0.0027  -0.0004 -0.0015 437 SER A N     
2182 C CA    . SER A 297 ? 0.0680 0.0730 0.0657 0.0027  0.0015  -0.0028 437 SER A CA    
2183 C C     . SER A 297 ? 0.0735 0.0796 0.0671 0.0024  0.0042  -0.0042 437 SER A C     
2184 O O     . SER A 297 ? 0.0781 0.0810 0.0681 0.0027  0.0032  -0.0053 437 SER A O     
2185 C CB    . SER A 297 ? 0.0736 0.0827 0.0779 0.0063  0.0011  -0.0046 437 SER A CB    
2186 O OG    . SER A 297 ? 0.0772 0.0830 0.0809 0.0089  0.0021  -0.0078 437 SER A OG    
2187 N N     . LYS A 298 ? 0.0713 0.0824 0.0653 0.0015  0.0077  -0.0042 438 LYS A N     
2188 C CA    . LYS A 298 ? 0.0594 0.0710 0.0466 0.0019  0.0109  -0.0046 438 LYS A CA    
2189 C C     . LYS A 298 ? 0.0827 0.0940 0.0677 0.0050  0.0104  -0.0091 438 LYS A C     
2190 O O     . LYS A 298 ? 0.0852 0.0944 0.0630 0.0055  0.0090  -0.0102 438 LYS A O     
2191 C CB    . LYS A 298 ? 0.0830 0.0999 0.0723 0.0001  0.0163  -0.0038 438 LYS A CB    
2192 C CG    . LYS A 298 ? 0.1420 0.1588 0.1219 0.0009  0.0209  -0.0034 438 LYS A CG    
2193 C CD    . LYS A 298 ? 0.1847 0.2060 0.1675 -0.0022 0.0279  -0.0015 438 LYS A CD    
2194 C CE    . LYS A 298 ? 0.2275 0.2481 0.1986 -0.0010 0.0338  -0.0003 438 LYS A CE    
2195 N NZ    . LYS A 298 ? 0.2572 0.2783 0.2288 -0.0056 0.0418  0.0039  438 LYS A NZ    
2196 N N     . LEU A 299 ? 0.0818 0.0953 0.0734 0.0074  0.0110  -0.0122 439 LEU A N     
2197 C CA    . LEU A 299 ? 0.0815 0.0924 0.0710 0.0104  0.0109  -0.0176 439 LEU A CA    
2198 C C     . LEU A 299 ? 0.0829 0.0864 0.0710 0.0095  0.0063  -0.0187 439 LEU A C     
2199 O O     . LEU A 299 ? 0.0880 0.0892 0.0708 0.0095  0.0053  -0.0230 439 LEU A O     
2200 C CB    . LEU A 299 ? 0.0950 0.1084 0.0930 0.0144  0.0127  -0.0204 439 LEU A CB    
2201 C CG    . LEU A 299 ? 0.1060 0.1140 0.1019 0.0180  0.0133  -0.0270 439 LEU A CG    
2202 C CD1   . LEU A 299 ? 0.1238 0.1344 0.1094 0.0179  0.0169  -0.0309 439 LEU A CD1   
2203 C CD2   . LEU A 299 ? 0.1190 0.1281 0.1247 0.0235  0.0150  -0.0292 439 LEU A CD2   
2204 N N     . PHE A 300 ? 0.0839 0.0840 0.0766 0.0081  0.0037  -0.0151 440 PHE A N     
2205 C CA    . PHE A 300 ? 0.0788 0.0725 0.0716 0.0062  0.0009  -0.0156 440 PHE A CA    
2206 C C     . PHE A 300 ? 0.0896 0.0860 0.0774 0.0039  -0.0006 -0.0163 440 PHE A C     
2207 O O     . PHE A 300 ? 0.1046 0.0990 0.0922 0.0025  -0.0028 -0.0205 440 PHE A O     
2208 C CB    . PHE A 300 ? 0.0844 0.0747 0.0805 0.0051  -0.0003 -0.0106 440 PHE A CB    
2209 C CG    . PHE A 300 ? 0.0937 0.0771 0.0914 0.0028  -0.0014 -0.0105 440 PHE A CG    
2210 C CD1   . PHE A 300 ? 0.1049 0.0903 0.1022 -0.0005 -0.0021 -0.0099 440 PHE A CD1   
2211 C CD2   . PHE A 300 ? 0.1175 0.0922 0.1180 0.0041  -0.0011 -0.0109 440 PHE A CD2   
2212 C CE1   . PHE A 300 ? 0.1032 0.0839 0.1043 -0.0037 -0.0021 -0.0101 440 PHE A CE1   
2213 C CE2   . PHE A 300 ? 0.1372 0.1044 0.1396 0.0007  -0.0008 -0.0104 440 PHE A CE2   
2214 C CZ    . PHE A 300 ? 0.1191 0.0902 0.1225 -0.0037 -0.0011 -0.0103 440 PHE A CZ    
2215 N N     . GLN A 301 ? 0.0896 0.0901 0.0739 0.0034  0.0001  -0.0124 441 GLN A N     
2216 C CA    . GLN A 301 ? 0.0952 0.0983 0.0749 0.0029  -0.0020 -0.0119 441 GLN A CA    
2217 C C     . GLN A 301 ? 0.0977 0.1037 0.0696 0.0046  -0.0027 -0.0162 441 GLN A C     
2218 O O     . GLN A 301 ? 0.1009 0.1094 0.0708 0.0043  -0.0066 -0.0188 441 GLN A O     
2219 C CB    . GLN A 301 ? 0.1211 0.1251 0.0982 0.0030  -0.0005 -0.0061 441 GLN A CB    
2220 C CG    . GLN A 301 ? 0.1286 0.1299 0.1112 0.0013  -0.0004 -0.0030 441 GLN A CG    
2221 C CD    . GLN A 301 ? 0.1500 0.1510 0.1372 0.0000  -0.0026 -0.0040 441 GLN A CD    
2222 O OE1   . GLN A 301 ? 0.1494 0.1542 0.1367 0.0005  -0.0049 -0.0049 441 GLN A OE1   
2223 N NE2   . GLN A 301 ? 0.1795 0.1766 0.1710 -0.0014 -0.0021 -0.0037 441 GLN A NE2   
2224 N N     . ARG A 302 ? 0.0934 0.1001 0.0609 0.0064  0.0012  -0.0171 442 ARG A N     
2225 C CA    . ARG A 302 ? 0.0984 0.1072 0.0561 0.0083  0.0014  -0.0218 442 ARG A CA    
2226 C C     . ARG A 302 ? 0.1011 0.1075 0.0608 0.0078  -0.0019 -0.0299 442 ARG A C     
2227 O O     . ARG A 302 ? 0.1274 0.1361 0.0802 0.0077  -0.0058 -0.0344 442 ARG A O     
2228 C CB    . ARG A 302 ? 0.1161 0.1265 0.0706 0.0102  0.0079  -0.0218 442 ARG A CB    
2229 C CG    . ARG A 302 ? 0.1286 0.1407 0.0800 0.0095  0.0120  -0.0146 442 ARG A CG    
2230 C CD    . ARG A 302 ? 0.1422 0.1577 0.0946 0.0100  0.0195  -0.0148 442 ARG A CD    
2231 N NE    . ARG A 302 ? 0.1524 0.1693 0.0916 0.0125  0.0229  -0.0180 442 ARG A NE    
2232 C CZ    . ARG A 302 ? 0.2073 0.2263 0.1431 0.0122  0.0305  -0.0161 442 ARG A CZ    
2233 N NH1   . ARG A 302 ? 0.2024 0.2255 0.1476 0.0100  0.0362  -0.0125 442 ARG A NH1   
2234 N NH2   . ARG A 302 ? 0.1832 0.2003 0.1075 0.0129  0.0324  -0.0181 442 ARG A NH2   
2235 N N     . GLU A 303 ? 0.1040 0.1052 0.0730 0.0072  -0.0009 -0.0318 443 GLU A N     
2236 C CA    . GLU A 303 ? 0.1108 0.1063 0.0826 0.0061  -0.0030 -0.0393 443 GLU A CA    
2237 C C     . GLU A 303 ? 0.1245 0.1204 0.1006 0.0018  -0.0081 -0.0403 443 GLU A C     
2238 O O     . GLU A 303 ? 0.1327 0.1282 0.1075 -0.0003 -0.0115 -0.0479 443 GLU A O     
2239 C CB    . GLU A 303 ? 0.1398 0.1279 0.1202 0.0076  -0.0001 -0.0390 443 GLU A CB    
2240 C CG    . GLU A 303 ? 0.1364 0.1264 0.1158 0.0124  0.0048  -0.0399 443 GLU A CG    
2241 C CD    . GLU A 303 ? 0.2455 0.2314 0.2199 0.0147  0.0064  -0.0495 443 GLU A CD    
2242 O OE1   . GLU A 303 ? 0.2169 0.1929 0.1963 0.0149  0.0059  -0.0541 443 GLU A OE1   
2243 O OE2   . GLU A 303 ? 0.2208 0.2124 0.1855 0.0162  0.0086  -0.0523 443 GLU A OE2   
2244 N N     . LEU A 304 ? 0.1014 0.0990 0.0832 0.0001  -0.0086 -0.0333 444 LEU A N     
2245 C CA    . LEU A 304 ? 0.0830 0.0833 0.0711 -0.0038 -0.0124 -0.0338 444 LEU A CA    
2246 C C     . LEU A 304 ? 0.1017 0.1116 0.0842 -0.0032 -0.0174 -0.0365 444 LEU A C     
2247 O O     . LEU A 304 ? 0.1109 0.1247 0.0982 -0.0066 -0.0219 -0.0423 444 LEU A O     
2248 C CB    . LEU A 304 ? 0.1056 0.1063 0.0993 -0.0045 -0.0107 -0.0259 444 LEU A CB    
2249 C CG    . LEU A 304 ? 0.1160 0.1201 0.1185 -0.0084 -0.0126 -0.0256 444 LEU A CG    
2250 C CD1   . LEU A 304 ? 0.1253 0.1221 0.1354 -0.0130 -0.0118 -0.0298 444 LEU A CD1   
2251 C CD2   . LEU A 304 ? 0.1229 0.1271 0.1278 -0.0079 -0.0098 -0.0180 444 LEU A CD2   
2252 N N     . ARG A 305 ? 0.1111 0.1251 0.0838 0.0008  -0.0167 -0.0322 445 ARG A N     
2253 C CA    . ARG A 305 ? 0.1056 0.1279 0.0700 0.0031  -0.0217 -0.0333 445 ARG A CA    
2254 C C     . ARG A 305 ? 0.1372 0.1597 0.0938 0.0030  -0.0241 -0.0419 445 ARG A C     
2255 O O     . ARG A 305 ? 0.1380 0.1659 0.0942 0.0020  -0.0295 -0.0445 445 ARG A O     
2256 C CB    . ARG A 305 ? 0.1118 0.1345 0.0663 0.0075  -0.0187 -0.0252 445 ARG A CB    
2257 C CG    . ARG A 305 ? 0.1081 0.1303 0.0700 0.0075  -0.0172 -0.0174 445 ARG A CG    
2258 C CD    . ARG A 305 ? 0.1122 0.1306 0.0664 0.0102  -0.0124 -0.0102 445 ARG A CD    
2259 N NE    . ARG A 305 ? 0.1207 0.1372 0.0820 0.0099  -0.0111 -0.0047 445 ARG A NE    
2260 C CZ    . ARG A 305 ? 0.1458 0.1584 0.1026 0.0119  -0.0079 0.0018  445 ARG A CZ    
2261 N NH1   . ARG A 305 ? 0.1486 0.1582 0.0941 0.0138  -0.0048 0.0050  445 ARG A NH1   
2262 N NH2   . ARG A 305 ? 0.1356 0.1458 0.0992 0.0115  -0.0068 0.0051  445 ARG A NH2   
2263 N N     . ARG A 306 ? 0.1218 0.1372 0.0742 0.0037  -0.0191 -0.0450 446 ARG A N     
2264 C CA    . ARG A 306 ? 0.1328 0.1455 0.0789 0.0033  -0.0195 -0.0519 446 ARG A CA    
2265 C C     . ARG A 306 ? 0.1445 0.1546 0.1006 -0.0018 -0.0234 -0.0589 446 ARG A C     
2266 O O     . ARG A 306 ? 0.1635 0.1763 0.1161 -0.0035 -0.0279 -0.0638 446 ARG A O     
2267 C CB    . ARG A 306 ? 0.1446 0.1506 0.0865 0.0059  -0.0125 -0.0535 446 ARG A CB    
2268 C CG    . ARG A 306 ? 0.1685 0.1707 0.1017 0.0063  -0.0115 -0.0605 446 ARG A CG    
2269 C CD    . ARG A 306 ? 0.1979 0.1961 0.1276 0.0100  -0.0035 -0.0606 446 ARG A CD    
2270 N NE    . ARG A 306 ? 0.1969 0.1887 0.1384 0.0108  0.0001  -0.0621 446 ARG A NE    
2271 C CZ    . ARG A 306 ? 0.2568 0.2397 0.2012 0.0110  0.0017  -0.0686 446 ARG A CZ    
2272 N NH1   . ARG A 306 ? 0.2741 0.2534 0.2106 0.0096  -0.0003 -0.0755 446 ARG A NH1   
2273 N NH2   . ARG A 306 ? 0.2451 0.2218 0.2001 0.0131  0.0050  -0.0682 446 ARG A NH2   
2274 N N     . PHE A 307 ? 0.1319 0.1363 0.1004 -0.0047 -0.0215 -0.0589 447 PHE A N     
2275 C CA    . PHE A 307 ? 0.1298 0.1298 0.1091 -0.0106 -0.0235 -0.0638 447 PHE A CA    
2276 C C     . PHE A 307 ? 0.1582 0.1694 0.1430 -0.0139 -0.0298 -0.0641 447 PHE A C     
2277 O O     . PHE A 307 ? 0.1658 0.1779 0.1525 -0.0177 -0.0334 -0.0702 447 PHE A O     
2278 C CB    . PHE A 307 ? 0.1286 0.1197 0.1192 -0.0127 -0.0194 -0.0608 447 PHE A CB    
2279 C CG    . PHE A 307 ? 0.1578 0.1428 0.1594 -0.0192 -0.0197 -0.0635 447 PHE A CG    
2280 C CD1   . PHE A 307 ? 0.1843 0.1564 0.1856 -0.0204 -0.0173 -0.0682 447 PHE A CD1   
2281 C CD2   . PHE A 307 ? 0.1521 0.1442 0.1644 -0.0239 -0.0217 -0.0611 447 PHE A CD2   
2282 C CE1   . PHE A 307 ? 0.1895 0.1547 0.1999 -0.0268 -0.0169 -0.0700 447 PHE A CE1   
2283 C CE2   . PHE A 307 ? 0.1765 0.1633 0.1991 -0.0305 -0.0207 -0.0629 447 PHE A CE2   
2284 C CZ    . PHE A 307 ? 0.1932 0.1660 0.2142 -0.0321 -0.0185 -0.0672 447 PHE A CZ    
2285 N N     A SER A 308 ? 0.1252 0.1450 0.1136 -0.0125 -0.0312 -0.0578 448 SER A N     
2286 N N     B SER A 308 ? 0.1221 0.1423 0.1098 -0.0122 -0.0314 -0.0578 448 SER A N     
2287 C CA    A SER A 308 ? 0.1176 0.1496 0.1130 -0.0141 -0.0368 -0.0572 448 SER A CA    
2288 C CA    B SER A 308 ? 0.1184 0.1504 0.1143 -0.0145 -0.0369 -0.0575 448 SER A CA    
2289 C C     A SER A 308 ? 0.1406 0.1789 0.1265 -0.0125 -0.0423 -0.0611 448 SER A C     
2290 C C     B SER A 308 ? 0.1387 0.1780 0.1248 -0.0122 -0.0427 -0.0606 448 SER A C     
2291 O O     A SER A 308 ? 0.1462 0.1897 0.1390 -0.0167 -0.0469 -0.0663 448 SER A O     
2292 O O     B SER A 308 ? 0.1458 0.1925 0.1391 -0.0157 -0.0478 -0.0646 448 SER A O     
2293 C CB    A SER A 308 ? 0.1123 0.1515 0.1090 -0.0102 -0.0367 -0.0492 448 SER A CB    
2294 C CB    B SER A 308 ? 0.1099 0.1494 0.1102 -0.0116 -0.0368 -0.0498 448 SER A CB    
2295 O OG    A SER A 308 ? 0.1232 0.1747 0.1293 -0.0109 -0.0414 -0.0481 448 SER A OG    
2296 O OG    B SER A 308 ? 0.1085 0.1510 0.0950 -0.0048 -0.0376 -0.0447 448 SER A OG    
2297 N N     . ARG A 309 ? 0.1633 0.2007 0.1331 -0.0067 -0.0416 -0.0585 449 ARG A N     
2298 C CA    . ARG A 309 ? 0.1835 0.2267 0.1417 -0.0044 -0.0468 -0.0606 449 ARG A CA    
2299 C C     . ARG A 309 ? 0.1970 0.2346 0.1509 -0.0079 -0.0478 -0.0702 449 ARG A C     
2300 O O     . ARG A 309 ? 0.2234 0.2674 0.1776 -0.0103 -0.0543 -0.0755 449 ARG A O     
2301 C CB    . ARG A 309 ? 0.2031 0.2451 0.1448 0.0023  -0.0441 -0.0537 449 ARG A CB    
2302 C CG    . ARG A 309 ? 0.2423 0.2876 0.1687 0.0050  -0.0482 -0.0552 449 ARG A CG    
2303 C CD    . ARG A 309 ? 0.2411 0.2832 0.1517 0.0108  -0.0437 -0.0470 449 ARG A CD    
2304 N NE    . ARG A 309 ? 0.2538 0.3000 0.1665 0.0147  -0.0446 -0.0374 449 ARG A NE    
2305 C CZ    . ARG A 309 ? 0.2962 0.3490 0.2039 0.0185  -0.0503 -0.0334 449 ARG A CZ    
2306 N NH1   . ARG A 309 ? 0.3375 0.3948 0.2369 0.0186  -0.0564 -0.0384 449 ARG A NH1   
2307 N NH2   . ARG A 309 ? 0.3539 0.4080 0.2643 0.0225  -0.0499 -0.0246 449 ARG A NH2   
2308 N N     . LYS A 310 ? 0.1889 0.2146 0.1393 -0.0083 -0.0416 -0.0731 450 LYS A N     
2309 C CA    . LYS A 310 ? 0.2149 0.2334 0.1587 -0.0105 -0.0416 -0.0822 450 LYS A CA    
2310 C C     . LYS A 310 ? 0.2292 0.2431 0.1868 -0.0177 -0.0432 -0.0891 450 LYS A C     
2311 O O     . LYS A 310 ? 0.2719 0.2847 0.2262 -0.0209 -0.0470 -0.0973 450 LYS A O     
2312 C CB    . LYS A 310 ? 0.2399 0.2475 0.1747 -0.0069 -0.0336 -0.0825 450 LYS A CB    
2313 C CG    . LYS A 310 ? 0.2804 0.2915 0.2018 -0.0008 -0.0304 -0.0755 450 LYS A CG    
2314 C CD    . LYS A 310 ? 0.3199 0.3380 0.2268 0.0010  -0.0355 -0.0759 450 LYS A CD    
2315 C CE    . LYS A 310 ? 0.3240 0.3428 0.2168 0.0063  -0.0306 -0.0681 450 LYS A CE    
2316 N NZ    . LYS A 310 ? 0.3330 0.3573 0.2103 0.0085  -0.0354 -0.0672 450 LYS A NZ    
2317 N N     . GLU A 311 ? 0.2064 0.2170 0.1788 -0.0206 -0.0402 -0.0858 451 GLU A N     
2318 C CA    . GLU A 311 ? 0.2036 0.2076 0.1889 -0.0279 -0.0401 -0.0909 451 GLU A CA    
2319 C C     . GLU A 311 ? 0.2440 0.2603 0.2433 -0.0331 -0.0453 -0.0905 451 GLU A C     
2320 O O     . GLU A 311 ? 0.2566 0.2715 0.2636 -0.0397 -0.0476 -0.0969 451 GLU A O     
2321 C CB    . GLU A 311 ? 0.2179 0.2086 0.2106 -0.0284 -0.0328 -0.0872 451 GLU A CB    
2322 C CG    . GLU A 311 ? 0.2380 0.2172 0.2201 -0.0227 -0.0272 -0.0874 451 GLU A CG    
2323 C CD    . GLU A 311 ? 0.3143 0.2848 0.2873 -0.0229 -0.0272 -0.0965 451 GLU A CD    
2324 O OE1   . GLU A 311 ? 0.2983 0.2648 0.2762 -0.0290 -0.0299 -0.1028 451 GLU A OE1   
2325 O OE2   . GLU A 311 ? 0.2977 0.2654 0.2585 -0.0172 -0.0241 -0.0974 451 GLU A OE2   
2326 N N     . LYS A 312 ? 0.2102 0.2385 0.2137 -0.0303 -0.0469 -0.0834 452 LYS A N     
2327 C CA    . LYS A 312 ? 0.1955 0.2365 0.2143 -0.0344 -0.0506 -0.0824 452 LYS A CA    
2328 C C     . LYS A 312 ? 0.2087 0.2662 0.2236 -0.0306 -0.0586 -0.0818 452 LYS A C     
2329 O O     . LYS A 312 ? 0.2268 0.2968 0.2552 -0.0335 -0.0627 -0.0821 452 LYS A O     
2330 C CB    . LYS A 312 ? 0.1941 0.2353 0.2236 -0.0343 -0.0455 -0.0744 452 LYS A CB    
2331 C CG    . LYS A 312 ? 0.1813 0.2056 0.2145 -0.0376 -0.0377 -0.0734 452 LYS A CG    
2332 C CD    . LYS A 312 ? 0.2221 0.2403 0.2653 -0.0458 -0.0370 -0.0790 452 LYS A CD    
2333 C CE    . LYS A 312 ? 0.2688 0.2675 0.3128 -0.0478 -0.0293 -0.0770 452 LYS A CE    
2334 N NZ    . LYS A 312 ? 0.3169 0.3084 0.3707 -0.0561 -0.0279 -0.0812 452 LYS A NZ    
2335 N N     . GLY A 313 ? 0.1849 0.2427 0.1821 -0.0239 -0.0606 -0.0805 453 GLY A N     
2336 C CA    . GLY A 313 ? 0.1945 0.2659 0.1859 -0.0194 -0.0679 -0.0786 453 GLY A CA    
2337 C C     . GLY A 313 ? 0.1986 0.2797 0.1968 -0.0147 -0.0684 -0.0696 453 GLY A C     
2338 O O     . GLY A 313 ? 0.2072 0.3014 0.2075 -0.0119 -0.0750 -0.0681 453 GLY A O     
2339 N N     . LEU A 314 ? 0.1656 0.2406 0.1672 -0.0134 -0.0616 -0.0635 454 LEU A N     
2340 C CA    . LEU A 314 ? 0.1528 0.2350 0.1614 -0.0093 -0.0610 -0.0554 454 LEU A CA    
2341 C C     . LEU A 314 ? 0.1674 0.2419 0.1613 -0.0026 -0.0566 -0.0481 454 LEU A C     
2342 O O     . LEU A 314 ? 0.1631 0.2263 0.1488 -0.0034 -0.0516 -0.0492 454 LEU A O     
2343 C CB    . LEU A 314 ? 0.1534 0.2354 0.1807 -0.0149 -0.0564 -0.0549 454 LEU A CB    
2344 C CG    . LEU A 314 ? 0.1679 0.2555 0.2118 -0.0231 -0.0582 -0.0613 454 LEU A CG    
2345 C CD1   . LEU A 314 ? 0.1622 0.2474 0.2221 -0.0283 -0.0514 -0.0590 454 LEU A CD1   
2346 C CD2   . LEU A 314 ? 0.1834 0.2885 0.2337 -0.0210 -0.0661 -0.0619 454 LEU A CD2   
2347 N N     . TRP A 315 ? 0.1435 0.2237 0.1349 0.0038  -0.0581 -0.0406 455 TRP A N     
2348 C CA    . TRP A 315 ? 0.1397 0.2123 0.1162 0.0102  -0.0541 -0.0328 455 TRP A CA    
2349 C C     . TRP A 315 ? 0.1216 0.1922 0.1064 0.0112  -0.0492 -0.0270 455 TRP A C     
2350 O O     . TRP A 315 ? 0.1214 0.2001 0.1171 0.0133  -0.0510 -0.0238 455 TRP A O     
2351 C CB    . TRP A 315 ? 0.1596 0.2366 0.1254 0.0171  -0.0584 -0.0276 455 TRP A CB    
2352 C CG    . TRP A 315 ? 0.1841 0.2638 0.1400 0.0164  -0.0638 -0.0332 455 TRP A CG    
2353 C CD1   . TRP A 315 ? 0.2057 0.2823 0.1598 0.0108  -0.0639 -0.0421 455 TRP A CD1   
2354 C CD2   . TRP A 315 ? 0.2398 0.3252 0.1856 0.0217  -0.0698 -0.0305 455 TRP A CD2   
2355 N NE1   . TRP A 315 ? 0.2516 0.3320 0.1944 0.0121  -0.0698 -0.0456 455 TRP A NE1   
2356 C CE2   . TRP A 315 ? 0.2283 0.3147 0.1657 0.0187  -0.0738 -0.0384 455 TRP A CE2   
2357 C CE3   . TRP A 315 ? 0.2811 0.3699 0.2236 0.0291  -0.0722 -0.0220 455 TRP A CE3   
2358 C CZ2   . TRP A 315 ? 0.2875 0.3794 0.2124 0.0227  -0.0806 -0.0382 455 TRP A CZ2   
2359 C CZ3   . TRP A 315 ? 0.2997 0.3935 0.2305 0.0334  -0.0789 -0.0212 455 TRP A CZ3   
2360 C CH2   . TRP A 315 ? 0.3082 0.4041 0.2300 0.0301  -0.0833 -0.0292 455 TRP A CH2   
2361 N N     . LEU A 316 ? 0.1158 0.1763 0.0957 0.0100  -0.0431 -0.0259 456 LEU A N     
2362 C CA    . LEU A 316 ? 0.1021 0.1589 0.0886 0.0100  -0.0380 -0.0209 456 LEU A CA    
2363 C C     . LEU A 316 ? 0.1211 0.1693 0.0948 0.0152  -0.0332 -0.0122 456 LEU A C     
2364 O O     . LEU A 316 ? 0.1298 0.1721 0.0899 0.0164  -0.0311 -0.0117 456 LEU A O     
2365 C CB    . LEU A 316 ? 0.0829 0.1303 0.0751 0.0035  -0.0326 -0.0243 456 LEU A CB    
2366 C CG    . LEU A 316 ? 0.0757 0.1151 0.0737 0.0022  -0.0255 -0.0183 456 LEU A CG    
2367 C CD1   . LEU A 316 ? 0.0776 0.1244 0.0896 0.0012  -0.0258 -0.0168 456 LEU A CD1   
2368 C CD2   . LEU A 316 ? 0.0970 0.1267 0.0966 -0.0023 -0.0214 -0.0210 456 LEU A CD2   
2369 N N     . ASN A 317 ? 0.1010 0.1479 0.0798 0.0179  -0.0306 -0.0057 457 ASN A N     
2370 C CA    . ASN A 317 ? 0.1015 0.1376 0.0707 0.0210  -0.0247 0.0019  457 ASN A CA    
2371 C C     . ASN A 317 ? 0.0999 0.1321 0.0792 0.0200  -0.0201 0.0050  457 ASN A C     
2372 O O     . ASN A 317 ? 0.0957 0.1329 0.0878 0.0167  -0.0203 0.0017  457 ASN A O     
2373 C CB    . ASN A 317 ? 0.1195 0.1559 0.0758 0.0282  -0.0274 0.0073  457 ASN A CB    
2374 C CG    . ASN A 317 ? 0.1244 0.1680 0.0888 0.0332  -0.0315 0.0098  457 ASN A CG    
2375 O OD1   . ASN A 317 ? 0.1230 0.1723 0.1011 0.0333  -0.0317 0.0091  457 ASN A OD1   
2376 N ND2   . ASN A 317 ? 0.1699 0.2137 0.1262 0.0375  -0.0344 0.0127  457 ASN A ND2   
2377 N N     . SER A 318 ? 0.1129 0.1350 0.0857 0.0222  -0.0151 0.0110  458 SER A N     
2378 C CA    . SER A 318 ? 0.1030 0.1198 0.0828 0.0211  -0.0103 0.0128  458 SER A CA    
2379 C C     . SER A 318 ? 0.1141 0.1369 0.1023 0.0260  -0.0118 0.0144  458 SER A C     
2380 O O     . SER A 318 ? 0.1216 0.1407 0.1155 0.0254  -0.0073 0.0149  458 SER A O     
2381 C CB    . SER A 318 ? 0.1367 0.1405 0.1080 0.0209  -0.0045 0.0172  458 SER A CB    
2382 O OG    . SER A 318 ? 0.1628 0.1622 0.1268 0.0272  -0.0045 0.0229  458 SER A OG    
2383 N N     . HIS A 319 ? 0.1248 0.1581 0.1143 0.0310  -0.0182 0.0144  459 HIS A N     
2384 C CA    . HIS A 319 ? 0.1416 0.1841 0.1417 0.0369  -0.0204 0.0156  459 HIS A CA    
2385 C C     . HIS A 319 ? 0.1248 0.1846 0.1410 0.0340  -0.0251 0.0095  459 HIS A C     
2386 O O     . HIS A 319 ? 0.1375 0.2067 0.1670 0.0373  -0.0252 0.0095  459 HIS A O     
2387 C CB    . HIS A 319 ? 0.1399 0.1834 0.1315 0.0462  -0.0251 0.0210  459 HIS A CB    
2388 C CG    . HIS A 319 ? 0.1821 0.2073 0.1581 0.0474  -0.0197 0.0270  459 HIS A CG    
2389 N ND1   . HIS A 319 ? 0.2284 0.2398 0.2030 0.0473  -0.0122 0.0302  459 HIS A ND1   
2390 C CD2   . HIS A 319 ? 0.2495 0.2682 0.2119 0.0479  -0.0201 0.0298  459 HIS A CD2   
2391 C CE1   . HIS A 319 ? 0.2674 0.2651 0.2296 0.0466  -0.0085 0.0341  459 HIS A CE1   
2392 N NE2   . HIS A 319 ? 0.2720 0.2743 0.2269 0.0474  -0.0129 0.0345  459 HIS A NE2   
2393 N N     . GLY A 320 ? 0.1002 0.1647 0.1165 0.0280  -0.0288 0.0038  460 GLY A N     
2394 C CA    . GLY A 320 ? 0.0937 0.1746 0.1258 0.0245  -0.0338 -0.0026 460 GLY A CA    
2395 C C     . GLY A 320 ? 0.0814 0.1640 0.1092 0.0189  -0.0384 -0.0092 460 GLY A C     
2396 O O     . GLY A 320 ? 0.0947 0.1660 0.1076 0.0180  -0.0369 -0.0087 460 GLY A O     
2397 N N     . LEU A 321 ? 0.0975 0.1936 0.1395 0.0145  -0.0431 -0.0158 461 LEU A N     
2398 C CA    . LEU A 321 ? 0.1092 0.2044 0.1492 0.0077  -0.0464 -0.0232 461 LEU A CA    
2399 C C     . LEU A 321 ? 0.1233 0.2305 0.1684 0.0087  -0.0535 -0.0259 461 LEU A C     
2400 O O     . LEU A 321 ? 0.1180 0.2366 0.1805 0.0070  -0.0541 -0.0269 461 LEU A O     
2401 C CB    . LEU A 321 ? 0.0931 0.1860 0.1458 -0.0017 -0.0419 -0.0283 461 LEU A CB    
2402 C CG    . LEU A 321 ? 0.1033 0.1913 0.1548 -0.0090 -0.0435 -0.0359 461 LEU A CG    
2403 C CD1   . LEU A 321 ? 0.1270 0.2034 0.1595 -0.0071 -0.0437 -0.0370 461 LEU A CD1   
2404 C CD2   . LEU A 321 ? 0.1264 0.2088 0.1906 -0.0176 -0.0372 -0.0382 461 LEU A CD2   
2405 N N     . PHE A 322 ? 0.1238 0.2290 0.1541 0.0112  -0.0585 -0.0270 462 PHE A N     
2406 C CA    . PHE A 322 ? 0.1345 0.2511 0.1657 0.0142  -0.0664 -0.0282 462 PHE A CA    
2407 C C     . PHE A 322 ? 0.1583 0.2779 0.1903 0.0072  -0.0709 -0.0374 462 PHE A C     
2408 O O     . PHE A 322 ? 0.1532 0.2624 0.1728 0.0045  -0.0693 -0.0409 462 PHE A O     
2409 C CB    . PHE A 322 ? 0.1586 0.2700 0.1707 0.0231  -0.0683 -0.0215 462 PHE A CB    
2410 C CG    . PHE A 322 ? 0.2133 0.3357 0.2244 0.0278  -0.0767 -0.0212 462 PHE A CG    
2411 C CD1   . PHE A 322 ? 0.2065 0.3411 0.2324 0.0319  -0.0798 -0.0184 462 PHE A CD1   
2412 C CD2   . PHE A 322 ? 0.2277 0.3482 0.2222 0.0288  -0.0814 -0.0233 462 PHE A CD2   
2413 C CE1   . PHE A 322 ? 0.2350 0.3804 0.2599 0.0369  -0.0884 -0.0177 462 PHE A CE1   
2414 C CE2   . PHE A 322 ? 0.2695 0.4005 0.2615 0.0336  -0.0900 -0.0226 462 PHE A CE2   
2415 C CZ    . PHE A 322 ? 0.2469 0.3906 0.2546 0.0377  -0.0939 -0.0198 462 PHE A CZ    
2416 N N     . ASP A 323 ? 0.1733 0.3071 0.2206 0.0042  -0.0762 -0.0417 463 ASP A N     
2417 C CA    . ASP A 323 ? 0.1872 0.3254 0.2350 -0.0017 -0.0821 -0.0505 463 ASP A CA    
2418 C C     . ASP A 323 ? 0.2179 0.3636 0.2539 0.0050  -0.0910 -0.0495 463 ASP A C     
2419 O O     . ASP A 323 ? 0.2339 0.3936 0.2797 0.0093  -0.0962 -0.0468 463 ASP A O     
2420 C CB    . ASP A 323 ? 0.1835 0.3332 0.2551 -0.0096 -0.0827 -0.0557 463 ASP A CB    
2421 C CG    . ASP A 323 ? 0.2802 0.4340 0.3536 -0.0167 -0.0888 -0.0656 463 ASP A CG    
2422 O OD1   . ASP A 323 ? 0.3002 0.4524 0.3571 -0.0138 -0.0947 -0.0682 463 ASP A OD1   
2423 O OD2   . ASP A 323 ? 0.3214 0.4796 0.4125 -0.0254 -0.0873 -0.0706 463 ASP A OD2   
2424 N N     . PRO A 324 ? 0.2377 0.3748 0.2526 0.0068  -0.0926 -0.0511 464 PRO A N     
2425 C CA    . PRO A 324 ? 0.2756 0.4182 0.2763 0.0140  -0.1002 -0.0485 464 PRO A CA    
2426 C C     . PRO A 324 ? 0.3113 0.4688 0.3187 0.0108  -0.1105 -0.0563 464 PRO A C     
2427 O O     . PRO A 324 ? 0.3629 0.5279 0.3609 0.0172  -0.1182 -0.0539 464 PRO A O     
2428 C CB    . PRO A 324 ? 0.3136 0.4410 0.2901 0.0154  -0.0964 -0.0481 464 PRO A CB    
2429 C CG    . PRO A 324 ? 0.2864 0.4055 0.2676 0.0066  -0.0914 -0.0560 464 PRO A CG    
2430 C CD    . PRO A 324 ? 0.2530 0.3750 0.2564 0.0023  -0.0871 -0.0553 464 PRO A CD    
2431 N N     . GLU A 325 ? 0.3131 0.4746 0.3362 0.0010  -0.1108 -0.0653 465 GLU A N     
2432 C CA    . GLU A 325 ? 0.3238 0.5008 0.3566 -0.0033 -0.1206 -0.0734 465 GLU A CA    
2433 C C     . GLU A 325 ? 0.3726 0.5682 0.4286 -0.0017 -0.1242 -0.0705 465 GLU A C     
2434 O O     . GLU A 325 ? 0.3934 0.6041 0.4508 0.0029  -0.1340 -0.0702 465 GLU A O     
2435 C CB    . GLU A 325 ? 0.2979 0.4695 0.3375 -0.0150 -0.1187 -0.0843 465 GLU A CB    
2436 N N     . GLN A 326 ? 0.3634 0.5587 0.4378 -0.0054 -0.1164 -0.0682 466 GLN A N     
2437 C CA    . GLN A 326 ? 0.3217 0.5341 0.4181 -0.0030 -0.1179 -0.0645 466 GLN A CA    
2438 C C     . GLN A 326 ? 0.3109 0.5234 0.4005 0.0096  -0.1175 -0.0535 466 GLN A C     
2439 O O     . GLN A 326 ? 0.3155 0.5434 0.4204 0.0143  -0.1209 -0.0501 466 GLN A O     
2440 C CB    . GLN A 326 ? 0.3292 0.5403 0.4461 -0.0108 -0.1083 -0.0651 466 GLN A CB    
2441 C CG    . GLN A 326 ? 0.3718 0.5828 0.4997 -0.0238 -0.1076 -0.0751 466 GLN A CG    
2442 C CD    . GLN A 326 ? 0.3925 0.6034 0.5410 -0.0310 -0.0978 -0.0741 466 GLN A CD    
2443 O OE1   . GLN A 326 ? 0.4317 0.6409 0.5842 -0.0263 -0.0909 -0.0663 466 GLN A OE1   
2444 N NE2   . GLN A 326 ? 0.3985 0.6102 0.5595 -0.0426 -0.0967 -0.0819 466 GLN A NE2   
2445 N N     A LYS A 327 ? 0.2831 0.4786 0.3509 0.0150  -0.1130 -0.0477 467 LYS A N     
2446 N N     B LYS A 327 ? 0.2850 0.4806 0.3525 0.0151  -0.1132 -0.0478 467 LYS A N     
2447 C CA    A LYS A 327 ? 0.2803 0.4719 0.3405 0.0263  -0.1111 -0.0370 467 LYS A CA    
2448 C CA    B LYS A 327 ? 0.2749 0.4663 0.3351 0.0262  -0.1110 -0.0370 467 LYS A CA    
2449 C C     A LYS A 327 ? 0.2713 0.4648 0.3501 0.0269  -0.1034 -0.0325 467 LYS A C     
2450 C C     B LYS A 327 ? 0.2788 0.4733 0.3588 0.0266  -0.1037 -0.0329 467 LYS A C     
2451 O O     A LYS A 327 ? 0.2743 0.4745 0.3599 0.0352  -0.1044 -0.0261 467 LYS A O     
2452 O O     B LYS A 327 ? 0.2835 0.4867 0.3724 0.0342  -0.1053 -0.0271 467 LYS A O     
2453 C CB    A LYS A 327 ? 0.3020 0.5062 0.3588 0.0349  -0.1216 -0.0339 467 LYS A CB    
2454 C CB    B LYS A 327 ? 0.3074 0.5101 0.3623 0.0352  -0.1212 -0.0336 467 LYS A CB    
2455 C CG    A LYS A 327 ? 0.3023 0.4953 0.3397 0.0464  -0.1202 -0.0232 467 LYS A CG    
2456 C CG    B LYS A 327 ? 0.3262 0.5229 0.3562 0.0368  -0.1270 -0.0354 467 LYS A CG    
2457 N N     . THR A 328 ? 0.2212 0.4080 0.3078 0.0184  -0.0954 -0.0358 468 THR A N     
2458 C CA    . THR A 328 ? 0.1763 0.3644 0.2796 0.0176  -0.0872 -0.0325 468 THR A CA    
2459 C C     . THR A 328 ? 0.1679 0.3373 0.2603 0.0163  -0.0778 -0.0297 468 THR A C     
2460 O O     . THR A 328 ? 0.1819 0.3398 0.2608 0.0119  -0.0768 -0.0331 468 THR A O     
2461 C CB    . THR A 328 ? 0.1931 0.3931 0.3197 0.0077  -0.0858 -0.0390 468 THR A CB    
2462 O OG1   . THR A 328 ? 0.2238 0.4155 0.3451 -0.0021 -0.0852 -0.0464 468 THR A OG1   
2463 C CG2   . THR A 328 ? 0.2126 0.4342 0.3543 0.0092  -0.0948 -0.0415 468 THR A CG2   
2464 N N     . PHE A 329 ? 0.1549 0.3221 0.2539 0.0202  -0.0709 -0.0238 469 PHE A N     
2465 C CA    . PHE A 329 ? 0.1268 0.2793 0.2198 0.0184  -0.0618 -0.0214 469 PHE A CA    
2466 C C     . PHE A 329 ? 0.1455 0.3012 0.2566 0.0097  -0.0546 -0.0246 469 PHE A C     
2467 O O     . PHE A 329 ? 0.1872 0.3560 0.3169 0.0089  -0.0535 -0.0248 469 PHE A O     
2468 C CB    . PHE A 329 ? 0.1458 0.2918 0.2327 0.0285  -0.0580 -0.0129 469 PHE A CB    
2469 C CG    . PHE A 329 ? 0.2060 0.3422 0.2710 0.0359  -0.0617 -0.0082 469 PHE A CG    
2470 C CD1   . PHE A 329 ? 0.1882 0.3086 0.2350 0.0350  -0.0582 -0.0066 469 PHE A CD1   
2471 C CD2   . PHE A 329 ? 0.2090 0.3514 0.2714 0.0437  -0.0683 -0.0049 469 PHE A CD2   
2472 C CE1   . PHE A 329 ? 0.1899 0.3004 0.2165 0.0408  -0.0598 -0.0017 469 PHE A CE1   
2473 C CE2   . PHE A 329 ? 0.2221 0.3538 0.2633 0.0499  -0.0704 0.0003  469 PHE A CE2   
2474 C CZ    . PHE A 329 ? 0.2233 0.3388 0.2466 0.0481  -0.0656 0.0019  469 PHE A CZ    
2475 N N     A PHE A 330 ? 0.1311 0.2743 0.2365 0.0031  -0.0493 -0.0267 470 PHE A N     
2476 N N     B PHE A 330 ? 0.1256 0.2685 0.2307 0.0034  -0.0490 -0.0264 470 PHE A N     
2477 C CA    A PHE A 330 ? 0.1369 0.2790 0.2559 -0.0051 -0.0409 -0.0282 470 PHE A CA    
2478 C CA    B PHE A 330 ? 0.1383 0.2798 0.2568 -0.0052 -0.0408 -0.0282 470 PHE A CA    
2479 C C     A PHE A 330 ? 0.1440 0.2841 0.2663 -0.0002 -0.0328 -0.0221 470 PHE A C     
2480 C C     B PHE A 330 ? 0.1483 0.2872 0.2703 -0.0011 -0.0322 -0.0223 470 PHE A C     
2481 O O     A PHE A 330 ? 0.1756 0.3072 0.2851 0.0066  -0.0318 -0.0179 470 PHE A O     
2482 O O     B PHE A 330 ? 0.1576 0.2862 0.2667 0.0039  -0.0301 -0.0187 470 PHE A O     
2483 C CB    A PHE A 330 ? 0.1411 0.2684 0.2517 -0.0129 -0.0380 -0.0319 470 PHE A CB    
2484 C CB    B PHE A 330 ? 0.1424 0.2693 0.2521 -0.0129 -0.0384 -0.0321 470 PHE A CB    
2485 C CG    A PHE A 330 ? 0.1537 0.2810 0.2616 -0.0183 -0.0443 -0.0389 470 PHE A CG    
2486 C CG    B PHE A 330 ? 0.1317 0.2516 0.2502 -0.0208 -0.0287 -0.0318 470 PHE A CG    
2487 C CD1   A PHE A 330 ? 0.1596 0.2846 0.2515 -0.0137 -0.0514 -0.0404 470 PHE A CD1   
2488 C CD1   B PHE A 330 ? 0.1526 0.2792 0.2866 -0.0279 -0.0258 -0.0341 470 PHE A CD1   
2489 C CD2   A PHE A 330 ? 0.1743 0.3032 0.2949 -0.0279 -0.0423 -0.0438 470 PHE A CD2   
2490 C CD2   B PHE A 330 ? 0.1399 0.2458 0.2499 -0.0210 -0.0221 -0.0286 470 PHE A CD2   
2491 C CE1   A PHE A 330 ? 0.1744 0.2991 0.2628 -0.0183 -0.0567 -0.0475 470 PHE A CE1   
2492 C CE1   B PHE A 330 ? 0.1428 0.2603 0.2815 -0.0347 -0.0159 -0.0322 470 PHE A CE1   
2493 C CE2   A PHE A 330 ? 0.1859 0.3141 0.3040 -0.0327 -0.0480 -0.0510 470 PHE A CE2   
2494 C CE2   B PHE A 330 ? 0.1327 0.2298 0.2476 -0.0276 -0.0129 -0.0269 470 PHE A CE2   
2495 C CZ    A PHE A 330 ? 0.1706 0.2971 0.2726 -0.0278 -0.0554 -0.0532 470 PHE A CZ    
2496 C CZ    B PHE A 330 ? 0.1355 0.2374 0.2632 -0.0342 -0.0095 -0.0282 470 PHE A CZ    
2497 N N     . GLN A 331 ? 0.1297 0.2775 0.2686 -0.0036 -0.0264 -0.0217 471 GLN A N     
2498 C CA    . GLN A 331 ? 0.1345 0.2803 0.2765 0.0007  -0.0173 -0.0168 471 GLN A CA    
2499 C C     . GLN A 331 ? 0.2235 0.3560 0.3622 -0.0074 -0.0078 -0.0168 471 GLN A C     
2500 O O     . GLN A 331 ? 0.3603 0.4936 0.5076 -0.0159 -0.0031 -0.0185 471 GLN A O     
2501 C CB    . GLN A 331 ? 0.2040 0.3656 0.3639 0.0030  -0.0148 -0.0156 471 GLN A CB    
2502 C CG    . GLN A 331 ? 0.2664 0.4405 0.4305 0.0116  -0.0243 -0.0148 471 GLN A CG    
2503 C CD    . GLN A 331 ? 0.3616 0.5256 0.5096 0.0226  -0.0275 -0.0102 471 GLN A CD    
2504 O OE1   . GLN A 331 ? 0.4328 0.5864 0.5746 0.0270  -0.0203 -0.0067 471 GLN A OE1   
2505 N NE2   . GLN A 331 ? 0.3532 0.5187 0.4924 0.0267  -0.0378 -0.0104 471 GLN A NE2   
2506 N N     . ALA A 332 ? 0.1227 0.2415 0.2476 -0.0048 -0.0051 -0.0144 472 ALA A N     
2507 C CA    . ALA A 332 ? 0.0972 0.1981 0.2127 -0.0110 0.0035  -0.0120 472 ALA A CA    
2508 C C     . ALA A 332 ? 0.1102 0.2052 0.2218 -0.0072 0.0129  -0.0071 472 ALA A C     
2509 O O     . ALA A 332 ? 0.1216 0.2149 0.2263 0.0014  0.0123  -0.0043 472 ALA A O     
2510 C CB    . ALA A 332 ? 0.0971 0.1804 0.1919 -0.0107 0.0003  -0.0108 472 ALA A CB    
2511 N N     . ALA A 333 ? 0.1046 0.1939 0.2181 -0.0136 0.0222  -0.0058 473 ALA A N     
2512 C CA    . ALA A 333 ? 0.1014 0.1825 0.2067 -0.0107 0.0316  -0.0017 473 ALA A CA    
2513 C C     . ALA A 333 ? 0.1246 0.1845 0.2084 -0.0126 0.0343  0.0018  473 ALA A C     
2514 O O     . ALA A 333 ? 0.1338 0.1853 0.2067 -0.0098 0.0407  0.0046  473 ALA A O     
2515 C CB    . ALA A 333 ? 0.1399 0.2281 0.2550 -0.0147 0.0393  -0.0016 473 ALA A CB    
2516 N N     . SER A 334 ? 0.0877 0.1394 0.1650 -0.0164 0.0291  0.0012  474 SER A N     
2517 C CA    . SER A 334 ? 0.0919 0.1258 0.1514 -0.0176 0.0306  0.0044  474 SER A CA    
2518 C C     . SER A 334 ? 0.0836 0.1126 0.1385 -0.0185 0.0227  0.0024  474 SER A C     
2519 O O     . SER A 334 ? 0.0627 0.1005 0.1278 -0.0204 0.0175  -0.0018 474 SER A O     
2520 C CB    . SER A 334 ? 0.0877 0.1145 0.1469 -0.0240 0.0388  0.0072  474 SER A CB    
2521 O OG    . SER A 334 ? 0.0950 0.1255 0.1668 -0.0307 0.0374  0.0045  474 SER A OG    
2522 N N     . GLU A 335 ? 0.0885 0.1043 0.1281 -0.0171 0.0218  0.0049  475 GLU A N     
2523 C CA    . GLU A 335 ? 0.0852 0.0954 0.1207 -0.0181 0.0163  0.0030  475 GLU A CA    
2524 C C     . GLU A 335 ? 0.0881 0.0959 0.1320 -0.0246 0.0176  0.0011  475 GLU A C     
2525 O O     . GLU A 335 ? 0.0912 0.1002 0.1387 -0.0262 0.0126  -0.0034 475 GLU A O     
2526 C CB    . GLU A 335 ? 0.0847 0.0829 0.1053 -0.0155 0.0160  0.0062  475 GLU A CB    
2527 C CG    . GLU A 335 ? 0.1036 0.1021 0.1160 -0.0105 0.0143  0.0070  475 GLU A CG    
2528 C CD    . GLU A 335 ? 0.1077 0.0972 0.1085 -0.0092 0.0131  0.0089  475 GLU A CD    
2529 O OE1   . GLU A 335 ? 0.1382 0.1208 0.1333 -0.0102 0.0157  0.0117  475 GLU A OE1   
2530 O OE2   . GLU A 335 ? 0.1180 0.1082 0.1155 -0.0070 0.0096  0.0077  475 GLU A OE2   
2531 N N     . GLU A 336 ? 0.0902 0.0929 0.1358 -0.0286 0.0249  0.0045  476 GLU A N     
2532 C CA    . GLU A 336 ? 0.0981 0.0964 0.1524 -0.0358 0.0275  0.0031  476 GLU A CA    
2533 C C     . GLU A 336 ? 0.0954 0.1083 0.1670 -0.0397 0.0235  -0.0039 476 GLU A C     
2534 O O     . GLU A 336 ? 0.1025 0.1117 0.1769 -0.0432 0.0200  -0.0082 476 GLU A O     
2535 C CB    . GLU A 336 ? 0.1196 0.1127 0.1702 -0.0375 0.0349  0.0084  476 GLU A CB    
2536 C CG    . GLU A 336 ? 0.1393 0.1177 0.1717 -0.0339 0.0368  0.0147  476 GLU A CG    
2537 C CD    . GLU A 336 ? 0.1551 0.1281 0.1836 -0.0360 0.0431  0.0194  476 GLU A CD    
2538 O OE1   . GLU A 336 ? 0.1866 0.1589 0.2052 -0.0330 0.0466  0.0231  476 GLU A OE1   
2539 O OE2   . GLU A 336 ? 0.1710 0.1402 0.2060 -0.0410 0.0448  0.0191  476 GLU A OE2   
2540 N N     . ASP A 337 ? 0.0935 0.1229 0.1752 -0.0380 0.0233  -0.0054 477 ASP A N     
2541 C CA    . ASP A 337 ? 0.0873 0.1331 0.1839 -0.0398 0.0174  -0.0118 477 ASP A CA    
2542 C C     . ASP A 337 ? 0.0798 0.1262 0.1730 -0.0384 0.0080  -0.0174 477 ASP A C     
2543 O O     . ASP A 337 ? 0.0886 0.1392 0.1878 -0.0421 0.0031  -0.0232 477 ASP A O     
2544 C CB    . ASP A 337 ? 0.0962 0.1595 0.2020 -0.0348 0.0171  -0.0117 477 ASP A CB    
2545 C CG    . ASP A 337 ? 0.1289 0.2010 0.2460 -0.0376 0.0226  -0.0107 477 ASP A CG    
2546 O OD1   . ASP A 337 ? 0.1462 0.2120 0.2653 -0.0444 0.0266  -0.0104 477 ASP A OD1   
2547 O OD2   . ASP A 337 ? 0.1334 0.2191 0.2577 -0.0323 0.0230  -0.0103 477 ASP A OD2   
2548 N N     . ILE A 338 ? 0.0691 0.1093 0.1462 -0.0310 0.0049  -0.0146 478 ILE A N     
2549 C CA    . ILE A 338 ? 0.0605 0.1015 0.1308 -0.0281 -0.0032 -0.0189 478 ILE A CA    
2550 C C     . ILE A 338 ? 0.0785 0.1073 0.1457 -0.0328 -0.0036 -0.0228 478 ILE A C     
2551 O O     . ILE A 338 ? 0.0873 0.1201 0.1567 -0.0347 -0.0095 -0.0300 478 ILE A O     
2552 C CB    . ILE A 338 ? 0.0687 0.1052 0.1236 -0.0201 -0.0046 -0.0145 478 ILE A CB    
2553 C CG1   . ILE A 338 ? 0.0786 0.1247 0.1366 -0.0150 -0.0037 -0.0111 478 ILE A CG1   
2554 C CG2   . ILE A 338 ? 0.0896 0.1269 0.1366 -0.0174 -0.0113 -0.0185 478 ILE A CG2   
2555 C CD1   . ILE A 338 ? 0.0848 0.1237 0.1288 -0.0084 -0.0029 -0.0061 478 ILE A CD1   
2556 N N     . PHE A 339 ? 0.0961 0.1091 0.1562 -0.0335 0.0020  -0.0182 479 PHE A N     
2557 C CA    . PHE A 339 ? 0.0894 0.0889 0.1475 -0.0370 0.0025  -0.0213 479 PHE A CA    
2558 C C     . PHE A 339 ? 0.1027 0.1049 0.1730 -0.0445 0.0025  -0.0265 479 PHE A C     
2559 O O     . PHE A 339 ? 0.1187 0.1170 0.1877 -0.0460 -0.0012 -0.0326 479 PHE A O     
2560 C CB    . PHE A 339 ? 0.0967 0.0799 0.1463 -0.0357 0.0085  -0.0140 479 PHE A CB    
2561 C CG    . PHE A 339 ? 0.1061 0.0850 0.1420 -0.0282 0.0066  -0.0105 479 PHE A CG    
2562 C CD1   . PHE A 339 ? 0.1198 0.1034 0.1497 -0.0239 0.0075  -0.0054 479 PHE A CD1   
2563 C CD2   . PHE A 339 ? 0.1197 0.0894 0.1498 -0.0256 0.0047  -0.0128 479 PHE A CD2   
2564 C CE1   . PHE A 339 ? 0.1339 0.1144 0.1533 -0.0183 0.0058  -0.0029 479 PHE A CE1   
2565 C CE2   . PHE A 339 ? 0.1368 0.1050 0.1571 -0.0191 0.0034  -0.0098 479 PHE A CE2   
2566 C CZ    . PHE A 339 ? 0.1215 0.0954 0.1369 -0.0161 0.0038  -0.0049 479 PHE A CZ    
2567 N N     . ARG A 340 ? 0.0961 0.1048 0.1756 -0.0479 0.0068  -0.0235 480 ARG A N     
2568 C CA    . ARG A 340 ? 0.1071 0.1189 0.1970 -0.0544 0.0069  -0.0273 480 ARG A CA    
2569 C C     . ARG A 340 ? 0.1177 0.1449 0.2143 -0.0549 -0.0018 -0.0356 480 ARG A C     
2570 O O     . ARG A 340 ? 0.1339 0.1585 0.2335 -0.0595 -0.0043 -0.0414 480 ARG A O     
2571 C CB    . ARG A 340 ? 0.1196 0.1373 0.2185 -0.0576 0.0137  -0.0225 480 ARG A CB    
2572 C CG    . ARG A 340 ? 0.1487 0.1500 0.2391 -0.0581 0.0219  -0.0146 480 ARG A CG    
2573 C CD    . ARG A 340 ? 0.1607 0.1676 0.2593 -0.0620 0.0292  -0.0108 480 ARG A CD    
2574 N NE    . ARG A 340 ? 0.1492 0.1701 0.2510 -0.0581 0.0309  -0.0086 480 ARG A NE    
2575 C CZ    . ARG A 340 ? 0.1252 0.1411 0.2176 -0.0545 0.0371  -0.0018 480 ARG A CZ    
2576 N NH1   . ARG A 340 ? 0.1516 0.1502 0.2302 -0.0540 0.0413  0.0041  480 ARG A NH1   
2577 N NH2   . ARG A 340 ? 0.1309 0.1597 0.2269 -0.0506 0.0385  -0.0011 480 ARG A NH2   
2578 N N     A HIS A 341 ? 0.1300 0.1730 0.2285 -0.0499 -0.0063 -0.0359 481 HIS A N     
2579 N N     B HIS A 341 ? 0.1280 0.1702 0.2256 -0.0497 -0.0066 -0.0361 481 HIS A N     
2580 C CA    A HIS A 341 ? 0.1307 0.1875 0.2312 -0.0482 -0.0156 -0.0424 481 HIS A CA    
2581 C CA    B HIS A 341 ? 0.1290 0.1857 0.2298 -0.0485 -0.0157 -0.0427 481 HIS A CA    
2582 C C     A HIS A 341 ? 0.1356 0.1822 0.2249 -0.0482 -0.0199 -0.0481 481 HIS A C     
2583 C C     B HIS A 341 ? 0.1368 0.1853 0.2252 -0.0471 -0.0210 -0.0482 481 HIS A C     
2584 O O     A HIS A 341 ? 0.1507 0.2002 0.2428 -0.0518 -0.0243 -0.0547 481 HIS A O     
2585 O O     B HIS A 341 ? 0.1413 0.1968 0.2304 -0.0483 -0.0275 -0.0546 481 HIS A O     
2586 C CB    A HIS A 341 ? 0.1325 0.2023 0.2303 -0.0400 -0.0199 -0.0399 481 HIS A CB    
2587 C CB    B HIS A 341 ? 0.1325 0.2049 0.2343 -0.0414 -0.0196 -0.0402 481 HIS A CB    
2588 C CG    A HIS A 341 ? 0.1417 0.2249 0.2519 -0.0386 -0.0170 -0.0358 481 HIS A CG    
2589 C CG    B HIS A 341 ? 0.1641 0.2535 0.2726 -0.0402 -0.0277 -0.0445 481 HIS A CG    
2590 N ND1   A HIS A 341 ? 0.1505 0.2419 0.2754 -0.0440 -0.0146 -0.0368 481 HIS A ND1   
2591 N ND1   B HIS A 341 ? 0.1776 0.2784 0.3023 -0.0451 -0.0272 -0.0462 481 HIS A ND1   
2592 C CD2   A HIS A 341 ? 0.1253 0.2151 0.2353 -0.0318 -0.0156 -0.0308 481 HIS A CD2   
2593 C CD2   B HIS A 341 ? 0.1810 0.2776 0.2813 -0.0346 -0.0364 -0.0472 481 HIS A CD2   
2594 C CE1   A HIS A 341 ? 0.1394 0.2423 0.2727 -0.0403 -0.0116 -0.0327 481 HIS A CE1   
2595 C CE1   B HIS A 341 ? 0.1693 0.2846 0.2969 -0.0425 -0.0360 -0.0500 481 HIS A CE1   
2596 N NE2   A HIS A 341 ? 0.1323 0.2336 0.2565 -0.0327 -0.0121 -0.0290 481 HIS A NE2   
2597 N NE2   B HIS A 341 ? 0.1628 0.2751 0.2747 -0.0360 -0.0417 -0.0503 481 HIS A NE2   
2598 N N     . LEU A 342 ? 0.1269 0.1614 0.2036 -0.0441 -0.0182 -0.0460 482 LEU A N     
2599 C CA    . LEU A 342 ? 0.1227 0.1477 0.1872 -0.0422 -0.0212 -0.0509 482 LEU A CA    
2600 C C     . LEU A 342 ? 0.1566 0.1650 0.2212 -0.0471 -0.0172 -0.0532 482 LEU A C     
2601 O O     . LEU A 342 ? 0.1733 0.1726 0.2283 -0.0451 -0.0186 -0.0575 482 LEU A O     
2602 C CB    . LEU A 342 ? 0.1214 0.1413 0.1739 -0.0356 -0.0204 -0.0475 482 LEU A CB    
2603 C CG    . LEU A 342 ? 0.1192 0.1536 0.1684 -0.0297 -0.0250 -0.0454 482 LEU A CG    
2604 C CD1   . LEU A 342 ? 0.1361 0.1623 0.1718 -0.0231 -0.0216 -0.0384 482 LEU A CD1   
2605 C CD2   . LEU A 342 ? 0.1563 0.1995 0.1989 -0.0271 -0.0323 -0.0504 482 LEU A CD2   
2606 N N     . GLY A 343 ? 0.1524 0.1561 0.2265 -0.0529 -0.0119 -0.0503 483 GLY A N     
2607 C CA    . GLY A 343 ? 0.1790 0.1655 0.2524 -0.0571 -0.0081 -0.0517 483 GLY A CA    
2608 C C     . GLY A 343 ? 0.1954 0.1638 0.2581 -0.0524 -0.0038 -0.0469 483 GLY A C     
2609 O O     . GLY A 343 ? 0.2222 0.1761 0.2804 -0.0527 -0.0028 -0.0498 483 GLY A O     
2610 N N     . LEU A 344 ? 0.1556 0.1244 0.2142 -0.0478 -0.0013 -0.0399 484 LEU A N     
2611 C CA    . LEU A 344 ? 0.1524 0.1065 0.2013 -0.0424 0.0020  -0.0349 484 LEU A CA    
2612 C C     . LEU A 344 ? 0.1835 0.1297 0.2322 -0.0430 0.0084  -0.0251 484 LEU A C     
2613 O O     . LEU A 344 ? 0.1893 0.1449 0.2433 -0.0453 0.0105  -0.0214 484 LEU A O     
2614 C CB    . LEU A 344 ? 0.1438 0.1046 0.1861 -0.0360 -0.0008 -0.0347 484 LEU A CB    
2615 C CG    . LEU A 344 ? 0.1595 0.1271 0.1965 -0.0330 -0.0066 -0.0428 484 LEU A CG    
2616 C CD1   . LEU A 344 ? 0.1526 0.1301 0.1824 -0.0267 -0.0086 -0.0393 484 LEU A CD1   
2617 C CD2   . LEU A 344 ? 0.1809 0.1348 0.2112 -0.0301 -0.0056 -0.0463 484 LEU A CD2   
2618 N N     A GLU A 345 ? 0.1933 0.1227 0.2351 -0.0401 0.0113  -0.0207 485 GLU A N     
2619 N N     B GLU A 345 ? 0.1943 0.1238 0.2361 -0.0400 0.0113  -0.0207 485 GLU A N     
2620 C CA    A GLU A 345 ? 0.2085 0.1305 0.2458 -0.0385 0.0163  -0.0105 485 GLU A CA    
2621 C CA    B GLU A 345 ? 0.2070 0.1289 0.2441 -0.0384 0.0163  -0.0105 485 GLU A CA    
2622 C C     A GLU A 345 ? 0.1882 0.1174 0.2201 -0.0335 0.0159  -0.0059 485 GLU A C     
2623 C C     B GLU A 345 ? 0.1888 0.1179 0.2206 -0.0335 0.0159  -0.0059 485 GLU A C     
2624 O O     A GLU A 345 ? 0.1799 0.1110 0.2081 -0.0287 0.0127  -0.0084 485 GLU A O     
2625 O O     B GLU A 345 ? 0.1796 0.1106 0.2077 -0.0286 0.0127  -0.0083 485 GLU A O     
2626 C CB    A GLU A 345 ? 0.2135 0.1171 0.2434 -0.0346 0.0178  -0.0067 485 GLU A CB    
2627 C CB    B GLU A 345 ? 0.2104 0.1140 0.2402 -0.0343 0.0176  -0.0069 485 GLU A CB    
2628 C CG    A GLU A 345 ? 0.2332 0.1263 0.2678 -0.0399 0.0193  -0.0102 485 GLU A CG    
2629 C CG    B GLU A 345 ? 0.2221 0.1176 0.2452 -0.0323 0.0218  0.0037  485 GLU A CG    
2630 N N     . TYR A 346 ? 0.1887 0.1217 0.2198 -0.0348 0.0197  0.0004  486 TYR A N     
2631 C CA    . TYR A 346 ? 0.1656 0.1043 0.1904 -0.0304 0.0198  0.0049  486 TYR A CA    
2632 C C     . TYR A 346 ? 0.1853 0.1142 0.1985 -0.0232 0.0184  0.0096  486 TYR A C     
2633 O O     . TYR A 346 ? 0.2119 0.1296 0.2199 -0.0211 0.0194  0.0139  486 TYR A O     
2634 C CB    . TYR A 346 ? 0.1878 0.1307 0.2118 -0.0324 0.0248  0.0104  486 TYR A CB    
2635 C CG    . TYR A 346 ? 0.1792 0.1267 0.1948 -0.0278 0.0250  0.0144  486 TYR A CG    
2636 C CD1   . TYR A 346 ? 0.1840 0.1441 0.2034 -0.0269 0.0226  0.0108  486 TYR A CD1   
2637 C CD2   . TYR A 346 ? 0.1915 0.1321 0.1945 -0.0237 0.0261  0.0210  486 TYR A CD2   
2638 C CE1   . TYR A 346 ? 0.1720 0.1357 0.1824 -0.0223 0.0221  0.0138  486 TYR A CE1   
2639 C CE2   . TYR A 346 ? 0.2214 0.1663 0.2156 -0.0198 0.0255  0.0234  486 TYR A CE2   
2640 C CZ    . TYR A 346 ? 0.2124 0.1670 0.2103 -0.0197 0.0245  0.0199  486 TYR A CZ    
2641 O OH    . TYR A 346 ? 0.2334 0.1914 0.2219 -0.0157 0.0234  0.0214  486 TYR A OH    
2642 N N     . LEU A 347 ? 0.1537 0.0905 0.1630 -0.0185 0.0147  0.0087  487 LEU A N     
2643 C CA    . LEU A 347 ? 0.1458 0.0791 0.1455 -0.0114 0.0123  0.0127  487 LEU A CA    
2644 C C     . LEU A 347 ? 0.1294 0.0710 0.1227 -0.0098 0.0119  0.0162  487 LEU A C     
2645 O O     . LEU A 347 ? 0.1330 0.0860 0.1291 -0.0107 0.0105  0.0128  487 LEU A O     
2646 C CB    . LEU A 347 ? 0.1415 0.0794 0.1431 -0.0074 0.0077  0.0070  487 LEU A CB    
2647 C CG    . LEU A 347 ? 0.1572 0.0848 0.1631 -0.0075 0.0080  0.0026  487 LEU A CG    
2648 C CD1   . LEU A 347 ? 0.1779 0.1127 0.1849 -0.0040 0.0046  -0.0041 487 LEU A CD1   
2649 C CD2   . LEU A 347 ? 0.1991 0.1109 0.2006 -0.0032 0.0097  0.0086  487 LEU A CD2   
2650 N N     . PRO A 348 ? 0.1409 0.0765 0.1246 -0.0071 0.0131  0.0227  488 PRO A N     
2651 C CA    . PRO A 348 ? 0.1420 0.0848 0.1182 -0.0054 0.0120  0.0243  488 PRO A CA    
2652 C C     . PRO A 348 ? 0.1328 0.0840 0.1096 -0.0017 0.0062  0.0208  488 PRO A C     
2653 O O     . PRO A 348 ? 0.1357 0.0865 0.1168 0.0009  0.0035  0.0185  488 PRO A O     
2654 C CB    . PRO A 348 ? 0.1676 0.1031 0.1330 -0.0028 0.0128  0.0309  488 PRO A CB    
2655 C CG    . PRO A 348 ? 0.1906 0.1171 0.1580 -0.0002 0.0114  0.0327  488 PRO A CG    
2656 C CD    . PRO A 348 ? 0.1695 0.0933 0.1483 -0.0047 0.0138  0.0280  488 PRO A CD    
2657 N N     . PRO A 349 ? 0.1269 0.0854 0.1000 -0.0016 0.0052  0.0198  489 PRO A N     
2658 C CA    . PRO A 349 ? 0.1187 0.0852 0.0939 0.0003  0.0009  0.0162  489 PRO A CA    
2659 C C     . PRO A 349 ? 0.1099 0.0766 0.0847 0.0048  -0.0033 0.0171  489 PRO A C     
2660 O O     . PRO A 349 ? 0.1195 0.0922 0.1004 0.0062  -0.0054 0.0137  489 PRO A O     
2661 C CB    . PRO A 349 ? 0.1157 0.0858 0.0851 -0.0009 0.0014  0.0159  489 PRO A CB    
2662 C CG    . PRO A 349 ? 0.1390 0.1062 0.1072 -0.0034 0.0065  0.0173  489 PRO A CG    
2663 C CD    . PRO A 349 ? 0.1362 0.0956 0.1046 -0.0039 0.0089  0.0210  489 PRO A CD    
2664 N N     . GLU A 350 ? 0.1390 0.0996 0.1062 0.0076  -0.0044 0.0220  490 GLU A N     
2665 C CA    A GLU A 350 ? 0.1422 0.1040 0.1093 0.0134  -0.0095 0.0236  490 GLU A CA    
2666 C CA    B GLU A 350 ? 0.1415 0.1031 0.1085 0.0134  -0.0094 0.0237  490 GLU A CA    
2667 C C     . GLU A 350 ? 0.1484 0.1057 0.1233 0.0166  -0.0091 0.0228  490 GLU A C     
2668 O O     . GLU A 350 ? 0.1581 0.1191 0.1368 0.0222  -0.0130 0.0227  490 GLU A O     
2669 C CB    A GLU A 350 ? 0.1818 0.1368 0.1364 0.0166  -0.0110 0.0301  490 GLU A CB    
2670 C CB    B GLU A 350 ? 0.1920 0.1461 0.1462 0.0166  -0.0107 0.0304  490 GLU A CB    
2671 C CG    A GLU A 350 ? 0.1821 0.1232 0.1326 0.0157  -0.0056 0.0353  490 GLU A CG    
2672 C CG    B GLU A 350 ? 0.2083 0.1667 0.1525 0.0144  -0.0117 0.0301  490 GLU A CG    
2673 C CD    A GLU A 350 ? 0.2406 0.1803 0.1812 0.0138  -0.0034 0.0391  490 GLU A CD    
2674 C CD    B GLU A 350 ? 0.2542 0.2068 0.1930 0.0094  -0.0046 0.0311  490 GLU A CD    
2675 O OE1   A GLU A 350 ? 0.2967 0.2428 0.2297 0.0154  -0.0073 0.0388  490 GLU A OE1   
2676 O OE1   B GLU A 350 ? 0.1587 0.1063 0.1037 0.0065  0.0008  0.0315  490 GLU A OE1   
2677 O OE2   A GLU A 350 ? 0.2096 0.1422 0.1504 0.0105  0.0023  0.0417  490 GLU A OE2   
2678 O OE2   B GLU A 350 ? 0.2993 0.2550 0.2302 0.0080  -0.0043 0.0301  490 GLU A OE2   
2679 N N     . GLN A 351 ? 0.1139 0.0644 0.0925 0.0131  -0.0047 0.0213  491 GLN A N     
2680 C CA    . GLN A 351 ? 0.1266 0.0716 0.1120 0.0153  -0.0039 0.0186  491 GLN A CA    
2681 C C     . GLN A 351 ? 0.1114 0.0642 0.1039 0.0123  -0.0030 0.0112  491 GLN A C     
2682 O O     . GLN A 351 ? 0.1222 0.0700 0.1190 0.0125  -0.0016 0.0073  491 GLN A O     
2683 C CB    . GLN A 351 ? 0.1537 0.0829 0.1372 0.0132  0.0003  0.0219  491 GLN A CB    
2684 C CG    . GLN A 351 ? 0.1701 0.0889 0.1439 0.0169  0.0003  0.0306  491 GLN A CG    
2685 C CD    . GLN A 351 ? 0.2011 0.1205 0.1755 0.0255  -0.0045 0.0326  491 GLN A CD    
2686 O OE1   . GLN A 351 ? 0.2007 0.1201 0.1825 0.0298  -0.0056 0.0285  491 GLN A OE1   
2687 N NE2   . GLN A 351 ? 0.2339 0.1549 0.2011 0.0283  -0.0073 0.0385  491 GLN A NE2   
2688 N N     . ARG A 352 ? 0.1011 0.0652 0.0937 0.0100  -0.0038 0.0092  492 ARG A N     
2689 C CA    . ARG A 352 ? 0.0807 0.0523 0.0772 0.0081  -0.0031 0.0037  492 ARG A CA    
2690 C C     . ARG A 352 ? 0.0856 0.0670 0.0852 0.0110  -0.0045 0.0017  492 ARG A C     
2691 O O     . ARG A 352 ? 0.0996 0.0880 0.0999 0.0090  -0.0033 -0.0010 492 ARG A O     
2692 C CB    . ARG A 352 ? 0.0769 0.0523 0.0713 0.0033  -0.0020 0.0037  492 ARG A CB    
2693 C CG    . ARG A 352 ? 0.0914 0.0607 0.0856 -0.0001 0.0001  0.0051  492 ARG A CG    
2694 C CD    . ARG A 352 ? 0.0819 0.0572 0.0761 -0.0032 0.0011  0.0047  492 ARG A CD    
2695 N NE    . ARG A 352 ? 0.0926 0.0641 0.0873 -0.0062 0.0040  0.0072  492 ARG A NE    
2696 C CZ    . ARG A 352 ? 0.0953 0.0709 0.0898 -0.0077 0.0059  0.0082  492 ARG A CZ    
2697 N NH1   . ARG A 352 ? 0.0815 0.0631 0.0746 -0.0065 0.0049  0.0071  492 ARG A NH1   
2698 N NH2   . ARG A 352 ? 0.1054 0.0781 0.1011 -0.0104 0.0098  0.0106  492 ARG A NH2   
2699 N N     . ASN A 353 ? 0.1065 0.0889 0.1086 0.0159  -0.0067 0.0034  493 ASN A N     
2700 C CA    . ASN A 353 ? 0.1112 0.1054 0.1193 0.0184  -0.0079 0.0015  493 ASN A CA    
2701 C C     . ASN A 353 ? 0.1375 0.1338 0.1518 0.0221  -0.0055 -0.0030 493 ASN A C     
2702 O O     . ASN A 353 ? 0.1580 0.1596 0.1794 0.0278  -0.0065 -0.0037 493 ASN A O     
2703 C CB    . ASN A 353 ? 0.1212 0.1184 0.1301 0.0225  -0.0126 0.0051  493 ASN A CB    
2704 C CG    . ASN A 353 ? 0.1214 0.1202 0.1236 0.0184  -0.0147 0.0075  493 ASN A CG    
2705 O OD1   . ASN A 353 ? 0.1217 0.1284 0.1256 0.0142  -0.0143 0.0051  493 ASN A OD1   
2706 N ND2   . ASN A 353 ? 0.1425 0.1325 0.1362 0.0195  -0.0163 0.0122  493 ASN A ND2   
2707 N N     . ALA A 354 ? 0.1456 0.1387 0.1573 0.0193  -0.0024 -0.0066 494 ALA A N     
2708 C CA    . ALA A 354 ? 0.1733 0.1677 0.1880 0.0224  0.0006  -0.0120 494 ALA A CA    
2709 C C     . ALA A 354 ? 0.2355 0.2438 0.2553 0.0230  0.0030  -0.0138 494 ALA A C     
2710 O O     . ALA A 354 ? 0.1847 0.1995 0.2030 0.0184  0.0035  -0.0121 494 ALA A O     
2711 C CB    . ALA A 354 ? 0.1411 0.1299 0.1498 0.0189  0.0024  -0.0161 494 ALA A CB    
2712 O OXT   . ALA A 354 ? 0.2295 0.2421 0.2556 0.0281  0.0053  -0.0171 494 ALA A OXT   
2713 O "O5'" . DC  B 1   ? 0.4104 0.4240 0.2021 0.0466  -0.0279 -0.1040 1   DC  T "O5'" 
2714 C "C5'" . DC  B 1   ? 0.4049 0.4211 0.1898 0.0464  -0.0357 -0.1091 1   DC  T "C5'" 
2715 C "C4'" . DC  B 1   ? 0.3952 0.4142 0.1944 0.0431  -0.0440 -0.1103 1   DC  T "C4'" 
2716 O "O4'" . DC  B 1   ? 0.3957 0.4105 0.2083 0.0402  -0.0437 -0.1168 1   DC  T "O4'" 
2717 C "C3'" . DC  B 1   ? 0.3444 0.3667 0.1525 0.0423  -0.0444 -0.1003 1   DC  T "C3'" 
2718 O "O3'" . DC  B 1   ? 0.3504 0.3778 0.1517 0.0437  -0.0494 -0.0961 1   DC  T "O3'" 
2719 C "C2'" . DC  B 1   ? 0.3654 0.3872 0.1919 0.0381  -0.0482 -0.1035 1   DC  T "C2'" 
2720 C "C1'" . DC  B 1   ? 0.3973 0.4139 0.2261 0.0369  -0.0473 -0.1136 1   DC  T "C1'" 
2721 N N1    . DC  B 1   ? 0.3236 0.3353 0.1638 0.0352  -0.0421 -0.1138 1   DC  T N1    
2722 C C2    . DC  B 1   ? 0.3077 0.3189 0.1652 0.0309  -0.0453 -0.1142 1   DC  T C2    
2723 O O2    . DC  B 1   ? 0.3128 0.3280 0.1761 0.0286  -0.0517 -0.1138 1   DC  T O2    
2724 N N3    . DC  B 1   ? 0.2973 0.3036 0.1650 0.0291  -0.0410 -0.1149 1   DC  T N3    
2725 C C4    . DC  B 1   ? 0.3020 0.3042 0.1638 0.0320  -0.0339 -0.1155 1   DC  T C4    
2726 N N4    . DC  B 1   ? 0.2921 0.2894 0.1650 0.0303  -0.0302 -0.1163 1   DC  T N4    
2727 C C5    . DC  B 1   ? 0.3176 0.3206 0.1624 0.0364  -0.0300 -0.1151 1   DC  T C5    
2728 C C6    . DC  B 1   ? 0.3303 0.3380 0.1646 0.0377  -0.0344 -0.1143 1   DC  T C6    
2729 P P     . DG  B 2   ? 0.3844 0.4146 0.1878 0.0446  -0.0475 -0.0841 2   DG  T P     
2730 O OP1   . DG  B 2   ? 0.4737 0.5079 0.2651 0.0471  -0.0518 -0.0812 2   DG  T OP1   
2731 O OP2   . DG  B 2   ? 0.3543 0.3809 0.1583 0.0453  -0.0383 -0.0785 2   DG  T OP2   
2732 O "O5'" . DG  B 2   ? 0.3418 0.3740 0.1633 0.0410  -0.0521 -0.0837 2   DG  T "O5'" 
2733 C "C5'" . DG  B 2   ? 0.3285 0.3640 0.1553 0.0392  -0.0605 -0.0894 2   DG  T "C5'" 
2734 C "C4'" . DG  B 2   ? 0.3131 0.3502 0.1575 0.0356  -0.0629 -0.0875 2   DG  T "C4'" 
2735 O "O4'" . DG  B 2   ? 0.3079 0.3402 0.1626 0.0325  -0.0589 -0.0904 2   DG  T "O4'" 
2736 C "C3'" . DG  B 2   ? 0.3076 0.3469 0.1548 0.0363  -0.0607 -0.0773 2   DG  T "C3'" 
2737 O "O3'" . DG  B 2   ? 0.2983 0.3413 0.1587 0.0335  -0.0661 -0.0773 2   DG  T "O3'" 
2738 C "C2'" . DG  B 2   ? 0.2952 0.3295 0.1457 0.0354  -0.0526 -0.0740 2   DG  T "C2'" 
2739 C "C1'" . DG  B 2   ? 0.3013 0.3324 0.1611 0.0320  -0.0535 -0.0825 2   DG  T "C1'" 
2740 N N9    . DG  B 2   ? 0.2883 0.3137 0.1467 0.0321  -0.0468 -0.0840 2   DG  T N9    
2741 C C8    . DG  B 2   ? 0.3035 0.3267 0.1493 0.0357  -0.0411 -0.0831 2   DG  T C8    
2742 N N7    . DG  B 2   ? 0.3013 0.3197 0.1504 0.0351  -0.0358 -0.0855 2   DG  T N7    
2743 C C5    . DG  B 2   ? 0.2728 0.2899 0.1374 0.0307  -0.0386 -0.0880 2   DG  T C5    
2744 C C6    . DG  B 2   ? 0.2566 0.2687 0.1316 0.0280  -0.0357 -0.0910 2   DG  T C6    
2745 O O6    . DG  B 2   ? 0.2775 0.2853 0.1502 0.0296  -0.0299 -0.0926 2   DG  T O6    
2746 N N1    . DG  B 2   ? 0.2450 0.2573 0.1349 0.0230  -0.0402 -0.0922 2   DG  T N1    
2747 C C2    . DG  B 2   ? 0.2447 0.2617 0.1392 0.0210  -0.0461 -0.0908 2   DG  T C2    
2748 N N2    . DG  B 2   ? 0.2437 0.2602 0.1535 0.0157  -0.0488 -0.0917 2   DG  T N2    
2749 N N3    . DG  B 2   ? 0.2535 0.2755 0.1389 0.0239  -0.0488 -0.0884 2   DG  T N3    
2750 C C4    . DG  B 2   ? 0.2612 0.2827 0.1317 0.0286  -0.0451 -0.0870 2   DG  T C4    
2751 P P     . DG  B 3   ? 0.3241 0.3704 0.1896 0.0340  -0.0660 -0.0683 3   DG  T P     
2752 O OP1   . DG  B 3   ? 0.3361 0.3876 0.2114 0.0320  -0.0737 -0.0715 3   DG  T OP1   
2753 O OP2   . DG  B 3   ? 0.3374 0.3831 0.1901 0.0381  -0.0619 -0.0606 3   DG  T OP2   
2754 O "O5'" . DG  B 3   ? 0.2777 0.3201 0.1543 0.0304  -0.0603 -0.0656 3   DG  T "O5'" 
2755 C "C5'" . DG  B 3   ? 0.2697 0.3114 0.1601 0.0256  -0.0624 -0.0708 3   DG  T "C5'" 
2756 C "C4'" . DG  B 3   ? 0.2524 0.2899 0.1498 0.0227  -0.0565 -0.0675 3   DG  T "C4'" 
2757 O "O4'" . DG  B 3   ? 0.2689 0.3013 0.1594 0.0239  -0.0517 -0.0698 3   DG  T "O4'" 
2758 C "C3'" . DG  B 3   ? 0.2641 0.3020 0.1596 0.0240  -0.0524 -0.0580 3   DG  T "C3'" 
2759 O "O3'" . DG  B 3   ? 0.2490 0.2887 0.1576 0.0200  -0.0540 -0.0563 3   DG  T "O3'" 
2760 C "C2'" . DG  B 3   ? 0.2591 0.2915 0.1496 0.0245  -0.0450 -0.0552 3   DG  T "C2'" 
2761 C "C1'" . DG  B 3   ? 0.2701 0.2993 0.1624 0.0230  -0.0455 -0.0637 3   DG  T "C1'" 
2762 N N9    . DG  B 3   ? 0.2559 0.2812 0.1385 0.0258  -0.0399 -0.0640 3   DG  T N9    
2763 C C8    . DG  B 3   ? 0.2684 0.2941 0.1369 0.0305  -0.0373 -0.0617 3   DG  T C8    
2764 N N7    . DG  B 3   ? 0.2649 0.2867 0.1283 0.0320  -0.0316 -0.0629 3   DG  T N7    
2765 C C5    . DG  B 3   ? 0.2498 0.2683 0.1245 0.0283  -0.0310 -0.0664 3   DG  T C5    
2766 C C6    . DG  B 3   ? 0.2511 0.2648 0.1273 0.0282  -0.0260 -0.0692 3   DG  T C6    
2767 O O6    . DG  B 3   ? 0.2520 0.2636 0.1196 0.0316  -0.0205 -0.0693 3   DG  T O6    
2768 N N1    . DG  B 3   ? 0.2233 0.2344 0.1131 0.0236  -0.0275 -0.0721 3   DG  T N1    
2769 C C2    . DG  B 3   ? 0.2417 0.2547 0.1424 0.0191  -0.0327 -0.0719 3   DG  T C2    
2770 N N2    . DG  B 3   ? 0.2274 0.2369 0.1411 0.0143  -0.0332 -0.0744 3   DG  T N2    
2771 N N3    . DG  B 3   ? 0.2222 0.2401 0.1218 0.0193  -0.0370 -0.0696 3   DG  T N3    
2772 C C4    . DG  B 3   ? 0.2397 0.2601 0.1260 0.0242  -0.0360 -0.0669 3   DG  T C4    
2773 P P     . DC  B 4   ? 0.2256 0.2666 0.1352 0.0205  -0.0512 -0.0474 4   DC  T P     
2774 O OP1   . DC  B 4   ? 0.2481 0.2931 0.1713 0.0169  -0.0554 -0.0491 4   DC  T OP1   
2775 O OP2   . DC  B 4   ? 0.2417 0.2834 0.1392 0.0258  -0.0494 -0.0414 4   DC  T OP2   
2776 O "O5'" . DC  B 4   ? 0.2034 0.2388 0.1149 0.0177  -0.0445 -0.0443 4   DC  T "O5'" 
2777 C "C5'" . DC  B 4   ? 0.1781 0.2113 0.1008 0.0122  -0.0447 -0.0483 4   DC  T "C5'" 
2778 C "C4'" . DC  B 4   ? 0.1860 0.2137 0.1065 0.0109  -0.0386 -0.0454 4   DC  T "C4'" 
2779 O "O4'" . DC  B 4   ? 0.2022 0.2273 0.1128 0.0147  -0.0362 -0.0479 4   DC  T "O4'" 
2780 C "C3'" . DC  B 4   ? 0.1806 0.2077 0.0968 0.0120  -0.0336 -0.0360 4   DC  T "C3'" 
2781 O "O3'" . DC  B 4   ? 0.1700 0.1949 0.0945 0.0065  -0.0312 -0.0342 4   DC  T "O3'" 
2782 C "C2'" . DC  B 4   ? 0.1806 0.2049 0.0847 0.0165  -0.0284 -0.0329 4   DC  T "C2'" 
2783 C "C1'" . DC  B 4   ? 0.1845 0.2066 0.0890 0.0161  -0.0296 -0.0413 4   DC  T "C1'" 
2784 N N1    . DC  B 4   ? 0.1801 0.2007 0.0730 0.0210  -0.0263 -0.0418 4   DC  T N1    
2785 C C2    . DC  B 4   ? 0.1846 0.2013 0.0770 0.0210  -0.0230 -0.0457 4   DC  T C2    
2786 O O2    . DC  B 4   ? 0.1967 0.2109 0.0984 0.0169  -0.0234 -0.0488 4   DC  T O2    
2787 N N3    . DC  B 4   ? 0.1939 0.2095 0.0761 0.0253  -0.0193 -0.0463 4   DC  T N3    
2788 C C4    . DC  B 4   ? 0.2221 0.2403 0.0949 0.0289  -0.0193 -0.0431 4   DC  T C4    
2789 N N4    . DC  B 4   ? 0.2569 0.2739 0.1200 0.0324  -0.0152 -0.0439 4   DC  T N4    
2790 C C5    . DC  B 4   ? 0.2273 0.2491 0.1004 0.0289  -0.0232 -0.0391 4   DC  T C5    
2791 C C6    . DC  B 4   ? 0.2149 0.2380 0.0984 0.0252  -0.0264 -0.0387 4   DC  T C6    
2792 P P     . DA  B 5   ? 0.1442 0.1698 0.0692 0.0052  -0.0277 -0.0254 5   DA  T P     
2793 O OP1   . DA  B 5   ? 0.1508 0.1745 0.0654 0.0101  -0.0229 -0.0176 5   DA  T OP1   
2794 O OP2   . DA  B 5   ? 0.1240 0.1453 0.0598 -0.0022 -0.0246 -0.0241 5   DA  T OP2   
2795 O "O5'" . DA  B 5   ? 0.1373 0.1685 0.0690 0.0050  -0.0330 -0.0270 5   DA  T "O5'" 
2796 C "C5'" . DA  B 5   ? 0.1232 0.1563 0.0688 -0.0010 -0.0367 -0.0326 5   DA  T "C5'" 
2797 C "C4'" . DA  B 5   ? 0.1369 0.1752 0.0900 -0.0023 -0.0385 -0.0307 5   DA  T "C4'" 
2798 O "O4'" . DA  B 5   ? 0.1229 0.1583 0.0769 -0.0049 -0.0322 -0.0226 5   DA  T "O4'" 
2799 C "C3'" . DA  B 5   ? 0.1475 0.1905 0.0952 0.0042  -0.0419 -0.0294 5   DA  T "C3'" 
2800 O "O3'" . DA  B 5   ? 0.1461 0.1947 0.1060 0.0019  -0.0462 -0.0325 5   DA  T "O3'" 
2801 C "C2'" . DA  B 5   ? 0.1314 0.1728 0.0699 0.0077  -0.0370 -0.0205 5   DA  T "C2'" 
2802 C "C1'" . DA  B 5   ? 0.1284 0.1660 0.0749 0.0008  -0.0314 -0.0169 5   DA  T "C1'" 
2803 N N9    . DA  B 5   ? 0.1348 0.1663 0.0737 0.0013  -0.0242 -0.0086 5   DA  T N9    
2804 C C8    . DA  B 5   ? 0.1432 0.1718 0.0697 0.0056  -0.0217 -0.0062 5   DA  T C8    
2805 N N7    . DA  B 5   ? 0.1433 0.1660 0.0676 0.0044  -0.0148 0.0018  5   DA  T N7    
2806 C C5    . DA  B 5   ? 0.1196 0.1419 0.0538 -0.0012 -0.0131 0.0043  5   DA  T C5    
2807 C C6    . DA  B 5   ? 0.1290 0.1463 0.0656 -0.0054 -0.0070 0.0114  5   DA  T C6    
2808 N N6    . DA  B 5   ? 0.1431 0.1518 0.0775 -0.0032 -0.0014 0.0160  5   DA  T N6    
2809 N N1    . DA  B 5   ? 0.1239 0.1413 0.0709 -0.0109 -0.0064 0.0113  5   DA  T N1    
2810 C C2    . DA  B 5   ? 0.1221 0.1447 0.0773 -0.0121 -0.0113 0.0049  5   DA  T C2    
2811 N N3    . DA  B 5   ? 0.1211 0.1491 0.0763 -0.0087 -0.0177 -0.0020 5   DA  T N3    
2812 C C4    . DA  B 5   ? 0.1259 0.1531 0.0694 -0.0032 -0.0184 -0.0020 5   DA  T C4    
2813 P P     . DT  B 6   ? 0.1773 0.2325 0.1362 0.0077  -0.0512 -0.0321 6   DT  T P     
2814 O OP1   . DT  B 6   ? 0.1963 0.2562 0.1696 0.0041  -0.0557 -0.0378 6   DT  T OP1   
2815 O OP2   . DT  B 6   ? 0.1967 0.2504 0.1415 0.0139  -0.0523 -0.0312 6   DT  T OP2   
2816 O "O5'" . DT  B 6   ? 0.1709 0.2281 0.1289 0.0097  -0.0484 -0.0250 6   DT  T "O5'" 
2817 C "C5'" . DT  B 6   ? 0.1725 0.2314 0.1438 0.0038  -0.0460 -0.0246 6   DT  T "C5'" 
2818 C "C4'" . DT  B 6   ? 0.1583 0.2139 0.1272 0.0052  -0.0399 -0.0155 6   DT  T "C4'" 
2819 O "O4'" . DT  B 6   ? 0.1793 0.2269 0.1379 0.0047  -0.0334 -0.0098 6   DT  T "O4'" 
2820 C "C3'" . DT  B 6   ? 0.2053 0.2652 0.1672 0.0138  -0.0433 -0.0117 6   DT  T "C3'" 
2821 O "O3'" . DT  B 6   ? 0.1965 0.2622 0.1713 0.0136  -0.0456 -0.0124 6   DT  T "O3'" 
2822 C "C2'" . DT  B 6   ? 0.2046 0.2572 0.1561 0.0156  -0.0360 -0.0023 6   DT  T "C2'" 
2823 C "C1'" . DT  B 6   ? 0.1934 0.2390 0.1477 0.0080  -0.0295 -0.0019 6   DT  T "C1'" 
2824 N N1    . DT  B 6   ? 0.1816 0.2205 0.1236 0.0094  -0.0242 0.0040  6   DT  T N1    
2825 C C2    . DT  B 6   ? 0.2155 0.2481 0.1593 0.0052  -0.0170 0.0102  6   DT  T C2    
2826 O O2    . DT  B 6   ? 0.2245 0.2565 0.1788 0.0003  -0.0147 0.0105  6   DT  T O2    
2827 N N3    . DT  B 6   ? 0.1845 0.2117 0.1179 0.0068  -0.0124 0.0156  6   DT  T N3    
2828 C C4    . DT  B 6   ? 0.1703 0.1937 0.0962 0.0107  -0.0130 0.0144  6   DT  T C4    
2829 O O4    . DT  B 6   ? 0.2237 0.2394 0.1471 0.0097  -0.0080 0.0177  6   DT  T O4    
2830 C C5    . DT  B 6   ? 0.1730 0.2031 0.0962 0.0147  -0.0201 0.0081  6   DT  T C5    
2831 C C7    . DT  B 6   ? 0.1909 0.2190 0.1058 0.0181  -0.0206 0.0066  6   DT  T C7    
2832 C C6    . DT  B 6   ? 0.1715 0.2099 0.1014 0.0145  -0.0262 0.0032  6   DT  T C6    
2833 P P     . DA  B 7   ? 0.1909 0.2625 0.1634 0.0221  -0.0506 -0.0090 7   DA  T P     
2834 O OP1   . DA  B 7   ? 0.1990 0.2792 0.1886 0.0208  -0.0556 -0.0145 7   DA  T OP1   
2835 O OP2   . DA  B 7   ? 0.2082 0.2784 0.1645 0.0284  -0.0538 -0.0076 7   DA  T OP2   
2836 O "O5'" . DA  B 7   ? 0.1991 0.2643 0.1705 0.0226  -0.0425 0.0003  7   DA  T "O5'" 
2837 C "C5'" . DA  B 7   ? 0.1959 0.2593 0.1809 0.0162  -0.0369 0.0003  7   DA  T "C5'" 
2838 C "C4'" . DA  B 7   ? 0.2343 0.2896 0.2146 0.0158  -0.0288 0.0084  7   DA  T "C4'" 
2839 O "O4'" . DA  B 7   ? 0.2521 0.3004 0.2186 0.0150  -0.0253 0.0116  7   DA  T "O4'" 
2840 C "C3'" . DA  B 7   ? 0.2799 0.3360 0.2567 0.0236  -0.0298 0.0149  7   DA  T "C3'" 
2841 O "O3'" . DA  B 7   ? 0.3212 0.3770 0.3109 0.0214  -0.0258 0.0161  7   DA  T "O3'" 
2842 C "C2'" . DA  B 7   ? 0.3177 0.3656 0.2785 0.0258  -0.0250 0.0224  7   DA  T "C2'" 
2843 C "C1'" . DA  B 7   ? 0.2744 0.3171 0.2335 0.0182  -0.0203 0.0201  7   DA  T "C1'" 
2844 N N9    . DA  B 7   ? 0.2657 0.3037 0.2097 0.0200  -0.0185 0.0235  7   DA  T N9    
2845 C C8    . DA  B 7   ? 0.2313 0.2712 0.1654 0.0243  -0.0230 0.0210  7   DA  T C8    
2846 N N7    . DA  B 7   ? 0.2339 0.2649 0.1617 0.0225  -0.0178 0.0231  7   DA  T N7    
2847 C C5    . DA  B 7   ? 0.1891 0.2136 0.1209 0.0178  -0.0109 0.0274  7   DA  T C5    
2848 C C6    . DA  B 7   ? 0.1881 0.2025 0.1196 0.0135  -0.0047 0.0295  7   DA  T C6    
2849 N N6    . DA  B 7   ? 0.2012 0.2121 0.1277 0.0137  -0.0039 0.0288  7   DA  T N6    
2850 N N1    . DA  B 7   ? 0.1855 0.1944 0.1231 0.0088  0.0001  0.0315  7   DA  T N1    
2851 C C2    . DA  B 7   ? 0.1936 0.2070 0.1367 0.0082  0.0002  0.0329  7   DA  T C2    
2852 N N3    . DA  B 7   ? 0.2442 0.2689 0.1890 0.0118  -0.0049 0.0325  7   DA  T N3    
2853 C C4    . DA  B 7   ? 0.2230 0.2527 0.1618 0.0169  -0.0111 0.0290  7   DA  T C4    
2854 P P     . DC  B 8   ? 0.2431 0.3000 0.2356 0.0287  -0.0265 0.0218  8   DC  T P     
2855 O OP1   . DC  B 8   ? 0.2744 0.3369 0.2858 0.0259  -0.0267 0.0169  8   DC  T OP1   
2856 O OP2   . DC  B 8   ? 0.2568 0.3165 0.2380 0.0376  -0.0330 0.0256  8   DC  T OP2   
2857 O "O5'" . DC  B 8   ? 0.2076 0.2537 0.1959 0.0262  -0.0169 0.0289  8   DC  T "O5'" 
2858 C "C5'" . DC  B 8   ? 0.1790 0.2206 0.1737 0.0174  -0.0101 0.0268  8   DC  T "C5'" 
2859 C "C4'" . DC  B 8   ? 0.1652 0.1963 0.1514 0.0154  -0.0023 0.0337  8   DC  T "C4'" 
2860 O "O4'" . DC  B 8   ? 0.1779 0.2059 0.1496 0.0161  -0.0028 0.0363  8   DC  T "O4'" 
2861 C "C3'" . DC  B 8   ? 0.1586 0.1859 0.1436 0.0213  -0.0002 0.0408  8   DC  T "C3'" 
2862 O "O3'" . DC  B 8   ? 0.1714 0.1904 0.1590 0.0156  0.0082  0.0433  8   DC  T "O3'" 
2863 C "C2'" . DC  B 8   ? 0.1781 0.2033 0.1470 0.0271  -0.0024 0.0468  8   DC  T "C2'" 
2864 C "C1'" . DC  B 8   ? 0.1787 0.2010 0.1406 0.0209  -0.0001 0.0447  8   DC  T "C1'" 
2865 N N1    . DC  B 8   ? 0.1680 0.1900 0.1173 0.0241  -0.0031 0.0449  8   DC  T N1    
2866 C C2    . DC  B 8   ? 0.1605 0.1727 0.1066 0.0190  0.0014  0.0435  8   DC  T C2    
2867 O O2    . DC  B 8   ? 0.1745 0.1798 0.1251 0.0134  0.0064  0.0433  8   DC  T O2    
2868 N N3    . DC  B 8   ? 0.1735 0.1846 0.1125 0.0201  -0.0007 0.0415  8   DC  T N3    
2869 C C4    . DC  B 8   ? 0.1841 0.2021 0.1182 0.0255  -0.0066 0.0401  8   DC  T C4    
2870 N N4    . DC  B 8   ? 0.2154 0.2319 0.1426 0.0261  -0.0076 0.0385  8   DC  T N4    
2871 C C5    . DC  B 8   ? 0.2009 0.2284 0.1384 0.0303  -0.0125 0.0396  8   DC  T C5    
2872 C C6    . DC  B 8   ? 0.2049 0.2349 0.1506 0.0298  -0.0109 0.0422  8   DC  T C6    
2873 P P     . DG  B 9   ? 0.1675 0.1789 0.1535 0.0192  0.0130  0.0510  9   DG  T P     
2874 O OP1   . DG  B 9   ? 0.1722 0.1785 0.1670 0.0120  0.0202  0.0488  9   DG  T OP1   
2875 O OP2   . DG  B 9   ? 0.1963 0.2126 0.1844 0.0287  0.0074  0.0537  9   DG  T OP2   
2876 O "O5'" . DG  B 9   ? 0.1653 0.1696 0.1371 0.0183  0.0148  0.0549  9   DG  T "O5'" 
2877 C "C5'" . DG  B 9   ? 0.1464 0.1436 0.1180 0.0090  0.0179  0.0486  9   DG  T "C5'" 
2878 C "C4'" . DG  B 9   ? 0.1553 0.1455 0.1237 0.0076  0.0183  0.0473  9   DG  T "C4'" 
2879 O "O4'" . DG  B 9   ? 0.1828 0.1733 0.1439 0.0095  0.0151  0.0470  9   DG  T "O4'" 
2880 C "C3'" . DG  B 9   ? 0.1997 0.1885 0.1714 0.0127  0.0201  0.0523  9   DG  T "C3'" 
2881 O "O3'" . DG  B 9   ? 0.2192 0.2019 0.1915 0.0080  0.0218  0.0495  9   DG  T "O3'" 
2882 C "C2'" . DG  B 9   ? 0.1757 0.1674 0.1411 0.0198  0.0164  0.0562  9   DG  T "C2'" 
2883 C "C1'" . DG  B 9   ? 0.1600 0.1509 0.1188 0.0158  0.0143  0.0519  9   DG  T "C1'" 
2884 N N9    . DG  B 9   ? 0.1635 0.1593 0.1158 0.0206  0.0103  0.0528  9   DG  T N9    
2885 C C8    . DG  B 9   ? 0.1863 0.1894 0.1379 0.0255  0.0065  0.0539  9   DG  T C8    
2886 N N7    . DG  B 9   ? 0.1733 0.1797 0.1178 0.0282  0.0023  0.0526  9   DG  T N7    
2887 C C5    . DG  B 9   ? 0.1454 0.1458 0.0862 0.0246  0.0047  0.0517  9   DG  T C5    
2888 C C6    . DG  B 9   ? 0.1652 0.1658 0.0989 0.0252  0.0031  0.0507  9   DG  T C6    
2889 O O6    . DG  B 9   ? 0.1845 0.1896 0.1124 0.0287  -0.0008 0.0497  9   DG  T O6    
2890 N N1    . DG  B 9   ? 0.1627 0.1587 0.0966 0.0220  0.0068  0.0509  9   DG  T N1    
2891 C C2    . DG  B 9   ? 0.1604 0.1533 0.1006 0.0194  0.0109  0.0517  9   DG  T C2    
2892 N N2    . DG  B 9   ? 0.1788 0.1705 0.1192 0.0192  0.0143  0.0528  9   DG  T N2    
2893 N N3    . DG  B 9   ? 0.1498 0.1409 0.0956 0.0174  0.0116  0.0513  9   DG  T N3    
2894 C C4    . DG  B 9   ? 0.1521 0.1468 0.0980 0.0200  0.0088  0.0515  9   DG  T C4    
2895 O "O5'" . DC  C 1   ? 0.3054 0.3072 0.2046 0.0309  0.0153  0.0512  1   DC  P "O5'" 
2896 C "C5'" . DC  C 1   ? 0.2569 0.2568 0.1590 0.0311  0.0197  0.0549  1   DC  P "C5'" 
2897 C "C4'" . DC  C 1   ? 0.2285 0.2261 0.1392 0.0291  0.0206  0.0564  1   DC  P "C4'" 
2898 O "O4'" . DC  C 1   ? 0.2535 0.2513 0.1620 0.0312  0.0177  0.0581  1   DC  P "O4'" 
2899 C "C3'" . DC  C 1   ? 0.2271 0.2240 0.1466 0.0244  0.0201  0.0527  1   DC  P "C3'" 
2900 O "O3'" . DC  C 1   ? 0.2350 0.2309 0.1594 0.0219  0.0229  0.0520  1   DC  P "O3'" 
2901 C "C2'" . DC  C 1   ? 0.2117 0.2069 0.1361 0.0237  0.0199  0.0543  1   DC  P "C2'" 
2902 C "C1'" . DC  C 1   ? 0.2277 0.2241 0.1447 0.0280  0.0173  0.0568  1   DC  P "C1'" 
2903 N N1    . DC  C 1   ? 0.2183 0.2164 0.1341 0.0278  0.0128  0.0541  1   DC  P N1    
2904 C C2    . DC  C 1   ? 0.1829 0.1799 0.1048 0.0259  0.0118  0.0537  1   DC  P C2    
2905 O O2    . DC  C 1   ? 0.2121 0.2066 0.1401 0.0244  0.0148  0.0552  1   DC  P O2    
2906 N N3    . DC  C 1   ? 0.1908 0.1895 0.1118 0.0259  0.0075  0.0515  1   DC  P N3    
2907 C C4    . DC  C 1   ? 0.2097 0.2113 0.1242 0.0275  0.0039  0.0493  1   DC  P C4    
2908 N N4    . DC  C 1   ? 0.2109 0.2150 0.1254 0.0278  -0.0009 0.0471  1   DC  P N4    
2909 C C5    . DC  C 1   ? 0.2250 0.2277 0.1327 0.0293  0.0049  0.0493  1   DC  P C5    
2910 C C6    . DC  C 1   ? 0.2153 0.2161 0.1239 0.0294  0.0096  0.0519  1   DC  P C6    
2911 P P     . DG  C 2   ? 0.2758 0.2715 0.2059 0.0173  0.0219  0.0476  2   DG  P P     
2912 O OP1   . DG  C 2   ? 0.2055 0.2004 0.1395 0.0160  0.0248  0.0483  2   DG  P OP1   
2913 O OP2   . DG  C 2   ? 0.2152 0.2127 0.1401 0.0176  0.0191  0.0446  2   DG  P OP2   
2914 O "O5'" . DG  C 2   ? 0.1984 0.1924 0.1352 0.0140  0.0207  0.0465  2   DG  P "O5'" 
2915 C "C5'" . DG  C 2   ? 0.1790 0.1710 0.1215 0.0127  0.0228  0.0482  2   DG  P "C5'" 
2916 C "C4'" . DG  C 2   ? 0.1655 0.1562 0.1122 0.0103  0.0215  0.0470  2   DG  P "C4'" 
2917 O "O4'" . DG  C 2   ? 0.1995 0.1911 0.1420 0.0134  0.0199  0.0485  2   DG  P "O4'" 
2918 C "C3'" . DG  C 2   ? 0.1537 0.1442 0.1032 0.0060  0.0194  0.0428  2   DG  P "C3'" 
2919 O "O3'" . DG  C 2   ? 0.1694 0.1583 0.1240 0.0022  0.0201  0.0413  2   DG  P "O3'" 
2920 C "C2'" . DG  C 2   ? 0.1685 0.1584 0.1192 0.0057  0.0182  0.0427  2   DG  P "C2'" 
2921 C "C1'" . DG  C 2   ? 0.1710 0.1624 0.1161 0.0108  0.0178  0.0459  2   DG  P "C1'" 
2922 N N9    . DG  C 2   ? 0.1662 0.1599 0.1060 0.0123  0.0147  0.0446  2   DG  P N9    
2923 C C8    . DG  C 2   ? 0.1631 0.1588 0.0965 0.0147  0.0137  0.0443  2   DG  P C8    
2924 N N7    . DG  C 2   ? 0.1718 0.1694 0.1011 0.0155  0.0102  0.0425  2   DG  P N7    
2925 C C5    . DG  C 2   ? 0.1532 0.1501 0.0868 0.0136  0.0089  0.0418  2   DG  P C5    
2926 C C6    . DG  C 2   ? 0.1450 0.1434 0.0771 0.0136  0.0049  0.0399  2   DG  P C6    
2927 O O6    . DG  C 2   ? 0.1741 0.1766 0.1011 0.0166  0.0014  0.0386  2   DG  P O6    
2928 N N1    . DG  C 2   ? 0.1461 0.1428 0.0839 0.0115  0.0057  0.0402  2   DG  P N1    
2929 C C2    . DG  C 2   ? 0.1338 0.1277 0.0774 0.0093  0.0095  0.0414  2   DG  P C2    
2930 N N2    . DG  C 2   ? 0.1440 0.1365 0.0922 0.0072  0.0101  0.0411  2   DG  P N2    
2931 N N3    . DG  C 2   ? 0.1512 0.1439 0.0961 0.0093  0.0124  0.0427  2   DG  P N3    
2932 C C4    . DG  C 2   ? 0.1483 0.1425 0.0881 0.0115  0.0120  0.0430  2   DG  P C4    
2933 P P     . DT  C 3   ? 0.1995 0.1880 0.1559 -0.0022 0.0184  0.0373  3   DT  P P     
2934 O OP1   . DT  C 3   ? 0.1639 0.1508 0.1245 -0.0052 0.0191  0.0367  3   DT  P OP1   
2935 O OP2   . DT  C 3   ? 0.1539 0.1441 0.1063 -0.0010 0.0175  0.0365  3   DT  P OP2   
2936 O "O5'" . DT  C 3   ? 0.1597 0.1473 0.1170 -0.0046 0.0167  0.0352  3   DT  P "O5'" 
2937 C "C5'" . DT  C 3   ? 0.1596 0.1455 0.1200 -0.0060 0.0173  0.0354  3   DT  P "C5'" 
2938 C "C4'" . DT  C 3   ? 0.1630 0.1485 0.1234 -0.0076 0.0162  0.0336  3   DT  P "C4'" 
2939 O "O4'" . DT  C 3   ? 0.1645 0.1520 0.1216 -0.0036 0.0156  0.0356  3   DT  P "O4'" 
2940 C "C3'" . DT  C 3   ? 0.1579 0.1422 0.1179 -0.0107 0.0151  0.0298  3   DT  P "C3'" 
2941 O "O3'" . DT  C 3   ? 0.1812 0.1633 0.1449 -0.0135 0.0154  0.0267  3   DT  P "O3'" 
2942 C "C2'" . DT  C 3   ? 0.1551 0.1398 0.1139 -0.0100 0.0146  0.0294  3   DT  P "C2'" 
2943 C "C1'" . DT  C 3   ? 0.1426 0.1302 0.0983 -0.0051 0.0140  0.0333  3   DT  P "C1'" 
2944 N N1    . DT  C 3   ? 0.1450 0.1348 0.0953 -0.0025 0.0121  0.0333  3   DT  P N1    
2945 C C2    . DT  C 3   ? 0.1328 0.1237 0.0800 -0.0017 0.0098  0.0321  3   DT  P C2    
2946 O O2    . DT  C 3   ? 0.1554 0.1456 0.1048 -0.0030 0.0100  0.0315  3   DT  P O2    
2947 N N3    . DT  C 3   ? 0.1520 0.1452 0.0933 0.0009  0.0072  0.0316  3   DT  P N3    
2948 C C4    . DT  C 3   ? 0.1439 0.1383 0.0825 0.0024  0.0076  0.0322  3   DT  P C4    
2949 O O4    . DT  C 3   ? 0.1836 0.1803 0.1164 0.0047  0.0053  0.0311  3   DT  P O4    
2950 C C5    . DT  C 3   ? 0.1461 0.1391 0.0887 0.0016  0.0109  0.0339  3   DT  P C5    
2951 C C7    . DT  C 3   ? 0.1667 0.1606 0.1068 0.0035  0.0122  0.0349  3   DT  P C7    
2952 C C6    . DT  C 3   ? 0.1434 0.1343 0.0916 -0.0008 0.0125  0.0342  3   DT  P C6    
2953 P P     A DA  C 4   ? 0.1960 0.1769 0.1646 -0.0103 0.0181  0.0242  4   DA  P P     
2954 O OP1   A DA  C 4   ? 0.1721 0.1579 0.1503 -0.0106 0.0181  0.0255  4   DA  P OP1   
2955 O OP2   A DA  C 4   ? 0.1638 0.1450 0.1283 -0.0102 0.0168  0.0243  4   DA  P OP2   
2956 O "O5'" A DA  C 4   ? 0.1833 0.1691 0.1563 -0.0097 0.0175  0.0246  4   DA  P "O5'" 
2957 C "C5'" A DA  C 4   ? 0.1648 0.1516 0.1419 -0.0105 0.0184  0.0247  4   DA  P "C5'" 
2958 C "C4'" A DA  C 4   ? 0.1539 0.1440 0.1329 -0.0124 0.0173  0.0239  4   DA  P "C4'" 
2959 O "O4'" A DA  C 4   ? 0.1662 0.1540 0.1374 -0.0103 0.0173  0.0243  4   DA  P "O4'" 
2960 C "C3'" A DA  C 4   ? 0.1245 0.1173 0.1053 -0.0161 0.0140  0.0212  4   DA  P "C3'" 
2961 O "O3'" A DA  C 4   ? 0.1148 0.1073 0.0982 -0.0201 0.0125  0.0183  4   DA  P "O3'" 
2962 C "C2'" A DA  C 4   ? 0.1507 0.1459 0.1303 -0.0162 0.0132  0.0208  4   DA  P "C2'" 
2963 C "C1'" A DA  C 4   ? 0.1717 0.1641 0.1438 -0.0113 0.0154  0.0237  4   DA  P "C1'" 
2964 N N9    A DA  C 4   ? 0.1843 0.1752 0.1476 -0.0083 0.0140  0.0243  4   DA  P N9    
2965 C C8    A DA  C 4   ? 0.1408 0.1285 0.1008 -0.0073 0.0141  0.0245  4   DA  P C8    
2966 N N7    A DA  C 4   ? 0.1486 0.1358 0.1005 -0.0056 0.0119  0.0244  4   DA  P N7    
2967 C C5    A DA  C 4   ? 0.1742 0.1666 0.1233 -0.0046 0.0094  0.0247  4   DA  P C5    
2968 C C6    A DA  C 4   ? 0.1315 0.1322 0.0742 -0.0022 0.0046  0.0248  4   DA  P C6    
2969 N N6    A DA  C 4   ? 0.1313 0.1299 0.0672 -0.0001 0.0034  0.0242  4   DA  P N6    
2970 N N1    A DA  C 4   ? 0.1840 0.1965 0.1279 -0.0023 0.0002  0.0243  4   DA  P N1    
2971 C C2    A DA  C 4   ? 0.1901 0.2058 0.1413 -0.0074 0.0014  0.0253  4   DA  P C2    
2972 N N3    A DA  C 4   ? 0.1669 0.1746 0.1256 -0.0109 0.0067  0.0259  4   DA  P N3    
2973 C C4    A DA  C 4   ? 0.1769 0.1738 0.1342 -0.0077 0.0102  0.0251  4   DA  P C4    
2974 O OP3   . DG  D 1   ? 0.2905 0.2762 0.2033 0.0395  0.0364  -0.0542 1   DG  D OP3   
2975 P P     . DG  D 1   ? 0.2522 0.2431 0.1478 0.0414  0.0355  -0.0498 1   DG  D P     
2976 O OP1   . DG  D 1   ? 0.2693 0.2625 0.1628 0.0423  0.0429  -0.0381 1   DG  D OP1   
2977 O OP2   . DG  D 1   ? 0.2945 0.2874 0.1753 0.0453  0.0333  -0.0590 1   DG  D OP2   
2978 O "O5'" . DG  D 1   ? 0.2664 0.2574 0.1668 0.0351  0.0268  -0.0474 1   DG  D "O5'" 
2979 C "C5'" . DG  D 1   ? 0.2567 0.2452 0.1729 0.0284  0.0258  -0.0392 1   DG  D "C5'" 
2980 C "C4'" . DG  D 1   ? 0.2329 0.2187 0.1595 0.0228  0.0176  -0.0444 1   DG  D "C4'" 
2981 O "O4'" . DG  D 1   ? 0.2132 0.2029 0.1305 0.0224  0.0116  -0.0462 1   DG  D "O4'" 
2982 C "C3'" . DG  D 1   ? 0.2292 0.2115 0.1610 0.0239  0.0151  -0.0562 1   DG  D "C3'" 
2983 O "O3'" . DG  D 1   ? 0.2269 0.2046 0.1755 0.0172  0.0106  -0.0564 1   DG  D "O3'" 
2984 C "C2'" . DG  D 1   ? 0.2154 0.2011 0.1323 0.0274  0.0102  -0.0653 1   DG  D "C2'" 
2985 C "C1'" . DG  D 1   ? 0.2136 0.2035 0.1261 0.0247  0.0065  -0.0583 1   DG  D "C1'" 
2986 N N9    . DG  D 1   ? 0.2217 0.2172 0.1155 0.0299  0.0053  -0.0596 1   DG  D N9    
2987 C C8    . DG  D 1   ? 0.2293 0.2267 0.1102 0.0353  0.0104  -0.0587 1   DG  D C8    
2988 N N7    . DG  D 1   ? 0.2464 0.2478 0.1189 0.0356  0.0076  -0.0555 1   DG  D N7    
2989 C C5    . DG  D 1   ? 0.2254 0.2281 0.1035 0.0317  0.0007  -0.0552 1   DG  D C5    
2990 C C6    . DG  D 1   ? 0.2200 0.2266 0.0949 0.0307  -0.0046 -0.0525 1   DG  D C6    
2991 O O6    . DG  D 1   ? 0.2447 0.2541 0.1106 0.0332  -0.0047 -0.0496 1   DG  D O6    
2992 N N1    . DG  D 1   ? 0.1957 0.2028 0.0802 0.0263  -0.0102 -0.0534 1   DG  D N1    
2993 C C2    . DG  D 1   ? 0.1868 0.1907 0.0824 0.0225  -0.0110 -0.0565 1   DG  D C2    
2994 N N2    . DG  D 1   ? 0.1825 0.1877 0.0873 0.0175  -0.0165 -0.0567 1   DG  D N2    
2995 N N3    . DG  D 1   ? 0.1940 0.1934 0.0947 0.0225  -0.0065 -0.0582 1   DG  D N3    
2996 C C4    . DG  D 1   ? 0.1962 0.1957 0.0858 0.0284  -0.0008 -0.0585 1   DG  D C4    
2997 P P     . DC  D 2   ? 0.2414 0.2131 0.2019 0.0165  0.0086  -0.0661 2   DC  D P     
2998 O OP1   . DC  D 2   ? 0.2464 0.2133 0.2251 0.0102  0.0084  -0.0590 2   DC  D OP1   
2999 O OP2   . DC  D 2   ? 0.2825 0.2541 0.2353 0.0238  0.0134  -0.0736 2   DC  D OP2   
3000 O "O5'" . DC  D 2   ? 0.2419 0.2140 0.2012 0.0138  0.0000  -0.0748 2   DC  D "O5'" 
3001 C "C5'" . DC  D 2   ? 0.2314 0.2041 0.1976 0.0069  -0.0047 -0.0695 2   DC  D "C5'" 
3002 C "C4'" . DC  D 2   ? 0.2105 0.1878 0.1689 0.0067  -0.0114 -0.0757 2   DC  D "C4'" 
3003 O "O4'" . DC  D 2   ? 0.2125 0.1956 0.1527 0.0132  -0.0098 -0.0763 2   DC  D "O4'" 
3004 C "C3'" . DC  D 2   ? 0.2242 0.1991 0.1865 0.0062  -0.0172 -0.0887 2   DC  D "C3'" 
3005 O "O3'" . DC  D 2   ? 0.2180 0.1902 0.1954 -0.0016 -0.0219 -0.0879 2   DC  D "O3'" 
3006 C "C2'" . DC  D 2   ? 0.2566 0.2380 0.2034 0.0103  -0.0204 -0.0925 2   DC  D "C2'" 
3007 C "C1'" . DC  D 2   ? 0.2353 0.2219 0.1703 0.0132  -0.0171 -0.0844 2   DC  D "C1'" 
3008 N N1    . DC  D 2   ? 0.2278 0.2191 0.1450 0.0196  -0.0156 -0.0842 2   DC  D N1    
3009 C C2    . DC  D 2   ? 0.2090 0.2059 0.1200 0.0193  -0.0197 -0.0807 2   DC  D C2    
3010 O O2    . DC  D 2   ? 0.2154 0.2138 0.1352 0.0144  -0.0242 -0.0789 2   DC  D O2    
3011 N N3    . DC  D 2   ? 0.2152 0.2157 0.1118 0.0241  -0.0183 -0.0790 2   DC  D N3    
3012 C C4    . DC  D 2   ? 0.2514 0.2503 0.1394 0.0286  -0.0127 -0.0807 2   DC  D C4    
3013 N N4    . DC  D 2   ? 0.2680 0.2701 0.1424 0.0324  -0.0116 -0.0786 2   DC  D N4    
3014 C C5    . DC  D 2   ? 0.2458 0.2395 0.1396 0.0294  -0.0079 -0.0843 2   DC  D C5    
3015 C C6    . DC  D 2   ? 0.2604 0.2504 0.1690 0.0251  -0.0097 -0.0862 2   DC  D C6    
3016 P P     A DC  D 3   ? 0.2067 0.1755 0.1943 -0.0051 -0.0262 -0.0925 3   DC  D P     
3017 P P     B DC  D 3   ? 0.1972 0.1683 0.1809 -0.0044 -0.0271 -0.0928 3   DC  D P     
3018 O OP1   A DC  D 3   ? 0.1822 0.1464 0.1858 -0.0123 -0.0266 -0.0861 3   DC  D OP1   
3019 O OP1   B DC  D 3   ? 0.1872 0.1539 0.1871 -0.0118 -0.0283 -0.0876 3   DC  D OP1   
3020 O OP2   A DC  D 3   ? 0.2415 0.2073 0.2251 0.0002  -0.0244 -0.1007 3   DC  D OP2   
3021 O OP2   B DC  D 3   ? 0.2206 0.1897 0.1987 0.0009  -0.0261 -0.1014 3   DC  D OP2   
3022 O "O5'" A DC  D 3   ? 0.1892 0.1648 0.1707 -0.0059 -0.0311 -0.0928 3   DC  D "O5'" 
3023 O "O5'" B DC  D 3   ? 0.2007 0.1794 0.1759 -0.0042 -0.0311 -0.0919 3   DC  D "O5'" 
3024 C "C5'" A DC  D 3   ? 0.2111 0.1908 0.1942 -0.0099 -0.0326 -0.0856 3   DC  D "C5'" 
3025 C "C5'" B DC  D 3   ? 0.2057 0.1877 0.1842 -0.0085 -0.0323 -0.0846 3   DC  D "C5'" 
3026 C "C4'" A DC  D 3   ? 0.2221 0.2079 0.2008 -0.0096 -0.0371 -0.0872 3   DC  D "C4'" 
3027 C "C4'" B DC  D 3   ? 0.2135 0.2012 0.1891 -0.0088 -0.0368 -0.0856 3   DC  D "C4'" 
3028 O "O4'" A DC  D 3   ? 0.2296 0.2205 0.1928 -0.0031 -0.0367 -0.0887 3   DC  D "O4'" 
3029 O "O4'" B DC  D 3   ? 0.2406 0.2332 0.2006 -0.0022 -0.0369 -0.0880 3   DC  D "O4'" 
3030 C "C3'" A DC  D 3   ? 0.2525 0.2369 0.2359 -0.0104 -0.0405 -0.0938 3   DC  D "C3'" 
3031 C "C3'" B DC  D 3   ? 0.2410 0.2268 0.2236 -0.0108 -0.0402 -0.0912 3   DC  D "C3'" 
3032 O "O3'" A DC  D 3   ? 0.2924 0.2770 0.2875 -0.0168 -0.0428 -0.0904 3   DC  D "O3'" 
3033 O "O3'" B DC  D 3   ? 0.2593 0.2479 0.2494 -0.0157 -0.0430 -0.0879 3   DC  D "O3'" 
3034 C "C2'" A DC  D 3   ? 0.2516 0.2413 0.2219 -0.0051 -0.0431 -0.0991 3   DC  D "C2'" 
3035 C "C2'" B DC  D 3   ? 0.2450 0.2335 0.2151 -0.0047 -0.0417 -0.0986 3   DC  D "C2'" 
3036 C "C1'" A DC  D 3   ? 0.2304 0.2243 0.1887 -0.0010 -0.0407 -0.0943 3   DC  D "C1'" 
3037 C "C1'" B DC  D 3   ? 0.2302 0.2243 0.1871 -0.0004 -0.0406 -0.0947 3   DC  D "C1'" 
3038 N N1    A DC  D 3   ? 0.2263 0.2208 0.1693 0.0059  -0.0382 -0.0978 3   DC  D N1    
3039 N N1    B DC  D 3   ? 0.2287 0.2236 0.1698 0.0067  -0.0381 -0.0979 3   DC  D N1    
3040 C C2    A DC  D 3   ? 0.2401 0.2405 0.1699 0.0100  -0.0396 -0.0965 3   DC  D C2    
3041 C C2    B DC  D 3   ? 0.2379 0.2389 0.1662 0.0106  -0.0396 -0.0964 3   DC  D C2    
3042 O O2    A DC  D 3   ? 0.2353 0.2405 0.1673 0.0082  -0.0435 -0.0936 3   DC  D O2    
3043 O O2    B DC  D 3   ? 0.2394 0.2450 0.1706 0.0085  -0.0436 -0.0936 3   DC  D O2    
3044 N N3    A DC  D 3   ? 0.2292 0.2298 0.1447 0.0158  -0.0364 -0.0981 3   DC  D N3    
3045 N N3    B DC  D 3   ? 0.2299 0.2313 0.1434 0.0164  -0.0364 -0.0975 3   DC  D N3    
3046 C C4    A DC  D 3   ? 0.2339 0.2294 0.1483 0.0179  -0.0315 -0.1014 3   DC  D C4    
3047 C C4    B DC  D 3   ? 0.2349 0.2313 0.1464 0.0187  -0.0314 -0.1006 3   DC  D C4    
3048 N N4    A DC  D 3   ? 0.2464 0.2423 0.1465 0.0233  -0.0275 -0.1023 3   DC  D N4    
3049 N N4    B DC  D 3   ? 0.2471 0.2442 0.1441 0.0241  -0.0273 -0.1010 3   DC  D N4    
3050 C C5    A DC  D 3   ? 0.2265 0.2160 0.1552 0.0142  -0.0303 -0.1034 3   DC  D C5    
3051 C C5    B DC  D 3   ? 0.2279 0.2183 0.1533 0.0153  -0.0299 -0.1029 3   DC  D C5    
3052 C C6    A DC  D 3   ? 0.2361 0.2252 0.1784 0.0082  -0.0339 -0.1011 3   DC  D C6    
3053 C C6    B DC  D 3   ? 0.2344 0.2241 0.1741 0.0092  -0.0336 -0.1011 3   DC  D C6    
3054 P P     A DG  D 4   ? 0.2544 0.2458 0.2494 -0.0188 -0.0455 -0.0867 4   DG  D P     
3055 P P     B DG  D 4   ? 0.2753 0.2622 0.2747 -0.0192 -0.0462 -0.0920 4   DG  D P     
3056 O OP1   A DG  D 4   ? 0.2243 0.2194 0.2101 -0.0156 -0.0439 -0.0828 4   DG  D OP1   
3057 O OP1   B DG  D 4   ? 0.2672 0.2543 0.2760 -0.0252 -0.0460 -0.0853 4   DG  D OP1   
3058 O OP2   A DG  D 4   ? 0.2914 0.2810 0.2981 -0.0253 -0.0455 -0.0820 4   DG  D OP2   
3059 O OP2   B DG  D 4   ? 0.3133 0.2939 0.3153 -0.0180 -0.0453 -0.0977 4   DG  D OP2   
3060 O "O5'" A DG  D 4   ? 0.2619 0.2574 0.2518 -0.0156 -0.0503 -0.0944 4   DG  D "O5'" 
3061 O "O5'" B DG  D 4   ? 0.2699 0.2631 0.2615 -0.0157 -0.0508 -0.0978 4   DG  D "O5'" 
3062 C "C5'" A DG  D 4   ? 0.2571 0.2599 0.2410 -0.0135 -0.0532 -0.0937 4   DG  D "C5'" 
3063 C "C5'" B DG  D 4   ? 0.2433 0.2433 0.2291 -0.0142 -0.0522 -0.0943 4   DG  D "C5'" 
3064 C "C4'" A DG  D 4   ? 0.2594 0.2648 0.2369 -0.0101 -0.0576 -0.1016 4   DG  D "C4'" 
3065 C "C4'" B DG  D 4   ? 0.2654 0.2706 0.2428 -0.0102 -0.0567 -0.1003 4   DG  D "C4'" 
3066 O "O4'" A DG  D 4   ? 0.2742 0.2791 0.2376 -0.0041 -0.0559 -0.1044 4   DG  D "O4'" 
3067 O "O4'" B DG  D 4   ? 0.2695 0.2742 0.2330 -0.0041 -0.0552 -0.1033 4   DG  D "O4'" 
3068 C "C3'" A DG  D 4   ? 0.2610 0.2622 0.2463 -0.0128 -0.0594 -0.1079 4   DG  D "C3'" 
3069 C "C3'" B DG  D 4   ? 0.2660 0.2699 0.2492 -0.0121 -0.0605 -0.1074 4   DG  D "C3'" 
3070 O "O3'" A DG  D 4   ? 0.2533 0.2590 0.2403 -0.0136 -0.0648 -0.1119 4   DG  D "O3'" 
3071 O "O3'" B DG  D 4   ? 0.2504 0.2608 0.2326 -0.0117 -0.0657 -0.1093 4   DG  D "O3'" 
3072 C "C2'" A DG  D 4   ? 0.2700 0.2671 0.2464 -0.0083 -0.0578 -0.1139 4   DG  D "C2'" 
3073 C "C2'" B DG  D 4   ? 0.2738 0.2738 0.2481 -0.0078 -0.0597 -0.1142 4   DG  D "C2'" 
3074 C "C1'" A DG  D 4   ? 0.2710 0.2731 0.2322 -0.0027 -0.0576 -0.1127 4   DG  D "C1'" 
3075 C "C1'" B DG  D 4   ? 0.2649 0.2683 0.2248 -0.0023 -0.0578 -0.1117 4   DG  D "C1'" 
3076 N N9    A DG  D 4   ? 0.2515 0.2504 0.2014 0.0023  -0.0536 -0.1151 4   DG  D N9    
3077 N N9    B DG  D 4   ? 0.2475 0.2464 0.1985 0.0018  -0.0537 -0.1146 4   DG  D N9    
3078 C C8    A DG  D 4   ? 0.2455 0.2376 0.1987 0.0024  -0.0495 -0.1170 4   DG  D C8    
3079 C C8    B DG  D 4   ? 0.2408 0.2327 0.1979 0.0008  -0.0501 -0.1165 4   DG  D C8    
3080 N N7    A DG  D 4   ? 0.2530 0.2439 0.1939 0.0076  -0.0458 -0.1191 4   DG  D N7    
3081 N N7    B DG  D 4   ? 0.2485 0.2380 0.1953 0.0056  -0.0463 -0.1191 4   DG  D N7    
3082 C C5    A DG  D 4   ? 0.2554 0.2525 0.1832 0.0111  -0.0477 -0.1178 4   DG  D C5    
3083 C C5    B DG  D 4   ? 0.2533 0.2486 0.1854 0.0099  -0.0473 -0.1183 4   DG  D C5    
3084 C C6    A DG  D 4   ? 0.2666 0.2653 0.1774 0.0169  -0.0449 -0.1181 4   DG  D C6    
3085 C C6    B DG  D 4   ? 0.2647 0.2606 0.1806 0.0158  -0.0438 -0.1194 4   DG  D C6    
3086 O O6    A DG  D 4   ? 0.2732 0.2684 0.1768 0.0204  -0.0394 -0.1198 4   DG  D O6    
3087 O O6    B DG  D 4   ? 0.2703 0.2617 0.1817 0.0187  -0.0385 -0.1217 4   DG  D O6    
3088 N N1    A DG  D 4   ? 0.2709 0.2761 0.1730 0.0185  -0.0487 -0.1156 4   DG  D N1    
3089 N N1    B DG  D 4   ? 0.2699 0.2721 0.1745 0.0183  -0.0465 -0.1168 4   DG  D N1    
3090 C C2    A DG  D 4   ? 0.2646 0.2745 0.1745 0.0153  -0.0544 -0.1138 4   DG  D C2    
3091 C C2    B DG  D 4   ? 0.2648 0.2722 0.1740 0.0158  -0.0520 -0.1143 4   DG  D C2    
3092 N N2    A DG  D 4   ? 0.2706 0.2864 0.1711 0.0179  -0.0576 -0.1116 4   DG  D N2    
3093 N N2    B DG  D 4   ? 0.2718 0.2847 0.1693 0.0191  -0.0542 -0.1119 4   DG  D N2    
3094 N N3    A DG  D 4   ? 0.2541 0.2626 0.1799 0.0099  -0.0565 -0.1138 4   DG  D N3    
3095 N N3    B DG  D 4   ? 0.2539 0.2611 0.1787 0.0105  -0.0549 -0.1137 4   DG  D N3    
3096 C C4    A DG  D 4   ? 0.2501 0.2522 0.1838 0.0079  -0.0529 -0.1156 4   DG  D C4    
3097 C C4    B DG  D 4   ? 0.2490 0.2500 0.1840 0.0076  -0.0522 -0.1156 4   DG  D C4    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   129 ?   ?   ?   A . n 
A 1 2   SER 2   130 ?   ?   ?   A . n 
A 1 3   ALA 3   131 ?   ?   ?   A . n 
A 1 4   ALA 4   132 ?   ?   ?   A . n 
A 1 5   ALA 5   133 ?   ?   ?   A . n 
A 1 6   SER 6   134 ?   ?   ?   A . n 
A 1 7   PRO 7   135 ?   ?   ?   A . n 
A 1 8   ALA 8   136 ?   ?   ?   A . n 
A 1 9   TRP 9   137 ?   ?   ?   A . n 
A 1 10  MET 10  138 138 MET MET A . n 
A 1 11  PRO 11  139 139 PRO PRO A . n 
A 1 12  ALA 12  140 140 ALA ALA A . n 
A 1 13  TYR 13  141 141 TYR TYR A . n 
A 1 14  ALA 14  142 142 ALA ALA A . n 
A 1 15  CYS 15  143 143 CYS CYS A . n 
A 1 16  GLN 16  144 144 GLN GLN A . n 
A 1 17  ARG 17  145 145 ARG ARG A . n 
A 1 18  PRO 18  146 146 PRO PRO A . n 
A 1 19  THR 19  147 147 THR THR A . n 
A 1 20  PRO 20  148 148 PRO PRO A . n 
A 1 21  LEU 21  149 149 LEU LEU A . n 
A 1 22  THR 22  150 150 THR THR A . n 
A 1 23  HIS 23  151 151 HIS HIS A . n 
A 1 24  HIS 24  152 152 HIS HIS A . n 
A 1 25  ASN 25  153 153 ASN ASN A . n 
A 1 26  THR 26  154 154 THR THR A . n 
A 1 27  GLY 27  155 155 GLY GLY A . n 
A 1 28  LEU 28  156 156 LEU LEU A . n 
A 1 29  SER 29  157 157 SER SER A . n 
A 1 30  GLU 30  158 158 GLU GLU A . n 
A 1 31  ALA 31  159 159 ALA ALA A . n 
A 1 32  LEU 32  160 160 LEU LEU A . n 
A 1 33  GLU 33  161 161 GLU GLU A . n 
A 1 34  ILE 34  162 162 ILE ILE A . n 
A 1 35  LEU 35  163 163 LEU LEU A . n 
A 1 36  ALA 36  164 164 ALA ALA A . n 
A 1 37  GLU 37  165 165 GLU GLU A . n 
A 1 38  ALA 38  166 166 ALA ALA A . n 
A 1 39  ALA 39  167 167 ALA ALA A . n 
A 1 40  GLY 40  168 168 GLY GLY A . n 
A 1 41  PHE 41  169 169 PHE PHE A . n 
A 1 42  GLU 42  170 170 GLU GLU A . n 
A 1 43  GLY 43  171 171 GLY GLY A . n 
A 1 44  SER 44  172 172 SER SER A . n 
A 1 45  GLU 45  173 173 GLU GLU A . n 
A 1 46  GLY 46  174 174 GLY GLY A . n 
A 1 47  ARG 47  175 175 ARG ARG A . n 
A 1 48  LEU 48  176 176 LEU LEU A . n 
A 1 49  LEU 49  177 177 LEU LEU A . n 
A 1 50  THR 50  178 178 THR THR A . n 
A 1 51  PHE 51  179 179 PHE PHE A . n 
A 1 52  CYS 52  180 180 CYS CYS A . n 
A 1 53  ARG 53  181 181 ARG ARG A . n 
A 1 54  ALA 54  182 182 ALA ALA A . n 
A 1 55  ALA 55  183 183 ALA ALA A . n 
A 1 56  SER 56  184 184 SER SER A . n 
A 1 57  VAL 57  185 185 VAL VAL A . n 
A 1 58  LEU 58  186 186 LEU LEU A . n 
A 1 59  LYS 59  187 187 LYS LYS A . n 
A 1 60  ALA 60  188 188 ALA ALA A . n 
A 1 61  LEU 61  189 189 LEU LEU A . n 
A 1 62  PRO 62  190 190 PRO PRO A . n 
A 1 63  SER 63  191 191 SER SER A . n 
A 1 64  PRO 64  192 192 PRO PRO A . n 
A 1 65  VAL 65  193 193 VAL VAL A . n 
A 1 66  THR 66  194 194 THR THR A . n 
A 1 67  THR 67  195 195 THR THR A . n 
A 1 68  LEU 68  196 196 LEU LEU A . n 
A 1 69  SER 69  197 197 SER SER A . n 
A 1 70  GLN 70  198 198 GLN GLN A . n 
A 1 71  LEU 71  199 199 LEU LEU A . n 
A 1 72  GLN 72  200 200 GLN GLN A . n 
A 1 73  GLY 73  201 201 GLY GLY A . n 
A 1 74  LEU 74  202 202 LEU LEU A . n 
A 1 75  PRO 75  203 203 PRO PRO A . n 
A 1 76  HIS 76  204 204 HIS HIS A . n 
A 1 77  PHE 77  205 205 PHE PHE A . n 
A 1 78  GLY 78  206 206 GLY GLY A . n 
A 1 79  GLU 79  207 207 GLU GLU A . n 
A 1 80  HIS 80  208 208 HIS HIS A . n 
A 1 81  SER 81  209 209 SER SER A . n 
A 1 82  SER 82  210 210 SER SER A . n 
A 1 83  ARG 83  211 211 ARG ARG A . n 
A 1 84  VAL 84  212 212 VAL VAL A . n 
A 1 85  VAL 85  213 213 VAL VAL A . n 
A 1 86  GLN 86  214 214 GLN GLN A . n 
A 1 87  GLU 87  215 215 GLU GLU A . n 
A 1 88  LEU 88  216 216 LEU LEU A . n 
A 1 89  LEU 89  217 217 LEU LEU A . n 
A 1 90  GLU 90  218 218 GLU GLU A . n 
A 1 91  HIS 91  219 219 HIS HIS A . n 
A 1 92  GLY 92  220 220 GLY GLY A . n 
A 1 93  VAL 93  221 221 VAL VAL A . n 
A 1 94  CYS 94  222 222 CYS CYS A . n 
A 1 95  GLU 95  223 223 GLU GLU A . n 
A 1 96  GLU 96  224 224 GLU GLU A . n 
A 1 97  VAL 97  225 225 VAL VAL A . n 
A 1 98  GLU 98  226 226 GLU GLU A . n 
A 1 99  ARG 99  227 227 ARG ARG A . n 
A 1 100 VAL 100 228 228 VAL VAL A . n 
A 1 101 ARG 101 229 229 ARG ARG A . n 
A 1 102 ARG 102 230 230 ARG ARG A . n 
A 1 103 SER 103 231 231 SER SER A . n 
A 1 104 GLU 104 232 232 GLU GLU A . n 
A 1 105 ARG 105 233 233 ARG ARG A . n 
A 1 106 TYR 106 234 234 TYR TYR A . n 
A 1 107 GLN 107 235 235 GLN GLN A . n 
A 1 108 THR 108 236 236 THR THR A . n 
A 1 109 MET 109 237 237 MET MET A . n 
A 1 110 LYS 110 238 238 LYS LYS A . n 
A 1 111 LEU 111 239 239 LEU LEU A . n 
A 1 112 PHE 112 240 240 PHE PHE A . n 
A 1 113 THR 113 241 241 THR THR A . n 
A 1 114 GLN 114 242 242 GLN GLN A . n 
A 1 115 ILE 115 243 243 ILE ILE A . n 
A 1 116 PHE 116 244 244 PHE PHE A . n 
A 1 117 GLY 117 245 245 GLY GLY A . n 
A 1 118 VAL 118 246 246 VAL VAL A . n 
A 1 119 GLY 119 247 247 GLY GLY A . n 
A 1 120 VAL 120 248 248 VAL VAL A . n 
A 1 121 LYS 121 249 249 LYS LYS A . n 
A 1 122 THR 122 250 250 THR THR A . n 
A 1 123 ALA 123 251 251 ALA ALA A . n 
A 1 124 ASP 124 252 252 ASP ASP A . n 
A 1 125 ARG 125 253 253 ARG ARG A . n 
A 1 126 TRP 126 254 254 TRP TRP A . n 
A 1 127 TYR 127 255 255 TYR TYR A . n 
A 1 128 ARG 128 256 256 ARG ARG A . n 
A 1 129 GLU 129 257 257 GLU GLU A . n 
A 1 130 GLY 130 258 258 GLY GLY A . n 
A 1 131 LEU 131 259 259 LEU LEU A . n 
A 1 132 ARG 132 260 260 ARG ARG A . n 
A 1 133 THR 133 261 261 THR THR A . n 
A 1 134 LEU 134 262 262 LEU LEU A . n 
A 1 135 ASP 135 263 263 ASP ASP A . n 
A 1 136 ASP 136 264 264 ASP ASP A . n 
A 1 137 LEU 137 265 265 LEU LEU A . n 
A 1 138 ARG 138 266 266 ARG ARG A . n 
A 1 139 GLU 139 267 267 GLU GLU A . n 
A 1 140 GLN 140 268 268 GLN GLN A . n 
A 1 141 PRO 141 269 269 PRO PRO A . n 
A 1 142 GLN 142 270 270 GLN GLN A . n 
A 1 143 LYS 143 271 271 LYS LYS A . n 
A 1 144 LEU 144 272 272 LEU LEU A . n 
A 1 145 THR 145 273 273 THR THR A . n 
A 1 146 GLN 146 274 274 GLN GLN A . n 
A 1 147 GLN 147 275 275 GLN GLN A . n 
A 1 148 GLN 148 276 276 GLN GLN A . n 
A 1 149 LYS 149 277 277 LYS LYS A . n 
A 1 150 ALA 150 278 278 ALA ALA A . n 
A 1 151 GLY 151 279 279 GLY GLY A . n 
A 1 152 LEU 152 280 280 LEU LEU A . n 
A 1 153 GLN 153 281 281 GLN GLN A . n 
A 1 154 HIS 154 282 282 HIS HIS A . n 
A 1 155 HIS 155 283 283 HIS HIS A . n 
A 1 156 GLN 156 284 284 GLN GLN A . n 
A 1 157 ASP 157 285 285 ASP ASP A . n 
A 1 158 LEU 158 286 286 LEU LEU A . n 
A 1 159 SER 159 287 287 SER SER A . n 
A 1 160 THR 160 288 288 THR THR A . n 
A 1 161 PRO 161 289 289 PRO PRO A . n 
A 1 162 VAL 162 290 290 VAL VAL A . n 
A 1 163 LEU 163 291 291 LEU LEU A . n 
A 1 164 ARG 164 292 292 ARG ARG A . n 
A 1 165 SER 165 293 293 SER SER A . n 
A 1 166 ASP 166 294 294 ASP ASP A . n 
A 1 167 VAL 167 295 295 VAL VAL A . n 
A 1 168 ASP 168 296 296 ASP ASP A . n 
A 1 169 ALA 169 297 297 ALA ALA A . n 
A 1 170 LEU 170 298 298 LEU LEU A . n 
A 1 171 GLN 171 299 299 GLN GLN A . n 
A 1 172 GLN 172 300 300 GLN GLN A . n 
A 1 173 VAL 173 301 301 VAL VAL A . n 
A 1 174 VAL 174 302 302 VAL VAL A . n 
A 1 175 GLU 175 303 303 GLU GLU A . n 
A 1 176 GLU 176 304 304 GLU GLU A . n 
A 1 177 ALA 177 305 305 ALA ALA A . n 
A 1 178 VAL 178 306 306 VAL VAL A . n 
A 1 179 GLY 179 307 307 GLY GLY A . n 
A 1 180 GLN 180 308 308 GLN GLN A . n 
A 1 181 ALA 181 309 309 ALA ALA A . n 
A 1 182 LEU 182 310 310 LEU LEU A . n 
A 1 183 PRO 183 311 311 PRO PRO A . n 
A 1 184 GLY 184 312 312 GLY GLY A . n 
A 1 185 ALA 185 313 313 ALA ALA A . n 
A 1 186 THR 186 314 314 THR THR A . n 
A 1 187 VAL 187 315 315 VAL VAL A . n 
A 1 188 THR 188 316 316 THR THR A . n 
A 1 189 LEU 189 317 317 LEU LEU A . n 
A 1 190 THR 190 318 318 THR THR A . n 
A 1 191 GLY 191 319 319 GLY GLY A . n 
A 1 192 GLY 192 320 320 GLY GLY A . n 
A 1 193 PHE 193 321 321 PHE PHE A . n 
A 1 194 ARG 194 322 322 ARG ARG A . n 
A 1 195 ARG 195 323 323 ARG ARG A . n 
A 1 196 GLY 196 324 324 GLY GLY A . n 
A 1 197 LYS 197 325 325 LYS LYS A . n 
A 1 198 LEU 198 326 326 LEU LEU A . n 
A 1 199 GLN 199 327 327 GLN GLN A . n 
A 1 200 GLY 200 328 328 GLY GLY A . n 
A 1 201 HIS 201 329 329 HIS HIS A . n 
A 1 202 ASP 202 330 330 ASP ASP A . n 
A 1 203 VAL 203 331 331 VAL VAL A . n 
A 1 204 ASP 204 332 332 ASP ASP A . n 
A 1 205 PHE 205 333 333 PHE PHE A . n 
A 1 206 LEU 206 334 334 LEU LEU A . n 
A 1 207 ILE 207 335 335 ILE ILE A . n 
A 1 208 THR 208 336 336 THR THR A . n 
A 1 209 HIS 209 337 337 HIS HIS A . n 
A 1 210 PRO 210 338 338 PRO PRO A . n 
A 1 211 LYS 211 339 339 LYS LYS A . n 
A 1 212 GLU 212 340 340 GLU GLU A . n 
A 1 213 GLY 213 341 341 GLY GLY A . n 
A 1 214 GLN 214 342 342 GLN GLN A . n 
A 1 215 GLU 215 343 343 GLU GLU A . n 
A 1 216 ALA 216 344 344 ALA ALA A . n 
A 1 217 GLY 217 345 345 GLY GLY A . n 
A 1 218 LEU 218 346 346 LEU LEU A . n 
A 1 219 LEU 219 347 347 LEU LEU A . n 
A 1 220 PRO 220 348 348 PRO PRO A . n 
A 1 221 ARG 221 349 349 ARG ARG A . n 
A 1 222 VAL 222 350 350 VAL VAL A . n 
A 1 223 MET 223 351 351 MET MET A . n 
A 1 224 CYS 224 352 352 CYS CYS A . n 
A 1 225 ARG 225 353 353 ARG ARG A . n 
A 1 226 LEU 226 354 354 LEU LEU A . n 
A 1 227 GLN 227 355 355 GLN GLN A . n 
A 1 228 ASP 228 356 356 ASP ASP A . n 
A 1 229 GLN 229 357 357 GLN GLN A . n 
A 1 230 GLY 230 358 358 GLY GLY A . n 
A 1 231 LEU 231 359 359 LEU LEU A . n 
A 1 232 ILE 232 360 360 ILE ILE A . n 
A 1 233 LEU 233 361 361 LEU LEU A . n 
A 1 234 TYR 234 362 362 TYR TYR A . n 
A 1 235 HIS 235 363 363 HIS HIS A . n 
A 1 236 GLN 236 364 364 GLN GLN A . n 
A 1 237 HIS 237 365 365 HIS HIS A . n 
A 1 238 GLN 238 366 ?   ?   ?   A . n 
A 1 239 HIS 239 367 ?   ?   ?   A . n 
A 1 240 SER 240 368 ?   ?   ?   A . n 
A 1 241 CYS 241 369 ?   ?   ?   A . n 
A 1 242 CYS 242 370 ?   ?   ?   A . n 
A 1 243 GLU 243 371 ?   ?   ?   A . n 
A 1 244 SER 244 372 ?   ?   ?   A . n 
A 1 245 PRO 245 373 ?   ?   ?   A . n 
A 1 246 THR 246 374 ?   ?   ?   A . n 
A 1 247 ARG 247 375 ?   ?   ?   A . n 
A 1 248 LEU 248 376 ?   ?   ?   A . n 
A 1 249 ALA 249 377 ?   ?   ?   A . n 
A 1 250 GLN 250 378 ?   ?   ?   A . n 
A 1 251 GLN 251 379 ?   ?   ?   A . n 
A 1 252 SER 252 380 ?   ?   ?   A . n 
A 1 253 HIS 253 381 ?   ?   ?   A . n 
A 1 254 MET 254 382 ?   ?   ?   A . n 
A 1 255 ASP 255 383 ?   ?   ?   A . n 
A 1 256 ALA 256 384 384 ALA ALA A . n 
A 1 257 PHE 257 385 385 PHE PHE A . n 
A 1 258 GLU 258 386 386 GLU GLU A . n 
A 1 259 ARG 259 387 387 ARG ARG A . n 
A 1 260 SER 260 388 388 SER SER A . n 
A 1 261 PHE 261 389 389 PHE PHE A . n 
A 1 262 CYS 262 390 390 CYS CYS A . n 
A 1 263 ILE 263 391 391 ILE ILE A . n 
A 1 264 PHE 264 392 392 PHE PHE A . n 
A 1 265 ARG 265 393 393 ARG ARG A . n 
A 1 266 LEU 266 394 394 LEU LEU A . n 
A 1 267 PRO 267 395 395 PRO PRO A . n 
A 1 268 GLN 268 396 396 GLN GLN A . n 
A 1 269 PRO 269 397 397 PRO PRO A . n 
A 1 270 GLY 270 410 410 GLY GLY A . n 
A 1 271 SER 271 411 411 SER SER A . n 
A 1 272 TRP 272 412 412 TRP TRP A . n 
A 1 273 LYS 273 413 413 LYS LYS A . n 
A 1 274 ALA 274 414 414 ALA ALA A . n 
A 1 275 VAL 275 415 415 VAL VAL A . n 
A 1 276 ARG 276 416 416 ARG ARG A . n 
A 1 277 VAL 277 417 417 VAL VAL A . n 
A 1 278 ASP 278 418 418 ASP ASP A . n 
A 1 279 LEU 279 419 419 LEU LEU A . n 
A 1 280 VAL 280 420 420 VAL VAL A . n 
A 1 281 VAL 281 421 421 VAL VAL A . n 
A 1 282 ALA 282 422 422 ALA ALA A . n 
A 1 283 PRO 283 423 423 PRO PRO A . n 
A 1 284 VAL 284 424 424 VAL VAL A . n 
A 1 285 SER 285 425 425 SER SER A . n 
A 1 286 GLN 286 426 426 GLN GLN A . n 
A 1 287 PHE 287 427 427 PHE PHE A . n 
A 1 288 PRO 288 428 428 PRO PRO A . n 
A 1 289 PHE 289 429 429 PHE PHE A . n 
A 1 290 ALA 290 430 430 ALA ALA A . n 
A 1 291 LEU 291 431 431 LEU LEU A . n 
A 1 292 LEU 292 432 432 LEU LEU A . n 
A 1 293 ALA 293 433 433 ALA ALA A . n 
A 1 294 TRP 294 434 434 TRP TRP A . n 
A 1 295 THR 295 435 435 THR THR A . n 
A 1 296 GLY 296 436 436 GLY GLY A . n 
A 1 297 SER 297 437 437 SER SER A . n 
A 1 298 LYS 298 438 438 LYS LYS A . n 
A 1 299 LEU 299 439 439 LEU LEU A . n 
A 1 300 PHE 300 440 440 PHE PHE A . n 
A 1 301 GLN 301 441 441 GLN GLN A . n 
A 1 302 ARG 302 442 442 ARG ARG A . n 
A 1 303 GLU 303 443 443 GLU GLU A . n 
A 1 304 LEU 304 444 444 LEU LEU A . n 
A 1 305 ARG 305 445 445 ARG ARG A . n 
A 1 306 ARG 306 446 446 ARG ARG A . n 
A 1 307 PHE 307 447 447 PHE PHE A . n 
A 1 308 SER 308 448 448 SER SER A . n 
A 1 309 ARG 309 449 449 ARG ARG A . n 
A 1 310 LYS 310 450 450 LYS LYS A . n 
A 1 311 GLU 311 451 451 GLU GLU A . n 
A 1 312 LYS 312 452 452 LYS LYS A . n 
A 1 313 GLY 313 453 453 GLY GLY A . n 
A 1 314 LEU 314 454 454 LEU LEU A . n 
A 1 315 TRP 315 455 455 TRP TRP A . n 
A 1 316 LEU 316 456 456 LEU LEU A . n 
A 1 317 ASN 317 457 457 ASN ASN A . n 
A 1 318 SER 318 458 458 SER SER A . n 
A 1 319 HIS 319 459 459 HIS HIS A . n 
A 1 320 GLY 320 460 460 GLY GLY A . n 
A 1 321 LEU 321 461 461 LEU LEU A . n 
A 1 322 PHE 322 462 462 PHE PHE A . n 
A 1 323 ASP 323 463 463 ASP ASP A . n 
A 1 324 PRO 324 464 464 PRO PRO A . n 
A 1 325 GLU 325 465 465 GLU GLU A . n 
A 1 326 GLN 326 466 466 GLN GLN A . n 
A 1 327 LYS 327 467 467 LYS LYS A . n 
A 1 328 THR 328 468 468 THR THR A . n 
A 1 329 PHE 329 469 469 PHE PHE A . n 
A 1 330 PHE 330 470 470 PHE PHE A . n 
A 1 331 GLN 331 471 471 GLN GLN A . n 
A 1 332 ALA 332 472 472 ALA ALA A . n 
A 1 333 ALA 333 473 473 ALA ALA A . n 
A 1 334 SER 334 474 474 SER SER A . n 
A 1 335 GLU 335 475 475 GLU GLU A . n 
A 1 336 GLU 336 476 476 GLU GLU A . n 
A 1 337 ASP 337 477 477 ASP ASP A . n 
A 1 338 ILE 338 478 478 ILE ILE A . n 
A 1 339 PHE 339 479 479 PHE PHE A . n 
A 1 340 ARG 340 480 480 ARG ARG A . n 
A 1 341 HIS 341 481 481 HIS HIS A . n 
A 1 342 LEU 342 482 482 LEU LEU A . n 
A 1 343 GLY 343 483 483 GLY GLY A . n 
A 1 344 LEU 344 484 484 LEU LEU A . n 
A 1 345 GLU 345 485 485 GLU GLU A . n 
A 1 346 TYR 346 486 486 TYR TYR A . n 
A 1 347 LEU 347 487 487 LEU LEU A . n 
A 1 348 PRO 348 488 488 PRO PRO A . n 
A 1 349 PRO 349 489 489 PRO PRO A . n 
A 1 350 GLU 350 490 490 GLU GLU A . n 
A 1 351 GLN 351 491 491 GLN GLN A . n 
A 1 352 ARG 352 492 492 ARG ARG A . n 
A 1 353 ASN 353 493 493 ASN ASN A . n 
A 1 354 ALA 354 494 494 ALA ALA A . n 
B 2 1   DC  1   1   1   DC  DC  T . n 
B 2 2   DG  2   2   2   DG  DG  T . n 
B 2 3   DG  3   3   3   DG  DG  T . n 
B 2 4   DC  4   4   4   DC  DC  T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DA  7   7   7   DA  DA  T . n 
B 2 8   DC  8   8   8   DC  DC  T . n 
B 2 9   DG  9   9   9   DG  DG  T . n 
C 3 1   DC  1   1   1   DC  DC  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DT  3   3   3   DT  DT  P . n 
C 3 4   DA  4   4   4   DA  DA  P . n 
D 4 1   DG  1   1   1   DG  DG  D . n 
D 4 2   DC  2   2   2   DC  DC  D . n 
D 4 3   DC  3   3   3   DC  DC  D . n 
D 4 4   DG  4   4   4   DG  DG  D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5  2KH 1   701  701 2KH ZUN A . 
F 6  MG  1   702  1   MG  MG  A . 
G 6  MG  1   703  2   MG  MG  A . 
H 7  NA  1   704  3   NA  NA  A . 
I 8  CL  1   705  4   CL  CL  A . 
J 9  EDO 1   706  2   EDO EDO A . 
K 10 EPE 1   707  1   EPE EPE A . 
L 11 HOH 1   801  371 HOH HOH A . 
L 11 HOH 2   802  345 HOH HOH A . 
L 11 HOH 3   803  200 HOH HOH A . 
L 11 HOH 4   804  487 HOH HOH A . 
L 11 HOH 5   805  197 HOH HOH A . 
L 11 HOH 6   806  255 HOH HOH A . 
L 11 HOH 7   807  236 HOH HOH A . 
L 11 HOH 8   808  451 HOH HOH A . 
L 11 HOH 9   809  479 HOH HOH A . 
L 11 HOH 10  810  298 HOH HOH A . 
L 11 HOH 11  811  265 HOH HOH A . 
L 11 HOH 12  812  389 HOH HOH A . 
L 11 HOH 13  813  264 HOH HOH A . 
L 11 HOH 14  814  266 HOH HOH A . 
L 11 HOH 15  815  115 HOH HOH A . 
L 11 HOH 16  816  220 HOH HOH A . 
L 11 HOH 17  817  150 HOH HOH A . 
L 11 HOH 18  818  180 HOH HOH A . 
L 11 HOH 19  819  363 HOH HOH A . 
L 11 HOH 20  820  111 HOH HOH A . 
L 11 HOH 21  821  145 HOH HOH A . 
L 11 HOH 22  822  80  HOH HOH A . 
L 11 HOH 23  823  393 HOH HOH A . 
L 11 HOH 24  824  218 HOH HOH A . 
L 11 HOH 25  825  64  HOH HOH A . 
L 11 HOH 26  826  287 HOH HOH A . 
L 11 HOH 27  827  397 HOH HOH A . 
L 11 HOH 28  828  50  HOH HOH A . 
L 11 HOH 29  829  317 HOH HOH A . 
L 11 HOH 30  830  100 HOH HOH A . 
L 11 HOH 31  831  48  HOH HOH A . 
L 11 HOH 32  832  494 HOH HOH A . 
L 11 HOH 33  833  12  HOH HOH A . 
L 11 HOH 34  834  113 HOH HOH A . 
L 11 HOH 35  835  329 HOH HOH A . 
L 11 HOH 36  836  488 HOH HOH A . 
L 11 HOH 37  837  82  HOH HOH A . 
L 11 HOH 38  838  339 HOH HOH A . 
L 11 HOH 39  839  402 HOH HOH A . 
L 11 HOH 40  840  3   HOH HOH A . 
L 11 HOH 41  841  304 HOH HOH A . 
L 11 HOH 42  842  47  HOH HOH A . 
L 11 HOH 43  843  242 HOH HOH A . 
L 11 HOH 44  844  152 HOH HOH A . 
L 11 HOH 45  845  75  HOH HOH A . 
L 11 HOH 46  846  71  HOH HOH A . 
L 11 HOH 47  847  70  HOH HOH A . 
L 11 HOH 48  848  168 HOH HOH A . 
L 11 HOH 49  849  409 HOH HOH A . 
L 11 HOH 50  850  24  HOH HOH A . 
L 11 HOH 51  851  59  HOH HOH A . 
L 11 HOH 52  852  166 HOH HOH A . 
L 11 HOH 53  853  253 HOH HOH A . 
L 11 HOH 54  854  246 HOH HOH A . 
L 11 HOH 55  855  223 HOH HOH A . 
L 11 HOH 56  856  58  HOH HOH A . 
L 11 HOH 57  857  99  HOH HOH A . 
L 11 HOH 58  858  65  HOH HOH A . 
L 11 HOH 59  859  21  HOH HOH A . 
L 11 HOH 60  860  439 HOH HOH A . 
L 11 HOH 61  861  268 HOH HOH A . 
L 11 HOH 62  862  112 HOH HOH A . 
L 11 HOH 63  863  187 HOH HOH A . 
L 11 HOH 64  864  211 HOH HOH A . 
L 11 HOH 65  865  122 HOH HOH A . 
L 11 HOH 66  866  134 HOH HOH A . 
L 11 HOH 67  867  23  HOH HOH A . 
L 11 HOH 68  868  195 HOH HOH A . 
L 11 HOH 69  869  249 HOH HOH A . 
L 11 HOH 70  870  84  HOH HOH A . 
L 11 HOH 71  871  42  HOH HOH A . 
L 11 HOH 72  872  7   HOH HOH A . 
L 11 HOH 73  873  13  HOH HOH A . 
L 11 HOH 74  874  199 HOH HOH A . 
L 11 HOH 75  875  160 HOH HOH A . 
L 11 HOH 76  876  39  HOH HOH A . 
L 11 HOH 77  877  493 HOH HOH A . 
L 11 HOH 78  878  22  HOH HOH A . 
L 11 HOH 79  879  60  HOH HOH A . 
L 11 HOH 80  880  15  HOH HOH A . 
L 11 HOH 81  881  278 HOH HOH A . 
L 11 HOH 82  882  38  HOH HOH A . 
L 11 HOH 83  883  35  HOH HOH A . 
L 11 HOH 84  884  320 HOH HOH A . 
L 11 HOH 85  885  275 HOH HOH A . 
L 11 HOH 86  886  133 HOH HOH A . 
L 11 HOH 87  887  232 HOH HOH A . 
L 11 HOH 88  888  284 HOH HOH A . 
L 11 HOH 89  889  163 HOH HOH A . 
L 11 HOH 90  890  20  HOH HOH A . 
L 11 HOH 91  891  118 HOH HOH A . 
L 11 HOH 92  892  102 HOH HOH A . 
L 11 HOH 93  893  375 HOH HOH A . 
L 11 HOH 94  894  354 HOH HOH A . 
L 11 HOH 95  895  137 HOH HOH A . 
L 11 HOH 96  896  26  HOH HOH A . 
L 11 HOH 97  897  125 HOH HOH A . 
L 11 HOH 98  898  5   HOH HOH A . 
L 11 HOH 99  899  208 HOH HOH A . 
L 11 HOH 100 900  73  HOH HOH A . 
L 11 HOH 101 901  25  HOH HOH A . 
L 11 HOH 102 902  1   HOH HOH A . 
L 11 HOH 103 903  228 HOH HOH A . 
L 11 HOH 104 904  36  HOH HOH A . 
L 11 HOH 105 905  334 HOH HOH A . 
L 11 HOH 106 906  189 HOH HOH A . 
L 11 HOH 107 907  201 HOH HOH A . 
L 11 HOH 108 908  283 HOH HOH A . 
L 11 HOH 109 909  419 HOH HOH A . 
L 11 HOH 110 910  198 HOH HOH A . 
L 11 HOH 111 911  27  HOH HOH A . 
L 11 HOH 112 912  68  HOH HOH A . 
L 11 HOH 113 913  86  HOH HOH A . 
L 11 HOH 114 914  6   HOH HOH A . 
L 11 HOH 115 915  54  HOH HOH A . 
L 11 HOH 116 916  105 HOH HOH A . 
L 11 HOH 117 917  294 HOH HOH A . 
L 11 HOH 118 918  388 HOH HOH A . 
L 11 HOH 119 919  56  HOH HOH A . 
L 11 HOH 120 920  486 HOH HOH A . 
L 11 HOH 121 921  11  HOH HOH A . 
L 11 HOH 122 922  260 HOH HOH A . 
L 11 HOH 123 923  16  HOH HOH A . 
L 11 HOH 124 924  156 HOH HOH A . 
L 11 HOH 125 925  135 HOH HOH A . 
L 11 HOH 126 926  78  HOH HOH A . 
L 11 HOH 127 927  51  HOH HOH A . 
L 11 HOH 128 928  302 HOH HOH A . 
L 11 HOH 129 929  46  HOH HOH A . 
L 11 HOH 130 930  441 HOH HOH A . 
L 11 HOH 131 931  57  HOH HOH A . 
L 11 HOH 132 932  420 HOH HOH A . 
L 11 HOH 133 933  406 HOH HOH A . 
L 11 HOH 134 934  72  HOH HOH A . 
L 11 HOH 135 935  108 HOH HOH A . 
L 11 HOH 136 936  167 HOH HOH A . 
L 11 HOH 137 937  98  HOH HOH A . 
L 11 HOH 138 938  248 HOH HOH A . 
L 11 HOH 139 939  45  HOH HOH A . 
L 11 HOH 140 940  227 HOH HOH A . 
L 11 HOH 141 941  286 HOH HOH A . 
L 11 HOH 142 942  484 HOH HOH A . 
L 11 HOH 143 943  140 HOH HOH A . 
L 11 HOH 144 944  49  HOH HOH A . 
L 11 HOH 145 945  34  HOH HOH A . 
L 11 HOH 146 946  4   HOH HOH A . 
L 11 HOH 147 947  240 HOH HOH A . 
L 11 HOH 148 948  95  HOH HOH A . 
L 11 HOH 149 949  19  HOH HOH A . 
L 11 HOH 150 950  323 HOH HOH A . 
L 11 HOH 151 951  221 HOH HOH A . 
L 11 HOH 152 952  175 HOH HOH A . 
L 11 HOH 153 953  206 HOH HOH A . 
L 11 HOH 154 954  9   HOH HOH A . 
L 11 HOH 155 955  194 HOH HOH A . 
L 11 HOH 156 956  69  HOH HOH A . 
L 11 HOH 157 957  492 HOH HOH A . 
L 11 HOH 158 958  62  HOH HOH A . 
L 11 HOH 159 959  157 HOH HOH A . 
L 11 HOH 160 960  164 HOH HOH A . 
L 11 HOH 161 961  155 HOH HOH A . 
L 11 HOH 162 962  161 HOH HOH A . 
L 11 HOH 163 963  138 HOH HOH A . 
L 11 HOH 164 964  74  HOH HOH A . 
L 11 HOH 165 965  226 HOH HOH A . 
L 11 HOH 166 966  43  HOH HOH A . 
L 11 HOH 167 967  93  HOH HOH A . 
L 11 HOH 168 968  367 HOH HOH A . 
L 11 HOH 169 969  256 HOH HOH A . 
L 11 HOH 170 970  126 HOH HOH A . 
L 11 HOH 171 971  151 HOH HOH A . 
L 11 HOH 172 972  365 HOH HOH A . 
L 11 HOH 173 973  446 HOH HOH A . 
L 11 HOH 174 974  238 HOH HOH A . 
L 11 HOH 175 975  214 HOH HOH A . 
L 11 HOH 176 976  67  HOH HOH A . 
L 11 HOH 177 977  139 HOH HOH A . 
L 11 HOH 178 978  315 HOH HOH A . 
L 11 HOH 179 979  40  HOH HOH A . 
L 11 HOH 180 980  37  HOH HOH A . 
L 11 HOH 181 981  281 HOH HOH A . 
L 11 HOH 182 982  426 HOH HOH A . 
L 11 HOH 183 983  103 HOH HOH A . 
L 11 HOH 184 984  52  HOH HOH A . 
L 11 HOH 185 985  416 HOH HOH A . 
L 11 HOH 186 986  188 HOH HOH A . 
L 11 HOH 187 987  360 HOH HOH A . 
L 11 HOH 188 988  29  HOH HOH A . 
L 11 HOH 189 989  259 HOH HOH A . 
L 11 HOH 190 990  411 HOH HOH A . 
L 11 HOH 191 991  41  HOH HOH A . 
L 11 HOH 192 992  463 HOH HOH A . 
L 11 HOH 193 993  307 HOH HOH A . 
L 11 HOH 194 994  14  HOH HOH A . 
L 11 HOH 195 995  273 HOH HOH A . 
L 11 HOH 196 996  322 HOH HOH A . 
L 11 HOH 197 997  296 HOH HOH A . 
L 11 HOH 198 998  293 HOH HOH A . 
L 11 HOH 199 999  460 HOH HOH A . 
L 11 HOH 200 1000 204 HOH HOH A . 
L 11 HOH 201 1001 182 HOH HOH A . 
L 11 HOH 202 1002 235 HOH HOH A . 
L 11 HOH 203 1003 466 HOH HOH A . 
L 11 HOH 204 1004 90  HOH HOH A . 
L 11 HOH 205 1005 33  HOH HOH A . 
L 11 HOH 206 1006 373 HOH HOH A . 
L 11 HOH 207 1007 269 HOH HOH A . 
L 11 HOH 208 1008 366 HOH HOH A . 
L 11 HOH 209 1009 179 HOH HOH A . 
L 11 HOH 210 1010 489 HOH HOH A . 
L 11 HOH 211 1011 442 HOH HOH A . 
L 11 HOH 212 1012 403 HOH HOH A . 
L 11 HOH 213 1013 85  HOH HOH A . 
L 11 HOH 214 1014 77  HOH HOH A . 
L 11 HOH 215 1015 216 HOH HOH A . 
L 11 HOH 216 1016 490 HOH HOH A . 
L 11 HOH 217 1017 263 HOH HOH A . 
L 11 HOH 218 1018 468 HOH HOH A . 
L 11 HOH 219 1019 318 HOH HOH A . 
L 11 HOH 220 1020 30  HOH HOH A . 
L 11 HOH 221 1021 144 HOH HOH A . 
L 11 HOH 222 1022 31  HOH HOH A . 
L 11 HOH 223 1023 241 HOH HOH A . 
L 11 HOH 224 1024 79  HOH HOH A . 
L 11 HOH 225 1025 141 HOH HOH A . 
L 11 HOH 226 1026 88  HOH HOH A . 
L 11 HOH 227 1027 237 HOH HOH A . 
L 11 HOH 228 1028 362 HOH HOH A . 
L 11 HOH 229 1029 254 HOH HOH A . 
L 11 HOH 230 1030 257 HOH HOH A . 
L 11 HOH 231 1031 109 HOH HOH A . 
L 11 HOH 232 1032 292 HOH HOH A . 
L 11 HOH 233 1033 173 HOH HOH A . 
L 11 HOH 234 1034 170 HOH HOH A . 
L 11 HOH 235 1035 337 HOH HOH A . 
L 11 HOH 236 1036 434 HOH HOH A . 
L 11 HOH 237 1037 230 HOH HOH A . 
L 11 HOH 238 1038 270 HOH HOH A . 
L 11 HOH 239 1039 491 HOH HOH A . 
L 11 HOH 240 1040 146 HOH HOH A . 
L 11 HOH 241 1041 295 HOH HOH A . 
L 11 HOH 242 1042 364 HOH HOH A . 
L 11 HOH 243 1043 348 HOH HOH A . 
L 11 HOH 244 1044 159 HOH HOH A . 
L 11 HOH 245 1045 96  HOH HOH A . 
L 11 HOH 246 1046 392 HOH HOH A . 
L 11 HOH 247 1047 81  HOH HOH A . 
L 11 HOH 248 1048 413 HOH HOH A . 
L 11 HOH 249 1049 61  HOH HOH A . 
L 11 HOH 250 1050 314 HOH HOH A . 
L 11 HOH 251 1051 351 HOH HOH A . 
L 11 HOH 252 1052 385 HOH HOH A . 
L 11 HOH 253 1053 309 HOH HOH A . 
L 11 HOH 254 1054 209 HOH HOH A . 
L 11 HOH 255 1055 401 HOH HOH A . 
L 11 HOH 256 1056 382 HOH HOH A . 
L 11 HOH 257 1057 467 HOH HOH A . 
L 11 HOH 258 1058 128 HOH HOH A . 
L 11 HOH 259 1059 319 HOH HOH A . 
L 11 HOH 260 1060 429 HOH HOH A . 
L 11 HOH 261 1061 331 HOH HOH A . 
L 11 HOH 262 1062 343 HOH HOH A . 
L 11 HOH 263 1063 66  HOH HOH A . 
L 11 HOH 264 1064 290 HOH HOH A . 
L 11 HOH 265 1065 212 HOH HOH A . 
L 11 HOH 266 1066 440 HOH HOH A . 
L 11 HOH 267 1067 272 HOH HOH A . 
L 11 HOH 268 1068 368 HOH HOH A . 
L 11 HOH 269 1069 410 HOH HOH A . 
L 11 HOH 270 1070 455 HOH HOH A . 
L 11 HOH 271 1071 423 HOH HOH A . 
L 11 HOH 272 1072 311 HOH HOH A . 
L 11 HOH 273 1073 312 HOH HOH A . 
L 11 HOH 274 1074 288 HOH HOH A . 
L 11 HOH 275 1075 394 HOH HOH A . 
L 11 HOH 276 1076 225 HOH HOH A . 
L 11 HOH 277 1077 377 HOH HOH A . 
L 11 HOH 278 1078 202 HOH HOH A . 
L 11 HOH 279 1079 341 HOH HOH A . 
L 11 HOH 280 1080 131 HOH HOH A . 
L 11 HOH 281 1081 405 HOH HOH A . 
L 11 HOH 282 1082 279 HOH HOH A . 
L 11 HOH 283 1083 148 HOH HOH A . 
L 11 HOH 284 1084 174 HOH HOH A . 
L 11 HOH 285 1085 404 HOH HOH A . 
L 11 HOH 286 1086 338 HOH HOH A . 
L 11 HOH 287 1087 453 HOH HOH A . 
L 11 HOH 288 1088 495 HOH HOH A . 
L 11 HOH 289 1089 421 HOH HOH A . 
L 11 HOH 290 1090 274 HOH HOH A . 
L 11 HOH 291 1091 350 HOH HOH A . 
L 11 HOH 292 1092 380 HOH HOH A . 
L 11 HOH 293 1093 300 HOH HOH A . 
L 11 HOH 294 1094 407 HOH HOH A . 
L 11 HOH 295 1095 193 HOH HOH A . 
L 11 HOH 296 1096 352 HOH HOH A . 
L 11 HOH 297 1097 408 HOH HOH A . 
L 11 HOH 298 1098 276 HOH HOH A . 
L 11 HOH 299 1099 459 HOH HOH A . 
L 11 HOH 300 1100 356 HOH HOH A . 
L 11 HOH 301 1101 445 HOH HOH A . 
L 11 HOH 302 1102 383 HOH HOH A . 
L 11 HOH 303 1103 414 HOH HOH A . 
L 11 HOH 304 1104 172 HOH HOH A . 
L 11 HOH 305 1105 129 HOH HOH A . 
L 11 HOH 306 1106 303 HOH HOH A . 
L 11 HOH 307 1107 355 HOH HOH A . 
L 11 HOH 308 1108 379 HOH HOH A . 
L 11 HOH 309 1109 390 HOH HOH A . 
L 11 HOH 310 1110 386 HOH HOH A . 
L 11 HOH 311 1111 378 HOH HOH A . 
L 11 HOH 312 1112 176 HOH HOH A . 
L 11 HOH 313 1113 169 HOH HOH A . 
L 11 HOH 314 1114 359 HOH HOH A . 
L 11 HOH 315 1115 192 HOH HOH A . 
L 11 HOH 316 1116 328 HOH HOH A . 
L 11 HOH 317 1117 461 HOH HOH A . 
L 11 HOH 318 1118 335 HOH HOH A . 
L 11 HOH 319 1119 448 HOH HOH A . 
M 11 HOH 1   101  370 HOH HOH T . 
M 11 HOH 2   102  477 HOH HOH T . 
M 11 HOH 3   103  177 HOH HOH T . 
M 11 HOH 4   104  91  HOH HOH T . 
M 11 HOH 5   105  231 HOH HOH T . 
M 11 HOH 6   106  183 HOH HOH T . 
M 11 HOH 7   107  181 HOH HOH T . 
M 11 HOH 8   108  243 HOH HOH T . 
M 11 HOH 9   109  374 HOH HOH T . 
M 11 HOH 10  110  83  HOH HOH T . 
M 11 HOH 11  111  271 HOH HOH T . 
M 11 HOH 12  112  432 HOH HOH T . 
M 11 HOH 13  113  28  HOH HOH T . 
M 11 HOH 14  114  63  HOH HOH T . 
M 11 HOH 15  115  142 HOH HOH T . 
M 11 HOH 16  116  217 HOH HOH T . 
M 11 HOH 17  117  119 HOH HOH T . 
M 11 HOH 18  118  158 HOH HOH T . 
M 11 HOH 19  119  347 HOH HOH T . 
M 11 HOH 20  120  44  HOH HOH T . 
M 11 HOH 21  121  136 HOH HOH T . 
M 11 HOH 22  122  18  HOH HOH T . 
M 11 HOH 23  123  470 HOH HOH T . 
M 11 HOH 24  124  17  HOH HOH T . 
M 11 HOH 25  125  186 HOH HOH T . 
M 11 HOH 26  126  222 HOH HOH T . 
M 11 HOH 27  127  149 HOH HOH T . 
M 11 HOH 28  128  210 HOH HOH T . 
M 11 HOH 29  129  130 HOH HOH T . 
M 11 HOH 30  130  165 HOH HOH T . 
M 11 HOH 31  131  313 HOH HOH T . 
M 11 HOH 32  132  436 HOH HOH T . 
M 11 HOH 33  133  171 HOH HOH T . 
M 11 HOH 34  134  258 HOH HOH T . 
M 11 HOH 35  135  400 HOH HOH T . 
M 11 HOH 36  136  280 HOH HOH T . 
M 11 HOH 37  137  412 HOH HOH T . 
M 11 HOH 38  138  184 HOH HOH T . 
M 11 HOH 39  139  247 HOH HOH T . 
M 11 HOH 40  140  110 HOH HOH T . 
M 11 HOH 41  141  381 HOH HOH T . 
M 11 HOH 42  142  336 HOH HOH T . 
M 11 HOH 43  143  205 HOH HOH T . 
M 11 HOH 44  144  346 HOH HOH T . 
M 11 HOH 45  145  306 HOH HOH T . 
N 11 HOH 1   101  483 HOH HOH P . 
N 11 HOH 2   102  55  HOH HOH P . 
N 11 HOH 3   103  262 HOH HOH P . 
N 11 HOH 4   104  162 HOH HOH P . 
N 11 HOH 5   105  8   HOH HOH P . 
N 11 HOH 6   106  97  HOH HOH P . 
N 11 HOH 7   107  76  HOH HOH P . 
N 11 HOH 8   108  132 HOH HOH P . 
N 11 HOH 9   109  372 HOH HOH P . 
N 11 HOH 10  110  229 HOH HOH P . 
N 11 HOH 11  111  92  HOH HOH P . 
N 11 HOH 12  112  124 HOH HOH P . 
N 11 HOH 13  113  120 HOH HOH P . 
N 11 HOH 14  114  106 HOH HOH P . 
N 11 HOH 15  115  89  HOH HOH P . 
O 11 HOH 1   101  433 HOH HOH D . 
O 11 HOH 2   102  117 HOH HOH D . 
O 11 HOH 3   103  357 HOH HOH D . 
O 11 HOH 4   104  267 HOH HOH D . 
O 11 HOH 5   105  104 HOH HOH D . 
O 11 HOH 6   106  101 HOH HOH D . 
O 11 HOH 7   107  244 HOH HOH D . 
O 11 HOH 8   108  153 HOH HOH D . 
O 11 HOH 9   109  196 HOH HOH D . 
O 11 HOH 10  110  147 HOH HOH D . 
O 11 HOH 11  111  123 HOH HOH D . 
O 11 HOH 12  112  245 HOH HOH D . 
O 11 HOH 13  113  213 HOH HOH D . 
O 11 HOH 14  114  107 HOH HOH D . 
O 11 HOH 15  115  94  HOH HOH D . 
O 11 HOH 16  116  431 HOH HOH D . 
O 11 HOH 17  117  325 HOH HOH D . 
O 11 HOH 18  118  234 HOH HOH D . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4740  ? 
1 MORE         -51   ? 
1 'SSA (A^2)'  16330 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O     ? A THR 113 ? A THR 241 ? 1_555 NA ? H NA . ? A NA 704 ? 1_555 O     ? A ILE 115 ? A ILE 243 ? 1_555 96.0  ? 
2  O     ? A THR 113 ? A THR 241 ? 1_555 NA ? H NA . ? A NA 704 ? 1_555 O     ? A VAL 118 ? A VAL 246 ? 1_555 88.4  ? 
3  O     ? A ILE 115 ? A ILE 243 ? 1_555 NA ? H NA . ? A NA 704 ? 1_555 O     ? A VAL 118 ? A VAL 246 ? 1_555 92.5  ? 
4  O     ? A THR 113 ? A THR 241 ? 1_555 NA ? H NA . ? A NA 704 ? 1_555 OP1   ? C DT  3   ? P DT  3   ? 1_555 171.8 ? 
5  O     ? A ILE 115 ? A ILE 243 ? 1_555 NA ? H NA . ? A NA 704 ? 1_555 OP1   ? C DT  3   ? P DT  3   ? 1_555 92.2  ? 
6  O     ? A VAL 118 ? A VAL 246 ? 1_555 NA ? H NA . ? A NA 704 ? 1_555 OP1   ? C DT  3   ? P DT  3   ? 1_555 90.5  ? 
7  O     ? A THR 113 ? A THR 241 ? 1_555 NA ? H NA . ? A NA 704 ? 1_555 O     A N HOH .   ? P HOH 111 ? 1_555 85.6  ? 
8  O     ? A ILE 115 ? A ILE 243 ? 1_555 NA ? H NA . ? A NA 704 ? 1_555 O     A N HOH .   ? P HOH 111 ? 1_555 174.2 ? 
9  O     ? A VAL 118 ? A VAL 246 ? 1_555 NA ? H NA . ? A NA 704 ? 1_555 O     A N HOH .   ? P HOH 111 ? 1_555 81.9  ? 
10 OP1   ? C DT  3   ? P DT  3   ? 1_555 NA ? H NA . ? A NA 704 ? 1_555 O     A N HOH .   ? P HOH 111 ? 1_555 86.2  ? 
11 O     ? A THR 113 ? A THR 241 ? 1_555 NA ? H NA . ? A NA 704 ? 1_555 O     ? N HOH .   ? P HOH 114 ? 1_555 93.5  ? 
12 O     ? A ILE 115 ? A ILE 243 ? 1_555 NA ? H NA . ? A NA 704 ? 1_555 O     ? N HOH .   ? P HOH 114 ? 1_555 97.8  ? 
13 O     ? A VAL 118 ? A VAL 246 ? 1_555 NA ? H NA . ? A NA 704 ? 1_555 O     ? N HOH .   ? P HOH 114 ? 1_555 169.2 ? 
14 OP1   ? C DT  3   ? P DT  3   ? 1_555 NA ? H NA . ? A NA 704 ? 1_555 O     ? N HOH .   ? P HOH 114 ? 1_555 86.0  ? 
15 O     A N HOH .   ? P HOH 111 ? 1_555 NA ? H NA . ? A NA 704 ? 1_555 O     ? N HOH .   ? P HOH 114 ? 1_555 87.7  ? 
16 OD1   ? A ASP 202 ? A ASP 330 ? 1_555 MG ? G MG . ? A MG 703 ? 1_555 OD2   ? A ASP 204 ? A ASP 332 ? 1_555 93.9  ? 
17 OD1   ? A ASP 202 ? A ASP 330 ? 1_555 MG ? G MG . ? A MG 703 ? 1_555 O2A   ? E 2KH .   ? A 2KH 701 ? 1_555 94.7  ? 
18 OD2   ? A ASP 204 ? A ASP 332 ? 1_555 MG ? G MG . ? A MG 703 ? 1_555 O2A   ? E 2KH .   ? A 2KH 701 ? 1_555 90.0  ? 
19 OD1   ? A ASP 202 ? A ASP 330 ? 1_555 MG ? G MG . ? A MG 703 ? 1_555 O1B   ? E 2KH .   ? A 2KH 701 ? 1_555 173.1 ? 
20 OD2   ? A ASP 204 ? A ASP 332 ? 1_555 MG ? G MG . ? A MG 703 ? 1_555 O1B   ? E 2KH .   ? A 2KH 701 ? 1_555 92.4  ? 
21 O2A   ? E 2KH .   ? A 2KH 701 ? 1_555 MG ? G MG . ? A MG 703 ? 1_555 O1B   ? E 2KH .   ? A 2KH 701 ? 1_555 87.8  ? 
22 OD1   ? A ASP 202 ? A ASP 330 ? 1_555 MG ? G MG . ? A MG 703 ? 1_555 O3G   ? E 2KH .   ? A 2KH 701 ? 1_555 86.2  ? 
23 OD2   ? A ASP 204 ? A ASP 332 ? 1_555 MG ? G MG . ? A MG 703 ? 1_555 O3G   ? E 2KH .   ? A 2KH 701 ? 1_555 178.0 ? 
24 O2A   ? E 2KH .   ? A 2KH 701 ? 1_555 MG ? G MG . ? A MG 703 ? 1_555 O3G   ? E 2KH .   ? A 2KH 701 ? 1_555 92.0  ? 
25 O1B   ? E 2KH .   ? A 2KH 701 ? 1_555 MG ? G MG . ? A MG 703 ? 1_555 O3G   ? E 2KH .   ? A 2KH 701 ? 1_555 87.4  ? 
26 OD1   ? A ASP 202 ? A ASP 330 ? 1_555 MG ? G MG . ? A MG 703 ? 1_555 O     ? L HOH .   ? A HOH 902 ? 1_555 85.7  ? 
27 OD2   ? A ASP 204 ? A ASP 332 ? 1_555 MG ? G MG . ? A MG 703 ? 1_555 O     ? L HOH .   ? A HOH 902 ? 1_555 87.6  ? 
28 O2A   ? E 2KH .   ? A 2KH 701 ? 1_555 MG ? G MG . ? A MG 703 ? 1_555 O     ? L HOH .   ? A HOH 902 ? 1_555 177.6 ? 
29 O1B   ? E 2KH .   ? A 2KH 701 ? 1_555 MG ? G MG . ? A MG 703 ? 1_555 O     ? L HOH .   ? A HOH 902 ? 1_555 92.1  ? 
30 O3G   ? E 2KH .   ? A 2KH 701 ? 1_555 MG ? G MG . ? A MG 703 ? 1_555 O     ? L HOH .   ? A HOH 902 ? 1_555 90.4  ? 
31 OD2   ? A ASP 202 ? A ASP 330 ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 OD1   ? A ASP 204 ? A ASP 332 ? 1_555 100.8 ? 
32 OD2   ? A ASP 202 ? A ASP 330 ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 OD2   ? A ASP 278 ? A ASP 418 ? 1_555 85.4  ? 
33 OD1   ? A ASP 204 ? A ASP 332 ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 OD2   ? A ASP 278 ? A ASP 418 ? 1_555 94.7  ? 
34 OD2   ? A ASP 202 ? A ASP 330 ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 "O3'" A C DA  4   ? P DA  4   ? 1_555 166.1 ? 
35 OD1   ? A ASP 204 ? A ASP 332 ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 "O3'" A C DA  4   ? P DA  4   ? 1_555 87.2  ? 
36 OD2   ? A ASP 278 ? A ASP 418 ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 "O3'" A C DA  4   ? P DA  4   ? 1_555 82.6  ? 
37 OD2   ? A ASP 202 ? A ASP 330 ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 O2A   ? E 2KH .   ? A 2KH 701 ? 1_555 93.7  ? 
38 OD1   ? A ASP 204 ? A ASP 332 ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 O2A   ? E 2KH .   ? A 2KH 701 ? 1_555 91.8  ? 
39 OD2   ? A ASP 278 ? A ASP 418 ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 O2A   ? E 2KH .   ? A 2KH 701 ? 1_555 173.5 ? 
40 "O3'" A C DA  4   ? P DA  4   ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 O2A   ? E 2KH .   ? A 2KH 701 ? 1_555 97.4  ? 
41 OD2   ? A ASP 202 ? A ASP 330 ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 O     B L HOH .   ? A HOH 942 ? 1_555 166.1 ? 
42 OD1   ? A ASP 204 ? A ASP 332 ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 O     B L HOH .   ? A HOH 942 ? 1_555 87.1  ? 
43 OD2   ? A ASP 278 ? A ASP 418 ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 O     B L HOH .   ? A HOH 942 ? 1_555 82.6  ? 
44 "O3'" A C DA  4   ? P DA  4   ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 O     B L HOH .   ? A HOH 942 ? 1_555 0.1   ? 
45 O2A   ? E 2KH .   ? A 2KH 701 ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 O     B L HOH .   ? A HOH 942 ? 1_555 97.4  ? 
46 OD2   ? A ASP 202 ? A ASP 330 ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 O     ? N HOH .   ? P HOH 105 ? 1_555 88.7  ? 
47 OD1   ? A ASP 204 ? A ASP 332 ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 O     ? N HOH .   ? P HOH 105 ? 1_555 170.1 ? 
48 OD2   ? A ASP 278 ? A ASP 418 ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 O     ? N HOH .   ? P HOH 105 ? 1_555 88.8  ? 
49 "O3'" A C DA  4   ? P DA  4   ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 O     ? N HOH .   ? P HOH 105 ? 1_555 84.1  ? 
50 O2A   ? E 2KH .   ? A 2KH 701 ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 O     ? N HOH .   ? P HOH 105 ? 1_555 84.8  ? 
51 O     B L HOH .   ? A HOH 942 ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 O     ? N HOH .   ? P HOH 105 ? 1_555 84.2  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-07-05 
2 'Structure model' 1 1 2017-09-20 
3 'Structure model' 1 2 2017-09-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Author supporting evidence' 
2 3 'Structure model' 'Database references'        
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' pdbx_audit_support 
2 3 'Structure model' citation           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_pdbx_audit_support.funding_organization' 
2 3 'Structure model' '_citation.journal_volume'                 
3 3 'Structure model' '_citation.page_first'                     
4 3 'Structure model' '_citation.page_last'                      
5 3 'Structure model' '_citation.pdbx_database_id_PubMed'        
6 3 'Structure model' '_citation.title'                          
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 12.8626  -18.5987 -14.6161 0.1163 0.1176 0.1141 0.0427  0.0000  -0.0302 1.2405 1.1631 1.4823 
-0.2286 0.2373  -0.3582 0.0213 0.1574  -0.1511 -0.1061 -0.0799 -0.1319 0.1507  0.2477  0.0567  
'X-RAY DIFFRACTION' 2 ? refined 17.1801  7.9784   -16.7285 0.1451 0.1659 0.2122 -0.0160 0.0591  0.0405  0.9608 1.1742 1.7500 
-0.4045 -0.3552 0.7881  0.0939 0.1442  0.1945  -0.2958 -0.0182 -0.3216 -0.2565 0.1448  -0.0384 
'X-RAY DIFFRACTION' 3 ? refined -2.0595  8.7709   -0.7118  0.0755 0.0762 0.1064 -0.0074 0.0060  -0.0229 1.6205 1.4855 0.5195 
-0.2664 -0.0564 0.0282  0.0463 -0.1206 0.3229  0.1253  -0.0310 -0.0438 -0.1026 -0.0335 -0.0063 
'X-RAY DIFFRACTION' 4 ? refined -11.3440 -10.3251 -11.4058 0.0593 0.0895 0.0815 -0.0095 -0.0167 -0.0191 1.4437 1.5544 1.5244 
-0.2088 -0.3436 0.2346  0.0269 0.2196  -0.1804 -0.1039 -0.0548 0.2335  0.0794  -0.2208 -0.0168 
'X-RAY DIFFRACTION' 5 ? refined 0.2415   -8.8969  -23.3463 0.1486 0.1767 0.0457 0.0181  -0.0258 -0.0220 0.7826 0.8391 0.3986 
0.1212  -0.0206 -0.0139 0.1332 0.3576  -0.1321 -0.2934 -0.1612 0.1106  0.0228  -0.1088 -0.0258 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? 'chain A and resid 137:231'     
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? 'chain A and resid 232:289'     
'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? 'chain A and resid 290:423'     
'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? 'chain A and resid 424:494'     
'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? 'chain T or chain P or chain D' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? '(1.10.1_2155)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .               2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .               3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .               4 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 "O3'" P DT 3 ? ? "C3'" P DT 3 ? ? 1.360 1.419 -0.059 0.006 N 
2 1 P     D DG 1 ? ? OP3   D DG 1 ? ? 1.485 1.607 -0.122 0.012 N 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             "O4'" 
_pdbx_validate_rmsd_angle.auth_asym_id_1             T 
_pdbx_validate_rmsd_angle.auth_comp_id_1             DC 
_pdbx_validate_rmsd_angle.auth_seq_id_1              4 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             "C1'" 
_pdbx_validate_rmsd_angle.auth_asym_id_2             T 
_pdbx_validate_rmsd_angle.auth_comp_id_2             DC 
_pdbx_validate_rmsd_angle.auth_seq_id_2              4 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             N1 
_pdbx_validate_rmsd_angle.auth_asym_id_3             T 
_pdbx_validate_rmsd_angle.auth_comp_id_3             DC 
_pdbx_validate_rmsd_angle.auth_seq_id_3              4 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                110.78 
_pdbx_validate_rmsd_angle.angle_target_value         108.30 
_pdbx_validate_rmsd_angle.angle_deviation            2.48 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 THR A 318 ? A -124.03 -150.03 
2 1 THR A 318 ? B -129.44 -157.39 
3 1 PRO A 397 ? ? -53.67  109.76  
4 1 SER A 411 ? ? -164.42 -144.08 
5 1 ASN A 493 ? ? -87.81  49.96   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 170 ? CD  ? A GLU 42  CD  
2  1 Y 1 A GLU 170 ? OE1 ? A GLU 42  OE1 
3  1 Y 1 A GLU 170 ? OE2 ? A GLU 42  OE2 
4  1 Y 1 A GLN 200 ? CD  ? A GLN 72  CD  
5  1 Y 1 A GLN 200 ? OE1 ? A GLN 72  OE1 
6  1 Y 1 A GLN 200 ? NE2 ? A GLN 72  NE2 
7  1 Y 1 A GLU 207 ? CD  ? A GLU 79  CD  
8  1 Y 1 A GLU 207 ? OE1 ? A GLU 79  OE1 
9  1 Y 1 A GLU 207 ? OE2 ? A GLU 79  OE2 
10 1 Y 1 A ARG 211 ? NE  ? A ARG 83  NE  
11 1 Y 1 A ARG 211 ? CZ  ? A ARG 83  CZ  
12 1 Y 1 A ARG 211 ? NH1 ? A ARG 83  NH1 
13 1 Y 1 A ARG 211 ? NH2 ? A ARG 83  NH2 
14 1 Y 1 A GLU 218 ? CG  ? A GLU 90  CG  
15 1 Y 1 A GLU 218 ? CD  ? A GLU 90  CD  
16 1 Y 1 A GLU 218 ? OE1 ? A GLU 90  OE1 
17 1 Y 1 A GLU 218 ? OE2 ? A GLU 90  OE2 
18 1 Y 1 A GLU 223 ? CD  ? A GLU 95  CD  
19 1 Y 1 A GLU 223 ? OE1 ? A GLU 95  OE1 
20 1 Y 1 A GLU 223 ? OE2 ? A GLU 95  OE2 
21 1 Y 1 A GLU 267 ? CG  ? A GLU 139 CG  
22 1 Y 1 A GLU 267 ? CD  ? A GLU 139 CD  
23 1 Y 1 A GLU 267 ? OE1 ? A GLU 139 OE1 
24 1 Y 1 A GLU 267 ? OE2 ? A GLU 139 OE2 
25 1 Y 1 A GLN 268 ? CG  ? A GLN 140 CG  
26 1 Y 1 A GLN 268 ? CD  ? A GLN 140 CD  
27 1 Y 1 A GLN 268 ? OE1 ? A GLN 140 OE1 
28 1 Y 1 A GLN 268 ? NE2 ? A GLN 140 NE2 
29 1 Y 1 A GLN 270 ? CG  ? A GLN 142 CG  
30 1 Y 1 A GLN 270 ? CD  ? A GLN 142 CD  
31 1 Y 1 A GLN 270 ? OE1 ? A GLN 142 OE1 
32 1 Y 1 A GLN 270 ? NE2 ? A GLN 142 NE2 
33 1 Y 1 A LYS 271 ? CG  ? A LYS 143 CG  
34 1 Y 1 A LYS 271 ? CD  ? A LYS 143 CD  
35 1 Y 1 A LYS 271 ? CE  ? A LYS 143 CE  
36 1 Y 1 A LYS 271 ? NZ  ? A LYS 143 NZ  
37 1 Y 1 A GLN 274 ? CG  ? A GLN 146 CG  
38 1 Y 1 A GLN 274 ? CD  ? A GLN 146 CD  
39 1 Y 1 A GLN 274 ? OE1 ? A GLN 146 OE1 
40 1 Y 1 A GLN 274 ? NE2 ? A GLN 146 NE2 
41 1 Y 1 A GLN 284 ? CD  ? A GLN 156 CD  
42 1 Y 1 A GLN 284 ? OE1 ? A GLN 156 OE1 
43 1 Y 1 A GLN 284 ? NE2 ? A GLN 156 NE2 
44 1 Y 1 A SER 293 ? OG  ? A SER 165 OG  
45 1 Y 1 A ASP 296 ? CG  ? A ASP 168 CG  
46 1 Y 1 A ASP 296 ? OD1 ? A ASP 168 OD1 
47 1 Y 1 A ASP 296 ? OD2 ? A ASP 168 OD2 
48 1 Y 1 A GLN 300 ? CD  ? A GLN 172 CD  
49 1 Y 1 A GLN 300 ? OE1 ? A GLN 172 OE1 
50 1 Y 1 A GLN 300 ? NE2 ? A GLN 172 NE2 
51 1 Y 1 A GLU 304 ? CD  ? A GLU 176 CD  
52 1 Y 1 A GLU 304 ? OE1 ? A GLU 176 OE1 
53 1 Y 1 A GLU 304 ? OE2 ? A GLU 176 OE2 
54 1 Y 1 A LYS 339 ? CD  ? A LYS 211 CD  
55 1 Y 1 A LYS 339 ? CE  ? A LYS 211 CE  
56 1 Y 1 A LYS 339 ? NZ  ? A LYS 211 NZ  
57 1 Y 1 A GLN 355 ? CD  ? A GLN 227 CD  
58 1 Y 1 A GLN 355 ? OE1 ? A GLN 227 OE1 
59 1 Y 1 A GLN 355 ? NE2 ? A GLN 227 NE2 
60 1 Y 1 A ASP 356 ? CG  ? A ASP 228 CG  
61 1 Y 1 A ASP 356 ? OD1 ? A ASP 228 OD1 
62 1 Y 1 A ASP 356 ? OD2 ? A ASP 228 OD2 
63 1 Y 1 A GLN 357 ? OE1 ? A GLN 229 OE1 
64 1 Y 1 A GLN 357 ? NE2 ? A GLN 229 NE2 
65 1 Y 1 A HIS 363 ? ND1 ? A HIS 235 ND1 
66 1 Y 1 A HIS 363 ? CD2 ? A HIS 235 CD2 
67 1 Y 1 A HIS 363 ? CE1 ? A HIS 235 CE1 
68 1 Y 1 A HIS 363 ? NE2 ? A HIS 235 NE2 
69 1 Y 1 A GLN 364 ? CG  ? A GLN 236 CG  
70 1 Y 1 A GLN 364 ? CD  ? A GLN 236 CD  
71 1 Y 1 A GLN 364 ? OE1 ? A GLN 236 OE1 
72 1 Y 1 A GLN 364 ? NE2 ? A GLN 236 NE2 
73 1 Y 1 A GLU 465 ? CG  ? A GLU 325 CG  
74 1 Y 1 A GLU 465 ? CD  ? A GLU 325 CD  
75 1 Y 1 A GLU 465 ? OE1 ? A GLU 325 OE1 
76 1 Y 1 A GLU 465 ? OE2 ? A GLU 325 OE2 
77 1 Y 1 A LYS 467 ? CD  ? A LYS 327 CD  
78 1 Y 1 A LYS 467 ? CE  ? A LYS 327 CE  
79 1 Y 1 A LYS 467 ? NZ  ? A LYS 327 NZ  
80 1 Y 1 A GLU 485 ? CD  ? A GLU 345 CD  
81 1 Y 1 A GLU 485 ? OE1 ? A GLU 345 OE1 
82 1 Y 1 A GLU 485 ? OE2 ? A GLU 345 OE2 
83 1 N 1 A EPE 707 ? C2  ? K EPE 1   C2  
84 1 N 1 A EPE 707 ? C3  ? K EPE 1   C3  
85 1 N 1 A EPE 707 ? C7  ? K EPE 1   C7  
86 1 N 1 A EPE 707 ? C8  ? K EPE 1   C8  
87 1 N 1 A EPE 707 ? O8  ? K EPE 1   O8  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 129 ? A GLY 1   
2  1 Y 1 A SER 130 ? A SER 2   
3  1 Y 1 A ALA 131 ? A ALA 3   
4  1 Y 1 A ALA 132 ? A ALA 4   
5  1 Y 1 A ALA 133 ? A ALA 5   
6  1 Y 1 A SER 134 ? A SER 6   
7  1 Y 1 A PRO 135 ? A PRO 7   
8  1 Y 1 A ALA 136 ? A ALA 8   
9  1 Y 1 A TRP 137 ? A TRP 9   
10 1 Y 1 A GLN 366 ? A GLN 238 
11 1 Y 1 A HIS 367 ? A HIS 239 
12 1 Y 1 A SER 368 ? A SER 240 
13 1 Y 1 A CYS 369 ? A CYS 241 
14 1 Y 1 A CYS 370 ? A CYS 242 
15 1 Y 1 A GLU 371 ? A GLU 243 
16 1 Y 1 A SER 372 ? A SER 244 
17 1 Y 1 A PRO 373 ? A PRO 245 
18 1 Y 1 A THR 374 ? A THR 246 
19 1 Y 1 A ARG 375 ? A ARG 247 
20 1 Y 1 A LEU 376 ? A LEU 248 
21 1 Y 1 A ALA 377 ? A ALA 249 
22 1 Y 1 A GLN 378 ? A GLN 250 
23 1 Y 1 A GLN 379 ? A GLN 251 
24 1 Y 1 A SER 380 ? A SER 252 
25 1 Y 1 A HIS 381 ? A HIS 253 
26 1 Y 1 A MET 382 ? A MET 254 
27 1 Y 1 A ASP 383 ? A ASP 255 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5VZ7 'double helix'        
5VZ7 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DC 1 1_555 D DG 4 1_555 0.455  -0.286 0.312  -11.074 -10.844 -6.996 1 T_DC1:DG4_D T 1 ? D 4 ? 19 1 
1 B DG 2 1_555 D DC 3 1_555 -0.253 -0.004 0.208  -0.142  -10.488 1.764  2 T_DG2:DC3_D T 2 ? D 3 ? 19 1 
1 B DG 3 1_555 D DC 2 1_555 -0.224 -0.177 0.111  -0.215  -9.060  -2.671 3 T_DG3:DC2_D T 3 ? D 2 ? 19 1 
1 B DC 4 1_555 D DG 1 1_555 0.256  -0.099 -0.261 13.073  2.618   -0.969 4 T_DC4:DG1_D T 4 ? D 1 ? 19 1 
1 B DT 6 1_555 C DA 4 1_555 0.397  -0.211 -0.123 1.517   -3.291  6.542  5 T_DT6:DA4_P T 6 ? P 4 ? 20 1 
1 B DA 7 1_555 C DT 3 1_555 0.123  -0.149 0.176  14.514  -4.803  2.504  6 T_DA7:DT3_P T 7 ? P 3 ? 20 1 
1 B DC 8 1_555 C DG 2 1_555 0.289  -0.159 -0.105 15.523  -13.993 -0.456 7 T_DC8:DG2_P T 8 ? P 2 ? 19 1 
1 B DG 9 1_555 C DC 1 1_555 -0.145 -0.142 0.039  -1.767  -10.422 -0.405 8 T_DG9:DC1_P T 9 ? P 1 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DC 1 1_555 D DG 4 1_555 B DG 2 1_555 D DC 3 1_555 -0.210 0.432  3.177 2.360  7.308 29.310 -0.628 0.872  3.163 14.138 -4.566 
30.278 1 TT_DC1DG2:DC3DG4_DD T 1 ? D 4 ? T 2 ? D 3 ? 
1 B DG 2 1_555 D DC 3 1_555 B DG 3 1_555 D DC 2 1_555 0.563  -0.055 3.407 -0.776 4.123 34.977 -0.728 -1.050 3.366 6.829  1.285  
35.220 2 TT_DG2DG3:DC2DC3_DD T 2 ? D 3 ? T 3 ? D 2 ? 
1 B DG 3 1_555 D DC 2 1_555 B DC 4 1_555 D DG 1 1_555 0.449  0.078  3.051 4.269  3.243 26.652 -0.604 0.059  3.071 6.945  -9.143 
27.176 3 TT_DG3DC4:DG1DC2_DD T 3 ? D 2 ? T 4 ? D 1 ? 
1 B DT 6 1_555 C DA 4 1_555 B DA 7 1_555 C DT 3 1_555 0.145  -0.759 3.133 -1.534 8.633 26.571 -3.460 -0.637 2.743 18.165 3.227  
27.956 4 TT_DT6DA7:DT3DA4_PP T 6 ? P 4 ? T 7 ? P 3 ? 
1 B DA 7 1_555 C DT 3 1_555 B DC 8 1_555 C DG 2 1_555 -0.624 -0.902 3.385 -1.254 0.081 34.960 -1.513 0.841  3.402 0.135  2.086  
34.982 5 TT_DA7DC8:DG2DT3_PP T 7 ? P 3 ? T 8 ? P 2 ? 
1 B DC 8 1_555 C DG 2 1_555 B DG 9 1_555 C DC 1 1_555 -0.741 -1.133 3.598 -5.756 8.706 36.973 -2.899 0.351  3.331 13.404 8.861  
38.368 6 TT_DC8DG9:DC1DG2_PP T 8 ? P 2 ? T 9 ? P 1 ? 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Institute of Environmental Health Sciences' 'United States' '1ZIA ES 102645'  1 
'National Institutes of Health/National Institute of Environmental Health Sciences' 'United States' 'Z01 ES065070'    2 
'American Cancer Society'                                                           'United States' PF-14-0438-01-DMC 3 
'National Institutes of Health/National Cancer Institute'                           'United States' CA097096          4 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5  "5'-O-[(S)-hydroxy{[(S)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]uridine" 2KH 
6  'MAGNESIUM ION'                                                                   MG  
7  'SODIUM ION'                                                                      NA  
8  'CHLORIDE ION'                                                                    CL  
9  1,2-ETHANEDIOL                                                                    EDO 
10 '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID'                             EPE 
11 water                                                                             HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#