data_5VZH
# 
_entry.id   5VZH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5VZH         
WWPDB D_1000228192 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 5TWP unspecified 
PDB . 5TWQ unspecified 
PDB . 5TWR unspecified 
PDB . 5TWS unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5VZH 
_pdbx_database_status.recvd_initial_deposition_date   2017-05-27 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Moon, A.F.'     1 ? 
'Pryor, J.M.'    2 ? 
'Ramsden, D.A.'  3 ? 
'Kunkel, T.A.'   4 ? 
'Bebenek, K.'    5 ? 
'Pedersen, L.C.' 6 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            45 
_citation.language                  ? 
_citation.page_first                9138 
_citation.page_last                 9148 
_citation.title                     
'Structural accommodation of ribonucleotide incorporation by the DNA repair enzyme polymerase Mu.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gkx527 
_citation.pdbx_database_id_PubMed   28911097 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Moon, A.F.'     1 
primary 'Pryor, J.M.'    2 
primary 'Ramsden, D.A.'  3 
primary 'Kunkel, T.A.'   4 
primary 'Bebenek, K.'    5 
primary 'Pedersen, L.C.' 6 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5VZH 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     59.637 
_cell.length_a_esd                 ? 
_cell.length_b                     68.722 
_cell.length_b_esd                 ? 
_cell.length_c                     109.404 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5VZH 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'DNA-directed DNA/RNA polymerase mu'        39796.094 1   2.7.7.7 W434H 'UNP residues 134-494' ? 
2  polymer     syn 
;DNA (5'-D(*CP*GP*GP*CP*AP*TP*AP*CP*G)-3')
;
2740.812  1   ?       ?     ?                      ? 
3  polymer     syn 
;DNA/RNA (5'-D(*CP*GP*TP*A)-R(P*U)-3')
;
1496.996  1   ?       ?     ?                      ? 
4  polymer     syn 
;DNA (5'-D(P*GP*CP*CP*G)-3')
;
1191.818  1   ?       ?     ?                      ? 
5  non-polymer syn 'MAGNESIUM ION'                             24.305    2   ?       ?     ?                      ? 
6  non-polymer syn 'SODIUM ION'                                22.990    1   ?       ?     ?                      ? 
7  non-polymer syn 'CHLORIDE ION'                              35.453    2   ?       ?     ?                      ? 
8  non-polymer syn 
;URIDINE 5'-TRIPHOSPHATE
;
484.141   1   ?       ?     ?                      ? 
9  non-polymer syn 'GLYCOLIC ACID'                             76.051    1   ?       ?     ?                      ? 
10 non-polymer syn 1,2-ETHANEDIOL                              62.068    1   ?       ?     ?                      ? 
11 water       nat water                                       18.015    258 ?       ?     ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Pol Mu,Terminal transferase' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'                                    no no 
;GSAAASPAWMPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLKALPSPVTTLSQLQGLPHFGEH
SSRVVQELLEHGVCEEVERVRRSERYQTMKLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDLST
PVLRSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLITHPKEGQEAGLLPRVMCRLQDQGLILYHQHQHS
CCESPTRLAQQSHMDAFERSFCIFRLPQPGSWKAVRVDLVVAPVSQFPFALLGHTGSKLFQRELRRFSRKEKGLWLNSHG
LFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRNA
;
;GSAAASPAWMPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLKALPSPVTTLSQLQGLPHFGEH
SSRVVQELLEHGVCEEVERVRRSERYQTMKLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDLST
PVLRSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLITHPKEGQEAGLLPRVMCRLQDQGLILYHQHQHS
CCESPTRLAQQSHMDAFERSFCIFRLPQPGSWKAVRVDLVVAPVSQFPFALLGHTGSKLFQRELRRFSRKEKGLWLNSHG
LFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRNA
;
A ? 
2 polydeoxyribonucleotide                             no no '(DC)(DG)(DG)(DC)(DA)(DT)(DA)(DC)(DG)' CGGCATACG T ? 
3 'polydeoxyribonucleotide/polyribonucleotide hybrid' no no '(DC)(DG)(DT)(DA)U' CGTAU P ? 
4 polydeoxyribonucleotide                             no no '(DG)(DC)(DC)(DG)' GCCG D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   ALA n 
1 4   ALA n 
1 5   ALA n 
1 6   SER n 
1 7   PRO n 
1 8   ALA n 
1 9   TRP n 
1 10  MET n 
1 11  PRO n 
1 12  ALA n 
1 13  TYR n 
1 14  ALA n 
1 15  CYS n 
1 16  GLN n 
1 17  ARG n 
1 18  PRO n 
1 19  THR n 
1 20  PRO n 
1 21  LEU n 
1 22  THR n 
1 23  HIS n 
1 24  HIS n 
1 25  ASN n 
1 26  THR n 
1 27  GLY n 
1 28  LEU n 
1 29  SER n 
1 30  GLU n 
1 31  ALA n 
1 32  LEU n 
1 33  GLU n 
1 34  ILE n 
1 35  LEU n 
1 36  ALA n 
1 37  GLU n 
1 38  ALA n 
1 39  ALA n 
1 40  GLY n 
1 41  PHE n 
1 42  GLU n 
1 43  GLY n 
1 44  SER n 
1 45  GLU n 
1 46  GLY n 
1 47  ARG n 
1 48  LEU n 
1 49  LEU n 
1 50  THR n 
1 51  PHE n 
1 52  CYS n 
1 53  ARG n 
1 54  ALA n 
1 55  ALA n 
1 56  SER n 
1 57  VAL n 
1 58  LEU n 
1 59  LYS n 
1 60  ALA n 
1 61  LEU n 
1 62  PRO n 
1 63  SER n 
1 64  PRO n 
1 65  VAL n 
1 66  THR n 
1 67  THR n 
1 68  LEU n 
1 69  SER n 
1 70  GLN n 
1 71  LEU n 
1 72  GLN n 
1 73  GLY n 
1 74  LEU n 
1 75  PRO n 
1 76  HIS n 
1 77  PHE n 
1 78  GLY n 
1 79  GLU n 
1 80  HIS n 
1 81  SER n 
1 82  SER n 
1 83  ARG n 
1 84  VAL n 
1 85  VAL n 
1 86  GLN n 
1 87  GLU n 
1 88  LEU n 
1 89  LEU n 
1 90  GLU n 
1 91  HIS n 
1 92  GLY n 
1 93  VAL n 
1 94  CYS n 
1 95  GLU n 
1 96  GLU n 
1 97  VAL n 
1 98  GLU n 
1 99  ARG n 
1 100 VAL n 
1 101 ARG n 
1 102 ARG n 
1 103 SER n 
1 104 GLU n 
1 105 ARG n 
1 106 TYR n 
1 107 GLN n 
1 108 THR n 
1 109 MET n 
1 110 LYS n 
1 111 LEU n 
1 112 PHE n 
1 113 THR n 
1 114 GLN n 
1 115 ILE n 
1 116 PHE n 
1 117 GLY n 
1 118 VAL n 
1 119 GLY n 
1 120 VAL n 
1 121 LYS n 
1 122 THR n 
1 123 ALA n 
1 124 ASP n 
1 125 ARG n 
1 126 TRP n 
1 127 TYR n 
1 128 ARG n 
1 129 GLU n 
1 130 GLY n 
1 131 LEU n 
1 132 ARG n 
1 133 THR n 
1 134 LEU n 
1 135 ASP n 
1 136 ASP n 
1 137 LEU n 
1 138 ARG n 
1 139 GLU n 
1 140 GLN n 
1 141 PRO n 
1 142 GLN n 
1 143 LYS n 
1 144 LEU n 
1 145 THR n 
1 146 GLN n 
1 147 GLN n 
1 148 GLN n 
1 149 LYS n 
1 150 ALA n 
1 151 GLY n 
1 152 LEU n 
1 153 GLN n 
1 154 HIS n 
1 155 HIS n 
1 156 GLN n 
1 157 ASP n 
1 158 LEU n 
1 159 SER n 
1 160 THR n 
1 161 PRO n 
1 162 VAL n 
1 163 LEU n 
1 164 ARG n 
1 165 SER n 
1 166 ASP n 
1 167 VAL n 
1 168 ASP n 
1 169 ALA n 
1 170 LEU n 
1 171 GLN n 
1 172 GLN n 
1 173 VAL n 
1 174 VAL n 
1 175 GLU n 
1 176 GLU n 
1 177 ALA n 
1 178 VAL n 
1 179 GLY n 
1 180 GLN n 
1 181 ALA n 
1 182 LEU n 
1 183 PRO n 
1 184 GLY n 
1 185 ALA n 
1 186 THR n 
1 187 VAL n 
1 188 THR n 
1 189 LEU n 
1 190 THR n 
1 191 GLY n 
1 192 GLY n 
1 193 PHE n 
1 194 ARG n 
1 195 ARG n 
1 196 GLY n 
1 197 LYS n 
1 198 LEU n 
1 199 GLN n 
1 200 GLY n 
1 201 HIS n 
1 202 ASP n 
1 203 VAL n 
1 204 ASP n 
1 205 PHE n 
1 206 LEU n 
1 207 ILE n 
1 208 THR n 
1 209 HIS n 
1 210 PRO n 
1 211 LYS n 
1 212 GLU n 
1 213 GLY n 
1 214 GLN n 
1 215 GLU n 
1 216 ALA n 
1 217 GLY n 
1 218 LEU n 
1 219 LEU n 
1 220 PRO n 
1 221 ARG n 
1 222 VAL n 
1 223 MET n 
1 224 CYS n 
1 225 ARG n 
1 226 LEU n 
1 227 GLN n 
1 228 ASP n 
1 229 GLN n 
1 230 GLY n 
1 231 LEU n 
1 232 ILE n 
1 233 LEU n 
1 234 TYR n 
1 235 HIS n 
1 236 GLN n 
1 237 HIS n 
1 238 GLN n 
1 239 HIS n 
1 240 SER n 
1 241 CYS n 
1 242 CYS n 
1 243 GLU n 
1 244 SER n 
1 245 PRO n 
1 246 THR n 
1 247 ARG n 
1 248 LEU n 
1 249 ALA n 
1 250 GLN n 
1 251 GLN n 
1 252 SER n 
1 253 HIS n 
1 254 MET n 
1 255 ASP n 
1 256 ALA n 
1 257 PHE n 
1 258 GLU n 
1 259 ARG n 
1 260 SER n 
1 261 PHE n 
1 262 CYS n 
1 263 ILE n 
1 264 PHE n 
1 265 ARG n 
1 266 LEU n 
1 267 PRO n 
1 268 GLN n 
1 269 PRO n 
1 270 GLY n 
1 271 SER n 
1 272 TRP n 
1 273 LYS n 
1 274 ALA n 
1 275 VAL n 
1 276 ARG n 
1 277 VAL n 
1 278 ASP n 
1 279 LEU n 
1 280 VAL n 
1 281 VAL n 
1 282 ALA n 
1 283 PRO n 
1 284 VAL n 
1 285 SER n 
1 286 GLN n 
1 287 PHE n 
1 288 PRO n 
1 289 PHE n 
1 290 ALA n 
1 291 LEU n 
1 292 LEU n 
1 293 GLY n 
1 294 HIS n 
1 295 THR n 
1 296 GLY n 
1 297 SER n 
1 298 LYS n 
1 299 LEU n 
1 300 PHE n 
1 301 GLN n 
1 302 ARG n 
1 303 GLU n 
1 304 LEU n 
1 305 ARG n 
1 306 ARG n 
1 307 PHE n 
1 308 SER n 
1 309 ARG n 
1 310 LYS n 
1 311 GLU n 
1 312 LYS n 
1 313 GLY n 
1 314 LEU n 
1 315 TRP n 
1 316 LEU n 
1 317 ASN n 
1 318 SER n 
1 319 HIS n 
1 320 GLY n 
1 321 LEU n 
1 322 PHE n 
1 323 ASP n 
1 324 PRO n 
1 325 GLU n 
1 326 GLN n 
1 327 LYS n 
1 328 THR n 
1 329 PHE n 
1 330 PHE n 
1 331 GLN n 
1 332 ALA n 
1 333 ALA n 
1 334 SER n 
1 335 GLU n 
1 336 GLU n 
1 337 ASP n 
1 338 ILE n 
1 339 PHE n 
1 340 ARG n 
1 341 HIS n 
1 342 LEU n 
1 343 GLY n 
1 344 LEU n 
1 345 GLU n 
1 346 TYR n 
1 347 LEU n 
1 348 PRO n 
1 349 PRO n 
1 350 GLU n 
1 351 GLN n 
1 352 ARG n 
1 353 ASN n 
1 354 ALA n 
2 1   DC  n 
2 2   DG  n 
2 3   DG  n 
2 4   DC  n 
2 5   DA  n 
2 6   DT  n 
2 7   DA  n 
2 8   DC  n 
2 9   DG  n 
3 1   DC  n 
3 2   DG  n 
3 3   DT  n 
3 4   DA  n 
3 5   U   n 
4 1   DG  n 
4 2   DC  n 
4 3   DC  n 
4 4   DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   354 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLM, polmu' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEXM 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 9 'synthetic construct' ? 32630 ? 
3 1 sample 1 5 'synthetic construct' ? 32630 ? 
4 1 sample 1 4 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP DPOLM_HUMAN Q9NP87 ? 1 
;SPAWMPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLKALPSPVTTLSQLQGLPHFGEHSSRVV
QELLEHGVCEEVERVRRSERYQTMKLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDLSTPVLRS
DVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLITHPKEGQEAGLLPRVMCRLQDQGLILYHQHQHSCCESP
TRLAQQSHMDAFERSFCIFRLPQPPGAAVGGSTRPCPSWKAVRVDLVVAPVSQFPFALLGWTGSKLFQRELRRFSRKEKG
LWLNSHGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRNA
;
134 
2 PDB 5VZH        5VZH   ? 2 ? 1   
3 PDB 5VZH        5VZH   ? 3 ? 1   
4 PDB 5VZH        5VZH   ? 4 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5VZH A 6 ? 354 ? Q9NP87 134 ? 494 ? 134 494 
2 2 5VZH T 1 ? 9   ? 5VZH   1   ? 9   ? 1   9   
3 3 5VZH P 1 ? 5   ? 5VZH   1   ? 5   ? 1   5   
4 4 5VZH D 1 ? 4   ? 5VZH   1   ? 4   ? 1   4   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5VZH GLY A 1   ? UNP Q9NP87 ?   ?   'expression tag'      129 1  
1 5VZH SER A 2   ? UNP Q9NP87 ?   ?   'expression tag'      130 2  
1 5VZH ALA A 3   ? UNP Q9NP87 ?   ?   'expression tag'      131 3  
1 5VZH ALA A 4   ? UNP Q9NP87 ?   ?   'expression tag'      132 4  
1 5VZH ALA A 5   ? UNP Q9NP87 ?   ?   'expression tag'      133 5  
1 5VZH ?   A ?   ? UNP Q9NP87 PRO 398 deletion              ?   6  
1 5VZH ?   A ?   ? UNP Q9NP87 GLY 399 deletion              ?   7  
1 5VZH ?   A ?   ? UNP Q9NP87 ALA 400 deletion              ?   8  
1 5VZH ?   A ?   ? UNP Q9NP87 ALA 401 deletion              ?   9  
1 5VZH ?   A ?   ? UNP Q9NP87 VAL 402 deletion              ?   10 
1 5VZH ?   A ?   ? UNP Q9NP87 GLY 403 deletion              ?   11 
1 5VZH ?   A ?   ? UNP Q9NP87 GLY 404 deletion              ?   12 
1 5VZH ?   A ?   ? UNP Q9NP87 SER 405 deletion              ?   13 
1 5VZH ?   A ?   ? UNP Q9NP87 THR 406 deletion              ?   14 
1 5VZH ?   A ?   ? UNP Q9NP87 ARG 407 deletion              ?   15 
1 5VZH ?   A ?   ? UNP Q9NP87 PRO 408 deletion              ?   16 
1 5VZH ?   A ?   ? UNP Q9NP87 CYS 409 deletion              ?   17 
1 5VZH GLY A 270 ? UNP Q9NP87 PRO 410 linker                410 18 
1 5VZH HIS A 294 ? UNP Q9NP87 TRP 434 'engineered mutation' 434 19 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                                          'C3 H7 N O2'       
89.093  
ARG 'L-peptide linking' y ARGININE                             ?                                          'C6 H15 N4 O2 1'   
175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                                          'C4 H8 N2 O3'      
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                                          'C4 H7 N O4'       
133.103 
CL  non-polymer         . 'CHLORIDE ION'                       ?                                          'Cl -1'            
35.453  
CYS 'L-peptide linking' y CYSTEINE                             ?                                          'C3 H7 N O2 S'     
121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                                          'C10 H14 N5 O6 P'  
331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                                          'C9 H14 N3 O7 P'   
307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                                          'C10 H14 N5 O7 P'  
347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                                          'C10 H15 N2 O8 P'  
322.208 
EDO non-polymer         . 1,2-ETHANEDIOL                       'ETHYLENE GLYCOL'                          'C2 H6 O2'         
62.068  
GLN 'L-peptide linking' y GLUTAMINE                            ?                                          'C5 H10 N2 O3'     
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                                          'C5 H9 N O4'       
147.129 
GLY 'peptide linking'   y GLYCINE                              ?                                          'C2 H5 N O2'       
75.067  
GOA non-polymer         . 'GLYCOLIC ACID'                      'HYDROXYACETIC ACID; HYDROXYETHANOIC ACID' 'C2 H4 O3'         
76.051  
HIS 'L-peptide linking' y HISTIDINE                            ?                                          'C6 H10 N3 O2 1'   
156.162 
HOH non-polymer         . WATER                                ?                                          'H2 O'             
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                                          'C6 H13 N O2'      
131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                                          'C6 H13 N O2'      
131.173 
LYS 'L-peptide linking' y LYSINE                               ?                                          'C6 H15 N2 O2 1'   
147.195 
MET 'L-peptide linking' y METHIONINE                           ?                                          'C5 H11 N O2 S'    
149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ?                                          'Mg 2'             
24.305  
NA  non-polymer         . 'SODIUM ION'                         ?                                          'Na 1'             
22.990  
PHE 'L-peptide linking' y PHENYLALANINE                        ?                                          'C9 H11 N O2'      
165.189 
PRO 'L-peptide linking' y PROLINE                              ?                                          'C5 H9 N O2'       
115.130 
SER 'L-peptide linking' y SERINE                               ?                                          'C3 H7 N O3'       
105.093 
THR 'L-peptide linking' y THREONINE                            ?                                          'C4 H9 N O3'       
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                                          'C11 H12 N2 O2'    
204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                                          'C9 H11 N O3'      
181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"           ?                                          'C9 H13 N2 O9 P'   
324.181 
UTP non-polymer         . 
;URIDINE 5'-TRIPHOSPHATE
;
?                                          'C9 H15 N2 O15 P3' 484.141 
VAL 'L-peptide linking' y VALINE                               ?                                          'C5 H11 N O2'      
117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5VZH 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.81 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         56.3 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '90mM HEPES pH 7.5, 18% PEG4K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      'VariMax HF' 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 200K' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-04-07 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    mirrors 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'RIGAKU MICROMAX-007 HF' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.54 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_synchrotron_site       ? 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5VZH 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.95 
_reflns.d_resolution_low                 50.00 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       33554 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100.0 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.0 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.065 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            22.70 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 0.974 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.023 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.95 
_reflns_shell.d_res_low                   1.98 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.01 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           1620 
_reflns_shell.percent_possible_all        99.9 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             4.2 
_reflns_shell.pdbx_Rsym_value             0.613 
_reflns_shell.pdbx_chi_squared            0.736 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             0.332 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.771 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5VZH 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.950 
_refine.ls_d_res_low                             45.042 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     32953 
_refine.ls_number_reflns_R_free                  1649 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.33 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1805 
_refine.ls_R_factor_R_free                       0.2108 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1789 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.47 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4M04 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 20.14 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.20 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2502 
_refine_hist.pdbx_number_atoms_nucleic_acid   350 
_refine_hist.pdbx_number_atoms_ligand         43 
_refine_hist.number_atoms_solvent             258 
_refine_hist.number_atoms_total               3153 
_refine_hist.d_res_high                       1.950 
_refine_hist.d_res_low                        45.042 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.007  ? 3190 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.819  ? 4436 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 12.408 ? 1005 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.043  ? 488  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.005  ? 518  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.9497 2.0070  . . 114 2175 84.00  . . . 0.2609 . 0.2278 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0070 2.0718  . . 136 2527 96.00  . . . 0.2705 . 0.2086 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0718 2.1459  . . 134 2611 99.00  . . . 0.2372 . 0.1996 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1459 2.2318  . . 138 2607 100.00 . . . 0.2262 . 0.1782 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2318 2.3333  . . 139 2627 100.00 . . . 0.2153 . 0.1810 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3333 2.4563  . . 138 2635 100.00 . . . 0.2247 . 0.1854 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4563 2.6102  . . 138 2611 100.00 . . . 0.2204 . 0.1920 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6102 2.8117  . . 141 2647 100.00 . . . 0.2457 . 0.1948 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8117 3.0946  . . 137 2667 100.00 . . . 0.2192 . 0.1920 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0946 3.5423  . . 143 2665 100.00 . . . 0.2001 . 0.1663 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5423 4.4623  . . 141 2701 100.00 . . . 0.1552 . 0.1471 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.4623 45.0537 . . 150 2831 100.00 . . . 0.2058 . 0.1780 . . . . . . . . . . 
# 
_struct.entry_id                     5VZH 
_struct.title                        'Post-catalytic complex of human Polymerase Mu (W434H) mutant with incoming UTP' 
_struct.pdbx_descriptor              'DNA-directed DNA/RNA polymerase mu/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5VZH 
_struct_keywords.text            
;Family X DNA polymerase, nonhomologous end-joining, DNA double strand break repair, ribonucleotide incorporation, TRANSFERASE-DNA complex
;
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 5  ? 
G N N 6  ? 
H N N 7  ? 
I N N 7  ? 
J N N 8  ? 
K N N 9  ? 
L N N 10 ? 
M N N 11 ? 
N N N 11 ? 
O N N 11 ? 
P N N 11 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 TYR A 13  ? ARG A 17  ? TYR A 141 ARG A 145 5 ? 5  
HELX_P HELX_P2  AA2 ASN A 25  ? GLU A 42  ? ASN A 153 GLU A 170 1 ? 18 
HELX_P HELX_P3  AA3 SER A 44  ? LEU A 61  ? SER A 172 LEU A 189 1 ? 18 
HELX_P HELX_P4  AA4 THR A 67  ? GLN A 72  ? THR A 195 GLN A 200 5 ? 6  
HELX_P HELX_P5  AA5 GLY A 78  ? GLY A 92  ? GLY A 206 GLY A 220 1 ? 15 
HELX_P HELX_P6  AA6 CYS A 94  ? SER A 103 ? CYS A 222 SER A 231 1 ? 10 
HELX_P HELX_P7  AA7 SER A 103 ? GLN A 114 ? SER A 231 GLN A 242 1 ? 12 
HELX_P HELX_P8  AA8 GLY A 119 ? GLU A 129 ? GLY A 247 GLU A 257 1 ? 11 
HELX_P HELX_P9  AA9 THR A 133 ? GLU A 139 ? THR A 261 GLU A 267 1 ? 7  
HELX_P HELX_P10 AB1 GLN A 140 ? LEU A 144 ? GLN A 268 LEU A 272 5 ? 5  
HELX_P HELX_P11 AB2 THR A 145 ? HIS A 154 ? THR A 273 HIS A 282 1 ? 10 
HELX_P HELX_P12 AB3 HIS A 154 ? SER A 159 ? HIS A 282 SER A 287 1 ? 6  
HELX_P HELX_P13 AB4 ARG A 164 ? LEU A 182 ? ARG A 292 LEU A 310 1 ? 19 
HELX_P HELX_P14 AB5 THR A 190 ? ARG A 195 ? THR A 318 ARG A 323 1 ? 6  
HELX_P HELX_P15 AB6 GLY A 217 ? GLN A 229 ? GLY A 345 GLN A 357 1 ? 13 
HELX_P HELX_P16 AB7 PRO A 283 ? SER A 285 ? PRO A 423 SER A 425 5 ? 3  
HELX_P HELX_P17 AB8 GLN A 286 ? GLY A 296 ? GLN A 426 GLY A 436 1 ? 11 
HELX_P HELX_P18 AB9 SER A 297 ? GLY A 313 ? SER A 437 GLY A 453 1 ? 17 
HELX_P HELX_P19 AC1 SER A 334 ? LEU A 342 ? SER A 474 LEU A 482 1 ? 9  
HELX_P HELX_P20 AC2 PRO A 348 ? ARG A 352 ? PRO A 488 ARG A 492 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A THR 113 O   ? ? ? 1_555 G NA  . NA  ? ? A THR 241 A NA  503 1_555 ? ? ? ? ? ? ?                       2.283 
? 
metalc2  metalc ? ? A ILE 115 O   ? ? ? 1_555 G NA  . NA  ? ? A ILE 243 A NA  503 1_555 ? ? ? ? ? ? ?                       2.434 
? 
metalc3  metalc ? ? A VAL 118 O   ? ? ? 1_555 G NA  . NA  ? ? A VAL 246 A NA  503 1_555 ? ? ? ? ? ? ?                       2.369 
? 
metalc4  metalc ? ? A ASP 202 OD1 ? ? ? 1_555 F MG  . MG  ? ? A ASP 330 A MG  502 1_555 ? ? ? ? ? ? ?                       2.025 
? 
metalc5  metalc ? ? A ASP 202 OD2 ? ? ? 1_555 E MG  . MG  ? ? A ASP 330 A MG  501 1_555 ? ? ? ? ? ? ?                       1.969 
? 
metalc6  metalc ? ? A ASP 204 OD1 ? ? ? 1_555 E MG  . MG  ? ? A ASP 332 A MG  501 1_555 ? ? ? ? ? ? ?                       1.991 
? 
metalc7  metalc ? ? A ASP 204 OD2 ? ? ? 1_555 F MG  . MG  ? ? A ASP 332 A MG  502 1_555 ? ? ? ? ? ? ?                       2.094 
? 
metalc8  metalc ? ? A ASP 278 OD2 ? ? ? 1_555 E MG  . MG  ? ? A ASP 418 A MG  501 1_555 ? ? ? ? ? ? ?                       2.034 
? 
metalc9  metalc ? ? C DT  3   OP1 ? ? ? 1_555 G NA  . NA  ? ? P DT  3   A NA  503 1_555 ? ? ? ? ? ? ?                       2.291 
? 
metalc10 metalc ? ? C U   5   OP1 ? ? ? 1_555 G NA  . NA  ? ? P U   5   A NA  503 1_555 ? ? ? ? ? ? ?                       2.221 
? 
metalc11 metalc ? ? E MG  .   MG  ? ? ? 1_555 J UTP . O2A ? ? A MG  501 A UTP 506 1_555 ? ? ? ? ? ? ?                       2.403 
? 
metalc12 metalc ? ? E MG  .   MG  ? ? ? 1_555 K GOA . O12 ? ? A MG  501 A GOA 507 1_555 ? ? ? ? ? ? ?                       2.078 
? 
metalc13 metalc ? ? E MG  .   MG  ? ? ? 1_555 K GOA . O2  ? ? A MG  501 A GOA 507 1_555 ? ? ? ? ? ? ?                       2.142 
? 
metalc14 metalc ? ? F MG  .   MG  ? ? ? 1_555 J UTP . O2A ? ? A MG  502 A UTP 506 1_555 ? ? ? ? ? ? ?                       2.141 
? 
metalc15 metalc ? ? F MG  .   MG  ? ? ? 1_555 J UTP . O1B ? ? A MG  502 A UTP 506 1_555 ? ? ? ? ? ? ?                       2.036 
? 
metalc16 metalc ? ? F MG  .   MG  ? ? ? 1_555 J UTP . O1G ? ? A MG  502 A UTP 506 1_555 ? ? ? ? ? ? ?                       2.109 
? 
metalc17 metalc ? ? F MG  .   MG  ? ? ? 1_555 M HOH . O   ? ? A MG  502 A HOH 656 1_555 ? ? ? ? ? ? ?                       2.094 
? 
metalc18 metalc ? ? G NA  .   NA  ? ? ? 1_555 O HOH . O   ? ? A NA  503 P HOH 105 1_555 ? ? ? ? ? ? ?                       2.361 
? 
hydrog1  hydrog ? ? B DC  1   N3  ? ? ? 1_555 D DG  4 N1  A ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog2  hydrog ? ? B DC  1   N3  ? ? ? 1_555 D DG  4 N1  B ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog3  hydrog ? ? B DC  1   N4  ? ? ? 1_555 D DG  4 O6  A ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog4  hydrog ? ? B DC  1   N4  ? ? ? 1_555 D DG  4 O6  B ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog5  hydrog ? ? B DC  1   O2  ? ? ? 1_555 D DG  4 N2  A ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog6  hydrog ? ? B DC  1   O2  ? ? ? 1_555 D DG  4 N2  B ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog7  hydrog ? ? B DG  2   N1  ? ? ? 1_555 D DC  3 N3  A ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog8  hydrog ? ? B DG  2   N1  ? ? ? 1_555 D DC  3 N3  B ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog9  hydrog ? ? B DG  2   N2  ? ? ? 1_555 D DC  3 O2  A ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog10 hydrog ? ? B DG  2   N2  ? ? ? 1_555 D DC  3 O2  B ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog11 hydrog ? ? B DG  2   O6  ? ? ? 1_555 D DC  3 N4  A ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog12 hydrog ? ? B DG  2   O6  ? ? ? 1_555 D DC  3 N4  B ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog13 hydrog ? ? B DG  3   N1  ? ? ? 1_555 D DC  2 N3  ? ? T DG  3   D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog14 hydrog ? ? B DG  3   N2  ? ? ? 1_555 D DC  2 O2  ? ? T DG  3   D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog15 hydrog ? ? B DG  3   O6  ? ? ? 1_555 D DC  2 N4  ? ? T DG  3   D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog16 hydrog ? ? B DC  4   N3  ? ? ? 1_555 D DG  1 N1  ? ? T DC  4   D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog17 hydrog ? ? B DC  4   N4  ? ? ? 1_555 D DG  1 O6  ? ? T DC  4   D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog18 hydrog ? ? B DC  4   O2  ? ? ? 1_555 D DG  1 N2  ? ? T DC  4   D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog19 hydrog ? ? B DT  6   N3  ? ? ? 1_555 C DA  4 N1  ? ? T DT  6   P DA  4   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ?     
? 
hydrog20 hydrog ? ? B DT  6   O2  ? ? ? 1_555 C DA  4 N6  ? ? T DT  6   P DA  4   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ?     
? 
hydrog21 hydrog ? ? B DA  7   N1  ? ? ? 1_555 C DT  3 N3  ? ? T DA  7   P DT  3   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog22 hydrog ? ? B DA  7   N6  ? ? ? 1_555 C DT  3 O4  ? ? T DA  7   P DT  3   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog23 hydrog ? ? B DC  8   N3  ? ? ? 1_555 C DG  2 N1  ? ? T DC  8   P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog24 hydrog ? ? B DC  8   N4  ? ? ? 1_555 C DG  2 O6  ? ? T DC  8   P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog25 hydrog ? ? B DC  8   O2  ? ? ? 1_555 C DG  2 N2  ? ? T DC  8   P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog26 hydrog ? ? B DG  9   N1  ? ? ? 1_555 C DC  1 N3  ? ? T DG  9   P DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog27 hydrog ? ? B DG  9   N2  ? ? ? 1_555 C DC  1 O2  ? ? T DG  9   P DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog28 hydrog ? ? B DG  9   O6  ? ? ? 1_555 C DC  1 N4  ? ? T DG  9   P DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           296 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            436 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   SER 
_struct_mon_prot_cis.pdbx_label_seq_id_2    297 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    SER 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     437 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -5.16 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 5 ? 
AA3 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 162 ? LEU A 163 ? VAL A 290 LEU A 291 
AA1 2 GLN A 199 ? GLY A 200 ? GLN A 327 GLY A 328 
AA2 1 THR A 186 ? LEU A 189 ? THR A 314 LEU A 317 
AA2 2 VAL A 203 ? THR A 208 ? VAL A 331 THR A 336 
AA2 3 SER A 271 ? VAL A 281 ? SER A 411 VAL A 421 
AA2 4 ARG A 259 ? GLN A 268 ? ARG A 387 GLN A 396 
AA2 5 ILE A 232 ? TYR A 234 ? ILE A 360 TYR A 362 
AA3 1 TRP A 315 ? ASN A 317 ? TRP A 455 ASN A 457 
AA3 2 GLY A 320 ? ASP A 323 ? GLY A 460 ASP A 463 
AA3 3 THR A 328 ? PHE A 329 ? THR A 468 PHE A 469 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 162 ? N VAL A 290 O GLY A 200 ? O GLY A 328 
AA2 1 2 N THR A 188 ? N THR A 316 O LEU A 206 ? O LEU A 334 
AA2 2 3 N ILE A 207 ? N ILE A 335 O VAL A 280 ? O VAL A 420 
AA2 3 4 O VAL A 275 ? O VAL A 415 N PHE A 264 ? N PHE A 392 
AA2 4 5 O ILE A 263 ? O ILE A 391 N LEU A 233 ? N LEU A 361 
AA3 1 2 N TRP A 315 ? N TRP A 455 O PHE A 322 ? O PHE A 462 
AA3 2 3 N ASP A 323 ? N ASP A 463 O THR A 328 ? O THR A 468 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG  501 ? 5  'binding site for residue MG A 501'  
AC2 Software A MG  502 ? 4  'binding site for residue MG A 502'  
AC3 Software A NA  503 ? 6  'binding site for residue NA A 503'  
AC4 Software A CL  504 ? 4  'binding site for residue CL A 504'  
AC5 Software A CL  505 ? 4  'binding site for residue CL A 505'  
AC6 Software A UTP 506 ? 24 'binding site for residue UTP A 506' 
AC7 Software A GOA 507 ? 9  'binding site for residue GOA A 507' 
AC8 Software A EDO 508 ? 3  'binding site for residue EDO A 508' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  ASP A 202 ? ASP A 330 . ? 1_555 ? 
2  AC1 5  ASP A 204 ? ASP A 332 . ? 1_555 ? 
3  AC1 5  ASP A 278 ? ASP A 418 . ? 1_555 ? 
4  AC1 5  UTP J .   ? UTP A 506 . ? 1_555 ? 
5  AC1 5  GOA K .   ? GOA A 507 . ? 1_555 ? 
6  AC2 4  ASP A 202 ? ASP A 330 . ? 1_555 ? 
7  AC2 4  ASP A 204 ? ASP A 332 . ? 1_555 ? 
8  AC2 4  UTP J .   ? UTP A 506 . ? 1_555 ? 
9  AC2 4  HOH M .   ? HOH A 656 . ? 1_555 ? 
10 AC3 6  THR A 113 ? THR A 241 . ? 1_555 ? 
11 AC3 6  ILE A 115 ? ILE A 243 . ? 1_555 ? 
12 AC3 6  VAL A 118 ? VAL A 246 . ? 1_555 ? 
13 AC3 6  DT  C 3   ? DT  P 3   . ? 1_555 ? 
14 AC3 6  U   C 5   ? U   P 5   . ? 1_555 ? 
15 AC3 6  HOH O .   ? HOH P 105 . ? 1_555 ? 
16 AC4 4  LEU A 344 ? LEU A 484 . ? 1_555 ? 
17 AC4 4  GLU A 345 ? GLU A 485 . ? 1_555 ? 
18 AC4 4  HOH M .   ? HOH A 696 . ? 1_555 ? 
19 AC4 4  HOH M .   ? HOH A 776 . ? 1_555 ? 
20 AC5 4  ARG A 53  ? ARG A 181 . ? 1_555 ? 
21 AC5 4  DG  B 3   ? DG  T 3   . ? 1_555 ? 
22 AC5 4  DC  B 4   ? DC  T 4   . ? 1_555 ? 
23 AC5 4  HOH N .   ? HOH T 113 . ? 1_555 ? 
24 AC6 24 GLY A 191 ? GLY A 319 . ? 1_555 ? 
25 AC6 24 GLY A 192 ? GLY A 320 . ? 1_555 ? 
26 AC6 24 ARG A 195 ? ARG A 323 . ? 1_555 ? 
27 AC6 24 LYS A 197 ? LYS A 325 . ? 1_555 ? 
28 AC6 24 GLY A 200 ? GLY A 328 . ? 1_555 ? 
29 AC6 24 HIS A 201 ? HIS A 329 . ? 1_555 ? 
30 AC6 24 ASP A 202 ? ASP A 330 . ? 1_555 ? 
31 AC6 24 ASP A 204 ? ASP A 332 . ? 1_555 ? 
32 AC6 24 GLY A 293 ? GLY A 433 . ? 1_555 ? 
33 AC6 24 HIS A 294 ? HIS A 434 . ? 1_555 ? 
34 AC6 24 THR A 295 ? THR A 435 . ? 1_555 ? 
35 AC6 24 GLY A 296 ? GLY A 436 . ? 1_555 ? 
36 AC6 24 MG  E .   ? MG  A 501 . ? 1_555 ? 
37 AC6 24 MG  F .   ? MG  A 502 . ? 1_555 ? 
38 AC6 24 GOA K .   ? GOA A 507 . ? 1_555 ? 
39 AC6 24 HOH M .   ? HOH A 604 . ? 1_555 ? 
40 AC6 24 HOH M .   ? HOH A 639 . ? 1_555 ? 
41 AC6 24 HOH M .   ? HOH A 656 . ? 1_555 ? 
42 AC6 24 HOH M .   ? HOH A 710 . ? 1_555 ? 
43 AC6 24 HOH M .   ? HOH A 714 . ? 1_555 ? 
44 AC6 24 HOH M .   ? HOH A 716 . ? 1_555 ? 
45 AC6 24 HOH M .   ? HOH A 749 . ? 1_555 ? 
46 AC6 24 DA  C 4   ? DA  P 4   . ? 1_555 ? 
47 AC6 24 DA  B 5   ? DA  T 5   . ? 1_555 ? 
48 AC7 9  HIS A 201 ? HIS A 329 . ? 1_555 ? 
49 AC7 9  ASP A 202 ? ASP A 330 . ? 1_555 ? 
50 AC7 9  ASP A 204 ? ASP A 332 . ? 1_555 ? 
51 AC7 9  ASP A 278 ? ASP A 418 . ? 1_555 ? 
52 AC7 9  MG  E .   ? MG  A 501 . ? 1_555 ? 
53 AC7 9  UTP J .   ? UTP A 506 . ? 1_555 ? 
54 AC7 9  HOH M .   ? HOH A 703 . ? 1_555 ? 
55 AC7 9  DT  C 3   ? DT  P 3   . ? 1_555 ? 
56 AC7 9  DA  C 4   ? DA  P 4   . ? 1_555 ? 
57 AC8 3  PRO A 62  ? PRO A 190 . ? 1_555 ? 
58 AC8 3  SER A 63  ? SER A 191 . ? 1_555 ? 
59 AC8 3  GLN A 70  ? GLN A 198 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5VZH 
_atom_sites.fract_transf_matrix[1][1]   0.016768 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014551 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009140 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
MG 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1  10  ? 0.469   -28.573 -11.427 1.00 32.22 ?  138 MET A N     1 
ATOM   2    C  CA    . MET A 1  10  ? 0.834   -27.175 -11.628 1.00 27.88 ?  138 MET A CA    1 
ATOM   3    C  C     . MET A 1  10  ? 0.011   -26.555 -12.762 1.00 26.38 ?  138 MET A C     1 
ATOM   4    O  O     . MET A 1  10  ? 0.309   -26.781 -13.934 1.00 23.55 ?  138 MET A O     1 
ATOM   5    C  CB    . MET A 1  10  ? 2.330   -27.059 -11.936 1.00 33.92 ?  138 MET A CB    1 
ATOM   6    C  CG    . MET A 1  10  ? 2.825   -25.636 -12.186 1.00 32.79 ?  138 MET A CG    1 
ATOM   7    S  SD    . MET A 1  10  ? 2.696   -24.534 -10.763 1.00 33.95 ?  138 MET A SD    1 
ATOM   8    C  CE    . MET A 1  10  ? 3.784   -25.345 -9.588  1.00 26.23 ?  138 MET A CE    1 
ATOM   9    N  N     A PRO A 1  11  ? -1.022  -25.785 -12.417 0.23 25.37 ?  139 PRO A N     1 
ATOM   10   N  N     B PRO A 1  11  ? -1.016  -25.776 -12.426 0.77 26.16 ?  139 PRO A N     1 
ATOM   11   C  CA    A PRO A 1  11  ? -1.826  -25.127 -13.453 0.23 25.15 ?  139 PRO A CA    1 
ATOM   12   C  CA    B PRO A 1  11  ? -1.827  -25.146 -13.474 0.77 25.77 ?  139 PRO A CA    1 
ATOM   13   C  C     A PRO A 1  11  ? -0.995  -24.149 -14.271 0.23 23.01 ?  139 PRO A C     1 
ATOM   14   C  C     B PRO A 1  11  ? -1.035  -24.097 -14.241 0.77 21.45 ?  139 PRO A C     1 
ATOM   15   O  O     A PRO A 1  11  ? 0.081   -23.706 -13.861 0.23 23.13 ?  139 PRO A O     1 
ATOM   16   O  O     B PRO A 1  11  ? -0.031  -23.559 -13.770 0.77 23.60 ?  139 PRO A O     1 
ATOM   17   C  CB    A PRO A 1  11  ? -2.920  -24.403 -12.656 0.23 24.43 ?  139 PRO A CB    1 
ATOM   18   C  CB    B PRO A 1  11  ? -2.988  -24.516 -12.698 0.77 25.06 ?  139 PRO A CB    1 
ATOM   19   C  CG    A PRO A 1  11  ? -2.968  -25.108 -11.341 0.23 22.96 ?  139 PRO A CG    1 
ATOM   20   C  CG    B PRO A 1  11  ? -2.443  -24.279 -11.342 0.77 21.15 ?  139 PRO A CG    1 
ATOM   21   C  CD    A PRO A 1  11  ? -1.566  -25.548 -11.069 0.23 23.43 ?  139 PRO A CD    1 
ATOM   22   C  CD    B PRO A 1  11  ? -1.481  -25.403 -11.078 0.77 23.37 ?  139 PRO A CD    1 
ATOM   23   N  N     . ALA A 1  12  ? -1.519  -23.803 -15.449 1.00 23.73 ?  140 ALA A N     1 
ATOM   24   C  CA    . ALA A 1  12  ? -0.767  -22.976 -16.386 1.00 22.01 ?  140 ALA A CA    1 
ATOM   25   C  C     . ALA A 1  12  ? -0.838  -21.489 -16.060 1.00 22.58 ?  140 ALA A C     1 
ATOM   26   O  O     . ALA A 1  12  ? 0.088   -20.746 -16.405 1.00 23.51 ?  140 ALA A O     1 
ATOM   27   C  CB    . ALA A 1  12  ? -1.273  -23.216 -17.810 1.00 21.39 ?  140 ALA A CB    1 
ATOM   28   N  N     . TYR A 1  13  ? -1.904  -21.031 -15.404 1.00 13.65 ?  141 TYR A N     1 
ATOM   29   C  CA    . TYR A 1  13  ? -2.072  -19.613 -15.122 1.00 15.97 ?  141 TYR A CA    1 
ATOM   30   C  C     . TYR A 1  13  ? -1.682  -19.312 -13.679 1.00 16.79 ?  141 TYR A C     1 
ATOM   31   O  O     . TYR A 1  13  ? -2.029  -20.068 -12.768 1.00 19.67 ?  141 TYR A O     1 
ATOM   32   C  CB    . TYR A 1  13  ? -3.522  -19.185 -15.341 1.00 11.80 ?  141 TYR A CB    1 
ATOM   33   C  CG    . TYR A 1  13  ? -4.045  -19.178 -16.761 1.00 12.49 ?  141 TYR A CG    1 
ATOM   34   C  CD1   . TYR A 1  13  ? -4.547  -20.321 -17.349 1.00 16.57 ?  141 TYR A CD1   1 
ATOM   35   C  CD2   . TYR A 1  13  ? -4.123  -17.988 -17.471 1.00 14.80 ?  141 TYR A CD2   1 
ATOM   36   C  CE1   . TYR A 1  13  ? -5.078  -20.287 -18.637 1.00 21.12 ?  141 TYR A CE1   1 
ATOM   37   C  CE2   . TYR A 1  13  ? -4.638  -17.938 -18.739 1.00 22.09 ?  141 TYR A CE2   1 
ATOM   38   C  CZ    . TYR A 1  13  ? -5.118  -19.085 -19.325 1.00 22.34 ?  141 TYR A CZ    1 
ATOM   39   O  OH    . TYR A 1  13  ? -5.640  -19.002 -20.592 1.00 23.81 ?  141 TYR A OH    1 
ATOM   40   N  N     . ALA A 1  14  ? -1.002  -18.180 -13.460 1.00 16.23 ?  142 ALA A N     1 
ATOM   41   C  CA    . ALA A 1  14  ? -0.562  -17.880 -12.098 1.00 16.62 ?  142 ALA A CA    1 
ATOM   42   C  C     . ALA A 1  14  ? -1.733  -17.632 -11.151 1.00 16.78 ?  142 ALA A C     1 
ATOM   43   O  O     . ALA A 1  14  ? -1.596  -17.836 -9.938  1.00 15.02 ?  142 ALA A O     1 
ATOM   44   C  CB    . ALA A 1  14  ? 0.365   -16.665 -12.080 1.00 14.75 ?  142 ALA A CB    1 
ATOM   45   N  N     . CYS A 1  15  ? -2.872  -17.194 -11.660 1.00 9.92  ?  143 CYS A N     1 
ATOM   46   C  CA    . CYS A 1  15  ? -4.015  -16.944 -10.786 1.00 12.05 ?  143 CYS A CA    1 
ATOM   47   C  C     . CYS A 1  15  ? -4.678  -18.226 -10.324 1.00 12.78 ?  143 CYS A C     1 
ATOM   48   O  O     . CYS A 1  15  ? -5.630  -18.164 -9.544  1.00 15.64 ?  143 CYS A O     1 
ATOM   49   C  CB    . CYS A 1  15  ? -5.043  -16.068 -11.495 1.00 11.84 ?  143 CYS A CB    1 
ATOM   50   S  SG    . CYS A 1  15  ? -5.627  -16.784 -13.048 1.00 15.98 ?  143 CYS A SG    1 
ATOM   51   N  N     . GLN A 1  16  ? -4.221  -19.379 -10.813 1.00 11.53 ?  144 GLN A N     1 
ATOM   52   C  CA    . GLN A 1  16  ? -4.788  -20.671 -10.467 1.00 12.26 ?  144 GLN A CA    1 
ATOM   53   C  C     . GLN A 1  16  ? -4.036  -21.360 -9.342  1.00 18.76 ?  144 GLN A C     1 
ATOM   54   O  O     . GLN A 1  16  ? -4.380  -22.487 -8.986  1.00 16.31 ?  144 GLN A O     1 
ATOM   55   C  CB    . GLN A 1  16  ? -4.806  -21.591 -11.702 1.00 12.92 ?  144 GLN A CB    1 
ATOM   56   C  CG    . GLN A 1  16  ? -5.809  -21.201 -12.756 1.00 16.07 ?  144 GLN A CG    1 
ATOM   57   C  CD    . GLN A 1  16  ? -5.758  -22.126 -13.952 1.00 22.08 ?  144 GLN A CD    1 
ATOM   58   O  OE1   . GLN A 1  16  ? -4.745  -22.211 -14.646 1.00 20.59 ?  144 GLN A OE1   1 
ATOM   59   N  NE2   . GLN A 1  16  ? -6.835  -22.841 -14.179 1.00 23.81 ?  144 GLN A NE2   1 
ATOM   60   N  N     . ARG A 1  17  ? -3.032  -20.708 -8.761  1.00 19.68 ?  145 ARG A N     1 
ATOM   61   C  CA    . ARG A 1  17  ? -2.191  -21.369 -7.776  1.00 19.14 ?  145 ARG A CA    1 
ATOM   62   C  C     . ARG A 1  17  ? -1.707  -20.330 -6.782  1.00 14.36 ?  145 ARG A C     1 
ATOM   63   O  O     . ARG A 1  17  ? -1.479  -19.170 -7.152  1.00 16.64 ?  145 ARG A O     1 
ATOM   64   C  CB    . ARG A 1  17  ? -0.995  -22.060 -8.442  1.00 20.18 ?  145 ARG A CB    1 
ATOM   65   C  CG    . ARG A 1  17  ? -0.067  -21.079 -9.118  1.00 19.10 ?  145 ARG A CG    1 
ATOM   66   C  CD    . ARG A 1  17  ? 0.727   -21.672 -10.277 1.00 27.27 ?  145 ARG A CD    1 
ATOM   67   N  NE    . ARG A 1  17  ? 1.641   -20.651 -10.778 1.00 25.63 ?  145 ARG A NE    1 
ATOM   68   C  CZ    . ARG A 1  17  ? 1.921   -20.444 -12.058 1.00 30.62 ?  145 ARG A CZ    1 
ATOM   69   N  NH1   . ARG A 1  17  ? 1.371   -21.207 -13.013 1.00 24.39 ?  145 ARG A NH1   1 
ATOM   70   N  NH2   . ARG A 1  17  ? 2.744   -19.452 -12.372 1.00 26.27 ?  145 ARG A NH2   1 
ATOM   71   N  N     . PRO A 1  18  ? -1.541  -20.707 -5.516  1.00 13.63 ?  146 PRO A N     1 
ATOM   72   C  CA    . PRO A 1  18  ? -0.993  -19.759 -4.547  1.00 13.18 ?  146 PRO A CA    1 
ATOM   73   C  C     . PRO A 1  18  ? 0.493   -19.541 -4.781  1.00 14.06 ?  146 PRO A C     1 
ATOM   74   O  O     . PRO A 1  18  ? 1.244   -20.481 -5.059  1.00 13.54 ?  146 PRO A O     1 
ATOM   75   C  CB    . PRO A 1  18  ? -1.259  -20.435 -3.199  1.00 22.05 ?  146 PRO A CB    1 
ATOM   76   C  CG    . PRO A 1  18  ? -1.259  -21.885 -3.511  1.00 27.06 ?  146 PRO A CG    1 
ATOM   77   C  CD    . PRO A 1  18  ? -1.801  -22.027 -4.909  1.00 20.89 ?  146 PRO A CD    1 
ATOM   78   N  N     . THR A 1  19  ? 0.911   -18.288 -4.681  1.00 12.72 ?  147 THR A N     1 
ATOM   79   C  CA    . THR A 1  19  ? 2.320   -17.920 -4.802  1.00 9.87  ?  147 THR A CA    1 
ATOM   80   C  C     . THR A 1  19  ? 2.700   -17.090 -3.587  1.00 10.86 ?  147 THR A C     1 
ATOM   81   O  O     . THR A 1  19  ? 2.303   -15.904 -3.506  1.00 11.71 ?  147 THR A O     1 
ATOM   82   C  CB    . THR A 1  19  ? 2.599   -17.150 -6.090  1.00 14.65 ?  147 THR A CB    1 
ATOM   83   O  OG1   . THR A 1  19  ? 1.950   -17.789 -7.198  1.00 13.19 ?  147 THR A OG1   1 
ATOM   84   C  CG2   . THR A 1  19  ? 4.094   -17.117 -6.349  1.00 10.91 ?  147 THR A CG2   1 
ATOM   85   N  N     . PRO A 1  20  ? 3.445   -17.636 -2.635  1.00 15.09 ?  148 PRO A N     1 
ATOM   86   C  CA    . PRO A 1  20  ? 3.812   -16.872 -1.442  1.00 9.91  ?  148 PRO A CA    1 
ATOM   87   C  C     . PRO A 1  20  ? 4.908   -15.862 -1.756  1.00 12.25 ?  148 PRO A C     1 
ATOM   88   O  O     . PRO A 1  20  ? 5.559   -15.908 -2.800  1.00 11.44 ?  148 PRO A O     1 
ATOM   89   C  CB    . PRO A 1  20  ? 4.302   -17.950 -0.472  1.00 14.15 ?  148 PRO A CB    1 
ATOM   90   C  CG    . PRO A 1  20  ? 4.884   -18.996 -1.374  1.00 13.90 ?  148 PRO A CG    1 
ATOM   91   C  CD    . PRO A 1  20  ? 4.044   -18.986 -2.624  1.00 16.02 ?  148 PRO A CD    1 
ATOM   92   N  N     . LEU A 1  21  ? 5.103   -14.934 -0.818  1.00 11.07 ?  149 LEU A N     1 
ATOM   93   C  CA    . LEU A 1  21  ? 6.109   -13.893 -1.008  1.00 10.74 ?  149 LEU A CA    1 
ATOM   94   C  C     . LEU A 1  21  ? 7.515   -14.479 -0.996  1.00 17.86 ?  149 LEU A C     1 
ATOM   95   O  O     . LEU A 1  21  ? 8.355   -14.125 -1.831  1.00 18.12 ?  149 LEU A O     1 
ATOM   96   C  CB    . LEU A 1  21  ? 5.970   -12.821 0.073   1.00 12.10 ?  149 LEU A CB    1 
ATOM   97   C  CG    . LEU A 1  21  ? 6.962   -11.658 -0.036  1.00 16.65 ?  149 LEU A CG    1 
ATOM   98   C  CD1   . LEU A 1  21  ? 6.924   -11.009 -1.421  1.00 18.33 ?  149 LEU A CD1   1 
ATOM   99   C  CD2   . LEU A 1  21  ? 6.691   -10.623 1.036   1.00 18.57 ?  149 LEU A CD2   1 
ATOM   100  N  N     . THR A 1  22  ? 7.792   -15.367 -0.047  1.00 9.15  ?  150 THR A N     1 
ATOM   101  C  CA    . THR A 1  22  ? 9.060   -16.073 0.024   1.00 13.23 ?  150 THR A CA    1 
ATOM   102  C  C     . THR A 1  22  ? 8.831   -17.539 -0.312  1.00 12.00 ?  150 THR A C     1 
ATOM   103  O  O     . THR A 1  22  ? 7.761   -18.093 -0.042  1.00 13.33 ?  150 THR A O     1 
ATOM   104  C  CB    . THR A 1  22  ? 9.697   -15.943 1.413   1.00 13.38 ?  150 THR A CB    1 
ATOM   105  O  OG1   . THR A 1  22  ? 8.817   -16.490 2.400   1.00 13.31 ?  150 THR A OG1   1 
ATOM   106  C  CG2   . THR A 1  22  ? 9.978   -14.483 1.738   1.00 21.69 ?  150 THR A CG2   1 
ATOM   107  N  N     . HIS A 1  23  ? 9.836   -18.165 -0.912  1.00 10.61 ?  151 HIS A N     1 
ATOM   108  C  CA    . HIS A 1  23  ? 9.636   -19.496 -1.460  1.00 11.30 ?  151 HIS A CA    1 
ATOM   109  C  C     . HIS A 1  23  ? 10.961  -20.255 -1.425  1.00 15.20 ?  151 HIS A C     1 
ATOM   110  O  O     . HIS A 1  23  ? 11.874  -19.913 -0.665  1.00 11.74 ?  151 HIS A O     1 
ATOM   111  C  CB    . HIS A 1  23  ? 9.012   -19.385 -2.865  1.00 9.98  ?  151 HIS A CB    1 
ATOM   112  C  CG    . HIS A 1  23  ? 9.829   -18.592 -3.832  1.00 12.70 ?  151 HIS A CG    1 
ATOM   113  N  ND1   . HIS A 1  23  ? 10.771  -19.165 -4.660  1.00 9.51  ?  151 HIS A ND1   1 
ATOM   114  C  CD2   . HIS A 1  23  ? 9.844   -17.266 -4.105  1.00 13.54 ?  151 HIS A CD2   1 
ATOM   115  C  CE1   . HIS A 1  23  ? 11.333  -18.225 -5.399  1.00 17.07 ?  151 HIS A CE1   1 
ATOM   116  N  NE2   . HIS A 1  23  ? 10.791  -17.064 -5.080  1.00 14.85 ?  151 HIS A NE2   1 
ATOM   117  N  N     . HIS A 1  24  ? 11.056  -21.307 -2.237  1.00 10.84 ?  152 HIS A N     1 
ATOM   118  C  CA    . HIS A 1  24  ? 12.114  -22.304 -2.119  1.00 12.35 ?  152 HIS A CA    1 
ATOM   119  C  C     . HIS A 1  24  ? 12.995  -22.376 -3.359  1.00 17.85 ?  152 HIS A C     1 
ATOM   120  O  O     . HIS A 1  24  ? 13.791  -23.315 -3.495  1.00 16.27 ?  152 HIS A O     1 
ATOM   121  C  CB    . HIS A 1  24  ? 11.478  -23.666 -1.821  1.00 12.24 ?  152 HIS A CB    1 
ATOM   122  C  CG    . HIS A 1  24  ? 10.409  -23.595 -0.775  1.00 15.26 ?  152 HIS A CG    1 
ATOM   123  N  ND1   . HIS A 1  24  ? 10.683  -23.366 0.557   1.00 15.85 ?  152 HIS A ND1   1 
ATOM   124  C  CD2   . HIS A 1  24  ? 9.061   -23.674 -0.873  1.00 12.18 ?  152 HIS A CD2   1 
ATOM   125  C  CE1   . HIS A 1  24  ? 9.549   -23.324 1.236   1.00 21.07 ?  152 HIS A CE1   1 
ATOM   126  N  NE2   . HIS A 1  24  ? 8.550   -23.504 0.390   1.00 15.04 ?  152 HIS A NE2   1 
ATOM   127  N  N     . ASN A 1  25  ? 12.892  -21.398 -4.253  1.00 14.00 ?  153 ASN A N     1 
ATOM   128  C  CA    . ASN A 1  25  ? 13.642  -21.396 -5.503  1.00 13.59 ?  153 ASN A CA    1 
ATOM   129  C  C     . ASN A 1  25  ? 14.044  -19.977 -5.869  1.00 19.83 ?  153 ASN A C     1 
ATOM   130  O  O     . ASN A 1  25  ? 13.995  -19.578 -7.037  1.00 14.24 ?  153 ASN A O     1 
ATOM   131  C  CB    . ASN A 1  25  ? 12.830  -22.040 -6.624  1.00 11.17 ?  153 ASN A CB    1 
ATOM   132  C  CG    . ASN A 1  25  ? 12.669  -23.531 -6.435  1.00 16.62 ?  153 ASN A CG    1 
ATOM   133  O  OD1   . ASN A 1  25  ? 13.603  -24.294 -6.668  1.00 13.37 ?  153 ASN A OD1   1 
ATOM   134  N  ND2   . ASN A 1  25  ? 11.482  -23.958 -6.011  1.00 11.82 ?  153 ASN A ND2   1 
ATOM   135  N  N     . THR A 1  26  ? 14.467  -19.206 -4.862  1.00 10.75 ?  154 THR A N     1 
ATOM   136  C  CA    . THR A 1  26  ? 14.727  -17.782 -5.047  1.00 14.88 ?  154 THR A CA    1 
ATOM   137  C  C     . THR A 1  26  ? 15.790  -17.541 -6.112  1.00 14.05 ?  154 THR A C     1 
ATOM   138  O  O     . THR A 1  26  ? 15.601  -16.722 -7.018  1.00 13.22 ?  154 THR A O     1 
ATOM   139  C  CB    . THR A 1  26  ? 15.155  -17.162 -3.716  1.00 17.70 ?  154 THR A CB    1 
ATOM   140  O  OG1   . THR A 1  26  ? 14.261  -17.592 -2.681  1.00 17.26 ?  154 THR A OG1   1 
ATOM   141  C  CG2   . THR A 1  26  ? 15.144  -15.635 -3.798  1.00 16.70 ?  154 THR A CG2   1 
ATOM   142  N  N     . GLY A 1  27  ? 16.922  -18.240 -6.012  1.00 13.39 ?  155 GLY A N     1 
ATOM   143  C  CA    . GLY A 1  27  ? 17.999  -18.025 -6.967  1.00 18.00 ?  155 GLY A CA    1 
ATOM   144  C  C     . GLY A 1  27  ? 17.591  -18.327 -8.397  1.00 17.25 ?  155 GLY A C     1 
ATOM   145  O  O     . GLY A 1  27  ? 17.921  -17.574 -9.319  1.00 15.45 ?  155 GLY A O     1 
ATOM   146  N  N     . LEU A 1  28  ? 16.868  -19.430 -8.605  1.00 13.74 ?  156 LEU A N     1 
ATOM   147  C  CA    . LEU A 1  28  ? 16.438  -19.781 -9.953  1.00 13.88 ?  156 LEU A CA    1 
ATOM   148  C  C     . LEU A 1  28  ? 15.450  -18.757 -10.497 1.00 15.34 ?  156 LEU A C     1 
ATOM   149  O  O     . LEU A 1  28  ? 15.556  -18.338 -11.654 1.00 11.38 ?  156 LEU A O     1 
ATOM   150  C  CB    . LEU A 1  28  ? 15.815  -21.175 -9.964  1.00 14.96 ?  156 LEU A CB    1 
ATOM   151  C  CG    . LEU A 1  28  ? 16.691  -22.338 -9.494  1.00 18.05 ?  156 LEU A CG    1 
ATOM   152  C  CD1   . LEU A 1  28  ? 15.879  -23.622 -9.507  1.00 13.40 ?  156 LEU A CD1   1 
ATOM   153  C  CD2   . LEU A 1  28  ? 17.933  -22.487 -10.363 1.00 16.70 ?  156 LEU A CD2   1 
ATOM   154  N  N     . SER A 1  29  ? 14.500  -18.324 -9.668  1.00 11.77 ?  157 SER A N     1 
ATOM   155  C  CA    A SER A 1  29  ? 13.541  -17.362 -10.173 0.54 10.41 ?  157 SER A CA    1 
ATOM   156  C  CA    B SER A 1  29  ? 13.538  -17.346 -10.145 0.46 10.70 ?  157 SER A CA    1 
ATOM   157  C  C     . SER A 1  29  ? 14.213  -16.036 -10.483 1.00 11.43 ?  157 SER A C     1 
ATOM   158  O  O     . SER A 1  29  ? 13.805  -15.365 -11.440 1.00 11.38 ?  157 SER A O     1 
ATOM   159  C  CB    A SER A 1  29  ? 12.402  -17.158 -9.180  0.54 13.04 ?  157 SER A CB    1 
ATOM   160  C  CB    B SER A 1  29  ? 12.460  -17.095 -9.105  0.46 12.63 ?  157 SER A CB    1 
ATOM   161  O  OG    A SER A 1  29  ? 12.887  -16.793 -7.911  0.54 11.84 ?  157 SER A OG    1 
ATOM   162  O  OG    B SER A 1  29  ? 11.671  -18.244 -8.971  0.46 13.71 ?  157 SER A OG    1 
ATOM   163  N  N     . GLU A 1  30  ? 15.191  -15.636 -9.660  1.00 11.70 ?  158 GLU A N     1 
ATOM   164  C  CA    . GLU A 1  30  ? 15.851  -14.341 -9.933  1.00 13.09 ?  158 GLU A CA    1 
ATOM   165  C  C     . GLU A 1  30  ? 16.553  -14.382 -11.270 1.00 11.50 ?  158 GLU A C     1 
ATOM   166  O  O     . GLU A 1  30  ? 16.532  -13.390 -12.015 1.00 11.96 ?  158 GLU A O     1 
ATOM   167  C  CB    . GLU A 1  30  ? 16.811  -13.941 -8.832  1.00 15.57 ?  158 GLU A CB    1 
ATOM   168  C  CG    . GLU A 1  30  ? 16.008  -13.535 -7.525  1.00 30.65 ?  158 GLU A CG    1 
ATOM   169  C  CD    . GLU A 1  30  ? 16.862  -13.268 -6.223  1.00 36.97 ?  158 GLU A CD    1 
ATOM   170  O  OE1   . GLU A 1  30  ? 18.090  -13.563 -6.158  1.00 36.89 ?  158 GLU A OE1   1 
ATOM   171  O  OE2   . GLU A 1  30  ? 16.262  -12.748 -5.246  1.00 35.13 ?  158 GLU A OE2   1 
ATOM   172  N  N     . ALA A 1  31  ? 17.198  -15.510 -11.594 1.00 11.94 ?  159 ALA A N     1 
ATOM   173  C  CA    . ALA A 1  31  ? 17.898  -15.602 -12.865 1.00 12.47 ?  159 ALA A CA    1 
ATOM   174  C  C     . ALA A 1  31  ? 16.940  -15.486 -14.026 1.00 16.03 ?  159 ALA A C     1 
ATOM   175  O  O     . ALA A 1  31  ? 17.212  -14.778 -15.000 1.00 22.58 ?  159 ALA A O     1 
ATOM   176  C  CB    . ALA A 1  31  ? 18.679  -16.896 -12.938 1.00 13.24 ?  159 ALA A CB    1 
ATOM   177  N  N     . LEU A 1  32  ? 15.818  -16.188 -13.957 1.00 12.96 ?  160 LEU A N     1 
ATOM   178  C  CA    . LEU A 1  32  ? 14.852  -16.112 -15.045 1.00 16.99 ?  160 LEU A CA    1 
ATOM   179  C  C     . LEU A 1  32  ? 14.268  -14.714 -15.171 1.00 15.88 ?  160 LEU A C     1 
ATOM   180  O  O     . LEU A 1  32  ? 13.965  -14.263 -16.283 1.00 13.56 ?  160 LEU A O     1 
ATOM   181  C  CB    . LEU A 1  32  ? 13.738  -17.140 -14.834 1.00 14.89 ?  160 LEU A CB    1 
ATOM   182  C  CG    . LEU A 1  32  ? 14.174  -18.597 -15.013 1.00 14.19 ?  160 LEU A CG    1 
ATOM   183  C  CD1   . LEU A 1  32  ? 13.151  -19.554 -14.414 1.00 18.18 ?  160 LEU A CD1   1 
ATOM   184  C  CD2   . LEU A 1  32  ? 14.399  -18.917 -16.484 1.00 14.12 ?  160 LEU A CD2   1 
ATOM   185  N  N     . GLU A 1  33  ? 14.116  -14.003 -14.053 1.00 12.27 ?  161 GLU A N     1 
ATOM   186  C  CA    . GLU A 1  33  ? 13.541  -12.667 -14.119 1.00 10.12 ?  161 GLU A CA    1 
ATOM   187  C  C     . GLU A 1  33  ? 14.528  -11.661 -14.700 1.00 13.58 ?  161 GLU A C     1 
ATOM   188  O  O     . GLU A 1  33  ? 14.107  -10.650 -15.276 1.00 13.28 ?  161 GLU A O     1 
ATOM   189  C  CB    . GLU A 1  33  ? 13.056  -12.249 -12.734 1.00 9.53  ?  161 GLU A CB    1 
ATOM   190  C  CG    . GLU A 1  33  ? 11.836  -13.044 -12.319 1.00 16.86 ?  161 GLU A CG    1 
ATOM   191  C  CD    . GLU A 1  33  ? 11.269  -12.636 -10.974 1.00 26.40 ?  161 GLU A CD    1 
ATOM   192  O  OE1   . GLU A 1  33  ? 11.990  -11.993 -10.186 1.00 29.63 ?  161 GLU A OE1   1 
ATOM   193  O  OE2   . GLU A 1  33  ? 10.091  -12.966 -10.712 1.00 28.70 ?  161 GLU A OE2   1 
ATOM   194  N  N     . ILE A 1  34  ? 15.834  -11.922 -14.585 1.00 11.48 ?  162 ILE A N     1 
ATOM   195  C  CA    . ILE A 1  34  ? 16.814  -11.116 -15.312 1.00 13.12 ?  162 ILE A CA    1 
ATOM   196  C  C     . ILE A 1  34  ? 16.553  -11.211 -16.810 1.00 14.57 ?  162 ILE A C     1 
ATOM   197  O  O     . ILE A 1  34  ? 16.527  -10.201 -17.525 1.00 15.24 ?  162 ILE A O     1 
ATOM   198  C  CB    . ILE A 1  34  ? 18.249  -11.562 -14.970 1.00 13.21 ?  162 ILE A CB    1 
ATOM   199  C  CG1   . ILE A 1  34  ? 18.571  -11.324 -13.491 1.00 21.93 ?  162 ILE A CG1   1 
ATOM   200  C  CG2   . ILE A 1  34  ? 19.263  -10.837 -15.858 1.00 16.59 ?  162 ILE A CG2   1 
ATOM   201  C  CD1   . ILE A 1  34  ? 18.714  -9.874  -13.095 1.00 28.13 ?  162 ILE A CD1   1 
ATOM   202  N  N     . LEU A 1  35  ? 16.361  -12.435 -17.308 1.00 12.84 ?  163 LEU A N     1 
ATOM   203  C  CA    . LEU A 1  35  ? 16.134  -12.619 -18.736 1.00 17.08 ?  163 LEU A CA    1 
ATOM   204  C  C     . LEU A 1  35  ? 14.800  -12.019 -19.160 1.00 14.12 ?  163 LEU A C     1 
ATOM   205  O  O     . LEU A 1  35  ? 14.678  -11.490 -20.269 1.00 14.52 ?  163 LEU A O     1 
ATOM   206  C  CB    . LEU A 1  35  ? 16.199  -14.104 -19.081 1.00 15.60 ?  163 LEU A CB    1 
ATOM   207  C  CG    . LEU A 1  35  ? 17.531  -14.791 -18.759 1.00 19.25 ?  163 LEU A CG    1 
ATOM   208  C  CD1   . LEU A 1  35  ? 17.481  -16.270 -19.120 1.00 18.97 ?  163 LEU A CD1   1 
ATOM   209  C  CD2   . LEU A 1  35  ? 18.687  -14.101 -19.480 1.00 20.75 ?  163 LEU A CD2   1 
ATOM   210  N  N     . ALA A 1  36  ? 13.813  -12.013 -18.261 1.00 14.06 ?  164 ALA A N     1 
ATOM   211  C  CA    . ALA A 1  36  ? 12.522  -11.425 -18.590 1.00 11.40 ?  164 ALA A CA    1 
ATOM   212  C  C     . ALA A 1  36  ? 12.656  -9.932  -18.742 1.00 11.62 ?  164 ALA A C     1 
ATOM   213  O  O     . ALA A 1  36  ? 12.164  -9.350  -19.708 1.00 12.87 ?  164 ALA A O     1 
ATOM   214  C  CB    . ALA A 1  36  ? 11.489  -11.757 -17.497 1.00 12.98 ?  164 ALA A CB    1 
ATOM   215  N  N     . GLU A 1  37  ? 13.332  -9.320  -17.774 1.00 11.57 ?  165 GLU A N     1 
ATOM   216  C  CA    . GLU A 1  37  ? 13.596  -7.879  -17.782 1.00 13.55 ?  165 GLU A CA    1 
ATOM   217  C  C     . GLU A 1  37  ? 14.359  -7.479  -19.021 1.00 16.31 ?  165 GLU A C     1 
ATOM   218  O  O     . GLU A 1  37  ? 13.941  -6.549  -19.748 1.00 14.79 ?  165 GLU A O     1 
ATOM   219  C  CB    . GLU A 1  37  ? 14.382  -7.524  -16.496 1.00 21.14 ?  165 GLU A CB    1 
ATOM   220  C  CG    . GLU A 1  37  ? 14.588  -6.092  -16.215 1.00 32.22 ?  165 GLU A CG    1 
ATOM   221  C  CD    . GLU A 1  37  ? 15.326  -5.857  -14.877 1.00 32.16 ?  165 GLU A CD    1 
ATOM   222  O  OE1   . GLU A 1  37  ? 15.999  -6.794  -14.308 1.00 26.35 ?  165 GLU A OE1   1 
ATOM   223  O  OE2   . GLU A 1  37  ? 15.235  -4.702  -14.431 1.00 35.27 ?  165 GLU A OE2   1 
ATOM   224  N  N     . ALA A 1  38  ? 15.396  -8.235  -19.372 1.00 15.43 ?  166 ALA A N     1 
ATOM   225  C  CA    . ALA A 1  38  ? 16.138  -7.933  -20.596 1.00 20.09 ?  166 ALA A CA    1 
ATOM   226  C  C     . ALA A 1  38  ? 15.285  -8.093  -21.849 1.00 20.78 ?  166 ALA A C     1 
ATOM   227  O  O     . ALA A 1  38  ? 15.383  -7.305  -22.809 1.00 25.71 ?  166 ALA A O     1 
ATOM   228  C  CB    . ALA A 1  38  ? 17.377  -8.853  -20.678 1.00 19.22 ?  166 ALA A CB    1 
ATOM   229  N  N     . ALA A 1  39  ? 14.471  -9.125  -21.897 1.00 15.20 ?  167 ALA A N     1 
ATOM   230  C  CA    . ALA A 1  39  ? 13.591  -9.291  -23.047 1.00 16.99 ?  167 ALA A CA    1 
ATOM   231  C  C     . ALA A 1  39  ? 12.685  -8.078  -23.220 1.00 16.80 ?  167 ALA A C     1 
ATOM   232  O  O     . ALA A 1  39  ? 12.455  -7.616  -24.343 1.00 20.86 ?  167 ALA A O     1 
ATOM   233  C  CB    . ALA A 1  39  ? 12.760  -10.564 -22.891 1.00 19.34 ?  167 ALA A CB    1 
ATOM   234  N  N     . GLY A 1  40  ? 12.171  -7.543  -22.114 1.00 13.87 ?  168 GLY A N     1 
ATOM   235  C  CA    . GLY A 1  40  ? 11.352  -6.347  -22.193 1.00 20.34 ?  168 GLY A CA    1 
ATOM   236  C  C     . GLY A 1  40  ? 12.122  -5.145  -22.706 1.00 28.09 ?  168 GLY A C     1 
ATOM   237  O  O     . GLY A 1  40  ? 11.597  -4.345  -23.484 1.00 23.53 ?  168 GLY A O     1 
ATOM   238  N  N     . PHE A 1  41  ? 13.379  -5.001  -22.279 1.00 24.69 ?  169 PHE A N     1 
ATOM   239  C  CA    . PHE A 1  41  ? 14.190  -3.879  -22.739 1.00 25.20 ?  169 PHE A CA    1 
ATOM   240  C  C     . PHE A 1  41  ? 14.398  -3.925  -24.247 1.00 22.85 ?  169 PHE A C     1 
ATOM   241  O  O     . PHE A 1  41  ? 14.639  -2.887  -24.876 1.00 26.13 ?  169 PHE A O     1 
ATOM   242  C  CB    . PHE A 1  41  ? 15.544  -3.878  -22.025 1.00 22.36 ?  169 PHE A CB    1 
ATOM   243  C  CG    . PHE A 1  41  ? 15.465  -3.560  -20.553 1.00 26.83 ?  169 PHE A CG    1 
ATOM   244  C  CD1   . PHE A 1  41  ? 14.364  -2.911  -20.014 1.00 25.62 ?  169 PHE A CD1   1 
ATOM   245  C  CD2   . PHE A 1  41  ? 16.506  -3.909  -19.709 1.00 23.15 ?  169 PHE A CD2   1 
ATOM   246  C  CE1   . PHE A 1  41  ? 14.304  -2.623  -18.664 1.00 19.19 ?  169 PHE A CE1   1 
ATOM   247  C  CE2   . PHE A 1  41  ? 16.451  -3.621  -18.356 1.00 20.69 ?  169 PHE A CE2   1 
ATOM   248  C  CZ    . PHE A 1  41  ? 15.350  -2.979  -17.835 1.00 23.38 ?  169 PHE A CZ    1 
ATOM   249  N  N     . GLU A 1  42  ? 14.319  -5.113  -24.844 1.00 21.33 ?  170 GLU A N     1 
ATOM   250  C  CA    . GLU A 1  42  ? 14.502  -5.283  -26.277 1.00 33.29 ?  170 GLU A CA    1 
ATOM   251  C  C     . GLU A 1  42  ? 13.173  -5.395  -27.019 1.00 35.32 ?  170 GLU A C     1 
ATOM   252  O  O     . GLU A 1  42  ? 13.139  -5.878  -28.156 1.00 44.83 ?  170 GLU A O     1 
ATOM   253  C  CB    . GLU A 1  42  ? 15.380  -6.507  -26.546 1.00 33.45 ?  170 GLU A CB    1 
ATOM   254  C  CG    . GLU A 1  42  ? 16.713  -6.476  -25.797 1.00 39.90 ?  170 GLU A CG    1 
ATOM   255  C  CD    . GLU A 1  42  ? 17.453  -5.155  -25.957 1.00 48.60 ?  170 GLU A CD    1 
ATOM   256  O  OE1   . GLU A 1  42  ? 17.560  -4.664  -27.100 1.00 56.40 ?  170 GLU A OE1   1 
ATOM   257  O  OE2   . GLU A 1  42  ? 17.918  -4.602  -24.937 1.00 36.35 ?  170 GLU A OE2   1 
ATOM   258  N  N     . GLY A 1  43  ? 12.082  -4.960  -26.395 1.00 30.55 ?  171 GLY A N     1 
ATOM   259  C  CA    . GLY A 1  43  ? 10.797  -4.876  -27.056 1.00 30.43 ?  171 GLY A CA    1 
ATOM   260  C  C     . GLY A 1  43  ? 10.040  -6.177  -27.203 1.00 33.83 ?  171 GLY A C     1 
ATOM   261  O  O     . GLY A 1  43  ? 9.021   -6.202  -27.903 1.00 36.20 ?  171 GLY A O     1 
ATOM   262  N  N     . SER A 1  44  ? 10.486  -7.259  -26.562 1.00 26.95 ?  172 SER A N     1 
ATOM   263  C  CA    . SER A 1  44  ? 9.863   -8.571  -26.746 1.00 27.42 ?  172 SER A CA    1 
ATOM   264  C  C     . SER A 1  44  ? 8.988   -8.874  -25.533 1.00 25.31 ?  172 SER A C     1 
ATOM   265  O  O     . SER A 1  44  ? 9.387   -9.552  -24.583 1.00 17.63 ?  172 SER A O     1 
ATOM   266  C  CB    . SER A 1  44  ? 10.918  -9.647  -26.963 1.00 34.79 ?  172 SER A CB    1 
ATOM   267  O  OG    . SER A 1  44  ? 10.296  -10.904 -27.164 1.00 42.48 ?  172 SER A OG    1 
ATOM   268  N  N     . GLU A 1  45  ? 7.758   -8.361  -25.587 1.00 17.71 ?  173 GLU A N     1 
ATOM   269  C  CA    . GLU A 1  45  ? 6.806   -8.600  -24.510 1.00 25.07 ?  173 GLU A CA    1 
ATOM   270  C  C     . GLU A 1  45  ? 6.509   -10.085 -24.350 1.00 17.89 ?  173 GLU A C     1 
ATOM   271  O  O     . GLU A 1  45  ? 6.309   -10.561 -23.226 1.00 16.71 ?  173 GLU A O     1 
ATOM   272  C  CB    . GLU A 1  45  ? 5.518   -7.826  -24.786 1.00 34.52 ?  173 GLU A CB    1 
ATOM   273  C  CG    . GLU A 1  45  ? 4.656   -7.591  -23.565 1.00 47.12 ?  173 GLU A CG    1 
ATOM   274  C  CD    . GLU A 1  45  ? 5.191   -6.486  -22.677 1.00 51.04 ?  173 GLU A CD    1 
ATOM   275  O  OE1   . GLU A 1  45  ? 6.362   -6.089  -22.853 1.00 47.96 ?  173 GLU A OE1   1 
ATOM   276  O  OE2   . GLU A 1  45  ? 4.434   -6.009  -21.807 1.00 57.48 ?  173 GLU A OE2   1 
ATOM   277  N  N     . GLY A 1  46  ? 6.480   -10.831 -25.456 1.00 18.72 ?  174 GLY A N     1 
ATOM   278  C  CA    . GLY A 1  46  ? 6.182   -12.253 -25.378 1.00 15.45 ?  174 GLY A CA    1 
ATOM   279  C  C     . GLY A 1  46  ? 7.241   -13.034 -24.623 1.00 17.16 ?  174 GLY A C     1 
ATOM   280  O  O     . GLY A 1  46  ? 6.925   -13.857 -23.758 1.00 15.37 ?  174 GLY A O     1 
ATOM   281  N  N     . ARG A 1  47  ? 8.514   -12.802 -24.949 1.00 18.85 ?  175 ARG A N     1 
ATOM   282  C  CA    . ARG A 1  47  ? 9.592   -13.472 -24.227 1.00 14.42 ?  175 ARG A CA    1 
ATOM   283  C  C     . ARG A 1  47  ? 9.624   -13.044 -22.762 1.00 12.75 ?  175 ARG A C     1 
ATOM   284  O  O     . ARG A 1  47  ? 9.865   -13.868 -21.871 1.00 14.13 ?  175 ARG A O     1 
ATOM   285  C  CB    . ARG A 1  47  ? 10.934  -13.188 -24.907 1.00 23.24 ?  175 ARG A CB    1 
ATOM   286  C  CG    . ARG A 1  47  ? 11.057  -13.792 -26.300 1.00 21.63 ?  175 ARG A CG    1 
ATOM   287  C  CD    . ARG A 1  47  ? 12.392  -13.463 -26.971 1.00 25.48 ?  175 ARG A CD    1 
ATOM   288  N  NE    . ARG A 1  47  ? 13.483  -14.297 -26.471 1.00 46.46 ?  175 ARG A NE    1 
ATOM   289  C  CZ    . ARG A 1  47  ? 14.529  -13.867 -25.764 1.00 49.71 ?  175 ARG A CZ    1 
ATOM   290  N  NH1   . ARG A 1  47  ? 14.673  -12.583 -25.456 1.00 44.85 ?  175 ARG A NH1   1 
ATOM   291  N  NH2   . ARG A 1  47  ? 15.450  -14.738 -25.370 1.00 30.36 ?  175 ARG A NH2   1 
ATOM   292  N  N     . LEU A 1  48  ? 9.379   -11.762 -22.489 1.00 12.53 ?  176 LEU A N     1 
ATOM   293  C  CA    . LEU A 1  48  ? 9.292   -11.311 -21.103 1.00 13.01 ?  176 LEU A CA    1 
ATOM   294  C  C     . LEU A 1  48  ? 8.239   -12.103 -20.340 1.00 17.16 ?  176 LEU A C     1 
ATOM   295  O  O     . LEU A 1  48  ? 8.479   -12.560 -19.216 1.00 11.75 ?  176 LEU A O     1 
ATOM   296  C  CB    . LEU A 1  48  ? 8.973   -9.816  -21.052 1.00 11.49 ?  176 LEU A CB    1 
ATOM   297  C  CG    . LEU A 1  48  ? 8.735   -9.202  -19.667 1.00 20.35 ?  176 LEU A CG    1 
ATOM   298  C  CD1   . LEU A 1  48  ? 9.206   -7.766  -19.664 1.00 16.93 ?  176 LEU A CD1   1 
ATOM   299  C  CD2   . LEU A 1  48  ? 7.258   -9.265  -19.244 1.00 19.36 ?  176 LEU A CD2   1 
ATOM   300  N  N     . LEU A 1  49  ? 7.079   -12.251 -20.941 1.00 15.31 ?  177 LEU A N     1 
ATOM   301  C  CA    . LEU A 1  49  ? 6.020   -12.956 -20.229 1.00 19.38 ?  177 LEU A CA    1 
ATOM   302  C  C     . LEU A 1  49  ? 6.410   -14.408 -19.975 1.00 13.66 ?  177 LEU A C     1 
ATOM   303  O  O     . LEU A 1  49  ? 6.119   -14.960 -18.913 1.00 10.74 ?  177 LEU A O     1 
ATOM   304  C  CB    . LEU A 1  49  ? 4.698   -12.886 -21.014 1.00 10.81 ?  177 LEU A CB    1 
ATOM   305  C  CG    . LEU A 1  49  ? 3.926   -11.616 -20.976 1.00 16.43 ?  177 LEU A CG    1 
ATOM   306  C  CD1   . LEU A 1  49  ? 2.744   -11.599 -21.977 1.00 15.14 ?  177 LEU A CD1   1 
ATOM   307  C  CD2   . LEU A 1  49  ? 3.355   -11.450 -19.568 1.00 12.96 ?  177 LEU A CD2   1 
ATOM   308  N  N     . THR A 1  50  ? 6.941   -15.095 -20.979 1.00 13.17 ?  178 THR A N     1 
ATOM   309  C  CA    . THR A 1  50  ? 7.298   -16.483 -20.738 1.00 12.70 ?  178 THR A CA    1 
ATOM   310  C  C     . THR A 1  50  ? 8.308   -16.602 -19.601 1.00 14.60 ?  178 THR A C     1 
ATOM   311  O  O     . THR A 1  50  ? 8.131   -17.430 -18.691 1.00 11.88 ?  178 THR A O     1 
ATOM   312  C  CB    . THR A 1  50  ? 7.807   -17.137 -22.015 1.00 12.64 ?  178 THR A CB    1 
ATOM   313  O  OG1   . THR A 1  50  ? 6.693   -17.446 -22.865 1.00 15.22 ?  178 THR A OG1   1 
ATOM   314  C  CG2   . THR A 1  50  ? 8.545   -18.455 -21.724 1.00 15.02 ?  178 THR A CG2   1 
ATOM   315  N  N     . PHE A 1  51  ? 9.364   -15.791 -19.623 1.00 11.24 ?  179 PHE A N     1 
ATOM   316  C  CA    . PHE A 1  51  ? 10.363  -15.918 -18.560 1.00 12.83 ?  179 PHE A CA    1 
ATOM   317  C  C     . PHE A 1  51  ? 9.768   -15.546 -17.203 1.00 11.52 ?  179 PHE A C     1 
ATOM   318  O  O     . PHE A 1  51  ? 10.115  -16.186 -16.196 1.00 13.46 ?  179 PHE A O     1 
ATOM   319  C  CB    . PHE A 1  51  ? 11.562  -15.037 -18.844 1.00 11.39 ?  179 PHE A CB    1 
ATOM   320  C  CG    . PHE A 1  51  ? 12.499  -15.601 -19.893 1.00 15.08 ?  179 PHE A CG    1 
ATOM   321  C  CD1   . PHE A 1  51  ? 12.977  -16.883 -19.823 1.00 15.98 ?  179 PHE A CD1   1 
ATOM   322  C  CD2   . PHE A 1  51  ? 12.884  -14.802 -20.942 1.00 14.81 ?  179 PHE A CD2   1 
ATOM   323  C  CE1   . PHE A 1  51  ? 13.861  -17.381 -20.827 1.00 20.26 ?  179 PHE A CE1   1 
ATOM   324  C  CE2   . PHE A 1  51  ? 13.831  -15.304 -21.927 1.00 14.18 ?  179 PHE A CE2   1 
ATOM   325  C  CZ    . PHE A 1  51  ? 14.273  -16.584 -21.829 1.00 14.59 ?  179 PHE A CZ    1 
ATOM   326  N  N     . CYS A 1  52  ? 8.935   -14.487 -17.136 1.00 11.64 ?  180 CYS A N     1 
ATOM   327  C  CA    . CYS A 1  52  ? 8.223   -14.155 -15.867 1.00 11.36 ?  180 CYS A CA    1 
ATOM   328  C  C     . CYS A 1  52  ? 7.346   -15.293 -15.384 1.00 10.42 ?  180 CYS A C     1 
ATOM   329  O  O     . CYS A 1  52  ? 7.323   -15.591 -14.193 1.00 11.71 ?  180 CYS A O     1 
ATOM   330  C  CB    . CYS A 1  52  ? 7.333   -12.926 -15.984 1.00 13.66 ?  180 CYS A CB    1 
ATOM   331  S  SG    . CYS A 1  52  ? 8.157   -11.392 -16.089 1.00 22.27 ?  180 CYS A SG    1 
ATOM   332  N  N     . ARG A 1  53  ? 6.581   -15.928 -16.303 1.00 9.38  ?  181 ARG A N     1 
ATOM   333  C  CA    . ARG A 1  53  ? 5.727   -17.038 -15.927 1.00 11.32 ?  181 ARG A CA    1 
ATOM   334  C  C     . ARG A 1  53  ? 6.534   -18.231 -15.429 1.00 15.33 ?  181 ARG A C     1 
ATOM   335  O  O     . ARG A 1  53  ? 6.173   -18.864 -14.438 1.00 10.90 ?  181 ARG A O     1 
ATOM   336  C  CB    . ARG A 1  53  ? 4.848   -17.433 -17.093 1.00 9.92  ?  181 ARG A CB    1 
ATOM   337  C  CG    . ARG A 1  53  ? 3.801   -16.412 -17.498 1.00 12.15 ?  181 ARG A CG    1 
ATOM   338  C  CD    . ARG A 1  53  ? 3.232   -16.795 -18.890 1.00 10.54 ?  181 ARG A CD    1 
ATOM   339  N  NE    . ARG A 1  53  ? 2.259   -15.824 -19.419 1.00 11.93 ?  181 ARG A NE    1 
ATOM   340  C  CZ    . ARG A 1  53  ? 1.900   -15.721 -20.687 1.00 12.48 ?  181 ARG A CZ    1 
ATOM   341  N  NH1   . ARG A 1  53  ? 2.367   -16.551 -21.595 1.00 12.21 ?  181 ARG A NH1   1 
ATOM   342  N  NH2   . ARG A 1  53  ? 1.039   -14.795 -21.052 1.00 13.11 ?  181 ARG A NH2   1 
ATOM   343  N  N     . ALA A 1  54  ? 7.621   -18.566 -16.106 1.00 13.46 ?  182 ALA A N     1 
ATOM   344  C  CA    . ALA A 1  54  ? 8.457   -19.675 -15.656 1.00 16.63 ?  182 ALA A CA    1 
ATOM   345  C  C     . ALA A 1  54  ? 9.031   -19.389 -14.276 1.00 12.57 ?  182 ALA A C     1 
ATOM   346  O  O     . ALA A 1  54  ? 9.051   -20.262 -13.400 1.00 14.16 ?  182 ALA A O     1 
ATOM   347  C  CB    . ALA A 1  54  ? 9.574   -19.931 -16.667 1.00 12.77 ?  182 ALA A CB    1 
ATOM   348  N  N     . ALA A 1  55  ? 9.503   -18.161 -14.064 1.00 11.57 ?  183 ALA A N     1 
ATOM   349  C  CA    . ALA A 1  55  ? 9.981   -17.769 -12.746 1.00 15.84 ?  183 ALA A CA    1 
ATOM   350  C  C     . ALA A 1  55  ? 8.887   -17.931 -11.702 1.00 14.13 ?  183 ALA A C     1 
ATOM   351  O  O     . ALA A 1  55  ? 9.141   -18.425 -10.597 1.00 13.11 ?  183 ALA A O     1 
ATOM   352  C  CB    . ALA A 1  55  ? 10.477  -16.325 -12.782 1.00 10.81 ?  183 ALA A CB    1 
ATOM   353  N  N     . SER A 1  56  ? 7.654   -17.543 -12.045 1.00 14.66 ?  184 SER A N     1 
ATOM   354  C  CA    A SER A 1  56  ? 6.557   -17.614 -11.087 0.53 10.56 ?  184 SER A CA    1 
ATOM   355  C  CA    B SER A 1  56  ? 6.560   -17.616 -11.082 0.47 10.58 ?  184 SER A CA    1 
ATOM   356  C  C     . SER A 1  56  ? 6.179   -19.057 -10.771 1.00 12.01 ?  184 SER A C     1 
ATOM   357  O  O     . SER A 1  56  ? 5.780   -19.359 -9.641  1.00 14.17 ?  184 SER A O     1 
ATOM   358  C  CB    A SER A 1  56  ? 5.348   -16.848 -11.627 0.53 8.80  ?  184 SER A CB    1 
ATOM   359  C  CB    B SER A 1  56  ? 5.342   -16.853 -11.607 0.47 8.95  ?  184 SER A CB    1 
ATOM   360  O  OG    A SER A 1  56  ? 4.273   -16.875 -10.707 0.53 8.11  ?  184 SER A OG    1 
ATOM   361  O  OG    B SER A 1  56  ? 4.672   -17.587 -12.618 0.47 8.75  ?  184 SER A OG    1 
ATOM   362  N  N     . VAL A 1  57  ? 6.282   -19.955 -11.753 1.00 13.27 ?  185 VAL A N     1 
ATOM   363  C  CA    . VAL A 1  57  ? 6.025   -21.369 -11.485 1.00 9.99  ?  185 VAL A CA    1 
ATOM   364  C  C     . VAL A 1  57  ? 6.958   -21.872 -10.390 1.00 11.50 ?  185 VAL A C     1 
ATOM   365  O  O     . VAL A 1  57  ? 6.537   -22.598 -9.482  1.00 11.27 ?  185 VAL A O     1 
ATOM   366  C  CB    . VAL A 1  57  ? 6.166   -22.199 -12.777 1.00 11.21 ?  185 VAL A CB    1 
ATOM   367  C  CG1   . VAL A 1  57  ? 6.229   -23.689 -12.467 1.00 17.91 ?  185 VAL A CG1   1 
ATOM   368  C  CG2   . VAL A 1  57  ? 5.001   -21.924 -13.717 1.00 14.08 ?  185 VAL A CG2   1 
ATOM   369  N  N     . LEU A 1  58  ? 8.238   -21.494 -10.456 1.00 11.08 ?  186 LEU A N     1 
ATOM   370  C  CA    . LEU A 1  58  ? 9.188   -21.929 -9.435  1.00 12.59 ?  186 LEU A CA    1 
ATOM   371  C  C     . LEU A 1  58  ? 8.830   -21.360 -8.066  1.00 16.05 ?  186 LEU A C     1 
ATOM   372  O  O     . LEU A 1  58  ? 9.036   -22.019 -7.038  1.00 14.63 ?  186 LEU A O     1 
ATOM   373  C  CB    . LEU A 1  58  ? 10.608  -21.522 -9.826  1.00 14.94 ?  186 LEU A CB    1 
ATOM   374  C  CG    . LEU A 1  58  ? 11.174  -22.103 -11.127 1.00 11.08 ?  186 LEU A CG    1 
ATOM   375  C  CD1   . LEU A 1  58  ? 12.625  -21.671 -11.315 1.00 17.28 ?  186 LEU A CD1   1 
ATOM   376  C  CD2   . LEU A 1  58  ? 11.060  -23.615 -11.159 1.00 15.93 ?  186 LEU A CD2   1 
ATOM   377  N  N     . LYS A 1  59  ? 8.302   -20.132 -8.028  1.00 12.27 ?  187 LYS A N     1 
ATOM   378  C  CA    . LYS A 1  59  ? 7.881   -19.550 -6.756  1.00 12.67 ?  187 LYS A CA    1 
ATOM   379  C  C     . LYS A 1  59  ? 6.748   -20.348 -6.126  1.00 12.28 ?  187 LYS A C     1 
ATOM   380  O  O     . LYS A 1  59  ? 6.609   -20.372 -4.895  1.00 12.18 ?  187 LYS A O     1 
ATOM   381  C  CB    . LYS A 1  59  ? 7.437   -18.099 -6.955  1.00 11.32 ?  187 LYS A CB    1 
ATOM   382  C  CG    . LYS A 1  59  ? 8.459   -17.205 -7.623  1.00 13.39 ?  187 LYS A CG    1 
ATOM   383  C  CD    . LYS A 1  59  ? 7.937   -15.782 -7.759  1.00 13.63 ?  187 LYS A CD    1 
ATOM   384  C  CE    . LYS A 1  59  ? 8.834   -14.939 -8.648  1.00 16.05 ?  187 LYS A CE    1 
ATOM   385  N  NZ    . LYS A 1  59  ? 8.178   -13.652 -9.023  1.00 16.48 ?  187 LYS A NZ    1 
ATOM   386  N  N     . ALA A 1  60  ? 5.937   -21.010 -6.947  1.00 12.15 ?  188 ALA A N     1 
ATOM   387  C  CA    . ALA A 1  60  ? 4.766   -21.728 -6.467  1.00 15.87 ?  188 ALA A CA    1 
ATOM   388  C  C     . ALA A 1  60  ? 5.079   -23.150 -6.024  1.00 15.08 ?  188 ALA A C     1 
ATOM   389  O  O     . ALA A 1  60  ? 4.215   -23.798 -5.426  1.00 13.81 ?  188 ALA A O     1 
ATOM   390  C  CB    . ALA A 1  60  ? 3.692   -21.759 -7.560  1.00 15.19 ?  188 ALA A CB    1 
ATOM   391  N  N     . LEU A 1  61  ? 6.284   -23.643 -6.294  1.00 14.53 ?  189 LEU A N     1 
ATOM   392  C  CA    . LEU A 1  61  ? 6.626   -25.012 -5.952  1.00 14.15 ?  189 LEU A CA    1 
ATOM   393  C  C     . LEU A 1  61  ? 6.776   -25.169 -4.439  1.00 13.91 ?  189 LEU A C     1 
ATOM   394  O  O     . LEU A 1  61  ? 7.092   -24.208 -3.736  1.00 12.61 ?  189 LEU A O     1 
ATOM   395  C  CB    . LEU A 1  61  ? 7.919   -25.428 -6.643  1.00 16.07 ?  189 LEU A CB    1 
ATOM   396  C  CG    . LEU A 1  61  ? 7.826   -25.664 -8.153  1.00 15.58 ?  189 LEU A CG    1 
ATOM   397  C  CD1   . LEU A 1  61  ? 9.212   -25.851 -8.754  1.00 17.87 ?  189 LEU A CD1   1 
ATOM   398  C  CD2   . LEU A 1  61  ? 6.956   -26.868 -8.450  1.00 13.62 ?  189 LEU A CD2   1 
ATOM   399  N  N     . PRO A 1  62  ? 6.558   -26.382 -3.916  1.00 13.07 ?  190 PRO A N     1 
ATOM   400  C  CA    . PRO A 1  62  ? 6.617   -26.583 -2.462  1.00 14.40 ?  190 PRO A CA    1 
ATOM   401  C  C     . PRO A 1  62  ? 8.010   -26.850 -1.911  1.00 13.82 ?  190 PRO A C     1 
ATOM   402  O  O     . PRO A 1  62  ? 8.155   -26.955 -0.685  1.00 16.67 ?  190 PRO A O     1 
ATOM   403  C  CB    . PRO A 1  62  ? 5.715   -27.802 -2.254  1.00 17.57 ?  190 PRO A CB    1 
ATOM   404  C  CG    . PRO A 1  62  ? 5.911   -28.598 -3.505  1.00 20.12 ?  190 PRO A CG    1 
ATOM   405  C  CD    . PRO A 1  62  ? 6.058   -27.581 -4.611  1.00 13.92 ?  190 PRO A CD    1 
ATOM   406  N  N     . SER A 1  63  ? 9.030   -26.977 -2.752  1.00 15.62 ?  191 SER A N     1 
ATOM   407  C  CA    . SER A 1  63  ? 10.369  -27.285 -2.271  1.00 14.31 ?  191 SER A CA    1 
ATOM   408  C  C     . SER A 1  63  ? 11.363  -26.927 -3.368  1.00 15.29 ?  191 SER A C     1 
ATOM   409  O  O     . SER A 1  63  ? 10.966  -26.617 -4.500  1.00 15.08 ?  191 SER A O     1 
ATOM   410  C  CB    . SER A 1  63  ? 10.488  -28.767 -1.874  1.00 15.58 ?  191 SER A CB    1 
ATOM   411  O  OG    . SER A 1  63  ? 10.337  -29.588 -3.016  1.00 21.51 ?  191 SER A OG    1 
ATOM   412  N  N     . PRO A 1  64  ? 12.662  -26.958 -3.068  1.00 15.70 ?  192 PRO A N     1 
ATOM   413  C  CA    . PRO A 1  64  ? 13.655  -26.550 -4.068  1.00 15.69 ?  192 PRO A CA    1 
ATOM   414  C  C     . PRO A 1  64  ? 13.724  -27.524 -5.231  1.00 19.69 ?  192 PRO A C     1 
ATOM   415  O  O     . PRO A 1  64  ? 13.597  -28.738 -5.060  1.00 15.83 ?  192 PRO A O     1 
ATOM   416  C  CB    . PRO A 1  64  ? 14.971  -26.537 -3.279  1.00 16.64 ?  192 PRO A CB    1 
ATOM   417  C  CG    . PRO A 1  64  ? 14.570  -26.430 -1.853  1.00 15.30 ?  192 PRO A CG    1 
ATOM   418  C  CD    . PRO A 1  64  ? 13.279  -27.186 -1.752  1.00 15.45 ?  192 PRO A CD    1 
ATOM   419  N  N     . VAL A 1  65  ? 13.923  -26.974 -6.426  1.00 16.18 ?  193 VAL A N     1 
ATOM   420  C  CA    . VAL A 1  65  ? 14.286  -27.779 -7.587  1.00 15.28 ?  193 VAL A CA    1 
ATOM   421  C  C     . VAL A 1  65  ? 15.756  -28.157 -7.455  1.00 22.39 ?  193 VAL A C     1 
ATOM   422  O  O     . VAL A 1  65  ? 16.623  -27.282 -7.356  1.00 15.92 ?  193 VAL A O     1 
ATOM   423  C  CB    . VAL A 1  65  ? 14.027  -27.017 -8.894  1.00 16.53 ?  193 VAL A CB    1 
ATOM   424  C  CG1   . VAL A 1  65  ? 14.563  -27.804 -10.095 1.00 18.50 ?  193 VAL A CG1   1 
ATOM   425  C  CG2   . VAL A 1  65  ? 12.544  -26.736 -9.048  1.00 14.02 ?  193 VAL A CG2   1 
ATOM   426  N  N     . THR A 1  66  ? 16.039  -29.460 -7.453  1.00 22.95 ?  194 THR A N     1 
ATOM   427  C  CA    . THR A 1  66  ? 17.403  -29.962 -7.345  1.00 25.71 ?  194 THR A CA    1 
ATOM   428  C  C     . THR A 1  66  ? 17.899  -30.656 -8.602  1.00 29.83 ?  194 THR A C     1 
ATOM   429  O  O     . THR A 1  66  ? 19.109  -30.696 -8.829  1.00 25.14 ?  194 THR A O     1 
ATOM   430  C  CB    . THR A 1  66  ? 17.522  -30.951 -6.177  1.00 24.80 ?  194 THR A CB    1 
ATOM   431  O  OG1   . THR A 1  66  ? 16.564  -32.004 -6.340  1.00 30.44 ?  194 THR A OG1   1 
ATOM   432  C  CG2   . THR A 1  66  ? 17.285  -30.255 -4.850  1.00 30.07 ?  194 THR A CG2   1 
ATOM   433  N  N     . THR A 1  67  ? 17.000  -31.198 -9.418  1.00 27.06 ?  195 THR A N     1 
ATOM   434  C  CA    . THR A 1  67  ? 17.373  -31.928 -10.619 1.00 30.94 ?  195 THR A CA    1 
ATOM   435  C  C     . THR A 1  67  ? 16.527  -31.443 -11.784 1.00 28.13 ?  195 THR A C     1 
ATOM   436  O  O     . THR A 1  67  ? 15.391  -30.994 -11.603 1.00 22.55 ?  195 THR A O     1 
ATOM   437  C  CB    . THR A 1  67  ? 17.189  -33.445 -10.442 1.00 35.83 ?  195 THR A CB    1 
ATOM   438  O  OG1   . THR A 1  67  ? 15.792  -33.760 -10.393 1.00 40.07 ?  195 THR A OG1   1 
ATOM   439  C  CG2   . THR A 1  67  ? 17.846  -33.915 -9.159  1.00 36.81 ?  195 THR A CG2   1 
ATOM   440  N  N     . LEU A 1  68  ? 17.090  -31.546 -12.989 1.00 30.68 ?  196 LEU A N     1 
ATOM   441  C  CA    . LEU A 1  68  ? 16.384  -31.071 -14.173 1.00 32.69 ?  196 LEU A CA    1 
ATOM   442  C  C     . LEU A 1  68  ? 15.101  -31.855 -14.407 1.00 33.22 ?  196 LEU A C     1 
ATOM   443  O  O     . LEU A 1  68  ? 14.127  -31.308 -14.940 1.00 31.07 ?  196 LEU A O     1 
ATOM   444  C  CB    . LEU A 1  68  ? 17.294  -31.165 -15.397 1.00 37.90 ?  196 LEU A CB    1 
ATOM   445  C  CG    . LEU A 1  68  ? 16.856  -30.325 -16.598 1.00 45.02 ?  196 LEU A CG    1 
ATOM   446  N  N     . SER A 1  69  ? 15.075  -33.132 -14.014 1.00 29.00 ?  197 SER A N     1 
ATOM   447  C  CA    . SER A 1  69  ? 13.889  -33.951 -14.242 1.00 37.05 ?  197 SER A CA    1 
ATOM   448  C  C     . SER A 1  69  ? 12.667  -33.360 -13.556 1.00 34.01 ?  197 SER A C     1 
ATOM   449  O  O     . SER A 1  69  ? 11.539  -33.538 -14.032 1.00 33.72 ?  197 SER A O     1 
ATOM   450  C  CB    . SER A 1  69  ? 14.132  -35.382 -13.754 1.00 34.98 ?  197 SER A CB    1 
ATOM   451  O  OG    . SER A 1  69  ? 14.240  -35.435 -12.342 1.00 38.38 ?  197 SER A OG    1 
ATOM   452  N  N     . GLN A 1  70  ? 12.870  -32.645 -12.449 1.00 27.15 ?  198 GLN A N     1 
ATOM   453  C  CA    . GLN A 1  70  ? 11.758  -32.040 -11.729 1.00 28.54 ?  198 GLN A CA    1 
ATOM   454  C  C     . GLN A 1  70  ? 11.071  -30.946 -12.537 1.00 23.27 ?  198 GLN A C     1 
ATOM   455  O  O     . GLN A 1  70  ? 9.961   -30.539 -12.182 1.00 25.08 ?  198 GLN A O     1 
ATOM   456  C  CB    . GLN A 1  70  ? 12.256  -31.487 -10.395 1.00 30.73 ?  198 GLN A CB    1 
ATOM   457  C  CG    . GLN A 1  70  ? 12.660  -32.583 -9.414  1.00 38.02 ?  198 GLN A CG    1 
ATOM   458  C  CD    . GLN A 1  70  ? 13.477  -32.070 -8.242  1.00 35.64 ?  198 GLN A CD    1 
ATOM   459  O  OE1   . GLN A 1  70  ? 14.104  -31.012 -8.317  1.00 29.63 ?  198 GLN A OE1   1 
ATOM   460  N  NE2   . GLN A 1  70  ? 13.474  -32.824 -7.149  1.00 31.42 ?  198 GLN A NE2   1 
ATOM   461  N  N     . LEU A 1  71  ? 11.696  -30.466 -13.613 1.00 22.80 ?  199 LEU A N     1 
ATOM   462  C  CA    . LEU A 1  71  ? 11.051  -29.490 -14.482 1.00 20.97 ?  199 LEU A CA    1 
ATOM   463  C  C     . LEU A 1  71  ? 10.103  -30.129 -15.487 1.00 29.58 ?  199 LEU A C     1 
ATOM   464  O  O     . LEU A 1  71  ? 9.242   -29.431 -16.032 1.00 23.80 ?  199 LEU A O     1 
ATOM   465  C  CB    . LEU A 1  71  ? 12.097  -28.677 -15.245 1.00 21.47 ?  199 LEU A CB    1 
ATOM   466  C  CG    . LEU A 1  71  ? 13.030  -27.769 -14.447 1.00 22.75 ?  199 LEU A CG    1 
ATOM   467  C  CD1   . LEU A 1  71  ? 13.914  -27.016 -15.413 1.00 21.76 ?  199 LEU A CD1   1 
ATOM   468  C  CD2   . LEU A 1  71  ? 12.262  -26.801 -13.556 1.00 16.12 ?  199 LEU A CD2   1 
ATOM   469  N  N     . GLN A 1  72  ? 10.238  -31.429 -15.744 1.00 31.03 ?  200 GLN A N     1 
ATOM   470  C  CA    . GLN A 1  72  ? 9.387   -32.085 -16.726 1.00 31.20 ?  200 GLN A CA    1 
ATOM   471  C  C     . GLN A 1  72  ? 7.924   -31.908 -16.349 1.00 28.76 ?  200 GLN A C     1 
ATOM   472  O  O     . GLN A 1  72  ? 7.536   -32.105 -15.194 1.00 32.26 ?  200 GLN A O     1 
ATOM   473  C  CB    . GLN A 1  72  ? 9.741   -33.571 -16.822 1.00 33.95 ?  200 GLN A CB    1 
ATOM   474  N  N     . GLY A 1  73  ? 7.114   -31.507 -17.323 1.00 33.93 ?  201 GLY A N     1 
ATOM   475  C  CA    . GLY A 1  73  ? 5.702   -31.304 -17.096 1.00 40.11 ?  201 GLY A CA    1 
ATOM   476  C  C     . GLY A 1  73  ? 5.333   -29.976 -16.469 1.00 35.31 ?  201 GLY A C     1 
ATOM   477  O  O     . GLY A 1  73  ? 4.139   -29.670 -16.372 1.00 33.55 ?  201 GLY A O     1 
ATOM   478  N  N     . LEU A 1  74  ? 6.304   -29.176 -16.039 1.00 31.08 ?  202 LEU A N     1 
ATOM   479  C  CA    . LEU A 1  74  ? 5.976   -27.871 -15.476 1.00 24.74 ?  202 LEU A CA    1 
ATOM   480  C  C     . LEU A 1  74  ? 5.633   -26.901 -16.602 1.00 18.80 ?  202 LEU A C     1 
ATOM   481  O  O     . LEU A 1  74  ? 6.386   -26.805 -17.576 1.00 21.47 ?  202 LEU A O     1 
ATOM   482  C  CB    . LEU A 1  74  ? 7.135   -27.317 -14.648 1.00 21.52 ?  202 LEU A CB    1 
ATOM   483  C  CG    . LEU A 1  74  ? 7.434   -27.996 -13.308 1.00 24.76 ?  202 LEU A CG    1 
ATOM   484  C  CD1   . LEU A 1  74  ? 8.566   -27.271 -12.597 1.00 22.26 ?  202 LEU A CD1   1 
ATOM   485  C  CD2   . LEU A 1  74  ? 6.201   -28.051 -12.413 1.00 26.82 ?  202 LEU A CD2   1 
ATOM   486  N  N     . PRO A 1  75  ? 4.516   -26.182 -16.517 1.00 20.73 ?  203 PRO A N     1 
ATOM   487  C  CA    . PRO A 1  75  ? 4.166   -25.249 -17.593 1.00 21.92 ?  203 PRO A CA    1 
ATOM   488  C  C     . PRO A 1  75  ? 5.185   -24.126 -17.719 1.00 20.63 ?  203 PRO A C     1 
ATOM   489  O  O     . PRO A 1  75  ? 5.755   -23.660 -16.729 1.00 16.87 ?  203 PRO A O     1 
ATOM   490  C  CB    . PRO A 1  75  ? 2.790   -24.720 -17.173 1.00 18.33 ?  203 PRO A CB    1 
ATOM   491  C  CG    . PRO A 1  75  ? 2.703   -24.988 -15.704 1.00 27.81 ?  203 PRO A CG    1 
ATOM   492  C  CD    . PRO A 1  75  ? 3.462   -26.253 -15.491 1.00 20.52 ?  203 PRO A CD    1 
ATOM   493  N  N     . HIS A 1  76  ? 5.411   -23.702 -18.964 1.00 20.11 ?  204 HIS A N     1 
ATOM   494  C  CA    . HIS A 1  76  ? 6.253   -22.568 -19.348 1.00 18.06 ?  204 HIS A CA    1 
ATOM   495  C  C     . HIS A 1  76  ? 7.738   -22.877 -19.244 1.00 18.89 ?  204 HIS A C     1 
ATOM   496  O  O     . HIS A 1  76  ? 8.557   -21.952 -19.309 1.00 27.11 ?  204 HIS A O     1 
ATOM   497  C  CB    . HIS A 1  76  ? 5.928   -21.321 -18.522 1.00 14.65 ?  204 HIS A CB    1 
ATOM   498  C  CG    . HIS A 1  76  ? 4.472   -20.991 -18.511 1.00 14.00 ?  204 HIS A CG    1 
ATOM   499  N  ND1   . HIS A 1  76  ? 3.813   -20.505 -19.619 1.00 13.26 ?  204 HIS A ND1   1 
ATOM   500  C  CD2   . HIS A 1  76  ? 3.535   -21.119 -17.542 1.00 17.62 ?  204 HIS A CD2   1 
ATOM   501  C  CE1   . HIS A 1  76  ? 2.536   -20.330 -19.328 1.00 15.80 ?  204 HIS A CE1   1 
ATOM   502  N  NE2   . HIS A 1  76  ? 2.342   -20.694 -18.073 1.00 17.10 ?  204 HIS A NE2   1 
ATOM   503  N  N     . PHE A 1  77  ? 8.116   -24.141 -19.101 1.00 16.78 ?  205 PHE A N     1 
ATOM   504  C  CA    . PHE A 1  77  ? 9.516   -24.545 -19.136 1.00 19.23 ?  205 PHE A CA    1 
ATOM   505  C  C     . PHE A 1  77  ? 9.763   -25.336 -20.413 1.00 23.40 ?  205 PHE A C     1 
ATOM   506  O  O     . PHE A 1  77  ? 9.441   -26.524 -20.495 1.00 39.60 ?  205 PHE A O     1 
ATOM   507  C  CB    . PHE A 1  77  ? 9.887   -25.342 -17.893 1.00 15.73 ?  205 PHE A CB    1 
ATOM   508  C  CG    . PHE A 1  77  ? 10.269  -24.476 -16.741 1.00 17.33 ?  205 PHE A CG    1 
ATOM   509  C  CD1   . PHE A 1  77  ? 11.563  -24.002 -16.620 1.00 13.85 ?  205 PHE A CD1   1 
ATOM   510  C  CD2   . PHE A 1  77  ? 9.326   -24.094 -15.804 1.00 15.14 ?  205 PHE A CD2   1 
ATOM   511  C  CE1   . PHE A 1  77  ? 11.918  -23.185 -15.568 1.00 16.69 ?  205 PHE A CE1   1 
ATOM   512  C  CE2   . PHE A 1  77  ? 9.674   -23.277 -14.751 1.00 18.26 ?  205 PHE A CE2   1 
ATOM   513  C  CZ    . PHE A 1  77  ? 10.972  -22.820 -14.633 1.00 19.26 ?  205 PHE A CZ    1 
ATOM   514  N  N     . GLY A 1  78  ? 10.335  -24.661 -21.406 1.00 25.07 ?  206 GLY A N     1 
ATOM   515  C  CA    . GLY A 1  78  ? 10.766  -25.302 -22.630 1.00 26.80 ?  206 GLY A CA    1 
ATOM   516  C  C     . GLY A 1  78  ? 12.275  -25.377 -22.691 1.00 29.58 ?  206 GLY A C     1 
ATOM   517  O  O     . GLY A 1  78  ? 12.944  -25.383 -21.652 1.00 24.52 ?  206 GLY A O     1 
ATOM   518  N  N     . GLU A 1  79  ? 12.826  -25.405 -23.905 1.00 19.64 ?  207 GLU A N     1 
ATOM   519  C  CA    . GLU A 1  79  ? 14.262  -25.606 -24.062 1.00 25.58 ?  207 GLU A CA    1 
ATOM   520  C  C     . GLU A 1  79  ? 15.062  -24.508 -23.370 1.00 22.92 ?  207 GLU A C     1 
ATOM   521  O  O     . GLU A 1  79  ? 16.041  -24.791 -22.670 1.00 20.74 ?  207 GLU A O     1 
ATOM   522  C  CB    . GLU A 1  79  ? 14.617  -25.669 -25.548 1.00 22.89 ?  207 GLU A CB    1 
ATOM   523  C  CG    . GLU A 1  79  ? 16.099  -25.869 -25.821 1.00 32.83 ?  207 GLU A CG    1 
ATOM   524  N  N     . HIS A 1  80  ? 14.660  -23.250 -23.548 1.00 21.71 ?  208 HIS A N     1 
ATOM   525  C  CA    . HIS A 1  80  ? 15.477  -22.132 -23.088 1.00 20.60 ?  208 HIS A CA    1 
ATOM   526  C  C     . HIS A 1  80  ? 15.476  -22.030 -21.565 1.00 19.99 ?  208 HIS A C     1 
ATOM   527  O  O     . HIS A 1  80  ? 16.536  -22.043 -20.929 1.00 24.06 ?  208 HIS A O     1 
ATOM   528  C  CB    . HIS A 1  80  ? 14.975  -20.835 -23.726 1.00 24.32 ?  208 HIS A CB    1 
ATOM   529  C  CG    . HIS A 1  80  ? 15.991  -19.734 -23.741 1.00 23.91 ?  208 HIS A CG    1 
ATOM   530  N  ND1   . HIS A 1  80  ? 16.029  -18.774 -24.729 1.00 21.33 ?  208 HIS A ND1   1 
ATOM   531  C  CD2   . HIS A 1  80  ? 16.999  -19.436 -22.888 1.00 22.94 ?  208 HIS A CD2   1 
ATOM   532  C  CE1   . HIS A 1  80  ? 17.019  -17.934 -24.486 1.00 19.46 ?  208 HIS A CE1   1 
ATOM   533  N  NE2   . HIS A 1  80  ? 17.624  -18.313 -23.375 1.00 24.89 ?  208 HIS A NE2   1 
ATOM   534  N  N     . SER A 1  81  ? 14.293  -21.927 -20.954 1.00 18.00 ?  209 SER A N     1 
ATOM   535  C  CA    A SER A 1  81  ? 14.213  -21.793 -19.502 0.54 17.66 ?  209 SER A CA    1 
ATOM   536  C  CA    B SER A 1  81  ? 14.236  -21.784 -19.504 0.46 17.76 ?  209 SER A CA    1 
ATOM   537  C  C     . SER A 1  81  ? 14.787  -23.017 -18.800 1.00 18.84 ?  209 SER A C     1 
ATOM   538  O  O     . SER A 1  81  ? 15.388  -22.900 -17.727 1.00 17.63 ?  209 SER A O     1 
ATOM   539  C  CB    A SER A 1  81  ? 12.762  -21.567 -19.073 0.54 18.53 ?  209 SER A CB    1 
ATOM   540  C  CB    B SER A 1  81  ? 12.801  -21.508 -19.055 0.46 18.13 ?  209 SER A CB    1 
ATOM   541  O  OG    A SER A 1  81  ? 12.188  -20.460 -19.747 0.54 18.30 ?  209 SER A OG    1 
ATOM   542  O  OG    B SER A 1  81  ? 11.933  -22.536 -19.488 0.46 21.77 ?  209 SER A OG    1 
ATOM   543  N  N     . SER A 1  82  ? 14.605  -24.204 -19.389 1.00 19.74 ?  210 SER A N     1 
ATOM   544  C  CA    . SER A 1  82  ? 15.166  -25.415 -18.793 1.00 27.85 ?  210 SER A CA    1 
ATOM   545  C  C     . SER A 1  82  ? 16.690  -25.403 -18.854 1.00 28.19 ?  210 SER A C     1 
ATOM   546  O  O     . SER A 1  82  ? 17.358  -25.827 -17.902 1.00 20.51 ?  210 SER A O     1 
ATOM   547  C  CB    . SER A 1  82  ? 14.613  -26.655 -19.494 1.00 29.96 ?  210 SER A CB    1 
ATOM   548  O  OG    . SER A 1  82  ? 13.212  -26.762 -19.300 1.00 26.19 ?  210 SER A OG    1 
ATOM   549  N  N     A ARG A 1  83  ? 17.266  -24.932 -19.961 0.38 25.61 ?  211 ARG A N     1 
ATOM   550  N  N     B ARG A 1  83  ? 17.247  -24.928 -19.971 0.62 25.52 ?  211 ARG A N     1 
ATOM   551  C  CA    A ARG A 1  83  ? 18.720  -24.835 -20.027 0.38 24.61 ?  211 ARG A CA    1 
ATOM   552  C  CA    B ARG A 1  83  ? 18.694  -24.785 -20.102 0.62 24.99 ?  211 ARG A CA    1 
ATOM   553  C  C     A ARG A 1  83  ? 19.241  -23.881 -18.962 0.38 23.01 ?  211 ARG A C     1 
ATOM   554  C  C     B ARG A 1  83  ? 19.248  -23.864 -19.020 0.62 22.90 ?  211 ARG A C     1 
ATOM   555  O  O     A ARG A 1  83  ? 20.231  -24.173 -18.281 0.38 23.52 ?  211 ARG A O     1 
ATOM   556  O  O     B ARG A 1  83  ? 20.263  -24.168 -18.384 0.62 23.66 ?  211 ARG A O     1 
ATOM   557  C  CB    A ARG A 1  83  ? 19.171  -24.386 -21.416 0.38 23.32 ?  211 ARG A CB    1 
ATOM   558  C  CB    B ARG A 1  83  ? 19.021  -24.246 -21.498 0.62 22.36 ?  211 ARG A CB    1 
ATOM   559  C  CG    A ARG A 1  83  ? 20.687  -24.265 -21.533 0.38 26.30 ?  211 ARG A CG    1 
ATOM   560  C  CG    B ARG A 1  83  ? 20.502  -24.135 -21.823 0.62 26.78 ?  211 ARG A CG    1 
ATOM   561  C  CD    A ARG A 1  83  ? 21.142  -22.824 -21.387 0.38 31.05 ?  211 ARG A CD    1 
ATOM   562  C  CD    B ARG A 1  83  ? 20.758  -23.236 -23.034 0.62 31.78 ?  211 ARG A CD    1 
ATOM   563  N  NE    A ARG A 1  83  ? 20.742  -22.007 -22.529 0.38 34.89 ?  211 ARG A NE    1 
ATOM   564  N  NE    B ARG A 1  83  ? 19.953  -23.603 -24.201 0.62 40.27 ?  211 ARG A NE    1 
ATOM   565  C  CZ    A ARG A 1  83  ? 20.787  -20.679 -22.556 0.38 41.03 ?  211 ARG A CZ    1 
ATOM   566  C  CZ    B ARG A 1  83  ? 19.163  -22.774 -24.884 0.62 38.56 ?  211 ARG A CZ    1 
ATOM   567  N  NH1   A ARG A 1  83  ? 21.205  -19.995 -21.499 0.38 42.87 ?  211 ARG A NH1   1 
ATOM   568  N  NH1   B ARG A 1  83  ? 19.049  -21.496 -24.550 0.62 39.00 ?  211 ARG A NH1   1 
ATOM   569  N  NH2   A ARG A 1  83  ? 20.402  -20.034 -23.646 0.38 43.92 ?  211 ARG A NH2   1 
ATOM   570  N  NH2   B ARG A 1  83  ? 18.483  -23.228 -25.925 0.62 42.65 ?  211 ARG A NH2   1 
ATOM   571  N  N     . VAL A 1  84  ? 18.582  -22.729 -18.801 1.00 20.83 ?  212 VAL A N     1 
ATOM   572  C  CA    . VAL A 1  84  ? 19.009  -21.777 -17.777 1.00 24.14 ?  212 VAL A CA    1 
ATOM   573  C  C     . VAL A 1  84  ? 19.064  -22.457 -16.415 1.00 24.28 ?  212 VAL A C     1 
ATOM   574  O  O     . VAL A 1  84  ? 20.064  -22.365 -15.695 1.00 21.04 ?  212 VAL A O     1 
ATOM   575  C  CB    . VAL A 1  84  ? 18.067  -20.558 -17.757 1.00 22.73 ?  212 VAL A CB    1 
ATOM   576  C  CG1   . VAL A 1  84  ? 18.415  -19.622 -16.610 1.00 17.92 ?  212 VAL A CG1   1 
ATOM   577  C  CG2   . VAL A 1  84  ? 18.133  -19.812 -19.087 1.00 26.46 ?  212 VAL A CG2   1 
ATOM   578  N  N     . VAL A 1  85  ? 17.983  -23.151 -16.031 1.00 16.10 ?  213 VAL A N     1 
ATOM   579  C  CA    . VAL A 1  85  ? 17.942  -23.828 -14.738 1.00 18.99 ?  213 VAL A CA    1 
ATOM   580  C  C     . VAL A 1  85  ? 19.028  -24.926 -14.663 1.00 23.26 ?  213 VAL A C     1 
ATOM   581  O  O     . VAL A 1  85  ? 19.697  -25.074 -13.643 1.00 28.16 ?  213 VAL A O     1 
ATOM   582  C  CB    . VAL A 1  85  ? 16.535  -24.400 -14.474 1.00 19.51 ?  213 VAL A CB    1 
ATOM   583  C  CG1   . VAL A 1  85  ? 16.606  -25.502 -13.424 1.00 19.56 ?  213 VAL A CG1   1 
ATOM   584  C  CG2   . VAL A 1  85  ? 15.593  -23.357 -14.007 1.00 20.50 ?  213 VAL A CG2   1 
ATOM   585  N  N     . GLN A 1  86  ? 19.214  -25.698 -15.732 1.00 18.26 ?  214 GLN A N     1 
ATOM   586  C  CA    . GLN A 1  86  ? 20.227  -26.762 -15.727 1.00 19.66 ?  214 GLN A CA    1 
ATOM   587  C  C     . GLN A 1  86  ? 21.611  -26.208 -15.422 1.00 26.46 ?  214 GLN A C     1 
ATOM   588  O  O     . GLN A 1  86  ? 22.370  -26.780 -14.617 1.00 28.18 ?  214 GLN A O     1 
ATOM   589  C  CB    . GLN A 1  86  ? 20.269  -27.494 -17.069 1.00 22.94 ?  214 GLN A CB    1 
ATOM   590  C  CG    . GLN A 1  86  ? 21.389  -28.564 -17.054 1.00 22.44 ?  214 GLN A CG    1 
ATOM   591  N  N     . GLU A 1  87  ? 21.987  -25.126 -16.102 1.00 20.12 ?  215 GLU A N     1 
ATOM   592  C  CA    . GLU A 1  87  ? 23.310  -24.560 -15.879 1.00 25.45 ?  215 GLU A CA    1 
ATOM   593  C  C     . GLU A 1  87  ? 23.433  -24.062 -14.451 1.00 20.41 ?  215 GLU A C     1 
ATOM   594  O  O     . GLU A 1  87  ? 24.469  -24.241 -13.803 1.00 24.46 ?  215 GLU A O     1 
ATOM   595  C  CB    . GLU A 1  87  ? 23.614  -23.436 -16.859 1.00 21.48 ?  215 GLU A CB    1 
ATOM   596  C  CG    . GLU A 1  87  ? 23.405  -23.789 -18.223 1.00 26.48 ?  215 GLU A CG    1 
ATOM   597  C  CD    . GLU A 1  87  ? 23.952  -22.756 -19.212 1.00 38.84 ?  215 GLU A CD    1 
ATOM   598  O  OE1   . GLU A 1  87  ? 24.404  -21.657 -18.827 1.00 39.61 ?  215 GLU A OE1   1 
ATOM   599  O  OE2   . GLU A 1  87  ? 23.921  -23.080 -20.412 1.00 44.60 ?  215 GLU A OE2   1 
ATOM   600  N  N     . LEU A 1  88  ? 22.380  -23.468 -13.919 1.00 22.45 ?  216 LEU A N     1 
ATOM   601  C  CA    . LEU A 1  88  ? 22.479  -22.982 -12.548 1.00 22.65 ?  216 LEU A CA    1 
ATOM   602  C  C     . LEU A 1  88  ? 22.639  -24.147 -11.579 1.00 25.73 ?  216 LEU A C     1 
ATOM   603  O  O     . LEU A 1  88  ? 23.431  -24.078 -10.644 1.00 23.94 ?  216 LEU A O     1 
ATOM   604  C  CB    . LEU A 1  88  ? 21.241  -22.144 -12.219 1.00 16.61 ?  216 LEU A CB    1 
ATOM   605  C  CG    . LEU A 1  88  ? 21.237  -20.720 -12.768 1.00 22.07 ?  216 LEU A CG    1 
ATOM   606  C  CD1   . LEU A 1  88  ? 19.820  -20.175 -12.846 1.00 15.73 ?  216 LEU A CD1   1 
ATOM   607  C  CD2   . LEU A 1  88  ? 22.075  -19.792 -11.941 1.00 23.96 ?  216 LEU A CD2   1 
ATOM   608  N  N     . LEU A 1  89  ? 21.905  -25.236 -11.807 1.00 21.58 ?  217 LEU A N     1 
ATOM   609  C  CA    . LEU A 1  89  ? 22.019  -26.409 -10.949 1.00 22.74 ?  217 LEU A CA    1 
ATOM   610  C  C     . LEU A 1  89  ? 23.406  -27.029 -11.057 1.00 31.09 ?  217 LEU A C     1 
ATOM   611  O  O     . LEU A 1  89  ? 23.972  -27.484 -10.056 1.00 28.66 ?  217 LEU A O     1 
ATOM   612  C  CB    . LEU A 1  89  ? 20.948  -27.438 -11.316 1.00 24.80 ?  217 LEU A CB    1 
ATOM   613  C  CG    . LEU A 1  89  ? 19.478  -27.063 -11.090 1.00 25.95 ?  217 LEU A CG    1 
ATOM   614  C  CD1   . LEU A 1  89  ? 18.581  -28.190 -11.580 1.00 20.85 ?  217 LEU A CD1   1 
ATOM   615  C  CD2   . LEU A 1  89  ? 19.193  -26.749 -9.632  1.00 24.25 ?  217 LEU A CD2   1 
ATOM   616  N  N     . GLU A 1  90  ? 23.977  -27.040 -12.264 1.00 21.64 ?  218 GLU A N     1 
ATOM   617  C  CA    . GLU A 1  90  ? 25.239  -27.735 -12.491 1.00 27.32 ?  218 GLU A CA    1 
ATOM   618  C  C     . GLU A 1  90  ? 26.443  -26.886 -12.096 1.00 32.00 ?  218 GLU A C     1 
ATOM   619  O  O     . GLU A 1  90  ? 27.422  -27.415 -11.558 1.00 34.00 ?  218 GLU A O     1 
ATOM   620  C  CB    . GLU A 1  90  ? 25.349  -28.152 -13.958 1.00 32.82 ?  218 GLU A CB    1 
ATOM   621  N  N     . HIS A 1  91  ? 26.396  -25.576 -12.346 1.00 27.21 ?  219 HIS A N     1 
ATOM   622  C  CA    . HIS A 1  91  ? 27.558  -24.721 -12.148 1.00 30.42 ?  219 HIS A CA    1 
ATOM   623  C  C     . HIS A 1  91  ? 27.313  -23.540 -11.218 1.00 31.79 ?  219 HIS A C     1 
ATOM   624  O  O     . HIS A 1  91  ? 28.242  -22.759 -10.990 1.00 33.83 ?  219 HIS A O     1 
ATOM   625  C  CB    . HIS A 1  91  ? 28.061  -24.189 -13.499 1.00 34.20 ?  219 HIS A CB    1 
ATOM   626  C  CG    . HIS A 1  91  ? 28.370  -25.265 -14.494 1.00 41.54 ?  219 HIS A CG    1 
ATOM   627  N  ND1   . HIS A 1  91  ? 27.528  -25.577 -15.540 1.00 44.07 ?  219 HIS A ND1   1 
ATOM   628  C  CD2   . HIS A 1  91  ? 29.426  -26.106 -14.597 1.00 39.56 ?  219 HIS A CD2   1 
ATOM   629  C  CE1   . HIS A 1  91  ? 28.054  -26.561 -16.248 1.00 40.51 ?  219 HIS A CE1   1 
ATOM   630  N  NE2   . HIS A 1  91  ? 29.205  -26.900 -15.696 1.00 44.18 ?  219 HIS A NE2   1 
ATOM   631  N  N     . GLY A 1  92  ? 26.108  -23.387 -10.673 1.00 27.75 ?  220 GLY A N     1 
ATOM   632  C  CA    . GLY A 1  92  ? 25.798  -22.254 -9.825  1.00 30.09 ?  220 GLY A CA    1 
ATOM   633  C  C     . GLY A 1  92  ? 25.688  -20.930 -10.547 1.00 33.93 ?  220 GLY A C     1 
ATOM   634  O  O     . GLY A 1  92  ? 25.484  -19.900 -9.892  1.00 25.45 ?  220 GLY A O     1 
ATOM   635  N  N     . VAL A 1  93  ? 25.798  -20.922 -11.873 1.00 35.42 ?  221 VAL A N     1 
ATOM   636  C  CA    . VAL A 1  93  ? 25.782  -19.687 -12.646 1.00 33.52 ?  221 VAL A CA    1 
ATOM   637  C  C     . VAL A 1  93  ? 25.327  -20.034 -14.053 1.00 28.52 ?  221 VAL A C     1 
ATOM   638  O  O     . VAL A 1  93  ? 25.596  -21.128 -14.554 1.00 27.89 ?  221 VAL A O     1 
ATOM   639  C  CB    . VAL A 1  93  ? 27.177  -19.011 -12.635 1.00 28.86 ?  221 VAL A CB    1 
ATOM   640  C  CG1   . VAL A 1  93  ? 28.245  -19.987 -13.108 1.00 27.61 ?  221 VAL A CG1   1 
ATOM   641  C  CG2   . VAL A 1  93  ? 27.182  -17.758 -13.491 1.00 30.80 ?  221 VAL A CG2   1 
ATOM   642  N  N     . CYS A 1  94  ? 24.621  -19.101 -14.687 1.00 26.03 ?  222 CYS A N     1 
ATOM   643  C  CA    . CYS A 1  94  ? 24.177  -19.247 -16.069 1.00 25.46 ?  222 CYS A CA    1 
ATOM   644  C  C     . CYS A 1  94  ? 24.865  -18.180 -16.908 1.00 25.80 ?  222 CYS A C     1 
ATOM   645  O  O     . CYS A 1  94  ? 24.725  -16.983 -16.631 1.00 25.12 ?  222 CYS A O     1 
ATOM   646  C  CB    . CYS A 1  94  ? 22.654  -19.131 -16.177 1.00 21.53 ?  222 CYS A CB    1 
ATOM   647  S  SG    . CYS A 1  94  ? 22.027  -19.113 -17.876 1.00 25.24 ?  222 CYS A SG    1 
ATOM   648  N  N     . GLU A 1  95  ? 25.604  -18.614 -17.932 1.00 21.65 ?  223 GLU A N     1 
ATOM   649  C  CA    . GLU A 1  95  ? 26.433  -17.683 -18.692 1.00 22.75 ?  223 GLU A CA    1 
ATOM   650  C  C     . GLU A 1  95  ? 25.590  -16.606 -19.358 1.00 24.38 ?  223 GLU A C     1 
ATOM   651  O  O     . GLU A 1  95  ? 25.956  -15.424 -19.340 1.00 26.78 ?  223 GLU A O     1 
ATOM   652  C  CB    . GLU A 1  95  ? 27.254  -18.437 -19.736 1.00 27.53 ?  223 GLU A CB    1 
ATOM   653  C  CG    . GLU A 1  95  ? 28.269  -17.567 -20.456 1.00 35.99 ?  223 GLU A CG    1 
ATOM   654  N  N     . GLU A 1  96  ? 24.459  -16.991 -19.957 1.00 21.92 ?  224 GLU A N     1 
ATOM   655  C  CA    . GLU A 1  96  ? 23.592  -16.003 -20.590 1.00 20.92 ?  224 GLU A CA    1 
ATOM   656  C  C     . GLU A 1  96  ? 23.135  -14.955 -19.586 1.00 19.48 ?  224 GLU A C     1 
ATOM   657  O  O     . GLU A 1  96  ? 23.119  -13.757 -19.891 1.00 23.04 ?  224 GLU A O     1 
ATOM   658  C  CB    . GLU A 1  96  ? 22.382  -16.684 -21.232 1.00 20.27 ?  224 GLU A CB    1 
ATOM   659  C  CG    . GLU A 1  96  ? 21.589  -15.748 -22.132 1.00 24.03 ?  224 GLU A CG    1 
ATOM   660  C  CD    . GLU A 1  96  ? 20.228  -16.291 -22.514 1.00 27.76 ?  224 GLU A CD    1 
ATOM   661  O  OE1   . GLU A 1  96  ? 19.916  -17.447 -22.159 1.00 27.65 ?  224 GLU A OE1   1 
ATOM   662  O  OE2   . GLU A 1  96  ? 19.468  -15.551 -23.172 1.00 26.57 ?  224 GLU A OE2   1 
ATOM   663  N  N     . VAL A 1  97  ? 22.756  -15.386 -18.381 1.00 19.22 ?  225 VAL A N     1 
ATOM   664  C  CA    . VAL A 1  97  ? 22.311  -14.444 -17.355 1.00 18.65 ?  225 VAL A CA    1 
ATOM   665  C  C     . VAL A 1  97  ? 23.442  -13.493 -16.985 1.00 23.25 ?  225 VAL A C     1 
ATOM   666  O  O     . VAL A 1  97  ? 23.250  -12.274 -16.895 1.00 21.25 ?  225 VAL A O     1 
ATOM   667  C  CB    . VAL A 1  97  ? 21.784  -15.209 -16.126 1.00 21.53 ?  225 VAL A CB    1 
ATOM   668  C  CG1   . VAL A 1  97  ? 21.565  -14.269 -14.938 1.00 20.29 ?  225 VAL A CG1   1 
ATOM   669  C  CG2   . VAL A 1  97  ? 20.488  -15.932 -16.473 1.00 15.68 ?  225 VAL A CG2   1 
ATOM   670  N  N     . GLU A 1  98  ? 24.639  -14.036 -16.761 1.00 19.46 ?  226 GLU A N     1 
ATOM   671  C  CA    . GLU A 1  98  ? 25.765  -13.193 -16.377 1.00 20.63 ?  226 GLU A CA    1 
ATOM   672  C  C     . GLU A 1  98  ? 26.122  -12.220 -17.489 1.00 24.45 ?  226 GLU A C     1 
ATOM   673  O  O     . GLU A 1  98  ? 26.443  -11.057 -17.222 1.00 25.55 ?  226 GLU A O     1 
ATOM   674  C  CB    . GLU A 1  98  ? 26.967  -14.060 -16.005 1.00 24.00 ?  226 GLU A CB    1 
ATOM   675  C  CG    . GLU A 1  98  ? 26.720  -14.935 -14.791 1.00 27.44 ?  226 GLU A CG    1 
ATOM   676  C  CD    . GLU A 1  98  ? 26.186  -14.145 -13.610 1.00 31.93 ?  226 GLU A CD    1 
ATOM   677  O  OE1   . GLU A 1  98  ? 26.870  -13.194 -13.178 1.00 39.30 ?  226 GLU A OE1   1 
ATOM   678  O  OE2   . GLU A 1  98  ? 25.074  -14.456 -13.132 1.00 31.20 ?  226 GLU A OE2   1 
ATOM   679  N  N     . ARG A 1  99  ? 26.052  -12.668 -18.743 1.00 22.00 ?  227 ARG A N     1 
ATOM   680  C  CA    . ARG A 1  99  ? 26.337  -11.778 -19.863 1.00 23.03 ?  227 ARG A CA    1 
ATOM   681  C  C     . ARG A 1  99  ? 25.370  -10.600 -19.879 1.00 22.81 ?  227 ARG A C     1 
ATOM   682  O  O     . ARG A 1  99  ? 25.778  -9.450  -20.073 1.00 28.10 ?  227 ARG A O     1 
ATOM   683  C  CB    . ARG A 1  99  ? 26.271  -12.560 -21.175 1.00 29.77 ?  227 ARG A CB    1 
ATOM   684  C  CG    . ARG A 1  99  ? 26.762  -11.782 -22.383 1.00 45.02 ?  227 ARG A CG    1 
ATOM   685  C  CD    . ARG A 1  99  ? 27.091  -12.691 -23.566 1.00 49.87 ?  227 ARG A CD    1 
ATOM   686  N  NE    . ARG A 1  99  ? 25.936  -13.457 -24.035 1.00 51.43 ?  227 ARG A NE    1 
ATOM   687  C  CZ    . ARG A 1  99  ? 25.721  -14.750 -23.796 1.00 51.04 ?  227 ARG A CZ    1 
ATOM   688  N  NH1   . ARG A 1  99  ? 26.580  -15.469 -23.084 1.00 51.80 ?  227 ARG A NH1   1 
ATOM   689  N  NH2   . ARG A 1  99  ? 24.633  -15.333 -24.279 1.00 49.45 ?  227 ARG A NH2   1 
ATOM   690  N  N     . VAL A 1  100 ? 24.079  -10.869 -19.671 1.00 20.79 ?  228 VAL A N     1 
ATOM   691  C  CA    . VAL A 1  100 ? 23.095  -9.792  -19.581 1.00 19.68 ?  228 VAL A CA    1 
ATOM   692  C  C     . VAL A 1  100 ? 23.437  -8.864  -18.421 1.00 19.58 ?  228 VAL A C     1 
ATOM   693  O  O     . VAL A 1  100 ? 23.470  -7.638  -18.572 1.00 23.89 ?  228 VAL A O     1 
ATOM   694  C  CB    . VAL A 1  100 ? 21.677  -10.378 -19.436 1.00 23.59 ?  228 VAL A CB    1 
ATOM   695  C  CG1   . VAL A 1  100 ? 20.660  -9.285  -19.115 1.00 26.90 ?  228 VAL A CG1   1 
ATOM   696  C  CG2   . VAL A 1  100 ? 21.274  -11.113 -20.705 1.00 21.03 ?  228 VAL A CG2   1 
ATOM   697  N  N     . ARG A 1  101 ? 23.695  -9.442  -17.245 1.00 21.23 ?  229 ARG A N     1 
ATOM   698  C  CA    . ARG A 1  101 ? 23.954  -8.649  -16.046 1.00 22.05 ?  229 ARG A CA    1 
ATOM   699  C  C     . ARG A 1  101 ? 24.996  -7.563  -16.288 1.00 26.52 ?  229 ARG A C     1 
ATOM   700  O  O     . ARG A 1  101 ? 24.799  -6.403  -15.908 1.00 31.16 ?  229 ARG A O     1 
ATOM   701  C  CB    . ARG A 1  101 ? 24.424  -9.557  -14.912 1.00 25.48 ?  229 ARG A CB    1 
ATOM   702  C  CG    . ARG A 1  101 ? 23.338  -10.121 -14.033 1.00 27.13 ?  229 ARG A CG    1 
ATOM   703  C  CD    . ARG A 1  101 ? 23.946  -10.596 -12.720 1.00 32.50 ?  229 ARG A CD    1 
ATOM   704  N  NE    . ARG A 1  101 ? 23.447  -11.904 -12.307 1.00 39.89 ?  229 ARG A NE    1 
ATOM   705  C  CZ    . ARG A 1  101 ? 22.342  -12.100 -11.593 1.00 44.75 ?  229 ARG A CZ    1 
ATOM   706  N  NH1   . ARG A 1  101 ? 21.597  -11.071 -11.207 1.00 42.85 ?  229 ARG A NH1   1 
ATOM   707  N  NH2   . ARG A 1  101 ? 21.979  -13.333 -11.268 1.00 39.22 ?  229 ARG A NH2   1 
ATOM   708  N  N     A ARG A 1  102 ? 26.121  -7.923  -16.905 0.46 24.96 ?  230 ARG A N     1 
ATOM   709  N  N     B ARG A 1  102 ? 26.115  -7.924  -16.915 0.54 24.75 ?  230 ARG A N     1 
ATOM   710  C  CA    A ARG A 1  102 ? 27.229  -6.989  -17.063 0.46 27.96 ?  230 ARG A CA    1 
ATOM   711  C  CA    B ARG A 1  102 ? 27.243  -7.018  -17.080 0.54 27.94 ?  230 ARG A CA    1 
ATOM   712  C  C     A ARG A 1  102 ? 27.124  -6.134  -18.319 0.46 27.57 ?  230 ARG A C     1 
ATOM   713  C  C     B ARG A 1  102 ? 27.260  -6.332  -18.440 0.54 28.75 ?  230 ARG A C     1 
ATOM   714  O  O     A ARG A 1  102 ? 27.909  -5.192  -18.472 0.46 31.05 ?  230 ARG A O     1 
ATOM   715  O  O     B ARG A 1  102 ? 28.267  -5.713  -18.797 0.54 31.39 ?  230 ARG A O     1 
ATOM   716  C  CB    A ARG A 1  102 ? 28.566  -7.745  -17.073 0.46 32.45 ?  230 ARG A CB    1 
ATOM   717  C  CB    B ARG A 1  102 ? 28.560  -7.769  -16.856 0.54 32.34 ?  230 ARG A CB    1 
ATOM   718  C  CG    A ARG A 1  102 ? 28.691  -8.840  -18.126 0.46 34.23 ?  230 ARG A CG    1 
ATOM   719  C  CG    B ARG A 1  102 ? 28.778  -8.953  -17.784 0.54 34.31 ?  230 ARG A CG    1 
ATOM   720  C  CD    A ARG A 1  102 ? 30.074  -9.480  -18.083 0.46 37.26 ?  230 ARG A CD    1 
ATOM   721  C  CD    B ARG A 1  102 ? 30.020  -9.746  -17.408 0.54 36.92 ?  230 ARG A CD    1 
ATOM   722  N  NE    A ARG A 1  102 ? 30.143  -10.738 -18.828 0.46 37.76 ?  230 ARG A NE    1 
ATOM   723  N  NE    B ARG A 1  102 ? 29.999  -11.091 -17.980 0.54 35.87 ?  230 ARG A NE    1 
ATOM   724  C  CZ    A ARG A 1  102 ? 30.111  -11.955 -18.284 0.46 36.79 ?  230 ARG A CZ    1 
ATOM   725  C  CZ    B ARG A 1  102 ? 30.213  -11.364 -19.263 0.54 38.85 ?  230 ARG A CZ    1 
ATOM   726  N  NH1   A ARG A 1  102 ? 30.011  -12.118 -16.971 0.46 33.48 ?  230 ARG A NH1   1 
ATOM   727  N  NH1   B ARG A 1  102 ? 30.465  -10.385 -20.124 0.54 35.94 ?  230 ARG A NH1   1 
ATOM   728  N  NH2   A ARG A 1  102 ? 30.181  -13.023 -19.065 0.46 41.06 ?  230 ARG A NH2   1 
ATOM   729  N  NH2   B ARG A 1  102 ? 30.168  -12.618 -19.691 0.54 39.95 ?  230 ARG A NH2   1 
ATOM   730  N  N     . SER A 1  103 ? 26.177  -6.424  -19.207 1.00 23.73 ?  231 SER A N     1 
ATOM   731  C  CA    . SER A 1  103 ? 26.092  -5.702  -20.466 1.00 30.10 ?  231 SER A CA    1 
ATOM   732  C  C     . SER A 1  103 ? 25.759  -4.237  -20.221 1.00 31.98 ?  231 SER A C     1 
ATOM   733  O  O     . SER A 1  103 ? 24.943  -3.901  -19.357 1.00 29.83 ?  231 SER A O     1 
ATOM   734  C  CB    . SER A 1  103 ? 25.041  -6.333  -21.378 1.00 27.79 ?  231 SER A CB    1 
ATOM   735  O  OG    . SER A 1  103 ? 23.735  -5.971  -20.974 1.00 27.83 ?  231 SER A OG    1 
ATOM   736  N  N     . GLU A 1  104 ? 26.402  -3.359  -20.992 1.00 22.65 ?  232 GLU A N     1 
ATOM   737  C  CA    . GLU A 1  104 ? 26.142  -1.929  -20.861 1.00 28.14 ?  232 GLU A CA    1 
ATOM   738  C  C     . GLU A 1  104 ? 24.687  -1.609  -21.178 1.00 26.95 ?  232 GLU A C     1 
ATOM   739  O  O     . GLU A 1  104 ? 24.076  -0.747  -20.537 1.00 26.72 ?  232 GLU A O     1 
ATOM   740  C  CB    . GLU A 1  104 ? 27.081  -1.148  -21.780 1.00 25.45 ?  232 GLU A CB    1 
ATOM   741  C  CG    . GLU A 1  104 ? 27.022  0.357   -21.605 1.00 27.02 ?  232 GLU A CG    1 
ATOM   742  C  CD    . GLU A 1  104 ? 27.915  1.087   -22.590 1.00 39.09 ?  232 GLU A CD    1 
ATOM   743  O  OE1   . GLU A 1  104 ? 28.335  0.462   -23.587 1.00 47.78 ?  232 GLU A OE1   1 
ATOM   744  O  OE2   . GLU A 1  104 ? 28.197  2.283   -22.368 1.00 37.51 ?  232 GLU A OE2   1 
ATOM   745  N  N     . ARG A 1  105 ? 24.115  -2.296  -22.166 1.00 25.64 ?  233 ARG A N     1 
ATOM   746  C  CA    . ARG A 1  105 ? 22.720  -2.079  -22.530 1.00 28.17 ?  233 ARG A CA    1 
ATOM   747  C  C     . ARG A 1  105 ? 21.800  -2.343  -21.344 1.00 31.65 ?  233 ARG A C     1 
ATOM   748  O  O     . ARG A 1  105 ? 21.034  -1.468  -20.923 1.00 28.78 ?  233 ARG A O     1 
ATOM   749  C  CB    . ARG A 1  105 ? 22.368  -2.976  -23.720 1.00 27.82 ?  233 ARG A CB    1 
ATOM   750  C  CG    . ARG A 1  105 ? 20.890  -3.088  -24.059 1.00 31.48 ?  233 ARG A CG    1 
ATOM   751  C  CD    . ARG A 1  105 ? 20.343  -1.820  -24.688 1.00 29.35 ?  233 ARG A CD    1 
ATOM   752  N  NE    . ARG A 1  105 ? 18.957  -2.006  -25.111 1.00 28.73 ?  233 ARG A NE    1 
ATOM   753  C  CZ    . ARG A 1  105 ? 18.226  -1.087  -25.731 1.00 30.78 ?  233 ARG A CZ    1 
ATOM   754  N  NH1   . ARG A 1  105 ? 18.740  0.102   -26.015 1.00 38.28 ?  233 ARG A NH1   1 
ATOM   755  N  NH2   . ARG A 1  105 ? 16.974  -1.361  -26.071 1.00 27.00 ?  233 ARG A NH2   1 
ATOM   756  N  N     . TYR A 1  106 ? 21.864  -3.554  -20.790 1.00 24.43 ?  234 TYR A N     1 
ATOM   757  C  CA    . TYR A 1  106 ? 20.997  -3.909  -19.673 1.00 20.22 ?  234 TYR A CA    1 
ATOM   758  C  C     . TYR A 1  106 ? 21.152  -2.921  -18.522 1.00 20.14 ?  234 TYR A C     1 
ATOM   759  O  O     . TYR A 1  106 ? 20.162  -2.395  -18.001 1.00 16.81 ?  234 TYR A O     1 
ATOM   760  C  CB    . TYR A 1  106 ? 21.307  -5.334  -19.212 1.00 23.55 ?  234 TYR A CB    1 
ATOM   761  C  CG    . TYR A 1  106 ? 20.570  -5.747  -17.962 1.00 24.74 ?  234 TYR A CG    1 
ATOM   762  C  CD1   . TYR A 1  106 ? 19.271  -6.231  -18.026 1.00 24.52 ?  234 TYR A CD1   1 
ATOM   763  C  CD2   . TYR A 1  106 ? 21.173  -5.652  -16.716 1.00 21.99 ?  234 TYR A CD2   1 
ATOM   764  C  CE1   . TYR A 1  106 ? 18.589  -6.609  -16.882 1.00 23.14 ?  234 TYR A CE1   1 
ATOM   765  C  CE2   . TYR A 1  106 ? 20.502  -6.030  -15.566 1.00 22.75 ?  234 TYR A CE2   1 
ATOM   766  C  CZ    . TYR A 1  106 ? 19.211  -6.508  -15.654 1.00 23.14 ?  234 TYR A CZ    1 
ATOM   767  O  OH    . TYR A 1  106 ? 18.540  -6.881  -14.510 1.00 27.61 ?  234 TYR A OH    1 
ATOM   768  N  N     . GLN A 1  107 ? 22.394  -2.643  -18.123 1.00 23.59 ?  235 GLN A N     1 
ATOM   769  C  CA    . GLN A 1  107 ? 22.622  -1.797  -16.957 1.00 25.26 ?  235 GLN A CA    1 
ATOM   770  C  C     . GLN A 1  107 ? 22.064  -0.394  -17.166 1.00 25.28 ?  235 GLN A C     1 
ATOM   771  O  O     . GLN A 1  107 ? 21.509  0.204   -16.237 1.00 20.46 ?  235 GLN A O     1 
ATOM   772  C  CB    . GLN A 1  107 ? 24.115  -1.740  -16.637 1.00 24.90 ?  235 GLN A CB    1 
ATOM   773  C  CG    . GLN A 1  107 ? 24.668  -3.041  -16.072 1.00 27.17 ?  235 GLN A CG    1 
ATOM   774  C  CD    . GLN A 1  107 ? 26.174  -3.002  -15.840 1.00 46.82 ?  235 GLN A CD    1 
ATOM   775  O  OE1   . GLN A 1  107 ? 26.852  -4.023  -15.948 1.00 49.21 ?  235 GLN A OE1   1 
ATOM   776  N  NE2   . GLN A 1  107 ? 26.701  -1.826  -15.510 1.00 54.20 ?  235 GLN A NE2   1 
ATOM   777  N  N     . THR A 1  108 ? 22.195  0.148   -18.380 1.00 25.89 ?  236 THR A N     1 
ATOM   778  C  CA    . THR A 1  108 ? 21.715  1.502   -18.640 1.00 20.66 ?  236 THR A CA    1 
ATOM   779  C  C     . THR A 1  108 ? 20.195  1.545   -18.768 1.00 23.14 ?  236 THR A C     1 
ATOM   780  O  O     . THR A 1  108 ? 19.555  2.467   -18.247 1.00 19.74 ?  236 THR A O     1 
ATOM   781  C  CB    . THR A 1  108 ? 22.372  2.062   -19.905 1.00 28.29 ?  236 THR A CB    1 
ATOM   782  O  OG1   . THR A 1  108 ? 23.795  1.944   -19.802 1.00 29.89 ?  236 THR A OG1   1 
ATOM   783  C  CG2   . THR A 1  108 ? 22.011  3.534   -20.093 1.00 26.00 ?  236 THR A CG2   1 
ATOM   784  N  N     . MET A 1  109 ? 19.590  0.546   -19.442 1.00 19.13 ?  237 MET A N     1 
ATOM   785  C  CA    . MET A 1  109 ? 18.127  0.496   -19.542 1.00 23.21 ?  237 MET A CA    1 
ATOM   786  C  C     . MET A 1  109 ? 17.519  0.316   -18.166 1.00 23.09 ?  237 MET A C     1 
ATOM   787  O  O     . MET A 1  109 ? 16.479  0.907   -17.855 1.00 24.13 ?  237 MET A O     1 
ATOM   788  C  CB    . MET A 1  109 ? 17.697  -0.638  -20.479 1.00 19.72 ?  237 MET A CB    1 
ATOM   789  C  CG    . MET A 1  109 ? 18.036  -0.386  -21.939 1.00 20.08 ?  237 MET A CG    1 
ATOM   790  S  SD    . MET A 1  109 ? 17.075  0.917   -22.740 1.00 22.79 ?  237 MET A SD    1 
ATOM   791  C  CE    . MET A 1  109 ? 15.387  0.221   -22.680 1.00 22.30 ?  237 MET A CE    1 
ATOM   792  N  N     . LYS A 1  110 ? 18.208  -0.424  -17.298 1.00 22.59 ?  238 LYS A N     1 
ATOM   793  C  CA    . LYS A 1  110 ? 17.721  -0.589  -15.938 1.00 19.82 ?  238 LYS A CA    1 
ATOM   794  C  C     . LYS A 1  110 ? 17.789  0.732   -15.185 1.00 18.91 ?  238 LYS A C     1 
ATOM   795  O  O     . LYS A 1  110 ? 16.803  1.164   -14.584 1.00 24.07 ?  238 LYS A O     1 
ATOM   796  C  CB    . LYS A 1  110 ? 18.516  -1.670  -15.189 1.00 21.60 ?  238 LYS A CB    1 
ATOM   797  C  CG    . LYS A 1  110 ? 17.735  -2.365  -14.076 1.00 29.31 ?  238 LYS A CG    1 
ATOM   798  N  N     . LEU A 1  111 ? 18.930  1.409   -15.269 1.00 17.95 ?  239 LEU A N     1 
ATOM   799  C  CA    . LEU A 1  111 ? 19.094  2.711   -14.630 1.00 17.69 ?  239 LEU A CA    1 
ATOM   800  C  C     . LEU A 1  111 ? 18.046  3.693   -15.134 1.00 28.00 ?  239 LEU A C     1 
ATOM   801  O  O     . LEU A 1  111 ? 17.395  4.387   -14.333 1.00 23.55 ?  239 LEU A O     1 
ATOM   802  C  CB    . LEU A 1  111 ? 20.504  3.215   -14.893 1.00 19.05 ?  239 LEU A CB    1 
ATOM   803  C  CG    . LEU A 1  111 ? 20.854  4.633   -14.440 1.00 26.85 ?  239 LEU A CG    1 
ATOM   804  C  CD1   . LEU A 1  111 ? 20.979  4.663   -12.951 1.00 29.50 ?  239 LEU A CD1   1 
ATOM   805  C  CD2   . LEU A 1  111 ? 22.099  5.089   -15.096 1.00 29.35 ?  239 LEU A CD2   1 
ATOM   806  N  N     . PHE A 1  112 ? 17.845  3.746   -16.461 1.00 18.62 ?  240 PHE A N     1 
ATOM   807  C  CA    . PHE A 1  112 ? 16.962  4.760   -17.025 1.00 20.81 ?  240 PHE A CA    1 
ATOM   808  C  C     . PHE A 1  112 ? 15.496  4.452   -16.727 1.00 17.97 ?  240 PHE A C     1 
ATOM   809  O  O     . PHE A 1  112 ? 14.746  5.333   -16.291 1.00 17.96 ?  240 PHE A O     1 
ATOM   810  C  CB    . PHE A 1  112 ? 17.195  4.879   -18.533 1.00 20.25 ?  240 PHE A CB    1 
ATOM   811  C  CG    . PHE A 1  112 ? 18.437  5.657   -18.914 1.00 21.77 ?  240 PHE A CG    1 
ATOM   812  C  CD1   . PHE A 1  112 ? 19.224  6.285   -17.958 1.00 22.14 ?  240 PHE A CD1   1 
ATOM   813  C  CD2   . PHE A 1  112 ? 18.802  5.767   -20.242 1.00 23.22 ?  240 PHE A CD2   1 
ATOM   814  C  CE1   . PHE A 1  112 ? 20.354  6.998   -18.324 1.00 26.70 ?  240 PHE A CE1   1 
ATOM   815  C  CE2   . PHE A 1  112 ? 19.933  6.478   -20.617 1.00 30.63 ?  240 PHE A CE2   1 
ATOM   816  C  CZ    . PHE A 1  112 ? 20.709  7.094   -19.657 1.00 30.52 ?  240 PHE A CZ    1 
ATOM   817  N  N     . THR A 1  113 ? 15.061  3.209   -16.959 1.00 23.35 ?  241 THR A N     1 
ATOM   818  C  CA    . THR A 1  113 ? 13.652  2.891   -16.739 1.00 23.11 ?  241 THR A CA    1 
ATOM   819  C  C     . THR A 1  113 ? 13.269  2.999   -15.270 1.00 20.28 ?  241 THR A C     1 
ATOM   820  O  O     . THR A 1  113 ? 12.100  3.255   -14.955 1.00 18.42 ?  241 THR A O     1 
ATOM   821  C  CB    . THR A 1  113 ? 13.316  1.489   -17.251 1.00 22.42 ?  241 THR A CB    1 
ATOM   822  O  OG1   . THR A 1  113 ? 14.160  0.523   -16.614 1.00 16.45 ?  241 THR A OG1   1 
ATOM   823  C  CG2   . THR A 1  113 ? 13.482  1.412   -18.764 1.00 16.09 ?  241 THR A CG2   1 
ATOM   824  N  N     . GLN A 1  114 ? 14.223  2.799   -14.358 1.00 19.41 ?  242 GLN A N     1 
ATOM   825  C  CA    . GLN A 1  114 ? 13.919  2.930   -12.938 1.00 21.66 ?  242 GLN A CA    1 
ATOM   826  C  C     . GLN A 1  114 ? 13.564  4.358   -12.556 1.00 21.07 ?  242 GLN A C     1 
ATOM   827  O  O     . GLN A 1  114 ? 13.028  4.576   -11.464 1.00 19.20 ?  242 GLN A O     1 
ATOM   828  C  CB    . GLN A 1  114 ? 15.102  2.444   -12.096 1.00 19.59 ?  242 GLN A CB    1 
ATOM   829  N  N     . ILE A 1  115 ? 13.843  5.329   -13.424 1.00 17.09 ?  243 ILE A N     1 
ATOM   830  C  CA    . ILE A 1  115 ? 13.438  6.703   -13.170 1.00 18.95 ?  243 ILE A CA    1 
ATOM   831  C  C     . ILE A 1  115 ? 11.925  6.818   -13.298 1.00 20.71 ?  243 ILE A C     1 
ATOM   832  O  O     . ILE A 1  115 ? 11.316  6.290   -14.239 1.00 19.99 ?  243 ILE A O     1 
ATOM   833  C  CB    . ILE A 1  115 ? 14.142  7.666   -14.142 1.00 18.12 ?  243 ILE A CB    1 
ATOM   834  C  CG1   . ILE A 1  115 ? 15.660  7.496   -14.065 1.00 20.12 ?  243 ILE A CG1   1 
ATOM   835  C  CG2   . ILE A 1  115 ? 13.762  9.110   -13.830 1.00 25.67 ?  243 ILE A CG2   1 
ATOM   836  C  CD1   . ILE A 1  115 ? 16.410  8.190   -15.189 1.00 24.17 ?  243 ILE A CD1   1 
ATOM   837  N  N     . PHE A 1  116 ? 11.314  7.513   -12.343 1.00 15.68 ?  244 PHE A N     1 
ATOM   838  C  CA    . PHE A 1  116 ? 9.900   7.854   -12.418 1.00 15.36 ?  244 PHE A CA    1 
ATOM   839  C  C     . PHE A 1  116 ? 9.673   8.810   -13.584 1.00 24.12 ?  244 PHE A C     1 
ATOM   840  O  O     . PHE A 1  116 ? 10.198  9.929   -13.589 1.00 18.41 ?  244 PHE A O     1 
ATOM   841  C  CB    . PHE A 1  116 ? 9.459   8.474   -11.095 1.00 15.47 ?  244 PHE A CB    1 
ATOM   842  C  CG    . PHE A 1  116 ? 8.073   9.048   -11.109 1.00 17.97 ?  244 PHE A CG    1 
ATOM   843  C  CD1   . PHE A 1  116 ? 6.968   8.236   -11.300 1.00 15.74 ?  244 PHE A CD1   1 
ATOM   844  C  CD2   . PHE A 1  116 ? 7.876   10.401  -10.889 1.00 18.35 ?  244 PHE A CD2   1 
ATOM   845  C  CE1   . PHE A 1  116 ? 5.691   8.769   -11.296 1.00 13.85 ?  244 PHE A CE1   1 
ATOM   846  C  CE2   . PHE A 1  116 ? 6.604   10.941  -10.879 1.00 20.60 ?  244 PHE A CE2   1 
ATOM   847  C  CZ    . PHE A 1  116 ? 5.509   10.127  -11.083 1.00 20.40 ?  244 PHE A CZ    1 
ATOM   848  N  N     . GLY A 1  117 ? 8.912   8.362   -14.582 1.00 16.56 ?  245 GLY A N     1 
ATOM   849  C  CA    . GLY A 1  117 ? 8.642   9.146   -15.771 1.00 19.50 ?  245 GLY A CA    1 
ATOM   850  C  C     . GLY A 1  117 ? 9.407   8.704   -16.998 1.00 18.83 ?  245 GLY A C     1 
ATOM   851  O  O     . GLY A 1  117 ? 9.180   9.259   -18.083 1.00 19.55 ?  245 GLY A O     1 
ATOM   852  N  N     . VAL A 1  118 ? 10.306  7.733   -16.868 1.00 18.04 ?  246 VAL A N     1 
ATOM   853  C  CA    . VAL A 1  118 ? 11.073  7.203   -17.987 1.00 23.95 ?  246 VAL A CA    1 
ATOM   854  C  C     . VAL A 1  118 ? 10.673  5.749   -18.179 1.00 22.53 ?  246 VAL A C     1 
ATOM   855  O  O     . VAL A 1  118 ? 10.857  4.921   -17.278 1.00 18.68 ?  246 VAL A O     1 
ATOM   856  C  CB    . VAL A 1  118 ? 12.585  7.328   -17.750 1.00 21.42 ?  246 VAL A CB    1 
ATOM   857  C  CG1   . VAL A 1  118 ? 13.358  6.846   -18.972 1.00 20.30 ?  246 VAL A CG1   1 
ATOM   858  C  CG2   . VAL A 1  118 ? 12.955  8.767   -17.405 1.00 20.99 ?  246 VAL A CG2   1 
ATOM   859  N  N     . GLY A 1  119 ? 10.122  5.438   -19.353 1.00 21.74 ?  247 GLY A N     1 
ATOM   860  C  CA    . GLY A 1  119 ? 9.785   4.081   -19.713 1.00 18.64 ?  247 GLY A CA    1 
ATOM   861  C  C     . GLY A 1  119 ? 10.784  3.499   -20.703 1.00 22.07 ?  247 GLY A C     1 
ATOM   862  O  O     . GLY A 1  119 ? 11.780  4.116   -21.070 1.00 19.55 ?  247 GLY A O     1 
ATOM   863  N  N     . VAL A 1  120 ? 10.514  2.265   -21.115 1.00 21.49 ?  248 VAL A N     1 
ATOM   864  C  CA    . VAL A 1  120 ? 11.387  1.546   -22.025 1.00 20.02 ?  248 VAL A CA    1 
ATOM   865  C  C     . VAL A 1  120 ? 11.620  2.332   -23.305 1.00 23.56 ?  248 VAL A C     1 
ATOM   866  O  O     . VAL A 1  120 ? 12.771  2.492   -23.750 1.00 25.66 ?  248 VAL A O     1 
ATOM   867  C  CB    . VAL A 1  120 ? 10.808  0.147   -22.346 1.00 20.58 ?  248 VAL A CB    1 
ATOM   868  C  CG1   . VAL A 1  120 ? 11.659  -0.525  -23.384 1.00 18.13 ?  248 VAL A CG1   1 
ATOM   869  C  CG2   . VAL A 1  120 ? 10.773  -0.777  -21.114 1.00 26.29 ?  248 VAL A CG2   1 
ATOM   870  N  N     . LYS A 1  121 ? 10.552  2.839   -23.944 1.00 26.24 ?  249 LYS A N     1 
ATOM   871  C  CA    . LYS A 1  121 ? 10.788  3.613   -25.174 1.00 29.26 ?  249 LYS A CA    1 
ATOM   872  C  C     . LYS A 1  121 ? 11.666  4.838   -24.918 1.00 25.57 ?  249 LYS A C     1 
ATOM   873  O  O     . LYS A 1  121 ? 12.557  5.114   -25.701 1.00 24.99 ?  249 LYS A O     1 
ATOM   874  C  CB    . LYS A 1  121 ? 9.483   4.033   -25.838 1.00 31.57 ?  249 LYS A CB    1 
ATOM   875  C  CG    . LYS A 1  121 ? 8.765   2.787   -26.325 1.00 39.70 ?  249 LYS A CG    1 
ATOM   876  C  CD    . LYS A 1  121 ? 7.475   3.053   -27.074 1.00 40.59 ?  249 LYS A CD    1 
ATOM   877  C  CE    . LYS A 1  121 ? 6.815   1.738   -27.476 1.00 39.26 ?  249 LYS A CE    1 
ATOM   878  N  N     . THR A 1  122 ? 11.427  5.606   -23.844 1.00 27.35 ?  250 THR A N     1 
ATOM   879  C  CA    . THR A 1  122 ? 12.273  6.793   -23.634 1.00 26.22 ?  250 THR A CA    1 
ATOM   880  C  C     . THR A 1  122 ? 13.718  6.389   -23.342 1.00 28.10 ?  250 THR A C     1 
ATOM   881  O  O     . THR A 1  122 ? 14.653  6.940   -23.914 1.00 24.24 ?  250 THR A O     1 
ATOM   882  C  CB    . THR A 1  122 ? 11.707  7.632   -22.498 1.00 27.06 ?  250 THR A CB    1 
ATOM   883  O  OG1   . THR A 1  122 ? 10.333  7.986   -22.822 1.00 25.25 ?  250 THR A OG1   1 
ATOM   884  C  CG2   . THR A 1  122 ? 12.575  8.870   -22.305 1.00 24.92 ?  250 THR A CG2   1 
ATOM   885  N  N     . ALA A 1  123 ? 13.909  5.419   -22.443 1.00 22.62 ?  251 ALA A N     1 
ATOM   886  C  CA    . ALA A 1  123 ? 15.249  4.946   -22.112 1.00 21.57 ?  251 ALA A CA    1 
ATOM   887  C  C     . ALA A 1  123 ? 15.984  4.458   -23.352 1.00 29.84 ?  251 ALA A C     1 
ATOM   888  O  O     . ALA A 1  123 ? 17.182  4.718   -23.518 1.00 24.91 ?  251 ALA A O     1 
ATOM   889  C  CB    . ALA A 1  123 ? 15.166  3.830   -21.071 1.00 20.01 ?  251 ALA A CB    1 
ATOM   890  N  N     . ASP A 1  124 ? 15.281  3.747   -24.236 1.00 26.56 ?  252 ASP A N     1 
ATOM   891  C  CA    . ASP A 1  124 ? 15.923  3.213   -25.432 1.00 27.63 ?  252 ASP A CA    1 
ATOM   892  C  C     . ASP A 1  124 ? 16.423  4.332   -26.337 1.00 25.21 ?  252 ASP A C     1 
ATOM   893  O  O     . ASP A 1  124 ? 17.545  4.268   -26.851 1.00 32.68 ?  252 ASP A O     1 
ATOM   894  C  CB    . ASP A 1  124 ? 14.955  2.305   -26.192 1.00 25.52 ?  252 ASP A CB    1 
ATOM   895  C  CG    . ASP A 1  124 ? 15.550  1.778   -27.482 1.00 28.76 ?  252 ASP A CG    1 
ATOM   896  O  OD1   . ASP A 1  124 ? 16.529  1.010   -27.406 1.00 24.74 ?  252 ASP A OD1   1 
ATOM   897  O  OD2   . ASP A 1  124 ? 15.040  2.128   -28.567 1.00 33.51 ?  252 ASP A OD2   1 
ATOM   898  N  N     A ARG A 1  125 ? 15.607  5.369   -26.534 0.47 28.96 ?  253 ARG A N     1 
ATOM   899  N  N     B ARG A 1  125 ? 15.603  5.363   -26.558 0.53 28.95 ?  253 ARG A N     1 
ATOM   900  C  CA    A ARG A 1  125 ? 16.014  6.493   -27.370 0.47 31.44 ?  253 ARG A CA    1 
ATOM   901  C  CA    B ARG A 1  125 ? 16.049  6.481   -27.384 0.53 31.42 ?  253 ARG A CA    1 
ATOM   902  C  C     A ARG A 1  125 ? 17.249  7.179   -26.796 0.47 33.08 ?  253 ARG A C     1 
ATOM   903  C  C     B ARG A 1  125 ? 17.287  7.133   -26.785 0.53 33.05 ?  253 ARG A C     1 
ATOM   904  O  O     A ARG A 1  125 ? 18.205  7.477   -27.522 0.47 34.39 ?  253 ARG A O     1 
ATOM   905  O  O     B ARG A 1  125 ? 18.279  7.368   -27.484 0.53 33.85 ?  253 ARG A O     1 
ATOM   906  C  CB    A ARG A 1  125 ? 14.854  7.480   -27.505 0.47 32.31 ?  253 ARG A CB    1 
ATOM   907  C  CB    B ARG A 1  125 ? 14.932  7.514   -27.549 0.53 32.62 ?  253 ARG A CB    1 
ATOM   908  C  CG    A ARG A 1  125 ? 15.149  8.676   -28.393 0.47 35.15 ?  253 ARG A CG    1 
ATOM   909  C  CG    B ARG A 1  125 ? 15.385  8.749   -28.328 0.53 34.99 ?  253 ARG A CG    1 
ATOM   910  C  CD    A ARG A 1  125 ? 13.895  9.498   -28.656 0.47 36.95 ?  253 ARG A CD    1 
ATOM   911  C  CD    B ARG A 1  125 ? 14.258  9.721   -28.636 0.53 37.66 ?  253 ARG A CD    1 
ATOM   912  N  NE    A ARG A 1  125 ? 13.246  9.933   -27.422 0.47 35.74 ?  253 ARG A NE    1 
ATOM   913  N  NE    B ARG A 1  125 ? 13.808  10.448  -27.451 0.53 37.62 ?  253 ARG A NE    1 
ATOM   914  C  CZ    A ARG A 1  125 ? 13.681  10.929  -26.655 0.47 38.73 ?  253 ARG A CZ    1 
ATOM   915  C  CZ    B ARG A 1  125 ? 12.653  10.249  -26.818 0.53 37.53 ?  253 ARG A CZ    1 
ATOM   916  N  NH1   A ARG A 1  125 ? 14.779  11.599  -26.981 0.47 36.56 ?  253 ARG A NH1   1 
ATOM   917  N  NH1   B ARG A 1  125 ? 11.786  9.339   -27.243 0.53 33.80 ?  253 ARG A NH1   1 
ATOM   918  N  NH2   A ARG A 1  125 ? 13.020  11.253  -25.552 0.47 40.61 ?  253 ARG A NH2   1 
ATOM   919  N  NH2   B ARG A 1  125 ? 12.360  10.976  -25.749 0.53 41.02 ?  253 ARG A NH2   1 
ATOM   920  N  N     . TRP A 1  126 ? 17.246  7.435   -25.486 1.00 34.46 ?  254 TRP A N     1 
ATOM   921  C  CA    . TRP A 1  126 ? 18.407  8.036   -24.840 1.00 35.52 ?  254 TRP A CA    1 
ATOM   922  C  C     . TRP A 1  126 ? 19.635  7.149   -24.986 1.00 28.33 ?  254 TRP A C     1 
ATOM   923  O  O     . TRP A 1  126 ? 20.751  7.646   -25.177 1.00 28.98 ?  254 TRP A O     1 
ATOM   924  C  CB    . TRP A 1  126 ? 18.109  8.298   -23.365 1.00 26.64 ?  254 TRP A CB    1 
ATOM   925  C  CG    . TRP A 1  126 ? 17.120  9.396   -23.142 1.00 31.67 ?  254 TRP A CG    1 
ATOM   926  C  CD1   . TRP A 1  126 ? 16.666  10.294  -24.067 1.00 32.84 ?  254 TRP A CD1   1 
ATOM   927  C  CD2   . TRP A 1  126 ? 16.457  9.717   -21.914 1.00 29.53 ?  254 TRP A CD2   1 
ATOM   928  N  NE1   . TRP A 1  126 ? 15.765  11.153  -23.489 1.00 32.10 ?  254 TRP A NE1   1 
ATOM   929  C  CE2   . TRP A 1  126 ? 15.618  10.819  -22.169 1.00 29.92 ?  254 TRP A CE2   1 
ATOM   930  C  CE3   . TRP A 1  126 ? 16.490  9.177   -20.625 1.00 28.78 ?  254 TRP A CE3   1 
ATOM   931  C  CZ2   . TRP A 1  126 ? 14.819  11.393  -21.182 1.00 30.93 ?  254 TRP A CZ2   1 
ATOM   932  C  CZ3   . TRP A 1  126 ? 15.696  9.748   -19.646 1.00 31.72 ?  254 TRP A CZ3   1 
ATOM   933  C  CH2   . TRP A 1  126 ? 14.873  10.844  -19.930 1.00 27.66 ?  254 TRP A CH2   1 
ATOM   934  N  N     . TYR A 1  127 ? 19.450  5.830   -24.901 1.00 26.67 ?  255 TYR A N     1 
ATOM   935  C  CA    . TYR A 1  127 ? 20.575  4.920   -25.086 1.00 26.56 ?  255 TYR A CA    1 
ATOM   936  C  C     . TYR A 1  127 ? 21.152  5.048   -26.490 1.00 32.27 ?  255 TYR A C     1 
ATOM   937  O  O     . TYR A 1  127 ? 22.374  5.099   -26.670 1.00 32.13 ?  255 TYR A O     1 
ATOM   938  C  CB    . TYR A 1  127 ? 20.144  3.478   -24.821 1.00 24.98 ?  255 TYR A CB    1 
ATOM   939  C  CG    . TYR A 1  127 ? 21.321  2.538   -24.739 1.00 25.37 ?  255 TYR A CG    1 
ATOM   940  C  CD1   . TYR A 1  127 ? 21.968  2.317   -23.533 1.00 24.37 ?  255 TYR A CD1   1 
ATOM   941  C  CD2   . TYR A 1  127 ? 21.805  1.895   -25.872 1.00 25.52 ?  255 TYR A CD2   1 
ATOM   942  C  CE1   . TYR A 1  127 ? 23.055  1.472   -23.451 1.00 28.76 ?  255 TYR A CE1   1 
ATOM   943  C  CE2   . TYR A 1  127 ? 22.890  1.047   -25.802 1.00 25.53 ?  255 TYR A CE2   1 
ATOM   944  C  CZ    . TYR A 1  127 ? 23.513  0.839   -24.588 1.00 28.64 ?  255 TYR A CZ    1 
ATOM   945  O  OH    . TYR A 1  127 ? 24.596  -0.005  -24.501 1.00 31.71 ?  255 TYR A OH    1 
ATOM   946  N  N     . ARG A 1  128 ? 20.283  5.096   -27.502 1.00 31.51 ?  256 ARG A N     1 
ATOM   947  C  CA    . ARG A 1  128 ? 20.755  5.223   -28.876 1.00 36.06 ?  256 ARG A CA    1 
ATOM   948  C  C     . ARG A 1  128 ? 21.409  6.578   -29.124 1.00 39.63 ?  256 ARG A C     1 
ATOM   949  O  O     . ARG A 1  128 ? 22.313  6.682   -29.961 1.00 43.98 ?  256 ARG A O     1 
ATOM   950  C  CB    . ARG A 1  128 ? 19.597  4.996   -29.847 1.00 35.80 ?  256 ARG A CB    1 
ATOM   951  C  CG    . ARG A 1  128 ? 19.027  3.586   -29.787 1.00 37.90 ?  256 ARG A CG    1 
ATOM   952  C  CD    . ARG A 1  128 ? 17.980  3.340   -30.862 1.00 42.97 ?  256 ARG A CD    1 
ATOM   953  N  NE    . ARG A 1  128 ? 16.688  3.935   -30.529 1.00 45.50 ?  256 ARG A NE    1 
ATOM   954  C  CZ    . ARG A 1  128 ? 16.289  5.136   -30.937 1.00 49.22 ?  256 ARG A CZ    1 
ATOM   955  N  N     . GLU A 1  129 ? 20.977  7.621   -28.412 1.00 37.64 ?  257 GLU A N     1 
ATOM   956  C  CA    . GLU A 1  129 ? 21.608  8.931   -28.524 1.00 38.90 ?  257 GLU A CA    1 
ATOM   957  C  C     . GLU A 1  129 ? 22.963  9.001   -27.827 1.00 40.48 ?  257 GLU A C     1 
ATOM   958  O  O     . GLU A 1  129 ? 23.628  10.039  -27.916 1.00 42.09 ?  257 GLU A O     1 
ATOM   959  C  CB    . GLU A 1  129 ? 20.683  10.008  -27.952 1.00 38.63 ?  257 GLU A CB    1 
ATOM   960  C  CG    . GLU A 1  129 ? 19.405  10.214  -28.749 1.00 40.95 ?  257 GLU A CG    1 
ATOM   961  C  CD    . GLU A 1  129 ? 18.476  11.231  -28.113 1.00 50.15 ?  257 GLU A CD    1 
ATOM   962  O  OE1   . GLU A 1  129 ? 18.868  11.840  -27.096 1.00 52.16 ?  257 GLU A OE1   1 
ATOM   963  O  OE2   . GLU A 1  129 ? 17.353  11.418  -28.629 1.00 52.50 ?  257 GLU A OE2   1 
ATOM   964  N  N     . GLY A 1  130 ? 23.384  7.941   -27.140 1.00 32.41 ?  258 GLY A N     1 
ATOM   965  C  CA    . GLY A 1  130 ? 24.677  7.904   -26.490 1.00 37.54 ?  258 GLY A CA    1 
ATOM   966  C  C     . GLY A 1  130 ? 24.663  8.161   -24.999 1.00 36.34 ?  258 GLY A C     1 
ATOM   967  O  O     . GLY A 1  130 ? 25.725  8.088   -24.370 1.00 36.96 ?  258 GLY A O     1 
ATOM   968  N  N     . LEU A 1  131 ? 23.506  8.454   -24.414 1.00 30.92 ?  259 LEU A N     1 
ATOM   969  C  CA    . LEU A 1  131 ? 23.438  8.762   -22.993 1.00 30.13 ?  259 LEU A CA    1 
ATOM   970  C  C     . LEU A 1  131 ? 23.559  7.486   -22.167 1.00 35.10 ?  259 LEU A C     1 
ATOM   971  O  O     . LEU A 1  131 ? 23.046  6.428   -22.546 1.00 32.70 ?  259 LEU A O     1 
ATOM   972  C  CB    . LEU A 1  131 ? 22.128  9.483   -22.681 1.00 31.27 ?  259 LEU A CB    1 
ATOM   973  C  CG    . LEU A 1  131 ? 21.915  10.781  -23.470 1.00 35.83 ?  259 LEU A CG    1 
ATOM   974  C  CD1   . LEU A 1  131 ? 20.439  11.120  -23.588 1.00 38.02 ?  259 LEU A CD1   1 
ATOM   975  C  CD2   . LEU A 1  131 ? 22.671  11.925  -22.819 1.00 34.85 ?  259 LEU A CD2   1 
ATOM   976  N  N     . ARG A 1  132 ? 24.244  7.589   -21.025 1.00 34.90 ?  260 ARG A N     1 
ATOM   977  C  CA    . ARG A 1  132 ? 24.541  6.414   -20.211 1.00 27.17 ?  260 ARG A CA    1 
ATOM   978  C  C     . ARG A 1  132 ? 24.327  6.609   -18.716 1.00 30.93 ?  260 ARG A C     1 
ATOM   979  O  O     . ARG A 1  132 ? 24.062  5.621   -18.023 1.00 30.20 ?  260 ARG A O     1 
ATOM   980  C  CB    . ARG A 1  132 ? 25.992  5.967   -20.445 1.00 28.04 ?  260 ARG A CB    1 
ATOM   981  C  CG    . ARG A 1  132 ? 26.278  5.474   -21.858 1.00 28.75 ?  260 ARG A CG    1 
ATOM   982  C  CD    . ARG A 1  132 ? 25.544  4.178   -22.158 1.00 33.88 ?  260 ARG A CD    1 
ATOM   983  N  NE    . ARG A 1  132 ? 25.878  3.639   -23.475 1.00 31.57 ?  260 ARG A NE    1 
ATOM   984  C  CZ    . ARG A 1  132 ? 25.257  3.963   -24.606 1.00 32.30 ?  260 ARG A CZ    1 
ATOM   985  N  NH1   . ARG A 1  132 ? 24.257  4.835   -24.603 1.00 33.32 ?  260 ARG A NH1   1 
ATOM   986  N  NH2   . ARG A 1  132 ? 25.638  3.411   -25.748 1.00 29.86 ?  260 ARG A NH2   1 
ATOM   987  N  N     . THR A 1  133 ? 24.419  7.828   -18.188 1.00 29.26 ?  261 THR A N     1 
ATOM   988  C  CA    . THR A 1  133 ? 24.417  8.058   -16.752 1.00 32.20 ?  261 THR A CA    1 
ATOM   989  C  C     . THR A 1  133 ? 23.340  9.072   -16.393 1.00 31.83 ?  261 THR A C     1 
ATOM   990  O  O     . THR A 1  133 ? 22.782  9.756   -17.256 1.00 32.78 ?  261 THR A O     1 
ATOM   991  C  CB    . THR A 1  133 ? 25.783  8.563   -16.265 1.00 34.00 ?  261 THR A CB    1 
ATOM   992  O  OG1   . THR A 1  133 ? 25.939  9.940   -16.628 1.00 38.20 ?  261 THR A OG1   1 
ATOM   993  C  CG2   . THR A 1  133 ? 26.911  7.752   -16.883 1.00 31.92 ?  261 THR A CG2   1 
ATOM   994  N  N     . LEU A 1  134 ? 23.051  9.166   -15.093 1.00 34.26 ?  262 LEU A N     1 
ATOM   995  C  CA    . LEU A 1  134 ? 22.093  10.164  -14.628 1.00 34.08 ?  262 LEU A CA    1 
ATOM   996  C  C     . LEU A 1  134 ? 22.625  11.573  -14.847 1.00 34.82 ?  262 LEU A C     1 
ATOM   997  O  O     . LEU A 1  134 ? 21.868  12.478  -15.214 1.00 34.15 ?  262 LEU A O     1 
ATOM   998  C  CB    . LEU A 1  134 ? 21.765  9.941   -13.153 1.00 29.53 ?  262 LEU A CB    1 
ATOM   999  C  CG    . LEU A 1  134 ? 21.115  8.609   -12.766 1.00 29.94 ?  262 LEU A CG    1 
ATOM   1000 C  CD1   . LEU A 1  134 ? 20.659  8.667   -11.319 1.00 28.73 ?  262 LEU A CD1   1 
ATOM   1001 C  CD2   . LEU A 1  134 ? 19.946  8.255   -13.680 1.00 31.58 ?  262 LEU A CD2   1 
ATOM   1002 N  N     . ASP A 1  135 ? 23.925  11.780  -14.624 1.00 33.19 ?  263 ASP A N     1 
ATOM   1003 C  CA    . ASP A 1  135 ? 24.513  13.086  -14.900 1.00 39.66 ?  263 ASP A CA    1 
ATOM   1004 C  C     . ASP A 1  135 ? 24.429  13.430  -16.381 1.00 33.84 ?  263 ASP A C     1 
ATOM   1005 O  O     . ASP A 1  135 ? 24.283  14.606  -16.737 1.00 34.76 ?  263 ASP A O     1 
ATOM   1006 C  CB    . ASP A 1  135 ? 25.963  13.127  -14.416 1.00 38.37 ?  263 ASP A CB    1 
ATOM   1007 C  CG    . ASP A 1  135 ? 26.072  13.144  -12.901 1.00 52.29 ?  263 ASP A CG    1 
ATOM   1008 O  OD1   . ASP A 1  135 ? 25.099  13.562  -12.233 1.00 57.75 ?  263 ASP A OD1   1 
ATOM   1009 O  OD2   . ASP A 1  135 ? 27.133  12.745  -12.376 1.00 57.04 ?  263 ASP A OD2   1 
ATOM   1010 N  N     . ASP A 1  136 ? 24.507  12.427  -17.259 1.00 34.83 ?  264 ASP A N     1 
ATOM   1011 C  CA    . ASP A 1  136 ? 24.281  12.678  -18.679 1.00 31.96 ?  264 ASP A CA    1 
ATOM   1012 C  C     . ASP A 1  136 ? 22.900  13.280  -18.912 1.00 33.66 ?  264 ASP A C     1 
ATOM   1013 O  O     . ASP A 1  136 ? 22.734  14.162  -19.762 1.00 32.19 ?  264 ASP A O     1 
ATOM   1014 C  CB    . ASP A 1  136 ? 24.445  11.384  -19.478 1.00 36.31 ?  264 ASP A CB    1 
ATOM   1015 C  CG    . ASP A 1  136 ? 25.873  10.864  -19.468 1.00 41.61 ?  264 ASP A CG    1 
ATOM   1016 O  OD1   . ASP A 1  136 ? 26.804  11.669  -19.258 1.00 35.52 ?  264 ASP A OD1   1 
ATOM   1017 O  OD2   . ASP A 1  136 ? 26.065  9.647   -19.679 1.00 42.14 ?  264 ASP A OD2   1 
ATOM   1018 N  N     . LEU A 1  137 ? 21.897  12.818  -18.162 1.00 29.33 ?  265 LEU A N     1 
ATOM   1019 C  CA    . LEU A 1  137 ? 20.556  13.382  -18.279 1.00 33.00 ?  265 LEU A CA    1 
ATOM   1020 C  C     . LEU A 1  137 ? 20.487  14.763  -17.641 1.00 37.39 ?  265 LEU A C     1 
ATOM   1021 O  O     . LEU A 1  137 ? 19.906  15.694  -18.210 1.00 40.47 ?  265 LEU A O     1 
ATOM   1022 C  CB    . LEU A 1  137 ? 19.534  12.444  -17.630 1.00 27.10 ?  265 LEU A CB    1 
ATOM   1023 C  CG    . LEU A 1  137 ? 19.488  11.004  -18.147 1.00 28.58 ?  265 LEU A CG    1 
ATOM   1024 C  CD1   . LEU A 1  137 ? 18.536  10.166  -17.301 1.00 25.85 ?  265 LEU A CD1   1 
ATOM   1025 C  CD2   . LEU A 1  137 ? 19.071  10.974  -19.608 1.00 28.92 ?  265 LEU A CD2   1 
ATOM   1026 N  N     . ARG A 1  138 ? 21.074  14.914  -16.451 1.00 39.08 ?  266 ARG A N     1 
ATOM   1027 C  CA    . ARG A 1  138 ? 21.069  16.207  -15.778 1.00 38.58 ?  266 ARG A CA    1 
ATOM   1028 C  C     . ARG A 1  138 ? 21.776  17.269  -16.609 1.00 47.08 ?  266 ARG A C     1 
ATOM   1029 O  O     . ARG A 1  138 ? 21.415  18.450  -16.545 1.00 51.01 ?  266 ARG A O     1 
ATOM   1030 C  CB    . ARG A 1  138 ? 21.729  16.082  -14.403 1.00 40.63 ?  266 ARG A CB    1 
ATOM   1031 C  CG    . ARG A 1  138 ? 21.033  15.098  -13.461 1.00 42.42 ?  266 ARG A CG    1 
ATOM   1032 C  CD    . ARG A 1  138 ? 21.591  15.182  -12.047 1.00 46.55 ?  266 ARG A CD    1 
ATOM   1033 N  NE    . ARG A 1  138 ? 20.771  14.448  -11.081 1.00 47.90 ?  266 ARG A NE    1 
ATOM   1034 C  CZ    . ARG A 1  138 ? 21.128  13.325  -10.460 1.00 45.71 ?  266 ARG A CZ    1 
ATOM   1035 N  NH1   . ARG A 1  138 ? 22.312  12.765  -10.673 1.00 41.32 ?  266 ARG A NH1   1 
ATOM   1036 N  NH2   . ARG A 1  138 ? 20.290  12.758  -9.604  1.00 43.63 ?  266 ARG A NH2   1 
ATOM   1037 N  N     . GLU A 1  139 ? 22.774  16.872  -17.399 1.00 45.59 ?  267 GLU A N     1 
ATOM   1038 C  CA    . GLU A 1  139 ? 23.540  17.807  -18.214 1.00 52.89 ?  267 GLU A CA    1 
ATOM   1039 C  C     . GLU A 1  139 ? 22.810  18.239  -19.482 1.00 57.89 ?  267 GLU A C     1 
ATOM   1040 O  O     . GLU A 1  139 ? 23.385  18.989  -20.279 1.00 60.10 ?  267 GLU A O     1 
ATOM   1041 C  CB    . GLU A 1  139 ? 24.891  17.190  -18.590 1.00 43.79 ?  267 GLU A CB    1 
ATOM   1042 N  N     . GLN A 1  140 ? 21.569  17.794  -19.688 1.00 57.20 ?  268 GLN A N     1 
ATOM   1043 C  CA    . GLN A 1  140 ? 20.775  18.169  -20.863 1.00 59.33 ?  268 GLN A CA    1 
ATOM   1044 C  C     . GLN A 1  140 ? 19.314  18.259  -20.456 1.00 60.74 ?  268 GLN A C     1 
ATOM   1045 O  O     . GLN A 1  140 ? 18.451  17.523  -20.954 1.00 62.07 ?  268 GLN A O     1 
ATOM   1046 C  CB    . GLN A 1  140 ? 20.984  17.168  -21.998 1.00 59.84 ?  268 GLN A CB    1 
ATOM   1047 N  N     . PRO A 1  141 ? 18.987  19.166  -19.532 1.00 57.10 ?  269 PRO A N     1 
ATOM   1048 C  CA    . PRO A 1  141 ? 17.641  19.183  -18.945 1.00 55.41 ?  269 PRO A CA    1 
ATOM   1049 C  C     . PRO A 1  141 ? 16.554  19.648  -19.898 1.00 55.68 ?  269 PRO A C     1 
ATOM   1050 O  O     . PRO A 1  141 ? 15.369  19.474  -19.584 1.00 57.20 ?  269 PRO A O     1 
ATOM   1051 C  CB    . PRO A 1  141 ? 17.788  20.147  -17.762 1.00 53.14 ?  269 PRO A CB    1 
ATOM   1052 C  CG    . PRO A 1  141 ? 18.875  21.075  -18.182 1.00 55.32 ?  269 PRO A CG    1 
ATOM   1053 C  CD    . PRO A 1  141 ? 19.826  20.271  -19.029 1.00 55.49 ?  269 PRO A CD    1 
ATOM   1054 N  N     . GLN A 1  142 ? 16.907  20.230  -21.045 1.00 54.34 ?  270 GLN A N     1 
ATOM   1055 C  CA    . GLN A 1  142 ? 15.893  20.659  -22.001 1.00 58.28 ?  270 GLN A CA    1 
ATOM   1056 C  C     . GLN A 1  142 ? 15.128  19.484  -22.596 1.00 56.66 ?  270 GLN A C     1 
ATOM   1057 O  O     . GLN A 1  142 ? 14.032  19.680  -23.132 1.00 60.53 ?  270 GLN A O     1 
ATOM   1058 C  CB    . GLN A 1  142 ? 16.541  21.477  -23.120 1.00 57.56 ?  270 GLN A CB    1 
ATOM   1059 N  N     . LYS A 1  143 ? 15.672  18.273  -22.507 1.00 51.47 ?  271 LYS A N     1 
ATOM   1060 C  CA    . LYS A 1  143 ? 15.046  17.093  -23.086 1.00 53.07 ?  271 LYS A CA    1 
ATOM   1061 C  C     . LYS A 1  143 ? 14.109  16.377  -22.123 1.00 50.84 ?  271 LYS A C     1 
ATOM   1062 O  O     . LYS A 1  143 ? 13.568  15.326  -22.480 1.00 58.11 ?  271 LYS A O     1 
ATOM   1063 C  CB    . LYS A 1  143 ? 16.123  16.113  -23.564 1.00 55.09 ?  271 LYS A CB    1 
ATOM   1064 N  N     . LEU A 1  144 ? 13.894  16.913  -20.925 1.00 40.42 ?  272 LEU A N     1 
ATOM   1065 C  CA    . LEU A 1  144 ? 13.160  16.217  -19.879 1.00 39.65 ?  272 LEU A CA    1 
ATOM   1066 C  C     . LEU A 1  144 ? 11.792  16.846  -19.665 1.00 40.84 ?  272 LEU A C     1 
ATOM   1067 O  O     . LEU A 1  144 ? 11.650  18.074  -19.672 1.00 36.54 ?  272 LEU A O     1 
ATOM   1068 C  CB    . LEU A 1  144 ? 13.931  16.243  -18.559 1.00 36.49 ?  272 LEU A CB    1 
ATOM   1069 C  CG    . LEU A 1  144 ? 15.355  15.702  -18.614 1.00 37.77 ?  272 LEU A CG    1 
ATOM   1070 C  CD1   . LEU A 1  144 ? 16.086  16.017  -17.320 1.00 38.08 ?  272 LEU A CD1   1 
ATOM   1071 C  CD2   . LEU A 1  144 ? 15.343  14.209  -18.879 1.00 36.05 ?  272 LEU A CD2   1 
ATOM   1072 N  N     . THR A 1  145 ? 10.790  15.995  -19.467 1.00 31.51 ?  273 THR A N     1 
ATOM   1073 C  CA    . THR A 1  145 ? 9.501   16.461  -18.990 1.00 30.11 ?  273 THR A CA    1 
ATOM   1074 C  C     . THR A 1  145 ? 9.619   16.880  -17.529 1.00 31.03 ?  273 THR A C     1 
ATOM   1075 O  O     . THR A 1  145 ? 10.591  16.559  -16.842 1.00 27.68 ?  273 THR A O     1 
ATOM   1076 C  CB    . THR A 1  145 ? 8.444   15.368  -19.134 1.00 30.39 ?  273 THR A CB    1 
ATOM   1077 O  OG1   . THR A 1  145 ? 8.751   14.284  -18.248 1.00 29.96 ?  273 THR A OG1   1 
ATOM   1078 C  CG2   . THR A 1  145 ? 8.398   14.845  -20.567 1.00 28.53 ?  273 THR A CG2   1 
ATOM   1079 N  N     . GLN A 1  146 ? 8.619   17.624  -17.055 1.00 33.26 ?  274 GLN A N     1 
ATOM   1080 C  CA    . GLN A 1  146 ? 8.613   18.016  -15.650 1.00 31.16 ?  274 GLN A CA    1 
ATOM   1081 C  C     . GLN A 1  146 ? 8.551   16.789  -14.748 1.00 27.46 ?  274 GLN A C     1 
ATOM   1082 O  O     . GLN A 1  146 ? 9.192   16.750  -13.691 1.00 33.21 ?  274 GLN A O     1 
ATOM   1083 C  CB    . GLN A 1  146 ? 7.440   18.956  -15.370 1.00 34.94 ?  274 GLN A CB    1 
ATOM   1084 N  N     . GLN A 1  147 ? 7.784   15.775  -15.152 1.00 22.43 ?  275 GLN A N     1 
ATOM   1085 C  CA    . GLN A 1  147 ? 7.728   14.529  -14.397 1.00 25.79 ?  275 GLN A CA    1 
ATOM   1086 C  C     . GLN A 1  147 ? 9.098   13.869  -14.320 1.00 33.04 ?  275 GLN A C     1 
ATOM   1087 O  O     . GLN A 1  147 ? 9.502   13.375  -13.260 1.00 29.52 ?  275 GLN A O     1 
ATOM   1088 C  CB    . GLN A 1  147 ? 6.715   13.582  -15.038 1.00 25.34 ?  275 GLN A CB    1 
ATOM   1089 C  CG    . GLN A 1  147 ? 6.614   12.220  -14.370 1.00 27.18 ?  275 GLN A CG    1 
ATOM   1090 C  CD    . GLN A 1  147 ? 5.639   11.299  -15.076 1.00 29.03 ?  275 GLN A CD    1 
ATOM   1091 O  OE1   . GLN A 1  147 ? 5.816   10.972  -16.249 1.00 31.72 ?  275 GLN A OE1   1 
ATOM   1092 N  NE2   . GLN A 1  147 ? 4.598   10.883  -14.368 1.00 31.75 ?  275 GLN A NE2   1 
ATOM   1093 N  N     . GLN A 1  148 ? 9.825   13.848  -15.439 1.00 27.16 ?  276 GLN A N     1 
ATOM   1094 C  CA    . GLN A 1  148 ? 11.153  13.250  -15.454 1.00 21.86 ?  276 GLN A CA    1 
ATOM   1095 C  C     . GLN A 1  148 ? 12.144  14.087  -14.656 1.00 23.65 ?  276 GLN A C     1 
ATOM   1096 O  O     . GLN A 1  148 ? 13.043  13.543  -14.006 1.00 22.08 ?  276 GLN A O     1 
ATOM   1097 C  CB    . GLN A 1  148 ? 11.612  13.080  -16.900 1.00 28.10 ?  276 GLN A CB    1 
ATOM   1098 C  CG    . GLN A 1  148 ? 10.803  12.038  -17.657 1.00 22.15 ?  276 GLN A CG    1 
ATOM   1099 C  CD    . GLN A 1  148 ? 10.987  12.116  -19.159 1.00 31.95 ?  276 GLN A CD    1 
ATOM   1100 O  OE1   . GLN A 1  148 ? 11.664  13.008  -19.674 1.00 29.30 ?  276 GLN A OE1   1 
ATOM   1101 N  NE2   . GLN A 1  148 ? 10.378  11.179  -19.872 1.00 22.80 ?  276 GLN A NE2   1 
ATOM   1102 N  N     . LYS A 1  149 ? 12.001  15.414  -14.694 1.00 23.60 ?  277 LYS A N     1 
ATOM   1103 C  CA    . LYS A 1  149 ? 12.814  16.266  -13.834 1.00 32.27 ?  277 LYS A CA    1 
ATOM   1104 C  C     . LYS A 1  149 ? 12.593  15.921  -12.367 1.00 22.87 ?  277 LYS A C     1 
ATOM   1105 O  O     . LYS A 1  149 ? 13.547  15.858  -11.582 1.00 24.88 ?  277 LYS A O     1 
ATOM   1106 C  CB    . LYS A 1  149 ? 12.488  17.738  -14.095 1.00 26.83 ?  277 LYS A CB    1 
ATOM   1107 C  CG    . LYS A 1  149 ? 12.873  18.223  -15.482 1.00 32.67 ?  277 LYS A CG    1 
ATOM   1108 N  N     . ALA A 1  150 ? 11.336  15.694  -11.980 1.00 27.04 ?  278 ALA A N     1 
ATOM   1109 C  CA    . ALA A 1  150 ? 11.037  15.295  -10.609 1.00 26.32 ?  278 ALA A CA    1 
ATOM   1110 C  C     . ALA A 1  150 ? 11.645  13.934  -10.290 1.00 28.41 ?  278 ALA A C     1 
ATOM   1111 O  O     . ALA A 1  150 ? 12.275  13.750  -9.242  1.00 24.59 ?  278 ALA A O     1 
ATOM   1112 C  CB    . ALA A 1  150 ? 9.523   15.266  -10.396 1.00 22.21 ?  278 ALA A CB    1 
ATOM   1113 N  N     . GLY A 1  151 ? 11.456  12.961  -11.182 1.00 19.19 ?  279 GLY A N     1 
ATOM   1114 C  CA    . GLY A 1  151 ? 12.027  11.643  -10.960 1.00 18.31 ?  279 GLY A CA    1 
ATOM   1115 C  C     . GLY A 1  151 ? 13.539  11.666  -10.870 1.00 19.03 ?  279 GLY A C     1 
ATOM   1116 O  O     . GLY A 1  151 ? 14.135  10.876  -10.134 1.00 19.33 ?  279 GLY A O     1 
ATOM   1117 N  N     . LEU A 1  152 ? 14.178  12.574  -11.604 1.00 20.48 ?  280 LEU A N     1 
ATOM   1118 C  CA    . LEU A 1  152 ? 15.632  12.651  -11.602 1.00 21.34 ?  280 LEU A CA    1 
ATOM   1119 C  C     . LEU A 1  152 ? 16.150  13.407  -10.381 1.00 24.81 ?  280 LEU A C     1 
ATOM   1120 O  O     . LEU A 1  152 ? 17.133  12.989  -9.761  1.00 25.35 ?  280 LEU A O     1 
ATOM   1121 C  CB    . LEU A 1  152 ? 16.102  13.312  -12.897 1.00 22.87 ?  280 LEU A CB    1 
ATOM   1122 C  CG    . LEU A 1  152 ? 17.598  13.359  -13.197 1.00 40.81 ?  280 LEU A CG    1 
ATOM   1123 C  CD1   . LEU A 1  152 ? 18.224  11.972  -13.128 1.00 37.26 ?  280 LEU A CD1   1 
ATOM   1124 C  CD2   . LEU A 1  152 ? 17.801  13.971  -14.578 1.00 35.73 ?  280 LEU A CD2   1 
ATOM   1125 N  N     . GLN A 1  153 ? 15.508  14.524  -10.023 1.00 22.24 ?  281 GLN A N     1 
ATOM   1126 C  CA    . GLN A 1  153 ? 15.898  15.251  -8.816  1.00 24.74 ?  281 GLN A CA    1 
ATOM   1127 C  C     . GLN A 1  153 ? 15.794  14.367  -7.579  1.00 20.71 ?  281 GLN A C     1 
ATOM   1128 O  O     . GLN A 1  153 ? 16.687  14.376  -6.723  1.00 25.41 ?  281 GLN A O     1 
ATOM   1129 C  CB    . GLN A 1  153 ? 15.028  16.497  -8.645  1.00 27.50 ?  281 GLN A CB    1 
ATOM   1130 C  CG    . GLN A 1  153 ? 15.526  17.724  -9.396  1.00 34.59 ?  281 GLN A CG    1 
ATOM   1131 C  CD    . GLN A 1  153 ? 14.450  18.781  -9.564  1.00 42.66 ?  281 GLN A CD    1 
ATOM   1132 N  N     . HIS A 1  154 ? 14.717  13.592  -7.472  1.00 19.43 ?  282 HIS A N     1 
ATOM   1133 C  CA    . HIS A 1  154 ? 14.468  12.751  -6.308  1.00 18.10 ?  282 HIS A CA    1 
ATOM   1134 C  C     . HIS A 1  154 ? 14.941  11.317  -6.501  1.00 17.39 ?  282 HIS A C     1 
ATOM   1135 O  O     . HIS A 1  154 ? 14.594  10.449  -5.695  1.00 16.22 ?  282 HIS A O     1 
ATOM   1136 C  CB    . HIS A 1  154 ? 12.977  12.772  -5.971  1.00 19.08 ?  282 HIS A CB    1 
ATOM   1137 C  CG    . HIS A 1  154 ? 12.473  14.128  -5.588  1.00 19.00 ?  282 HIS A CG    1 
ATOM   1138 N  ND1   . HIS A 1  154 ? 12.765  14.713  -4.374  1.00 24.89 ?  282 HIS A ND1   1 
ATOM   1139 C  CD2   . HIS A 1  154 ? 11.713  15.021  -6.263  1.00 18.36 ?  282 HIS A CD2   1 
ATOM   1140 C  CE1   . HIS A 1  154 ? 12.194  15.904  -4.314  1.00 22.62 ?  282 HIS A CE1   1 
ATOM   1141 N  NE2   . HIS A 1  154 ? 11.549  16.115  -5.447  1.00 18.74 ?  282 HIS A NE2   1 
ATOM   1142 N  N     . HIS A 1  155 ? 15.751  11.056  -7.528  1.00 21.11 ?  283 HIS A N     1 
ATOM   1143 C  CA    . HIS A 1  155 ? 16.100  9.678   -7.861  1.00 23.85 ?  283 HIS A CA    1 
ATOM   1144 C  C     . HIS A 1  155 ? 16.735  8.954   -6.680  1.00 19.73 ?  283 HIS A C     1 
ATOM   1145 O  O     . HIS A 1  155 ? 16.423  7.786   -6.423  1.00 15.74 ?  283 HIS A O     1 
ATOM   1146 C  CB    . HIS A 1  155 ? 17.043  9.645   -9.061  1.00 28.95 ?  283 HIS A CB    1 
ATOM   1147 C  CG    . HIS A 1  155 ? 17.469  8.262   -9.444  1.00 33.07 ?  283 HIS A CG    1 
ATOM   1148 N  ND1   . HIS A 1  155 ? 18.559  7.635   -8.880  1.00 29.80 ?  283 HIS A ND1   1 
ATOM   1149 C  CD2   . HIS A 1  155 ? 16.939  7.378   -10.322 1.00 34.41 ?  283 HIS A CD2   1 
ATOM   1150 C  CE1   . HIS A 1  155 ? 18.686  6.427   -9.398  1.00 28.96 ?  283 HIS A CE1   1 
ATOM   1151 N  NE2   . HIS A 1  155 ? 17.717  6.247   -10.278 1.00 32.57 ?  283 HIS A NE2   1 
ATOM   1152 N  N     . GLN A 1  156 ? 17.632  9.622   -5.952  1.00 17.55 ?  284 GLN A N     1 
ATOM   1153 C  CA    . GLN A 1  156 ? 18.348  8.944   -4.876  1.00 18.95 ?  284 GLN A CA    1 
ATOM   1154 C  C     . GLN A 1  156 ? 17.386  8.473   -3.792  1.00 18.80 ?  284 GLN A C     1 
ATOM   1155 O  O     . GLN A 1  156 ? 17.426  7.310   -3.377  1.00 16.73 ?  284 GLN A O     1 
ATOM   1156 C  CB    . GLN A 1  156 ? 19.421  9.865   -4.292  1.00 19.19 ?  284 GLN A CB    1 
ATOM   1157 C  CG    . GLN A 1  156 ? 20.244  9.210   -3.194  1.00 26.55 ?  284 GLN A CG    1 
ATOM   1158 C  CD    . GLN A 1  156 ? 21.378  10.091  -2.707  1.00 41.27 ?  284 GLN A CD    1 
ATOM   1159 O  OE1   . GLN A 1  156 ? 21.783  11.037  -3.383  1.00 38.83 ?  284 GLN A OE1   1 
ATOM   1160 N  NE2   . GLN A 1  156 ? 21.894  9.785   -1.522  1.00 49.01 ?  284 GLN A NE2   1 
ATOM   1161 N  N     . ASP A 1  157 ? 16.506  9.362   -3.321  1.00 16.27 ?  285 ASP A N     1 
ATOM   1162 C  CA    . ASP A 1  157 ? 15.505  8.951   -2.340  1.00 14.83 ?  285 ASP A CA    1 
ATOM   1163 C  C     . ASP A 1  157 ? 14.604  7.857   -2.897  1.00 15.88 ?  285 ASP A C     1 
ATOM   1164 O  O     . ASP A 1  157 ? 14.279  6.892   -2.197  1.00 16.13 ?  285 ASP A O     1 
ATOM   1165 C  CB    . ASP A 1  157 ? 14.659  10.148  -1.899  1.00 17.44 ?  285 ASP A CB    1 
ATOM   1166 C  CG    . ASP A 1  157 ? 15.374  11.039  -0.897  1.00 21.47 ?  285 ASP A CG    1 
ATOM   1167 O  OD1   . ASP A 1  157 ? 16.455  10.652  -0.406  1.00 18.80 ?  285 ASP A OD1   1 
ATOM   1168 O  OD2   . ASP A 1  157 ? 14.845  12.128  -0.592  1.00 21.64 ?  285 ASP A OD2   1 
ATOM   1169 N  N     . LEU A 1  158 ? 14.179  7.993   -4.154  1.00 15.35 ?  286 LEU A N     1 
ATOM   1170 C  CA    . LEU A 1  158 ? 13.261  7.015   -4.724  1.00 15.87 ?  286 LEU A CA    1 
ATOM   1171 C  C     . LEU A 1  158 ? 13.931  5.669   -4.962  1.00 14.99 ?  286 LEU A C     1 
ATOM   1172 O  O     . LEU A 1  158 ? 13.233  4.671   -5.165  1.00 19.21 ?  286 LEU A O     1 
ATOM   1173 C  CB    . LEU A 1  158 ? 12.668  7.552   -6.026  1.00 15.66 ?  286 LEU A CB    1 
ATOM   1174 C  CG    . LEU A 1  158 ? 11.903  8.879   -5.920  1.00 25.94 ?  286 LEU A CG    1 
ATOM   1175 C  CD1   . LEU A 1  158 ? 11.091  9.130   -7.182  1.00 23.91 ?  286 LEU A CD1   1 
ATOM   1176 C  CD2   . LEU A 1  158 ? 11.016  8.938   -4.686  1.00 12.92 ?  286 LEU A CD2   1 
ATOM   1177 N  N     . SER A 1  159 ? 15.263  5.617   -4.945  1.00 15.31 ?  287 SER A N     1 
ATOM   1178 C  CA    A SER A 1  159 ? 15.979  4.353   -5.044  0.23 17.36 ?  287 SER A CA    1 
ATOM   1179 C  CA    B SER A 1  159 ? 15.980  4.354   -5.043  0.77 16.66 ?  287 SER A CA    1 
ATOM   1180 C  C     . SER A 1  159 ? 16.127  3.663   -3.696  1.00 20.69 ?  287 SER A C     1 
ATOM   1181 O  O     . SER A 1  159 ? 16.562  2.508   -3.654  1.00 21.94 ?  287 SER A O     1 
ATOM   1182 C  CB    A SER A 1  159 ? 17.361  4.580   -5.657  0.23 18.90 ?  287 SER A CB    1 
ATOM   1183 C  CB    B SER A 1  159 ? 17.370  4.573   -5.651  0.77 18.42 ?  287 SER A CB    1 
ATOM   1184 O  OG    A SER A 1  159 ? 17.258  5.191   -6.931  0.23 18.93 ?  287 SER A OG    1 
ATOM   1185 O  OG    B SER A 1  159 ? 18.269  5.111   -4.697  0.77 22.89 ?  287 SER A OG    1 
ATOM   1186 N  N     . THR A 1  160 ? 15.781  4.343   -2.601  1.00 19.88 ?  288 THR A N     1 
ATOM   1187 C  CA    . THR A 1  160 ? 15.811  3.796   -1.250  1.00 21.38 ?  288 THR A CA    1 
ATOM   1188 C  C     . THR A 1  160 ? 14.521  3.025   -0.986  1.00 16.36 ?  288 THR A C     1 
ATOM   1189 O  O     . THR A 1  160 ? 13.432  3.574   -1.187  1.00 15.80 ?  288 THR A O     1 
ATOM   1190 C  CB    . THR A 1  160 ? 15.957  4.913   -0.229  1.00 23.76 ?  288 THR A CB    1 
ATOM   1191 O  OG1   . THR A 1  160 ? 17.086  5.727   -0.572  1.00 28.07 ?  288 THR A OG1   1 
ATOM   1192 C  CG2   . THR A 1  160 ? 16.147  4.347   1.168   1.00 27.74 ?  288 THR A CG2   1 
ATOM   1193 N  N     . PRO A 1  161 ? 14.584  1.769   -0.549  1.00 21.86 ?  289 PRO A N     1 
ATOM   1194 C  CA    . PRO A 1  161 ? 13.343  1.019   -0.317  1.00 22.23 ?  289 PRO A CA    1 
ATOM   1195 C  C     . PRO A 1  161 ? 12.457  1.693   0.719   1.00 17.67 ?  289 PRO A C     1 
ATOM   1196 O  O     . PRO A 1  161 ? 12.916  2.104   1.787   1.00 15.22 ?  289 PRO A O     1 
ATOM   1197 C  CB    . PRO A 1  161 ? 13.839  -0.347  0.168   1.00 18.44 ?  289 PRO A CB    1 
ATOM   1198 C  CG    . PRO A 1  161 ? 15.208  -0.470  -0.403  1.00 22.83 ?  289 PRO A CG    1 
ATOM   1199 C  CD    . PRO A 1  161 ? 15.773  0.918   -0.366  1.00 21.30 ?  289 PRO A CD    1 
ATOM   1200 N  N     . VAL A 1  162 ? 11.170  1.799   0.388   1.00 16.37 ?  290 VAL A N     1 
ATOM   1201 C  CA    . VAL A 1  162 ? 10.169  2.211   1.359   1.00 19.88 ?  290 VAL A CA    1 
ATOM   1202 C  C     . VAL A 1  162 ? 9.959   1.083   2.358   1.00 15.80 ?  290 VAL A C     1 
ATOM   1203 O  O     . VAL A 1  162 ? 9.845   -0.090  1.978   1.00 14.21 ?  290 VAL A O     1 
ATOM   1204 C  CB    . VAL A 1  162 ? 8.851   2.570   0.651   1.00 17.53 ?  290 VAL A CB    1 
ATOM   1205 C  CG1   . VAL A 1  162 ? 7.855   3.161   1.638   1.00 15.53 ?  290 VAL A CG1   1 
ATOM   1206 C  CG2   . VAL A 1  162 ? 9.103   3.531   -0.513  1.00 21.13 ?  290 VAL A CG2   1 
ATOM   1207 N  N     . LEU A 1  163 ? 9.903   1.426   3.641   1.00 20.24 ?  291 LEU A N     1 
ATOM   1208 C  CA    . LEU A 1  163 ? 9.771   0.436   4.699   1.00 24.03 ?  291 LEU A CA    1 
ATOM   1209 C  C     . LEU A 1  163 ? 8.353   0.437   5.256   1.00 23.01 ?  291 LEU A C     1 
ATOM   1210 O  O     . LEU A 1  163 ? 7.606   1.412   5.130   1.00 17.36 ?  291 LEU A O     1 
ATOM   1211 C  CB    . LEU A 1  163 ? 10.773  0.699   5.830   1.00 20.47 ?  291 LEU A CB    1 
ATOM   1212 C  CG    . LEU A 1  163 ? 12.245  0.777   5.419   1.00 22.59 ?  291 LEU A CG    1 
ATOM   1213 C  CD1   . LEU A 1  163 ? 13.118  1.016   6.641   1.00 27.27 ?  291 LEU A CD1   1 
ATOM   1214 C  CD2   . LEU A 1  163 ? 12.688  -0.476  4.683   1.00 25.12 ?  291 LEU A CD2   1 
ATOM   1215 N  N     . ARG A 1  164 ? 7.989   -0.681  5.885   1.00 26.02 ?  292 ARG A N     1 
ATOM   1216 C  CA    . ARG A 1  164 ? 6.652   -0.794  6.454   1.00 28.46 ?  292 ARG A CA    1 
ATOM   1217 C  C     . ARG A 1  164 ? 6.403   0.296   7.488   1.00 33.15 ?  292 ARG A C     1 
ATOM   1218 O  O     . ARG A 1  164 ? 5.275   0.785   7.615   1.00 34.15 ?  292 ARG A O     1 
ATOM   1219 C  CB    . ARG A 1  164 ? 6.464   -2.187  7.064   1.00 39.86 ?  292 ARG A CB    1 
ATOM   1220 C  CG    . ARG A 1  164 ? 5.020   -2.575  7.391   1.00 46.78 ?  292 ARG A CG    1 
ATOM   1221 C  CD    . ARG A 1  164 ? 4.114   -2.499  6.168   1.00 48.40 ?  292 ARG A CD    1 
ATOM   1222 N  NE    . ARG A 1  164 ? 2.744   -2.925  6.448   1.00 52.43 ?  292 ARG A NE    1 
ATOM   1223 C  CZ    . ARG A 1  164 ? 1.855   -2.202  7.123   1.00 49.08 ?  292 ARG A CZ    1 
ATOM   1224 N  NH1   . ARG A 1  164 ? 2.189   -1.016  7.614   1.00 48.39 ?  292 ARG A NH1   1 
ATOM   1225 N  NH2   . ARG A 1  164 ? 0.632   -2.671  7.320   1.00 47.80 ?  292 ARG A NH2   1 
ATOM   1226 N  N     . SER A 1  165 ? 7.443   0.706   8.219   1.00 27.00 ?  293 SER A N     1 
ATOM   1227 C  CA    . SER A 1  165 ? 7.295   1.818   9.153   1.00 27.58 ?  293 SER A CA    1 
ATOM   1228 C  C     . SER A 1  165 ? 6.923   3.101   8.423   1.00 33.63 ?  293 SER A C     1 
ATOM   1229 O  O     . SER A 1  165 ? 6.115   3.896   8.918   1.00 36.36 ?  293 SER A O     1 
ATOM   1230 C  CB    . SER A 1  165 ? 8.587   2.009   9.948   1.00 37.59 ?  293 SER A CB    1 
ATOM   1231 N  N     . ASP A 1  166 ? 7.507   3.324   7.244   1.00 24.58 ?  294 ASP A N     1 
ATOM   1232 C  CA    . ASP A 1  166 ? 7.149   4.493   6.450   1.00 22.29 ?  294 ASP A CA    1 
ATOM   1233 C  C     . ASP A 1  166 ? 5.678   4.471   6.062   1.00 26.50 ?  294 ASP A C     1 
ATOM   1234 O  O     . ASP A 1  166 ? 5.042   5.528   5.969   1.00 25.56 ?  294 ASP A O     1 
ATOM   1235 C  CB    . ASP A 1  166 ? 8.016   4.558   5.193   1.00 28.66 ?  294 ASP A CB    1 
ATOM   1236 C  CG    . ASP A 1  166 ? 9.499   4.589   5.504   1.00 28.29 ?  294 ASP A CG    1 
ATOM   1237 O  OD1   . ASP A 1  166 ? 9.865   5.007   6.624   1.00 30.05 ?  294 ASP A OD1   1 
ATOM   1238 O  OD2   . ASP A 1  166 ? 10.297  4.193   4.627   1.00 20.59 ?  294 ASP A OD2   1 
ATOM   1239 N  N     . VAL A 1  167 ? 5.130   3.274   5.856   1.00 28.66 ?  295 VAL A N     1 
ATOM   1240 C  CA    . VAL A 1  167 ? 3.771   3.135   5.352   1.00 22.91 ?  295 VAL A CA    1 
ATOM   1241 C  C     . VAL A 1  167 ? 2.786   3.628   6.373   1.00 20.55 ?  295 VAL A C     1 
ATOM   1242 O  O     . VAL A 1  167 ? 1.842   4.354   6.052   1.00 20.20 ?  295 VAL A O     1 
ATOM   1243 C  CB    . VAL A 1  167 ? 3.494   1.670   4.986   1.00 23.35 ?  295 VAL A CB    1 
ATOM   1244 C  CG1   . VAL A 1  167 ? 2.052   1.531   4.541   1.00 17.48 ?  295 VAL A CG1   1 
ATOM   1245 C  CG2   . VAL A 1  167 ? 4.433   1.235   3.874   1.00 18.11 ?  295 VAL A CG2   1 
ATOM   1246 N  N     . ASP A 1  168 ? 2.976   3.238   7.621   1.00 21.84 ?  296 ASP A N     1 
ATOM   1247 C  CA    . ASP A 1  168 ? 1.997   3.590   8.639   1.00 25.82 ?  296 ASP A CA    1 
ATOM   1248 C  C     . ASP A 1  168 ? 1.905   5.108   8.777   1.00 31.70 ?  296 ASP A C     1 
ATOM   1249 O  O     . ASP A 1  168 ? 0.811   5.677   8.914   1.00 28.21 ?  296 ASP A O     1 
ATOM   1250 C  CB    . ASP A 1  168 ? 2.373   2.916   9.974   1.00 36.82 ?  296 ASP A CB    1 
ATOM   1251 C  CG    . ASP A 1  168 ? 2.565   1.383   9.852   1.00 41.78 ?  296 ASP A CG    1 
ATOM   1252 N  N     . ALA A 1  169 ? 3.041   5.798   8.663   1.00 32.06 ?  297 ALA A N     1 
ATOM   1253 C  CA    . ALA A 1  169 ? 3.005   7.248   8.853   1.00 26.79 ?  297 ALA A CA    1 
ATOM   1254 C  C     . ALA A 1  169 ? 2.305   7.925   7.696   1.00 21.94 ?  297 ALA A C     1 
ATOM   1255 O  O     . ALA A 1  169 ? 1.573   8.893   7.888   1.00 29.11 ?  297 ALA A O     1 
ATOM   1256 C  CB    . ALA A 1  169 ? 4.436   7.823   8.999   1.00 28.21 ?  297 ALA A CB    1 
ATOM   1257 N  N     . LEU A 1  170 ? 2.550   7.441   6.485   1.00 19.39 ?  298 LEU A N     1 
ATOM   1258 C  CA    . LEU A 1  170 ? 1.930   8.021   5.297   1.00 21.74 ?  298 LEU A CA    1 
ATOM   1259 C  C     . LEU A 1  170 ? 0.421   7.797   5.286   1.00 23.91 ?  298 LEU A C     1 
ATOM   1260 O  O     . LEU A 1  170 ? -0.339  8.686   4.890   1.00 26.68 ?  298 LEU A O     1 
ATOM   1261 C  CB    . LEU A 1  170 ? 2.561   7.435   4.035   1.00 19.13 ?  298 LEU A CB    1 
ATOM   1262 C  CG    . LEU A 1  170 ? 3.919   8.017   3.653   1.00 32.41 ?  298 LEU A CG    1 
ATOM   1263 C  CD1   . LEU A 1  170 ? 4.614   7.136   2.627   1.00 29.91 ?  298 LEU A CD1   1 
ATOM   1264 C  CD2   . LEU A 1  170 ? 3.755   9.433   3.118   1.00 34.64 ?  298 LEU A CD2   1 
ATOM   1265 N  N     . GLN A 1  171 ? -0.035  6.616   5.701   1.00 19.74 ?  299 GLN A N     1 
ATOM   1266 C  CA    . GLN A 1  171 ? -1.470  6.362   5.707   1.00 21.38 ?  299 GLN A CA    1 
ATOM   1267 C  C     . GLN A 1  171 ? -2.192  7.327   6.637   1.00 19.15 ?  299 GLN A C     1 
ATOM   1268 O  O     . GLN A 1  171 ? -3.298  7.789   6.329   1.00 19.52 ?  299 GLN A O     1 
ATOM   1269 C  CB    . GLN A 1  171 ? -1.753  4.917   6.110   1.00 22.57 ?  299 GLN A CB    1 
ATOM   1270 C  CG    . GLN A 1  171 ? -3.235  4.584   6.097   1.00 20.89 ?  299 GLN A CG    1 
ATOM   1271 C  CD    . GLN A 1  171 ? -3.517  3.125   5.797   1.00 27.74 ?  299 GLN A CD    1 
ATOM   1272 O  OE1   . GLN A 1  171 ? -2.602  2.308   5.672   1.00 22.54 ?  299 GLN A OE1   1 
ATOM   1273 N  NE2   . GLN A 1  171 ? -4.793  2.791   5.672   1.00 26.93 ?  299 GLN A NE2   1 
ATOM   1274 N  N     . GLN A 1  172 ? -1.577  7.657   7.773   1.00 20.84 ?  300 GLN A N     1 
ATOM   1275 C  CA    . GLN A 1  172 ? -2.204  8.587   8.705   1.00 25.28 ?  300 GLN A CA    1 
ATOM   1276 C  C     . GLN A 1  172 ? -2.397  9.960   8.069   1.00 23.25 ?  300 GLN A C     1 
ATOM   1277 O  O     . GLN A 1  172 ? -3.464  10.570  8.198   1.00 26.62 ?  300 GLN A O     1 
ATOM   1278 C  CB    . GLN A 1  172 ? -1.368  8.692   9.981   1.00 30.91 ?  300 GLN A CB    1 
ATOM   1279 C  CG    . GLN A 1  172 ? -1.483  7.478   10.888  1.00 37.31 ?  300 GLN A CG    1 
ATOM   1280 N  N     . VAL A 1  173 ? -1.375  10.470  7.376   1.00 21.60 ?  301 VAL A N     1 
ATOM   1281 C  CA    . VAL A 1  173 ? -1.503  11.809  6.810   1.00 28.57 ?  301 VAL A CA    1 
ATOM   1282 C  C     . VAL A 1  173 ? -2.476  11.797  5.637   1.00 28.11 ?  301 VAL A C     1 
ATOM   1283 O  O     . VAL A 1  173 ? -3.213  12.769  5.426   1.00 24.10 ?  301 VAL A O     1 
ATOM   1284 C  CB    . VAL A 1  173 ? -0.126  12.384  6.409   1.00 33.30 ?  301 VAL A CB    1 
ATOM   1285 C  CG1   . VAL A 1  173 ? 0.884   12.205  7.535   1.00 33.68 ?  301 VAL A CG1   1 
ATOM   1286 C  CG2   . VAL A 1  173 ? 0.395   11.768  5.120   1.00 34.80 ?  301 VAL A CG2   1 
ATOM   1287 N  N     . VAL A 1  174 ? -2.513  10.706  4.866   1.00 21.32 ?  302 VAL A N     1 
ATOM   1288 C  CA    . VAL A 1  174 ? -3.495  10.600  3.790   1.00 19.37 ?  302 VAL A CA    1 
ATOM   1289 C  C     . VAL A 1  174 ? -4.908  10.556  4.365   1.00 22.42 ?  302 VAL A C     1 
ATOM   1290 O  O     . VAL A 1  174 ? -5.814  11.248  3.882   1.00 19.31 ?  302 VAL A O     1 
ATOM   1291 C  CB    . VAL A 1  174 ? -3.195  9.373   2.907   1.00 16.61 ?  302 VAL A CB    1 
ATOM   1292 C  CG1   . VAL A 1  174 ? -4.295  9.156   1.871   1.00 14.25 ?  302 VAL A CG1   1 
ATOM   1293 C  CG2   . VAL A 1  174 ? -1.858  9.547   2.210   1.00 17.54 ?  302 VAL A CG2   1 
ATOM   1294 N  N     . GLU A 1  175 ? -5.116  9.759   5.414   1.00 20.83 ?  303 GLU A N     1 
ATOM   1295 C  CA    . GLU A 1  175 ? -6.433  9.701   6.040   1.00 23.01 ?  303 GLU A CA    1 
ATOM   1296 C  C     . GLU A 1  175 ? -6.859  11.066  6.566   1.00 24.93 ?  303 GLU A C     1 
ATOM   1297 O  O     . GLU A 1  175 ? -8.016  11.468  6.397   1.00 21.09 ?  303 GLU A O     1 
ATOM   1298 C  CB    . GLU A 1  175 ? -6.433  8.661   7.156   1.00 22.69 ?  303 GLU A CB    1 
ATOM   1299 C  CG    . GLU A 1  175 ? -6.390  7.240   6.630   1.00 25.06 ?  303 GLU A CG    1 
ATOM   1300 C  CD    . GLU A 1  175 ? -6.309  6.204   7.729   1.00 30.01 ?  303 GLU A CD    1 
ATOM   1301 O  OE1   . GLU A 1  175 ? -6.142  6.593   8.902   1.00 36.96 ?  303 GLU A OE1   1 
ATOM   1302 O  OE2   . GLU A 1  175 ? -6.413  4.999   7.418   1.00 37.74 ?  303 GLU A OE2   1 
ATOM   1303 N  N     A GLU A 1  176 ? -5.938  11.795  7.199   0.16 22.82 ?  304 GLU A N     1 
ATOM   1304 N  N     B GLU A 1  176 ? -5.941  11.792  7.206   0.84 20.48 ?  304 GLU A N     1 
ATOM   1305 C  CA    A GLU A 1  176 ? -6.262  13.131  7.690   0.16 24.45 ?  304 GLU A CA    1 
ATOM   1306 C  CA    B GLU A 1  176 ? -6.262  13.132  7.686   0.84 25.35 ?  304 GLU A CA    1 
ATOM   1307 C  C     A GLU A 1  176 ? -6.756  14.022  6.557   0.16 26.09 ?  304 GLU A C     1 
ATOM   1308 C  C     B GLU A 1  176 ? -6.768  14.006  6.548   0.84 27.44 ?  304 GLU A C     1 
ATOM   1309 O  O     A GLU A 1  176 ? -7.806  14.665  6.668   0.16 26.49 ?  304 GLU A O     1 
ATOM   1310 O  O     B GLU A 1  176 ? -7.838  14.617  6.643   0.84 26.12 ?  304 GLU A O     1 
ATOM   1311 C  CB    A GLU A 1  176 ? -5.040  13.749  8.371   0.16 24.27 ?  304 GLU A CB    1 
ATOM   1312 C  CB    B GLU A 1  176 ? -5.033  13.766  8.340   0.84 23.39 ?  304 GLU A CB    1 
ATOM   1313 C  CG    A GLU A 1  176 ? -4.619  13.038  9.646   0.16 23.92 ?  304 GLU A CG    1 
ATOM   1314 C  CG    B GLU A 1  176 ? -5.282  15.161  8.902   0.84 26.18 ?  304 GLU A CG    1 
ATOM   1315 N  N     . ALA A 1  177 ? -6.009  14.070  5.451   1.00 25.45 ?  305 ALA A N     1 
ATOM   1316 C  CA    . ALA A 1  177 ? -6.424  14.881  4.313   1.00 21.37 ?  305 ALA A CA    1 
ATOM   1317 C  C     . ALA A 1  177 ? -7.723  14.358  3.715   1.00 20.44 ?  305 ALA A C     1 
ATOM   1318 O  O     . ALA A 1  177 ? -8.597  15.143  3.328   1.00 23.39 ?  305 ALA A O     1 
ATOM   1319 C  CB    . ALA A 1  177 ? -5.320  14.908  3.256   1.00 23.05 ?  305 ALA A CB    1 
ATOM   1320 N  N     . VAL A 1  178 ? -7.869  13.035  3.634   1.00 22.07 ?  306 VAL A N     1 
ATOM   1321 C  CA    . VAL A 1  178 ? -9.088  12.449  3.086   1.00 20.99 ?  306 VAL A CA    1 
ATOM   1322 C  C     . VAL A 1  178 ? -10.280 12.763  3.981   1.00 23.11 ?  306 VAL A C     1 
ATOM   1323 O  O     . VAL A 1  178 ? -11.384 13.029  3.492   1.00 19.76 ?  306 VAL A O     1 
ATOM   1324 C  CB    . VAL A 1  178 ? -8.903  10.930  2.893   1.00 17.93 ?  306 VAL A CB    1 
ATOM   1325 C  CG1   . VAL A 1  178 ? -10.244 10.228  2.688   1.00 20.26 ?  306 VAL A CG1   1 
ATOM   1326 C  CG2   . VAL A 1  178 ? -7.997  10.647  1.707   1.00 12.78 ?  306 VAL A CG2   1 
ATOM   1327 N  N     . GLY A 1  179 ? -10.083 12.707  5.313   1.00 24.04 ?  307 GLY A N     1 
ATOM   1328 C  CA    . GLY A 1  179 ? -11.160 13.014  6.252   1.00 22.20 ?  307 GLY A CA    1 
ATOM   1329 C  C     . GLY A 1  179 ? -11.679 14.430  6.132   1.00 27.00 ?  307 GLY A C     1 
ATOM   1330 O  O     . GLY A 1  179 ? -12.885 14.672  6.283   1.00 26.94 ?  307 GLY A O     1 
ATOM   1331 N  N     . GLN A 1  180 ? -10.782 15.397  5.891   1.00 23.96 ?  308 GLN A N     1 
ATOM   1332 C  CA    . GLN A 1  180 ? -11.219 16.775  5.634   1.00 23.33 ?  308 GLN A CA    1 
ATOM   1333 C  C     . GLN A 1  180 ? -11.871 16.900  4.278   1.00 27.07 ?  308 GLN A C     1 
ATOM   1334 O  O     . GLN A 1  180 ? -12.876 17.612  4.118   1.00 32.39 ?  308 GLN A O     1 
ATOM   1335 C  CB    . GLN A 1  180 ? -10.033 17.737  5.684   1.00 25.22 ?  308 GLN A CB    1 
ATOM   1336 C  CG    . GLN A 1  180 ? -9.467  17.805  7.107   1.00 27.51 ?  308 GLN A CG    1 
ATOM   1337 C  CD    . GLN A 1  180 ? -8.219  18.647  7.208   1.00 37.09 ?  308 GLN A CD    1 
ATOM   1338 O  OE1   . GLN A 1  180 ? -7.993  19.526  6.378   1.00 37.48 ?  308 GLN A OE1   1 
ATOM   1339 N  NE2   . GLN A 1  180 ? -7.372  18.356  8.206   1.00 44.01 ?  308 GLN A NE2   1 
ATOM   1340 N  N     . ALA A 1  181 ? -11.345 16.168  3.300   1.00 23.11 ?  309 ALA A N     1 
ATOM   1341 C  CA    . ALA A 1  181 ? -11.848 16.412  1.972   1.00 23.55 ?  309 ALA A CA    1 
ATOM   1342 C  C     . ALA A 1  181 ? -13.275 15.879  1.849   1.00 20.03 ?  309 ALA A C     1 
ATOM   1343 O  O     . ALA A 1  181 ? -14.108 16.478  1.169   1.00 29.61 ?  309 ALA A O     1 
ATOM   1344 C  CB    . ALA A 1  181 ? -10.896 15.799  0.943   1.00 20.94 ?  309 ALA A CB    1 
ATOM   1345 N  N     . LEU A 1  182 ? -13.558 14.754  2.460   1.00 19.13 ?  310 LEU A N     1 
ATOM   1346 C  CA    . LEU A 1  182 ? -14.870 14.119  2.412   1.00 18.46 ?  310 LEU A CA    1 
ATOM   1347 C  C     . LEU A 1  182 ? -15.054 13.221  3.630   1.00 19.79 ?  310 LEU A C     1 
ATOM   1348 O  O     . LEU A 1  182 ? -14.586 12.074  3.631   1.00 19.39 ?  310 LEU A O     1 
ATOM   1349 C  CB    . LEU A 1  182 ? -15.031 13.309  1.124   1.00 15.78 ?  310 LEU A CB    1 
ATOM   1350 C  CG    . LEU A 1  182 ? -16.336 12.513  0.986   1.00 15.58 ?  310 LEU A CG    1 
ATOM   1351 C  CD1   . LEU A 1  182 ? -17.546 13.426  0.907   1.00 16.93 ?  310 LEU A CD1   1 
ATOM   1352 C  CD2   . LEU A 1  182 ? -16.267 11.617  -0.231  1.00 16.72 ?  310 LEU A CD2   1 
ATOM   1353 N  N     . PRO A 1  183 ? -15.720 13.698  4.679   1.00 17.58 ?  311 PRO A N     1 
ATOM   1354 C  CA    . PRO A 1  183 ? -15.941 12.853  5.858   1.00 17.61 ?  311 PRO A CA    1 
ATOM   1355 C  C     . PRO A 1  183 ? -16.589 11.526  5.490   1.00 22.27 ?  311 PRO A C     1 
ATOM   1356 O  O     . PRO A 1  183 ? -17.492 11.460  4.652   1.00 19.39 ?  311 PRO A O     1 
ATOM   1357 C  CB    . PRO A 1  183 ? -16.860 13.709  6.736   1.00 22.85 ?  311 PRO A CB    1 
ATOM   1358 C  CG    . PRO A 1  183 ? -16.531 15.106  6.360   1.00 25.06 ?  311 PRO A CG    1 
ATOM   1359 C  CD    . PRO A 1  183 ? -16.212 15.072  4.889   1.00 20.85 ?  311 PRO A CD    1 
ATOM   1360 N  N     . GLY A 1  184 ? -16.123 10.459  6.136   1.00 19.56 ?  312 GLY A N     1 
ATOM   1361 C  CA    . GLY A 1  184 ? -16.604 9.126   5.860   1.00 15.40 ?  312 GLY A CA    1 
ATOM   1362 C  C     . GLY A 1  184 ? -15.849 8.391   4.775   1.00 17.51 ?  312 GLY A C     1 
ATOM   1363 O  O     . GLY A 1  184 ? -16.049 7.180   4.616   1.00 15.87 ?  312 GLY A O     1 
ATOM   1364 N  N     . ALA A 1  185 ? -15.001 9.077   4.016   1.00 14.86 ?  313 ALA A N     1 
ATOM   1365 C  CA    . ALA A 1  185 ? -14.188 8.404   3.015   1.00 13.63 ?  313 ALA A CA    1 
ATOM   1366 C  C     . ALA A 1  185 ? -13.129 7.548   3.698   1.00 15.85 ?  313 ALA A C     1 
ATOM   1367 O  O     . ALA A 1  185 ? -12.671 7.854   4.802   1.00 20.60 ?  313 ALA A O     1 
ATOM   1368 C  CB    . ALA A 1  185 ? -13.529 9.423   2.085   1.00 13.37 ?  313 ALA A CB    1 
ATOM   1369 N  N     . THR A 1  186 ? -12.737 6.466   3.027   1.00 18.31 ?  314 THR A N     1 
ATOM   1370 C  CA    . THR A 1  186 ? -11.836 5.478   3.602   1.00 15.40 ?  314 THR A CA    1 
ATOM   1371 C  C     . THR A 1  186 ? -10.585 5.337   2.745   1.00 13.92 ?  314 THR A C     1 
ATOM   1372 O  O     . THR A 1  186 ? -10.608 5.569   1.531   1.00 11.37 ?  314 THR A O     1 
ATOM   1373 C  CB    . THR A 1  186 ? -12.526 4.111   3.741   1.00 11.29 ?  314 THR A CB    1 
ATOM   1374 O  OG1   . THR A 1  186 ? -12.846 3.597   2.445   1.00 13.52 ?  314 THR A OG1   1 
ATOM   1375 C  CG2   . THR A 1  186 ? -13.807 4.232   4.568   1.00 15.17 ?  314 THR A CG2   1 
ATOM   1376 N  N     . VAL A 1  187 ? -9.491  4.955   3.397   1.00 10.41 ?  315 VAL A N     1 
ATOM   1377 C  CA    . VAL A 1  187 ? -8.196  4.763   2.754   1.00 12.20 ?  315 VAL A CA    1 
ATOM   1378 C  C     . VAL A 1  187 ? -7.791  3.316   2.983   1.00 17.21 ?  315 VAL A C     1 
ATOM   1379 O  O     . VAL A 1  187 ? -7.752  2.854   4.130   1.00 14.73 ?  315 VAL A O     1 
ATOM   1380 C  CB    . VAL A 1  187 ? -7.133  5.728   3.307   1.00 11.02 ?  315 VAL A CB    1 
ATOM   1381 C  CG1   . VAL A 1  187 ? -5.796  5.513   2.613   1.00 10.15 ?  315 VAL A CG1   1 
ATOM   1382 C  CG2   . VAL A 1  187 ? -7.589  7.172   3.147   1.00 11.25 ?  315 VAL A CG2   1 
ATOM   1383 N  N     . THR A 1  188 ? -7.510  2.596   1.899   1.00 10.94 ?  316 THR A N     1 
ATOM   1384 C  CA    . THR A 1  188 ? -7.115  1.197   1.971   1.00 11.41 ?  316 THR A CA    1 
ATOM   1385 C  C     . THR A 1  188 ? -5.726  1.031   1.372   1.00 12.16 ?  316 THR A C     1 
ATOM   1386 O  O     . THR A 1  188 ? -5.484  1.430   0.228   1.00 7.52  ?  316 THR A O     1 
ATOM   1387 C  CB    . THR A 1  188 ? -8.116  0.300   1.237   1.00 13.83 ?  316 THR A CB    1 
ATOM   1388 O  OG1   . THR A 1  188 ? -9.420  0.486   1.794   1.00 13.35 ?  316 THR A OG1   1 
ATOM   1389 C  CG2   . THR A 1  188 ? -7.720  -1.170  1.364   1.00 11.97 ?  316 THR A CG2   1 
ATOM   1390 N  N     . LEU A 1  189 ? -4.821  0.441   2.145   1.00 9.14  ?  317 LEU A N     1 
ATOM   1391 C  CA    . LEU A 1  189 ? -3.496  0.113   1.637   1.00 9.40  ?  317 LEU A CA    1 
ATOM   1392 C  C     . LEU A 1  189 ? -3.602  -1.007  0.609   1.00 9.72  ?  317 LEU A C     1 
ATOM   1393 O  O     . LEU A 1  189 ? -4.246  -2.030  0.858   1.00 12.12 ?  317 LEU A O     1 
ATOM   1394 C  CB    . LEU A 1  189 ? -2.585  -0.298  2.792   1.00 10.61 ?  317 LEU A CB    1 
ATOM   1395 C  CG    . LEU A 1  189 ? -1.152  -0.740  2.501   1.00 12.49 ?  317 LEU A CG    1 
ATOM   1396 C  CD1   . LEU A 1  189 ? -0.340  0.392   1.889   1.00 10.62 ?  317 LEU A CD1   1 
ATOM   1397 C  CD2   . LEU A 1  189 ? -0.499  -1.236  3.786   1.00 13.51 ?  317 LEU A CD2   1 
ATOM   1398 N  N     A THR A 1  190 ? -2.986  -0.803  -0.557  0.59 9.15  ?  318 THR A N     1 
ATOM   1399 N  N     B THR A 1  190 ? -2.975  -0.815  -0.546  0.41 9.02  ?  318 THR A N     1 
ATOM   1400 C  CA    A THR A 1  190 ? -2.990  -1.812  -1.609  0.59 7.25  ?  318 THR A CA    1 
ATOM   1401 C  CA    B THR A 1  190 ? -2.965  -1.831  -1.592  0.41 7.61  ?  318 THR A CA    1 
ATOM   1402 C  C     A THR A 1  190 ? -1.561  -2.108  -2.052  0.59 8.45  ?  318 THR A C     1 
ATOM   1403 C  C     B THR A 1  190 ? -1.531  -1.980  -2.098  0.41 8.36  ?  318 THR A C     1 
ATOM   1404 O  O     A THR A 1  190 ? -0.623  -1.992  -1.256  0.59 6.50  ?  318 THR A O     1 
ATOM   1405 O  O     B THR A 1  190 ? -0.555  -1.640  -1.419  0.41 11.42 ?  318 THR A O     1 
ATOM   1406 C  CB    A THR A 1  190 ? -3.853  -1.350  -2.789  0.59 9.19  ?  318 THR A CB    1 
ATOM   1407 C  CB    B THR A 1  190 ? -3.967  -1.474  -2.701  0.41 8.10  ?  318 THR A CB    1 
ATOM   1408 O  OG1   A THR A 1  190 ? -3.299  -0.158  -3.362  0.59 11.32 ?  318 THR A OG1   1 
ATOM   1409 O  OG1   B THR A 1  190 ? -3.959  -2.497  -3.706  0.41 5.49  ?  318 THR A OG1   1 
ATOM   1410 C  CG2   A THR A 1  190 ? -5.276  -1.077  -2.336  0.59 6.06  ?  318 THR A CG2   1 
ATOM   1411 C  CG2   B THR A 1  190 ? -3.629  -0.130  -3.335  0.41 7.52  ?  318 THR A CG2   1 
ATOM   1412 N  N     . GLY A 1  191 ? -1.384  -2.509  -3.307  1.00 7.10  ?  319 GLY A N     1 
ATOM   1413 C  CA    . GLY A 1  191 ? -0.056  -2.775  -3.823  1.00 9.09  ?  319 GLY A CA    1 
ATOM   1414 C  C     . GLY A 1  191 ? 0.687   -3.837  -3.018  1.00 9.29  ?  319 GLY A C     1 
ATOM   1415 O  O     . GLY A 1  191 ? 0.105   -4.668  -2.311  1.00 6.27  ?  319 GLY A O     1 
ATOM   1416 N  N     . GLY A 1  192 ? 2.015   -3.772  -3.124  1.00 9.85  ?  320 GLY A N     1 
ATOM   1417 C  CA    . GLY A 1  192 ? 2.857   -4.826  -2.586  1.00 9.02  ?  320 GLY A CA    1 
ATOM   1418 C  C     . GLY A 1  192 ? 2.771   -4.980  -1.083  1.00 10.92 ?  320 GLY A C     1 
ATOM   1419 O  O     . GLY A 1  192 ? 2.875   -6.095  -0.566  1.00 8.43  ?  320 GLY A O     1 
ATOM   1420 N  N     . PHE A 1  193 ? 2.596   -3.873  -0.357  1.00 7.76  ?  321 PHE A N     1 
ATOM   1421 C  CA    . PHE A 1  193 ? 2.513   -3.975  1.096   1.00 9.04  ?  321 PHE A CA    1 
ATOM   1422 C  C     . PHE A 1  193 ? 1.262   -4.726  1.528   1.00 7.54  ?  321 PHE A C     1 
ATOM   1423 O  O     . PHE A 1  193 ? 1.285   -5.421  2.552   1.00 9.93  ?  321 PHE A O     1 
ATOM   1424 C  CB    . PHE A 1  193 ? 2.564   -2.585  1.728   1.00 8.33  ?  321 PHE A CB    1 
ATOM   1425 C  CG    . PHE A 1  193 ? 3.931   -1.959  1.688   1.00 8.89  ?  321 PHE A CG    1 
ATOM   1426 C  CD1   . PHE A 1  193 ? 4.923   -2.381  2.559   1.00 9.63  ?  321 PHE A CD1   1 
ATOM   1427 C  CD2   . PHE A 1  193 ? 4.227   -0.963  0.775   1.00 10.11 ?  321 PHE A CD2   1 
ATOM   1428 C  CE1   . PHE A 1  193 ? 6.185   -1.812  2.527   1.00 11.47 ?  321 PHE A CE1   1 
ATOM   1429 C  CE2   . PHE A 1  193 ? 5.489   -0.391  0.737   1.00 9.42  ?  321 PHE A CE2   1 
ATOM   1430 C  CZ    . PHE A 1  193 ? 6.467   -0.818  1.612   1.00 13.21 ?  321 PHE A CZ    1 
ATOM   1431 N  N     . ARG A 1  194 ? 0.173   -4.626  0.762   1.00 9.44  ?  322 ARG A N     1 
ATOM   1432 C  CA    . ARG A 1  194 ? -0.992  -5.448  1.070   1.00 11.60 ?  322 ARG A CA    1 
ATOM   1433 C  C     . ARG A 1  194 ? -0.711  -6.929  0.835   1.00 12.91 ?  322 ARG A C     1 
ATOM   1434 O  O     . ARG A 1  194 ? -1.340  -7.782  1.470   1.00 8.54  ?  322 ARG A O     1 
ATOM   1435 C  CB    . ARG A 1  194 ? -2.207  -5.019  0.248   1.00 6.30  ?  322 ARG A CB    1 
ATOM   1436 C  CG    . ARG A 1  194 ? -3.450  -5.830  0.610   1.00 7.40  ?  322 ARG A CG    1 
ATOM   1437 C  CD    . ARG A 1  194 ? -4.746  -5.241  0.065   1.00 8.86  ?  322 ARG A CD    1 
ATOM   1438 N  NE    . ARG A 1  194 ? -5.887  -6.070  0.459   1.00 8.79  ?  322 ARG A NE    1 
ATOM   1439 C  CZ    . ARG A 1  194 ? -6.645  -6.793  -0.361  1.00 13.10 ?  322 ARG A CZ    1 
ATOM   1440 N  NH1   . ARG A 1  194 ? -6.440  -6.798  -1.670  1.00 5.61  ?  322 ARG A NH1   1 
ATOM   1441 N  NH2   . ARG A 1  194 ? -7.632  -7.518  0.142   1.00 9.14  ?  322 ARG A NH2   1 
ATOM   1442 N  N     . ARG A 1  195 ? 0.206   -7.257  -0.076  1.00 11.80 ?  323 ARG A N     1 
ATOM   1443 C  CA    . ARG A 1  195 ? 0.586   -8.648  -0.296  1.00 11.92 ?  323 ARG A CA    1 
ATOM   1444 C  C     . ARG A 1  195 ? 1.593   -9.149  0.732   1.00 12.51 ?  323 ARG A C     1 
ATOM   1445 O  O     . ARG A 1  195 ? 2.053   -10.291 0.619   1.00 10.08 ?  323 ARG A O     1 
ATOM   1446 C  CB    . ARG A 1  195 ? 1.162   -8.831  -1.705  1.00 9.58  ?  323 ARG A CB    1 
ATOM   1447 C  CG    . ARG A 1  195 ? 0.229   -8.412  -2.835  1.00 5.46  ?  323 ARG A CG    1 
ATOM   1448 C  CD    . ARG A 1  195 ? 0.699   -8.970  -4.178  1.00 10.37 ?  323 ARG A CD    1 
ATOM   1449 N  NE    . ARG A 1  195 ? 2.103   -8.663  -4.451  1.00 7.70  ?  323 ARG A NE    1 
ATOM   1450 C  CZ    . ARG A 1  195 ? 2.543   -7.531  -4.996  1.00 10.23 ?  323 ARG A CZ    1 
ATOM   1451 N  NH1   . ARG A 1  195 ? 1.693   -6.570  -5.343  1.00 7.39  ?  323 ARG A NH1   1 
ATOM   1452 N  NH2   . ARG A 1  195 ? 3.843   -7.362  -5.199  1.00 7.92  ?  323 ARG A NH2   1 
ATOM   1453 N  N     . GLY A 1  196 ? 1.950   -8.328  1.716   1.00 14.97 ?  324 GLY A N     1 
ATOM   1454 C  CA    . GLY A 1  196 ? 2.856   -8.731  2.770   1.00 12.85 ?  324 GLY A CA    1 
ATOM   1455 C  C     . GLY A 1  196 ? 4.300   -8.337  2.573   1.00 13.08 ?  324 GLY A C     1 
ATOM   1456 O  O     . GLY A 1  196 ? 5.149   -8.745  3.374   1.00 11.60 ?  324 GLY A O     1 
ATOM   1457 N  N     . LYS A 1  197 ? 4.614   -7.562  1.541   1.00 8.82  ?  325 LYS A N     1 
ATOM   1458 C  CA    . LYS A 1  197 ? 5.990   -7.129  1.348   1.00 8.83  ?  325 LYS A CA    1 
ATOM   1459 C  C     . LYS A 1  197 ? 6.440   -6.278  2.524   1.00 15.00 ?  325 LYS A C     1 
ATOM   1460 O  O     . LYS A 1  197 ? 5.664   -5.504  3.089   1.00 14.18 ?  325 LYS A O     1 
ATOM   1461 C  CB    . LYS A 1  197 ? 6.132   -6.338  0.046   1.00 11.22 ?  325 LYS A CB    1 
ATOM   1462 C  CG    . LYS A 1  197 ? 5.969   -7.166  -1.216  1.00 11.04 ?  325 LYS A CG    1 
ATOM   1463 C  CD    . LYS A 1  197 ? 6.309   -6.350  -2.474  1.00 12.20 ?  325 LYS A CD    1 
ATOM   1464 C  CE    . LYS A 1  197 ? 7.800   -6.074  -2.604  1.00 18.47 ?  325 LYS A CE    1 
ATOM   1465 N  NZ    . LYS A 1  197 ? 8.138   -5.392  -3.884  1.00 20.47 ?  325 LYS A NZ    1 
ATOM   1466 N  N     . LEU A 1  198 ? 7.690   -6.430  2.915   1.00 10.53 ?  326 LEU A N     1 
ATOM   1467 C  CA    . LEU A 1  198 ? 8.274   -5.625  3.953   1.00 11.96 ?  326 LEU A CA    1 
ATOM   1468 C  C     . LEU A 1  198 ? 8.930   -4.368  3.401   1.00 19.09 ?  326 LEU A C     1 
ATOM   1469 O  O     . LEU A 1  198 ? 9.255   -3.475  4.186   1.00 16.89 ?  326 LEU A O     1 
ATOM   1470 C  CB    . LEU A 1  198 ? 9.315   -6.429  4.707   1.00 20.52 ?  326 LEU A CB    1 
ATOM   1471 C  CG    . LEU A 1  198 ? 8.736   -7.692  5.339   1.00 22.64 ?  326 LEU A CG    1 
ATOM   1472 C  CD1   . LEU A 1  198 ? 9.763   -8.310  6.181   1.00 27.36 ?  326 LEU A CD1   1 
ATOM   1473 C  CD2   . LEU A 1  198 ? 7.508   -7.425  6.206   1.00 28.31 ?  326 LEU A CD2   1 
ATOM   1474 N  N     . GLN A 1  199 ? 9.106   -4.286  2.079   1.00 17.05 ?  327 GLN A N     1 
ATOM   1475 C  CA    . GLN A 1  199 ? 9.681   -3.122  1.422   1.00 16.43 ?  327 GLN A CA    1 
ATOM   1476 C  C     . GLN A 1  199 ? 8.938   -2.832  0.131   1.00 18.75 ?  327 GLN A C     1 
ATOM   1477 O  O     . GLN A 1  199 ? 8.166   -3.663  -0.351  1.00 16.56 ?  327 GLN A O     1 
ATOM   1478 C  CB    . GLN A 1  199 ? 11.126  -3.379  1.052   1.00 20.32 ?  327 GLN A CB    1 
ATOM   1479 C  CG    . GLN A 1  199 ? 12.088  -3.432  2.140   1.00 29.85 ?  327 GLN A CG    1 
ATOM   1480 C  CD    . GLN A 1  199 ? 13.499  -3.653  1.550   1.00 32.34 ?  327 GLN A CD    1 
ATOM   1481 O  OE1   . GLN A 1  199 ? 13.687  -3.886  0.318   1.00 36.43 ?  327 GLN A OE1   1 
ATOM   1482 N  NE2   . GLN A 1  199 ? 14.472  -3.511  2.396   1.00 34.53 ?  327 GLN A NE2   1 
ATOM   1483 N  N     . GLY A 1  200 ? 9.151   -1.625  -0.431  1.00 12.73 ?  328 GLY A N     1 
ATOM   1484 C  CA    . GLY A 1  200 ? 8.580   -1.345  -1.732  1.00 10.09 ?  328 GLY A CA    1 
ATOM   1485 C  C     . GLY A 1  200 ? 9.218   -0.135  -2.383  1.00 15.44 ?  328 GLY A C     1 
ATOM   1486 O  O     . GLY A 1  200 ? 10.009  0.603   -1.781  1.00 16.63 ?  328 GLY A O     1 
ATOM   1487 N  N     . HIS A 1  201 ? 8.880   0.045   -3.646  1.00 9.61  ?  329 HIS A N     1 
ATOM   1488 C  CA    . HIS A 1  201 ? 9.328   1.220   -4.378  1.00 12.64 ?  329 HIS A CA    1 
ATOM   1489 C  C     . HIS A 1  201 ? 8.382   2.398   -4.210  1.00 11.21 ?  329 HIS A C     1 
ATOM   1490 O  O     . HIS A 1  201 ? 8.757   3.529   -4.543  1.00 12.75 ?  329 HIS A O     1 
ATOM   1491 C  CB    . HIS A 1  201 ? 9.498   0.880   -5.867  1.00 13.22 ?  329 HIS A CB    1 
ATOM   1492 C  CG    . HIS A 1  201 ? 8.418   1.423   -6.754  1.00 12.84 ?  329 HIS A CG    1 
ATOM   1493 N  ND1   . HIS A 1  201 ? 7.153   0.878   -6.812  1.00 18.27 ?  329 HIS A ND1   1 
ATOM   1494 C  CD2   . HIS A 1  201 ? 8.426   2.447   -7.640  1.00 14.76 ?  329 HIS A CD2   1 
ATOM   1495 C  CE1   . HIS A 1  201 ? 6.424   1.553   -7.684  1.00 13.68 ?  329 HIS A CE1   1 
ATOM   1496 N  NE2   . HIS A 1  201 ? 7.173   2.510   -8.202  1.00 17.11 ?  329 HIS A NE2   1 
ATOM   1497 N  N     . ASP A 1  202 ? 7.184   2.159   -3.682  1.00 9.60  ?  330 ASP A N     1 
ATOM   1498 C  CA    . ASP A 1  202 ? 6.205   3.209   -3.434  1.00 14.92 ?  330 ASP A CA    1 
ATOM   1499 C  C     . ASP A 1  202 ? 5.198   2.692   -2.411  1.00 13.22 ?  330 ASP A C     1 
ATOM   1500 O  O     . ASP A 1  202 ? 5.303   1.567   -1.917  1.00 12.32 ?  330 ASP A O     1 
ATOM   1501 C  CB    . ASP A 1  202 ? 5.510   3.644   -4.731  1.00 12.15 ?  330 ASP A CB    1 
ATOM   1502 C  CG    . ASP A 1  202 ? 4.553   2.585   -5.286  1.00 13.90 ?  330 ASP A CG    1 
ATOM   1503 O  OD1   . ASP A 1  202 ? 4.378   1.516   -4.663  1.00 10.03 ?  330 ASP A OD1   1 
ATOM   1504 O  OD2   . ASP A 1  202 ? 3.958   2.833   -6.355  1.00 12.39 ?  330 ASP A OD2   1 
ATOM   1505 N  N     . VAL A 1  203 ? 4.214   3.531   -2.102  1.00 10.34 ?  331 VAL A N     1 
ATOM   1506 C  CA    . VAL A 1  203 ? 3.063   3.145   -1.296  1.00 9.06  ?  331 VAL A CA    1 
ATOM   1507 C  C     . VAL A 1  203 ? 1.813   3.419   -2.121  1.00 10.60 ?  331 VAL A C     1 
ATOM   1508 O  O     . VAL A 1  203 ? 1.655   4.514   -2.677  1.00 10.21 ?  331 VAL A O     1 
ATOM   1509 C  CB    . VAL A 1  203 ? 3.014   3.903   0.043   1.00 14.40 ?  331 VAL A CB    1 
ATOM   1510 C  CG1   . VAL A 1  203 ? 1.939   3.313   0.948   1.00 10.06 ?  331 VAL A CG1   1 
ATOM   1511 C  CG2   . VAL A 1  203 ? 4.370   3.866   0.723   1.00 10.55 ?  331 VAL A CG2   1 
ATOM   1512 N  N     . ASP A 1  204 ? 0.938   2.422   -2.205  1.00 7.95  ?  332 ASP A N     1 
ATOM   1513 C  CA    . ASP A 1  204 ? -0.257  2.475   -3.034  1.00 11.91 ?  332 ASP A CA    1 
ATOM   1514 C  C     . ASP A 1  204 ? -1.490  2.481   -2.139  1.00 13.00 ?  332 ASP A C     1 
ATOM   1515 O  O     . ASP A 1  204 ? -1.615  1.635   -1.247  1.00 8.08  ?  332 ASP A O     1 
ATOM   1516 C  CB    . ASP A 1  204 ? -0.304  1.276   -3.987  1.00 7.43  ?  332 ASP A CB    1 
ATOM   1517 C  CG    . ASP A 1  204 ? 0.987   1.099   -4.773  1.00 11.49 ?  332 ASP A CG    1 
ATOM   1518 O  OD1   . ASP A 1  204 ? 1.250   1.917   -5.679  1.00 11.97 ?  332 ASP A OD1   1 
ATOM   1519 O  OD2   . ASP A 1  204 ? 1.732   0.135   -4.489  1.00 10.52 ?  332 ASP A OD2   1 
ATOM   1520 N  N     . PHE A 1  205 ? -2.401  3.426   -2.381  1.00 8.87  ?  333 PHE A N     1 
ATOM   1521 C  CA    . PHE A 1  205 ? -3.629  3.534   -1.601  1.00 7.88  ?  333 PHE A CA    1 
ATOM   1522 C  C     . PHE A 1  205 ? -4.846  3.554   -2.518  1.00 10.96 ?  333 PHE A C     1 
ATOM   1523 O  O     . PHE A 1  205 ? -4.801  4.075   -3.635  1.00 8.73  ?  333 PHE A O     1 
ATOM   1524 C  CB    . PHE A 1  205 ? -3.659  4.798   -0.735  1.00 10.11 ?  333 PHE A CB    1 
ATOM   1525 C  CG    . PHE A 1  205 ? -2.625  4.824   0.360   1.00 14.23 ?  333 PHE A CG    1 
ATOM   1526 C  CD1   . PHE A 1  205 ? -2.741  3.994   1.466   1.00 12.34 ?  333 PHE A CD1   1 
ATOM   1527 C  CD2   . PHE A 1  205 ? -1.556  5.705   0.299   1.00 14.04 ?  333 PHE A CD2   1 
ATOM   1528 C  CE1   . PHE A 1  205 ? -1.799  4.027   2.482   1.00 11.21 ?  333 PHE A CE1   1 
ATOM   1529 C  CE2   . PHE A 1  205 ? -0.609  5.746   1.311   1.00 18.45 ?  333 PHE A CE2   1 
ATOM   1530 C  CZ    . PHE A 1  205 ? -0.730  4.905   2.406   1.00 13.24 ?  333 PHE A CZ    1 
ATOM   1531 N  N     . LEU A 1  206 ? -5.947  3.005   -2.012  1.00 8.57  ?  334 LEU A N     1 
ATOM   1532 C  CA    . LEU A 1  206 ? -7.237  3.024   -2.689  1.00 9.76  ?  334 LEU A CA    1 
ATOM   1533 C  C     . LEU A 1  206 ? -8.243  3.730   -1.792  1.00 7.99  ?  334 LEU A C     1 
ATOM   1534 O  O     . LEU A 1  206 ? -8.370  3.394   -0.609  1.00 12.10 ?  334 LEU A O     1 
ATOM   1535 C  CB    . LEU A 1  206 ? -7.696  1.600   -3.013  1.00 6.89  ?  334 LEU A CB    1 
ATOM   1536 C  CG    . LEU A 1  206 ? -9.070  1.406   -3.644  1.00 13.08 ?  334 LEU A CG    1 
ATOM   1537 C  CD1   . LEU A 1  206 ? -9.183  2.141   -4.977  1.00 9.25  ?  334 LEU A CD1   1 
ATOM   1538 C  CD2   . LEU A 1  206 ? -9.318  -0.086  -3.823  1.00 11.72 ?  334 LEU A CD2   1 
ATOM   1539 N  N     . ILE A 1  207 ? -8.949  4.708   -2.353  1.00 8.42  ?  335 ILE A N     1 
ATOM   1540 C  CA    . ILE A 1  207 ? -9.847  5.582   -1.607  1.00 9.09  ?  335 ILE A CA    1 
ATOM   1541 C  C     . ILE A 1  207 ? -11.258 5.419   -2.159  1.00 10.94 ?  335 ILE A C     1 
ATOM   1542 O  O     . ILE A 1  207 ? -11.455 5.363   -3.378  1.00 10.75 ?  335 ILE A O     1 
ATOM   1543 C  CB    . ILE A 1  207 ? -9.391  7.054   -1.697  1.00 13.98 ?  335 ILE A CB    1 
ATOM   1544 C  CG1   . ILE A 1  207 ? -7.995  7.224   -1.085  1.00 11.07 ?  335 ILE A CG1   1 
ATOM   1545 C  CG2   . ILE A 1  207 ? -10.389 7.977   -1.004  1.00 16.34 ?  335 ILE A CG2   1 
ATOM   1546 C  CD1   . ILE A 1  207 ? -7.305  8.515   -1.469  1.00 14.90 ?  335 ILE A CD1   1 
ATOM   1547 N  N     . THR A 1  208 ? -12.242 5.359   -1.262  1.00 9.51  ?  336 THR A N     1 
ATOM   1548 C  CA    . THR A 1  208 ? -13.638 5.272   -1.667  1.00 11.24 ?  336 THR A CA    1 
ATOM   1549 C  C     . THR A 1  208 ? -14.502 5.883   -0.571  1.00 14.12 ?  336 THR A C     1 
ATOM   1550 O  O     . THR A 1  208 ? -14.000 6.413   0.424   1.00 12.78 ?  336 THR A O     1 
ATOM   1551 C  CB    . THR A 1  208 ? -14.047 3.822   -1.957  1.00 13.30 ?  336 THR A CB    1 
ATOM   1552 O  OG1   . THR A 1  208 ? -15.338 3.797   -2.583  1.00 13.59 ?  336 THR A OG1   1 
ATOM   1553 C  CG2   . THR A 1  208 ? -14.092 3.002   -0.671  1.00 15.13 ?  336 THR A CG2   1 
ATOM   1554 N  N     . HIS A 1  209 ? -15.819 5.804   -0.762  1.00 14.34 ?  337 HIS A N     1 
ATOM   1555 C  CA    . HIS A 1  209 ? -16.768 6.316   0.206   1.00 15.34 ?  337 HIS A CA    1 
ATOM   1556 C  C     . HIS A 1  209 ? -17.975 5.388   0.176   1.00 17.41 ?  337 HIS A C     1 
ATOM   1557 O  O     . HIS A 1  209 ? -18.363 4.933   -0.909  1.00 14.87 ?  337 HIS A O     1 
ATOM   1558 C  CB    . HIS A 1  209 ? -17.190 7.758   -0.106  1.00 12.56 ?  337 HIS A CB    1 
ATOM   1559 C  CG    . HIS A 1  209 ? -18.031 8.383   0.962   1.00 15.65 ?  337 HIS A CG    1 
ATOM   1560 N  ND1   . HIS A 1  209 ? -19.376 8.121   1.096   1.00 18.25 ?  337 HIS A ND1   1 
ATOM   1561 C  CD2   . HIS A 1  209 ? -17.717 9.253   1.951   1.00 14.19 ?  337 HIS A CD2   1 
ATOM   1562 C  CE1   . HIS A 1  209 ? -19.857 8.801   2.123   1.00 17.26 ?  337 HIS A CE1   1 
ATOM   1563 N  NE2   . HIS A 1  209 ? -18.870 9.495   2.659   1.00 15.06 ?  337 HIS A NE2   1 
ATOM   1564 N  N     . PRO A 1  210 ? -18.577 5.077   1.329   1.00 16.57 ?  338 PRO A N     1 
ATOM   1565 C  CA    . PRO A 1  210 ? -19.631 4.045   1.346   1.00 19.63 ?  338 PRO A CA    1 
ATOM   1566 C  C     . PRO A 1  210 ? -20.909 4.427   0.614   1.00 22.84 ?  338 PRO A C     1 
ATOM   1567 O  O     . PRO A 1  210 ? -21.703 3.534   0.297   1.00 23.05 ?  338 PRO A O     1 
ATOM   1568 C  CB    . PRO A 1  210 ? -19.892 3.831   2.843   1.00 18.23 ?  338 PRO A CB    1 
ATOM   1569 C  CG    . PRO A 1  210 ? -19.344 5.037   3.519   1.00 19.72 ?  338 PRO A CG    1 
ATOM   1570 C  CD    . PRO A 1  210 ? -18.186 5.481   2.691   1.00 13.49 ?  338 PRO A CD    1 
ATOM   1571 N  N     A LYS A 1  211 ? -21.140 5.711   0.344   0.67 16.51 ?  339 LYS A N     1 
ATOM   1572 N  N     B LYS A 1  211 ? -21.142 5.711   0.354   0.33 17.72 ?  339 LYS A N     1 
ATOM   1573 C  CA    A LYS A 1  211 ? -22.319 6.172   -0.382  0.67 17.84 ?  339 LYS A CA    1 
ATOM   1574 C  CA    B LYS A 1  211 ? -22.315 6.168   -0.384  0.33 18.67 ?  339 LYS A CA    1 
ATOM   1575 C  C     A LYS A 1  211 ? -21.924 6.389   -1.840  0.67 20.85 ?  339 LYS A C     1 
ATOM   1576 C  C     B LYS A 1  211 ? -21.905 6.375   -1.838  0.33 19.48 ?  339 LYS A C     1 
ATOM   1577 O  O     A LYS A 1  211 ? -21.177 7.323   -2.156  0.67 16.86 ?  339 LYS A O     1 
ATOM   1578 O  O     B LYS A 1  211 ? -21.133 7.288   -2.149  0.33 17.45 ?  339 LYS A O     1 
ATOM   1579 C  CB    A LYS A 1  211 ? -22.874 7.455   0.238   0.67 22.76 ?  339 LYS A CB    1 
ATOM   1580 C  CB    B LYS A 1  211 ? -22.876 7.453   0.222   0.33 21.78 ?  339 LYS A CB    1 
ATOM   1581 C  CG    A LYS A 1  211 ? -24.163 7.957   -0.405  0.67 23.72 ?  339 LYS A CG    1 
ATOM   1582 C  CG    B LYS A 1  211 ? -23.337 7.306   1.663   0.33 18.66 ?  339 LYS A CG    1 
ATOM   1583 N  N     . GLU A 1  212 ? -22.417 5.518   -2.720  1.00 15.61 ?  340 GLU A N     1 
ATOM   1584 C  CA    . GLU A 1  212 ? -22.091 5.594   -4.138  1.00 13.52 ?  340 GLU A CA    1 
ATOM   1585 C  C     . GLU A 1  212 ? -22.276 7.009   -4.673  1.00 19.85 ?  340 GLU A C     1 
ATOM   1586 O  O     . GLU A 1  212 ? -23.312 7.644   -4.453  1.00 20.26 ?  340 GLU A O     1 
ATOM   1587 C  CB    . GLU A 1  212 ? -22.969 4.611   -4.921  1.00 18.34 ?  340 GLU A CB    1 
ATOM   1588 C  CG    . GLU A 1  212 ? -22.681 4.527   -6.419  1.00 20.05 ?  340 GLU A CG    1 
ATOM   1589 C  CD    . GLU A 1  212 ? -21.541 3.583   -6.748  1.00 21.50 ?  340 GLU A CD    1 
ATOM   1590 O  OE1   . GLU A 1  212 ? -21.007 2.947   -5.820  1.00 17.52 ?  340 GLU A OE1   1 
ATOM   1591 O  OE2   . GLU A 1  212 ? -21.184 3.472   -7.939  1.00 19.29 ?  340 GLU A OE2   1 
ATOM   1592 N  N     . GLY A 1  213 ? -21.254 7.504   -5.373  1.00 18.56 ?  341 GLY A N     1 
ATOM   1593 C  CA    . GLY A 1  213 ? -21.285 8.802   -5.999  1.00 22.11 ?  341 GLY A CA    1 
ATOM   1594 C  C     . GLY A 1  213 ? -20.622 9.899   -5.189  1.00 17.55 ?  341 GLY A C     1 
ATOM   1595 O  O     . GLY A 1  213 ? -20.157 10.887  -5.767  1.00 18.41 ?  341 GLY A O     1 
ATOM   1596 N  N     . GLN A 1  214 ? -20.570 9.751   -3.865  1.00 18.05 ?  342 GLN A N     1 
ATOM   1597 C  CA    . GLN A 1  214 ? -19.955 10.781  -3.037  1.00 19.05 ?  342 GLN A CA    1 
ATOM   1598 C  C     . GLN A 1  214 ? -18.467 10.933  -3.323  1.00 15.83 ?  342 GLN A C     1 
ATOM   1599 O  O     . GLN A 1  214 ? -17.904 12.001  -3.061  1.00 18.97 ?  342 GLN A O     1 
ATOM   1600 C  CB    . GLN A 1  214 ? -20.168 10.470  -1.555  1.00 18.50 ?  342 GLN A CB    1 
ATOM   1601 C  CG    . GLN A 1  214 ? -21.583 10.720  -1.066  1.00 20.50 ?  342 GLN A CG    1 
ATOM   1602 C  CD    . GLN A 1  214 ? -21.976 12.181  -1.166  1.00 29.79 ?  342 GLN A CD    1 
ATOM   1603 O  OE1   . GLN A 1  214 ? -21.502 13.018  -0.396  1.00 27.48 ?  342 GLN A OE1   1 
ATOM   1604 N  NE2   . GLN A 1  214 ? -22.829 12.499  -2.133  1.00 24.99 ?  342 GLN A NE2   1 
ATOM   1605 N  N     . GLU A 1  215 ? -17.821 9.895   -3.861  1.00 21.80 ?  343 GLU A N     1 
ATOM   1606 C  CA    . GLU A 1  215 ? -16.394 9.960   -4.157  1.00 22.90 ?  343 GLU A CA    1 
ATOM   1607 C  C     . GLU A 1  215 ? -16.083 10.797  -5.390  1.00 16.47 ?  343 GLU A C     1 
ATOM   1608 O  O     . GLU A 1  215 ? -14.905 11.077  -5.647  1.00 15.57 ?  343 GLU A O     1 
ATOM   1609 C  CB    . GLU A 1  215 ? -15.832 8.543   -4.340  1.00 23.57 ?  343 GLU A CB    1 
ATOM   1610 C  CG    . GLU A 1  215 ? -16.057 7.923   -5.720  1.00 13.54 ?  343 GLU A CG    1 
ATOM   1611 C  CD    . GLU A 1  215 ? -17.523 7.750   -6.075  1.00 20.29 ?  343 GLU A CD    1 
ATOM   1612 O  OE1   . GLU A 1  215 ? -18.360 7.587   -5.158  1.00 19.75 ?  343 GLU A OE1   1 
ATOM   1613 O  OE2   . GLU A 1  215 ? -17.841 7.774   -7.280  1.00 21.26 ?  343 GLU A OE2   1 
ATOM   1614 N  N     . ALA A 1  216 ? -17.093 11.185  -6.161  1.00 17.67 ?  344 ALA A N     1 
ATOM   1615 C  CA    . ALA A 1  216 ? -16.864 12.010  -7.339  1.00 20.21 ?  344 ALA A CA    1 
ATOM   1616 C  C     . ALA A 1  216 ? -16.159 13.307  -6.957  1.00 23.17 ?  344 ALA A C     1 
ATOM   1617 O  O     . ALA A 1  216 ? -16.513 13.960  -5.973  1.00 19.97 ?  344 ALA A O     1 
ATOM   1618 C  CB    . ALA A 1  216 ? -18.191 12.319  -8.030  1.00 19.46 ?  344 ALA A CB    1 
ATOM   1619 N  N     . GLY A 1  217 ? -15.146 13.672  -7.742  1.00 22.99 ?  345 GLY A N     1 
ATOM   1620 C  CA    . GLY A 1  217 ? -14.411 14.901  -7.505  1.00 24.90 ?  345 GLY A CA    1 
ATOM   1621 C  C     . GLY A 1  217 ? -13.555 14.902  -6.262  1.00 19.08 ?  345 GLY A C     1 
ATOM   1622 O  O     . GLY A 1  217 ? -13.094 15.968  -5.844  1.00 16.98 ?  345 GLY A O     1 
ATOM   1623 N  N     . LEU A 1  218 ? -13.300 13.735  -5.672  1.00 15.09 ?  346 LEU A N     1 
ATOM   1624 C  CA    . LEU A 1  218 ? -12.641 13.695  -4.373  1.00 15.56 ?  346 LEU A CA    1 
ATOM   1625 C  C     . LEU A 1  218 ? -11.145 13.974  -4.486  1.00 17.46 ?  346 LEU A C     1 
ATOM   1626 O  O     . LEU A 1  218 ? -10.573 14.674  -3.642  1.00 17.90 ?  346 LEU A O     1 
ATOM   1627 C  CB    . LEU A 1  218 ? -12.880 12.336  -3.721  1.00 19.33 ?  346 LEU A CB    1 
ATOM   1628 C  CG    . LEU A 1  218 ? -12.146 12.063  -2.409  1.00 19.86 ?  346 LEU A CG    1 
ATOM   1629 C  CD1   . LEU A 1  218 ? -12.413 13.158  -1.385  1.00 18.17 ?  346 LEU A CD1   1 
ATOM   1630 C  CD2   . LEU A 1  218 ? -12.574 10.709  -1.872  1.00 18.85 ?  346 LEU A CD2   1 
ATOM   1631 N  N     . LEU A 1  219 ? -10.491 13.440  -5.511  1.00 15.59 ?  347 LEU A N     1 
ATOM   1632 C  CA    . LEU A 1  219 ? -9.032  13.416  -5.479  1.00 16.62 ?  347 LEU A CA    1 
ATOM   1633 C  C     . LEU A 1  219 ? -8.424  14.815  -5.580  1.00 19.68 ?  347 LEU A C     1 
ATOM   1634 O  O     . LEU A 1  219 ? -7.430  15.094  -4.897  1.00 16.20 ?  347 LEU A O     1 
ATOM   1635 C  CB    . LEU A 1  219 ? -8.483  12.514  -6.587  1.00 18.71 ?  347 LEU A CB    1 
ATOM   1636 C  CG    . LEU A 1  219 ? -7.018  12.091  -6.429  1.00 22.11 ?  347 LEU A CG    1 
ATOM   1637 C  CD1   . LEU A 1  219 ? -6.722  11.528  -5.042  1.00 19.96 ?  347 LEU A CD1   1 
ATOM   1638 C  CD2   . LEU A 1  219 ? -6.642  11.064  -7.490  1.00 23.65 ?  347 LEU A CD2   1 
ATOM   1639 N  N     . PRO A 1  220 ? -8.968  15.721  -6.400  1.00 20.58 ?  348 PRO A N     1 
ATOM   1640 C  CA    . PRO A 1  220 ? -8.430  17.094  -6.394  1.00 22.28 ?  348 PRO A CA    1 
ATOM   1641 C  C     . PRO A 1  220 ? -8.500  17.741  -5.025  1.00 21.99 ?  348 PRO A C     1 
ATOM   1642 O  O     . PRO A 1  220 ? -7.595  18.494  -4.644  1.00 18.65 ?  348 PRO A O     1 
ATOM   1643 C  CB    . PRO A 1  220 ? -9.313  17.825  -7.414  1.00 21.27 ?  348 PRO A CB    1 
ATOM   1644 C  CG    . PRO A 1  220 ? -9.836  16.756  -8.304  1.00 25.43 ?  348 PRO A CG    1 
ATOM   1645 C  CD    . PRO A 1  220 ? -9.986  15.535  -7.448  1.00 22.25 ?  348 PRO A CD    1 
ATOM   1646 N  N     . ARG A 1  221 ? -9.565  17.462  -4.273  1.00 21.18 ?  349 ARG A N     1 
ATOM   1647 C  CA    . ARG A 1  221 ? -9.704  18.016  -2.932  1.00 18.50 ?  349 ARG A CA    1 
ATOM   1648 C  C     . ARG A 1  221 ? -8.674  17.418  -1.983  1.00 17.45 ?  349 ARG A C     1 
ATOM   1649 O  O     . ARG A 1  221 ? -8.171  18.105  -1.088  1.00 18.19 ?  349 ARG A O     1 
ATOM   1650 C  CB    . ARG A 1  221 ? -11.124 17.769  -2.422  1.00 18.08 ?  349 ARG A CB    1 
ATOM   1651 C  CG    . ARG A 1  221 ? -12.179 18.509  -3.226  1.00 18.99 ?  349 ARG A CG    1 
ATOM   1652 C  CD    . ARG A 1  221 ? -13.599 18.113  -2.845  1.00 23.04 ?  349 ARG A CD    1 
ATOM   1653 N  NE    . ARG A 1  221 ? -13.826 18.170  -1.405  1.00 19.16 ?  349 ARG A NE    1 
ATOM   1654 C  CZ    . ARG A 1  221 ? -13.991 19.295  -0.715  1.00 33.05 ?  349 ARG A CZ    1 
ATOM   1655 N  NH1   . ARG A 1  221 ? -13.943 20.471  -1.327  1.00 21.52 ?  349 ARG A NH1   1 
ATOM   1656 N  NH2   . ARG A 1  221 ? -14.194 19.244  0.594   1.00 20.62 ?  349 ARG A NH2   1 
ATOM   1657 N  N     . VAL A 1  222 ? -8.352  16.135  -2.158  1.00 19.68 ?  350 VAL A N     1 
ATOM   1658 C  CA    . VAL A 1  222 ? -7.308  15.508  -1.355  1.00 17.57 ?  350 VAL A CA    1 
ATOM   1659 C  C     . VAL A 1  222 ? -5.954  16.116  -1.689  1.00 19.92 ?  350 VAL A C     1 
ATOM   1660 O  O     . VAL A 1  222 ? -5.186  16.493  -0.798  1.00 19.51 ?  350 VAL A O     1 
ATOM   1661 C  CB    . VAL A 1  222 ? -7.309  13.982  -1.571  1.00 16.46 ?  350 VAL A CB    1 
ATOM   1662 C  CG1   . VAL A 1  222 ? -6.121  13.330  -0.868  1.00 15.30 ?  350 VAL A CG1   1 
ATOM   1663 C  CG2   . VAL A 1  222 ? -8.604  13.378  -1.072  1.00 15.42 ?  350 VAL A CG2   1 
ATOM   1664 N  N     . MET A 1  223 ? -5.656  16.225  -2.977  1.00 18.09 ?  351 MET A N     1 
ATOM   1665 C  CA    . MET A 1  223 ? -4.327  16.636  -3.364  1.00 16.52 ?  351 MET A CA    1 
ATOM   1666 C  C     . MET A 1  223 ? -4.081  18.074  -2.951  1.00 23.26 ?  351 MET A C     1 
ATOM   1667 O  O     . MET A 1  223 ? -2.980  18.419  -2.509  1.00 23.53 ?  351 MET A O     1 
ATOM   1668 C  CB    . MET A 1  223 ? -4.096  16.469  -4.868  1.00 18.13 ?  351 MET A CB    1 
ATOM   1669 C  CG    . MET A 1  223 ? -4.083  15.034  -5.400  1.00 19.74 ?  351 MET A CG    1 
ATOM   1670 S  SD    . MET A 1  223 ? -3.050  13.962  -4.393  1.00 24.89 ?  351 MET A SD    1 
ATOM   1671 C  CE    . MET A 1  223 ? -1.547  14.887  -4.678  1.00 29.43 ?  351 MET A CE    1 
ATOM   1672 N  N     A CYS A 1  224 ? -5.119  18.909  -3.048  0.76 22.63 ?  352 CYS A N     1 
ATOM   1673 N  N     B CYS A 1  224 ? -5.082  18.943  -3.063  0.24 24.14 ?  352 CYS A N     1 
ATOM   1674 C  CA    A CYS A 1  224 ? -4.977  20.317  -2.697  0.76 28.05 ?  352 CYS A CA    1 
ATOM   1675 C  CA    B CYS A 1  224 ? -4.811  20.327  -2.695  0.24 28.07 ?  352 CYS A CA    1 
ATOM   1676 C  C     A CYS A 1  224 ? -4.718  20.473  -1.203  0.76 27.30 ?  352 CYS A C     1 
ATOM   1677 C  C     B CYS A 1  224 ? -4.720  20.512  -1.181  0.24 27.24 ?  352 CYS A C     1 
ATOM   1678 O  O     A CYS A 1  224 ? -3.901  21.317  -0.802  0.76 29.60 ?  352 CYS A O     1 
ATOM   1679 O  O     B CYS A 1  224 ? -4.070  21.463  -0.729  0.24 29.54 ?  352 CYS A O     1 
ATOM   1680 C  CB    A CYS A 1  224 ? -6.209  21.127  -3.150  0.76 32.37 ?  352 CYS A CB    1 
ATOM   1681 C  CB    B CYS A 1  224 ? -5.857  21.264  -3.293  0.24 33.52 ?  352 CYS A CB    1 
ATOM   1682 S  SG    A CYS A 1  224 ? -6.106  21.567  -4.947  0.76 42.39 ?  352 CYS A SG    1 
ATOM   1683 S  SG    B CYS A 1  224 ? -7.427  21.174  -2.530  0.24 34.28 ?  352 CYS A SG    1 
ATOM   1684 N  N     . ARG A 1  225 ? -5.317  19.625  -0.382  1.00 21.98 ?  353 ARG A N     1 
ATOM   1685 C  CA    . ARG A 1  225 ? -5.063  19.672  1.056   1.00 21.61 ?  353 ARG A CA    1 
ATOM   1686 C  C     . ARG A 1  225 ? -3.666  19.157  1.414   1.00 26.74 ?  353 ARG A C     1 
ATOM   1687 O  O     . ARG A 1  225 ? -2.978  19.713  2.271   1.00 28.08 ?  353 ARG A O     1 
ATOM   1688 C  CB    . ARG A 1  225 ? -6.127  18.868  1.765   1.00 24.31 ?  353 ARG A CB    1 
ATOM   1689 C  CG    . ARG A 1  225 ? -7.454  19.672  1.716   1.00 30.83 ?  353 ARG A CG    1 
ATOM   1690 C  CD    . ARG A 1  225 ? -8.748  18.914  2.079   1.00 32.11 ?  353 ARG A CD    1 
ATOM   1691 N  NE    . ARG A 1  225 ? -9.821  19.917  2.171   1.00 28.27 ?  353 ARG A NE    1 
ATOM   1692 C  CZ    . ARG A 1  225 ? -10.408 20.532  1.137   1.00 30.92 ?  353 ARG A CZ    1 
ATOM   1693 N  NH1   . ARG A 1  225 ? -10.095 20.214  -0.102  1.00 29.95 ?  353 ARG A NH1   1 
ATOM   1694 N  NH2   . ARG A 1  225 ? -11.320 21.506  1.350   1.00 27.04 ?  353 ARG A NH2   1 
ATOM   1695 N  N     . LEU A 1  226 ? -3.254  18.065  0.800   1.00 21.42 ?  354 LEU A N     1 
ATOM   1696 C  CA    . LEU A 1  226 ? -1.903  17.590  1.026   1.00 20.61 ?  354 LEU A CA    1 
ATOM   1697 C  C     . LEU A 1  226 ? -0.899  18.644  0.608   1.00 21.58 ?  354 LEU A C     1 
ATOM   1698 O  O     . LEU A 1  226 ? 0.120   18.871  1.312   1.00 25.74 ?  354 LEU A O     1 
ATOM   1699 C  CB    . LEU A 1  226 ? -1.675  16.286  0.249   1.00 19.73 ?  354 LEU A CB    1 
ATOM   1700 C  CG    . LEU A 1  226 ? -2.482  15.105  0.757   1.00 18.88 ?  354 LEU A CG    1 
ATOM   1701 C  CD1   . LEU A 1  226 ? -2.378  13.962  -0.227  1.00 16.95 ?  354 LEU A CD1   1 
ATOM   1702 C  CD2   . LEU A 1  226 ? -1.942  14.681  2.135   1.00 18.59 ?  354 LEU A CD2   1 
ATOM   1703 N  N     . GLN A 1  227 ? -1.135  19.280  -0.556  1.00 19.89 ?  355 GLN A N     1 
ATOM   1704 C  CA    . GLN A 1  227 ? -0.217  20.323  -1.027  1.00 32.22 ?  355 GLN A CA    1 
ATOM   1705 C  C     . GLN A 1  227 ? -0.186  21.477  -0.044  1.00 31.69 ?  355 GLN A C     1 
ATOM   1706 O  O     . GLN A 1  227 ? 0.878   21.991  0.293   1.00 27.91 ?  355 GLN A O     1 
ATOM   1707 C  CB    . GLN A 1  227 ? -0.595  20.821  -2.429  1.00 30.68 ?  355 GLN A CB    1 
ATOM   1708 N  N     . ASP A 1  228 ? -1.327  21.823  0.522   1.00 35.78 ?  356 ASP A N     1 
ATOM   1709 C  CA    . ASP A 1  228 ? -1.360  22.925  1.504   1.00 42.85 ?  356 ASP A CA    1 
ATOM   1710 C  C     . ASP A 1  228 ? -0.586  22.573  2.766   1.00 40.00 ?  356 ASP A C     1 
ATOM   1711 O  O     . ASP A 1  228 ? -0.012  23.465  3.405   1.00 40.44 ?  356 ASP A O     1 
ATOM   1712 C  CB    . ASP A 1  228 ? -2.814  23.283  1.879   1.00 48.46 ?  356 ASP A CB    1 
ATOM   1713 C  CG    . ASP A 1  228 ? -3.528  24.037  0.772   1.00 59.48 ?  356 ASP A CG    1 
ATOM   1714 O  OD1   . ASP A 1  228 ? -2.806  24.706  -0.015  1.00 64.37 ?  356 ASP A OD1   1 
ATOM   1715 O  OD2   . ASP A 1  228 ? -4.785  23.955  0.682   1.00 62.67 ?  356 ASP A OD2   1 
ATOM   1716 N  N     . GLN A 1  229 ? -0.607  21.273  3.185   1.00 31.03 ?  357 GLN A N     1 
ATOM   1717 C  CA    . GLN A 1  229 ? 0.192   20.894  4.342   1.00 29.37 ?  357 GLN A CA    1 
ATOM   1718 C  C     . GLN A 1  229 ? 1.746   20.775  4.011   1.00 30.64 ?  357 GLN A C     1 
ATOM   1719 O  O     . GLN A 1  229 ? 2.486   20.329  4.906   1.00 29.16 ?  357 GLN A O     1 
ATOM   1720 C  CB    . GLN A 1  229 ? -0.274  19.575  4.907   1.00 33.34 ?  357 GLN A CB    1 
ATOM   1721 C  CG    . GLN A 1  229 ? -1.590  19.605  5.666   1.00 38.16 ?  357 GLN A CG    1 
ATOM   1722 C  CD    . GLN A 1  229 ? -2.072  18.193  5.980   1.00 36.45 ?  357 GLN A CD    1 
ATOM   1723 N  N     . GLY A 1  230 ? 2.193   21.146  2.805   1.00 26.86 ?  358 GLY A N     1 
ATOM   1724 C  CA    . GLY A 1  230 ? 3.592   21.045  2.444   1.00 25.61 ?  358 GLY A CA    1 
ATOM   1725 C  C     . GLY A 1  230 ? 4.112   19.645  2.226   1.00 28.61 ?  358 GLY A C     1 
ATOM   1726 O  O     . GLY A 1  230 ? 5.311   19.447  2.193   1.00 26.32 ?  358 GLY A O     1 
ATOM   1727 N  N     . LEU A 1  231 ? 3.246   18.663  2.048   1.00 24.06 ?  359 LEU A N     1 
ATOM   1728 C  CA    . LEU A 1  231 ? 3.669   17.269  2.019   1.00 20.10 ?  359 LEU A CA    1 
ATOM   1729 C  C     . LEU A 1  231 ? 3.893   16.735  0.611   1.00 19.72 ?  359 LEU A C     1 
ATOM   1730 O  O     . LEU A 1  231 ? 4.340   15.593  0.464   1.00 23.51 ?  359 LEU A O     1 
ATOM   1731 C  CB    . LEU A 1  231 ? 2.637   16.395  2.739   1.00 20.50 ?  359 LEU A CB    1 
ATOM   1732 C  CG    . LEU A 1  231 ? 2.464   16.649  4.238   1.00 31.13 ?  359 LEU A CG    1 
ATOM   1733 C  CD1   . LEU A 1  231 ? 1.309   15.822  4.774   1.00 34.68 ?  359 LEU A CD1   1 
ATOM   1734 C  CD2   . LEU A 1  231 ? 3.746   16.334  4.998   1.00 36.07 ?  359 LEU A CD2   1 
ATOM   1735 N  N     . ILE A 1  232 ? 3.608   17.524  -0.421  1.00 19.48 ?  360 ILE A N     1 
ATOM   1736 C  CA    . ILE A 1  232 ? 3.702   17.076  -1.805  1.00 21.50 ?  360 ILE A CA    1 
ATOM   1737 C  C     . ILE A 1  232 ? 4.915   17.738  -2.435  1.00 23.84 ?  360 ILE A C     1 
ATOM   1738 O  O     . ILE A 1  232 ? 4.959   18.965  -2.577  1.00 22.28 ?  360 ILE A O     1 
ATOM   1739 C  CB    . ILE A 1  232 ? 2.429   17.400  -2.603  1.00 22.32 ?  360 ILE A CB    1 
ATOM   1740 C  CG1   . ILE A 1  232 ? 1.199   16.797  -1.922  1.00 20.72 ?  360 ILE A CG1   1 
ATOM   1741 C  CG2   . ILE A 1  232 ? 2.552   16.885  -4.036  1.00 21.17 ?  360 ILE A CG2   1 
ATOM   1742 C  CD1   . ILE A 1  232 ? 1.231   15.286  -1.796  1.00 23.40 ?  360 ILE A CD1   1 
ATOM   1743 N  N     . LEU A 1  233 ? 5.898   16.923  -2.809  1.00 21.72 ?  361 LEU A N     1 
ATOM   1744 C  CA    . LEU A 1  233 ? 7.047   17.408  -3.556  1.00 27.56 ?  361 LEU A CA    1 
ATOM   1745 C  C     . LEU A 1  233 ? 6.777   17.437  -5.053  1.00 27.75 ?  361 LEU A C     1 
ATOM   1746 O  O     . LEU A 1  233 ? 7.368   18.254  -5.766  1.00 28.01 ?  361 LEU A O     1 
ATOM   1747 C  CB    . LEU A 1  233 ? 8.273   16.535  -3.259  1.00 19.95 ?  361 LEU A CB    1 
ATOM   1748 C  CG    . LEU A 1  233 ? 8.760   16.589  -1.805  1.00 22.35 ?  361 LEU A CG    1 
ATOM   1749 C  CD1   . LEU A 1  233 ? 9.669   15.412  -1.479  1.00 23.65 ?  361 LEU A CD1   1 
ATOM   1750 C  CD2   . LEU A 1  233 ? 9.477   17.902  -1.517  1.00 23.70 ?  361 LEU A CD2   1 
ATOM   1751 N  N     . TYR A 1  234 ? 5.884   16.576  -5.539  1.00 25.19 ?  362 TYR A N     1 
ATOM   1752 C  CA    . TYR A 1  234 ? 5.494   16.582  -6.942  1.00 25.26 ?  362 TYR A CA    1 
ATOM   1753 C  C     . TYR A 1  234 ? 4.153   15.880  -7.093  1.00 25.42 ?  362 TYR A C     1 
ATOM   1754 O  O     . TYR A 1  234 ? 3.913   14.844  -6.468  1.00 16.43 ?  362 TYR A O     1 
ATOM   1755 C  CB    . TYR A 1  234 ? 6.530   15.883  -7.836  1.00 25.89 ?  362 TYR A CB    1 
ATOM   1756 C  CG    . TYR A 1  234 ? 5.977   15.532  -9.206  1.00 25.32 ?  362 TYR A CG    1 
ATOM   1757 C  CD1   . TYR A 1  234 ? 5.327   14.323  -9.426  1.00 31.31 ?  362 TYR A CD1   1 
ATOM   1758 C  CD2   . TYR A 1  234 ? 6.085   16.417  -10.271 1.00 30.02 ?  362 TYR A CD2   1 
ATOM   1759 C  CE1   . TYR A 1  234 ? 4.805   14.003  -10.665 1.00 28.54 ?  362 TYR A CE1   1 
ATOM   1760 C  CE2   . TYR A 1  234 ? 5.568   16.101  -11.521 1.00 28.57 ?  362 TYR A CE2   1 
ATOM   1761 C  CZ    . TYR A 1  234 ? 4.928   14.893  -11.707 1.00 33.02 ?  362 TYR A CZ    1 
ATOM   1762 O  OH    . TYR A 1  234 ? 4.407   14.560  -12.936 1.00 38.60 ?  362 TYR A OH    1 
ATOM   1763 N  N     . HIS A 1  235 ? 3.294   16.445  -7.934  1.00 26.54 ?  363 HIS A N     1 
ATOM   1764 C  CA    . HIS A 1  235 ? 2.140   15.724  -8.451  1.00 26.05 ?  363 HIS A CA    1 
ATOM   1765 C  C     . HIS A 1  235 ? 1.702   16.407  -9.738  1.00 30.21 ?  363 HIS A C     1 
ATOM   1766 O  O     . HIS A 1  235 ? 2.131   17.519  -10.052 1.00 33.72 ?  363 HIS A O     1 
ATOM   1767 C  CB    . HIS A 1  235 ? 1.002   15.650  -7.424  1.00 27.46 ?  363 HIS A CB    1 
ATOM   1768 C  CG    . HIS A 1  235 ? 0.239   16.927  -7.255  1.00 38.59 ?  363 HIS A CG    1 
ATOM   1769 N  ND1   . HIS A 1  235 ? -1.083  17.053  -7.623  1.00 44.48 ?  363 HIS A ND1   1 
ATOM   1770 C  CD2   . HIS A 1  235 ? 0.603   18.125  -6.740  1.00 45.61 ?  363 HIS A CD2   1 
ATOM   1771 C  CE1   . HIS A 1  235 ? -1.499  18.277  -7.350  1.00 45.24 ?  363 HIS A CE1   1 
ATOM   1772 N  NE2   . HIS A 1  235 ? -0.495  18.948  -6.812  1.00 47.26 ?  363 HIS A NE2   1 
ATOM   1773 N  N     . GLN A 1  236 ? 0.846   15.719  -10.483 1.00 27.75 ?  364 GLN A N     1 
ATOM   1774 C  CA    . GLN A 1  236 ? 0.431   16.185  -11.800 1.00 38.73 ?  364 GLN A CA    1 
ATOM   1775 C  C     . GLN A 1  236 ? -0.522  17.370  -11.694 1.00 37.83 ?  364 GLN A C     1 
ATOM   1776 O  O     . GLN A 1  236 ? -0.783  18.054  -12.681 1.00 47.22 ?  364 GLN A O     1 
ATOM   1777 C  CB    . GLN A 1  236 ? -0.230  15.047  -12.579 1.00 39.72 ?  364 GLN A CB    1 
ATOM   1778 N  N     . ALA A 1  256 ? -10.355 17.427  -13.196 1.00 36.39 ?  384 ALA A N     1 
ATOM   1779 C  CA    . ALA A 1  256 ? -10.903 16.204  -12.622 1.00 39.17 ?  384 ALA A CA    1 
ATOM   1780 C  C     . ALA A 1  256 ? -10.003 15.017  -12.931 1.00 40.85 ?  384 ALA A C     1 
ATOM   1781 O  O     . ALA A 1  256 ? -9.522  14.864  -14.054 1.00 41.99 ?  384 ALA A O     1 
ATOM   1782 C  CB    . ALA A 1  256 ? -12.307 15.950  -13.147 1.00 39.57 ?  384 ALA A CB    1 
ATOM   1783 N  N     . PHE A 1  257 ? -9.778  14.177  -11.925 1.00 29.94 ?  385 PHE A N     1 
ATOM   1784 C  CA    . PHE A 1  257 ? -8.955  12.989  -12.087 1.00 22.00 ?  385 PHE A CA    1 
ATOM   1785 C  C     . PHE A 1  257 ? -9.245  12.050  -10.926 1.00 23.47 ?  385 PHE A C     1 
ATOM   1786 O  O     . PHE A 1  257 ? -9.810  12.453  -9.907  1.00 27.81 ?  385 PHE A O     1 
ATOM   1787 C  CB    . PHE A 1  257 ? -7.465  13.347  -12.163 1.00 22.78 ?  385 PHE A CB    1 
ATOM   1788 C  CG    . PHE A 1  257 ? -6.981  14.195  -11.019 1.00 33.25 ?  385 PHE A CG    1 
ATOM   1789 C  CD1   . PHE A 1  257 ? -7.180  15.566  -11.017 1.00 41.26 ?  385 PHE A CD1   1 
ATOM   1790 C  CD2   . PHE A 1  257 ? -6.313  13.621  -9.952  1.00 37.18 ?  385 PHE A CD2   1 
ATOM   1791 C  CE1   . PHE A 1  257 ? -6.728  16.346  -9.968  1.00 38.64 ?  385 PHE A CE1   1 
ATOM   1792 C  CE2   . PHE A 1  257 ? -5.861  14.395  -8.900  1.00 36.33 ?  385 PHE A CE2   1 
ATOM   1793 C  CZ    . PHE A 1  257 ? -6.069  15.760  -8.907  1.00 37.95 ?  385 PHE A CZ    1 
ATOM   1794 N  N     . GLU A 1  258 ? -8.869  10.781  -11.106 1.00 19.03 ?  386 GLU A N     1 
ATOM   1795 C  CA    . GLU A 1  258 ? -9.142  9.747   -10.119 1.00 20.45 ?  386 GLU A CA    1 
ATOM   1796 C  C     . GLU A 1  258 ? -7.914  8.918   -9.767  1.00 21.69 ?  386 GLU A C     1 
ATOM   1797 O  O     . GLU A 1  258 ? -8.013  8.018   -8.923  1.00 16.94 ?  386 GLU A O     1 
ATOM   1798 C  CB    . GLU A 1  258 ? -10.255 8.817   -10.622 1.00 23.43 ?  386 GLU A CB    1 
ATOM   1799 C  CG    . GLU A 1  258 ? -9.860  7.969   -11.816 1.00 23.98 ?  386 GLU A CG    1 
ATOM   1800 C  CD    . GLU A 1  258 ? -11.059 7.477   -12.605 1.00 32.79 ?  386 GLU A CD    1 
ATOM   1801 O  OE1   . GLU A 1  258 ? -12.014 8.263   -12.782 1.00 42.16 ?  386 GLU A OE1   1 
ATOM   1802 O  OE2   . GLU A 1  258 ? -11.047 6.306   -13.043 1.00 29.53 ?  386 GLU A OE2   1 
ATOM   1803 N  N     . ARG A 1  259 ? -6.773  9.184   -10.395 1.00 16.29 ?  387 ARG A N     1 
ATOM   1804 C  CA    . ARG A 1  259 ? -5.509  8.558   -10.048 1.00 10.82 ?  387 ARG A CA    1 
ATOM   1805 C  C     . ARG A 1  259 ? -4.455  9.648   -10.005 1.00 19.78 ?  387 ARG A C     1 
ATOM   1806 O  O     . ARG A 1  259 ? -4.446  10.538  -10.859 1.00 17.52 ?  387 ARG A O     1 
ATOM   1807 C  CB    . ARG A 1  259 ? -5.096  7.485   -11.064 1.00 12.11 ?  387 ARG A CB    1 
ATOM   1808 C  CG    . ARG A 1  259 ? -6.109  6.382   -11.271 1.00 19.32 ?  387 ARG A CG    1 
ATOM   1809 C  CD    . ARG A 1  259 ? -5.585  5.347   -12.249 1.00 23.51 ?  387 ARG A CD    1 
ATOM   1810 N  NE    . ARG A 1  259 ? -6.596  4.350   -12.590 1.00 29.79 ?  387 ARG A NE    1 
ATOM   1811 C  CZ    . ARG A 1  259 ? -6.457  3.440   -13.548 1.00 37.38 ?  387 ARG A CZ    1 
ATOM   1812 N  NH1   . ARG A 1  259 ? -5.344  3.395   -14.270 1.00 34.55 ?  387 ARG A NH1   1 
ATOM   1813 N  NH2   . ARG A 1  259 ? -7.434  2.574   -13.789 1.00 35.38 ?  387 ARG A NH2   1 
ATOM   1814 N  N     A SER A 1  260 ? -3.587  9.600   -9.001  0.62 14.10 ?  388 SER A N     1 
ATOM   1815 N  N     B SER A 1  260 ? -3.560  9.558   -9.023  0.38 14.83 ?  388 SER A N     1 
ATOM   1816 C  CA    A SER A 1  260 ? -2.461  10.517  -8.938  0.62 15.87 ?  388 SER A CA    1 
ATOM   1817 C  CA    B SER A 1  260 ? -2.472  10.512  -8.865  0.38 16.60 ?  388 SER A CA    1 
ATOM   1818 C  C     A SER A 1  260 ? -1.205  9.747   -8.562  0.62 20.13 ?  388 SER A C     1 
ATOM   1819 C  C     B SER A 1  260 ? -1.195  9.758   -8.528  0.38 19.24 ?  388 SER A C     1 
ATOM   1820 O  O     A SER A 1  260 ? -1.223  8.902   -7.662  0.62 16.34 ?  388 SER A O     1 
ATOM   1821 O  O     B SER A 1  260 ? -1.183  8.935   -7.608  0.38 17.29 ?  388 SER A O     1 
ATOM   1822 C  CB    A SER A 1  260 ? -2.710  11.659  -7.941  0.62 18.76 ?  388 SER A CB    1 
ATOM   1823 C  CB    B SER A 1  260 ? -2.795  11.534  -7.768  0.38 19.02 ?  388 SER A CB    1 
ATOM   1824 O  OG    A SER A 1  260 ? -2.598  11.217  -6.601  0.62 21.57 ?  388 SER A OG    1 
ATOM   1825 O  OG    B SER A 1  260 ? -1.706  12.411  -7.549  0.38 16.27 ?  388 SER A OG    1 
ATOM   1826 N  N     . PHE A 1  261 ? -0.127  10.033  -9.277  1.00 18.11 ?  389 PHE A N     1 
ATOM   1827 C  CA    . PHE A 1  261 ? 1.191   9.458   -9.025  1.00 15.13 ?  389 PHE A CA    1 
ATOM   1828 C  C     . PHE A 1  261 ? 2.047   10.608  -8.517  1.00 19.55 ?  389 PHE A C     1 
ATOM   1829 O  O     . PHE A 1  261 ? 2.484   11.458  -9.296  1.00 20.18 ?  389 PHE A O     1 
ATOM   1830 C  CB    . PHE A 1  261 ? 1.763   8.819   -10.282 1.00 19.51 ?  389 PHE A CB    1 
ATOM   1831 C  CG    . PHE A 1  261 ? 0.726   8.164   -11.142 1.00 23.17 ?  389 PHE A CG    1 
ATOM   1832 C  CD1   . PHE A 1  261 ? 0.126   6.979   -10.748 1.00 21.65 ?  389 PHE A CD1   1 
ATOM   1833 C  CD2   . PHE A 1  261 ? 0.342   8.739   -12.343 1.00 28.38 ?  389 PHE A CD2   1 
ATOM   1834 C  CE1   . PHE A 1  261 ? -0.834  6.377   -11.539 1.00 20.98 ?  389 PHE A CE1   1 
ATOM   1835 C  CE2   . PHE A 1  261 ? -0.620  8.141   -13.140 1.00 28.39 ?  389 PHE A CE2   1 
ATOM   1836 C  CZ    . PHE A 1  261 ? -1.208  6.962   -12.737 1.00 23.64 ?  389 PHE A CZ    1 
ATOM   1837 N  N     A CYS A 1  262 ? 2.279   10.619  -7.208  0.62 16.31 ?  390 CYS A N     1 
ATOM   1838 N  N     B CYS A 1  262 ? 2.271   10.662  -7.211  0.38 17.34 ?  390 CYS A N     1 
ATOM   1839 C  CA    A CYS A 1  262 ? 2.856   11.748  -6.499  0.62 18.81 ?  390 CYS A CA    1 
ATOM   1840 C  CA    B CYS A 1  262 ? 2.933   11.819  -6.633  0.38 18.82 ?  390 CYS A CA    1 
ATOM   1841 C  C     A CYS A 1  262 ? 4.195   11.362  -5.882  0.62 14.83 ?  390 CYS A C     1 
ATOM   1842 C  C     B CYS A 1  262 ? 4.122   11.379  -5.791  0.38 15.99 ?  390 CYS A C     1 
ATOM   1843 O  O     A CYS A 1  262 ? 4.585   10.191  -5.855  0.62 15.34 ?  390 CYS A O     1 
ATOM   1844 O  O     B CYS A 1  262 ? 4.344   10.190  -5.540  0.38 13.45 ?  390 CYS A O     1 
ATOM   1845 C  CB    A CYS A 1  262 ? 1.904   12.235  -5.398  0.62 20.53 ?  390 CYS A CB    1 
ATOM   1846 C  CB    B CYS A 1  262 ? 1.954   12.651  -5.797  0.38 21.22 ?  390 CYS A CB    1 
ATOM   1847 S  SG    A CYS A 1  262 ? 0.135   12.078  -5.792  0.62 24.23 ?  390 CYS A SG    1 
ATOM   1848 S  SG    B CYS A 1  262 ? 1.244   11.757  -4.428  0.38 24.79 ?  390 CYS A SG    1 
ATOM   1849 N  N     . ILE A 1  263 ? 4.893   12.375  -5.371  1.00 14.67 ?  391 ILE A N     1 
ATOM   1850 C  CA    . ILE A 1  263 ? 6.077   12.185  -4.548  1.00 15.02 ?  391 ILE A CA    1 
ATOM   1851 C  C     . ILE A 1  263 ? 5.817   12.930  -3.248  1.00 19.74 ?  391 ILE A C     1 
ATOM   1852 O  O     . ILE A 1  263 ? 5.581   14.146  -3.261  1.00 17.27 ?  391 ILE A O     1 
ATOM   1853 C  CB    . ILE A 1  263 ? 7.355   12.690  -5.236  1.00 23.05 ?  391 ILE A CB    1 
ATOM   1854 C  CG1   . ILE A 1  263 ? 7.537   11.968  -6.572  1.00 20.45 ?  391 ILE A CG1   1 
ATOM   1855 C  CG2   . ILE A 1  263 ? 8.568   12.464  -4.335  1.00 20.82 ?  391 ILE A CG2   1 
ATOM   1856 C  CD1   . ILE A 1  263 ? 8.728   12.441  -7.388  1.00 18.84 ?  391 ILE A CD1   1 
ATOM   1857 N  N     . PHE A 1  264 ? 5.846   12.219  -2.138  1.00 18.06 ?  392 PHE A N     1 
ATOM   1858 C  CA    . PHE A 1  264 ? 5.504   12.777  -0.839  1.00 19.54 ?  392 PHE A CA    1 
ATOM   1859 C  C     . PHE A 1  264 ? 6.768   13.109  -0.069  1.00 22.84 ?  392 PHE A C     1 
ATOM   1860 O  O     . PHE A 1  264 ? 7.789   12.425  -0.176  1.00 19.71 ?  392 PHE A O     1 
ATOM   1861 C  CB    . PHE A 1  264 ? 4.718   11.785  0.014   1.00 20.13 ?  392 PHE A CB    1 
ATOM   1862 C  CG    . PHE A 1  264 ? 3.224   11.907  -0.061  1.00 19.93 ?  392 PHE A CG    1 
ATOM   1863 C  CD1   . PHE A 1  264 ? 2.553   11.840  -1.263  1.00 17.44 ?  392 PHE A CD1   1 
ATOM   1864 C  CD2   . PHE A 1  264 ? 2.489   11.997  1.106   1.00 28.97 ?  392 PHE A CD2   1 
ATOM   1865 C  CE1   . PHE A 1  264 ? 1.160   11.896  -1.290  1.00 24.53 ?  392 PHE A CE1   1 
ATOM   1866 C  CE2   . PHE A 1  264 ? 1.118   12.054  1.081   1.00 26.57 ?  392 PHE A CE2   1 
ATOM   1867 C  CZ    . PHE A 1  264 ? 0.453   11.998  -0.121  1.00 26.67 ?  392 PHE A CZ    1 
ATOM   1868 N  N     . ARG A 1  265 ? 6.648   14.108  0.787   1.00 20.86 ?  393 ARG A N     1 
ATOM   1869 C  CA    . ARG A 1  265 ? 7.663   14.441  1.770   1.00 22.07 ?  393 ARG A CA    1 
ATOM   1870 C  C     . ARG A 1  265 ? 7.416   13.623  3.036   1.00 28.26 ?  393 ARG A C     1 
ATOM   1871 O  O     . ARG A 1  265 ? 6.427   13.852  3.743   1.00 31.86 ?  393 ARG A O     1 
ATOM   1872 C  CB    . ARG A 1  265 ? 7.572   15.934  2.057   1.00 25.26 ?  393 ARG A CB    1 
ATOM   1873 C  CG    . ARG A 1  265 ? 8.781   16.514  2.645   1.00 30.53 ?  393 ARG A CG    1 
ATOM   1874 C  CD    . ARG A 1  265 ? 8.583   18.002  2.722   1.00 34.48 ?  393 ARG A CD    1 
ATOM   1875 N  NE    . ARG A 1  265 ? 9.314   18.519  3.847   1.00 28.16 ?  393 ARG A NE    1 
ATOM   1876 C  CZ    . ARG A 1  265 ? 10.157  19.529  3.785   1.00 26.39 ?  393 ARG A CZ    1 
ATOM   1877 N  NH1   . ARG A 1  265 ? 10.361  20.172  2.636   1.00 26.60 ?  393 ARG A NH1   1 
ATOM   1878 N  NH2   . ARG A 1  265 ? 10.764  19.904  4.894   1.00 31.67 ?  393 ARG A NH2   1 
ATOM   1879 N  N     . LEU A 1  266 ? 8.297   12.669  3.330   1.00 21.47 ?  394 LEU A N     1 
ATOM   1880 C  CA    . LEU A 1  266 ? 8.095   11.816  4.492   1.00 20.98 ?  394 LEU A CA    1 
ATOM   1881 C  C     . LEU A 1  266 ? 9.082   12.158  5.597   1.00 24.98 ?  394 LEU A C     1 
ATOM   1882 O  O     . LEU A 1  266 ? 10.302  12.032  5.397   1.00 27.11 ?  394 LEU A O     1 
ATOM   1883 C  CB    . LEU A 1  266 ? 8.219   10.346  4.129   1.00 19.92 ?  394 LEU A CB    1 
ATOM   1884 C  CG    . LEU A 1  266 ? 7.941   9.463   5.352   1.00 31.54 ?  394 LEU A CG    1 
ATOM   1885 C  CD1   . LEU A 1  266 ? 6.511   9.667   5.885   1.00 33.59 ?  394 LEU A CD1   1 
ATOM   1886 C  CD2   . LEU A 1  266 ? 8.184   8.027   5.025   1.00 28.25 ?  394 LEU A CD2   1 
ATOM   1887 N  N     . PRO A 1  267 ? 8.599   12.568  6.772   1.00 33.68 ?  395 PRO A N     1 
ATOM   1888 C  CA    . PRO A 1  267 ? 9.516   12.904  7.870   1.00 39.23 ?  395 PRO A CA    1 
ATOM   1889 C  C     . PRO A 1  267 ? 10.352  11.726  8.307   1.00 37.28 ?  395 PRO A C     1 
ATOM   1890 O  O     . PRO A 1  267 ? 9.945   10.563  8.237   1.00 45.03 ?  395 PRO A O     1 
ATOM   1891 C  CB    . PRO A 1  267 ? 8.584   13.372  8.993   1.00 41.01 ?  395 PRO A CB    1 
ATOM   1892 C  CG    . PRO A 1  267 ? 7.439   14.006  8.264   1.00 35.35 ?  395 PRO A CG    1 
ATOM   1893 C  CD    . PRO A 1  267 ? 7.262   13.167  6.981   1.00 32.56 ?  395 PRO A CD    1 
ATOM   1894 N  N     . GLN A 1  268 ? 11.544  12.074  8.744   1.00 32.81 ?  396 GLN A N     1 
ATOM   1895 C  CA    . GLN A 1  268 ? 12.671  11.216  9.059   1.00 33.98 ?  396 GLN A CA    1 
ATOM   1896 C  C     . GLN A 1  268 ? 13.355  11.871  10.251  1.00 45.21 ?  396 GLN A C     1 
ATOM   1897 O  O     . GLN A 1  268 ? 13.140  13.059  10.530  1.00 43.01 ?  396 GLN A O     1 
ATOM   1898 C  CB    . GLN A 1  268 ? 13.674  11.098  7.895   1.00 36.90 ?  396 GLN A CB    1 
ATOM   1899 C  CG    . GLN A 1  268 ? 13.265  10.341  6.648   1.00 31.81 ?  396 GLN A CG    1 
ATOM   1900 C  CD    . GLN A 1  268 ? 13.571  8.887   6.773   1.00 41.21 ?  396 GLN A CD    1 
ATOM   1901 O  OE1   . GLN A 1  268 ? 14.620  8.403   6.329   1.00 42.94 ?  396 GLN A OE1   1 
ATOM   1902 N  NE2   . GLN A 1  268 ? 12.642  8.156   7.383   1.00 37.52 ?  396 GLN A NE2   1 
ATOM   1903 N  N     . PRO A 1  269 ? 14.206  11.126  10.973  1.00 52.20 ?  397 PRO A N     1 
ATOM   1904 C  CA    . PRO A 1  269 ? 14.930  11.733  12.105  1.00 53.04 ?  397 PRO A CA    1 
ATOM   1905 C  C     . PRO A 1  269 ? 15.683  13.007  11.724  1.00 49.50 ?  397 PRO A C     1 
ATOM   1906 O  O     . PRO A 1  269 ? 16.707  12.937  11.032  1.00 43.61 ?  397 PRO A O     1 
ATOM   1907 C  CB    . PRO A 1  269 ? 15.908  10.614  12.528  1.00 52.97 ?  397 PRO A CB    1 
ATOM   1908 C  CG    . PRO A 1  269 ? 15.979  9.668   11.358  1.00 52.71 ?  397 PRO A CG    1 
ATOM   1909 C  CD    . PRO A 1  269 ? 14.599  9.712   10.784  1.00 51.94 ?  397 PRO A CD    1 
ATOM   1910 N  N     . GLY A 1  270 ? 15.202  14.173  12.161  1.00 46.43 ?  410 GLY A N     1 
ATOM   1911 C  CA    . GLY A 1  270 ? 15.959  15.384  11.870  1.00 43.92 ?  410 GLY A CA    1 
ATOM   1912 C  C     . GLY A 1  270 ? 15.900  15.830  10.420  1.00 35.70 ?  410 GLY A C     1 
ATOM   1913 O  O     . GLY A 1  270 ? 16.557  16.807  10.025  1.00 33.98 ?  410 GLY A O     1 
ATOM   1914 N  N     . SER A 1  271 ? 15.107  15.152  9.606   1.00 34.46 ?  411 SER A N     1 
ATOM   1915 C  CA    . SER A 1  271 ? 15.051  15.518  8.198   1.00 29.21 ?  411 SER A CA    1 
ATOM   1916 C  C     . SER A 1  271 ? 13.817  14.909  7.539   1.00 35.49 ?  411 SER A C     1 
ATOM   1917 O  O     . SER A 1  271 ? 12.748  14.843  8.156   1.00 32.45 ?  411 SER A O     1 
ATOM   1918 C  CB    . SER A 1  271 ? 16.332  15.068  7.494   1.00 33.10 ?  411 SER A CB    1 
ATOM   1919 O  OG    . SER A 1  271 ? 16.432  15.630  6.202   1.00 30.85 ?  411 SER A OG    1 
ATOM   1920 N  N     . TRP A 1  272 ? 13.948  14.473  6.290   1.00 31.31 ?  412 TRP A N     1 
ATOM   1921 C  CA    . TRP A 1  272 ? 12.847  13.850  5.566   1.00 24.10 ?  412 TRP A CA    1 
ATOM   1922 C  C     . TRP A 1  272 ? 13.412  13.193  4.316   1.00 23.16 ?  412 TRP A C     1 
ATOM   1923 O  O     . TRP A 1  272 ? 14.556  13.439  3.924   1.00 23.97 ?  412 TRP A O     1 
ATOM   1924 C  CB    . TRP A 1  272 ? 11.764  14.867  5.198   1.00 25.08 ?  412 TRP A CB    1 
ATOM   1925 C  CG    . TRP A 1  272 ? 12.286  16.063  4.452   1.00 27.33 ?  412 TRP A CG    1 
ATOM   1926 C  CD1   . TRP A 1  272 ? 12.723  17.240  4.995   1.00 26.58 ?  412 TRP A CD1   1 
ATOM   1927 C  CD2   . TRP A 1  272 ? 12.425  16.203  3.029   1.00 26.38 ?  412 TRP A CD2   1 
ATOM   1928 N  NE1   . TRP A 1  272 ? 13.124  18.098  4.001   1.00 27.08 ?  412 TRP A NE1   1 
ATOM   1929 C  CE2   . TRP A 1  272 ? 12.950  17.488  2.786   1.00 25.70 ?  412 TRP A CE2   1 
ATOM   1930 C  CE3   . TRP A 1  272 ? 12.157  15.367  1.940   1.00 25.77 ?  412 TRP A CE3   1 
ATOM   1931 C  CZ2   . TRP A 1  272 ? 13.211  17.958  1.500   1.00 25.72 ?  412 TRP A CZ2   1 
ATOM   1932 C  CZ3   . TRP A 1  272 ? 12.416  15.836  0.663   1.00 26.39 ?  412 TRP A CZ3   1 
ATOM   1933 C  CH2   . TRP A 1  272 ? 12.940  17.119  0.455   1.00 24.29 ?  412 TRP A CH2   1 
ATOM   1934 N  N     . LYS A 1  273 ? 12.596  12.345  3.695   1.00 22.00 ?  413 LYS A N     1 
ATOM   1935 C  CA    . LYS A 1  273 ? 12.945  11.747  2.417   1.00 22.29 ?  413 LYS A CA    1 
ATOM   1936 C  C     . LYS A 1  273 ? 11.735  11.784  1.498   1.00 19.37 ?  413 LYS A C     1 
ATOM   1937 O  O     . LYS A 1  273 ? 10.586  11.797  1.951   1.00 18.87 ?  413 LYS A O     1 
ATOM   1938 C  CB    . LYS A 1  273 ? 13.441  10.298  2.569   1.00 20.01 ?  413 LYS A CB    1 
ATOM   1939 C  CG    . LYS A 1  273 ? 12.392  9.318   3.072   1.00 23.10 ?  413 LYS A CG    1 
ATOM   1940 C  CD    . LYS A 1  273 ? 12.924  7.891   3.074   1.00 19.79 ?  413 LYS A CD    1 
ATOM   1941 C  CE    . LYS A 1  273 ? 11.904  6.926   3.652   1.00 17.77 ?  413 LYS A CE    1 
ATOM   1942 N  NZ    . LYS A 1  273 ? 12.290  5.506   3.425   1.00 20.44 ?  413 LYS A NZ    1 
ATOM   1943 N  N     . ALA A 1  274 ? 12.010  11.800  0.198   1.00 19.00 ?  414 ALA A N     1 
ATOM   1944 C  CA    . ALA A 1  274 ? 10.961  11.727  -0.803  1.00 22.25 ?  414 ALA A CA    1 
ATOM   1945 C  C     . ALA A 1  274 ? 10.510  10.283  -0.984  1.00 21.47 ?  414 ALA A C     1 
ATOM   1946 O  O     . ALA A 1  274 ? 11.329  9.360   -1.027  1.00 16.38 ?  414 ALA A O     1 
ATOM   1947 C  CB    . ALA A 1  274 ? 11.454  12.293  -2.132  1.00 20.96 ?  414 ALA A CB    1 
ATOM   1948 N  N     . VAL A 1  275 ? 9.199   10.092  -1.091  1.00 15.63 ?  415 VAL A N     1 
ATOM   1949 C  CA    . VAL A 1  275 ? 8.616   8.766   -1.256  1.00 14.96 ?  415 VAL A CA    1 
ATOM   1950 C  C     . VAL A 1  275 ? 7.539   8.841   -2.324  1.00 14.48 ?  415 VAL A C     1 
ATOM   1951 O  O     . VAL A 1  275 ? 6.738   9.780   -2.352  1.00 14.46 ?  415 VAL A O     1 
ATOM   1952 C  CB    . VAL A 1  275 ? 8.029   8.227   0.066   1.00 14.20 ?  415 VAL A CB    1 
ATOM   1953 C  CG1   . VAL A 1  275 ? 7.366   6.872   -0.160  1.00 12.99 ?  415 VAL A CG1   1 
ATOM   1954 C  CG2   . VAL A 1  275 ? 9.114   8.109   1.124   1.00 18.02 ?  415 VAL A CG2   1 
ATOM   1955 N  N     . ARG A 1  276 ? 7.521   7.847   -3.202  1.00 12.78 ?  416 ARG A N     1 
ATOM   1956 C  CA    . ARG A 1  276 ? 6.476   7.750   -4.208  1.00 12.09 ?  416 ARG A CA    1 
ATOM   1957 C  C     . ARG A 1  276 ? 5.200   7.208   -3.577  1.00 12.54 ?  416 ARG A C     1 
ATOM   1958 O  O     . ARG A 1  276 ? 5.227   6.201   -2.862  1.00 10.91 ?  416 ARG A O     1 
ATOM   1959 C  CB    . ARG A 1  276 ? 6.933   6.854   -5.356  1.00 11.63 ?  416 ARG A CB    1 
ATOM   1960 C  CG    . ARG A 1  276 ? 7.791   7.571   -6.383  1.00 13.24 ?  416 ARG A CG    1 
ATOM   1961 C  CD    . ARG A 1  276 ? 6.948   8.170   -7.500  1.00 15.64 ?  416 ARG A CD    1 
ATOM   1962 N  NE    . ARG A 1  276 ? 6.207   7.123   -8.199  1.00 11.67 ?  416 ARG A NE    1 
ATOM   1963 C  CZ    . ARG A 1  276 ? 4.892   6.920   -8.119  1.00 12.94 ?  416 ARG A CZ    1 
ATOM   1964 N  NH1   . ARG A 1  276 ? 4.111   7.708   -7.387  1.00 11.10 ?  416 ARG A NH1   1 
ATOM   1965 N  NH2   . ARG A 1  276 ? 4.353   5.918   -8.792  1.00 10.26 ?  416 ARG A NH2   1 
ATOM   1966 N  N     . VAL A 1  277 ? 4.088   7.892   -3.830  1.00 12.88 ?  417 VAL A N     1 
ATOM   1967 C  CA    . VAL A 1  277 ? 2.784   7.519   -3.300  1.00 13.40 ?  417 VAL A CA    1 
ATOM   1968 C  C     . VAL A 1  277 ? 1.783   7.571   -4.444  1.00 13.79 ?  417 VAL A C     1 
ATOM   1969 O  O     . VAL A 1  277 ? 1.714   8.571   -5.167  1.00 13.77 ?  417 VAL A O     1 
ATOM   1970 C  CB    . VAL A 1  277 ? 2.341   8.452   -2.153  1.00 12.16 ?  417 VAL A CB    1 
ATOM   1971 C  CG1   . VAL A 1  277 ? 0.946   8.081   -1.659  1.00 12.79 ?  417 VAL A CG1   1 
ATOM   1972 C  CG2   . VAL A 1  277 ? 3.341   8.407   -1.011  1.00 12.00 ?  417 VAL A CG2   1 
ATOM   1973 N  N     . ASP A 1  278 ? 1.012   6.500   -4.603  1.00 10.04 ?  418 ASP A N     1 
ATOM   1974 C  CA    . ASP A 1  278 ? -0.054  6.428   -5.592  1.00 13.45 ?  418 ASP A CA    1 
ATOM   1975 C  C     . ASP A 1  278 ? -1.400  6.441   -4.883  1.00 9.14  ?  418 ASP A C     1 
ATOM   1976 O  O     . ASP A 1  278 ? -1.624  5.669   -3.946  1.00 11.36 ?  418 ASP A O     1 
ATOM   1977 C  CB    . ASP A 1  278 ? 0.074   5.171   -6.455  1.00 11.56 ?  418 ASP A CB    1 
ATOM   1978 C  CG    . ASP A 1  278 ? 1.261   5.229   -7.394  1.00 15.37 ?  418 ASP A CG    1 
ATOM   1979 O  OD1   . ASP A 1  278 ? 1.655   6.347   -7.786  1.00 17.10 ?  418 ASP A OD1   1 
ATOM   1980 O  OD2   . ASP A 1  278 ? 1.797   4.157   -7.749  1.00 12.11 ?  418 ASP A OD2   1 
ATOM   1981 N  N     . LEU A 1  279 ? -2.287  7.317   -5.336  1.00 9.94  ?  419 LEU A N     1 
ATOM   1982 C  CA    . LEU A 1  279 ? -3.637  7.424   -4.809  1.00 10.94 ?  419 LEU A CA    1 
ATOM   1983 C  C     . LEU A 1  279 ? -4.613  7.108   -5.929  1.00 14.06 ?  419 LEU A C     1 
ATOM   1984 O  O     . LEU A 1  279 ? -4.479  7.629   -7.041  1.00 17.22 ?  419 LEU A O     1 
ATOM   1985 C  CB    . LEU A 1  279 ? -3.917  8.822   -4.250  1.00 14.88 ?  419 LEU A CB    1 
ATOM   1986 C  CG    . LEU A 1  279 ? -2.986  9.373   -3.168  1.00 16.18 ?  419 LEU A CG    1 
ATOM   1987 C  CD1   . LEU A 1  279 ? -3.480  10.746  -2.733  1.00 18.88 ?  419 LEU A CD1   1 
ATOM   1988 C  CD2   . LEU A 1  279 ? -2.888  8.441   -1.968  1.00 16.59 ?  419 LEU A CD2   1 
ATOM   1989 N  N     . VAL A 1  280 ? -5.583  6.252   -5.635  1.00 10.79 ?  420 VAL A N     1 
ATOM   1990 C  CA    . VAL A 1  280 ? -6.632  5.882   -6.575  1.00 8.63  ?  420 VAL A CA    1 
ATOM   1991 C  C     . VAL A 1  280 ? -7.969  6.036   -5.870  1.00 11.72 ?  420 VAL A C     1 
ATOM   1992 O  O     . VAL A 1  280 ? -8.117  5.627   -4.713  1.00 9.77  ?  420 VAL A O     1 
ATOM   1993 C  CB    . VAL A 1  280 ? -6.448  4.436   -7.085  1.00 14.96 ?  420 VAL A CB    1 
ATOM   1994 C  CG1   . VAL A 1  280 ? -7.636  4.009   -7.957  1.00 14.34 ?  420 VAL A CG1   1 
ATOM   1995 C  CG2   . VAL A 1  280 ? -5.136  4.308   -7.849  1.00 14.76 ?  420 VAL A CG2   1 
ATOM   1996 N  N     . VAL A 1  281 ? -8.939  6.623   -6.565  1.00 9.29  ?  421 VAL A N     1 
ATOM   1997 C  CA    . VAL A 1  281 ? -10.298 6.773   -6.063  1.00 9.57  ?  421 VAL A CA    1 
ATOM   1998 C  C     . VAL A 1  281 ? -11.210 5.904   -6.914  1.00 16.24 ?  421 VAL A C     1 
ATOM   1999 O  O     . VAL A 1  281 ? -11.105 5.905   -8.146  1.00 11.20 ?  421 VAL A O     1 
ATOM   2000 C  CB    . VAL A 1  281 ? -10.760 8.240   -6.090  1.00 13.25 ?  421 VAL A CB    1 
ATOM   2001 C  CG1   . VAL A 1  281 ? -12.225 8.344   -5.670  1.00 16.01 ?  421 VAL A CG1   1 
ATOM   2002 C  CG2   . VAL A 1  281 ? -9.891  9.092   -5.179  1.00 14.58 ?  421 VAL A CG2   1 
ATOM   2003 N  N     . ALA A 1  282 ? -12.101 5.166   -6.262  1.00 11.47 ?  422 ALA A N     1 
ATOM   2004 C  CA    . ALA A 1  282 ? -13.072 4.332   -6.949  1.00 9.07  ?  422 ALA A CA    1 
ATOM   2005 C  C     . ALA A 1  282 ? -14.418 4.448   -6.253  1.00 9.48  ?  422 ALA A C     1 
ATOM   2006 O  O     . ALA A 1  282 ? -14.474 4.591   -5.026  1.00 10.05 ?  422 ALA A O     1 
ATOM   2007 C  CB    . ALA A 1  282 ? -12.644 2.855   -6.973  1.00 8.28  ?  422 ALA A CB    1 
ATOM   2008 N  N     . PRO A 1  283 ? -15.516 4.395   -7.003  1.00 9.95  ?  423 PRO A N     1 
ATOM   2009 C  CA    . PRO A 1  283 ? -16.827 4.280   -6.359  1.00 18.94 ?  423 PRO A CA    1 
ATOM   2010 C  C     . PRO A 1  283 ? -16.948 2.939   -5.657  1.00 15.02 ?  423 PRO A C     1 
ATOM   2011 O  O     . PRO A 1  283 ? -16.323 1.950   -6.051  1.00 10.02 ?  423 PRO A O     1 
ATOM   2012 C  CB    . PRO A 1  283 ? -17.815 4.401   -7.525  1.00 20.68 ?  423 PRO A CB    1 
ATOM   2013 C  CG    . PRO A 1  283 ? -17.045 4.012   -8.724  1.00 18.92 ?  423 PRO A CG    1 
ATOM   2014 C  CD    . PRO A 1  283 ? -15.618 4.410   -8.472  1.00 13.96 ?  423 PRO A CD    1 
ATOM   2015 N  N     . VAL A 1  284 ? -17.750 2.914   -4.590  1.00 9.67  ?  424 VAL A N     1 
ATOM   2016 C  CA    . VAL A 1  284 ? -17.805 1.717   -3.759  1.00 9.61  ?  424 VAL A CA    1 
ATOM   2017 C  C     . VAL A 1  284 ? -18.320 0.532   -4.562  1.00 15.09 ?  424 VAL A C     1 
ATOM   2018 O  O     . VAL A 1  284 ? -17.944 -0.614  -4.296  1.00 11.49 ?  424 VAL A O     1 
ATOM   2019 C  CB    . VAL A 1  284 ? -18.654 1.964   -2.494  1.00 12.41 ?  424 VAL A CB    1 
ATOM   2020 C  CG1   . VAL A 1  284 ? -20.109 2.216   -2.844  1.00 17.74 ?  424 VAL A CG1   1 
ATOM   2021 C  CG2   . VAL A 1  284 ? -18.520 0.794   -1.536  1.00 16.20 ?  424 VAL A CG2   1 
ATOM   2022 N  N     . SER A 1  285 ? -19.166 0.780   -5.564  1.00 16.69 ?  425 SER A N     1 
ATOM   2023 C  CA    . SER A 1  285 ? -19.636 -0.310  -6.411  1.00 17.14 ?  425 SER A CA    1 
ATOM   2024 C  C     . SER A 1  285 ? -18.481 -1.018  -7.109  1.00 23.86 ?  425 SER A C     1 
ATOM   2025 O  O     . SER A 1  285 ? -18.546 -2.231  -7.338  1.00 20.70 ?  425 SER A O     1 
ATOM   2026 C  CB    . SER A 1  285 ? -20.628 0.217   -7.448  1.00 21.33 ?  425 SER A CB    1 
ATOM   2027 O  OG    . SER A 1  285 ? -20.026 1.200   -8.273  1.00 16.53 ?  425 SER A OG    1 
ATOM   2028 N  N     . GLN A 1  286 ? -17.424 -0.284  -7.460  1.00 12.11 ?  426 GLN A N     1 
ATOM   2029 C  CA    . GLN A 1  286 ? -16.274 -0.847  -8.153  1.00 10.26 ?  426 GLN A CA    1 
ATOM   2030 C  C     . GLN A 1  286 ? -15.125 -1.182  -7.217  1.00 13.47 ?  426 GLN A C     1 
ATOM   2031 O  O     . GLN A 1  286 ? -14.099 -1.688  -7.679  1.00 14.39 ?  426 GLN A O     1 
ATOM   2032 C  CB    . GLN A 1  286 ? -15.764 0.122   -9.224  1.00 13.33 ?  426 GLN A CB    1 
ATOM   2033 C  CG    . GLN A 1  286 ? -16.772 0.480   -10.295 1.00 12.60 ?  426 GLN A CG    1 
ATOM   2034 C  CD    . GLN A 1  286 ? -16.232 1.518   -11.258 1.00 20.41 ?  426 GLN A CD    1 
ATOM   2035 O  OE1   . GLN A 1  286 ? -15.051 1.867   -11.214 1.00 23.60 ?  426 GLN A OE1   1 
ATOM   2036 N  NE2   . GLN A 1  286 ? -17.095 2.021   -12.133 1.00 21.12 ?  426 GLN A NE2   1 
ATOM   2037 N  N     . PHE A 1  287 ? -15.274 -0.917  -5.920  1.00 13.15 ?  427 PHE A N     1 
ATOM   2038 C  CA    . PHE A 1  287 ? -14.153 -1.071  -4.999  1.00 10.63 ?  427 PHE A CA    1 
ATOM   2039 C  C     . PHE A 1  287 ? -13.538 -2.463  -5.035  1.00 14.66 ?  427 PHE A C     1 
ATOM   2040 O  O     . PHE A 1  287 ? -12.299 -2.556  -5.090  1.00 9.12  ?  427 PHE A O     1 
ATOM   2041 C  CB    . PHE A 1  287 ? -14.608 -0.706  -3.582  1.00 14.96 ?  427 PHE A CB    1 
ATOM   2042 C  CG    . PHE A 1  287 ? -13.556 -0.908  -2.533  1.00 9.73  ?  427 PHE A CG    1 
ATOM   2043 C  CD1   . PHE A 1  287 ? -12.622 0.079   -2.270  1.00 13.34 ?  427 PHE A CD1   1 
ATOM   2044 C  CD2   . PHE A 1  287 ? -13.509 -2.079  -1.800  1.00 11.33 ?  427 PHE A CD2   1 
ATOM   2045 C  CE1   . PHE A 1  287 ? -11.657 -0.102  -1.298  1.00 10.86 ?  427 PHE A CE1   1 
ATOM   2046 C  CE2   . PHE A 1  287 ? -12.548 -2.267  -0.831  1.00 15.69 ?  427 PHE A CE2   1 
ATOM   2047 C  CZ    . PHE A 1  287 ? -11.620 -1.279  -0.579  1.00 14.79 ?  427 PHE A CZ    1 
ATOM   2048 N  N     . PRO A 1  288 ? -14.304 -3.558  -5.018  1.00 13.36 ?  428 PRO A N     1 
ATOM   2049 C  CA    . PRO A 1  288 ? -13.661 -4.881  -5.087  1.00 7.90  ?  428 PRO A CA    1 
ATOM   2050 C  C     . PRO A 1  288 ? -12.780 -5.043  -6.310  1.00 6.67  ?  428 PRO A C     1 
ATOM   2051 O  O     . PRO A 1  288 ? -11.689 -5.617  -6.217  1.00 8.74  ?  428 PRO A O     1 
ATOM   2052 C  CB    . PRO A 1  288 ? -14.853 -5.853  -5.111  1.00 7.82  ?  428 PRO A CB    1 
ATOM   2053 C  CG    . PRO A 1  288 ? -15.999 -5.084  -4.554  1.00 12.77 ?  428 PRO A CG    1 
ATOM   2054 C  CD    . PRO A 1  288 ? -15.771 -3.659  -4.956  1.00 11.44 ?  428 PRO A CD    1 
ATOM   2055 N  N     . PHE A 1  289 ? -13.228 -4.540  -7.461  1.00 11.18 ?  429 PHE A N     1 
ATOM   2056 C  CA    . PHE A 1  289 ? -12.434 -4.646  -8.678  1.00 10.82 ?  429 PHE A CA    1 
ATOM   2057 C  C     . PHE A 1  289 ? -11.183 -3.786  -8.601  1.00 15.42 ?  429 PHE A C     1 
ATOM   2058 O  O     . PHE A 1  289 ? -10.117 -4.191  -9.078  1.00 8.76  ?  429 PHE A O     1 
ATOM   2059 C  CB    . PHE A 1  289 ? -13.275 -4.243  -9.884  1.00 8.90  ?  429 PHE A CB    1 
ATOM   2060 C  CG    . PHE A 1  289 ? -14.461 -5.127  -10.105 1.00 12.66 ?  429 PHE A CG    1 
ATOM   2061 C  CD1   . PHE A 1  289 ? -14.312 -6.362  -10.711 1.00 14.92 ?  429 PHE A CD1   1 
ATOM   2062 C  CD2   . PHE A 1  289 ? -15.722 -4.729  -9.699  1.00 14.49 ?  429 PHE A CD2   1 
ATOM   2063 C  CE1   . PHE A 1  289 ? -15.406 -7.184  -10.916 1.00 14.75 ?  429 PHE A CE1   1 
ATOM   2064 C  CE2   . PHE A 1  289 ? -16.820 -5.543  -9.904  1.00 13.75 ?  429 PHE A CE2   1 
ATOM   2065 C  CZ    . PHE A 1  289 ? -16.661 -6.773  -10.512 1.00 11.12 ?  429 PHE A CZ    1 
ATOM   2066 N  N     . ALA A 1  290 ? -11.297 -2.588  -8.026  1.00 8.80  ?  430 ALA A N     1 
ATOM   2067 C  CA    . ALA A 1  290 ? -10.134 -1.715  -7.919  1.00 7.88  ?  430 ALA A CA    1 
ATOM   2068 C  C     . ALA A 1  290 ? -9.153  -2.252  -6.889  1.00 7.48  ?  430 ALA A C     1 
ATOM   2069 O  O     . ALA A 1  290 ? -7.933  -2.188  -7.085  1.00 8.99  ?  430 ALA A O     1 
ATOM   2070 C  CB    . ALA A 1  290 ? -10.573 -0.297  -7.557  1.00 8.91  ?  430 ALA A CB    1 
ATOM   2071 N  N     . LEU A 1  291 ? -9.668  -2.787  -5.783  1.00 7.83  ?  431 LEU A N     1 
ATOM   2072 C  CA    . LEU A 1  291 ? -8.800  -3.423  -4.800  1.00 9.85  ?  431 LEU A CA    1 
ATOM   2073 C  C     . LEU A 1  291 ? -8.040  -4.589  -5.424  1.00 13.02 ?  431 LEU A C     1 
ATOM   2074 O  O     . LEU A 1  291 ? -6.815  -4.689  -5.297  1.00 9.12  ?  431 LEU A O     1 
ATOM   2075 C  CB    . LEU A 1  291 ? -9.628  -3.889  -3.604  1.00 8.03  ?  431 LEU A CB    1 
ATOM   2076 C  CG    . LEU A 1  291 ? -8.845  -4.529  -2.462  1.00 14.09 ?  431 LEU A CG    1 
ATOM   2077 C  CD1   . LEU A 1  291 ? -7.804  -3.559  -1.924  1.00 9.32  ?  431 LEU A CD1   1 
ATOM   2078 C  CD2   . LEU A 1  291 ? -9.796  -4.966  -1.365  1.00 10.55 ?  431 LEU A CD2   1 
ATOM   2079 N  N     . LEU A 1  292 ? -8.754  -5.479  -6.112  1.00 10.89 ?  432 LEU A N     1 
ATOM   2080 C  CA    . LEU A 1  292 ? -8.094  -6.591  -6.791  1.00 12.01 ?  432 LEU A CA    1 
ATOM   2081 C  C     . LEU A 1  292 ? -7.069  -6.082  -7.795  1.00 10.19 ?  432 LEU A C     1 
ATOM   2082 O  O     . LEU A 1  292 ? -5.922  -6.550  -7.830  1.00 6.56  ?  432 LEU A O     1 
ATOM   2083 C  CB    . LEU A 1  292 ? -9.142  -7.462  -7.484  1.00 10.45 ?  432 LEU A CB    1 
ATOM   2084 C  CG    . LEU A 1  292 ? -8.672  -8.731  -8.196  1.00 11.00 ?  432 LEU A CG    1 
ATOM   2085 C  CD1   . LEU A 1  292 ? -8.105  -9.743  -7.212  1.00 6.48  ?  432 LEU A CD1   1 
ATOM   2086 C  CD2   . LEU A 1  292 ? -9.834  -9.323  -8.983  1.00 6.99  ?  432 LEU A CD2   1 
ATOM   2087 N  N     . GLY A 1  293 ? -7.462  -5.100  -8.606  1.00 10.05 ?  433 GLY A N     1 
ATOM   2088 C  CA    . GLY A 1  293 ? -6.607  -4.640  -9.684  1.00 12.31 ?  433 GLY A CA    1 
ATOM   2089 C  C     . GLY A 1  293 ? -5.336  -3.965  -9.210  1.00 12.08 ?  433 GLY A C     1 
ATOM   2090 O  O     . GLY A 1  293 ? -4.305  -4.040  -9.886  1.00 12.28 ?  433 GLY A O     1 
ATOM   2091 N  N     . HIS A 1  294 ? -5.385  -3.292  -8.062  1.00 9.51  ?  434 HIS A N     1 
ATOM   2092 C  CA    . HIS A 1  294 ? -4.232  -2.556  -7.559  1.00 11.70 ?  434 HIS A CA    1 
ATOM   2093 C  C     . HIS A 1  294 ? -3.474  -3.292  -6.464  1.00 5.79  ?  434 HIS A C     1 
ATOM   2094 O  O     . HIS A 1  294 ? -2.445  -2.791  -6.004  1.00 12.68 ?  434 HIS A O     1 
ATOM   2095 C  CB    . HIS A 1  294 ? -4.674  -1.176  -7.061  1.00 11.17 ?  434 HIS A CB    1 
ATOM   2096 C  CG    . HIS A 1  294 ? -5.136  -0.273  -8.160  1.00 14.88 ?  434 HIS A CG    1 
ATOM   2097 N  ND1   . HIS A 1  294 ? -4.264  0.486   -8.909  1.00 16.82 ?  434 HIS A ND1   1 
ATOM   2098 C  CD2   . HIS A 1  294 ? -6.371  -0.032  -8.662  1.00 17.82 ?  434 HIS A CD2   1 
ATOM   2099 C  CE1   . HIS A 1  294 ? -4.942  1.165   -9.817  1.00 26.33 ?  434 HIS A CE1   1 
ATOM   2100 N  NE2   . HIS A 1  294 ? -6.223  0.871   -9.687  1.00 24.07 ?  434 HIS A NE2   1 
ATOM   2101 N  N     . THR A 1  295 ? -3.938  -4.466  -6.040  1.00 6.54  ?  435 THR A N     1 
ATOM   2102 C  CA    . THR A 1  295 ? -3.177  -5.256  -5.079  1.00 6.65  ?  435 THR A CA    1 
ATOM   2103 C  C     . THR A 1  295 ? -2.132  -6.141  -5.750  1.00 9.35  ?  435 THR A C     1 
ATOM   2104 O  O     . THR A 1  295 ? -1.139  -6.501  -5.107  1.00 11.20 ?  435 THR A O     1 
ATOM   2105 C  CB    . THR A 1  295 ? -4.126  -6.100  -4.219  1.00 10.27 ?  435 THR A CB    1 
ATOM   2106 O  OG1   . THR A 1  295 ? -4.926  -5.230  -3.409  1.00 9.07  ?  435 THR A OG1   1 
ATOM   2107 C  CG2   . THR A 1  295 ? -3.356  -7.034  -3.288  1.00 5.03  ?  435 THR A CG2   1 
ATOM   2108 N  N     . GLY A 1  296 ? -2.311  -6.477  -7.023  1.00 8.51  ?  436 GLY A N     1 
ATOM   2109 C  CA    . GLY A 1  296 ? -1.275  -7.182  -7.761  1.00 8.48  ?  436 GLY A CA    1 
ATOM   2110 C  C     . GLY A 1  296 ? -1.151  -8.653  -7.396  1.00 9.03  ?  436 GLY A C     1 
ATOM   2111 O  O     . GLY A 1  296 ? -2.117  -9.246  -6.917  1.00 8.36  ?  436 GLY A O     1 
ATOM   2112 N  N     . SER A 1  297 ? 0.013   -9.264  -7.629  1.00 8.58  ?  437 SER A N     1 
ATOM   2113 C  CA    . SER A 1  297 ? 1.146   -8.645  -8.311  1.00 7.07  ?  437 SER A CA    1 
ATOM   2114 C  C     . SER A 1  297 ? 0.805   -8.249  -9.747  1.00 10.09 ?  437 SER A C     1 
ATOM   2115 O  O     . SER A 1  297 ? -0.255  -8.597  -10.262 1.00 8.22  ?  437 SER A O     1 
ATOM   2116 C  CB    . SER A 1  297 ? 2.340   -9.603  -8.331  1.00 7.32  ?  437 SER A CB    1 
ATOM   2117 O  OG    . SER A 1  297 ? 2.087   -10.704 -9.198  1.00 6.70  ?  437 SER A OG    1 
ATOM   2118 N  N     . LYS A 1  298 ? 1.723   -7.523  -10.389 1.00 9.98  ?  438 LYS A N     1 
ATOM   2119 C  CA    . LYS A 1  298 ? 1.534   -7.161  -11.791 1.00 11.59 ?  438 LYS A CA    1 
ATOM   2120 C  C     . LYS A 1  298 ? 1.321   -8.403  -12.646 1.00 10.05 ?  438 LYS A C     1 
ATOM   2121 O  O     . LYS A 1  298 ? 0.386   -8.466  -13.453 1.00 9.10  ?  438 LYS A O     1 
ATOM   2122 C  CB    . LYS A 1  298 ? 2.736   -6.357  -12.291 1.00 16.13 ?  438 LYS A CB    1 
ATOM   2123 C  CG    . LYS A 1  298 ? 2.778   -6.183  -13.798 1.00 36.12 ?  438 LYS A CG    1 
ATOM   2124 N  N     . LEU A 1  299 ? 2.173   -9.414  -12.480 1.00 6.76  ?  439 LEU A N     1 
ATOM   2125 C  CA    . LEU A 1  299 ? 1.990   -10.633 -13.260 1.00 9.04  ?  439 LEU A CA    1 
ATOM   2126 C  C     . LEU A 1  299 ? 0.684   -11.317 -12.888 1.00 6.92  ?  439 LEU A C     1 
ATOM   2127 O  O     . LEU A 1  299 ? -0.034  -11.819 -13.760 1.00 8.68  ?  439 LEU A O     1 
ATOM   2128 C  CB    . LEU A 1  299 ? 3.169   -11.586 -13.054 1.00 7.01  ?  439 LEU A CB    1 
ATOM   2129 C  CG    . LEU A 1  299 ? 3.057   -12.925 -13.786 1.00 10.71 ?  439 LEU A CG    1 
ATOM   2130 C  CD1   . LEU A 1  299 ? 3.009   -12.714 -15.298 1.00 10.49 ?  439 LEU A CD1   1 
ATOM   2131 C  CD2   . LEU A 1  299 ? 4.208   -13.838 -13.407 1.00 8.53  ?  439 LEU A CD2   1 
ATOM   2132 N  N     . PHE A 1  300 ? 0.353   -11.338 -11.596 1.00 9.18  ?  440 PHE A N     1 
ATOM   2133 C  CA    . PHE A 1  300 ? -0.894  -11.961 -11.173 1.00 6.78  ?  440 PHE A CA    1 
ATOM   2134 C  C     . PHE A 1  300 ? -2.088  -11.327 -11.873 1.00 8.70  ?  440 PHE A C     1 
ATOM   2135 O  O     . PHE A 1  300 ? -2.986  -12.034 -12.343 1.00 8.25  ?  440 PHE A O     1 
ATOM   2136 C  CB    . PHE A 1  300 ? -1.048  -11.865 -9.657  1.00 9.19  ?  440 PHE A CB    1 
ATOM   2137 C  CG    . PHE A 1  300 ? -2.229  -12.624 -9.126  1.00 11.76 ?  440 PHE A CG    1 
ATOM   2138 C  CD1   . PHE A 1  300 ? -3.489  -12.057 -9.126  1.00 8.81  ?  440 PHE A CD1   1 
ATOM   2139 C  CD2   . PHE A 1  300 ? -2.079  -13.912 -8.633  1.00 7.01  ?  440 PHE A CD2   1 
ATOM   2140 C  CE1   . PHE A 1  300 ? -4.583  -12.759 -8.645  1.00 9.10  ?  440 PHE A CE1   1 
ATOM   2141 C  CE2   . PHE A 1  300 ? -3.162  -14.615 -8.148  1.00 10.09 ?  440 PHE A CE2   1 
ATOM   2142 C  CZ    . PHE A 1  300 ? -4.418  -14.038 -8.155  1.00 12.81 ?  440 PHE A CZ    1 
ATOM   2143 N  N     . GLN A 1  301 ? -2.117  -9.993  -11.956 1.00 11.07 ?  441 GLN A N     1 
ATOM   2144 C  CA    . GLN A 1  301 ? -3.248  -9.323  -12.590 1.00 12.18 ?  441 GLN A CA    1 
ATOM   2145 C  C     . GLN A 1  301 ? -3.297  -9.609  -14.085 1.00 10.83 ?  441 GLN A C     1 
ATOM   2146 O  O     . GLN A 1  301 ? -4.374  -9.868  -14.632 1.00 11.11 ?  441 GLN A O     1 
ATOM   2147 C  CB    . GLN A 1  301 ? -3.189  -7.817  -12.335 1.00 10.74 ?  441 GLN A CB    1 
ATOM   2148 C  CG    . GLN A 1  301 ? -3.503  -7.421  -10.900 1.00 15.49 ?  441 GLN A CG    1 
ATOM   2149 C  CD    . GLN A 1  301 ? -4.801  -8.019  -10.400 1.00 17.52 ?  441 GLN A CD    1 
ATOM   2150 O  OE1   . GLN A 1  301 ? -5.862  -7.796  -10.978 1.00 18.89 ?  441 GLN A OE1   1 
ATOM   2151 N  NE2   . GLN A 1  301 ? -4.716  -8.812  -9.338  1.00 20.49 ?  441 GLN A NE2   1 
ATOM   2152 N  N     . ARG A 1  302 ? -2.146  -9.559  -14.765 1.00 12.03 ?  442 ARG A N     1 
ATOM   2153 C  CA    . ARG A 1  302 ? -2.123  -9.886  -16.189 1.00 11.56 ?  442 ARG A CA    1 
ATOM   2154 C  C     . ARG A 1  302 ? -2.624  -11.303 -16.428 1.00 14.87 ?  442 ARG A C     1 
ATOM   2155 O  O     . ARG A 1  302 ? -3.427  -11.542 -17.335 1.00 9.38  ?  442 ARG A O     1 
ATOM   2156 C  CB    . ARG A 1  302 ? -0.710  -9.719  -16.751 1.00 9.96  ?  442 ARG A CB    1 
ATOM   2157 C  CG    . ARG A 1  302 ? -0.147  -8.319  -16.606 1.00 15.50 ?  442 ARG A CG    1 
ATOM   2158 C  CD    . ARG A 1  302 ? 1.293   -8.217  -17.095 1.00 17.50 ?  442 ARG A CD    1 
ATOM   2159 N  NE    . ARG A 1  302 ? 1.390   -8.344  -18.550 1.00 16.11 ?  442 ARG A NE    1 
ATOM   2160 C  CZ    . ARG A 1  302 ? 2.404   -7.887  -19.280 1.00 21.04 ?  442 ARG A CZ    1 
ATOM   2161 N  NH1   . ARG A 1  302 ? 3.424   -7.264  -18.702 1.00 16.76 ?  442 ARG A NH1   1 
ATOM   2162 N  NH2   . ARG A 1  302 ? 2.396   -8.046  -20.595 1.00 13.59 ?  442 ARG A NH2   1 
ATOM   2163 N  N     . GLU A 1  303 ? -2.171  -12.256 -15.611 1.00 12.84 ?  443 GLU A N     1 
ATOM   2164 C  CA    . GLU A 1  303 ? -2.611  -13.637 -15.771 1.00 8.94  ?  443 GLU A CA    1 
ATOM   2165 C  C     . GLU A 1  303 ? -4.098  -13.776 -15.484 1.00 11.66 ?  443 GLU A C     1 
ATOM   2166 O  O     . GLU A 1  303 ? -4.810  -14.509 -16.182 1.00 12.68 ?  443 GLU A O     1 
ATOM   2167 C  CB    . GLU A 1  303 ? -1.791  -14.547 -14.854 1.00 13.16 ?  443 GLU A CB    1 
ATOM   2168 C  CG    . GLU A 1  303 ? -0.338  -14.668 -15.264 1.00 12.77 ?  443 GLU A CG    1 
ATOM   2169 C  CD    . GLU A 1  303 ? -0.137  -15.644 -16.413 1.00 22.27 ?  443 GLU A CD    1 
ATOM   2170 O  OE1   . GLU A 1  303 ? -0.234  -16.867 -16.178 1.00 20.42 ?  443 GLU A OE1   1 
ATOM   2171 O  OE2   . GLU A 1  303 ? 0.104   -15.189 -17.549 1.00 18.28 ?  443 GLU A OE2   1 
ATOM   2172 N  N     . LEU A 1  304 ? -4.585  -13.068 -14.466 1.00 11.96 ?  444 LEU A N     1 
ATOM   2173 C  CA    . LEU A 1  304 ? -6.000  -13.130 -14.125 1.00 9.07  ?  444 LEU A CA    1 
ATOM   2174 C  C     . LEU A 1  304 ? -6.860  -12.550 -15.240 1.00 12.18 ?  444 LEU A C     1 
ATOM   2175 O  O     . LEU A 1  304 ? -7.903  -13.114 -15.588 1.00 12.80 ?  444 LEU A O     1 
ATOM   2176 C  CB    . LEU A 1  304 ? -6.239  -12.387 -12.811 1.00 13.26 ?  444 LEU A CB    1 
ATOM   2177 C  CG    . LEU A 1  304 ? -7.645  -12.452 -12.227 1.00 17.92 ?  444 LEU A CG    1 
ATOM   2178 C  CD1   . LEU A 1  304 ? -7.971  -13.863 -11.780 1.00 19.10 ?  444 LEU A CD1   1 
ATOM   2179 C  CD2   . LEU A 1  304 ? -7.767  -11.487 -11.065 1.00 14.50 ?  444 LEU A CD2   1 
ATOM   2180 N  N     . ARG A 1  305 ? -6.434  -11.430 -15.822 1.00 11.15 ?  445 ARG A N     1 
ATOM   2181 C  CA    . ARG A 1  305 ? -7.190  -10.843 -16.922 1.00 11.94 ?  445 ARG A CA    1 
ATOM   2182 C  C     . ARG A 1  305 ? -7.116  -11.717 -18.169 1.00 13.82 ?  445 ARG A C     1 
ATOM   2183 O  O     . ARG A 1  305 ? -8.114  -11.882 -18.883 1.00 13.62 ?  445 ARG A O     1 
ATOM   2184 C  CB    . ARG A 1  305 ? -6.670  -9.433  -17.190 1.00 13.42 ?  445 ARG A CB    1 
ATOM   2185 C  CG    . ARG A 1  305 ? -7.006  -8.490  -16.050 1.00 8.85  ?  445 ARG A CG    1 
ATOM   2186 C  CD    . ARG A 1  305 ? -6.196  -7.208  -16.061 1.00 8.67  ?  445 ARG A CD    1 
ATOM   2187 N  NE    . ARG A 1  305 ? -6.508  -6.407  -14.882 1.00 16.10 ?  445 ARG A NE    1 
ATOM   2188 C  CZ    . ARG A 1  305 ? -6.037  -5.187  -14.650 1.00 21.04 ?  445 ARG A CZ    1 
ATOM   2189 N  NH1   . ARG A 1  305 ? -5.219  -4.607  -15.521 1.00 12.20 ?  445 ARG A NH1   1 
ATOM   2190 N  NH2   . ARG A 1  305 ? -6.385  -4.547  -13.542 1.00 16.71 ?  445 ARG A NH2   1 
ATOM   2191 N  N     . ARG A 1  306 ? -5.947  -12.300 -18.437 1.00 10.49 ?  446 ARG A N     1 
ATOM   2192 C  CA    . ARG A 1  306 ? -5.827  -13.250 -19.538 1.00 11.36 ?  446 ARG A CA    1 
ATOM   2193 C  C     . ARG A 1  306 ? -6.699  -14.475 -19.299 1.00 14.72 ?  446 ARG A C     1 
ATOM   2194 O  O     . ARG A 1  306 ? -7.411  -14.931 -20.203 1.00 18.01 ?  446 ARG A O     1 
ATOM   2195 C  CB    . ARG A 1  306 ? -4.366  -13.653 -19.707 1.00 14.34 ?  446 ARG A CB    1 
ATOM   2196 C  CG    . ARG A 1  306 ? -4.102  -14.572 -20.881 1.00 16.84 ?  446 ARG A CG    1 
ATOM   2197 C  CD    . ARG A 1  306 ? -2.614  -14.717 -21.116 1.00 14.66 ?  446 ARG A CD    1 
ATOM   2198 N  NE    . ARG A 1  306 ? -1.937  -15.506 -20.087 1.00 16.23 ?  446 ARG A NE    1 
ATOM   2199 C  CZ    . ARG A 1  306 ? -1.603  -16.792 -20.206 1.00 26.90 ?  446 ARG A CZ    1 
ATOM   2200 N  NH1   . ARG A 1  306 ? -1.888  -17.474 -21.309 1.00 24.17 ?  446 ARG A NH1   1 
ATOM   2201 N  NH2   . ARG A 1  306 ? -0.976  -17.404 -19.214 1.00 17.81 ?  446 ARG A NH2   1 
ATOM   2202 N  N     . PHE A 1  307 ? -6.670  -15.014 -18.079 1.00 11.13 ?  447 PHE A N     1 
ATOM   2203 C  CA    . PHE A 1  307 ? -7.506  -16.163 -17.754 1.00 11.94 ?  447 PHE A CA    1 
ATOM   2204 C  C     . PHE A 1  307 ? -8.981  -15.834 -17.959 1.00 18.31 ?  447 PHE A C     1 
ATOM   2205 O  O     . PHE A 1  307 ? -9.716  -16.587 -18.608 1.00 18.97 ?  447 PHE A O     1 
ATOM   2206 C  CB    . PHE A 1  307 ? -7.248  -16.605 -16.310 1.00 11.30 ?  447 PHE A CB    1 
ATOM   2207 C  CG    . PHE A 1  307 ? -8.169  -17.696 -15.835 1.00 12.54 ?  447 PHE A CG    1 
ATOM   2208 C  CD1   . PHE A 1  307 ? -9.403  -17.390 -15.288 1.00 16.57 ?  447 PHE A CD1   1 
ATOM   2209 C  CD2   . PHE A 1  307 ? -7.800  -19.027 -15.939 1.00 15.47 ?  447 PHE A CD2   1 
ATOM   2210 C  CE1   . PHE A 1  307 ? -10.253 -18.391 -14.853 1.00 15.25 ?  447 PHE A CE1   1 
ATOM   2211 C  CE2   . PHE A 1  307 ? -8.642  -20.030 -15.504 1.00 18.53 ?  447 PHE A CE2   1 
ATOM   2212 C  CZ    . PHE A 1  307 ? -9.871  -19.711 -14.961 1.00 17.70 ?  447 PHE A CZ    1 
ATOM   2213 N  N     . SER A 1  308 ? -9.425  -14.704 -17.409 1.00 16.95 ?  448 SER A N     1 
ATOM   2214 C  CA    A SER A 1  308 ? -10.832 -14.325 -17.512 0.82 14.53 ?  448 SER A CA    1 
ATOM   2215 C  CA    B SER A 1  308 ? -10.836 -14.338 -17.513 0.18 15.26 ?  448 SER A CA    1 
ATOM   2216 C  C     . SER A 1  308 ? -11.278 -14.276 -18.973 1.00 17.12 ?  448 SER A C     1 
ATOM   2217 O  O     . SER A 1  308 ? -12.341 -14.796 -19.329 1.00 20.61 ?  448 SER A O     1 
ATOM   2218 C  CB    A SER A 1  308 ? -11.044 -12.972 -16.828 0.82 13.28 ?  448 SER A CB    1 
ATOM   2219 C  CB    B SER A 1  308 ? -11.077 -12.998 -16.819 0.18 15.52 ?  448 SER A CB    1 
ATOM   2220 O  OG    A SER A 1  308 ? -12.388 -12.541 -16.926 0.82 21.71 ?  448 SER A OG    1 
ATOM   2221 O  OG    B SER A 1  308 ? -10.632 -11.920 -17.623 0.18 18.10 ?  448 SER A OG    1 
ATOM   2222 N  N     . ARG A 1  309 ? -10.466 -13.658 -19.829 1.00 18.79 ?  449 ARG A N     1 
ATOM   2223 C  CA    . ARG A 1  309 ? -10.844 -13.504 -21.231 1.00 21.66 ?  449 ARG A CA    1 
ATOM   2224 C  C     . ARG A 1  309 ? -10.757 -14.829 -21.981 1.00 23.60 ?  449 ARG A C     1 
ATOM   2225 O  O     . ARG A 1  309 ? -11.708 -15.226 -22.663 1.00 16.69 ?  449 ARG A O     1 
ATOM   2226 C  CB    . ARG A 1  309 ? -9.960  -12.447 -21.897 1.00 23.21 ?  449 ARG A CB    1 
ATOM   2227 C  CG    . ARG A 1  309 ? -10.327 -12.167 -23.351 1.00 23.61 ?  449 ARG A CG    1 
ATOM   2228 C  CD    . ARG A 1  309 ? -9.457  -11.081 -23.964 1.00 22.97 ?  449 ARG A CD    1 
ATOM   2229 N  NE    . ARG A 1  309 ? -9.740  -9.757  -23.414 1.00 29.72 ?  449 ARG A NE    1 
ATOM   2230 C  CZ    . ARG A 1  309 ? -10.532 -8.847  -23.980 1.00 34.04 ?  449 ARG A CZ    1 
ATOM   2231 N  NH1   . ARG A 1  309 ? -11.139 -9.088  -25.134 1.00 36.79 ?  449 ARG A NH1   1 
ATOM   2232 N  NH2   . ARG A 1  309 ? -10.716 -7.678  -23.385 1.00 36.88 ?  449 ARG A NH2   1 
ATOM   2233 N  N     . LYS A 1  310 ? -9.631  -15.535 -21.856 1.00 15.05 ?  450 LYS A N     1 
ATOM   2234 C  CA    . LYS A 1  310 ? -9.376  -16.694 -22.707 1.00 19.27 ?  450 LYS A CA    1 
ATOM   2235 C  C     . LYS A 1  310 ? -10.124 -17.937 -22.238 1.00 18.98 ?  450 LYS A C     1 
ATOM   2236 O  O     . LYS A 1  310 ? -10.575 -18.736 -23.065 1.00 18.61 ?  450 LYS A O     1 
ATOM   2237 C  CB    . LYS A 1  310 ? -7.874  -16.986 -22.765 1.00 20.74 ?  450 LYS A CB    1 
ATOM   2238 C  CG    . LYS A 1  310 ? -7.020  -15.832 -23.268 1.00 33.19 ?  450 LYS A CG    1 
ATOM   2239 C  CD    . LYS A 1  310 ? -7.521  -15.282 -24.596 1.00 36.58 ?  450 LYS A CD    1 
ATOM   2240 C  CE    . LYS A 1  310 ? -6.613  -14.179 -25.108 1.00 34.79 ?  450 LYS A CE    1 
ATOM   2241 N  NZ    . LYS A 1  310 ? -7.212  -13.481 -26.276 1.00 38.19 ?  450 LYS A NZ    1 
ATOM   2242 N  N     . GLU A 1  311 ? -10.259 -18.131 -20.927 1.00 17.76 ?  451 GLU A N     1 
ATOM   2243 C  CA    . GLU A 1  311 ? -10.881 -19.344 -20.408 1.00 18.08 ?  451 GLU A CA    1 
ATOM   2244 C  C     . GLU A 1  311 ? -12.355 -19.174 -20.075 1.00 25.53 ?  451 GLU A C     1 
ATOM   2245 O  O     . GLU A 1  311 ? -13.104 -20.154 -20.138 1.00 23.41 ?  451 GLU A O     1 
ATOM   2246 C  CB    . GLU A 1  311 ? -10.138 -19.828 -19.157 1.00 16.54 ?  451 GLU A CB    1 
ATOM   2247 C  CG    . GLU A 1  311 ? -8.644  -20.026 -19.365 1.00 14.43 ?  451 GLU A CG    1 
ATOM   2248 C  CD    . GLU A 1  311 ? -8.333  -21.006 -20.483 1.00 25.39 ?  451 GLU A CD    1 
ATOM   2249 O  OE1   . GLU A 1  311 ? -9.130  -21.943 -20.694 1.00 24.25 ?  451 GLU A OE1   1 
ATOM   2250 O  OE2   . GLU A 1  311 ? -7.296  -20.833 -21.154 1.00 23.66 ?  451 GLU A OE2   1 
ATOM   2251 N  N     . LYS A 1  312 ? -12.795 -17.957 -19.743 1.00 20.16 ?  452 LYS A N     1 
ATOM   2252 C  CA    . LYS A 1  312 ? -14.165 -17.715 -19.317 1.00 16.31 ?  452 LYS A CA    1 
ATOM   2253 C  C     . LYS A 1  312 ? -14.946 -16.784 -20.234 1.00 23.31 ?  452 LYS A C     1 
ATOM   2254 O  O     . LYS A 1  312 ? -16.156 -16.626 -20.034 1.00 26.18 ?  452 LYS A O     1 
ATOM   2255 C  CB    . LYS A 1  312 ? -14.179 -17.134 -17.893 1.00 19.31 ?  452 LYS A CB    1 
ATOM   2256 C  CG    . LYS A 1  312 ? -13.471 -18.006 -16.866 1.00 19.28 ?  452 LYS A CG    1 
ATOM   2257 C  CD    . LYS A 1  312 ? -14.194 -19.322 -16.650 1.00 22.62 ?  452 LYS A CD    1 
ATOM   2258 C  CE    . LYS A 1  312 ? -13.349 -20.293 -15.852 1.00 29.94 ?  452 LYS A CE    1 
ATOM   2259 N  NZ    . LYS A 1  312 ? -14.116 -21.512 -15.485 1.00 27.63 ?  452 LYS A NZ    1 
ATOM   2260 N  N     . GLY A 1  313 ? -14.307 -16.167 -21.224 1.00 21.66 ?  453 GLY A N     1 
ATOM   2261 C  CA    . GLY A 1  313 ? -15.008 -15.242 -22.090 1.00 22.72 ?  453 GLY A CA    1 
ATOM   2262 C  C     . GLY A 1  313 ? -15.497 -13.981 -21.414 1.00 23.39 ?  453 GLY A C     1 
ATOM   2263 O  O     . GLY A 1  313 ? -16.440 -13.355 -21.904 1.00 20.16 ?  453 GLY A O     1 
ATOM   2264 N  N     . LEU A 1  314 ? -14.879 -13.582 -20.305 1.00 18.62 ?  454 LEU A N     1 
ATOM   2265 C  CA    . LEU A 1  314 ? -15.260 -12.381 -19.575 1.00 18.48 ?  454 LEU A CA    1 
ATOM   2266 C  C     . LEU A 1  314 ? -14.109 -11.384 -19.591 1.00 18.53 ?  454 LEU A C     1 
ATOM   2267 O  O     . LEU A 1  314 ? -12.936 -11.766 -19.585 1.00 18.01 ?  454 LEU A O     1 
ATOM   2268 C  CB    . LEU A 1  314 ? -15.644 -12.719 -18.129 1.00 17.48 ?  454 LEU A CB    1 
ATOM   2269 C  CG    . LEU A 1  314 ? -16.715 -13.800 -17.970 1.00 19.93 ?  454 LEU A CG    1 
ATOM   2270 C  CD1   . LEU A 1  314 ? -16.931 -14.126 -16.499 1.00 21.65 ?  454 LEU A CD1   1 
ATOM   2271 C  CD2   . LEU A 1  314 ? -18.031 -13.380 -18.626 1.00 17.26 ?  454 LEU A CD2   1 
ATOM   2272 N  N     . TRP A 1  315 ? -14.451 -10.097 -19.615 1.00 15.52 ?  455 TRP A N     1 
ATOM   2273 C  CA    . TRP A 1  315 ? -13.465 -9.024  -19.710 1.00 14.55 ?  455 TRP A CA    1 
ATOM   2274 C  C     . TRP A 1  315 ? -13.318 -8.377  -18.338 1.00 18.50 ?  455 TRP A C     1 
ATOM   2275 O  O     . TRP A 1  315 ? -14.265 -7.771  -17.823 1.00 13.33 ?  455 TRP A O     1 
ATOM   2276 C  CB    . TRP A 1  315 ? -13.876 -7.994  -20.761 1.00 17.94 ?  455 TRP A CB    1 
ATOM   2277 C  CG    . TRP A 1  315 ? -14.025 -8.564  -22.135 1.00 21.14 ?  455 TRP A CG    1 
ATOM   2278 C  CD1   . TRP A 1  315 ? -13.659 -9.810  -22.551 1.00 21.09 ?  455 TRP A CD1   1 
ATOM   2279 C  CD2   . TRP A 1  315 ? -14.591 -7.909  -23.277 1.00 26.12 ?  455 TRP A CD2   1 
ATOM   2280 N  NE1   . TRP A 1  315 ? -13.959 -9.972  -23.882 1.00 28.07 ?  455 TRP A NE1   1 
ATOM   2281 C  CE2   . TRP A 1  315 ? -14.532 -8.819  -24.351 1.00 28.83 ?  455 TRP A CE2   1 
ATOM   2282 C  CE3   . TRP A 1  315 ? -15.140 -6.642  -23.496 1.00 30.75 ?  455 TRP A CE3   1 
ATOM   2283 C  CZ2   . TRP A 1  315 ? -15.001 -8.502  -25.624 1.00 33.85 ?  455 TRP A CZ2   1 
ATOM   2284 C  CZ3   . TRP A 1  315 ? -15.605 -6.330  -24.761 1.00 34.55 ?  455 TRP A CZ3   1 
ATOM   2285 C  CH2   . TRP A 1  315 ? -15.532 -7.256  -25.808 1.00 31.46 ?  455 TRP A CH2   1 
ATOM   2286 N  N     . LEU A 1  316 ? -12.129 -8.500  -17.755 1.00 15.77 ?  456 LEU A N     1 
ATOM   2287 C  CA    . LEU A 1  316 ? -11.852 -8.029  -16.408 1.00 11.02 ?  456 LEU A CA    1 
ATOM   2288 C  C     . LEU A 1  316 ? -10.946 -6.807  -16.457 1.00 11.56 ?  456 LEU A C     1 
ATOM   2289 O  O     . LEU A 1  316 ? -9.969  -6.778  -17.209 1.00 13.58 ?  456 LEU A O     1 
ATOM   2290 C  CB    . LEU A 1  316 ? -11.186 -9.132  -15.576 1.00 10.27 ?  456 LEU A CB    1 
ATOM   2291 C  CG    . LEU A 1  316 ? -10.737 -8.761  -14.161 1.00 10.27 ?  456 LEU A CG    1 
ATOM   2292 C  CD1   . LEU A 1  316 ? -11.938 -8.507  -13.257 1.00 9.27  ?  456 LEU A CD1   1 
ATOM   2293 C  CD2   . LEU A 1  316 ? -9.842  -9.852  -13.584 1.00 8.68  ?  456 LEU A CD2   1 
ATOM   2294 N  N     . ASN A 1  317 ? -11.266 -5.805  -15.644 1.00 11.62 ?  457 ASN A N     1 
ATOM   2295 C  CA    . ASN A 1  317 ? -10.368 -4.680  -15.422 1.00 10.99 ?  457 ASN A CA    1 
ATOM   2296 C  C     . ASN A 1  317 ? -10.599 -4.166  -14.004 1.00 14.14 ?  457 ASN A C     1 
ATOM   2297 O  O     . ASN A 1  317 ? -11.351 -4.762  -13.225 1.00 14.33 ?  457 ASN A O     1 
ATOM   2298 C  CB    . ASN A 1  317 ? -10.563 -3.603  -16.502 1.00 13.64 ?  457 ASN A CB    1 
ATOM   2299 C  CG    . ASN A 1  317 ? -11.955 -3.002  -16.497 1.00 15.81 ?  457 ASN A CG    1 
ATOM   2300 O  OD1   . ASN A 1  317 ? -12.624 -2.954  -15.467 1.00 17.69 ?  457 ASN A OD1   1 
ATOM   2301 N  ND2   . ASN A 1  317 ? -12.395 -2.523  -17.661 1.00 16.06 ?  457 ASN A ND2   1 
ATOM   2302 N  N     A SER A 1  318 ? -9.948  -3.053  -13.667 0.39 13.30 ?  458 SER A N     1 
ATOM   2303 N  N     B SER A 1  318 ? -9.945  -3.054  -13.662 0.61 13.35 ?  458 SER A N     1 
ATOM   2304 C  CA    A SER A 1  318 ? -10.059 -2.496  -12.324 0.39 12.71 ?  458 SER A CA    1 
ATOM   2305 C  CA    B SER A 1  318 ? -10.063 -2.504  -12.315 0.61 12.02 ?  458 SER A CA    1 
ATOM   2306 C  C     A SER A 1  318 ? -11.408 -1.839  -12.064 0.39 15.75 ?  458 SER A C     1 
ATOM   2307 C  C     B SER A 1  318 ? -11.398 -1.816  -12.071 0.61 16.39 ?  458 SER A C     1 
ATOM   2308 O  O     A SER A 1  318 ? -11.635 -1.366  -10.944 0.39 14.36 ?  458 SER A O     1 
ATOM   2309 O  O     B SER A 1  318 ? -11.607 -1.296  -10.968 0.61 14.59 ?  458 SER A O     1 
ATOM   2310 C  CB    A SER A 1  318 ? -8.937  -1.483  -12.088 0.39 13.96 ?  458 SER A CB    1 
ATOM   2311 C  CB    B SER A 1  318 ? -8.918  -1.525  -12.043 0.61 13.74 ?  458 SER A CB    1 
ATOM   2312 O  OG    A SER A 1  318 ? -7.670  -2.078  -12.308 0.39 15.92 ?  458 SER A OG    1 
ATOM   2313 O  OG    B SER A 1  318 ? -8.996  -0.387  -12.883 0.61 13.88 ?  458 SER A OG    1 
ATOM   2314 N  N     . HIS A 1  319 ? -12.299 -1.803  -13.058 1.00 13.42 ?  459 HIS A N     1 
ATOM   2315 C  CA    . HIS A 1  319 ? -13.627 -1.224  -12.899 1.00 13.26 ?  459 HIS A CA    1 
ATOM   2316 C  C     . HIS A 1  319 ? -14.730 -2.260  -12.746 1.00 16.85 ?  459 HIS A C     1 
ATOM   2317 O  O     . HIS A 1  319 ? -15.786 -1.931  -12.200 1.00 19.00 ?  459 HIS A O     1 
ATOM   2318 C  CB    . HIS A 1  319 ? -13.979 -0.338  -14.105 1.00 16.29 ?  459 HIS A CB    1 
ATOM   2319 C  CG    . HIS A 1  319 ? -13.106 0.866   -14.262 1.00 27.12 ?  459 HIS A CG    1 
ATOM   2320 N  ND1   . HIS A 1  319 ? -12.573 1.550   -13.191 1.00 32.17 ?  459 HIS A ND1   1 
ATOM   2321 C  CD2   . HIS A 1  319 ? -12.682 1.516   -15.372 1.00 35.44 ?  459 HIS A CD2   1 
ATOM   2322 C  CE1   . HIS A 1  319 ? -11.853 2.565   -13.634 1.00 37.15 ?  459 HIS A CE1   1 
ATOM   2323 N  NE2   . HIS A 1  319 ? -11.903 2.567   -14.954 1.00 40.93 ?  459 HIS A NE2   1 
ATOM   2324 N  N     . GLY A 1  320 ? -14.532 -3.477  -13.233 1.00 15.29 ?  460 GLY A N     1 
ATOM   2325 C  CA    . GLY A 1  320 ? -15.615 -4.436  -13.267 1.00 16.74 ?  460 GLY A CA    1 
ATOM   2326 C  C     . GLY A 1  320 ? -15.250 -5.646  -14.095 1.00 17.18 ?  460 GLY A C     1 
ATOM   2327 O  O     . GLY A 1  320 ? -14.117 -5.803  -14.564 1.00 14.47 ?  460 GLY A O     1 
ATOM   2328 N  N     . LEU A 1  321 ? -16.249 -6.508  -14.258 1.00 14.81 ?  461 LEU A N     1 
ATOM   2329 C  CA    . LEU A 1  321 ? -16.124 -7.748  -15.012 1.00 15.31 ?  461 LEU A CA    1 
ATOM   2330 C  C     . LEU A 1  321 ? -17.291 -7.819  -15.982 1.00 14.07 ?  461 LEU A C     1 
ATOM   2331 O  O     . LEU A 1  321 ? -18.450 -7.824  -15.557 1.00 18.35 ?  461 LEU A O     1 
ATOM   2332 C  CB    . LEU A 1  321 ? -16.122 -8.955  -14.074 1.00 12.79 ?  461 LEU A CB    1 
ATOM   2333 C  CG    . LEU A 1  321 ? -15.982 -10.340 -14.703 1.00 17.76 ?  461 LEU A CG    1 
ATOM   2334 C  CD1   . LEU A 1  321 ? -14.724 -10.446 -15.542 1.00 13.69 ?  461 LEU A CD1   1 
ATOM   2335 C  CD2   . LEU A 1  321 ? -15.984 -11.391 -13.603 1.00 13.62 ?  461 LEU A CD2   1 
ATOM   2336 N  N     . PHE A 1  322 ? -16.987 -7.876  -17.275 1.00 17.06 ?  462 PHE A N     1 
ATOM   2337 C  CA    . PHE A 1  322 ? -17.976 -7.673  -18.325 1.00 19.75 ?  462 PHE A CA    1 
ATOM   2338 C  C     . PHE A 1  322 ? -18.204 -8.960  -19.108 1.00 24.11 ?  462 PHE A C     1 
ATOM   2339 O  O     . PHE A 1  322 ? -17.248 -9.595  -19.565 1.00 20.61 ?  462 PHE A O     1 
ATOM   2340 C  CB    . PHE A 1  322 ? -17.521 -6.552  -19.263 1.00 17.52 ?  462 PHE A CB    1 
ATOM   2341 C  CG    . PHE A 1  322 ? -18.529 -6.184  -20.311 1.00 20.19 ?  462 PHE A CG    1 
ATOM   2342 C  CD1   . PHE A 1  322 ? -19.731 -5.588  -19.963 1.00 25.43 ?  462 PHE A CD1   1 
ATOM   2343 C  CD2   . PHE A 1  322 ? -18.263 -6.413  -21.649 1.00 25.80 ?  462 PHE A CD2   1 
ATOM   2344 C  CE1   . PHE A 1  322 ? -20.653 -5.242  -20.932 1.00 24.65 ?  462 PHE A CE1   1 
ATOM   2345 C  CE2   . PHE A 1  322 ? -19.178 -6.063  -22.622 1.00 28.94 ?  462 PHE A CE2   1 
ATOM   2346 C  CZ    . PHE A 1  322 ? -20.374 -5.480  -22.263 1.00 26.62 ?  462 PHE A CZ    1 
ATOM   2347 N  N     . ASP A 1  323 ? -19.471 -9.338  -19.254 1.00 20.30 ?  463 ASP A N     1 
ATOM   2348 C  CA    . ASP A 1  323 ? -19.884 -10.441 -20.110 1.00 25.97 ?  463 ASP A CA    1 
ATOM   2349 C  C     . ASP A 1  323 ? -20.229 -9.869  -21.480 1.00 29.10 ?  463 ASP A C     1 
ATOM   2350 O  O     . ASP A 1  323 ? -21.286 -9.245  -21.636 1.00 30.68 ?  463 ASP A O     1 
ATOM   2351 C  CB    . ASP A 1  323 ? -21.082 -11.178 -19.504 1.00 26.21 ?  463 ASP A CB    1 
ATOM   2352 C  CG    . ASP A 1  323 ? -21.515 -12.387 -20.327 1.00 34.49 ?  463 ASP A CG    1 
ATOM   2353 O  OD1   . ASP A 1  323 ? -21.274 -12.409 -21.552 1.00 31.70 ?  463 ASP A OD1   1 
ATOM   2354 O  OD2   . ASP A 1  323 ? -22.107 -13.319 -19.743 1.00 33.67 ?  463 ASP A OD2   1 
ATOM   2355 N  N     . PRO A 1  324 ? -19.376 -10.052 -22.494 1.00 24.75 ?  464 PRO A N     1 
ATOM   2356 C  CA    . PRO A 1  324 ? -19.628 -9.388  -23.783 1.00 27.62 ?  464 PRO A CA    1 
ATOM   2357 C  C     . PRO A 1  324 ? -20.759 -10.009 -24.578 1.00 34.95 ?  464 PRO A C     1 
ATOM   2358 O  O     . PRO A 1  324 ? -21.239 -9.378  -25.528 1.00 39.59 ?  464 PRO A O     1 
ATOM   2359 C  CB    . PRO A 1  324 ? -18.288 -9.529  -24.515 1.00 31.34 ?  464 PRO A CB    1 
ATOM   2360 C  CG    . PRO A 1  324 ? -17.716 -10.799 -23.981 1.00 25.88 ?  464 PRO A CG    1 
ATOM   2361 C  CD    . PRO A 1  324 ? -18.175 -10.907 -22.543 1.00 28.06 ?  464 PRO A CD    1 
ATOM   2362 N  N     . GLU A 1  325 ? -21.196 -11.220 -24.228 1.00 38.14 ?  465 GLU A N     1 
ATOM   2363 C  CA    . GLU A 1  325 ? -22.339 -11.831 -24.898 1.00 39.00 ?  465 GLU A CA    1 
ATOM   2364 C  C     . GLU A 1  325 ? -23.651 -11.274 -24.357 1.00 46.35 ?  465 GLU A C     1 
ATOM   2365 O  O     . GLU A 1  325 ? -24.486 -10.777 -25.120 1.00 56.39 ?  465 GLU A O     1 
ATOM   2366 C  CB    . GLU A 1  325 ? -22.291 -13.352 -24.732 1.00 37.87 ?  465 GLU A CB    1 
ATOM   2367 N  N     . GLN A 1  326 ? -23.846 -11.344 -23.040 1.00 45.33 ?  466 GLN A N     1 
ATOM   2368 C  CA    . GLN A 1  326 ? -25.037 -10.785 -22.418 1.00 37.48 ?  466 GLN A CA    1 
ATOM   2369 C  C     . GLN A 1  326 ? -24.961 -9.273  -22.249 1.00 39.84 ?  466 GLN A C     1 
ATOM   2370 O  O     . GLN A 1  326 ? -25.969 -8.659  -21.884 1.00 42.38 ?  466 GLN A O     1 
ATOM   2371 C  CB    . GLN A 1  326 ? -25.272 -11.440 -21.054 1.00 37.46 ?  466 GLN A CB    1 
ATOM   2372 N  N     . LYS A 1  327 ? -23.808 -8.661  -22.513 1.00 32.74 ?  467 LYS A N     1 
ATOM   2373 C  CA    . LYS A 1  327 ? -23.629 -7.220  -22.346 1.00 33.79 ?  467 LYS A CA    1 
ATOM   2374 C  C     . LYS A 1  327 ? -24.031 -6.784  -20.938 1.00 32.31 ?  467 LYS A C     1 
ATOM   2375 O  O     . LYS A 1  327 ? -24.828 -5.865  -20.744 1.00 33.61 ?  467 LYS A O     1 
ATOM   2376 C  CB    . LYS A 1  327 ? -24.416 -6.445  -23.406 1.00 38.41 ?  467 LYS A CB    1 
ATOM   2377 C  CG    . LYS A 1  327 ? -23.955 -6.701  -24.832 1.00 37.36 ?  467 LYS A CG    1 
ATOM   2378 N  N     . THR A 1  328 ? -23.463 -7.460  -19.942 1.00 26.27 ?  468 THR A N     1 
ATOM   2379 C  CA    . THR A 1  328 ? -23.762 -7.189  -18.545 1.00 26.93 ?  468 THR A CA    1 
ATOM   2380 C  C     . THR A 1  328 ? -22.474 -7.136  -17.737 1.00 24.54 ?  468 THR A C     1 
ATOM   2381 O  O     . THR A 1  328 ? -21.470 -7.757  -18.092 1.00 29.00 ?  468 THR A O     1 
ATOM   2382 C  CB    . THR A 1  328 ? -24.692 -8.257  -17.949 1.00 27.49 ?  468 THR A CB    1 
ATOM   2383 O  OG1   . THR A 1  328 ? -24.124 -9.555  -18.152 1.00 35.77 ?  468 THR A OG1   1 
ATOM   2384 C  CG2   . THR A 1  328 ? -26.061 -8.204  -18.599 1.00 28.94 ?  468 THR A CG2   1 
ATOM   2385 N  N     . PHE A 1  329 ? -22.517 -6.376  -16.648 1.00 21.35 ?  469 PHE A N     1 
ATOM   2386 C  CA    . PHE A 1  329 ? -21.427 -6.301  -15.689 1.00 21.50 ?  469 PHE A CA    1 
ATOM   2387 C  C     . PHE A 1  329 ? -21.789 -7.103  -14.448 1.00 24.54 ?  469 PHE A C     1 
ATOM   2388 O  O     . PHE A 1  329 ? -22.912 -7.011  -13.943 1.00 26.35 ?  469 PHE A O     1 
ATOM   2389 C  CB    . PHE A 1  329 ? -21.141 -4.852  -15.288 1.00 25.35 ?  469 PHE A CB    1 
ATOM   2390 C  CG    . PHE A 1  329 ? -20.461 -4.044  -16.351 1.00 28.72 ?  469 PHE A CG    1 
ATOM   2391 C  CD1   . PHE A 1  329 ? -19.078 -4.021  -16.445 1.00 27.69 ?  469 PHE A CD1   1 
ATOM   2392 C  CD2   . PHE A 1  329 ? -21.201 -3.289  -17.244 1.00 30.24 ?  469 PHE A CD2   1 
ATOM   2393 C  CE1   . PHE A 1  329 ? -18.448 -3.271  -17.417 1.00 23.01 ?  469 PHE A CE1   1 
ATOM   2394 C  CE2   . PHE A 1  329 ? -20.576 -2.536  -18.220 1.00 24.77 ?  469 PHE A CE2   1 
ATOM   2395 C  CZ    . PHE A 1  329 ? -19.198 -2.526  -18.305 1.00 25.80 ?  469 PHE A CZ    1 
ATOM   2396 N  N     A PHE A 1  330 ? -20.839 -7.901  -13.971 0.51 19.40 ?  470 PHE A N     1 
ATOM   2397 N  N     B PHE A 1  330 ? -20.829 -7.869  -13.940 0.49 19.45 ?  470 PHE A N     1 
ATOM   2398 C  CA    A PHE A 1  330 ? -21.034 -8.627  -12.725 0.51 19.39 ?  470 PHE A CA    1 
ATOM   2399 C  CA    B PHE A 1  330 ? -21.047 -8.647  -12.727 0.49 19.38 ?  470 PHE A CA    1 
ATOM   2400 C  C     A PHE A 1  330 ? -20.917 -7.666  -11.552 0.51 21.17 ?  470 PHE A C     1 
ATOM   2401 C  C     B PHE A 1  330 ? -20.872 -7.753  -11.505 0.49 21.09 ?  470 PHE A C     1 
ATOM   2402 O  O     A PHE A 1  330 ? -19.963 -6.888  -11.465 0.51 24.69 ?  470 PHE A O     1 
ATOM   2403 O  O     B PHE A 1  330 ? -19.829 -7.112  -11.339 0.49 25.37 ?  470 PHE A O     1 
ATOM   2404 C  CB    A PHE A 1  330 ? -20.008 -9.749  -12.584 0.51 19.01 ?  470 PHE A CB    1 
ATOM   2405 C  CB    B PHE A 1  330 ? -20.086 -9.831  -12.668 0.49 19.78 ?  470 PHE A CB    1 
ATOM   2406 C  CG    A PHE A 1  330 ? -20.144 -10.831 -13.614 0.51 21.40 ?  470 PHE A CG    1 
ATOM   2407 C  CG    B PHE A 1  330 ? -20.038 -10.504 -11.325 0.49 17.37 ?  470 PHE A CG    1 
ATOM   2408 C  CD1   A PHE A 1  330 ? -19.665 -10.647 -14.900 0.51 16.98 ?  470 PHE A CD1   1 
ATOM   2409 C  CD1   B PHE A 1  330 ? -21.102 -11.270 -10.883 0.49 17.50 ?  470 PHE A CD1   1 
ATOM   2410 C  CD2   A PHE A 1  330 ? -20.739 -12.039 -13.291 0.51 23.60 ?  470 PHE A CD2   1 
ATOM   2411 C  CD2   B PHE A 1  330 ? -18.927 -10.371 -10.506 0.49 19.58 ?  470 PHE A CD2   1 
ATOM   2412 C  CE1   A PHE A 1  330 ? -19.786 -11.641 -15.847 0.51 18.90 ?  470 PHE A CE1   1 
ATOM   2413 C  CE1   B PHE A 1  330 ? -21.064 -11.890 -9.648  0.49 17.03 ?  470 PHE A CE1   1 
ATOM   2414 C  CE2   A PHE A 1  330 ? -20.862 -13.039 -14.235 0.51 26.83 ?  470 PHE A CE2   1 
ATOM   2415 C  CE2   B PHE A 1  330 ? -18.882 -10.989 -9.271  0.49 17.60 ?  470 PHE A CE2   1 
ATOM   2416 C  CZ    A PHE A 1  330 ? -20.384 -12.839 -15.516 0.51 21.88 ?  470 PHE A CZ    1 
ATOM   2417 C  CZ    B PHE A 1  330 ? -19.953 -11.749 -8.841  0.49 18.32 ?  470 PHE A CZ    1 
ATOM   2418 N  N     . GLN A 1  331 ? -21.892 -7.710  -10.653 1.00 18.00 ?  471 GLN A N     1 
ATOM   2419 C  CA    . GLN A 1  331 ? -21.827 -6.937  -9.423  1.00 25.73 ?  471 GLN A CA    1 
ATOM   2420 C  C     . GLN A 1  331 ? -21.059 -7.750  -8.393  1.00 28.80 ?  471 GLN A C     1 
ATOM   2421 O  O     . GLN A 1  331 ? -21.408 -8.902  -8.114  1.00 42.57 ?  471 GLN A O     1 
ATOM   2422 C  CB    . GLN A 1  331 ? -23.223 -6.584  -8.914  1.00 36.89 ?  471 GLN A CB    1 
ATOM   2423 C  CG    . GLN A 1  331 ? -24.058 -5.770  -9.893  1.00 49.84 ?  471 GLN A CG    1 
ATOM   2424 C  CD    . GLN A 1  331 ? -23.333 -4.534  -10.399 1.00 61.85 ?  471 GLN A CD    1 
ATOM   2425 O  OE1   . GLN A 1  331 ? -22.758 -3.772  -9.620  1.00 68.20 ?  471 GLN A OE1   1 
ATOM   2426 N  NE2   . GLN A 1  331 ? -23.348 -4.337  -11.714 1.00 61.36 ?  471 GLN A NE2   1 
ATOM   2427 N  N     . ALA A 1  332 ? -19.999 -7.166  -7.858  1.00 19.13 ?  472 ALA A N     1 
ATOM   2428 C  CA    . ALA A 1  332 ? -19.186 -7.815  -6.846  1.00 14.86 ?  472 ALA A CA    1 
ATOM   2429 C  C     . ALA A 1  332 ? -19.216 -6.987  -5.575  1.00 15.18 ?  472 ALA A C     1 
ATOM   2430 O  O     . ALA A 1  332 ? -19.098 -5.758  -5.619  1.00 16.08 ?  472 ALA A O     1 
ATOM   2431 C  CB    . ALA A 1  332 ? -17.742 -7.987  -7.320  1.00 9.87  ?  472 ALA A CB    1 
ATOM   2432 N  N     . ALA A 1  333 ? -19.388 -7.669  -4.445  1.00 14.70 ?  473 ALA A N     1 
ATOM   2433 C  CA    . ALA A 1  333 ? -19.290 -7.035  -3.143  1.00 15.14 ?  473 ALA A CA    1 
ATOM   2434 C  C     . ALA A 1  333 ? -17.949 -7.286  -2.468  1.00 14.92 ?  473 ALA A C     1 
ATOM   2435 O  O     . ALA A 1  333 ? -17.688 -6.703  -1.411  1.00 12.61 ?  473 ALA A O     1 
ATOM   2436 C  CB    . ALA A 1  333 ? -20.416 -7.528  -2.227  1.00 18.75 ?  473 ALA A CB    1 
ATOM   2437 N  N     . SER A 1  334 ? -17.097 -8.119  -3.059  1.00 12.56 ?  474 SER A N     1 
ATOM   2438 C  CA    . SER A 1  334 ? -15.853 -8.526  -2.426  1.00 13.83 ?  474 SER A CA    1 
ATOM   2439 C  C     . SER A 1  334 ? -14.936 -9.122  -3.483  1.00 9.67  ?  474 SER A C     1 
ATOM   2440 O  O     . SER A 1  334 ? -15.375 -9.515  -4.567  1.00 9.71  ?  474 SER A O     1 
ATOM   2441 C  CB    . SER A 1  334 ? -16.105 -9.551  -1.311  1.00 10.93 ?  474 SER A CB    1 
ATOM   2442 O  OG    . SER A 1  334 ? -16.606 -10.767 -1.850  1.00 13.61 ?  474 SER A OG    1 
ATOM   2443 N  N     . GLU A 1  335 ? -13.649 -9.199  -3.144  1.00 10.42 ?  475 GLU A N     1 
ATOM   2444 C  CA    . GLU A 1  335 ? -12.729 -9.962  -3.976  1.00 7.45  ?  475 GLU A CA    1 
ATOM   2445 C  C     . GLU A 1  335 ? -13.158 -11.421 -4.053  1.00 12.13 ?  475 GLU A C     1 
ATOM   2446 O  O     . GLU A 1  335 ? -13.086 -12.041 -5.120  1.00 9.49  ?  475 GLU A O     1 
ATOM   2447 C  CB    . GLU A 1  335 ? -11.307 -9.845  -3.434  1.00 7.09  ?  475 GLU A CB    1 
ATOM   2448 C  CG    . GLU A 1  335 ? -10.728 -8.449  -3.529  1.00 9.46  ?  475 GLU A CG    1 
ATOM   2449 C  CD    . GLU A 1  335 ? -9.286  -8.396  -3.078  1.00 13.61 ?  475 GLU A CD    1 
ATOM   2450 O  OE1   . GLU A 1  335 ? -8.982  -8.986  -2.024  1.00 8.27  ?  475 GLU A OE1   1 
ATOM   2451 O  OE2   . GLU A 1  335 ? -8.456  -7.784  -3.786  1.00 12.31 ?  475 GLU A OE2   1 
ATOM   2452 N  N     . GLU A 1  336 ? -13.621 -11.985 -2.934  1.00 10.17 ?  476 GLU A N     1 
ATOM   2453 C  CA    . GLU A 1  336 ? -14.127 -13.354 -2.949  1.00 12.01 ?  476 GLU A CA    1 
ATOM   2454 C  C     . GLU A 1  336 ? -15.186 -13.542 -4.028  1.00 10.74 ?  476 GLU A C     1 
ATOM   2455 O  O     . GLU A 1  336 ? -15.192 -14.562 -4.729  1.00 10.83 ?  476 GLU A O     1 
ATOM   2456 C  CB    . GLU A 1  336 ? -14.696 -13.722 -1.578  1.00 16.03 ?  476 GLU A CB    1 
ATOM   2457 C  CG    . GLU A 1  336 ? -13.639 -13.907 -0.497  1.00 16.39 ?  476 GLU A CG    1 
ATOM   2458 C  CD    . GLU A 1  336 ? -14.206 -14.528 0.766   1.00 17.54 ?  476 GLU A CD    1 
ATOM   2459 O  OE1   . GLU A 1  336 ? -14.177 -13.868 1.825   1.00 14.53 ?  476 GLU A OE1   1 
ATOM   2460 O  OE2   . GLU A 1  336 ? -14.684 -15.680 0.699   1.00 8.98  ?  476 GLU A OE2   1 
ATOM   2461 N  N     . ASP A 1  337 ? -16.095 -12.570 -4.172  1.00 11.80 ?  477 ASP A N     1 
ATOM   2462 C  CA    . ASP A 1  337 ? -17.091 -12.636 -5.239  1.00 10.72 ?  477 ASP A CA    1 
ATOM   2463 C  C     . ASP A 1  337 ? -16.430 -12.792 -6.599  1.00 14.77 ?  477 ASP A C     1 
ATOM   2464 O  O     . ASP A 1  337 ? -16.893 -13.576 -7.436  1.00 12.42 ?  477 ASP A O     1 
ATOM   2465 C  CB    . ASP A 1  337 ? -17.960 -11.377 -5.251  1.00 13.86 ?  477 ASP A CB    1 
ATOM   2466 C  CG    . ASP A 1  337 ? -19.280 -11.552 -4.525  1.00 16.03 ?  477 ASP A CG    1 
ATOM   2467 O  OD1   . ASP A 1  337 ? -19.615 -12.680 -4.107  1.00 15.91 ?  477 ASP A OD1   1 
ATOM   2468 O  OD2   . ASP A 1  337 ? -19.993 -10.538 -4.384  1.00 15.40 ?  477 ASP A OD2   1 
ATOM   2469 N  N     . ILE A 1  338 ? -15.356 -12.037 -6.843  1.00 12.30 ?  478 ILE A N     1 
ATOM   2470 C  CA    . ILE A 1  338 ? -14.754 -12.006 -8.172  1.00 9.07  ?  478 ILE A CA    1 
ATOM   2471 C  C     . ILE A 1  338 ? -14.097 -13.343 -8.488  1.00 14.74 ?  478 ILE A C     1 
ATOM   2472 O  O     . ILE A 1  338 ? -14.275 -13.896 -9.579  1.00 12.64 ?  478 ILE A O     1 
ATOM   2473 C  CB    . ILE A 1  338 ? -13.754 -10.841 -8.280  1.00 12.06 ?  478 ILE A CB    1 
ATOM   2474 C  CG1   . ILE A 1  338 ? -14.480 -9.517  -8.028  1.00 10.97 ?  478 ILE A CG1   1 
ATOM   2475 C  CG2   . ILE A 1  338 ? -13.091 -10.838 -9.657  1.00 10.43 ?  478 ILE A CG2   1 
ATOM   2476 C  CD1   . ILE A 1  338 ? -13.580 -8.307  -7.923  1.00 9.01  ?  478 ILE A CD1   1 
ATOM   2477 N  N     . PHE A 1  339 ? -13.317 -13.875 -7.545  1.00 11.28 ?  479 PHE A N     1 
ATOM   2478 C  CA    . PHE A 1  339 ? -12.750 -15.206 -7.730  1.00 8.86  ?  479 PHE A CA    1 
ATOM   2479 C  C     . PHE A 1  339 ? -13.843 -16.227 -8.011  1.00 12.21 ?  479 PHE A C     1 
ATOM   2480 O  O     . PHE A 1  339 ? -13.707 -17.065 -8.913  1.00 12.82 ?  479 PHE A O     1 
ATOM   2481 C  CB    . PHE A 1  339 ? -11.947 -15.612 -6.496  1.00 8.35  ?  479 PHE A CB    1 
ATOM   2482 C  CG    . PHE A 1  339 ? -10.565 -15.031 -6.452  1.00 10.53 ?  479 PHE A CG    1 
ATOM   2483 C  CD1   . PHE A 1  339 ? -10.328 -13.811 -5.845  1.00 12.74 ?  479 PHE A CD1   1 
ATOM   2484 C  CD2   . PHE A 1  339 ? -9.497  -15.717 -7.000  1.00 9.18  ?  479 PHE A CD2   1 
ATOM   2485 C  CE1   . PHE A 1  339 ? -9.049  -13.281 -5.793  1.00 15.23 ?  479 PHE A CE1   1 
ATOM   2486 C  CE2   . PHE A 1  339 ? -8.214  -15.189 -6.952  1.00 10.21 ?  479 PHE A CE2   1 
ATOM   2487 C  CZ    . PHE A 1  339 ? -7.995  -13.971 -6.350  1.00 6.51  ?  479 PHE A CZ    1 
ATOM   2488 N  N     . ARG A 1  340 ? -14.944 -16.167 -7.254  1.00 14.95 ?  480 ARG A N     1 
ATOM   2489 C  CA    . ARG A 1  340 ? -16.032 -17.120 -7.457  1.00 12.25 ?  480 ARG A CA    1 
ATOM   2490 C  C     . ARG A 1  340 ? -16.658 -16.963 -8.839  1.00 14.37 ?  480 ARG A C     1 
ATOM   2491 O  O     . ARG A 1  340 ? -16.979 -17.959 -9.496  1.00 18.84 ?  480 ARG A O     1 
ATOM   2492 C  CB    . ARG A 1  340 ? -17.091 -16.956 -6.366  1.00 11.69 ?  480 ARG A CB    1 
ATOM   2493 C  CG    . ARG A 1  340 ? -16.703 -17.569 -5.026  1.00 19.06 ?  480 ARG A CG    1 
ATOM   2494 C  CD    . ARG A 1  340 ? -17.886 -17.601 -4.053  1.00 17.60 ?  480 ARG A CD    1 
ATOM   2495 N  NE    . ARG A 1  340 ? -18.322 -16.265 -3.644  1.00 15.76 ?  480 ARG A NE    1 
ATOM   2496 C  CZ    . ARG A 1  340 ? -17.981 -15.663 -2.505  1.00 15.84 ?  480 ARG A CZ    1 
ATOM   2497 N  NH1   . ARG A 1  340 ? -17.188 -16.260 -1.625  1.00 12.27 ?  480 ARG A NH1   1 
ATOM   2498 N  NH2   . ARG A 1  340 ? -18.435 -14.445 -2.246  1.00 21.40 ?  480 ARG A NH2   1 
ATOM   2499 N  N     A HIS A 1  341 ? -16.864 -15.717 -9.278  0.51 17.04 ?  481 HIS A N     1 
ATOM   2500 N  N     B HIS A 1  341 ? -16.822 -15.730 -9.317  0.49 16.92 ?  481 HIS A N     1 
ATOM   2501 C  CA    A HIS A 1  341 ? -17.369 -15.458 -10.624 0.51 19.46 ?  481 HIS A CA    1 
ATOM   2502 C  CA    B HIS A 1  341 ? -17.431 -15.562 -10.630 0.49 19.29 ?  481 HIS A CA    1 
ATOM   2503 C  C     A HIS A 1  341 ? -16.526 -16.176 -11.666 0.51 20.40 ?  481 HIS A C     1 
ATOM   2504 C  C     B HIS A 1  341 ? -16.518 -16.037 -11.755 0.49 20.01 ?  481 HIS A C     1 
ATOM   2505 O  O     A HIS A 1  341 ? -17.052 -16.798 -12.597 0.51 13.71 ?  481 HIS A O     1 
ATOM   2506 O  O     B HIS A 1  341 ? -17.014 -16.367 -12.838 0.49 13.66 ?  481 HIS A O     1 
ATOM   2507 C  CB    A HIS A 1  341 ? -17.366 -13.953 -10.908 0.51 19.97 ?  481 HIS A CB    1 
ATOM   2508 C  CB    B HIS A 1  341 ? -17.823 -14.105 -10.862 0.49 20.29 ?  481 HIS A CB    1 
ATOM   2509 C  CG    A HIS A 1  341 ? -18.448 -13.189 -10.208 0.51 20.19 ?  481 HIS A CG    1 
ATOM   2510 C  CG    B HIS A 1  341 ? -18.886 -13.934 -11.902 0.49 19.85 ?  481 HIS A CG    1 
ATOM   2511 N  ND1   A HIS A 1  341 ? -19.693 -13.720 -9.951  0.51 22.61 ?  481 HIS A ND1   1 
ATOM   2512 N  ND1   B HIS A 1  341 ? -20.189 -14.338 -11.704 0.49 22.28 ?  481 HIS A ND1   1 
ATOM   2513 C  CD2   A HIS A 1  341 ? -18.471 -11.924 -9.724  0.51 16.65 ?  481 HIS A CD2   1 
ATOM   2514 C  CD2   B HIS A 1  341 ? -18.838 -13.419 -13.152 0.49 20.59 ?  481 HIS A CD2   1 
ATOM   2515 C  CE1   A HIS A 1  341 ? -20.436 -12.817 -9.334  0.51 18.85 ?  481 HIS A CE1   1 
ATOM   2516 C  CE1   B HIS A 1  341 ? -20.900 -14.071 -12.785 0.49 25.12 ?  481 HIS A CE1   1 
ATOM   2517 N  NE2   A HIS A 1  341 ? -19.717 -11.719 -9.183  0.51 19.49 ?  481 HIS A NE2   1 
ATOM   2518 N  NE2   B HIS A 1  341 ? -20.103 -13.513 -13.679 0.49 22.47 ?  481 HIS A NE2   1 
ATOM   2519 N  N     . LEU A 1  342 ? -15.207 -16.088 -11.525 1.00 18.28 ?  482 LEU A N     1 
ATOM   2520 C  CA    . LEU A 1  342 ? -14.272 -16.651 -12.489 1.00 17.77 ?  482 LEU A CA    1 
ATOM   2521 C  C     . LEU A 1  342 ? -14.011 -18.133 -12.262 1.00 15.54 ?  482 LEU A C     1 
ATOM   2522 O  O     . LEU A 1  342 ? -13.188 -18.715 -12.976 1.00 20.22 ?  482 LEU A O     1 
ATOM   2523 C  CB    . LEU A 1  342 ? -12.942 -15.888 -12.440 1.00 13.24 ?  482 LEU A CB    1 
ATOM   2524 C  CG    . LEU A 1  342 ? -13.017 -14.390 -12.744 1.00 12.58 ?  482 LEU A CG    1 
ATOM   2525 C  CD1   . LEU A 1  342 ? -11.665 -13.731 -12.507 1.00 15.75 ?  482 LEU A CD1   1 
ATOM   2526 C  CD2   . LEU A 1  342 ? -13.482 -14.154 -14.172 1.00 14.09 ?  482 LEU A CD2   1 
ATOM   2527 N  N     . GLY A 1  343 ? -14.678 -18.755 -11.293 1.00 18.65 ?  483 GLY A N     1 
ATOM   2528 C  CA    . GLY A 1  343 ? -14.464 -20.166 -11.029 1.00 16.54 ?  483 GLY A CA    1 
ATOM   2529 C  C     . GLY A 1  343 ? -13.084 -20.499 -10.509 1.00 18.79 ?  483 GLY A C     1 
ATOM   2530 O  O     . GLY A 1  343 ? -12.569 -21.589 -10.785 1.00 18.75 ?  483 GLY A O     1 
ATOM   2531 N  N     . LEU A 1  344 ? -12.465 -19.586 -9.768  1.00 11.87 ?  484 LEU A N     1 
ATOM   2532 C  CA    . LEU A 1  344 ? -11.139 -19.780 -9.200  1.00 13.21 ?  484 LEU A CA    1 
ATOM   2533 C  C     . LEU A 1  344 ? -11.231 -19.877 -7.684  1.00 19.51 ?  484 LEU A C     1 
ATOM   2534 O  O     . LEU A 1  344 ? -12.046 -19.192 -7.057  1.00 15.26 ?  484 LEU A O     1 
ATOM   2535 C  CB    . LEU A 1  344 ? -10.209 -18.615 -9.557  1.00 9.71  ?  484 LEU A CB    1 
ATOM   2536 C  CG    . LEU A 1  344 ? -9.816  -18.375 -11.014 1.00 14.76 ?  484 LEU A CG    1 
ATOM   2537 C  CD1   . LEU A 1  344 ? -9.274  -16.956 -11.171 1.00 15.26 ?  484 LEU A CD1   1 
ATOM   2538 C  CD2   . LEU A 1  344 ? -8.786  -19.387 -11.461 1.00 12.09 ?  484 LEU A CD2   1 
ATOM   2539 N  N     A GLU A 1  345 ? -10.399 -20.731 -7.095  0.70 18.08 ?  485 GLU A N     1 
ATOM   2540 N  N     B GLU A 1  345 ? -10.384 -20.716 -7.093  0.30 17.95 ?  485 GLU A N     1 
ATOM   2541 C  CA    A GLU A 1  345 ? -10.273 -20.736 -5.645  0.70 16.67 ?  485 GLU A CA    1 
ATOM   2542 C  CA    B GLU A 1  345 ? -10.271 -20.743 -5.641  0.30 16.33 ?  485 GLU A CA    1 
ATOM   2543 C  C     A GLU A 1  345 ? -9.750  -19.383 -5.182  0.70 14.20 ?  485 GLU A C     1 
ATOM   2544 C  C     B GLU A 1  345 ? -9.709  -19.415 -5.148  0.30 14.80 ?  485 GLU A C     1 
ATOM   2545 O  O     A GLU A 1  345 ? -8.878  -18.787 -5.817  0.70 14.05 ?  485 GLU A O     1 
ATOM   2546 O  O     B GLU A 1  345 ? -8.764  -18.870 -5.725  0.30 14.34 ?  485 GLU A O     1 
ATOM   2547 C  CB    A GLU A 1  345 ? -9.336  -21.856 -5.191  0.70 14.93 ?  485 GLU A CB    1 
ATOM   2548 C  CB    B GLU A 1  345 ? -9.373  -21.899 -5.197  0.30 15.62 ?  485 GLU A CB    1 
ATOM   2549 C  CG    A GLU A 1  345 ? -9.848  -23.253 -5.500  0.70 17.32 ?  485 GLU A CG    1 
ATOM   2550 C  CG    B GLU A 1  345 ? -9.289  -22.071 -3.688  0.30 16.63 ?  485 GLU A CG    1 
ATOM   2551 N  N     . TYR A 1  346 ? -10.299 -18.888 -4.079  1.00 13.82 ?  486 TYR A N     1 
ATOM   2552 C  CA    . TYR A 1  346 ? -9.884  -17.587 -3.577  1.00 14.32 ?  486 TYR A CA    1 
ATOM   2553 C  C     . TYR A 1  346 ? -8.426  -17.629 -3.140  1.00 15.80 ?  486 TYR A C     1 
ATOM   2554 O  O     . TYR A 1  346 ? -7.960  -18.607 -2.552  1.00 12.52 ?  486 TYR A O     1 
ATOM   2555 C  CB    . TYR A 1  346 ? -10.765 -17.142 -2.413  1.00 12.62 ?  486 TYR A CB    1 
ATOM   2556 C  CG    . TYR A 1  346 ? -10.293 -15.846 -1.789  1.00 15.55 ?  486 TYR A CG    1 
ATOM   2557 C  CD1   . TYR A 1  346 ? -10.470 -14.636 -2.446  1.00 16.30 ?  486 TYR A CD1   1 
ATOM   2558 C  CD2   . TYR A 1  346 ? -9.661  -15.835 -0.553  1.00 14.50 ?  486 TYR A CD2   1 
ATOM   2559 C  CE1   . TYR A 1  346 ? -10.031 -13.453 -1.893  1.00 18.55 ?  486 TYR A CE1   1 
ATOM   2560 C  CE2   . TYR A 1  346 ? -9.221  -14.653 0.010   1.00 16.42 ?  486 TYR A CE2   1 
ATOM   2561 C  CZ    . TYR A 1  346 ? -9.412  -13.464 -0.664  1.00 18.80 ?  486 TYR A CZ    1 
ATOM   2562 O  OH    . TYR A 1  346 ? -8.974  -12.283 -0.117  1.00 21.65 ?  486 TYR A OH    1 
ATOM   2563 N  N     . LEU A 1  347 ? -7.700  -16.560 -3.447  1.00 8.94  ?  487 LEU A N     1 
ATOM   2564 C  CA    . LEU A 1  347 ? -6.322  -16.407 -3.010  1.00 9.37  ?  487 LEU A CA    1 
ATOM   2565 C  C     . LEU A 1  347 ? -6.213  -15.120 -2.208  1.00 11.01 ?  487 LEU A C     1 
ATOM   2566 O  O     . LEU A 1  347 ? -6.531  -14.044 -2.740  1.00 12.25 ?  487 LEU A O     1 
ATOM   2567 C  CB    . LEU A 1  347 ? -5.369  -16.374 -4.203  1.00 9.58  ?  487 LEU A CB    1 
ATOM   2568 C  CG    . LEU A 1  347 ? -5.247  -17.689 -4.970  1.00 9.82  ?  487 LEU A CG    1 
ATOM   2569 C  CD1   . LEU A 1  347 ? -4.492  -17.475 -6.269  1.00 11.34 ?  487 LEU A CD1   1 
ATOM   2570 C  CD2   . LEU A 1  347 ? -4.552  -18.739 -4.107  1.00 15.36 ?  487 LEU A CD2   1 
ATOM   2571 N  N     . PRO A 1  348 ? -5.793  -15.158 -0.948  1.00 13.67 ?  488 PRO A N     1 
ATOM   2572 C  CA    . PRO A 1  348 ? -5.583  -13.916 -0.218  1.00 14.02 ?  488 PRO A CA    1 
ATOM   2573 C  C     . PRO A 1  348 ? -4.426  -13.142 -0.821  1.00 10.19 ?  488 PRO A C     1 
ATOM   2574 O  O     . PRO A 1  348 ? -3.599  -13.718 -1.545  1.00 7.45  ?  488 PRO A O     1 
ATOM   2575 C  CB    . PRO A 1  348 ? -5.268  -14.389 1.211   1.00 16.39 ?  488 PRO A CB    1 
ATOM   2576 C  CG    . PRO A 1  348 ? -4.715  -15.744 1.035   1.00 18.19 ?  488 PRO A CG    1 
ATOM   2577 C  CD    . PRO A 1  348 ? -5.457  -16.336 -0.128  1.00 14.76 ?  488 PRO A CD    1 
ATOM   2578 N  N     . PRO A 1  349 ? -4.340  -11.834 -0.561  1.00 9.24  ?  489 PRO A N     1 
ATOM   2579 C  CA    . PRO A 1  349 ? -3.274  -11.036 -1.188  1.00 9.55  ?  489 PRO A CA    1 
ATOM   2580 C  C     . PRO A 1  349 ? -1.890  -11.634 -1.014  1.00 10.44 ?  489 PRO A C     1 
ATOM   2581 O  O     . PRO A 1  349 ? -1.072  -11.581 -1.942  1.00 8.64  ?  489 PRO A O     1 
ATOM   2582 C  CB    . PRO A 1  349 ? -3.397  -9.680  -0.479  1.00 6.02  ?  489 PRO A CB    1 
ATOM   2583 C  CG    . PRO A 1  349 ? -4.805  -9.611  -0.027  1.00 11.69 ?  489 PRO A CG    1 
ATOM   2584 C  CD    . PRO A 1  349 ? -5.205  -11.020 0.309   1.00 10.87 ?  489 PRO A CD    1 
ATOM   2585 N  N     A GLU A 1  350 ? -1.619  -12.216 0.156   0.59 6.95  ?  490 GLU A N     1 
ATOM   2586 N  N     B GLU A 1  350 ? -1.594  -12.207 0.152   0.41 7.40  ?  490 GLU A N     1 
ATOM   2587 C  CA    A GLU A 1  350 ? -0.310  -12.784 0.455   0.59 8.49  ?  490 GLU A CA    1 
ATOM   2588 C  CA    B GLU A 1  350 ? -0.254  -12.732 0.389   0.41 7.72  ?  490 GLU A CA    1 
ATOM   2589 C  C     A GLU A 1  350 ? 0.044   -13.944 -0.464  0.59 9.51  ?  490 GLU A C     1 
ATOM   2590 C  C     B GLU A 1  350 ? 0.035   -14.001 -0.403  0.41 9.56  ?  490 GLU A C     1 
ATOM   2591 O  O     A GLU A 1  350 ? 1.221   -14.309 -0.560  0.59 12.26 ?  490 GLU A O     1 
ATOM   2592 O  O     B GLU A 1  350 ? 1.163   -14.503 -0.337  0.41 10.96 ?  490 GLU A O     1 
ATOM   2593 C  CB    A GLU A 1  350 ? -0.268  -13.255 1.913   0.59 9.65  ?  490 GLU A CB    1 
ATOM   2594 C  CB    B GLU A 1  350 ? -0.035  -12.988 1.886   0.41 10.48 ?  490 GLU A CB    1 
ATOM   2595 C  CG    A GLU A 1  350 ? -0.382  -12.138 2.939   0.59 13.37 ?  490 GLU A CG    1 
ATOM   2596 C  CG    B GLU A 1  350 ? -0.779  -14.180 2.476   0.41 9.28  ?  490 GLU A CG    1 
ATOM   2597 C  CD    A GLU A 1  350 ? -1.817  -11.710 3.205   0.59 20.46 ?  490 GLU A CD    1 
ATOM   2598 C  CD    B GLU A 1  350 ? -2.124  -13.812 3.077   0.41 17.06 ?  490 GLU A CD    1 
ATOM   2599 O  OE1   A GLU A 1  350 ? -2.745  -12.273 2.584   0.59 16.37 ?  490 GLU A OE1   1 
ATOM   2600 O  OE1   B GLU A 1  350 ? -2.599  -12.680 2.851   0.41 17.66 ?  490 GLU A OE1   1 
ATOM   2601 O  OE2   A GLU A 1  350 ? -2.015  -10.803 4.041   0.59 21.79 ?  490 GLU A OE2   1 
ATOM   2602 O  OE2   B GLU A 1  350 ? -2.706  -14.663 3.784   0.41 11.88 ?  490 GLU A OE2   1 
ATOM   2603 N  N     . GLN A 1  351 ? -0.943  -14.533 -1.134  1.00 11.29 ?  491 GLN A N     1 
ATOM   2604 C  CA    . GLN A 1  351 ? -0.719  -15.641 -2.049  1.00 9.56  ?  491 GLN A CA    1 
ATOM   2605 C  C     . GLN A 1  351 ? -0.837  -15.210 -3.503  1.00 9.89  ?  491 GLN A C     1 
ATOM   2606 O  O     . GLN A 1  351 ? -0.950  -16.066 -4.387  1.00 12.02 ?  491 GLN A O     1 
ATOM   2607 C  CB    . GLN A 1  351 ? -1.705  -16.776 -1.757  1.00 12.11 ?  491 GLN A CB    1 
ATOM   2608 C  CG    . GLN A 1  351 ? -1.545  -17.388 -0.371  1.00 10.67 ?  491 GLN A CG    1 
ATOM   2609 C  CD    . GLN A 1  351 ? -0.153  -17.941 -0.138  1.00 19.30 ?  491 GLN A CD    1 
ATOM   2610 O  OE1   . GLN A 1  351 ? 0.539   -18.330 -1.082  1.00 15.94 ?  491 GLN A OE1   1 
ATOM   2611 N  NE2   . GLN A 1  351 ? 0.268   -17.974 1.122   1.00 20.19 ?  491 GLN A NE2   1 
ATOM   2612 N  N     . ARG A 1  352 ? -0.819  -13.902 -3.766  1.00 10.64 ?  492 ARG A N     1 
ATOM   2613 C  CA    . ARG A 1  352 ? -0.857  -13.357 -5.117  1.00 7.16  ?  492 ARG A CA    1 
ATOM   2614 C  C     . ARG A 1  352 ? 0.500   -12.819 -5.549  1.00 9.92  ?  492 ARG A C     1 
ATOM   2615 O  O     . ARG A 1  352 ? 0.573   -11.947 -6.422  1.00 12.12 ?  492 ARG A O     1 
ATOM   2616 C  CB    . ARG A 1  352 ? -1.911  -12.254 -5.212  1.00 7.75  ?  492 ARG A CB    1 
ATOM   2617 C  CG    . ARG A 1  352 ? -3.300  -12.699 -4.822  1.00 7.63  ?  492 ARG A CG    1 
ATOM   2618 C  CD    . ARG A 1  352 ? -4.296  -11.548 -4.899  1.00 10.14 ?  492 ARG A CD    1 
ATOM   2619 N  NE    . ARG A 1  352 ? -5.470  -11.802 -4.071  1.00 8.01  ?  492 ARG A NE    1 
ATOM   2620 C  CZ    . ARG A 1  352 ? -6.349  -10.876 -3.700  1.00 9.71  ?  492 ARG A CZ    1 
ATOM   2621 N  NH1   . ARG A 1  352 ? -6.201  -9.615  -4.085  1.00 10.87 ?  492 ARG A NH1   1 
ATOM   2622 N  NH2   . ARG A 1  352 ? -7.375  -11.214 -2.934  1.00 10.03 ?  492 ARG A NH2   1 
ATOM   2623 N  N     . ASN A 1  353 ? 1.577   -13.311 -4.948  1.00 8.24  ?  493 ASN A N     1 
ATOM   2624 C  CA    . ASN A 1  353 ? 2.918   -12.809 -5.238  1.00 11.22 ?  493 ASN A CA    1 
ATOM   2625 C  C     . ASN A 1  353 ? 3.536   -13.527 -6.434  1.00 14.03 ?  493 ASN A C     1 
ATOM   2626 O  O     . ASN A 1  353 ? 4.670   -14.003 -6.389  1.00 10.60 ?  493 ASN A O     1 
ATOM   2627 C  CB    . ASN A 1  353 ? 3.796   -12.935 -3.999  1.00 7.32  ?  493 ASN A CB    1 
ATOM   2628 C  CG    . ASN A 1  353 ? 3.478   -11.876 -2.964  1.00 13.00 ?  493 ASN A CG    1 
ATOM   2629 O  OD1   . ASN A 1  353 ? 3.727   -10.695 -3.183  1.00 11.05 ?  493 ASN A OD1   1 
ATOM   2630 N  ND2   . ASN A 1  353 ? 2.914   -12.291 -1.840  1.00 11.97 ?  493 ASN A ND2   1 
ATOM   2631 N  N     . ALA A 1  354 ? 2.775   -13.602 -7.524  1.00 11.82 ?  494 ALA A N     1 
ATOM   2632 C  CA    . ALA A 1  354 ? 3.247   -14.228 -8.754  1.00 13.80 ?  494 ALA A CA    1 
ATOM   2633 C  C     . ALA A 1  354 ? 4.401   -13.438 -9.344  1.00 15.67 ?  494 ALA A C     1 
ATOM   2634 O  O     . ALA A 1  354 ? 4.407   -12.204 -9.307  1.00 10.73 ?  494 ALA A O     1 
ATOM   2635 C  CB    . ALA A 1  354 ? 2.114   -14.342 -9.761  1.00 9.87  ?  494 ALA A CB    1 
ATOM   2636 O  OXT   . ALA A 1  354 ? 5.348   -14.019 -9.878  1.00 18.27 ?  494 ALA A OXT   1 
ATOM   2637 O  "O5'" . DC  B 2  1   ? 3.214   -18.675 -38.338 1.00 36.72 ?  1   DC  T "O5'" 1 
ATOM   2638 C  "C5'" . DC  B 2  1   ? 2.080   -18.730 -39.200 1.00 36.82 ?  1   DC  T "C5'" 1 
ATOM   2639 C  "C4'" . DC  B 2  1   ? 0.814   -18.969 -38.402 1.00 39.08 ?  1   DC  T "C4'" 1 
ATOM   2640 O  "O4'" . DC  B 2  1   ? 0.938   -20.207 -37.671 1.00 39.16 ?  1   DC  T "O4'" 1 
ATOM   2641 C  "C3'" . DC  B 2  1   ? 0.525   -17.906 -37.362 1.00 29.70 ?  1   DC  T "C3'" 1 
ATOM   2642 O  "O3'" . DC  B 2  1   ? -0.295  -16.888 -37.921 1.00 32.51 ?  1   DC  T "O3'" 1 
ATOM   2643 C  "C2'" . DC  B 2  1   ? -0.164  -18.670 -36.227 1.00 28.63 ?  1   DC  T "C2'" 1 
ATOM   2644 C  "C1'" . DC  B 2  1   ? 0.228   -20.133 -36.452 1.00 33.64 ?  1   DC  T "C1'" 1 
ATOM   2645 N  N1    . DC  B 2  1   ? 1.098   -20.719 -35.377 1.00 28.83 ?  1   DC  T N1    1 
ATOM   2646 C  C2    . DC  B 2  1   ? 0.536   -21.104 -34.154 1.00 31.41 ?  1   DC  T C2    1 
ATOM   2647 O  O2    . DC  B 2  1   ? -0.674  -20.929 -33.964 1.00 28.46 ?  1   DC  T O2    1 
ATOM   2648 N  N3    . DC  B 2  1   ? 1.339   -21.652 -33.205 1.00 23.16 ?  1   DC  T N3    1 
ATOM   2649 C  C4    . DC  B 2  1   ? 2.641   -21.827 -33.453 1.00 23.31 ?  1   DC  T C4    1 
ATOM   2650 N  N4    . DC  B 2  1   ? 3.395   -22.374 -32.496 1.00 22.61 ?  1   DC  T N4    1 
ATOM   2651 C  C5    . DC  B 2  1   ? 3.228   -21.445 -34.693 1.00 24.22 ?  1   DC  T C5    1 
ATOM   2652 C  C6    . DC  B 2  1   ? 2.427   -20.908 -35.619 1.00 33.09 ?  1   DC  T C6    1 
ATOM   2653 P  P     . DG  B 2  2   ? -0.193  -15.375 -37.384 1.00 38.25 ?  2   DG  T P     1 
ATOM   2654 O  OP1   . DG  B 2  2   ? -0.762  -14.484 -38.421 1.00 42.38 ?  2   DG  T OP1   1 
ATOM   2655 O  OP2   . DG  B 2  2   ? 1.180   -15.134 -36.882 1.00 32.03 ?  2   DG  T OP2   1 
ATOM   2656 O  "O5'" . DG  B 2  2   ? -1.173  -15.373 -36.135 1.00 33.44 ?  2   DG  T "O5'" 1 
ATOM   2657 C  "C5'" . DG  B 2  2   ? -2.453  -15.965 -36.247 1.00 30.44 ?  2   DG  T "C5'" 1 
ATOM   2658 C  "C4'" . DG  B 2  2   ? -3.179  -15.882 -34.929 1.00 26.52 ?  2   DG  T "C4'" 1 
ATOM   2659 O  "O4'" . DG  B 2  2   ? -2.562  -16.795 -33.978 1.00 23.68 ?  2   DG  T "O4'" 1 
ATOM   2660 C  "C3'" . DG  B 2  2   ? -3.128  -14.512 -34.277 1.00 23.91 ?  2   DG  T "C3'" 1 
ATOM   2661 O  "O3'" . DG  B 2  2   ? -4.322  -14.265 -33.551 1.00 36.26 ?  2   DG  T "O3'" 1 
ATOM   2662 C  "C2'" . DG  B 2  2   ? -1.892  -14.610 -33.383 1.00 23.68 ?  2   DG  T "C2'" 1 
ATOM   2663 C  "C1'" . DG  B 2  2   ? -1.908  -16.073 -32.947 1.00 25.14 ?  2   DG  T "C1'" 1 
ATOM   2664 N  N9    . DG  B 2  2   ? -0.586  -16.672 -32.746 1.00 28.00 ?  2   DG  T N9    1 
ATOM   2665 C  C8    . DG  B 2  2   ? 0.530   -16.507 -33.527 1.00 22.95 ?  2   DG  T C8    1 
ATOM   2666 N  N7    . DG  B 2  2   ? 1.563   -17.188 -33.110 1.00 27.09 ?  2   DG  T N7    1 
ATOM   2667 C  C5    . DG  B 2  2   ? 1.102   -17.853 -31.983 1.00 23.64 ?  2   DG  T C5    1 
ATOM   2668 C  C6    . DG  B 2  2   ? 1.772   -18.744 -31.110 1.00 25.26 ?  2   DG  T C6    1 
ATOM   2669 O  O6    . DG  B 2  2   ? 2.949   -19.133 -31.162 1.00 23.94 ?  2   DG  T O6    1 
ATOM   2670 N  N1    . DG  B 2  2   ? 0.934   -19.194 -30.092 1.00 20.49 ?  2   DG  T N1    1 
ATOM   2671 C  C2    . DG  B 2  2   ? -0.380  -18.830 -29.939 1.00 20.70 ?  2   DG  T C2    1 
ATOM   2672 N  N2    . DG  B 2  2   ? -1.028  -19.366 -28.895 1.00 23.36 ?  2   DG  T N2    1 
ATOM   2673 N  N3    . DG  B 2  2   ? -1.019  -17.998 -30.751 1.00 24.78 ?  2   DG  T N3    1 
ATOM   2674 C  C4    . DG  B 2  2   ? -0.220  -17.549 -31.747 1.00 27.40 ?  2   DG  T C4    1 
ATOM   2675 P  P     . DG  B 2  3   ? -4.551  -12.858 -32.813 1.00 38.54 ?  3   DG  T P     1 
ATOM   2676 O  OP1   . DG  B 2  3   ? -6.015  -12.651 -32.715 1.00 40.94 ?  3   DG  T OP1   1 
ATOM   2677 O  OP2   . DG  B 2  3   ? -3.678  -11.842 -33.447 1.00 40.63 ?  3   DG  T OP2   1 
ATOM   2678 O  "O5'" . DG  B 2  3   ? -3.995  -13.121 -31.346 1.00 29.98 ?  3   DG  T "O5'" 1 
ATOM   2679 C  "C5'" . DG  B 2  3   ? -4.467  -14.225 -30.612 1.00 22.38 ?  3   DG  T "C5'" 1 
ATOM   2680 C  "C4'" . DG  B 2  3   ? -3.765  -14.308 -29.284 1.00 26.03 ?  3   DG  T "C4'" 1 
ATOM   2681 O  "O4'" . DG  B 2  3   ? -2.514  -15.006 -29.459 1.00 25.37 ?  3   DG  T "O4'" 1 
ATOM   2682 C  "C3'" . DG  B 2  3   ? -3.424  -12.946 -28.664 1.00 23.76 ?  3   DG  T "C3'" 1 
ATOM   2683 O  "O3'" . DG  B 2  3   ? -4.141  -12.774 -27.448 1.00 26.73 ?  3   DG  T "O3'" 1 
ATOM   2684 C  "C2'" . DG  B 2  3   ? -1.899  -12.981 -28.468 1.00 25.56 ?  3   DG  T "C2'" 1 
ATOM   2685 C  "C1'" . DG  B 2  3   ? -1.556  -14.461 -28.591 1.00 26.05 ?  3   DG  T "C1'" 1 
ATOM   2686 N  N9    . DG  B 2  3   ? -0.231  -14.742 -29.145 1.00 25.94 ?  3   DG  T N9    1 
ATOM   2687 C  C8    . DG  B 2  3   ? 0.314   -14.230 -30.297 1.00 20.33 ?  3   DG  T C8    1 
ATOM   2688 N  N7    . DG  B 2  3   ? 1.511   -14.681 -30.549 1.00 21.10 ?  3   DG  T N7    1 
ATOM   2689 C  C5    . DG  B 2  3   ? 1.770   -15.558 -29.505 1.00 20.00 ?  3   DG  T C5    1 
ATOM   2690 C  C6    . DG  B 2  3   ? 2.913   -16.348 -29.240 1.00 21.10 ?  3   DG  T C6    1 
ATOM   2691 O  O6    . DG  B 2  3   ? 3.958   -16.433 -29.899 1.00 20.08 ?  3   DG  T O6    1 
ATOM   2692 N  N1    . DG  B 2  3   ? 2.763   -17.094 -28.074 1.00 18.69 ?  3   DG  T N1    1 
ATOM   2693 C  C2    . DG  B 2  3   ? 1.653   -17.078 -27.268 1.00 19.48 ?  3   DG  T C2    1 
ATOM   2694 N  N2    . DG  B 2  3   ? 1.694   -17.864 -26.185 1.00 18.61 ?  3   DG  T N2    1 
ATOM   2695 N  N3    . DG  B 2  3   ? 0.575   -16.345 -27.506 1.00 20.89 ?  3   DG  T N3    1 
ATOM   2696 C  C4    . DG  B 2  3   ? 0.705   -15.611 -28.637 1.00 19.12 ?  3   DG  T C4    1 
ATOM   2697 P  P     . DC  B 2  4   ? -4.229  -11.333 -26.742 1.00 22.19 ?  4   DC  T P     1 
ATOM   2698 O  OP1   . DC  B 2  4   ? -5.519  -11.296 -26.024 1.00 22.95 ?  4   DC  T OP1   1 
ATOM   2699 O  OP2   . DC  B 2  4   ? -3.904  -10.277 -27.723 1.00 23.28 ?  4   DC  T OP2   1 
ATOM   2700 O  "O5'" . DC  B 2  4   ? -3.047  -11.376 -25.670 1.00 24.12 ?  4   DC  T "O5'" 1 
ATOM   2701 C  "C5'" . DC  B 2  4   ? -2.941  -12.475 -24.796 1.00 20.84 ?  4   DC  T "C5'" 1 
ATOM   2702 C  "C4'" . DC  B 2  4   ? -1.571  -12.522 -24.157 1.00 18.28 ?  4   DC  T "C4'" 1 
ATOM   2703 O  "O4'" . DC  B 2  4   ? -0.601  -13.000 -25.126 1.00 20.94 ?  4   DC  T "O4'" 1 
ATOM   2704 C  "C3'" . DC  B 2  4   ? -1.045  -11.165 -23.665 1.00 16.02 ?  4   DC  T "C3'" 1 
ATOM   2705 O  "O3'" . DC  B 2  4   ? -0.697  -11.232 -22.290 1.00 14.73 ?  4   DC  T "O3'" 1 
ATOM   2706 C  "C2'" . DC  B 2  4   ? 0.168   -10.900 -24.555 1.00 16.14 ?  4   DC  T "C2'" 1 
ATOM   2707 C  "C1'" . DC  B 2  4   ? 0.599   -12.311 -24.913 1.00 18.02 ?  4   DC  T "C1'" 1 
ATOM   2708 N  N1    . DC  B 2  4   ? 1.478   -12.434 -26.131 1.00 19.51 ?  4   DC  T N1    1 
ATOM   2709 C  C2    . DC  B 2  4   ? 2.463   -13.428 -26.155 1.00 17.73 ?  4   DC  T C2    1 
ATOM   2710 O  O2    . DC  B 2  4   ? 2.576   -14.181 -25.182 1.00 16.53 ?  4   DC  T O2    1 
ATOM   2711 N  N3    . DC  B 2  4   ? 3.260   -13.545 -27.245 1.00 17.84 ?  4   DC  T N3    1 
ATOM   2712 C  C4    . DC  B 2  4   ? 3.105   -12.716 -28.275 1.00 21.61 ?  4   DC  T C4    1 
ATOM   2713 N  N4    . DC  B 2  4   ? 3.919   -12.870 -29.323 1.00 23.62 ?  4   DC  T N4    1 
ATOM   2714 C  C5    . DC  B 2  4   ? 2.106   -11.693 -28.276 1.00 19.92 ?  4   DC  T C5    1 
ATOM   2715 C  C6    . DC  B 2  4   ? 1.322   -11.589 -27.193 1.00 26.87 ?  4   DC  T C6    1 
ATOM   2716 P  P     . DA  B 2  5   ? -0.648  -9.898  -21.397 1.00 15.30 ?  5   DA  T P     1 
ATOM   2717 O  OP1   . DA  B 2  5   ? 0.162   -8.874  -22.092 1.00 17.61 ?  5   DA  T OP1   1 
ATOM   2718 O  OP2   . DA  B 2  5   ? -0.235  -10.332 -20.047 1.00 14.05 ?  5   DA  T OP2   1 
ATOM   2719 O  "O5'" . DA  B 2  5   ? -2.171  -9.405  -21.360 1.00 18.07 ?  5   DA  T "O5'" 1 
ATOM   2720 C  "C5'" . DA  B 2  5   ? -3.151  -10.173 -20.674 1.00 14.00 ?  5   DA  T "C5'" 1 
ATOM   2721 C  "C4'" . DA  B 2  5   ? -4.216  -9.286  -20.047 1.00 13.78 ?  5   DA  T "C4'" 1 
ATOM   2722 O  "O4'" . DA  B 2  5   ? -3.596  -8.380  -19.090 1.00 13.12 ?  5   DA  T "O4'" 1 
ATOM   2723 C  "C3'" . DA  B 2  5   ? -4.975  -8.393  -21.017 1.00 16.41 ?  5   DA  T "C3'" 1 
ATOM   2724 O  "O3'" . DA  B 2  5   ? -6.313  -8.208  -20.562 1.00 20.13 ?  5   DA  T "O3'" 1 
ATOM   2725 C  "C2'" . DA  B 2  5   ? -4.159  -7.106  -20.995 1.00 14.45 ?  5   DA  T "C2'" 1 
ATOM   2726 C  "C1'" . DA  B 2  5   ? -3.701  -7.040  -19.542 1.00 14.77 ?  5   DA  T "C1'" 1 
ATOM   2727 N  N9    . DA  B 2  5   ? -2.410  -6.392  -19.334 1.00 13.56 ?  5   DA  T N9    1 
ATOM   2728 C  C8    . DA  B 2  5   ? -1.343  -6.364  -20.190 1.00 15.60 ?  5   DA  T C8    1 
ATOM   2729 N  N7    . DA  B 2  5   ? -0.302  -5.718  -19.718 1.00 16.81 ?  5   DA  T N7    1 
ATOM   2730 C  C5    . DA  B 2  5   ? -0.714  -5.305  -18.460 1.00 13.72 ?  5   DA  T C5    1 
ATOM   2731 C  C6    . DA  B 2  5   ? -0.069  -4.577  -17.441 1.00 18.14 ?  5   DA  T C6    1 
ATOM   2732 N  N6    . DA  B 2  5   ? 1.179   -4.114  -17.547 1.00 15.08 ?  5   DA  T N6    1 
ATOM   2733 N  N1    . DA  B 2  5   ? -0.763  -4.339  -16.306 1.00 16.95 ?  5   DA  T N1    1 
ATOM   2734 C  C2    . DA  B 2  5   ? -2.015  -4.801  -16.208 1.00 19.95 ?  5   DA  T C2    1 
ATOM   2735 N  N3    . DA  B 2  5   ? -2.724  -5.496  -17.097 1.00 19.95 ?  5   DA  T N3    1 
ATOM   2736 C  C4    . DA  B 2  5   ? -2.009  -5.714  -18.211 1.00 15.44 ?  5   DA  T C4    1 
ATOM   2737 P  P     . DT  B 2  6   ? -7.362  -7.328  -21.399 1.00 20.58 ?  6   DT  T P     1 
ATOM   2738 O  OP1   . DT  B 2  6   ? -8.694  -7.898  -21.105 1.00 26.35 ?  6   DT  T OP1   1 
ATOM   2739 O  OP2   . DT  B 2  6   ? -6.896  -7.215  -22.797 1.00 20.34 ?  6   DT  T OP2   1 
ATOM   2740 O  "O5'" . DT  B 2  6   ? -7.269  -5.891  -20.724 1.00 19.94 ?  6   DT  T "O5'" 1 
ATOM   2741 C  "C5'" . DT  B 2  6   ? -7.603  -5.749  -19.352 1.00 15.58 ?  6   DT  T "C5'" 1 
ATOM   2742 C  "C4'" . DT  B 2  6   ? -7.220  -4.381  -18.836 1.00 15.11 ?  6   DT  T "C4'" 1 
ATOM   2743 O  "O4'" . DT  B 2  6   ? -5.794  -4.285  -18.685 1.00 20.70 ?  6   DT  T "O4'" 1 
ATOM   2744 C  "C3'" . DT  B 2  6   ? -7.571  -3.224  -19.755 1.00 20.44 ?  6   DT  T "C3'" 1 
ATOM   2745 O  "O3'" . DT  B 2  6   ? -8.912  -2.804  -19.533 1.00 18.44 ?  6   DT  T "O3'" 1 
ATOM   2746 C  "C2'" . DT  B 2  6   ? -6.538  -2.150  -19.379 1.00 23.14 ?  6   DT  T "C2'" 1 
ATOM   2747 C  "C1'" . DT  B 2  6   ? -5.471  -2.916  -18.578 1.00 24.63 ?  6   DT  T "C1'" 1 
ATOM   2748 N  N1    . DT  B 2  6   ? -4.079  -2.708  -19.068 1.00 22.89 ?  6   DT  T N1    1 
ATOM   2749 C  C2    . DT  B 2  6   ? -3.164  -2.080  -18.253 1.00 19.49 ?  6   DT  T C2    1 
ATOM   2750 O  O2    . DT  B 2  6   ? -3.430  -1.677  -17.139 1.00 17.79 ?  6   DT  T O2    1 
ATOM   2751 N  N3    . DT  B 2  6   ? -1.917  -1.937  -18.793 1.00 22.02 ?  6   DT  T N3    1 
ATOM   2752 C  C4    . DT  B 2  6   ? -1.498  -2.348  -20.042 1.00 21.54 ?  6   DT  T C4    1 
ATOM   2753 O  O4    . DT  B 2  6   ? -0.350  -2.174  -20.435 1.00 26.81 ?  6   DT  T O4    1 
ATOM   2754 C  C5    . DT  B 2  6   ? -2.504  -3.002  -20.848 1.00 18.60 ?  6   DT  T C5    1 
ATOM   2755 C  C7    . DT  B 2  6   ? -2.168  -3.496  -22.224 1.00 21.42 ?  6   DT  T C7    1 
ATOM   2756 C  C6    . DT  B 2  6   ? -3.734  -3.147  -20.328 1.00 19.68 ?  6   DT  T C6    1 
ATOM   2757 P  P     . DA  B 2  7   ? -9.605  -1.725  -20.501 1.00 21.13 ?  7   DA  T P     1 
ATOM   2758 O  OP1   . DA  B 2  7   ? -11.060 -1.960  -20.399 1.00 19.71 ?  7   DA  T OP1   1 
ATOM   2759 O  OP2   . DA  B 2  7   ? -8.932  -1.739  -21.818 1.00 22.77 ?  7   DA  T OP2   1 
ATOM   2760 O  "O5'" . DA  B 2  7   ? -9.299  -0.345  -19.776 1.00 19.61 ?  7   DA  T "O5'" 1 
ATOM   2761 C  "C5'" . DA  B 2  7   ? -9.710  -0.191  -18.430 1.00 25.22 ?  7   DA  T "C5'" 1 
ATOM   2762 C  "C4'" . DA  B 2  7   ? -9.125  1.053   -17.825 1.00 23.82 ?  7   DA  T "C4'" 1 
ATOM   2763 O  "O4'" . DA  B 2  7   ? -7.676  0.958   -17.836 1.00 25.26 ?  7   DA  T "O4'" 1 
ATOM   2764 C  "C3'" . DA  B 2  7   ? -9.486  2.342   -18.555 1.00 31.23 ?  7   DA  T "C3'" 1 
ATOM   2765 O  "O3'" . DA  B 2  7   ? -9.905  3.300   -17.607 1.00 38.92 ?  7   DA  T "O3'" 1 
ATOM   2766 C  "C2'" . DA  B 2  7   ? -8.193  2.725   -19.278 1.00 33.23 ?  7   DA  T "C2'" 1 
ATOM   2767 C  "C1'" . DA  B 2  7   ? -7.122  2.136   -18.367 1.00 28.25 ?  7   DA  T "C1'" 1 
ATOM   2768 N  N9    . DA  B 2  7   ? -5.867  1.789   -19.031 1.00 30.17 ?  7   DA  T N9    1 
ATOM   2769 C  C8    . DA  B 2  7   ? -5.705  1.183   -20.247 1.00 21.87 ?  7   DA  T C8    1 
ATOM   2770 N  N7    . DA  B 2  7   ? -4.449  0.985   -20.575 1.00 22.85 ?  7   DA  T N7    1 
ATOM   2771 C  C5    . DA  B 2  7   ? -3.739  1.489   -19.495 1.00 20.18 ?  7   DA  T C5    1 
ATOM   2772 C  C6    . DA  B 2  7   ? -2.356  1.581   -19.222 1.00 20.98 ?  7   DA  T C6    1 
ATOM   2773 N  N6    . DA  B 2  7   ? -1.409  1.148   -20.057 1.00 17.34 ?  7   DA  T N6    1 
ATOM   2774 N  N1    . DA  B 2  7   ? -1.987  2.139   -18.052 1.00 22.79 ?  7   DA  T N1    1 
ATOM   2775 C  C2    . DA  B 2  7   ? -2.936  2.575   -17.215 1.00 24.48 ?  7   DA  T C2    1 
ATOM   2776 N  N3    . DA  B 2  7   ? -4.260  2.543   -17.361 1.00 30.10 ?  7   DA  T N3    1 
ATOM   2777 C  C4    . DA  B 2  7   ? -4.597  1.982   -18.535 1.00 20.72 ?  7   DA  T C4    1 
ATOM   2778 P  P     . DC  B 2  8   ? -10.521 4.713   -18.040 1.00 29.87 ?  8   DC  T P     1 
ATOM   2779 O  OP1   . DC  B 2  8   ? -11.895 4.750   -17.494 1.00 43.96 ?  8   DC  T OP1   1 
ATOM   2780 O  OP2   . DC  B 2  8   ? -10.288 4.964   -19.477 1.00 29.93 ?  8   DC  T OP2   1 
ATOM   2781 O  "O5'" . DC  B 2  8   ? -9.649  5.741   -17.189 1.00 26.54 ?  8   DC  T "O5'" 1 
ATOM   2782 C  "C5'" . DC  B 2  8   ? -9.352  5.434   -15.833 1.00 26.97 ?  8   DC  T "C5'" 1 
ATOM   2783 C  "C4'" . DC  B 2  8   ? -8.102  6.149   -15.375 1.00 23.23 ?  8   DC  T "C4'" 1 
ATOM   2784 O  "O4'" . DC  B 2  8   ? -6.944  5.580   -16.049 1.00 22.77 ?  8   DC  T "O4'" 1 
ATOM   2785 C  "C3'" . DC  B 2  8   ? -8.068  7.647   -15.677 1.00 19.59 ?  8   DC  T "C3'" 1 
ATOM   2786 O  "O3'" . DC  B 2  8   ? -7.535  8.344   -14.563 1.00 18.64 ?  8   DC  T "O3'" 1 
ATOM   2787 C  "C2'" . DC  B 2  8   ? -7.178  7.724   -16.913 1.00 17.63 ?  8   DC  T "C2'" 1 
ATOM   2788 C  "C1'" . DC  B 2  8   ? -6.184  6.618   -16.623 1.00 20.09 ?  8   DC  T "C1'" 1 
ATOM   2789 N  N1    . DC  B 2  8   ? -5.458  6.087   -17.816 1.00 17.98 ?  8   DC  T N1    1 
ATOM   2790 C  C2    . DC  B 2  8   ? -4.057  6.082   -17.819 1.00 21.39 ?  8   DC  T C2    1 
ATOM   2791 O  O2    . DC  B 2  8   ? -3.451  6.528   -16.835 1.00 18.20 ?  8   DC  T O2    1 
ATOM   2792 N  N3    . DC  B 2  8   ? -3.403  5.596   -18.902 1.00 18.12 ?  8   DC  T N3    1 
ATOM   2793 C  C4    . DC  B 2  8   ? -4.090  5.124   -19.941 1.00 23.42 ?  8   DC  T C4    1 
ATOM   2794 N  N4    . DC  B 2  8   ? -3.397  4.652   -20.984 1.00 18.84 ?  8   DC  T N4    1 
ATOM   2795 C  C5    . DC  B 2  8   ? -5.518  5.119   -19.960 1.00 24.26 ?  8   DC  T C5    1 
ATOM   2796 C  C6    . DC  B 2  8   ? -6.155  5.602   -18.883 1.00 27.93 ?  8   DC  T C6    1 
ATOM   2797 P  P     . DG  B 2  9   ? -7.184  9.908   -14.641 1.00 21.12 ?  9   DG  T P     1 
ATOM   2798 O  OP1   . DG  B 2  9   ? -7.244  10.389  -13.239 1.00 22.02 ?  9   DG  T OP1   1 
ATOM   2799 O  OP2   . DG  B 2  9   ? -8.009  10.547  -15.689 1.00 16.41 ?  9   DG  T OP2   1 
ATOM   2800 O  "O5'" . DG  B 2  9   ? -5.662  9.932   -15.133 1.00 15.33 ?  9   DG  T "O5'" 1 
ATOM   2801 C  "C5'" . DG  B 2  9   ? -4.616  9.618   -14.226 1.00 14.03 ?  9   DG  T "C5'" 1 
ATOM   2802 C  "C4'" . DG  B 2  9   ? -3.503  10.647  -14.303 1.00 18.19 ?  9   DG  T "C4'" 1 
ATOM   2803 O  "O4'" . DG  B 2  9   ? -2.591  10.302  -15.380 1.00 20.39 ?  9   DG  T "O4'" 1 
ATOM   2804 C  "C3'" . DG  B 2  9   ? -3.964  12.062  -14.604 1.00 23.46 ?  9   DG  T "C3'" 1 
ATOM   2805 O  "O3'" . DG  B 2  9   ? -3.097  13.010  -13.998 1.00 30.61 ?  9   DG  T "O3'" 1 
ATOM   2806 C  "C2'" . DG  B 2  9   ? -3.924  12.115  -16.129 1.00 19.22 ?  9   DG  T "C2'" 1 
ATOM   2807 C  "C1'" . DG  B 2  9   ? -2.751  11.196  -16.474 1.00 19.82 ?  9   DG  T "C1'" 1 
ATOM   2808 N  N9    . DG  B 2  9   ? -2.939  10.397  -17.684 1.00 23.45 ?  9   DG  T N9    1 
ATOM   2809 C  C8    . DG  B 2  9   ? -4.085  9.755   -18.089 1.00 21.71 ?  9   DG  T C8    1 
ATOM   2810 N  N7    . DG  B 2  9   ? -3.946  9.094   -19.202 1.00 20.20 ?  9   DG  T N7    1 
ATOM   2811 C  C5    . DG  B 2  9   ? -2.619  9.305   -19.559 1.00 17.79 ?  9   DG  T C5    1 
ATOM   2812 C  C6    . DG  B 2  9   ? -1.890  8.836   -20.676 1.00 21.01 ?  9   DG  T C6    1 
ATOM   2813 O  O6    . DG  B 2  9   ? -2.284  8.115   -21.602 1.00 21.19 ?  9   DG  T O6    1 
ATOM   2814 N  N1    . DG  B 2  9   ? -0.570  9.283   -20.656 1.00 17.56 ?  9   DG  T N1    1 
ATOM   2815 C  C2    . DG  B 2  9   ? -0.025  10.080  -19.681 1.00 20.74 ?  9   DG  T C2    1 
ATOM   2816 N  N2    . DG  B 2  9   ? 1.267   10.410  -19.836 1.00 15.96 ?  9   DG  T N2    1 
ATOM   2817 N  N3    . DG  B 2  9   ? -0.697  10.528  -18.629 1.00 18.83 ?  9   DG  T N3    1 
ATOM   2818 C  C4    . DG  B 2  9   ? -1.985  10.102  -18.634 1.00 21.93 ?  9   DG  T C4    1 
ATOM   2819 O  "O5'" . DC  C 3  1   ? 5.442   6.034   -26.245 1.00 29.23 ?  1   DC  P "O5'" 1 
ATOM   2820 C  "C5'" . DC  C 3  1   ? 6.480   6.997   -26.279 1.00 22.61 ?  1   DC  P "C5'" 1 
ATOM   2821 C  "C4'" . DC  C 3  1   ? 6.285   8.036   -25.192 1.00 25.57 ?  1   DC  P "C4'" 1 
ATOM   2822 O  "O4'" . DC  C 3  1   ? 5.022   8.729   -25.386 1.00 24.20 ?  1   DC  P "O4'" 1 
ATOM   2823 C  "C3'" . DC  C 3  1   ? 6.191   7.478   -23.785 1.00 23.37 ?  1   DC  P "C3'" 1 
ATOM   2824 O  "O3'" . DC  C 3  1   ? 7.473   7.216   -23.245 1.00 24.71 ?  1   DC  P "O3'" 1 
ATOM   2825 C  "C2'" . DC  C 3  1   ? 5.457   8.596   -23.059 1.00 22.06 ?  1   DC  P "C2'" 1 
ATOM   2826 C  "C1'" . DC  C 3  1   ? 4.469   9.074   -24.119 1.00 25.10 ?  1   DC  P "C1'" 1 
ATOM   2827 N  N1    . DC  C 3  1   ? 3.130   8.444   -23.985 1.00 21.32 ?  1   DC  P N1    1 
ATOM   2828 C  C2    . DC  C 3  1   ? 2.267   8.881   -22.979 1.00 19.66 ?  1   DC  P C2    1 
ATOM   2829 O  O2    . DC  C 3  1   ? 2.633   9.794   -22.232 1.00 21.38 ?  1   DC  P O2    1 
ATOM   2830 N  N3    . DC  C 3  1   ? 1.051   8.298   -22.856 1.00 19.98 ?  1   DC  P N3    1 
ATOM   2831 C  C4    . DC  C 3  1   ? 0.696   7.316   -23.683 1.00 19.48 ?  1   DC  P C4    1 
ATOM   2832 N  N4    . DC  C 3  1   ? -0.512  6.770   -23.520 1.00 17.70 ?  1   DC  P N4    1 
ATOM   2833 C  C5    . DC  C 3  1   ? 1.567   6.851   -24.714 1.00 21.52 ?  1   DC  P C5    1 
ATOM   2834 C  C6    . DC  C 3  1   ? 2.765   7.436   -24.824 1.00 18.38 ?  1   DC  P C6    1 
ATOM   2835 P  P     . DG  C 3  2   ? 7.666   6.035   -22.176 1.00 23.63 ?  2   DG  P P     1 
ATOM   2836 O  OP1   . DG  C 3  2   ? 9.113   5.975   -21.863 1.00 24.89 ?  2   DG  P OP1   1 
ATOM   2837 O  OP2   . DG  C 3  2   ? 6.984   4.821   -22.678 1.00 17.04 ?  2   DG  P OP2   1 
ATOM   2838 O  "O5'" . DG  C 3  2   ? 6.877   6.557   -20.889 1.00 19.47 ?  2   DG  P "O5'" 1 
ATOM   2839 C  "C5'" . DG  C 3  2   ? 7.357   7.686   -20.174 1.00 18.10 ?  2   DG  P "C5'" 1 
ATOM   2840 C  "C4'" . DG  C 3  2   ? 6.374   8.106   -19.099 1.00 15.77 ?  2   DG  P "C4'" 1 
ATOM   2841 O  "O4'" . DG  C 3  2   ? 5.113   8.487   -19.706 1.00 22.63 ?  2   DG  P "O4'" 1 
ATOM   2842 C  "C3'" . DG  C 3  2   ? 5.995   7.024   -18.105 1.00 15.18 ?  2   DG  P "C3'" 1 
ATOM   2843 O  "O3'" . DG  C 3  2   ? 6.975   6.876   -17.093 1.00 16.72 ?  2   DG  P "O3'" 1 
ATOM   2844 C  "C2'" . DG  C 3  2   ? 4.673   7.554   -17.574 1.00 15.26 ?  2   DG  P "C2'" 1 
ATOM   2845 C  "C1'" . DG  C 3  2   ? 4.043   8.158   -18.827 1.00 17.56 ?  2   DG  P "C1'" 1 
ATOM   2846 N  N9    . DG  C 3  2   ? 3.140   7.239   -19.508 1.00 16.52 ?  2   DG  P N9    1 
ATOM   2847 C  C8    . DG  C 3  2   ? 3.422   6.467   -20.606 1.00 24.14 ?  2   DG  P C8    1 
ATOM   2848 N  N7    . DG  C 3  2   ? 2.420   5.728   -20.990 1.00 23.22 ?  2   DG  P N7    1 
ATOM   2849 C  C5    . DG  C 3  2   ? 1.413   6.024   -20.083 1.00 19.39 ?  2   DG  P C5    1 
ATOM   2850 C  C6    . DG  C 3  2   ? 0.092   5.528   -19.995 1.00 21.96 ?  2   DG  P C6    1 
ATOM   2851 O  O6    . DG  C 3  2   ? -0.469  4.699   -20.725 1.00 22.06 ?  2   DG  P O6    1 
ATOM   2852 N  N1    . DG  C 3  2   ? -0.599  6.091   -18.928 1.00 14.51 ?  2   DG  P N1    1 
ATOM   2853 C  C2    . DG  C 3  2   ? -0.082  7.013   -18.056 1.00 20.33 ?  2   DG  P C2    1 
ATOM   2854 N  N2    . DG  C 3  2   ? -0.906  7.437   -17.090 1.00 13.75 ?  2   DG  P N2    1 
ATOM   2855 N  N3    . DG  C 3  2   ? 1.156   7.488   -18.124 1.00 16.52 ?  2   DG  P N3    1 
ATOM   2856 C  C4    . DG  C 3  2   ? 1.842   6.951   -19.163 1.00 17.58 ?  2   DG  P C4    1 
ATOM   2857 P  P     . DT  C 3  3   ? 7.054   5.502   -16.263 1.00 16.48 ?  3   DT  P P     1 
ATOM   2858 O  OP1   . DT  C 3  3   ? 8.198   5.606   -15.328 1.00 16.22 ?  3   DT  P OP1   1 
ATOM   2859 O  OP2   . DT  C 3  3   ? 6.991   4.397   -17.241 1.00 13.40 ?  3   DT  P OP2   1 
ATOM   2860 O  "O5'" . DT  C 3  3   ? 5.674   5.464   -15.449 1.00 14.77 ?  3   DT  P "O5'" 1 
ATOM   2861 C  "C5'" . DT  C 3  3   ? 5.408   6.426   -14.443 1.00 14.26 ?  3   DT  P "C5'" 1 
ATOM   2862 C  "C4'" . DT  C 3  3   ? 4.012   6.242   -13.865 1.00 13.76 ?  3   DT  P "C4'" 1 
ATOM   2863 O  "O4'" . DT  C 3  3   ? 3.024   6.417   -14.912 1.00 14.90 ?  3   DT  P "O4'" 1 
ATOM   2864 C  "C3'" . DT  C 3  3   ? 3.715   4.866   -13.290 1.00 10.53 ?  3   DT  P "C3'" 1 
ATOM   2865 O  "O3'" . DT  C 3  3   ? 4.177   4.745   -11.962 1.00 12.69 ?  3   DT  P "O3'" 1 
ATOM   2866 C  "C2'" . DT  C 3  3   ? 2.197   4.817   -13.373 1.00 11.81 ?  3   DT  P "C2'" 1 
ATOM   2867 C  "C1'" . DT  C 3  3   ? 1.909   5.566   -14.668 1.00 15.45 ?  3   DT  P "C1'" 1 
ATOM   2868 N  N1    . DT  C 3  3   ? 1.734   4.664   -15.826 1.00 15.03 ?  3   DT  P N1    1 
ATOM   2869 C  C2    . DT  C 3  3   ? 0.504   4.101   -16.053 1.00 16.96 ?  3   DT  P C2    1 
ATOM   2870 O  O2    . DT  C 3  3   ? -0.465  4.319   -15.354 1.00 14.63 ?  3   DT  P O2    1 
ATOM   2871 N  N3    . DT  C 3  3   ? 0.444   3.278   -17.142 1.00 12.70 ?  3   DT  P N3    1 
ATOM   2872 C  C4    . DT  C 3  3   ? 1.473   2.955   -17.997 1.00 18.09 ?  3   DT  P C4    1 
ATOM   2873 O  O4    . DT  C 3  3   ? 1.320   2.196   -18.946 1.00 23.93 ?  3   DT  P O4    1 
ATOM   2874 C  C5    . DT  C 3  3   ? 2.745   3.573   -17.694 1.00 15.86 ?  3   DT  P C5    1 
ATOM   2875 C  C7    . DT  C 3  3   ? 3.940   3.304   -18.553 1.00 16.39 ?  3   DT  P C7    1 
ATOM   2876 C  C6    . DT  C 3  3   ? 2.812   4.386   -16.635 1.00 16.41 ?  3   DT  P C6    1 
ATOM   2877 P  P     . DA  C 3  4   ? 5.461   3.842   -11.609 1.00 15.84 ?  4   DA  P P     1 
ATOM   2878 O  OP1   . DA  C 3  4   ? 5.325   3.472   -10.186 1.00 13.56 ?  4   DA  P OP1   1 
ATOM   2879 O  OP2   . DA  C 3  4   ? 6.675   4.568   -12.054 1.00 22.47 ?  4   DA  P OP2   1 
ATOM   2880 O  "O5'" . DA  C 3  4   ? 5.297   2.529   -12.501 1.00 16.57 ?  4   DA  P "O5'" 1 
ATOM   2881 C  "C5'" . DA  C 3  4   ? 6.086   1.377   -12.199 1.00 15.41 ?  4   DA  P "C5'" 1 
ATOM   2882 C  "C4'" . DA  C 3  4   ? 6.357   0.541   -13.439 1.00 19.72 ?  4   DA  P "C4'" 1 
ATOM   2883 O  "O4'" . DA  C 3  4   ? 5.135   -0.132  -13.846 1.00 19.38 ?  4   DA  P "O4'" 1 
ATOM   2884 C  "C3'" . DA  C 3  4   ? 6.806   1.318   -14.669 1.00 21.70 ?  4   DA  P "C3'" 1 
ATOM   2885 O  "O3'" . DA  C 3  4   ? 7.614   0.488   -15.510 1.00 23.66 ?  4   DA  P "O3'" 1 
ATOM   2886 C  "C2'" . DA  C 3  4   ? 5.473   1.678   -15.315 1.00 20.08 ?  4   DA  P "C2'" 1 
ATOM   2887 C  "C1'" . DA  C 3  4   ? 4.681   0.395   -15.086 1.00 21.50 ?  4   DA  P "C1'" 1 
ATOM   2888 N  N9    . DA  C 3  4   ? 3.234   0.551   -14.995 1.00 20.16 ?  4   DA  P N9    1 
ATOM   2889 C  C8    . DA  C 3  4   ? 2.528   1.129   -13.974 1.00 18.18 ?  4   DA  P C8    1 
ATOM   2890 N  N7    . DA  C 3  4   ? 1.227   1.088   -14.141 1.00 16.47 ?  4   DA  P N7    1 
ATOM   2891 C  C5    . DA  C 3  4   ? 1.069   0.421   -15.344 1.00 15.85 ?  4   DA  P C5    1 
ATOM   2892 C  C6    . DA  C 3  4   ? -0.071  0.049   -16.080 1.00 20.95 ?  4   DA  P C6    1 
ATOM   2893 N  N6    . DA  C 3  4   ? -1.322  0.313   -15.685 1.00 18.41 ?  4   DA  P N6    1 
ATOM   2894 N  N1    . DA  C 3  4   ? 0.123   -0.606  -17.243 1.00 14.28 ?  4   DA  P N1    1 
ATOM   2895 C  C2    . DA  C 3  4   ? 1.373   -0.870  -17.636 1.00 16.15 ?  4   DA  P C2    1 
ATOM   2896 N  N3    . DA  C 3  4   ? 2.522   -0.574  -17.030 1.00 17.69 ?  4   DA  P N3    1 
ATOM   2897 C  C4    . DA  C 3  4   ? 2.297   0.078   -15.879 1.00 19.04 ?  4   DA  P C4    1 
ATOM   2898 P  P     . U   C 3  5   ? 9.105   0.909   -15.951 1.00 23.62 ?  5   U   P P     1 
ATOM   2899 O  OP1   . U   C 3  5   ? 9.314   2.369   -15.678 1.00 20.38 ?  5   U   P OP1   1 
ATOM   2900 O  OP2   . U   C 3  5   ? 9.182   0.458   -17.365 1.00 27.48 ?  5   U   P OP2   1 
ATOM   2901 O  "O5'" . U   C 3  5   ? 10.031  -0.055  -15.088 1.00 26.92 ?  5   U   P "O5'" 1 
ATOM   2902 C  "C5'" . U   C 3  5   ? 10.415  0.120   -13.727 1.00 30.75 ?  5   U   P "C5'" 1 
ATOM   2903 C  "C4'" . U   C 3  5   ? 11.532  -0.874  -13.462 1.00 40.78 ?  5   U   P "C4'" 1 
ATOM   2904 O  OP3   . DG  D 4  1   ? 14.406  -18.799 -26.721 1.00 21.71 ?  1   DG  D OP3   1 
ATOM   2905 P  P     . DG  D 4  1   ? 13.751  -17.597 -27.286 1.00 24.97 ?  1   DG  D P     1 
ATOM   2906 O  OP1   . DG  D 4  1   ? 14.681  -16.462 -27.132 1.00 18.33 ?  1   DG  D OP1   1 
ATOM   2907 O  OP2   . DG  D 4  1   ? 13.243  -17.942 -28.625 1.00 23.69 ?  1   DG  D OP2   1 
ATOM   2908 O  "O5'" . DG  D 4  1   ? 12.465  -17.288 -26.389 1.00 25.97 ?  1   DG  D "O5'" 1 
ATOM   2909 C  "C5'" . DG  D 4  1   ? 12.610  -17.057 -25.003 1.00 19.88 ?  1   DG  D "C5'" 1 
ATOM   2910 C  "C4'" . DG  D 4  1   ? 11.630  -17.896 -24.206 1.00 20.23 ?  1   DG  D "C4'" 1 
ATOM   2911 O  "O4'" . DG  D 4  1   ? 10.283  -17.382 -24.382 1.00 19.10 ?  1   DG  D "O4'" 1 
ATOM   2912 C  "C3'" . DG  D 4  1   ? 11.545  -19.351 -24.615 1.00 16.73 ?  1   DG  D "C3'" 1 
ATOM   2913 O  "O3'" . DG  D 4  1   ? 11.164  -20.136 -23.503 1.00 17.83 ?  1   DG  D "O3'" 1 
ATOM   2914 C  "C2'" . DG  D 4  1   ? 10.489  -19.331 -25.716 1.00 17.37 ?  1   DG  D "C2'" 1 
ATOM   2915 C  "C1'" . DG  D 4  1   ? 9.543   -18.221 -25.255 1.00 16.86 ?  1   DG  D "C1'" 1 
ATOM   2916 N  N9    . DG  D 4  1   ? 9.009   -17.380 -26.323 1.00 21.75 ?  1   DG  D N9    1 
ATOM   2917 C  C8    . DG  D 4  1   ? 9.640   -17.006 -27.489 1.00 23.63 ?  1   DG  D C8    1 
ATOM   2918 N  N7    . DG  D 4  1   ? 8.919   -16.220 -28.239 1.00 18.67 ?  1   DG  D N7    1 
ATOM   2919 C  C5    . DG  D 4  1   ? 7.740   -16.049 -27.518 1.00 20.40 ?  1   DG  D C5    1 
ATOM   2920 C  C6    . DG  D 4  1   ? 6.582   -15.298 -27.829 1.00 19.63 ?  1   DG  D C6    1 
ATOM   2921 O  O6    . DG  D 4  1   ? 6.362   -14.609 -28.832 1.00 19.27 ?  1   DG  D O6    1 
ATOM   2922 N  N1    . DG  D 4  1   ? 5.619   -15.396 -26.830 1.00 17.58 ?  1   DG  D N1    1 
ATOM   2923 C  C2    . DG  D 4  1   ? 5.754   -16.128 -25.677 1.00 17.47 ?  1   DG  D C2    1 
ATOM   2924 N  N2    . DG  D 4  1   ? 4.712   -16.101 -24.833 1.00 16.88 ?  1   DG  D N2    1 
ATOM   2925 N  N3    . DG  D 4  1   ? 6.834   -16.837 -25.371 1.00 16.70 ?  1   DG  D N3    1 
ATOM   2926 C  C4    . DG  D 4  1   ? 7.782   -16.753 -26.338 1.00 19.75 ?  1   DG  D C4    1 
ATOM   2927 P  P     . DC  D 4  2   ? 11.271  -21.735 -23.538 1.00 21.88 ?  2   DC  D P     1 
ATOM   2928 O  OP1   . DC  D 4  2   ? 11.769  -22.134 -22.200 1.00 21.35 ?  2   DC  D OP1   1 
ATOM   2929 O  OP2   . DC  D 4  2   ? 11.992  -22.163 -24.757 1.00 22.22 ?  2   DC  D OP2   1 
ATOM   2930 O  "O5'" . DC  D 4  2   ? 9.752   -22.197 -23.660 1.00 16.83 ?  2   DC  D "O5'" 1 
ATOM   2931 C  "C5'" . DC  D 4  2   ? 8.874   -21.933 -22.589 1.00 18.60 ?  2   DC  D "C5'" 1 
ATOM   2932 C  "C4'" . DC  D 4  2   ? 7.456   -21.663 -23.064 1.00 20.95 ?  2   DC  D "C4'" 1 
ATOM   2933 O  "O4'" . DC  D 4  2   ? 7.439   -20.771 -24.189 1.00 20.28 ?  2   DC  D "O4'" 1 
ATOM   2934 C  "C3'" . DC  D 4  2   ? 6.679   -22.887 -23.540 1.00 17.80 ?  2   DC  D "C3'" 1 
ATOM   2935 O  "O3'" . DC  D 4  2   ? 5.908   -23.390 -22.463 1.00 20.42 ?  2   DC  D "O3'" 1 
ATOM   2936 C  "C2'" . DC  D 4  2   ? 5.820   -22.351 -24.707 1.00 21.97 ?  2   DC  D "C2'" 1 
ATOM   2937 C  "C1'" . DC  D 4  2   ? 6.142   -20.858 -24.718 1.00 20.17 ?  2   DC  D "C1'" 1 
ATOM   2938 N  N1    . DC  D 4  2   ? 6.105   -20.203 -26.062 1.00 18.26 ?  2   DC  D N1    1 
ATOM   2939 C  C2    . DC  D 4  2   ? 5.006   -19.405 -26.411 1.00 18.22 ?  2   DC  D C2    1 
ATOM   2940 O  O2    . DC  D 4  2   ? 4.072   -19.277 -25.611 1.00 17.33 ?  2   DC  D O2    1 
ATOM   2941 N  N3    . DC  D 4  2   ? 4.993   -18.799 -27.622 1.00 18.47 ?  2   DC  D N3    1 
ATOM   2942 C  C4    . DC  D 4  2   ? 6.018   -18.963 -28.461 1.00 25.71 ?  2   DC  D C4    1 
ATOM   2943 N  N4    . DC  D 4  2   ? 5.961   -18.347 -29.647 1.00 19.87 ?  2   DC  D N4    1 
ATOM   2944 C  C5    . DC  D 4  2   ? 7.147   -19.764 -28.121 1.00 18.95 ?  2   DC  D C5    1 
ATOM   2945 C  C6    . DC  D 4  2   ? 7.151   -20.355 -26.922 1.00 21.74 ?  2   DC  D C6    1 
ATOM   2946 P  P     A DC  D 4  3   ? 5.215   -24.834 -22.549 0.35 20.53 ?  3   DC  D P     1 
ATOM   2947 P  P     B DC  D 4  3   ? 4.913   -24.631 -22.672 0.65 19.57 ?  3   DC  D P     1 
ATOM   2948 O  OP1   A DC  D 4  3   ? 5.273   -25.424 -21.193 0.35 18.71 ?  3   DC  D OP1   1 
ATOM   2949 O  OP1   B DC  D 4  3   ? 4.669   -25.214 -21.333 0.65 18.04 ?  3   DC  D OP1   1 
ATOM   2950 O  OP2   A DC  D 4  3   ? 5.790   -25.563 -23.702 0.35 22.90 ?  3   DC  D OP2   1 
ATOM   2951 O  OP2   B DC  D 4  3   ? 5.426   -25.481 -23.770 0.65 22.65 ?  3   DC  D OP2   1 
ATOM   2952 O  "O5'" A DC  D 4  3   ? 3.693   -24.498 -22.885 0.35 19.70 ?  3   DC  D "O5'" 1 
ATOM   2953 O  "O5'" B DC  D 4  3   ? 3.571   -23.946 -23.177 0.65 18.21 ?  3   DC  D "O5'" 1 
ATOM   2954 C  "C5'" A DC  D 4  3   ? 2.924   -23.720 -21.979 0.35 18.90 ?  3   DC  D "C5'" 1 
ATOM   2955 C  "C5'" B DC  D 4  3   ? 3.011   -22.883 -22.433 0.65 17.19 ?  3   DC  D "C5'" 1 
ATOM   2956 C  "C4'" A DC  D 4  3   ? 1.595   -23.345 -22.597 0.35 22.06 ?  3   DC  D "C4'" 1 
ATOM   2957 C  "C4'" B DC  D 4  3   ? 1.538   -22.742 -22.737 0.65 21.64 ?  3   DC  D "C4'" 1 
ATOM   2958 O  "O4'" A DC  D 4  3   ? 1.830   -22.423 -23.683 0.35 20.12 ?  3   DC  D "O4'" 1 
ATOM   2959 O  "O4'" B DC  D 4  3   ? 1.370   -21.935 -23.933 0.65 22.71 ?  3   DC  D "O4'" 1 
ATOM   2960 C  "C3'" A DC  D 4  3   ? 0.831   -24.526 -23.188 0.35 24.81 ?  3   DC  D "C3'" 1 
ATOM   2961 C  "C3'" B DC  D 4  3   ? 0.823   -24.058 -23.009 0.65 24.65 ?  3   DC  D "C3'" 1 
ATOM   2962 O  "O3'" A DC  D 4  3   ? -0.228  -24.960 -22.295 0.35 30.15 ?  3   DC  D "O3'" 1 
ATOM   2963 O  "O3'" B DC  D 4  3   ? -0.499  -24.028 -22.480 0.65 27.68 ?  3   DC  D "O3'" 1 
ATOM   2964 C  "C2'" A DC  D 4  3   ? 0.311   -24.031 -24.547 0.35 24.03 ?  3   DC  D "C2'" 1 
ATOM   2965 C  "C2'" B DC  D 4  3   ? 0.856   -24.172 -24.533 0.65 22.48 ?  3   DC  D "C2'" 1 
ATOM   2966 C  "C1'" A DC  D 4  3   ? 0.903   -22.632 -24.723 0.35 24.15 ?  3   DC  D "C1'" 1 
ATOM   2967 C  "C1'" B DC  D 4  3   ? 0.851   -22.713 -24.998 0.65 25.07 ?  3   DC  D "C1'" 1 
ATOM   2968 N  N1    A DC  D 4  3   ? 1.624   -22.436 -26.024 0.35 23.70 ?  3   DC  D N1    1 
ATOM   2969 N  N1    B DC  D 4  3   ? 1.685   -22.421 -26.236 0.65 23.19 ?  3   DC  D N1    1 
ATOM   2970 C  C2    A DC  D 4  3   ? 1.115   -21.546 -26.980 0.35 22.20 ?  3   DC  D C2    1 
ATOM   2971 C  C2    B DC  D 4  3   ? 1.241   -21.453 -27.145 0.65 20.82 ?  3   DC  D C2    1 
ATOM   2972 O  O2    A DC  D 4  3   ? 0.062   -20.941 -26.745 0.35 22.66 ?  3   DC  D O2    1 
ATOM   2973 O  O2    B DC  D 4  3   ? 0.164   -20.882 -26.937 0.65 22.82 ?  3   DC  D O2    1 
ATOM   2974 N  N3    A DC  D 4  3   ? 1.792   -21.378 -28.143 0.35 19.30 ?  3   DC  D N3    1 
ATOM   2975 N  N3    B DC  D 4  3   ? 1.996   -21.176 -28.235 0.65 19.32 ?  3   DC  D N3    1 
ATOM   2976 C  C4    A DC  D 4  3   ? 2.925   -22.048 -28.361 0.35 21.17 ?  3   DC  D C4    1 
ATOM   2977 C  C4    B DC  D 4  3   ? 3.151   -21.811 -28.429 0.65 19.51 ?  3   DC  D C4    1 
ATOM   2978 N  N4    A DC  D 4  3   ? 3.556   -21.849 -29.522 0.35 22.16 ?  3   DC  D N4    1 
ATOM   2979 N  N4    B DC  D 4  3   ? 3.858   -21.500 -29.521 0.65 20.22 ?  3   DC  D N4    1 
ATOM   2980 C  C5    A DC  D 4  3   ? 3.459   -22.954 -27.399 0.35 19.90 ?  3   DC  D C5    1 
ATOM   2981 C  C5    B DC  D 4  3   ? 3.630   -22.794 -27.515 0.65 19.01 ?  3   DC  D C5    1 
ATOM   2982 C  C6    A DC  D 4  3   ? 2.784   -23.113 -26.256 0.35 21.27 ?  3   DC  D C6    1 
ATOM   2983 C  C6    B DC  D 4  3   ? 2.878   -23.060 -26.438 0.65 20.87 ?  3   DC  D C6    1 
ATOM   2984 P  P     A DG  D 4  4   ? -1.529  -24.054 -22.009 0.35 27.84 ?  4   DG  D P     1 
ATOM   2985 P  P     B DG  D 4  4   ? -1.381  -25.371 -22.420 0.65 32.09 ?  4   DG  D P     1 
ATOM   2986 O  OP1   A DG  D 4  4   ? -1.166  -22.624 -22.094 0.35 24.58 ?  4   DG  D OP1   1 
ATOM   2987 O  OP1   B DG  D 4  4   ? -2.077  -25.381 -21.117 0.65 28.38 ?  4   DG  D OP1   1 
ATOM   2988 O  OP2   A DG  D 4  4   ? -2.149  -24.578 -20.774 0.35 28.99 ?  4   DG  D OP2   1 
ATOM   2989 O  OP2   B DG  D 4  4   ? -0.520  -26.512 -22.812 0.65 32.09 ?  4   DG  D OP2   1 
ATOM   2990 O  "O5'" A DG  D 4  4   ? -2.516  -24.405 -23.218 0.35 32.36 ?  4   DG  D "O5'" 1 
ATOM   2991 O  "O5'" B DG  D 4  4   ? -2.466  -25.152 -23.573 0.65 35.23 ?  4   DG  D "O5'" 1 
ATOM   2992 C  "C5'" A DG  D 4  4   ? -3.255  -23.371 -23.857 0.35 30.37 ?  4   DG  D "C5'" 1 
ATOM   2993 C  "C5'" B DG  D 4  4   ? -3.068  -23.872 -23.737 0.65 31.23 ?  4   DG  D "C5'" 1 
ATOM   2994 C  "C4'" A DG  D 4  4   ? -3.842  -23.848 -25.177 0.35 27.64 ?  4   DG  D "C4'" 1 
ATOM   2995 C  "C4'" B DG  D 4  4   ? -3.792  -23.781 -25.066 0.65 27.59 ?  4   DG  D "C4'" 1 
ATOM   2996 O  "O4'" A DG  D 4  4   ? -2.910  -23.551 -26.257 0.35 26.07 ?  4   DG  D "O4'" 1 
ATOM   2997 O  "O4'" B DG  D 4  4   ? -2.834  -23.450 -26.114 0.65 25.89 ?  4   DG  D "O4'" 1 
ATOM   2998 C  "C3'" A DG  D 4  4   ? -4.119  -25.357 -25.258 0.35 27.39 ?  4   DG  D "C3'" 1 
ATOM   2999 C  "C3'" B DG  D 4  4   ? -4.474  -25.073 -25.511 0.65 27.93 ?  4   DG  D "C3'" 1 
ATOM   3000 O  "O3'" A DG  D 4  4   ? -5.442  -25.602 -25.726 0.35 27.89 ?  4   DG  D "O3'" 1 
ATOM   3001 O  "O3'" B DG  D 4  4   ? -5.745  -24.797 -26.092 0.65 28.63 ?  4   DG  D "O3'" 1 
ATOM   3002 C  "C2'" A DG  D 4  4   ? -3.059  -25.869 -26.230 0.35 26.40 ?  4   DG  D "C2'" 1 
ATOM   3003 C  "C2'" B DG  D 4  4   ? -3.489  -25.657 -26.517 0.65 27.27 ?  4   DG  D "C2'" 1 
ATOM   3004 C  "C1'" A DG  D 4  4   ? -2.838  -24.661 -27.121 0.35 27.32 ?  4   DG  D "C1'" 1 
ATOM   3005 C  "C1'" B DG  D 4  4   ? -2.913  -24.403 -27.152 0.65 26.99 ?  4   DG  D "C1'" 1 
ATOM   3006 N  N9    A DG  D 4  4   ? -1.552  -24.647 -27.823 0.35 26.04 ?  4   DG  D N9    1 
ATOM   3007 N  N9    B DG  D 4  4   ? -1.585  -24.574 -27.740 0.65 26.87 ?  4   DG  D N9    1 
ATOM   3008 C  C8    A DG  D 4  4   ? -0.437  -25.395 -27.531 0.35 22.72 ?  4   DG  D C8    1 
ATOM   3009 C  C8    B DG  D 4  4   ? -0.584  -25.412 -27.312 0.65 22.01 ?  4   DG  D C8    1 
ATOM   3010 N  N7    A DG  D 4  4   ? 0.565   -25.172 -28.336 0.35 21.03 ?  4   DG  D N7    1 
ATOM   3011 N  N7    B DG  D 4  4   ? 0.497   -25.344 -28.039 0.65 20.51 ?  4   DG  D N7    1 
ATOM   3012 C  C5    A DG  D 4  4   ? 0.083   -24.222 -29.225 0.35 22.12 ?  4   DG  D C5    1 
ATOM   3013 C  C5    B DG  D 4  4   ? 0.193   -24.404 -29.014 0.65 21.41 ?  4   DG  D C5    1 
ATOM   3014 C  C6    A DG  D 4  4   ? 0.720   -23.596 -30.324 0.35 22.68 ?  4   DG  D C6    1 
ATOM   3015 C  C6    B DG  D 4  4   ? 0.978   -23.915 -30.084 0.65 21.99 ?  4   DG  D C6    1 
ATOM   3016 O  O6    A DG  D 4  4   ? 1.874   -23.766 -30.740 0.35 22.79 ?  4   DG  D O6    1 
ATOM   3017 O  O6    B DG  D 4  4   ? 2.136   -24.228 -30.392 0.65 22.12 ?  4   DG  D O6    1 
ATOM   3018 N  N1    A DG  D 4  4   ? -0.125  -22.691 -30.962 0.35 22.39 ?  4   DG  D N1    1 
ATOM   3019 N  N1    B DG  D 4  4   ? 0.289   -22.967 -30.839 0.65 22.93 ?  4   DG  D N1    1 
ATOM   3020 C  C2    A DG  D 4  4   ? -1.420  -22.423 -30.585 0.35 24.41 ?  4   DG  D C2    1 
ATOM   3021 C  C2    B DG  D 4  4   ? -0.994  -22.544 -30.587 0.65 25.04 ?  4   DG  D C2    1 
ATOM   3022 N  N2    A DG  D 4  4   ? -2.078  -21.517 -31.324 0.35 24.07 ?  4   DG  D N2    1 
ATOM   3023 N  N2    B DG  D 4  4   ? -1.490  -21.620 -31.423 0.65 22.79 ?  4   DG  D N2    1 
ATOM   3024 N  N3    A DG  D 4  4   ? -2.029  -23.002 -29.556 0.35 22.92 ?  4   DG  D N3    1 
ATOM   3025 N  N3    B DG  D 4  4   ? -1.741  -22.993 -29.583 0.65 23.12 ?  4   DG  D N3    1 
ATOM   3026 C  C4    A DG  D 4  4   ? -1.219  -23.888 -28.924 0.35 24.34 ?  4   DG  D C4    1 
ATOM   3027 C  C4    B DG  D 4  4   ? -1.084  -23.919 -28.842 0.65 24.65 ?  4   DG  D C4    1 
HETATM 3028 MG MG    . MG  E 5  .   ? 2.341   2.246   -7.312  1.00 12.43 2  501 MG  A MG    1 
HETATM 3029 MG MG    . MG  F 5  .   ? 3.694   -0.353  -5.034  1.00 10.13 2  502 MG  A MG    1 
HETATM 3030 NA NA    . NA  G 6  .   ? 10.108  4.361   -15.101 1.00 6.65  1  503 NA  A NA    1 
HETATM 3031 CL CL    . CL  H 7  .   ? -8.281  -21.946 -8.674  0.68 26.72 -1 504 CL  A CL    1 
HETATM 3032 CL CL    . CL  I 7  .   ? 0.662   -15.598 -23.716 0.53 17.70 -1 505 CL  A CL    1 
HETATM 3033 P  PA    . UTP J 8  .   ? 3.390   -0.954  -8.225  1.00 13.87 ?  506 UTP A PA    1 
HETATM 3034 O  O1A   . UTP J 8  .   ? 4.189   -0.507  -9.424  1.00 13.35 ?  506 UTP A O1A   1 
HETATM 3035 O  O2A   . UTP J 8  .   ? 3.309   0.057   -7.100  1.00 8.80  ?  506 UTP A O2A   1 
HETATM 3036 O  O3A   . UTP J 8  .   ? 4.028   -2.350  -7.737  1.00 12.50 ?  506 UTP A O3A   1 
HETATM 3037 O  "O5'" . UTP J 8  .   ? 1.910   -1.292  -8.748  1.00 13.13 ?  506 UTP A "O5'" 1 
HETATM 3038 P  PB    . UTP J 8  .   ? 3.877   -3.130  -6.337  1.00 10.85 ?  506 UTP A PB    1 
HETATM 3039 O  O1B   . UTP J 8  .   ? 3.185   -2.310  -5.269  1.00 8.81  ?  506 UTP A O1B   1 
HETATM 3040 O  O2B   . UTP J 8  .   ? 3.179   -4.450  -6.576  1.00 11.51 ?  506 UTP A O2B   1 
HETATM 3041 O  O3B   . UTP J 8  .   ? 5.405   -3.411  -5.939  1.00 12.56 ?  506 UTP A O3B   1 
HETATM 3042 P  PG    . UTP J 8  .   ? 6.426   -2.246  -5.494  1.00 15.08 ?  506 UTP A PG    1 
HETATM 3043 O  O1G   . UTP J 8  .   ? 5.668   -0.938  -5.491  1.00 12.40 ?  506 UTP A O1G   1 
HETATM 3044 O  O2G   . UTP J 8  .   ? 7.464   -2.236  -6.599  1.00 15.06 ?  506 UTP A O2G   1 
HETATM 3045 O  O3G   . UTP J 8  .   ? 6.991   -2.653  -4.161  1.00 18.29 ?  506 UTP A O3G   1 
HETATM 3046 C  "C5'" . UTP J 8  .   ? 0.877   -1.512  -7.787  1.00 9.13  ?  506 UTP A "C5'" 1 
HETATM 3047 C  "C4'" . UTP J 8  .   ? -0.172  -2.403  -8.388  1.00 8.38  ?  506 UTP A "C4'" 1 
HETATM 3048 O  "O4'" . UTP J 8  .   ? -0.658  -1.809  -9.616  1.00 11.85 ?  506 UTP A "O4'" 1 
HETATM 3049 C  "C1'" . UTP J 8  .   ? -0.982  -2.834  -10.529 1.00 10.48 ?  506 UTP A "C1'" 1 
HETATM 3050 C  "C2'" . UTP J 8  .   ? -0.773  -4.170  -9.804  1.00 8.11  ?  506 UTP A "C2'" 1 
HETATM 3051 O  "O2'" . UTP J 8  .   ? -1.961  -4.495  -9.099  1.00 11.56 ?  506 UTP A "O2'" 1 
HETATM 3052 C  "C3'" . UTP J 8  .   ? 0.325   -3.766  -8.827  1.00 12.81 ?  506 UTP A "C3'" 1 
HETATM 3053 O  "O3'" . UTP J 8  .   ? 0.508   -4.634  -7.725  1.00 18.23 ?  506 UTP A "O3'" 1 
HETATM 3054 N  N1    . UTP J 8  .   ? -0.085  -2.734  -11.699 1.00 13.48 ?  506 UTP A N1    1 
HETATM 3055 C  C6    . UTP J 8  .   ? 1.130   -2.092  -11.642 1.00 15.46 ?  506 UTP A C6    1 
HETATM 3056 C  C2    . UTP J 8  .   ? -0.519  -3.347  -12.854 1.00 18.35 ?  506 UTP A C2    1 
HETATM 3057 O  O2    . UTP J 8  .   ? -1.590  -3.928  -12.923 1.00 17.04 ?  506 UTP A O2    1 
HETATM 3058 N  N3    . UTP J 8  .   ? 0.338   -3.247  -13.920 1.00 21.00 ?  506 UTP A N3    1 
HETATM 3059 C  C4    . UTP J 8  .   ? 1.565   -2.619  -13.941 1.00 17.54 ?  506 UTP A C4    1 
HETATM 3060 O  O4    . UTP J 8  .   ? 2.222   -2.620  -14.983 1.00 15.62 ?  506 UTP A O4    1 
HETATM 3061 C  C5    . UTP J 8  .   ? 1.949   -2.013  -12.700 1.00 14.82 ?  506 UTP A C5    1 
HETATM 3062 C  C1    . GOA K 9  .   ? 1.000   1.761   -9.721  1.00 34.03 ?  507 GOA A C1    1 
HETATM 3063 C  C2    . GOA K 9  .   ? 2.431   2.030   -10.224 1.00 24.90 ?  507 GOA A C2    1 
HETATM 3064 O  O11   . GOA K 9  .   ? 0.085   1.664   -10.605 1.00 37.02 ?  507 GOA A O11   1 
HETATM 3065 O  O12   . GOA K 9  .   ? 0.734   1.628   -8.475  1.00 16.85 ?  507 GOA A O12   1 
HETATM 3066 O  O2    . GOA K 9  .   ? 3.363   2.217   -9.194  1.00 13.06 ?  507 GOA A O2    1 
HETATM 3067 C  C1    . EDO L 10 .   ? 10.751  -30.332 -6.858  0.94 32.90 ?  508 EDO A C1    1 
HETATM 3068 O  O1    . EDO L 10 .   ? 9.888   -31.333 -7.408  0.94 38.65 ?  508 EDO A O1    1 
HETATM 3069 C  C2    . EDO L 10 .   ? 10.007  -29.005 -6.804  0.94 28.55 ?  508 EDO A C2    1 
HETATM 3070 O  O2    . EDO L 10 .   ? 8.909   -29.109 -5.886  0.94 28.75 ?  508 EDO A O2    1 
HETATM 3071 O  O     . HOH M 11 .   ? 13.709  -10.759 -9.631  1.00 29.39 ?  601 HOH A O     1 
HETATM 3072 O  O     . HOH M 11 .   ? 14.930  1.943   3.010   1.00 45.60 ?  602 HOH A O     1 
HETATM 3073 O  O     . HOH M 11 .   ? 5.518   -5.494  -19.737 0.92 31.35 ?  603 HOH A O     1 
HETATM 3074 O  O     . HOH M 11 .   ? 5.491   -2.798  -2.271  1.00 13.12 ?  604 HOH A O     1 
HETATM 3075 O  O     . HOH M 11 .   ? 13.226  -30.528 -3.433  1.00 24.47 ?  605 HOH A O     1 
HETATM 3076 O  O     . HOH M 11 .   ? -10.447 -9.633  -0.142  1.00 25.40 ?  606 HOH A O     1 
HETATM 3077 O  O     A HOH M 11 .   ? 9.575   6.166   8.813   0.57 22.24 ?  607 HOH A O     1 
HETATM 3078 O  O     B HOH M 11 .   ? 8.550   7.431   8.959   0.43 26.14 ?  607 HOH A O     1 
HETATM 3079 O  O     . HOH M 11 .   ? -14.092 -17.556 -0.836  1.00 19.19 ?  608 HOH A O     1 
HETATM 3080 O  O     A HOH M 11 .   ? 1.470   -18.652 -15.764 0.58 5.89  ?  609 HOH A O     1 
HETATM 3081 O  O     B HOH M 11 .   ? 3.230   -18.759 -14.310 0.42 6.32  ?  609 HOH A O     1 
HETATM 3082 O  O     . HOH M 11 .   ? 21.816  -0.402  -13.820 1.00 22.87 ?  610 HOH A O     1 
HETATM 3083 O  O     . HOH M 11 .   ? 2.881   -18.740 -9.716  1.00 19.50 ?  611 HOH A O     1 
HETATM 3084 O  O     . HOH M 11 .   ? -16.904 5.419   6.197   1.00 23.37 ?  612 HOH A O     1 
HETATM 3085 O  O     . HOH M 11 .   ? 1.512   -22.984 -5.113  1.00 18.91 ?  613 HOH A O     1 
HETATM 3086 O  O     . HOH M 11 .   ? -19.746 7.470   -8.902  0.91 24.38 ?  614 HOH A O     1 
HETATM 3087 O  O     . HOH M 11 .   ? -13.674 -11.425 2.194   1.00 12.53 ?  615 HOH A O     1 
HETATM 3088 O  O     . HOH M 11 .   ? 17.068  -14.748 -23.102 1.00 27.41 ?  616 HOH A O     1 
HETATM 3089 O  O     . HOH M 11 .   ? -1.473  -16.818 3.260   1.00 31.93 ?  617 HOH A O     1 
HETATM 3090 O  O     . HOH M 11 .   ? 20.066  -16.229 -9.523  1.00 29.34 ?  618 HOH A O     1 
HETATM 3091 O  O     A HOH M 11 .   ? 18.440  -5.997  -22.877 0.47 15.05 ?  619 HOH A O     1 
HETATM 3092 O  O     B HOH M 11 .   ? 19.679  -7.790  -23.610 0.53 17.82 ?  619 HOH A O     1 
HETATM 3093 O  O     . HOH M 11 .   ? 3.105   -14.808 1.299   1.00 14.78 ?  620 HOH A O     1 
HETATM 3094 O  O     . HOH M 11 .   ? 20.588  8.364   -7.489  1.00 35.67 ?  621 HOH A O     1 
HETATM 3095 O  O     . HOH M 11 .   ? 25.357  3.982   -16.526 1.00 33.76 ?  622 HOH A O     1 
HETATM 3096 O  O     . HOH M 11 .   ? 1.682   -0.374  -1.320  1.00 9.86  ?  623 HOH A O     1 
HETATM 3097 O  O     . HOH M 11 .   ? -18.714 -5.473  -13.216 1.00 16.59 ?  624 HOH A O     1 
HETATM 3098 O  O     . HOH M 11 .   ? -13.720 -19.054 -5.095  1.00 22.63 ?  625 HOH A O     1 
HETATM 3099 O  O     . HOH M 11 .   ? -21.554 1.030   0.917   1.00 29.32 ?  626 HOH A O     1 
HETATM 3100 O  O     . HOH M 11 .   ? 13.010  6.000   -9.296  1.00 32.59 ?  627 HOH A O     1 
HETATM 3101 O  O     . HOH M 11 .   ? 28.206  1.812   -25.804 1.00 41.83 ?  628 HOH A O     1 
HETATM 3102 O  O     . HOH M 11 .   ? -10.638 2.616   0.933   1.00 10.61 ?  629 HOH A O     1 
HETATM 3103 O  O     . HOH M 11 .   ? -8.117  -12.267 2.339   1.00 30.55 ?  630 HOH A O     1 
HETATM 3104 O  O     . HOH M 11 .   ? -9.331  4.562   -12.146 1.00 26.85 ?  631 HOH A O     1 
HETATM 3105 O  O     . HOH M 11 .   ? 23.670  -16.654 -13.348 1.00 21.05 ?  632 HOH A O     1 
HETATM 3106 O  O     . HOH M 11 .   ? 5.862   -22.052 -2.901  1.00 13.19 ?  633 HOH A O     1 
HETATM 3107 O  O     . HOH M 11 .   ? -12.681 1.293   -10.258 1.00 26.06 ?  634 HOH A O     1 
HETATM 3108 O  O     . HOH M 11 .   ? -19.549 -17.098 -13.333 1.00 42.34 ?  635 HOH A O     1 
HETATM 3109 O  O     . HOH M 11 .   ? 12.102  5.095   0.840   1.00 21.03 ?  636 HOH A O     1 
HETATM 3110 O  O     . HOH M 11 .   ? -20.950 12.997  2.173   0.99 29.23 ?  637 HOH A O     1 
HETATM 3111 O  O     . HOH M 11 .   ? 12.452  5.313   7.001   1.00 32.42 ?  638 HOH A O     1 
HETATM 3112 O  O     . HOH M 11 .   ? 9.981   -2.782  -6.055  1.00 26.11 ?  639 HOH A O     1 
HETATM 3113 O  O     . HOH M 11 .   ? -18.519 5.421   -3.493  1.00 11.92 ?  640 HOH A O     1 
HETATM 3114 O  O     . HOH M 11 .   ? 5.492   -9.599  -4.810  1.00 13.79 ?  641 HOH A O     1 
HETATM 3115 O  O     . HOH M 11 .   ? -4.966  -3.226  3.100   1.00 16.16 ?  642 HOH A O     1 
HETATM 3116 O  O     . HOH M 11 .   ? -18.268 -2.799  -11.926 1.00 19.66 ?  643 HOH A O     1 
HETATM 3117 O  O     . HOH M 11 .   ? -15.842 13.625  -3.379  0.72 24.38 ?  644 HOH A O     1 
HETATM 3118 O  O     . HOH M 11 .   ? 9.750   -3.066  6.757   1.00 37.89 ?  645 HOH A O     1 
HETATM 3119 O  O     . HOH M 11 .   ? 6.204   -26.516 1.056   1.00 20.04 ?  646 HOH A O     1 
HETATM 3120 O  O     . HOH M 11 .   ? 4.900   -10.163 5.606   1.00 42.52 ?  647 HOH A O     1 
HETATM 3121 O  O     . HOH M 11 .   ? -4.676  -8.768  -6.389  1.00 8.40  ?  648 HOH A O     1 
HETATM 3122 O  O     . HOH M 11 .   ? 13.439  -31.503 -17.499 0.71 25.23 ?  649 HOH A O     1 
HETATM 3123 O  O     . HOH M 11 .   ? 12.284  2.793   -3.455  1.00 23.29 ?  650 HOH A O     1 
HETATM 3124 O  O     A HOH M 11 .   ? -5.006  -11.735 3.891   0.59 14.24 ?  651 HOH A O     1 
HETATM 3125 O  O     . HOH M 11 .   ? 15.172  -8.356  -12.310 1.00 39.31 ?  652 HOH A O     1 
HETATM 3126 O  O     . HOH M 11 .   ? 21.262  11.050  -7.793  0.99 36.17 ?  653 HOH A O     1 
HETATM 3127 O  O     . HOH M 11 .   ? 11.274  -14.519 -5.775  1.00 25.35 ?  654 HOH A O     1 
HETATM 3128 O  O     . HOH M 11 .   ? -9.172  21.196  4.635   1.00 23.97 ?  655 HOH A O     1 
HETATM 3129 O  O     . HOH M 11 .   ? 4.092   -0.581  -2.991  1.00 11.89 ?  656 HOH A O     1 
HETATM 3130 O  O     . HOH M 11 .   ? 0.139   -9.513  5.014   1.00 35.13 ?  657 HOH A O     1 
HETATM 3131 O  O     . HOH M 11 .   ? 27.898  -8.503  -21.445 1.00 37.08 ?  658 HOH A O     1 
HETATM 3132 O  O     . HOH M 11 .   ? -20.399 -4.113  -7.906  1.00 25.93 ?  659 HOH A O     1 
HETATM 3133 O  O     . HOH M 11 .   ? -14.640 20.196  3.095   1.00 22.63 ?  660 HOH A O     1 
HETATM 3134 O  O     . HOH M 11 .   ? -9.881  -9.796  -19.157 1.00 16.71 ?  661 HOH A O     1 
HETATM 3135 O  O     . HOH M 11 .   ? 12.899  8.449   -10.281 1.00 18.55 ?  662 HOH A O     1 
HETATM 3136 O  O     . HOH M 11 .   ? 10.084  18.444  -5.588  1.00 23.25 ?  663 HOH A O     1 
HETATM 3137 O  O     . HOH M 11 .   ? 5.763   -10.886 -7.340  1.00 14.96 ?  664 HOH A O     1 
HETATM 3138 O  O     . HOH M 11 .   ? 3.259   -5.416  4.436   1.00 18.33 ?  665 HOH A O     1 
HETATM 3139 O  O     . HOH M 11 .   ? 11.533  13.509  -22.585 1.00 28.15 ?  666 HOH A O     1 
HETATM 3140 O  O     . HOH M 11 .   ? -8.011  -6.761  -12.308 1.00 14.25 ?  667 HOH A O     1 
HETATM 3141 O  O     . HOH M 11 .   ? 12.041  -29.190 -18.859 1.00 33.42 ?  668 HOH A O     1 
HETATM 3142 O  O     . HOH M 11 .   ? -12.390 -22.634 -13.303 1.00 41.13 ?  669 HOH A O     1 
HETATM 3143 O  O     . HOH M 11 .   ? 6.681   -20.114 1.447   1.00 25.65 ?  670 HOH A O     1 
HETATM 3144 O  O     . HOH M 11 .   ? -16.522 -17.894 -15.063 0.83 33.63 ?  671 HOH A O     1 
HETATM 3145 O  O     . HOH M 11 .   ? -22.114 -13.725 -3.668  1.00 33.57 ?  672 HOH A O     1 
HETATM 3146 O  O     . HOH M 11 .   ? 11.652  6.643   -1.246  1.00 14.72 ?  673 HOH A O     1 
HETATM 3147 O  O     . HOH M 11 .   ? 8.239   -11.286 -28.945 1.00 43.25 ?  674 HOH A O     1 
HETATM 3148 O  O     . HOH M 11 .   ? -0.509  -16.585 -7.449  1.00 13.91 ?  675 HOH A O     1 
HETATM 3149 O  O     . HOH M 11 .   ? 23.861  -19.656 -20.869 1.00 29.69 ?  676 HOH A O     1 
HETATM 3150 O  O     . HOH M 11 .   ? 14.289  13.431  -24.450 1.00 41.00 ?  677 HOH A O     1 
HETATM 3151 O  O     . HOH M 11 .   ? 6.920   -14.416 -4.672  1.00 16.70 ?  678 HOH A O     1 
HETATM 3152 O  O     . HOH M 11 .   ? 7.688   -13.555 -12.370 1.00 16.98 ?  679 HOH A O     1 
HETATM 3153 O  O     . HOH M 11 .   ? -19.345 13.379  3.942   1.00 26.49 ?  680 HOH A O     1 
HETATM 3154 O  O     . HOH M 11 .   ? -9.508  5.132   6.153   1.00 19.96 ?  681 HOH A O     1 
HETATM 3155 O  O     . HOH M 11 .   ? 20.325  -12.989 -23.758 1.00 36.94 ?  682 HOH A O     1 
HETATM 3156 O  O     . HOH M 11 .   ? -20.388 -2.722  -10.582 1.00 39.48 ?  683 HOH A O     1 
HETATM 3157 O  O     . HOH M 11 .   ? -24.101 10.229  -3.857  1.00 31.33 ?  684 HOH A O     1 
HETATM 3158 O  O     . HOH M 11 .   ? -15.565 -4.993  -0.925  0.83 25.51 ?  685 HOH A O     1 
HETATM 3159 O  O     . HOH M 11 .   ? 16.378  -12.043 -22.385 1.00 21.36 ?  686 HOH A O     1 
HETATM 3160 O  O     . HOH M 11 .   ? 9.380   -22.474 -4.327  1.00 11.91 ?  687 HOH A O     1 
HETATM 3161 O  O     . HOH M 11 .   ? 1.699   -20.787 -0.530  1.00 21.78 ?  688 HOH A O     1 
HETATM 3162 O  O     . HOH M 11 .   ? -13.802 -16.686 -3.611  1.00 27.07 ?  689 HOH A O     1 
HETATM 3163 O  O     . HOH M 11 .   ? -12.191 -20.432 -2.753  1.00 31.55 ?  690 HOH A O     1 
HETATM 3164 O  O     . HOH M 11 .   ? -10.661 -1.408  3.406   1.00 24.52 ?  691 HOH A O     1 
HETATM 3165 O  O     . HOH M 11 .   ? 9.528   10.647  -22.733 1.00 29.00 ?  692 HOH A O     1 
HETATM 3166 O  O     A HOH M 11 .   ? 10.666  -5.859  -4.950  0.52 13.35 ?  693 HOH A O     1 
HETATM 3167 O  O     B HOH M 11 .   ? 10.883  -5.285  -2.934  0.48 18.89 ?  693 HOH A O     1 
HETATM 3168 O  O     . HOH M 11 .   ? -3.381  -8.481  3.341   1.00 32.12 ?  694 HOH A O     1 
HETATM 3169 O  O     . HOH M 11 .   ? 17.082  -27.374 -22.657 1.00 32.27 ?  695 HOH A O     1 
HETATM 3170 O  O     . HOH M 11 .   ? -6.937  -19.740 -7.647  1.00 12.19 ?  696 HOH A O     1 
HETATM 3171 O  O     . HOH M 11 .   ? 10.732  4.336   -6.366  1.00 15.90 ?  697 HOH A O     1 
HETATM 3172 O  O     . HOH M 11 .   ? 6.053   -16.068 2.379   1.00 31.42 ?  698 HOH A O     1 
HETATM 3173 O  O     A HOH M 11 .   ? -22.771 -10.215 -4.325  0.53 19.30 ?  699 HOH A O     1 
HETATM 3174 O  O     B HOH M 11 .   ? -23.803 -10.556 -2.088  0.47 20.99 ?  699 HOH A O     1 
HETATM 3175 O  O     . HOH M 11 .   ? 10.983  -25.864 -25.964 0.80 26.67 ?  700 HOH A O     1 
HETATM 3176 O  O     . HOH M 11 .   ? 8.187   -12.238 -6.604  1.00 41.90 ?  701 HOH A O     1 
HETATM 3177 O  O     . HOH M 11 .   ? 16.354  -24.359 -6.135  1.00 26.66 ?  702 HOH A O     1 
HETATM 3178 O  O     . HOH M 11 .   ? -1.949  1.674   -7.661  1.00 26.73 ?  703 HOH A O     1 
HETATM 3179 O  O     . HOH M 11 .   ? 4.302   -18.581 -21.715 1.00 14.15 ?  704 HOH A O     1 
HETATM 3180 O  O     . HOH M 11 .   ? -10.041 8.338   5.662   0.95 29.37 ?  705 HOH A O     1 
HETATM 3181 O  O     . HOH M 11 .   ? 18.513  12.276  -6.231  1.00 24.38 ?  706 HOH A O     1 
HETATM 3182 O  O     A HOH M 11 .   ? -11.458 11.931  -7.691  0.62 11.67 ?  707 HOH A O     1 
HETATM 3183 O  O     B HOH M 11 .   ? -13.187 10.934  -8.378  0.38 12.41 ?  707 HOH A O     1 
HETATM 3184 O  O     . HOH M 11 .   ? -10.368 21.903  -2.338  1.00 29.13 ?  708 HOH A O     1 
HETATM 3185 O  O     . HOH M 11 .   ? 13.773  -1.117  -26.904 1.00 35.02 ?  709 HOH A O     1 
HETATM 3186 O  O     . HOH M 11 .   ? 3.691   -6.338  -8.738  1.00 12.00 ?  710 HOH A O     1 
HETATM 3187 O  O     B HOH M 11 .   ? 21.131  -19.979 -21.814 0.62 25.43 ?  711 HOH A O     1 
HETATM 3188 O  O     . HOH M 11 .   ? -19.121 -3.179  -4.005  1.00 22.96 ?  712 HOH A O     1 
HETATM 3189 O  O     . HOH M 11 .   ? -10.266 -6.246  -11.057 1.00 8.26  ?  713 HOH A O     1 
HETATM 3190 O  O     . HOH M 11 .   ? 7.419   -4.515  -8.300  1.00 24.23 ?  714 HOH A O     1 
HETATM 3191 O  O     . HOH M 11 .   ? 4.683   -9.271  -11.139 1.00 14.78 ?  715 HOH A O     1 
HETATM 3192 O  O     . HOH M 11 .   ? 6.902   -1.385  -9.422  1.00 27.89 ?  716 HOH A O     1 
HETATM 3193 O  O     . HOH M 11 .   ? -8.621  1.730   -11.007 1.00 23.80 ?  717 HOH A O     1 
HETATM 3194 O  O     . HOH M 11 .   ? 6.517   -11.492 -11.096 1.00 18.47 ?  718 HOH A O     1 
HETATM 3195 O  O     . HOH M 11 .   ? -12.121 -14.470 3.716   1.00 15.15 ?  719 HOH A O     1 
HETATM 3196 O  O     . HOH M 11 .   ? -5.633  -0.643  4.664   1.00 20.20 ?  720 HOH A O     1 
HETATM 3197 O  O     . HOH M 11 .   ? -6.754  -5.027  2.979   1.00 26.09 ?  721 HOH A O     1 
HETATM 3198 O  O     . HOH M 11 .   ? -16.420 -18.954 -0.985  1.00 22.91 ?  722 HOH A O     1 
HETATM 3199 O  O     . HOH M 11 .   ? 12.019  -16.248 -1.485  1.00 11.01 ?  723 HOH A O     1 
HETATM 3200 O  O     . HOH M 11 .   ? 17.403  -34.822 -13.837 1.00 34.84 ?  724 HOH A O     1 
HETATM 3201 O  O     . HOH M 11 .   ? 10.182  18.514  7.356   1.00 35.00 ?  725 HOH A O     1 
HETATM 3202 O  O     . HOH M 11 .   ? 6.222   -10.084 -28.234 1.00 31.51 ?  726 HOH A O     1 
HETATM 3203 O  O     . HOH M 11 .   ? 28.280  -4.586  -22.814 1.00 32.42 ?  727 HOH A O     1 
HETATM 3204 O  O     . HOH M 11 .   ? -4.119  4.977   10.212  1.00 46.98 ?  728 HOH A O     1 
HETATM 3205 O  O     . HOH M 11 .   ? -25.880 6.961   -3.277  0.93 31.50 ?  729 HOH A O     1 
HETATM 3206 O  O     . HOH M 11 .   ? 6.304   18.338  -18.667 0.91 28.53 ?  730 HOH A O     1 
HETATM 3207 O  O     . HOH M 11 .   ? -10.559 3.691   -9.958  1.00 34.33 ?  731 HOH A O     1 
HETATM 3208 O  O     . HOH M 11 .   ? -4.363  -24.763 -15.998 1.00 38.43 ?  732 HOH A O     1 
HETATM 3209 O  O     . HOH M 11 .   ? -23.967 3.236   -1.516  1.00 34.48 ?  733 HOH A O     1 
HETATM 3210 O  O     . HOH M 11 .   ? -19.808 1.294   -11.334 1.00 32.92 ?  734 HOH A O     1 
HETATM 3211 O  O     A HOH M 11 .   ? -14.582 -4.869  -17.922 0.63 17.97 ?  735 HOH A O     1 
HETATM 3212 O  O     B HOH M 11 .   ? -15.197 -3.055  -16.457 0.37 13.25 ?  735 HOH A O     1 
HETATM 3213 O  O     . HOH M 11 .   ? -24.103 -9.585  -11.022 1.00 39.18 ?  736 HOH A O     1 
HETATM 3214 O  O     . HOH M 11 .   ? 17.010  12.206  -3.804  1.00 17.58 ?  737 HOH A O     1 
HETATM 3215 O  O     . HOH M 11 .   ? 9.678   5.854   -3.014  1.00 14.53 ?  738 HOH A O     1 
HETATM 3216 O  O     B HOH M 11 .   ? 30.258  -11.702 -15.122 0.54 18.25 ?  739 HOH A O     1 
HETATM 3217 O  O     . HOH M 11 .   ? 25.624  -3.861  -24.141 1.00 23.34 ?  740 HOH A O     1 
HETATM 3218 O  O     . HOH M 11 .   ? 22.584  -16.209 -11.124 1.00 31.04 ?  741 HOH A O     1 
HETATM 3219 O  O     . HOH M 11 .   ? -24.916 -4.686  -16.340 1.00 32.50 ?  742 HOH A O     1 
HETATM 3220 O  O     A HOH M 11 .   ? -4.019  1.795   -5.456  0.59 13.04 ?  743 HOH A O     1 
HETATM 3221 O  O     . HOH M 11 .   ? 3.412   20.474  -0.486  1.00 28.74 ?  744 HOH A O     1 
HETATM 3222 O  O     . HOH M 11 .   ? 28.480  8.734   -21.127 1.00 39.63 ?  745 HOH A O     1 
HETATM 3223 O  O     . HOH M 11 .   ? -14.002 10.915  8.150   1.00 39.92 ?  746 HOH A O     1 
HETATM 3224 O  O     . HOH M 11 .   ? 5.822   -22.425 -0.087  1.00 23.99 ?  747 HOH A O     1 
HETATM 3225 O  O     . HOH M 11 .   ? -20.245 -15.240 -5.698  1.00 28.21 ?  748 HOH A O     1 
HETATM 3226 O  O     . HOH M 11 .   ? 6.387   -6.235  -6.309  1.00 19.76 ?  749 HOH A O     1 
HETATM 3227 O  O     . HOH M 11 .   ? 3.241   -12.364 2.437   1.00 22.80 ?  750 HOH A O     1 
HETATM 3228 O  O     . HOH M 11 .   ? -13.025 -7.096  -1.089  1.00 14.06 ?  751 HOH A O     1 
HETATM 3229 O  O     . HOH M 11 .   ? 12.622  -13.791 -7.861  1.00 39.23 ?  752 HOH A O     1 
HETATM 3230 O  O     . HOH M 11 .   ? 24.344  7.296   -13.114 1.00 24.54 ?  753 HOH A O     1 
HETATM 3231 O  O     . HOH M 11 .   ? 17.784  19.564  10.013  1.00 26.72 ?  754 HOH A O     1 
HETATM 3232 O  O     . HOH M 11 .   ? -0.327  -19.728 -22.577 1.00 34.19 ?  755 HOH A O     1 
HETATM 3233 O  O     . HOH M 11 .   ? 20.075  -32.038 -12.911 1.00 30.55 ?  756 HOH A O     1 
HETATM 3234 O  O     . HOH M 11 .   ? -16.604 -20.348 -14.208 1.00 46.73 ?  757 HOH A O     1 
HETATM 3235 O  O     . HOH M 11 .   ? -9.432  13.927  9.129   0.95 31.46 ?  758 HOH A O     1 
HETATM 3236 O  O     . HOH M 11 .   ? -17.659 -17.683 -17.616 1.00 46.01 ?  759 HOH A O     1 
HETATM 3237 O  O     . HOH M 11 .   ? 15.995  -10.595 -10.887 1.00 25.26 ?  760 HOH A O     1 
HETATM 3238 O  O     . HOH M 11 .   ? -12.923 -10.472 -0.360  1.00 12.23 ?  761 HOH A O     1 
HETATM 3239 O  O     . HOH M 11 .   ? 17.063  -21.307 -6.139  1.00 19.10 ?  762 HOH A O     1 
HETATM 3240 O  O     . HOH M 11 .   ? 11.758  -4.692  -18.626 1.00 28.74 ?  763 HOH A O     1 
HETATM 3241 O  O     . HOH M 11 .   ? -0.201  12.320  -11.344 1.00 31.61 ?  764 HOH A O     1 
HETATM 3242 O  O     . HOH M 11 .   ? -15.993 3.709   -14.483 1.00 44.61 ?  765 HOH A O     1 
HETATM 3243 O  O     . HOH M 11 .   ? 5.542   16.290  -17.251 1.00 29.68 ?  766 HOH A O     1 
HETATM 3244 O  O     . HOH M 11 .   ? -4.508  -2.011  -13.356 1.00 45.92 ?  767 HOH A O     1 
HETATM 3245 O  O     . HOH M 11 .   ? -11.604 11.394  -13.147 1.00 41.97 ?  768 HOH A O     1 
HETATM 3246 O  O     . HOH M 11 .   ? -7.791  -1.654  -15.567 1.00 11.65 ?  769 HOH A O     1 
HETATM 3247 O  O     . HOH M 11 .   ? 6.002   -7.269  -28.136 1.00 47.95 ?  770 HOH A O     1 
HETATM 3248 O  O     . HOH M 11 .   ? -5.261  -21.552 -6.029  1.00 17.44 ?  771 HOH A O     1 
HETATM 3249 O  O     . HOH M 11 .   ? -7.783  -7.948  3.340   1.00 36.80 ?  772 HOH A O     1 
HETATM 3250 O  O     . HOH M 11 .   ? 3.248   -22.448 -2.634  1.00 25.62 ?  773 HOH A O     1 
HETATM 3251 O  O     . HOH M 11 .   ? 12.548  18.041  8.709   1.00 34.72 ?  774 HOH A O     1 
HETATM 3252 O  O     . HOH M 11 .   ? 10.453  2.665   -10.916 1.00 31.01 ?  775 HOH A O     1 
HETATM 3253 O  O     . HOH M 11 .   ? -8.751  -23.111 -11.496 1.00 34.55 ?  776 HOH A O     1 
HETATM 3254 O  O     A HOH M 11 .   ? 7.110   11.045  -20.788 0.54 12.81 ?  777 HOH A O     1 
HETATM 3255 O  O     B HOH M 11 .   ? 7.089   12.145  -18.587 0.46 12.94 ?  777 HOH A O     1 
HETATM 3256 O  O     . HOH M 11 .   ? 22.909  -12.262 -25.172 1.00 42.61 ?  778 HOH A O     1 
HETATM 3257 O  O     . HOH M 11 .   ? -20.082 -6.188  -26.155 1.00 35.88 ?  779 HOH A O     1 
HETATM 3258 O  O     . HOH M 11 .   ? 18.811  -17.503 -3.197  1.00 34.65 ?  780 HOH A O     1 
HETATM 3259 O  O     A HOH M 11 .   ? -3.391  -15.995 -24.079 0.41 11.82 ?  781 HOH A O     1 
HETATM 3260 O  O     B HOH M 11 .   ? -4.361  -17.676 -22.734 0.59 20.59 ?  781 HOH A O     1 
HETATM 3261 O  O     . HOH M 11 .   ? 11.633  -2.154  -3.219  1.00 32.54 ?  782 HOH A O     1 
HETATM 3262 O  O     . HOH M 11 .   ? 11.792  -14.051 -2.827  0.50 15.39 ?  783 HOH A O     1 
HETATM 3263 O  O     . HOH M 11 .   ? -15.569 -0.861  -17.421 1.00 46.89 ?  784 HOH A O     1 
HETATM 3264 O  O     . HOH M 11 .   ? 8.057   -8.955  -4.536  1.00 27.05 ?  785 HOH A O     1 
HETATM 3265 O  O     . HOH M 11 .   ? -14.035 0.178   2.125   1.00 39.15 ?  786 HOH A O     1 
HETATM 3266 O  O     . HOH M 11 .   ? 25.539  -18.966 -23.155 1.00 46.93 ?  787 HOH A O     1 
HETATM 3267 O  O     . HOH M 11 .   ? 12.777  0.417   -4.153  1.00 32.41 ?  788 HOH A O     1 
HETATM 3268 O  O     . HOH M 11 .   ? 5.110   14.372  -18.541 0.97 37.67 ?  789 HOH A O     1 
HETATM 3269 O  O     . HOH M 11 .   ? 3.291   -16.979 3.020   1.00 36.08 ?  790 HOH A O     1 
HETATM 3270 O  O     . HOH M 11 .   ? -16.531 15.130  -10.879 1.00 42.37 ?  791 HOH A O     1 
HETATM 3271 O  O     . HOH M 11 .   ? 10.510  5.427   -8.806  1.00 23.93 ?  792 HOH A O     1 
HETATM 3272 O  O     . HOH M 11 .   ? -14.792 -3.883  -20.247 1.00 35.86 ?  793 HOH A O     1 
HETATM 3273 O  O     . HOH M 11 .   ? -14.998 5.824   7.998   1.00 42.77 ?  794 HOH A O     1 
HETATM 3274 O  O     . HOH M 11 .   ? 12.367  -32.179 -1.112  1.00 37.71 ?  795 HOH A O     1 
HETATM 3275 O  O     A HOH M 11 .   ? 16.624  -9.352  -26.014 0.51 25.77 ?  796 HOH A O     1 
HETATM 3276 O  O     B HOH M 11 .   ? 14.991  -10.091 -26.629 0.49 18.68 ?  796 HOH A O     1 
HETATM 3277 O  O     A HOH M 11 .   ? 18.287  2.452   -10.684 0.56 16.50 ?  797 HOH A O     1 
HETATM 3278 O  O     B HOH M 11 .   ? 17.623  4.138   -11.624 0.44 14.39 ?  797 HOH A O     1 
HETATM 3279 O  O     A HOH M 11 .   ? -13.962 -22.701 -6.607  0.45 15.68 ?  798 HOH A O     1 
HETATM 3280 O  O     B HOH M 11 .   ? -14.818 -20.959 -7.016  0.55 20.80 ?  798 HOH A O     1 
HETATM 3281 O  O     A HOH M 11 .   ? -17.543 0.157   -15.738 0.48 33.80 ?  799 HOH A O     1 
HETATM 3282 O  O     B HOH M 11 .   ? -19.097 -0.733  -14.474 0.52 33.03 ?  799 HOH A O     1 
HETATM 3283 O  O     . HOH M 11 .   ? 15.299  -1.235  -11.601 0.95 33.45 ?  800 HOH A O     1 
HETATM 3284 O  O     . HOH M 11 .   ? -12.388 -19.136 0.345   1.00 36.55 ?  801 HOH A O     1 
HETATM 3285 O  O     . HOH M 11 .   ? -0.111  -22.425 -0.038  0.85 26.56 ?  802 HOH A O     1 
HETATM 3286 O  O     . HOH M 11 .   ? 15.607  -12.682 -0.994  1.00 37.20 ?  803 HOH A O     1 
HETATM 3287 O  O     . HOH M 11 .   ? -22.260 -0.606  -0.912  0.94 40.22 ?  804 HOH A O     1 
HETATM 3288 O  O     . HOH M 11 .   ? -19.489 6.350   7.266   1.00 39.55 ?  805 HOH A O     1 
HETATM 3289 O  O     . HOH M 11 .   ? 11.529  -0.247  -27.178 1.00 39.78 ?  806 HOH A O     1 
HETATM 3290 O  O     . HOH M 11 .   ? -2.891  -4.616  4.318   1.00 20.36 ?  807 HOH A O     1 
HETATM 3291 O  O     . HOH M 11 .   ? -9.944  -4.018  2.122   1.00 31.74 ?  808 HOH A O     1 
HETATM 3292 O  O     . HOH M 11 .   ? -17.000 2.785   5.610   1.00 27.74 ?  809 HOH A O     1 
HETATM 3293 O  O     A HOH M 11 .   ? 6.291   -8.067  -14.419 0.50 16.04 ?  810 HOH A O     1 
HETATM 3294 O  O     B HOH M 11 .   ? 4.712   -8.058  -15.827 0.50 15.06 ?  810 HOH A O     1 
HETATM 3295 O  O     . HOH M 11 .   ? -19.026 0.061   2.208   1.00 32.36 ?  811 HOH A O     1 
HETATM 3296 O  O     . HOH M 11 .   ? 8.757   -1.195  -26.124 1.00 39.62 ?  812 HOH A O     1 
HETATM 3297 O  O     . HOH M 11 .   ? 17.320  -28.961 -1.409  1.00 41.66 ?  813 HOH A O     1 
HETATM 3298 O  O     . HOH M 11 .   ? -16.412 -21.632 -1.564  1.00 51.46 ?  814 HOH A O     1 
HETATM 3299 O  O     . HOH N 11 .   ? 3.457   -15.936 -37.207 1.00 34.23 ?  101 HOH T O     1 
HETATM 3300 O  O     . HOH N 11 .   ? -12.837 -0.352  -21.118 1.00 33.54 ?  102 HOH T O     1 
HETATM 3301 O  O     . HOH N 11 .   ? -3.143  12.954  -11.494 1.00 25.91 ?  103 HOH T O     1 
HETATM 3302 O  O     . HOH N 11 .   ? -12.901 6.255   -15.761 1.00 48.85 ?  104 HOH T O     1 
HETATM 3303 O  O     . HOH N 11 .   ? -0.820  -7.318  -23.831 1.00 34.12 ?  105 HOH T O     1 
HETATM 3304 O  O     . HOH N 11 .   ? 2.814   -13.772 -32.587 1.00 30.67 ?  106 HOH T O     1 
HETATM 3305 O  O     . HOH N 11 .   ? 5.039   -18.607 -32.609 1.00 27.31 ?  107 HOH T O     1 
HETATM 3306 O  O     . HOH N 11 .   ? -7.566  11.393  -18.113 1.00 35.99 ?  108 HOH T O     1 
HETATM 3307 O  O     . HOH N 11 .   ? -12.256 -4.306  -20.706 1.00 31.05 ?  109 HOH T O     1 
HETATM 3308 O  O     . HOH N 11 .   ? -0.371  -12.841 -19.174 1.00 18.33 ?  110 HOH T O     1 
HETATM 3309 O  O     . HOH N 11 .   ? -4.693  7.290   -22.566 1.00 30.94 ?  111 HOH T O     1 
HETATM 3310 O  O     . HOH N 11 .   ? 4.976   -15.633 -32.340 1.00 38.33 ?  112 HOH T O     1 
HETATM 3311 O  O     . HOH N 11 .   ? -1.091  -16.966 -25.379 1.00 30.47 ?  113 HOH T O     1 
HETATM 3312 O  O     . HOH N 11 .   ? -6.239  8.792   -20.753 1.00 26.99 ?  114 HOH T O     1 
HETATM 3313 O  O     . HOH N 11 .   ? -1.287  -9.309  -27.994 0.88 31.32 ?  115 HOH T O     1 
HETATM 3314 O  O     . HOH N 11 .   ? 5.756   -19.136 -39.438 0.95 36.87 ?  116 HOH T O     1 
HETATM 3315 O  O     . HOH N 11 .   ? 3.753   -11.280 -31.714 1.00 37.04 ?  117 HOH T O     1 
HETATM 3316 O  O     . HOH N 11 .   ? -10.909 -6.422  -19.975 0.86 33.14 ?  118 HOH T O     1 
HETATM 3317 O  O     . HOH N 11 .   ? -3.968  -18.317 -30.900 1.00 34.34 ?  119 HOH T O     1 
HETATM 3318 O  O     . HOH N 11 .   ? -5.431  -4.522  -23.529 1.00 28.58 ?  120 HOH T O     1 
HETATM 3319 O  O     . HOH O 11 .   ? 5.018   4.165   -24.134 1.00 29.95 ?  101 HOH P O     1 
HETATM 3320 O  O     . HOH O 11 .   ? 7.783   2.433   -23.000 1.00 31.31 ?  102 HOH P O     1 
HETATM 3321 O  O     . HOH O 11 .   ? 0.098   3.371   -22.895 1.00 34.20 ?  103 HOH P O     1 
HETATM 3322 O  O     . HOH O 11 .   ? 4.521   11.483  -21.457 1.00 25.35 ?  104 HOH P O     1 
HETATM 3323 O  O     . HOH O 11 .   ? 9.174   4.035   -12.957 1.00 15.75 ?  105 HOH P O     1 
HETATM 3324 O  O     . HOH O 11 .   ? 4.729   -0.868  -18.598 1.00 31.88 ?  106 HOH P O     1 
HETATM 3325 O  O     . HOH O 11 .   ? 2.772   3.728   -22.845 1.00 27.88 ?  107 HOH P O     1 
HETATM 3326 O  O     . HOH O 11 .   ? 7.916   5.183   -9.644  1.00 10.76 ?  108 HOH P O     1 
HETATM 3327 O  O     . HOH O 11 .   ? -3.006  5.087   -14.448 1.00 30.77 ?  109 HOH P O     1 
HETATM 3328 O  O     . HOH O 11 .   ? 8.110   0.770   -20.057 1.00 39.38 ?  110 HOH P O     1 
HETATM 3329 O  O     . HOH O 11 .   ? 2.263   9.234   -15.747 1.00 36.86 ?  111 HOH P O     1 
HETATM 3330 O  O     . HOH P 11 .   ? 6.342   -27.555 -20.421 1.00 45.77 ?  101 HOH D O     1 
HETATM 3331 O  O     . HOH P 11 .   ? -1.203  -19.546 -25.064 1.00 37.43 ?  102 HOH D O     1 
HETATM 3332 O  O     . HOH P 11 .   ? 4.198   -25.616 -29.776 1.00 34.73 ?  103 HOH D O     1 
HETATM 3333 O  O     . HOH P 11 .   ? 2.472   -26.549 -20.649 1.00 33.57 ?  104 HOH D O     1 
HETATM 3334 O  O     . HOH P 11 .   ? 2.845   -26.681 -27.713 1.00 37.72 ?  105 HOH D O     1 
HETATM 3335 O  O     . HOH P 11 .   ? 13.248  -21.676 -27.142 1.00 42.09 ?  106 HOH D O     1 
HETATM 3336 O  O     . HOH P 11 .   ? 11.391  -19.842 -29.376 1.00 38.02 ?  107 HOH D O     1 
HETATM 3337 O  O     . HOH P 11 .   ? 6.185   -23.034 -30.043 1.00 26.59 ?  108 HOH D O     1 
HETATM 3338 O  O     . HOH P 11 .   ? 2.223   -19.179 -23.317 1.00 27.01 ?  109 HOH D O     1 
HETATM 3339 O  O     . HOH P 11 .   ? 17.489  -17.231 -27.713 1.00 45.81 ?  110 HOH D O     1 
HETATM 3340 O  O     . HOH P 11 .   ? -0.986  -20.490 -19.908 1.00 44.73 ?  111 HOH D O     1 
HETATM 3341 O  O     B HOH P 11 .   ? -2.755  -22.236 -20.766 0.65 32.41 ?  112 HOH D O     1 
HETATM 3342 O  O     A HOH P 11 .   ? -5.523  -23.768 -18.680 0.29 12.44 ?  113 HOH D O     1 
HETATM 3343 O  O     B HOH P 11 .   ? -7.051  -23.962 -17.332 0.71 31.25 ?  113 HOH D O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . MET A 10  ? 0.4610 0.3040 0.4593 -0.0149 -0.0238 -0.0643 138 MET A N     
2    C CA    . MET A 10  ? 0.4011 0.2616 0.3968 -0.0098 -0.0230 -0.0639 138 MET A CA    
3    C C     . MET A 10  ? 0.3768 0.2510 0.3746 -0.0114 -0.0269 -0.0700 138 MET A C     
4    O O     . MET A 10  ? 0.3423 0.2180 0.3346 -0.0067 -0.0296 -0.0760 138 MET A O     
5    C CB    . MET A 10  ? 0.4799 0.3419 0.4671 0.0011  -0.0218 -0.0641 138 MET A CB    
6    C CG    . MET A 10  ? 0.4609 0.3399 0.4449 0.0058  -0.0208 -0.0632 138 MET A CG    
7    S SD    . MET A 10  ? 0.4732 0.3568 0.4597 0.0026  -0.0178 -0.0557 138 MET A SD    
8    C CE    . MET A 10  ? 0.3813 0.2505 0.3648 0.0066  -0.0161 -0.0495 138 MET A CE    
9    N N     A PRO A 11  ? 0.3579 0.2422 0.3639 -0.0174 -0.0272 -0.0686 139 PRO A N     
10   N N     B PRO A 11  ? 0.3679 0.2523 0.3739 -0.0173 -0.0272 -0.0686 139 PRO A N     
11   C CA    A PRO A 11  ? 0.3495 0.2479 0.3583 -0.0178 -0.0315 -0.0740 139 PRO A CA    
12   C CA    B PRO A 11  ? 0.3574 0.2557 0.3662 -0.0178 -0.0315 -0.0741 139 PRO A CA    
13   C C     A PRO A 11  ? 0.3224 0.2309 0.3212 -0.0086 -0.0311 -0.0750 139 PRO A C     
14   C C     B PRO A 11  ? 0.3023 0.2113 0.3014 -0.0088 -0.0311 -0.0749 139 PRO A C     
15   O O     A PRO A 11  ? 0.3259 0.2344 0.3184 -0.0034 -0.0273 -0.0710 139 PRO A O     
16   O O     B PRO A 11  ? 0.3312 0.2410 0.3246 -0.0039 -0.0272 -0.0706 139 PRO A O     
17   C CB    A PRO A 11  ? 0.3329 0.2411 0.3542 -0.0245 -0.0305 -0.0712 139 PRO A CB    
18   C CB    B PRO A 11  ? 0.3408 0.2484 0.3628 -0.0251 -0.0309 -0.0715 139 PRO A CB    
19   C CG    A PRO A 11  ? 0.3163 0.2126 0.3433 -0.0307 -0.0264 -0.0651 139 PRO A CG    
20   C CG    B PRO A 11  ? 0.2934 0.1956 0.3147 -0.0251 -0.0250 -0.0643 139 PRO A CG    
21   C CD    A PRO A 11  ? 0.3308 0.2142 0.3452 -0.0239 -0.0238 -0.0622 139 PRO A CD    
22   C CD    B PRO A 11  ? 0.3299 0.2146 0.3435 -0.0229 -0.0236 -0.0621 139 PRO A CD    
23   N N     . ALA A 12  ? 0.3287 0.2463 0.3265 -0.0071 -0.0355 -0.0802 140 ALA A N     
24   C CA    . ALA A 12  ? 0.3075 0.2335 0.2952 0.0011  -0.0353 -0.0808 140 ALA A CA    
25   C C     . ALA A 12  ? 0.3108 0.2485 0.2985 0.0026  -0.0332 -0.0765 140 ALA A C     
26   O O     . ALA A 12  ? 0.3240 0.2659 0.3034 0.0084  -0.0309 -0.0741 140 ALA A O     
27   C CB    . ALA A 12  ? 0.2996 0.2291 0.2842 0.0029  -0.0410 -0.0877 140 ALA A CB    
28   N N     . TYR A 13  ? 0.1928 0.1356 0.1901 -0.0025 -0.0339 -0.0756 141 TYR A N     
29   C CA    . TYR A 13  ? 0.2192 0.1717 0.2159 -0.0003 -0.0325 -0.0727 141 TYR A CA    
30   C C     . TYR A 13  ? 0.2305 0.1786 0.2287 -0.0021 -0.0273 -0.0673 141 TYR A C     
31   O O     . TYR A 13  ? 0.2666 0.2082 0.2725 -0.0076 -0.0259 -0.0666 141 TYR A O     
32   C CB    . TYR A 13  ? 0.1594 0.1226 0.1663 -0.0030 -0.0369 -0.0764 141 TYR A CB    
33   C CG    . TYR A 13  ? 0.1666 0.1365 0.1714 -0.0003 -0.0431 -0.0816 141 TYR A CG    
34   C CD1   . TYR A 13  ? 0.2178 0.1846 0.2271 -0.0040 -0.0477 -0.0869 141 TYR A CD1   
35   C CD2   . TYR A 13  ? 0.1951 0.1739 0.1934 0.0059  -0.0449 -0.0812 141 TYR A CD2   
36   C CE1   . TYR A 13  ? 0.2743 0.2474 0.2809 -0.0012 -0.0542 -0.0921 141 TYR A CE1   
37   C CE2   . TYR A 13  ? 0.2863 0.2712 0.2817 0.0090  -0.0510 -0.0856 141 TYR A CE2   
38   C CZ    . TYR A 13  ? 0.2889 0.2715 0.2885 0.0056  -0.0557 -0.0913 141 TYR A CZ    
39   O OH    . TYR A 13  ? 0.3067 0.2955 0.3025 0.0091  -0.0622 -0.0960 141 TYR A OH    
40   N N     . ALA A 14  ? 0.2250 0.1761 0.2156 0.0020  -0.0246 -0.0633 142 ALA A N     
41   C CA    . ALA A 14  ? 0.2318 0.1779 0.2218 0.0008  -0.0205 -0.0587 142 ALA A CA    
42   C C     . ALA A 14  ? 0.2294 0.1797 0.2285 -0.0036 -0.0182 -0.0568 142 ALA A C     
43   O O     . ALA A 14  ? 0.2085 0.1543 0.2080 -0.0061 -0.0137 -0.0514 142 ALA A O     
44   C CB    . ALA A 14  ? 0.2106 0.1591 0.1909 0.0052  -0.0188 -0.0547 142 ALA A CB    
45   N N     . CYS A 15  ? 0.1368 0.0973 0.1427 -0.0040 -0.0207 -0.0599 143 CYS A N     
46   C CA    . CYS A 15  ? 0.1578 0.1263 0.1738 -0.0073 -0.0173 -0.0570 143 CYS A CA    
47   C C     . CYS A 15  ? 0.1633 0.1302 0.1921 -0.0153 -0.0161 -0.0570 143 CYS A C     
48   O O     . CYS A 15  ? 0.1935 0.1685 0.2323 -0.0189 -0.0119 -0.0537 143 CYS A O     
49   C CB    . CYS A 15  ? 0.1490 0.1310 0.1699 -0.0043 -0.0207 -0.0602 143 CYS A CB    
50   S SG    . CYS A 15  ? 0.1974 0.1846 0.2250 -0.0055 -0.0299 -0.0692 143 CYS A SG    
51   N N     . GLN A 16  ? 0.1510 0.1074 0.1798 -0.0179 -0.0194 -0.0605 144 GLN A N     
52   C CA    . GLN A 16  ? 0.1582 0.1091 0.1986 -0.0263 -0.0192 -0.0605 144 GLN A CA    
53   C C     . GLN A 16  ? 0.2470 0.1837 0.2823 -0.0281 -0.0138 -0.0535 144 GLN A C     
54   O O     . GLN A 16  ? 0.2162 0.1445 0.2593 -0.0352 -0.0131 -0.0520 144 GLN A O     
55   C CB    . GLN A 16  ? 0.1680 0.1125 0.2106 -0.0279 -0.0274 -0.0696 144 GLN A CB    
56   C CG    . GLN A 16  ? 0.2005 0.1596 0.2505 -0.0280 -0.0338 -0.0762 144 GLN A CG    
57   C CD    . GLN A 16  ? 0.2803 0.2338 0.3250 -0.0275 -0.0398 -0.0806 144 GLN A CD    
58   O OE1   . GLN A 16  ? 0.2689 0.2155 0.2982 -0.0206 -0.0401 -0.0811 144 GLN A OE1   
59   N NE2   . GLN A 16  ? 0.2964 0.2536 0.3546 -0.0353 -0.0439 -0.0838 144 GLN A NE2   
60   N N     . ARG A 17  ? 0.2640 0.1975 0.2864 -0.0222 -0.0104 -0.0489 145 ARG A N     
61   C CA    . ARG A 17  ? 0.2637 0.1839 0.2796 -0.0224 -0.0068 -0.0426 145 ARG A CA    
62   C C     . ARG A 17  ? 0.2052 0.1290 0.2113 -0.0182 -0.0023 -0.0365 145 ARG A C     
63   O O     . ARG A 17  ? 0.2333 0.1648 0.2342 -0.0135 -0.0035 -0.0385 145 ARG A O     
64   C CB    . ARG A 17  ? 0.2834 0.1914 0.2919 -0.0178 -0.0110 -0.0462 145 ARG A CB    
65   C CG    . ARG A 17  ? 0.2709 0.1849 0.2698 -0.0101 -0.0130 -0.0488 145 ARG A CG    
66   C CD    . ARG A 17  ? 0.3774 0.2871 0.3717 -0.0053 -0.0169 -0.0543 145 ARG A CD    
67   N NE    . ARG A 17  ? 0.3565 0.2747 0.3427 0.0009  -0.0167 -0.0539 145 ARG A NE    
68   C CZ    . ARG A 17  ? 0.4185 0.3437 0.4010 0.0047  -0.0185 -0.0572 145 ARG A CZ    
69   N NH1   . ARG A 17  ? 0.3393 0.2636 0.3238 0.0038  -0.0213 -0.0621 145 ARG A NH1   
70   N NH2   . ARG A 17  ? 0.3632 0.2954 0.3396 0.0091  -0.0177 -0.0555 145 ARG A NH2   
71   N N     . PRO A 18  ? 0.1993 0.1167 0.2018 -0.0199 0.0026  -0.0290 146 PRO A N     
72   C CA    . PRO A 18  ? 0.1969 0.1161 0.1878 -0.0156 0.0057  -0.0243 146 PRO A CA    
73   C C     . PRO A 18  ? 0.2133 0.1271 0.1940 -0.0099 0.0017  -0.0250 146 PRO A C     
74   O O     . PRO A 18  ? 0.2097 0.1146 0.1899 -0.0088 -0.0007 -0.0253 146 PRO A O     
75   C CB    . PRO A 18  ? 0.3119 0.2250 0.3009 -0.0190 0.0116  -0.0161 146 PRO A CB    
76   C CG    . PRO A 18  ? 0.3769 0.2786 0.3727 -0.0235 0.0100  -0.0156 146 PRO A CG    
77   C CD    . PRO A 18  ? 0.2934 0.1998 0.3004 -0.0257 0.0051  -0.0243 146 PRO A CD    
78   N N     . THR A 19  ? 0.1968 0.1162 0.1703 -0.0062 0.0011  -0.0254 147 THR A N     
79   C CA    . THR A 19  ? 0.1640 0.0815 0.1297 -0.0020 -0.0023 -0.0252 147 THR A CA    
80   C C     . THR A 19  ? 0.1801 0.0970 0.1357 -0.0007 -0.0011 -0.0210 147 THR A C     
81   O O     . THR A 19  ? 0.1904 0.1119 0.1427 -0.0001 -0.0007 -0.0225 147 THR A O     
82   C CB    . THR A 19  ? 0.2219 0.1460 0.1887 0.0002  -0.0057 -0.0304 147 THR A CB    
83   O OG1   . THR A 19  ? 0.2003 0.1258 0.1750 -0.0008 -0.0071 -0.0354 147 THR A OG1   
84   C CG2   . THR A 19  ? 0.1760 0.0998 0.1386 0.0036  -0.0085 -0.0296 147 THR A CG2   
85   N N     . PRO A 20  ? 0.2378 0.1484 0.1871 0.0004  -0.0012 -0.0161 148 PRO A N     
86   C CA    . PRO A 20  ? 0.1764 0.0859 0.1141 0.0018  -0.0011 -0.0129 148 PRO A CA    
87   C C     . PRO A 20  ? 0.2060 0.1192 0.1401 0.0036  -0.0064 -0.0151 148 PRO A C     
88   O O     . PRO A 20  ? 0.1925 0.1095 0.1327 0.0042  -0.0092 -0.0175 148 PRO A O     
89   C CB    . PRO A 20  ? 0.2345 0.1362 0.1671 0.0028  -0.0006 -0.0068 148 PRO A CB    
90   C CG    . PRO A 20  ? 0.2295 0.1284 0.1703 0.0038  -0.0031 -0.0079 148 PRO A CG    
91   C CD    . PRO A 20  ? 0.2515 0.1545 0.2027 0.0012  -0.0022 -0.0137 148 PRO A CD    
92   N N     . LEU A 21  ? 0.1951 0.1068 0.1187 0.0041  -0.0076 -0.0143 149 LEU A N     
93   C CA    . LEU A 21  ? 0.1910 0.1051 0.1118 0.0040  -0.0131 -0.0161 149 LEU A CA    
94   C C     . LEU A 21  ? 0.2796 0.1963 0.2028 0.0051  -0.0176 -0.0136 149 LEU A C     
95   O O     . LEU A 21  ? 0.2787 0.2017 0.2080 0.0044  -0.0207 -0.0148 149 LEU A O     
96   C CB    . LEU A 21  ? 0.2142 0.1237 0.1220 0.0043  -0.0143 -0.0167 149 LEU A CB    
97   C CG    . LEU A 21  ? 0.2728 0.1824 0.1775 0.0025  -0.0209 -0.0188 149 LEU A CG    
98   C CD1   . LEU A 21  ? 0.2899 0.2034 0.2033 0.0006  -0.0211 -0.0212 149 LEU A CD1   
99   C CD2   . LEU A 21  ? 0.3044 0.2064 0.1947 0.0032  -0.0225 -0.0210 149 LEU A CD2   
100  N N     . THR A 22  ? 0.1723 0.0849 0.0907 0.0072  -0.0178 -0.0094 150 THR A N     
101  C CA    . THR A 22  ? 0.2220 0.1374 0.1432 0.0099  -0.0221 -0.0066 150 THR A CA    
102  C C     . THR A 22  ? 0.2060 0.1169 0.1329 0.0125  -0.0190 -0.0046 150 THR A C     
103  O O     . THR A 22  ? 0.2259 0.1295 0.1511 0.0112  -0.0141 -0.0032 150 THR A O     
104  C CB    . THR A 22  ? 0.2285 0.1416 0.1383 0.0115  -0.0266 -0.0032 150 THR A CB    
105  O OG1   . THR A 22  ? 0.2340 0.1380 0.1336 0.0126  -0.0222 0.0004  150 THR A OG1   
106  C CG2   . THR A 22  ? 0.3350 0.2503 0.2387 0.0084  -0.0311 -0.0064 150 THR A CG2   
107  N N     . HIS A 23  ? 0.1846 0.0997 0.1188 0.0160  -0.0217 -0.0045 151 HIS A N     
108  C CA    . HIS A 23  ? 0.1936 0.1023 0.1333 0.0189  -0.0193 -0.0043 151 HIS A CA    
109  C C     . HIS A 23  ? 0.2413 0.1526 0.1838 0.0257  -0.0234 -0.0019 151 HIS A C     
110  O O     . HIS A 23  ? 0.1965 0.1136 0.1358 0.0276  -0.0280 0.0012  151 HIS A O     
111  C CB    . HIS A 23  ? 0.1734 0.0849 0.1210 0.0170  -0.0167 -0.0104 151 HIS A CB    
112  C CG    . HIS A 23  ? 0.2017 0.1260 0.1547 0.0178  -0.0187 -0.0136 151 HIS A CG    
113  N ND1   . HIS A 23  ? 0.1573 0.0874 0.1166 0.0230  -0.0197 -0.0150 151 HIS A ND1   
114  C CD2   . HIS A 23  ? 0.2100 0.1419 0.1625 0.0141  -0.0194 -0.0151 151 HIS A CD2   
115  C CE1   . HIS A 23  ? 0.2476 0.1902 0.2106 0.0220  -0.0202 -0.0166 151 HIS A CE1   
116  N NE2   . HIS A 23  ? 0.2208 0.1636 0.1798 0.0161  -0.0204 -0.0164 151 HIS A NE2   
117  N N     . HIS A 24  ? 0.1856 0.0924 0.1340 0.0298  -0.0222 -0.0039 152 HIS A N     
118  C CA    . HIS A 24  ? 0.2045 0.1099 0.1548 0.0382  -0.0252 -0.0013 152 HIS A CA    
119  C C     . HIS A 24  ? 0.2671 0.1843 0.2270 0.0436  -0.0257 -0.0060 152 HIS A C     
120  O O     . HIS A 24  ? 0.2465 0.1623 0.2092 0.0523  -0.0273 -0.0054 152 HIS A O     
121  C CB    . HIS A 24  ? 0.2109 0.0964 0.1576 0.0400  -0.0232 0.0013  152 HIS A CB    
122  C CG    . HIS A 24  ? 0.2554 0.1308 0.1937 0.0336  -0.0203 0.0062  152 HIS A CG    
123  N ND1   . HIS A 24  ? 0.2665 0.1411 0.1947 0.0343  -0.0221 0.0129  152 HIS A ND1   
124  C CD2   . HIS A 24  ? 0.2188 0.0867 0.1573 0.0266  -0.0155 0.0052  152 HIS A CD2   
125  C CE1   . HIS A 24  ? 0.3375 0.2041 0.2590 0.0286  -0.0176 0.0161  152 HIS A CE1   
126  N NE2   . HIS A 24  ? 0.2598 0.1231 0.1888 0.0235  -0.0133 0.0118  152 HIS A NE2   
127  N N     . ASN A 25  ? 0.2130 0.1419 0.1773 0.0395  -0.0241 -0.0104 153 ASN A N     
128  C CA    . ASN A 25  ? 0.2010 0.1424 0.1731 0.0443  -0.0231 -0.0144 153 ASN A CA    
129  C C     . ASN A 25  ? 0.2730 0.2315 0.2489 0.0391  -0.0232 -0.0144 153 ASN A C     
130  O O     . ASN A 25  ? 0.1988 0.1647 0.1777 0.0386  -0.0204 -0.0180 153 ASN A O     
131  C CB    . ASN A 25  ? 0.1735 0.1056 0.1453 0.0455  -0.0199 -0.0208 153 ASN A CB    
132  C CG    . ASN A 25  ? 0.2492 0.1637 0.2188 0.0513  -0.0204 -0.0214 153 ASN A CG    
133  O OD1   . ASN A 25  ? 0.2067 0.1224 0.1788 0.0609  -0.0214 -0.0219 153 ASN A OD1   
134  N ND2   . ASN A 25  ? 0.1953 0.0931 0.1607 0.0457  -0.0195 -0.0210 153 ASN A ND2   
135  N N     . THR A 26  ? 0.1567 0.1205 0.1314 0.0351  -0.0270 -0.0101 154 THR A N     
136  C CA    . THR A 26  ? 0.2043 0.1797 0.1814 0.0281  -0.0279 -0.0098 154 THR A CA    
137  C C     . THR A 26  ? 0.1838 0.1781 0.1718 0.0304  -0.0265 -0.0100 154 THR A C     
138  O O     . THR A 26  ? 0.1710 0.1708 0.1603 0.0262  -0.0236 -0.0114 154 THR A O     
139  C CB    . THR A 26  ? 0.2408 0.2175 0.2144 0.0243  -0.0337 -0.0060 154 THR A CB    
140  O OG1   . THR A 26  ? 0.2444 0.2046 0.2068 0.0242  -0.0339 -0.0049 154 THR A OG1   
141  C CG2   . THR A 26  ? 0.2264 0.2083 0.1999 0.0156  -0.0351 -0.0064 154 THR A CG2   
142  N N     . GLY A 27  ? 0.1693 0.1746 0.1650 0.0377  -0.0282 -0.0081 155 GLY A N     
143  C CA    . GLY A 27  ? 0.2166 0.2433 0.2240 0.0405  -0.0259 -0.0075 155 GLY A CA    
144  C C     . GLY A 27  ? 0.2076 0.2339 0.2138 0.0444  -0.0192 -0.0121 155 GLY A C     
145  O O     . GLY A 27  ? 0.1789 0.2188 0.1895 0.0416  -0.0157 -0.0115 155 GLY A O     
146  N N     . LEU A 28  ? 0.1709 0.1809 0.1703 0.0506  -0.0178 -0.0165 156 LEU A N     
147  C CA    . LEU A 28  ? 0.1744 0.1822 0.1706 0.0548  -0.0128 -0.0222 156 LEU A CA    
148  C C     . LEU A 28  ? 0.1960 0.2002 0.1865 0.0460  -0.0111 -0.0236 156 LEU A C     
149  O O     . LEU A 28  ? 0.1429 0.1564 0.1332 0.0467  -0.0072 -0.0251 156 LEU A O     
150  C CB    . LEU A 28  ? 0.1966 0.1848 0.1868 0.0617  -0.0132 -0.0272 156 LEU A CB    
151  C CG    . LEU A 28  ? 0.2351 0.2220 0.2288 0.0725  -0.0151 -0.0262 156 LEU A CG    
152  C CD1   . LEU A 28  ? 0.1870 0.1491 0.1732 0.0769  -0.0158 -0.0309 156 LEU A CD1   
153  C CD2   . LEU A 28  ? 0.2083 0.2162 0.2101 0.0824  -0.0119 -0.0271 156 LEU A CD2   
154  N N     . SER A 29  ? 0.1569 0.1482 0.1421 0.0384  -0.0138 -0.0226 157 SER A N     
155  C CA    A SER A 29  ? 0.1425 0.1303 0.1226 0.0316  -0.0125 -0.0240 157 SER A CA    
156  C CA    B SER A 29  ? 0.1463 0.1340 0.1264 0.0315  -0.0126 -0.0239 157 SER A CA    
157  C C     . SER A 29  ? 0.1495 0.1516 0.1332 0.0263  -0.0118 -0.0197 157 SER A C     
158  O O     . SER A 29  ? 0.1494 0.1534 0.1297 0.0242  -0.0092 -0.0205 157 SER A O     
159  C CB    A SER A 29  ? 0.1827 0.1556 0.1572 0.0258  -0.0148 -0.0238 157 SER A CB    
160  C CB    B SER A 29  ? 0.1772 0.1506 0.1519 0.0255  -0.0150 -0.0234 157 SER A CB    
161  O OG    A SER A 29  ? 0.1671 0.1407 0.1422 0.0228  -0.0181 -0.0192 157 SER A OG    
162  O OG    B SER A 29  ? 0.1963 0.1563 0.1683 0.0284  -0.0148 -0.0268 157 SER A OG    
163  N N     . GLU A 30  ? 0.1477 0.1589 0.1379 0.0236  -0.0146 -0.0149 158 GLU A N     
164  C CA    . GLU A 30  ? 0.1595 0.1833 0.1545 0.0166  -0.0144 -0.0103 158 GLU A CA    
165  C C     . GLU A 30  ? 0.1321 0.1723 0.1324 0.0205  -0.0088 -0.0094 158 GLU A C     
166  O O     . GLU A 30  ? 0.1367 0.1816 0.1360 0.0154  -0.0061 -0.0067 158 GLU A O     
167  C CB    . GLU A 30  ? 0.1858 0.2175 0.1881 0.0122  -0.0197 -0.0060 158 GLU A CB    
168  C CG    . GLU A 30  ? 0.3857 0.4000 0.3788 0.0071  -0.0250 -0.0068 158 GLU A CG    
169  C CD    . GLU A 30  ? 0.4631 0.4820 0.4597 0.0037  -0.0322 -0.0038 158 GLU A CD    
170  O OE1   . GLU A 30  ? 0.4524 0.4886 0.4606 0.0059  -0.0342 -0.0010 158 GLU A OE1   
171  O OE2   . GLU A 30  ? 0.4473 0.4528 0.4345 -0.0006 -0.0362 -0.0047 158 GLU A OE2   
172  N N     . ALA A 31  ? 0.1333 0.1820 0.1384 0.0303  -0.0065 -0.0113 159 ALA A N     
173  C CA    . ALA A 31  ? 0.1330 0.1989 0.1420 0.0358  -0.0001 -0.0108 159 ALA A CA    
174  C C     . ALA A 31  ? 0.1848 0.2422 0.1820 0.0371  0.0037  -0.0148 159 ALA A C     
175  O O     . ALA A 31  ? 0.2642 0.3328 0.2608 0.0355  0.0085  -0.0117 159 ALA A O     
176  C CB    . ALA A 31  ? 0.1380 0.2122 0.1528 0.0480  0.0013  -0.0133 159 ALA A CB    
177  N N     . LEU A 32  ? 0.1553 0.1939 0.1434 0.0401  0.0015  -0.0213 160 LEU A N     
178  C CA    . LEU A 32  ? 0.2124 0.2436 0.1896 0.0415  0.0035  -0.0259 160 LEU A CA    
179  C C     . LEU A 32  ? 0.2005 0.2292 0.1736 0.0322  0.0030  -0.0218 160 LEU A C     
180  O O     . LEU A 32  ? 0.1727 0.2039 0.1385 0.0332  0.0060  -0.0219 160 LEU A O     
181  C CB    . LEU A 32  ? 0.1942 0.2063 0.1653 0.0447  0.0001  -0.0336 160 LEU A CB    
182  C CG    . LEU A 32  ? 0.1859 0.1957 0.1577 0.0552  0.0007  -0.0391 160 LEU A CG    
183  C CD1   . LEU A 32  ? 0.2446 0.2333 0.2131 0.0550  -0.0036 -0.0443 160 LEU A CD1   
184  C CD2   . LEU A 32  ? 0.1847 0.2017 0.1499 0.0638  0.0050  -0.0441 160 LEU A CD2   
185  N N     . GLU A 33  ? 0.1558 0.1786 0.1319 0.0241  -0.0009 -0.0181 161 GLU A N     
186  C CA    . GLU A 33  ? 0.1319 0.1493 0.1032 0.0163  -0.0019 -0.0146 161 GLU A CA    
187  C C     . GLU A 33  ? 0.1697 0.2012 0.1451 0.0118  0.0015  -0.0071 161 GLU A C     
188  O O     . GLU A 33  ? 0.1693 0.1969 0.1383 0.0077  0.0024  -0.0040 161 GLU A O     
189  C CB    . GLU A 33  ? 0.1285 0.1337 0.0999 0.0101  -0.0071 -0.0141 161 GLU A CB    
190  C CG    . GLU A 33  ? 0.2276 0.2189 0.1940 0.0131  -0.0090 -0.0202 161 GLU A CG    
191  C CD    . GLU A 33  ? 0.3527 0.3329 0.3174 0.0082  -0.0127 -0.0196 161 GLU A CD    
192  O OE1   . GLU A 33  ? 0.3921 0.3745 0.3593 0.0036  -0.0150 -0.0157 161 GLU A OE1   
193  O OE2   . GLU A 33  ? 0.3867 0.3566 0.3473 0.0090  -0.0133 -0.0233 161 GLU A OE2   
194  N N     . ILE A 34  ? 0.1338 0.1822 0.1203 0.0126  0.0034  -0.0036 162 ILE A N     
195  C CA    . ILE A 34  ? 0.1468 0.2124 0.1392 0.0085  0.0082  0.0040  162 ILE A CA    
196  C C     . ILE A 34  ? 0.1670 0.2368 0.1498 0.0148  0.0147  0.0034  162 ILE A C     
197  O O     . ILE A 34  ? 0.1764 0.2478 0.1547 0.0099  0.0177  0.0094  162 ILE A O     
198  C CB    . ILE A 34  ? 0.1356 0.2225 0.1438 0.0099  0.0095  0.0072  162 ILE A CB    
199  C CG1   . ILE A 34  ? 0.2443 0.3279 0.2608 0.0031  0.0019  0.0085  162 ILE A CG1   
200  C CG2   . ILE A 34  ? 0.1686 0.2770 0.1847 0.0060  0.0162  0.0157  162 ILE A CG2   
201  C CD1   . ILE A 34  ? 0.3232 0.4036 0.3421 -0.0104 -0.0015 0.0144  162 ILE A CD1   
202  N N     . LEU A 35  ? 0.1463 0.2168 0.1247 0.0259  0.0166  -0.0039 163 LEU A N     
203  C CA    . LEU A 35  ? 0.2024 0.2769 0.1696 0.0332  0.0221  -0.0059 163 LEU A CA    
204  C C     . LEU A 35  ? 0.1752 0.2329 0.1284 0.0308  0.0192  -0.0077 163 LEU A C     
205  O O     . LEU A 35  ? 0.1824 0.2437 0.1258 0.0322  0.0231  -0.0047 163 LEU A O     
206  C CB    . LEU A 35  ? 0.1841 0.2597 0.1488 0.0459  0.0233  -0.0149 163 LEU A CB    
207  C CG    . LEU A 35  ? 0.2200 0.3132 0.1981 0.0513  0.0265  -0.0136 163 LEU A CG    
208  C CD1   . LEU A 35  ? 0.2195 0.3087 0.1927 0.0650  0.0270  -0.0235 163 LEU A CD1   
209  C CD2   . LEU A 35  ? 0.2283 0.3467 0.2132 0.0501  0.0347  -0.0047 163 LEU A CD2   
210  N N     . ALA A 36  ? 0.1805 0.2211 0.1328 0.0271  0.0125  -0.0116 164 ALA A N     
211  C CA    . ALA A 36  ? 0.1550 0.1817 0.0963 0.0255  0.0093  -0.0133 164 ALA A CA    
212  C C     . ALA A 36  ? 0.1587 0.1850 0.0980 0.0178  0.0103  -0.0040 164 ALA A C     
213  O O     . ALA A 36  ? 0.1789 0.2028 0.1072 0.0193  0.0115  -0.0019 164 ALA A O     
214  C CB    . ALA A 36  ? 0.1796 0.1909 0.1227 0.0234  0.0030  -0.0189 164 ALA A CB    
215  N N     . GLU A 37  ? 0.1543 0.1817 0.1035 0.0095  0.0091  0.0014  165 GLU A N     
216  C CA    . GLU A 37  ? 0.1804 0.2050 0.1292 0.0005  0.0093  0.0105  165 GLU A CA    
217  C C     . GLU A 37  ? 0.2115 0.2501 0.1579 0.0008  0.0165  0.0182  165 GLU A C     
218  O O     . GLU A 37  ? 0.1980 0.2298 0.1341 -0.0011 0.0177  0.0236  165 GLU A O     
219  C CB    . GLU A 37  ? 0.2721 0.2978 0.2335 -0.0082 0.0059  0.0134  165 GLU A CB    
220  C CG    . GLU A 37  ? 0.4148 0.4328 0.3766 -0.0188 0.0038  0.0209  165 GLU A CG    
221  C CD    . GLU A 37  ? 0.4100 0.4285 0.3834 -0.0269 -0.0013 0.0216  165 GLU A CD    
222  O OE1   . GLU A 37  ? 0.3289 0.3598 0.3124 -0.0244 -0.0019 0.0188  165 GLU A OE1   
223  O OE2   . GLU A 37  ? 0.4543 0.4599 0.4256 -0.0355 -0.0053 0.0250  165 GLU A OE2   
224  N N     . ALA A 38  ? 0.1913 0.2495 0.1454 0.0048  0.0221  0.0187  166 ALA A N     
225  C CA    . ALA A 38  ? 0.2458 0.3203 0.1972 0.0063  0.0307  0.0263  166 ALA A CA    
226  C C     . ALA A 38  ? 0.2626 0.3320 0.1950 0.0152  0.0329  0.0234  166 ALA A C     
227  O O     . ALA A 38  ? 0.3271 0.3994 0.2503 0.0139  0.0378  0.0316  166 ALA A O     
228  C CB    . ALA A 38  ? 0.2227 0.3210 0.1867 0.0114  0.0364  0.0260  166 ALA A CB    
229  N N     . ALA A 39  ? 0.1965 0.2586 0.1223 0.0242  0.0292  0.0120  167 ALA A N     
230  C CA    . ALA A 39  ? 0.2269 0.2838 0.1347 0.0324  0.0293  0.0078  167 ALA A CA    
231  C C     . ALA A 39  ? 0.2327 0.2750 0.1307 0.0274  0.0256  0.0130  167 ALA A C     
232  O O     . ALA A 39  ? 0.2886 0.3318 0.1720 0.0310  0.0283  0.0172  167 ALA A O     
233  C CB    . ALA A 39  ? 0.2603 0.3092 0.1652 0.0403  0.0238  -0.0059 167 ALA A CB    
234  N N     . GLY A 40  ? 0.1979 0.2264 0.1025 0.0201  0.0193  0.0130  168 GLY A N     
235  C CA    . GLY A 40  ? 0.2877 0.3012 0.1837 0.0164  0.0157  0.0179  168 GLY A CA    
236  C C     . GLY A 40  ? 0.3859 0.4020 0.2793 0.0097  0.0209  0.0316  168 GLY A C     
237  O O     . GLY A 40  ? 0.3355 0.3435 0.2152 0.0111  0.0209  0.0371  168 GLY A O     
238  N N     . PHE A 41  ? 0.3346 0.3622 0.2415 0.0022  0.0253  0.0378  169 PHE A N     
239  C CA    . PHE A 41  ? 0.3397 0.3710 0.2469 -0.0063 0.0307  0.0517  169 PHE A CA    
240  C C     . PHE A 41  ? 0.3105 0.3534 0.2041 0.0005  0.0389  0.0574  169 PHE A C     
241  O O     . PHE A 41  ? 0.3552 0.3955 0.2420 -0.0047 0.0429  0.0697  169 PHE A O     
242  C CB    . PHE A 41  ? 0.2919 0.3382 0.2193 -0.0156 0.0335  0.0563  169 PHE A CB    
243  C CG    . PHE A 41  ? 0.3491 0.3828 0.2875 -0.0239 0.0253  0.0529  169 PHE A CG    
244  C CD1   . PHE A 41  ? 0.3448 0.3540 0.2746 -0.0252 0.0177  0.0498  169 PHE A CD1   
245  C CD2   . PHE A 41  ? 0.2917 0.3392 0.2485 -0.0295 0.0249  0.0527  169 PHE A CD2   
246  C CE1   . PHE A 41  ? 0.2646 0.2623 0.2022 -0.0317 0.0106  0.0462  169 PHE A CE1   
247  C CE2   . PHE A 41  ? 0.2619 0.2979 0.2264 -0.0365 0.0168  0.0493  169 PHE A CE2   
248  C CZ    . PHE A 41  ? 0.3078 0.3185 0.2619 -0.0376 0.0099  0.0459  169 PHE A CZ    
249  N N     . GLU A 42  ? 0.2892 0.3438 0.1776 0.0121  0.0414  0.0488  170 GLU A N     
250  C CA    . GLU A 42  ? 0.4420 0.5082 0.3148 0.0206  0.0491  0.0523  170 GLU A CA    
251  C C     . GLU A 42  ? 0.4791 0.5320 0.3310 0.0303  0.0435  0.0459  170 GLU A C     
252  O O     . GLU A 42  ? 0.6017 0.6633 0.4382 0.0404  0.0476  0.0438  170 GLU A O     
253  C CB    . GLU A 42  ? 0.4345 0.5229 0.3136 0.0284  0.0557  0.0466  170 GLU A CB    
254  C CG    . GLU A 42  ? 0.5028 0.6081 0.4051 0.0199  0.0604  0.0525  170 GLU A CG    
255  C CD    . GLU A 42  ? 0.6096 0.7198 0.5173 0.0072  0.0661  0.0693  170 GLU A CD    
256  O OE1   . GLU A 42  ? 0.7114 0.8265 0.6050 0.0093  0.0736  0.0783  170 GLU A OE1   
257  O OE2   . GLU A 42  ? 0.4493 0.5574 0.3744 -0.0051 0.0627  0.0735  170 GLU A OE2   
258  N N     . GLY A 43  ? 0.4256 0.4588 0.2764 0.0279  0.0341  0.0423  171 GLY A N     
259  C CA    . GLY A 43  ? 0.4338 0.4555 0.2670 0.0359  0.0279  0.0378  171 GLY A CA    
260  C C     . GLY A 43  ? 0.4772 0.5008 0.3073 0.0458  0.0225  0.0221  171 GLY A C     
261  O O     . GLY A 43  ? 0.5140 0.5318 0.3296 0.0531  0.0171  0.0177  171 GLY A O     
262  N N     . SER A 44  ? 0.3832 0.4141 0.2267 0.0461  0.0232  0.0136  172 SER A N     
263  C CA    . SER A 44  ? 0.3900 0.4211 0.2306 0.0548  0.0184  -0.0011 172 SER A CA    
264  C C     . SER A 44  ? 0.3631 0.3822 0.2165 0.0506  0.0101  -0.0089 172 SER A C     
265  O O     . SER A 44  ? 0.2606 0.2808 0.1283 0.0476  0.0102  -0.0130 172 SER A O     
266  C CB    . SER A 44  ? 0.4773 0.5229 0.3216 0.0599  0.0251  -0.0055 172 SER A CB    
267  O OG    . SER A 44  ? 0.5757 0.6164 0.4220 0.0656  0.0190  -0.0193 172 SER A OG    
268  N N     . GLU A 45  ? 0.2724 0.2807 0.1200 0.0511  0.0029  -0.0104 173 GLU A N     
269  C CA    . GLU A 45  ? 0.3650 0.3638 0.2240 0.0478  -0.0043 -0.0172 173 GLU A CA    
270  C C     . GLU A 45  ? 0.2715 0.2722 0.1359 0.0515  -0.0074 -0.0300 173 GLU A C     
271  O O     . GLU A 45  ? 0.2536 0.2498 0.1315 0.0471  -0.0095 -0.0340 173 GLU A O     
272  C CB    . GLU A 45  ? 0.4899 0.4803 0.3414 0.0499  -0.0110 -0.0168 173 GLU A CB    
273  C CG    . GLU A 45  ? 0.6484 0.6297 0.5122 0.0454  -0.0161 -0.0194 173 GLU A CG    
274  C CD    . GLU A 45  ? 0.6988 0.6726 0.5679 0.0379  -0.0132 -0.0099 173 GLU A CD    
275  O OE1   . GLU A 45  ? 0.6592 0.6362 0.5269 0.0342  -0.0072 -0.0019 173 GLU A OE1   
276  O OE2   . GLU A 45  ? 0.7815 0.7464 0.6562 0.0357  -0.0171 -0.0108 173 GLU A OE2   
277  N N     . GLY A 46  ? 0.2822 0.2879 0.1414 0.0572  -0.0075 -0.0350 174 GLY A N     
278  C CA    . GLY A 46  ? 0.2380 0.2424 0.1067 0.0583  -0.0108 -0.0453 174 GLY A CA    
279  C C     . GLY A 46  ? 0.2561 0.2629 0.1328 0.0578  -0.0061 -0.0470 174 GLY A C     
280  O O     . GLY A 46  ? 0.2317 0.2325 0.1199 0.0549  -0.0092 -0.0524 174 GLY A O     
281  N N     . ARG A 47  ? 0.2760 0.2927 0.1475 0.0607  0.0018  -0.0415 175 ARG A N     
282  C CA    . ARG A 47  ? 0.2153 0.2373 0.0953 0.0615  0.0065  -0.0425 175 ARG A CA    
283  C C     . ARG A 47  ? 0.1912 0.2082 0.0852 0.0527  0.0051  -0.0380 175 ARG A C     
284  O O     . ARG A 47  ? 0.2061 0.2203 0.1107 0.0518  0.0041  -0.0418 175 ARG A O     
285  C CB    . ARG A 47  ? 0.3232 0.3612 0.1984 0.0657  0.0161  -0.0355 175 ARG A CB    
286  C CG    . ARG A 47  ? 0.3044 0.3462 0.1713 0.0730  0.0175  -0.0390 175 ARG A CG    
287  C CD    . ARG A 47  ? 0.3483 0.4077 0.2122 0.0766  0.0281  -0.0310 175 ARG A CD    
288  N NE    . ARG A 47  ? 0.6072 0.6760 0.4822 0.0802  0.0327  -0.0329 175 ARG A NE    
289  C CZ    . ARG A 47  ? 0.6399 0.7232 0.5255 0.0773  0.0397  -0.0250 175 ARG A CZ    
290  N NH1   . ARG A 47  ? 0.5759 0.6631 0.4650 0.0676  0.0419  -0.0133 175 ARG A NH1   
291  N NH2   . ARG A 47  ? 0.3882 0.4805 0.2850 0.0822  0.0427  -0.0278 175 ARG A NH2   
292  N N     . LEU A 48  ? 0.1890 0.2034 0.0834 0.0459  0.0046  -0.0295 176 LEU A N     
293  C CA    . LEU A 48  ? 0.1933 0.2009 0.0999 0.0375  0.0023  -0.0260 176 LEU A CA    
294  C C     . LEU A 48  ? 0.2476 0.2449 0.1594 0.0371  -0.0037 -0.0347 176 LEU A C     
295  O O     . LEU A 48  ? 0.1766 0.1710 0.0987 0.0338  -0.0043 -0.0354 176 LEU A O     
296  C CB    . LEU A 48  ? 0.1771 0.1794 0.0800 0.0318  0.0016  -0.0175 176 LEU A CB    
297  C CG    . LEU A 48  ? 0.2895 0.2823 0.2015 0.0240  -0.0016 -0.0150 176 LEU A CG    
298  C CD1   . LEU A 48  ? 0.2477 0.2381 0.1576 0.0178  0.0002  -0.0045 176 LEU A CD1   
299  C CD2   . LEU A 48  ? 0.2807 0.2629 0.1921 0.0249  -0.0076 -0.0212 176 LEU A CD2   
300  N N     . LEU A 49  ? 0.2279 0.2206 0.1330 0.0403  -0.0084 -0.0406 177 LEU A N     
301  C CA    . LEU A 49  ? 0.2799 0.2645 0.1920 0.0386  -0.0137 -0.0478 177 LEU A CA    
302  C C     . LEU A 49  ? 0.2058 0.1892 0.1241 0.0404  -0.0133 -0.0540 177 LEU A C     
303  O O     . LEU A 49  ? 0.1676 0.1448 0.0956 0.0365  -0.0148 -0.0553 177 LEU A O     
304  C CB    . LEU A 49  ? 0.1727 0.1561 0.0818 0.0401  -0.0189 -0.0514 177 LEU A CB    
305  C CG    . LEU A 49  ? 0.2461 0.2273 0.1508 0.0392  -0.0216 -0.0475 177 LEU A CG    
306  C CD1   . LEU A 49  ? 0.2297 0.2133 0.1323 0.0422  -0.0267 -0.0504 177 LEU A CD1   
307  C CD2   . LEU A 49  ? 0.2006 0.1758 0.1160 0.0339  -0.0230 -0.0474 177 LEU A CD2   
308  N N     . THR A 50  ? 0.1996 0.1877 0.1133 0.0460  -0.0115 -0.0567 178 THR A N     
309  C CA    . THR A 50  ? 0.1927 0.1771 0.1127 0.0478  -0.0114 -0.0614 178 THR A CA    
310  C C     . THR A 50  ? 0.2147 0.1996 0.1403 0.0478  -0.0082 -0.0592 178 THR A C     
311  O O     . THR A 50  ? 0.1802 0.1570 0.1142 0.0454  -0.0101 -0.0609 178 THR A O     
312  C CB    . THR A 50  ? 0.1928 0.1819 0.1054 0.0550  -0.0098 -0.0648 178 THR A CB    
313  O OG1   . THR A 50  ? 0.2279 0.2131 0.1375 0.0546  -0.0150 -0.0692 178 THR A OG1   
314  C CG2   . THR A 50  ? 0.2226 0.2082 0.1399 0.0588  -0.0085 -0.0686 178 THR A CG2   
315  N N     . PHE A 51  ? 0.1688 0.1645 0.0939 0.0481  -0.0031 -0.0519 179 PHE A N     
316  C CA    . PHE A 51  ? 0.1842 0.1833 0.1200 0.0458  -0.0008 -0.0468 179 PHE A CA    
317  C C     . PHE A 51  ? 0.1683 0.1584 0.1111 0.0376  -0.0043 -0.0439 179 PHE A C     
318  O O     . PHE A 51  ? 0.1918 0.1782 0.1416 0.0369  -0.0050 -0.0436 179 PHE A O     
319  C CB    . PHE A 51  ? 0.1603 0.1747 0.0978 0.0450  0.0048  -0.0381 179 PHE A CB    
320  C CG    . PHE A 51  ? 0.2041 0.2311 0.1377 0.0543  0.0103  -0.0399 179 PHE A CG    
321  C CD1   . PHE A 51  ? 0.2148 0.2414 0.1510 0.0623  0.0108  -0.0461 179 PHE A CD1   
322  C CD2   . PHE A 51  ? 0.1992 0.2378 0.1257 0.0554  0.0154  -0.0348 179 PHE A CD2   
323  C CE1   . PHE A 51  ? 0.2663 0.3054 0.1979 0.0727  0.0167  -0.0483 179 PHE A CE1   
324  C CE2   . PHE A 51  ? 0.1878 0.2409 0.1101 0.0651  0.0222  -0.0359 179 PHE A CE2   
325  C CZ    . PHE A 51  ? 0.1921 0.2453 0.1172 0.0738  0.0225  -0.0432 179 PHE A CZ    
326  N N     . CYS A 52  ? 0.1718 0.1585 0.1119 0.0323  -0.0061 -0.0412 180 CYS A N     
327  C CA    . CYS A 52  ? 0.1696 0.1474 0.1145 0.0260  -0.0090 -0.0396 180 CYS A CA    
328  C C     . CYS A 52  ? 0.1597 0.1283 0.1080 0.0264  -0.0118 -0.0459 180 CYS A C     
329  O O     . CYS A 52  ? 0.1761 0.1393 0.1296 0.0233  -0.0123 -0.0442 180 CYS A O     
330  C CB    . CYS A 52  ? 0.2012 0.1760 0.1418 0.0226  -0.0107 -0.0372 180 CYS A CB    
331  S SG    . CYS A 52  ? 0.3097 0.2887 0.2476 0.0186  -0.0085 -0.0280 180 CYS A SG    
332  N N     . ARG A 53  ? 0.1484 0.1148 0.0932 0.0298  -0.0140 -0.0531 181 ARG A N     
333  C CA    . ARG A 53  ? 0.1733 0.1321 0.1246 0.0274  -0.0162 -0.0566 181 ARG A CA    
334  C C     . ARG A 53  ? 0.2249 0.1785 0.1792 0.0300  -0.0152 -0.0579 181 ARG A C     
335  O O     . ARG A 53  ? 0.1696 0.1152 0.1294 0.0265  -0.0158 -0.0570 181 ARG A O     
336  C CB    . ARG A 53  ? 0.1555 0.1159 0.1055 0.0281  -0.0187 -0.0607 181 ARG A CB    
337  C CG    . ARG A 53  ? 0.1829 0.1474 0.1314 0.0262  -0.0209 -0.0599 181 ARG A CG    
338  C CD    . ARG A 53  ? 0.1629 0.1303 0.1074 0.0292  -0.0241 -0.0646 181 ARG A CD    
339  N NE    . ARG A 53  ? 0.1797 0.1518 0.1219 0.0293  -0.0272 -0.0641 181 ARG A NE    
340  C CZ    . ARG A 53  ? 0.1875 0.1637 0.1229 0.0332  -0.0302 -0.0668 181 ARG A CZ    
341  N NH1   . ARG A 53  ? 0.1859 0.1620 0.1161 0.0369  -0.0304 -0.0707 181 ARG A NH1   
342  N NH2   . ARG A 53  ? 0.1950 0.1751 0.1282 0.0341  -0.0334 -0.0658 181 ARG A NH2   
343  N N     . ALA A 54  ? 0.2010 0.1591 0.1512 0.0369  -0.0134 -0.0597 182 ALA A N     
344  C CA    . ALA A 54  ? 0.2417 0.1951 0.1948 0.0414  -0.0126 -0.0607 182 ALA A CA    
345  C C     . ALA A 54  ? 0.1886 0.1419 0.1470 0.0386  -0.0117 -0.0540 182 ALA A C     
346  O O     . ALA A 54  ? 0.2108 0.1544 0.1726 0.0386  -0.0128 -0.0535 182 ALA A O     
347  C CB    . ALA A 54  ? 0.1915 0.1539 0.1400 0.0506  -0.0096 -0.0630 182 ALA A CB    
348  N N     . ALA A 55  ? 0.1721 0.1360 0.1314 0.0353  -0.0100 -0.0475 183 ALA A N     
349  C CA    . ALA A 55  ? 0.2245 0.1889 0.1884 0.0312  -0.0102 -0.0408 183 ALA A CA    
350  C C     . ALA A 55  ? 0.2068 0.1591 0.1711 0.0259  -0.0123 -0.0406 183 ALA A C     
351  O O     . ALA A 55  ? 0.1950 0.1419 0.1613 0.0254  -0.0129 -0.0376 183 ALA A O     
352  C CB    . ALA A 55  ? 0.1574 0.1323 0.1212 0.0270  -0.0091 -0.0351 183 ALA A CB    
353  N N     . SER A 56  ? 0.2152 0.1643 0.1776 0.0225  -0.0130 -0.0434 184 SER A N     
354  C CA    A SER A 56  ? 0.1654 0.1063 0.1296 0.0175  -0.0137 -0.0427 184 SER A CA    
355  C CA    B SER A 56  ? 0.1657 0.1066 0.1299 0.0175  -0.0137 -0.0427 184 SER A CA    
356  C C     . SER A 56  ? 0.1863 0.1165 0.1535 0.0179  -0.0144 -0.0453 184 SER A C     
357  O O     . SER A 56  ? 0.2154 0.1389 0.1842 0.0144  -0.0137 -0.0419 184 SER A O     
358  C CB    A SER A 56  ? 0.1427 0.0857 0.1060 0.0148  -0.0145 -0.0452 184 SER A CB    
359  C CB    B SER A 56  ? 0.1445 0.0874 0.1080 0.0148  -0.0145 -0.0452 184 SER A CB    
360  O OG    A SER A 56  ? 0.1344 0.0727 0.1009 0.0105  -0.0141 -0.0442 184 SER A OG    
361  O OG    B SER A 56  ? 0.1417 0.0840 0.1066 0.0160  -0.0160 -0.0510 184 SER A OG    
362  N N     . VAL A 57  ? 0.2033 0.1305 0.1702 0.0221  -0.0156 -0.0513 185 VAL A N     
363  C CA    . VAL A 57  ? 0.1644 0.0805 0.1347 0.0216  -0.0160 -0.0524 185 VAL A CA    
364  C C     . VAL A 57  ? 0.1863 0.0949 0.1556 0.0248  -0.0157 -0.0479 185 VAL A C     
365  O O     . VAL A 57  ? 0.1867 0.0839 0.1577 0.0217  -0.0156 -0.0450 185 VAL A O     
366  C CB    . VAL A 57  ? 0.1801 0.0964 0.1492 0.0255  -0.0168 -0.0579 185 VAL A CB    
367  C CG1   . VAL A 57  ? 0.2691 0.1715 0.2400 0.0264  -0.0174 -0.0589 185 VAL A CG1   
368  C CG2   . VAL A 57  ? 0.2147 0.1359 0.1845 0.0214  -0.0182 -0.0615 185 VAL A CG2   
369  N N     . LEU A 58  ? 0.1783 0.0964 0.1462 0.0301  -0.0149 -0.0453 186 LEU A N     
370  C CA    . LEU A 58  ? 0.1981 0.1138 0.1665 0.0333  -0.0151 -0.0396 186 LEU A CA    
371  C C     . LEU A 58  ? 0.2428 0.1570 0.2101 0.0272  -0.0148 -0.0328 186 LEU A C     
372  O O     . LEU A 58  ? 0.2281 0.1337 0.1940 0.0281  -0.0153 -0.0282 186 LEU A O     
373  C CB    . LEU A 58  ? 0.2225 0.1530 0.1923 0.0396  -0.0145 -0.0382 186 LEU A CB    
374  C CG    . LEU A 58  ? 0.1724 0.1067 0.1419 0.0481  -0.0135 -0.0444 186 LEU A CG    
375  C CD1   . LEU A 58  ? 0.2435 0.1960 0.2168 0.0537  -0.0119 -0.0410 186 LEU A CD1   
376  C CD2   . LEU A 58  ? 0.2400 0.1571 0.2080 0.0538  -0.0150 -0.0487 186 LEU A CD2   
377  N N     . LYS A 59  ? 0.1927 0.1142 0.1591 0.0218  -0.0141 -0.0321 187 LYS A N     
378  C CA    . LYS A 59  ? 0.1995 0.1189 0.1629 0.0170  -0.0136 -0.0270 187 LYS A CA    
379  C C     . LYS A 59  ? 0.1985 0.1061 0.1621 0.0135  -0.0119 -0.0260 187 LYS A C     
380  O O     . LYS A 59  ? 0.2000 0.1031 0.1596 0.0117  -0.0108 -0.0205 187 LYS A O     
381  C CB    . LYS A 59  ? 0.1804 0.1075 0.1421 0.0131  -0.0132 -0.0276 187 LYS A CB    
382  C CG    . LYS A 59  ? 0.2028 0.1411 0.1650 0.0146  -0.0143 -0.0275 187 LYS A CG    
383  C CD    . LYS A 59  ? 0.2056 0.1472 0.1650 0.0105  -0.0143 -0.0274 187 LYS A CD    
384  C CE    . LYS A 59  ? 0.2327 0.1842 0.1930 0.0109  -0.0147 -0.0267 187 LYS A CE    
385  N NZ    . LYS A 59  ? 0.2394 0.1907 0.1961 0.0077  -0.0147 -0.0269 187 LYS A NZ    
386  N N     . ALA A 60  ? 0.1969 0.0998 0.1648 0.0121  -0.0117 -0.0310 188 ALA A N     
387  C CA    . ALA A 60  ? 0.2462 0.1397 0.2173 0.0068  -0.0099 -0.0299 188 ALA A CA    
388  C C     . ALA A 60  ? 0.2413 0.1197 0.2121 0.0083  -0.0103 -0.0273 188 ALA A C     
389  O O     . ALA A 60  ? 0.2274 0.0967 0.2005 0.0030  -0.0082 -0.0241 188 ALA A O     
390  C CB    . ALA A 60  ? 0.2345 0.1305 0.2120 0.0034  -0.0109 -0.0369 188 ALA A CB    
391  N N     . LEU A 61  ? 0.2360 0.1118 0.2044 0.0157  -0.0126 -0.0279 189 LEU A N     
392  C CA    . LEU A 61  ? 0.2370 0.0963 0.2042 0.0190  -0.0136 -0.0257 189 LEU A CA    
393  C C     . LEU A 61  ? 0.2378 0.0911 0.1996 0.0181  -0.0119 -0.0157 189 LEU A C     
394  O O     . LEU A 61  ? 0.2193 0.0830 0.1769 0.0180  -0.0114 -0.0118 189 LEU A O     
395  C CB    . LEU A 61  ? 0.2614 0.1217 0.2275 0.0292  -0.0162 -0.0292 189 LEU A CB    
396  C CG    . LEU A 61  ? 0.2534 0.1164 0.2223 0.0316  -0.0173 -0.0389 189 LEU A CG    
397  C CD1   . LEU A 61  ? 0.2808 0.1501 0.2482 0.0428  -0.0182 -0.0414 189 LEU A CD1   
398  C CD2   . LEU A 61  ? 0.2314 0.0821 0.2041 0.0269  -0.0169 -0.0413 189 LEU A CD2   
399  N N     . PRO A 62  ? 0.2337 0.0687 0.1942 0.0175  -0.0116 -0.0115 190 PRO A N     
400  C CA    . PRO A 62  ? 0.2552 0.0835 0.2084 0.0168  -0.0096 -0.0009 190 PRO A CA    
401  C C     . PRO A 62  ? 0.2506 0.0775 0.1972 0.0267  -0.0130 0.0036  190 PRO A C     
402  O O     . PRO A 62  ? 0.2910 0.1132 0.2293 0.0274  -0.0124 0.0125  190 PRO A O     
403  C CB    . PRO A 62  ? 0.3013 0.1096 0.2568 0.0110  -0.0075 0.0023  190 PRO A CB    
404  C CG    . PRO A 62  ? 0.3338 0.1349 0.2956 0.0141  -0.0111 -0.0065 190 PRO A CG    
405  C CD    . PRO A 62  ? 0.2485 0.0668 0.2135 0.0159  -0.0128 -0.0160 190 PRO A CD    
406  N N     . SER A 63  ? 0.2707 0.1025 0.2204 0.0351  -0.0166 -0.0018 191 SER A N     
407  C CA    . SER A 63  ? 0.2548 0.0879 0.2008 0.0453  -0.0203 0.0024  191 SER A CA    
408  C C     . SER A 63  ? 0.2600 0.1087 0.2124 0.0525  -0.0224 -0.0049 191 SER A C     
409  O O     . SER A 63  ? 0.2539 0.1081 0.2112 0.0500  -0.0210 -0.0128 191 SER A O     
410  C CB    . SER A 63  ? 0.2803 0.0896 0.2222 0.0505  -0.0214 0.0071  191 SER A CB    
411  O OG    . SER A 63  ? 0.3549 0.1582 0.3040 0.0516  -0.0211 -0.0007 191 SER A OG    
412  N N     . PRO A 64  ? 0.2621 0.1197 0.2147 0.0618  -0.0258 -0.0021 192 PRO A N     
413  C CA    . PRO A 64  ? 0.2531 0.1297 0.2134 0.0683  -0.0267 -0.0077 192 PRO A CA    
414  C C     . PRO A 64  ? 0.3060 0.1733 0.2688 0.0756  -0.0258 -0.0152 192 PRO A C     
415  O O     . PRO A 64  ? 0.2652 0.1118 0.2246 0.0801  -0.0268 -0.0144 192 PRO A O     
416  C CB    . PRO A 64  ? 0.2612 0.1488 0.2225 0.0765  -0.0310 -0.0017 192 PRO A CB    
417  C CG    . PRO A 64  ? 0.2500 0.1290 0.2023 0.0716  -0.0326 0.0065  192 PRO A CG    
418  C CD    . PRO A 64  ? 0.2619 0.1169 0.2082 0.0660  -0.0290 0.0071  192 PRO A CD    
419  N N     . VAL A 65  ? 0.2550 0.1371 0.2227 0.0766  -0.0240 -0.0224 193 VAL A N     
420  C CA    . VAL A 65  ? 0.2446 0.1228 0.2133 0.0864  -0.0233 -0.0303 193 VAL A CA    
421  C C     . VAL A 65  ? 0.3294 0.2190 0.3024 0.0997  -0.0247 -0.0278 193 VAL A C     
422  O O     . VAL A 65  ? 0.2371 0.1511 0.2166 0.1009  -0.0247 -0.0247 193 VAL A O     
423  C CB    . VAL A 65  ? 0.2551 0.1472 0.2257 0.0836  -0.0203 -0.0379 193 VAL A CB    
424  C CG1   . VAL A 65  ? 0.2789 0.1739 0.2502 0.0918  -0.0184 -0.0445 193 VAL A CG1   
425  C CG2   . VAL A 65  ? 0.2277 0.1095 0.1954 0.0713  -0.0198 -0.0406 193 VAL A CG2   
426  N N     . THR A 66  ? 0.3410 0.2182 0.3130 0.1053  -0.0249 -0.0278 194 THR A N     
427  C CA    . THR A 66  ? 0.3709 0.2587 0.3475 0.1182  -0.0261 -0.0255 194 THR A CA    
428  C C     . THR A 66  ? 0.4212 0.3126 0.3995 0.1261  -0.0230 -0.0332 194 THR A C     
429  O O     . THR A 66  ? 0.3537 0.2632 0.3383 0.1367  -0.0224 -0.0328 194 THR A O     
430  C CB    . THR A 66  ? 0.3664 0.2366 0.3393 0.1208  -0.0294 -0.0180 194 THR A CB    
431  O OG1   . THR A 66  ? 0.4482 0.2926 0.4158 0.1156  -0.0282 -0.0204 194 THR A OG1   
432  C CG2   . THR A 66  ? 0.4344 0.3043 0.4039 0.1152  -0.0326 -0.0092 194 THR A CG2   
433  N N     . THR A 67  ? 0.3930 0.2690 0.3663 0.1210  -0.0213 -0.0400 195 THR A N     
434  C CA    . THR A 67  ? 0.4425 0.3186 0.4145 0.1284  -0.0190 -0.0478 195 THR A CA    
435  C C     . THR A 67  ? 0.4073 0.2857 0.3757 0.1212  -0.0167 -0.0554 195 THR A C     
436  O O     . THR A 67  ? 0.3397 0.2108 0.3064 0.1094  -0.0175 -0.0553 195 THR A O     
437  C CB    . THR A 67  ? 0.5144 0.3647 0.4823 0.1314  -0.0208 -0.0488 195 THR A CB    
438  O OG1   . THR A 67  ? 0.5763 0.4059 0.5403 0.1191  -0.0216 -0.0504 195 THR A OG1   
439  C CG2   . THR A 67  ? 0.5278 0.3731 0.4978 0.1372  -0.0237 -0.0398 195 THR A CG2   
440  N N     . LEU A 68  ? 0.4363 0.3258 0.4035 0.1286  -0.0138 -0.0618 196 LEU A N     
441  C CA    . LEU A 68  ? 0.4620 0.3555 0.4244 0.1231  -0.0120 -0.0686 196 LEU A CA    
442  C C     . LEU A 68  ? 0.4787 0.3480 0.4356 0.1147  -0.0147 -0.0733 196 LEU A C     
443  O O     . LEU A 68  ? 0.4520 0.3221 0.4065 0.1056  -0.0149 -0.0764 196 LEU A O     
444  C CB    . LEU A 68  ? 0.5237 0.4323 0.4840 0.1339  -0.0082 -0.0738 196 LEU A CB    
445  C CG    . LEU A 68  ? 0.6116 0.5322 0.5669 0.1299  -0.0055 -0.0784 196 LEU A CG    
446  N N     . SER A 69  ? 0.4327 0.2811 0.3883 0.1174  -0.0168 -0.0737 197 SER A N     
447  C CA    . SER A 69  ? 0.5433 0.3692 0.4953 0.1092  -0.0193 -0.0782 197 SER A CA    
448  C C     . SER A 69  ? 0.5051 0.3270 0.4603 0.0945  -0.0203 -0.0740 197 SER A C     
449  O O     . SER A 69  ? 0.5047 0.3180 0.4585 0.0855  -0.0216 -0.0785 197 SER A O     
450  C CB    . SER A 69  ? 0.5250 0.3282 0.4760 0.1144  -0.0211 -0.0776 197 SER A CB    
451  O OG    . SER A 69  ? 0.5686 0.3658 0.5238 0.1126  -0.0220 -0.0678 197 SER A OG    
452  N N     . GLN A 70  ? 0.4145 0.2434 0.3738 0.0924  -0.0199 -0.0656 198 GLN A N     
453  C CA    . GLN A 70  ? 0.4321 0.2582 0.3940 0.0794  -0.0203 -0.0612 198 GLN A CA    
454  C C     . GLN A 70  ? 0.3606 0.2011 0.3224 0.0726  -0.0195 -0.0653 198 GLN A C     
455  O O     . GLN A 70  ? 0.3837 0.2216 0.3477 0.0616  -0.0198 -0.0636 198 GLN A O     
456  C CB    . GLN A 70  ? 0.4577 0.2883 0.4218 0.0804  -0.0205 -0.0516 198 GLN A CB    
457  C CG    . GLN A 70  ? 0.5557 0.3694 0.5193 0.0849  -0.0218 -0.0456 198 GLN A CG    
458  C CD    . GLN A 70  ? 0.5228 0.3443 0.4870 0.0897  -0.0229 -0.0365 198 GLN A CD    
459  O OE1   . GLN A 70  ? 0.4395 0.2809 0.4054 0.0931  -0.0227 -0.0360 198 GLN A OE1   
460  N NE2   . GLN A 70  ? 0.4752 0.2810 0.4376 0.0899  -0.0243 -0.0289 198 GLN A NE2   
461  N N     . LEU A 71  ? 0.3504 0.2064 0.3095 0.0793  -0.0182 -0.0702 199 LEU A N     
462  C CA    . LEU A 71  ? 0.3235 0.1920 0.2812 0.0737  -0.0177 -0.0737 199 LEU A CA    
463  C C     . LEU A 71  ? 0.4370 0.2961 0.3909 0.0695  -0.0197 -0.0813 199 LEU A C     
464  O O     . LEU A 71  ? 0.3616 0.2276 0.3150 0.0628  -0.0204 -0.0833 199 LEU A O     
465  C CB    . LEU A 71  ? 0.3237 0.2130 0.2793 0.0823  -0.0148 -0.0748 199 LEU A CB    
466  C CG    . LEU A 71  ? 0.3334 0.2373 0.2935 0.0860  -0.0130 -0.0682 199 LEU A CG    
467  C CD1   . LEU A 71  ? 0.3141 0.2398 0.2730 0.0932  -0.0092 -0.0698 199 LEU A CD1   
468  C CD2   . LEU A 71  ? 0.2484 0.1527 0.2113 0.0759  -0.0141 -0.0634 199 LEU A CD2   
469  N N     . GLN A 72  ? 0.4615 0.3048 0.4127 0.0738  -0.0211 -0.0856 200 GLN A N     
470  C CA    . GLN A 72  ? 0.4683 0.3017 0.4153 0.0704  -0.0239 -0.0937 200 GLN A CA    
471  C C     . GLN A 72  ? 0.4377 0.2656 0.3895 0.0565  -0.0260 -0.0925 200 GLN A C     
472  O O     . GLN A 72  ? 0.4831 0.3020 0.4406 0.0502  -0.0255 -0.0865 200 GLN A O     
473  C CB    . GLN A 72  ? 0.5109 0.3244 0.4548 0.0764  -0.0254 -0.0979 200 GLN A CB    
474  N N     . GLY A 73  ? 0.5019 0.3362 0.4513 0.0521  -0.0282 -0.0979 201 GLY A N     
475  C CA    . GLY A 73  ? 0.5791 0.4112 0.5337 0.0397  -0.0305 -0.0975 201 GLY A CA    
476  C C     . GLY A 73  ? 0.5116 0.3587 0.4715 0.0342  -0.0286 -0.0908 201 GLY A C     
477  O O     . GLY A 73  ? 0.4871 0.3359 0.4517 0.0248  -0.0304 -0.0907 201 GLY A O     
478  N N     . LEU A 74  ? 0.4544 0.3127 0.4139 0.0398  -0.0252 -0.0856 202 LEU A N     
479  C CA    . LEU A 74  ? 0.3685 0.2398 0.3318 0.0349  -0.0236 -0.0800 202 LEU A CA    
480  C C     . LEU A 74  ? 0.2894 0.1756 0.2493 0.0351  -0.0247 -0.0832 202 LEU A C     
481  O O     . LEU A 74  ? 0.3233 0.2159 0.2765 0.0429  -0.0241 -0.0865 202 LEU A O     
482  C CB    . LEU A 74  ? 0.3255 0.2030 0.2893 0.0405  -0.0206 -0.0738 202 LEU A CB    
483  C CG    . LEU A 74  ? 0.3697 0.2342 0.3367 0.0402  -0.0199 -0.0682 202 LEU A CG    
484  C CD1   . LEU A 74  ? 0.3352 0.2086 0.3019 0.0463  -0.0183 -0.0627 202 LEU A CD1   
485  C CD2   . LEU A 74  ? 0.3967 0.2532 0.3690 0.0292  -0.0201 -0.0646 202 LEU A CD2   
486  N N     . PRO A 75  ? 0.3107 0.2026 0.2744 0.0273  -0.0260 -0.0821 203 PRO A N     
487  C CA    . PRO A 75  ? 0.3227 0.2277 0.2825 0.0284  -0.0275 -0.0845 203 PRO A CA    
488  C C     . PRO A 75  ? 0.3035 0.2214 0.2592 0.0342  -0.0240 -0.0807 203 PRO A C     
489  O O     . PRO A 75  ? 0.2543 0.1740 0.2129 0.0342  -0.0212 -0.0752 203 PRO A O     
490  C CB    . PRO A 75  ? 0.2739 0.1819 0.2408 0.0194  -0.0295 -0.0830 203 PRO A CB    
491  C CG    . PRO A 75  ? 0.3944 0.2945 0.3679 0.0144  -0.0271 -0.0777 203 PRO A CG    
492  C CD    . PRO A 75  ? 0.3073 0.1935 0.2789 0.0178  -0.0264 -0.0788 203 PRO A CD    
493  N N     . HIS A 76  ? 0.2964 0.2229 0.2448 0.0393  -0.0245 -0.0837 204 HIS A N     
494  C CA    . HIS A 76  ? 0.2678 0.2074 0.2111 0.0443  -0.0212 -0.0804 204 HIS A CA    
495  C C     . HIS A 76  ? 0.2784 0.2202 0.2194 0.0524  -0.0172 -0.0795 204 HIS A C     
496  O O     . HIS A 76  ? 0.3794 0.3327 0.3180 0.0559  -0.0136 -0.0759 204 HIS A O     
497  C CB    . HIS A 76  ? 0.2212 0.1666 0.1687 0.0389  -0.0201 -0.0743 204 HIS A CB    
498  C CG    . HIS A 76  ? 0.2119 0.1570 0.1632 0.0321  -0.0236 -0.0749 204 HIS A CG    
499  N ND1   . HIS A 76  ? 0.2020 0.1531 0.1486 0.0330  -0.0264 -0.0774 204 HIS A ND1   
500  C CD2   . HIS A 76  ? 0.2566 0.1968 0.2161 0.0250  -0.0248 -0.0734 204 HIS A CD2   
501  C CE1   . HIS A 76  ? 0.2323 0.1831 0.1851 0.0271  -0.0296 -0.0778 204 HIS A CE1   
502  N NE2   . HIS A 76  ? 0.2481 0.1927 0.2089 0.0220  -0.0283 -0.0754 204 HIS A NE2   
503  N N     . PHE A 77  ? 0.2548 0.1864 0.1965 0.0558  -0.0177 -0.0827 205 PHE A N     
504  C CA    . PHE A 77  ? 0.2853 0.2202 0.2252 0.0654  -0.0142 -0.0826 205 PHE A CA    
505  C C     . PHE A 77  ? 0.3414 0.2746 0.2731 0.0726  -0.0146 -0.0893 205 PHE A C     
506  O O     . PHE A 77  ? 0.5515 0.4705 0.4825 0.0729  -0.0175 -0.0943 205 PHE A O     
507  C CB    . PHE A 77  ? 0.2424 0.1665 0.1887 0.0656  -0.0143 -0.0801 205 PHE A CB    
508  C CG    . PHE A 77  ? 0.2589 0.1889 0.2106 0.0634  -0.0127 -0.0734 205 PHE A CG    
509  C CD1   . PHE A 77  ? 0.2103 0.1532 0.1627 0.0711  -0.0092 -0.0705 205 PHE A CD1   
510  C CD2   . PHE A 77  ? 0.2316 0.1559 0.1878 0.0540  -0.0146 -0.0700 205 PHE A CD2   
511  C CE1   . PHE A 77  ? 0.2428 0.1912 0.1999 0.0695  -0.0085 -0.0651 205 PHE A CE1   
512  C CE2   . PHE A 77  ? 0.2686 0.1971 0.2280 0.0524  -0.0137 -0.0645 205 PHE A CE2   
513  C CZ    . PHE A 77  ? 0.2775 0.2172 0.2369 0.0601  -0.0112 -0.0624 205 PHE A CZ    
514  N N     . GLY A 78  ? 0.3602 0.3075 0.2850 0.0785  -0.0114 -0.0894 206 GLY A N     
515  C CA    . GLY A 78  ? 0.3849 0.3330 0.3004 0.0871  -0.0107 -0.0953 206 GLY A CA    
516  C C     . GLY A 78  ? 0.4165 0.3759 0.3317 0.0975  -0.0045 -0.0932 206 GLY A C     
517  O O     . GLY A 78  ? 0.3489 0.3104 0.2725 0.0984  -0.0025 -0.0887 206 GLY A O     
518  N N     . GLU A 79  ? 0.2907 0.2590 0.1966 0.1058  -0.0014 -0.0960 207 GLU A N     
519  C CA    . GLU A 79  ? 0.3615 0.3424 0.2681 0.1166  0.0051  -0.0943 207 GLU A CA    
520  C C     . GLU A 79  ? 0.3187 0.3182 0.2340 0.1155  0.0107  -0.0852 207 GLU A C     
521  O O     . GLU A 79  ? 0.2861 0.2919 0.2100 0.1204  0.0136  -0.0823 207 GLU A O     
522  C CB    . GLU A 79  ? 0.3288 0.3179 0.2229 0.1250  0.0082  -0.0982 207 GLU A CB    
523  C CG    . GLU A 79  ? 0.4491 0.4540 0.3442 0.1365  0.0158  -0.0962 207 GLU A CG    
524  N N     . HIS A 80  ? 0.3008 0.3096 0.2145 0.1092  0.0121  -0.0806 208 HIS A N     
525  C CA    . HIS A 80  ? 0.2778 0.3063 0.1987 0.1083  0.0182  -0.0720 208 HIS A CA    
526  C C     . HIS A 80  ? 0.2675 0.2918 0.2003 0.1034  0.0158  -0.0688 208 HIS A C     
527  O O     . HIS A 80  ? 0.3116 0.3484 0.2543 0.1077  0.0194  -0.0646 208 HIS A O     
528  C CB    . HIS A 80  ? 0.3245 0.3610 0.2385 0.1028  0.0201  -0.0678 208 HIS A CB    
529  C CG    . HIS A 80  ? 0.3099 0.3702 0.2284 0.1032  0.0286  -0.0585 208 HIS A CG    
530  N ND1   . HIS A 80  ? 0.2762 0.3480 0.1863 0.1021  0.0335  -0.0535 208 HIS A ND1   
531  C CD2   . HIS A 80  ? 0.2879 0.3639 0.2198 0.1036  0.0332  -0.0523 208 HIS A CD2   
532  C CE1   . HIS A 80  ? 0.2425 0.3358 0.1610 0.1006  0.0413  -0.0439 208 HIS A CE1   
533  N NE2   . HIS A 80  ? 0.3051 0.4027 0.2379 0.1014  0.0411  -0.0433 208 HIS A NE2   
534  N N     . SER A 81  ? 0.2476 0.2559 0.1804 0.0946  0.0096  -0.0703 209 SER A N     
535  C CA    A SER A 81  ? 0.2419 0.2449 0.1841 0.0899  0.0072  -0.0672 209 SER A CA    
536  C CA    B SER A 81  ? 0.2431 0.2464 0.1853 0.0900  0.0073  -0.0671 209 SER A CA    
537  C C     . SER A 81  ? 0.2575 0.2524 0.2057 0.0955  0.0056  -0.0686 209 SER A C     
538  O O     . SER A 81  ? 0.2379 0.2372 0.1950 0.0968  0.0058  -0.0643 209 SER A O     
539  C CB    A SER A 81  ? 0.2588 0.2459 0.1995 0.0794  0.0012  -0.0685 209 SER A CB    
540  C CB    B SER A 81  ? 0.2534 0.2412 0.1942 0.0794  0.0014  -0.0682 209 SER A CB    
541  O OG    A SER A 81  ? 0.2558 0.2491 0.1903 0.0749  0.0019  -0.0671 209 SER A OG    
542  O OG    B SER A 81  ? 0.3058 0.2780 0.2432 0.0778  -0.0031 -0.0740 209 SER A OG    
543  N N     . SER A 82  ? 0.2748 0.2573 0.2180 0.0994  0.0035  -0.0745 210 SER A N     
544  C CA    . SER A 82  ? 0.3793 0.3523 0.3266 0.1056  0.0022  -0.0756 210 SER A CA    
545  C C     . SER A 82  ? 0.3751 0.3679 0.3280 0.1163  0.0076  -0.0724 210 SER A C     
546  O O     . SER A 82  ? 0.2752 0.2681 0.2362 0.1204  0.0069  -0.0692 210 SER A O     
547  C CB    . SER A 82  ? 0.4145 0.3697 0.3543 0.1074  -0.0010 -0.0832 210 SER A CB    
548  O OG    . SER A 82  ? 0.3725 0.3117 0.3109 0.0967  -0.0061 -0.0853 210 SER A OG    
549  N N     A ARG A 83  ? 0.3377 0.3485 0.2869 0.1211  0.0133  -0.0724 211 ARG A N     
550  N N     B ARG A 83  ? 0.3367 0.3473 0.2858 0.1210  0.0132  -0.0724 211 ARG A N     
551  C CA    A ARG A 83  ? 0.3147 0.3486 0.2719 0.1300  0.0194  -0.0680 211 ARG A CA    
552  C CA    B ARG A 83  ? 0.3195 0.3539 0.2762 0.1298  0.0196  -0.0681 211 ARG A CA    
553  C C     A ARG A 83  ? 0.2841 0.3349 0.2551 0.1264  0.0208  -0.0596 211 ARG A C     
554  C C     B ARG A 83  ? 0.2827 0.3341 0.2534 0.1264  0.0210  -0.0597 211 ARG A C     
555  O O     A ARG A 83  ? 0.2831 0.3449 0.2657 0.1319  0.0214  -0.0558 211 ARG A O     
556  O O     B ARG A 83  ? 0.2847 0.3474 0.2668 0.1323  0.0218  -0.0559 211 ARG A O     
557  C CB    A ARG A 83  ? 0.2947 0.3460 0.2454 0.1342  0.0261  -0.0681 211 ARG A CB    
558  C CB    B ARG A 83  ? 0.2831 0.3340 0.2326 0.1329  0.0260  -0.0681 211 ARG A CB    
559  C CG    A ARG A 83  ? 0.3200 0.3983 0.2811 0.1424  0.0334  -0.0626 211 ARG A CG    
560  C CG    B ARG A 83  ? 0.3273 0.4050 0.2850 0.1415  0.0338  -0.0632 211 ARG A CG    
561  C CD    A ARG A 83  ? 0.3681 0.4725 0.3390 0.1360  0.0389  -0.0530 211 ARG A CD    
562  C CD    B ARG A 83  ? 0.3863 0.4831 0.3382 0.1412  0.0412  -0.0599 211 ARG A CD    
563  N NE    A ARG A 83  ? 0.4186 0.5287 0.3785 0.1323  0.0432  -0.0520 211 ARG A NE    
564  N NE    B ARG A 83  ? 0.5046 0.5865 0.4388 0.1428  0.0393  -0.0673 211 ARG A NE    
565  C CZ    A ARG A 83  ? 0.4896 0.6161 0.4535 0.1243  0.0475  -0.0439 211 ARG A CZ    
566  C CZ    B ARG A 83  ? 0.4868 0.5674 0.4110 0.1365  0.0394  -0.0665 211 ARG A CZ    
567  N NH1   A ARG A 83  ? 0.5029 0.6433 0.4828 0.1185  0.0479  -0.0366 211 ARG A NH1   
568  N NH1   B ARG A 83  ? 0.4870 0.5789 0.4161 0.1279  0.0418  -0.0586 211 ARG A NH1   
569  N NH2   A ARG A 83  ? 0.5295 0.6581 0.4812 0.1219  0.0510  -0.0427 211 ARG A NH2   
570  N NH2   B ARG A 83  ? 0.5478 0.6157 0.4569 0.1391  0.0367  -0.0737 211 ARG A NH2   
571  N N     . VAL A 84  ? 0.2558 0.3096 0.2260 0.1171  0.0207  -0.0568 212 VAL A N     
572  C CA    . VAL A 84  ? 0.2883 0.3572 0.2719 0.1111  0.0208  -0.0484 212 VAL A CA    
573  C C     . VAL A 84  ? 0.2920 0.3481 0.2826 0.1110  0.0143  -0.0471 212 VAL A C     
574  O O     . VAL A 84  ? 0.2413 0.3130 0.2452 0.1122  0.0140  -0.0406 212 VAL A O     
575  C CB    . VAL A 84  ? 0.2734 0.3374 0.2527 0.0960  0.0191  -0.0444 212 VAL A CB    
576  C CG1   . VAL A 84  ? 0.2057 0.2777 0.1975 0.0843  0.0163  -0.0346 212 VAL A CG1   
577  C CG2   . VAL A 84  ? 0.3185 0.3965 0.2905 0.0965  0.0257  -0.0436 212 VAL A CG2   
578  N N     . VAL A 85  ? 0.2005 0.2286 0.1826 0.1091  0.0087  -0.0527 213 VAL A N     
579  C CA    . VAL A 85  ? 0.2405 0.2540 0.2269 0.1088  0.0030  -0.0505 213 VAL A CA    
580  C C     . VAL A 85  ? 0.2919 0.3090 0.2829 0.1225  0.0036  -0.0512 213 VAL A C     
581  O O     . VAL A 85  ? 0.3491 0.3715 0.3493 0.1259  0.0008  -0.0459 213 VAL A O     
582  C CB    . VAL A 85  ? 0.2604 0.2439 0.2370 0.1034  -0.0018 -0.0557 213 VAL A CB    
583  C CG1   . VAL A 85  ? 0.2664 0.2322 0.2446 0.1063  -0.0062 -0.0541 213 VAL A CG1   
584  C CG2   . VAL A 85  ? 0.2740 0.2548 0.2500 0.0884  -0.0037 -0.0516 213 VAL A CG2   
585  N N     . GLN A 86  ? 0.2316 0.2458 0.2162 0.1284  0.0064  -0.0565 214 GLN A N     
586  C CA    . GLN A 86  ? 0.2475 0.2638 0.2358 0.1396  0.0070  -0.0568 214 GLN A CA    
587  C C     . GLN A 86  ? 0.3182 0.3658 0.3215 0.1450  0.0102  -0.0498 214 GLN A C     
588  O O     . GLN A 86  ? 0.3365 0.3865 0.3478 0.1512  0.0075  -0.0463 214 GLN A O     
589  C CB    . GLN A 86  ? 0.2937 0.3055 0.2723 0.1458  0.0101  -0.0641 214 GLN A CB    
590  C CG    . GLN A 86  ? 0.2852 0.3000 0.2676 0.1587  0.0111  -0.0647 214 GLN A CG    
591  N N     . GLU A 87  ? 0.2279 0.3009 0.2358 0.1425  0.0161  -0.0471 215 GLU A N     
592  C CA    . GLU A 87  ? 0.2785 0.3847 0.3037 0.1452  0.0195  -0.0395 215 GLU A CA    
593  C C     . GLU A 87  ? 0.2087 0.3205 0.2462 0.1401  0.0133  -0.0327 215 GLU A C     
594  O O     . GLU A 87  ? 0.2502 0.3780 0.3012 0.1443  0.0112  -0.0275 215 GLU A O     
595  C CB    . GLU A 87  ? 0.2187 0.3505 0.2471 0.1408  0.0273  -0.0362 215 GLU A CB    
596  C CG    . GLU A 87  ? 0.2886 0.4146 0.3030 0.1450  0.0324  -0.0422 215 GLU A CG    
597  C CD    . GLU A 87  ? 0.4347 0.5884 0.4524 0.1420  0.0412  -0.0369 215 GLU A CD    
598  O OE1   . GLU A 87  ? 0.4320 0.6091 0.4639 0.1342  0.0435  -0.0282 215 GLU A OE1   
599  O OE2   . GLU A 87  ? 0.5127 0.6638 0.5182 0.1472  0.0456  -0.0413 215 GLU A OE2   
600  N N     . LEU A 88  ? 0.2419 0.3379 0.2733 0.1284  0.0091  -0.0320 216 LEU A N     
601  C CA    . LEU A 88  ? 0.2418 0.3380 0.2807 0.1184  0.0020  -0.0246 216 LEU A CA    
602  C C     . LEU A 88  ? 0.2862 0.3671 0.3245 0.1279  -0.0040 -0.0249 216 LEU A C     
603  O O     . LEU A 88  ? 0.2557 0.3491 0.3047 0.1288  -0.0087 -0.0188 216 LEU A O     
604  C CB    . LEU A 88  ? 0.1745 0.2529 0.2039 0.1023  -0.0007 -0.0239 216 LEU A CB    
605  C CG    . LEU A 88  ? 0.2372 0.3317 0.2698 0.0904  0.0029  -0.0200 216 LEU A CG    
606  C CD1   . LEU A 88  ? 0.1685 0.2415 0.1879 0.0797  0.0016  -0.0224 216 LEU A CD1   
607  C CD2   . LEU A 88  ? 0.2498 0.3640 0.2966 0.0817  -0.0005 -0.0117 216 LEU A CD2   
608  N N     . LEU A 89  ? 0.2472 0.3003 0.2725 0.1352  -0.0046 -0.0319 217 LEU A N     
609  C CA    . LEU A 89  ? 0.2692 0.3031 0.2917 0.1419  -0.0098 -0.0310 217 LEU A CA    
610  C C     . LEU A 89  ? 0.3657 0.4175 0.3981 0.1530  -0.0084 -0.0291 217 LEU A C     
611  O O     . LEU A 89  ? 0.3334 0.3848 0.3708 0.1572  -0.0136 -0.0240 217 LEU A O     
612  C CB    . LEU A 89  ? 0.3117 0.3117 0.3190 0.1408  -0.0099 -0.0378 217 LEU A CB    
613  C CG    . LEU A 89  ? 0.3366 0.3152 0.3343 0.1292  -0.0120 -0.0397 217 LEU A CG    
614  C CD1   . LEU A 89  ? 0.2849 0.2355 0.2716 0.1273  -0.0121 -0.0460 217 LEU A CD1   
615  C CD2   . LEU A 89  ? 0.3173 0.2885 0.3157 0.1225  -0.0175 -0.0322 217 LEU A CD2   
616  N N     . GLU A 90  ? 0.2398 0.3076 0.2746 0.1579  -0.0014 -0.0327 218 GLU A N     
617  C CA    . GLU A 90  ? 0.3040 0.3869 0.3471 0.1695  0.0007  -0.0319 218 GLU A CA    
618  C C     . GLU A 90  ? 0.3442 0.4643 0.4073 0.1688  0.0009  -0.0241 218 GLU A C     
619  O O     . GLU A 90  ? 0.3630 0.4930 0.4358 0.1764  -0.0019 -0.0207 218 GLU A O     
620  C CB    . GLU A 90  ? 0.3758 0.4596 0.4116 0.1755  0.0080  -0.0391 218 GLU A CB    
621  N N     . HIS A 91  ? 0.2741 0.4154 0.3446 0.1590  0.0036  -0.0209 219 HIS A N     
622  C CA    . HIS A 91  ? 0.2953 0.4740 0.3866 0.1556  0.0044  -0.0134 219 HIS A CA    
623  C C     . HIS A 91  ? 0.3065 0.4951 0.4062 0.1425  -0.0018 -0.0071 219 HIS A C     
624  O O     . HIS A 91  ? 0.3161 0.5351 0.4342 0.1366  -0.0026 -0.0006 219 HIS A O     
625  C CB    . HIS A 91  ? 0.3337 0.5360 0.4296 0.1552  0.0148  -0.0137 219 HIS A CB    
626  C CG    . HIS A 91  ? 0.4320 0.6273 0.5191 0.1681  0.0207  -0.0201 219 HIS A CG    
627  N ND1   . HIS A 91  ? 0.4768 0.6524 0.5452 0.1699  0.0252  -0.0276 219 HIS A ND1   
628  C CD2   . HIS A 91  ? 0.4013 0.6065 0.4952 0.1800  0.0220  -0.0204 219 HIS A CD2   
629  C CE1   . HIS A 91  ? 0.4340 0.6075 0.4978 0.1820  0.0288  -0.0323 219 HIS A CE1   
630  N NE2   . HIS A 91  ? 0.4695 0.6608 0.5486 0.1889  0.0275  -0.0282 219 HIS A NE2   
631  N N     . GLY A 92  ? 0.2682 0.4313 0.3550 0.1365  -0.0066 -0.0088 220 GLY A N     
632  C CA    . GLY A 92  ? 0.2975 0.4602 0.3858 0.1184  -0.0125 -0.0034 220 GLY A CA    
633  C C     . GLY A 92  ? 0.3402 0.5169 0.4321 0.1043  -0.0072 -0.0012 220 GLY A C     
634  O O     . GLY A 92  ? 0.2324 0.4086 0.3258 0.0892  -0.0121 0.0029  220 GLY A O     
635  N N     . VAL A 93  ? 0.3555 0.5429 0.4472 0.1092  0.0025  -0.0038 221 VAL A N     
636  C CA    . VAL A 93  ? 0.3256 0.5274 0.4205 0.0969  0.0083  -0.0002 221 VAL A CA    
637  C C     . VAL A 93  ? 0.2681 0.4648 0.3506 0.1047  0.0178  -0.0060 221 VAL A C     
638  O O     . VAL A 93  ? 0.2611 0.4580 0.3408 0.1212  0.0214  -0.0116 221 VAL A O     
639  C CB    . VAL A 93  ? 0.2452 0.4867 0.3645 0.0933  0.0100  0.0078  221 VAL A CB    
640  C CG1   . VAL A 93  ? 0.2175 0.4828 0.3486 0.1117  0.0152  0.0067  221 VAL A CG1   
641  C CG2   . VAL A 93  ? 0.2644 0.5192 0.3866 0.0802  0.0168  0.0128  221 VAL A CG2   
642  N N     . CYS A 94  ? 0.2416 0.4323 0.3151 0.0936  0.0212  -0.0051 222 CYS A N     
643  C CA    . CYS A 94  ? 0.2398 0.4273 0.3001 0.0996  0.0297  -0.0100 222 CYS A CA    
644  C C     . CYS A 94  ? 0.2317 0.4477 0.3009 0.0932  0.0381  -0.0022 222 CYS A C     
645  O O     . CYS A 94  ? 0.2213 0.4388 0.2943 0.0772  0.0361  0.0046  222 CYS A O     
646  C CB    . CYS A 94  ? 0.2076 0.3626 0.2479 0.0933  0.0263  -0.0154 222 CYS A CB    
647  S SG    . CYS A 94  ? 0.2618 0.4131 0.2841 0.0988  0.0347  -0.0211 222 CYS A SG    
648  N N     . GLU A 95  ? 0.1710 0.4086 0.2429 0.1058  0.0477  -0.0031 223 GLU A N     
649  C CA    . GLU A 95  ? 0.1717 0.4387 0.2539 0.0995  0.0566  0.0060  223 GLU A CA    
650  C C     . GLU A 95  ? 0.2000 0.4575 0.2689 0.0878  0.0597  0.0092  223 GLU A C     
651  O O     . GLU A 95  ? 0.2223 0.4937 0.3014 0.0735  0.0615  0.0193  223 GLU A O     
652  C CB    . GLU A 95  ? 0.2306 0.5062 0.3092 0.1116  0.0638  0.0036  223 GLU A CB    
653  C CG    . GLU A 95  ? 0.3237 0.6292 0.4144 0.1050  0.0726  0.0138  223 GLU A CG    
654  N N     . GLU A 96  ? 0.1852 0.4167 0.2310 0.0930  0.0594  0.0008  224 GLU A N     
655  C CA    . GLU A 96  ? 0.1814 0.4008 0.2126 0.0827  0.0608  0.0036  224 GLU A CA    
656  C C     . GLU A 96  ? 0.1657 0.3722 0.2020 0.0647  0.0525  0.0094  224 GLU A C     
657  O O     . GLU A 96  ? 0.2093 0.4201 0.2460 0.0526  0.0549  0.0178  224 GLU A O     
658  C CB    . GLU A 96  ? 0.1901 0.3829 0.1971 0.0912  0.0590  -0.0076 224 GLU A CB    
659  C CG    . GLU A 96  ? 0.2457 0.4307 0.2366 0.0844  0.0617  -0.0048 224 GLU A CG    
660  C CD    . GLU A 96  ? 0.3095 0.4663 0.2790 0.0893  0.0563  -0.0159 224 GLU A CD    
661  O OE1   . GLU A 96  ? 0.3136 0.4564 0.2805 0.0978  0.0514  -0.0260 224 GLU A OE1   
662  O OE2   . GLU A 96  ? 0.3017 0.4503 0.2575 0.0843  0.0566  -0.0141 224 GLU A OE2   
663  N N     . VAL A 97  ? 0.1672 0.3567 0.2062 0.0630  0.0427  0.0050  225 VAL A N     
664  C CA    . VAL A 97  ? 0.1635 0.3398 0.2054 0.0475  0.0345  0.0092  225 VAL A CA    
665  C C     . VAL A 97  ? 0.2070 0.4074 0.2690 0.0364  0.0352  0.0197  225 VAL A C     
666  O O     . VAL A 97  ? 0.1831 0.3791 0.2452 0.0224  0.0337  0.0260  225 VAL A O     
667  C CB    . VAL A 97  ? 0.2072 0.3632 0.2475 0.0497  0.0250  0.0028  225 VAL A CB    
668  C CG1   . VAL A 97  ? 0.1932 0.3400 0.2379 0.0352  0.0169  0.0071  225 VAL A CG1   
669  C CG2   . VAL A 97  ? 0.1481 0.2780 0.1695 0.0562  0.0236  -0.0065 225 VAL A CG2   
670  N N     . GLU A 98  ? 0.1446 0.3705 0.2244 0.0426  0.0370  0.0217  226 GLU A N     
671  C CA    . GLU A 98  ? 0.1433 0.3951 0.2454 0.0314  0.0366  0.0314  226 GLU A CA    
672  C C     . GLU A 98  ? 0.1854 0.4539 0.2899 0.0239  0.0466  0.0404  226 GLU A C     
673  O O     . GLU A 98  ? 0.1941 0.4680 0.3086 0.0077  0.0446  0.0488  226 GLU A O     
674  C CB    . GLU A 98  ? 0.1704 0.4494 0.2922 0.0416  0.0368  0.0315  226 GLU A CB    
675  C CG    . GLU A 98  ? 0.2199 0.4826 0.3400 0.0478  0.0262  0.0248  226 GLU A CG    
676  C CD    . GLU A 98  ? 0.2843 0.5272 0.4018 0.0329  0.0150  0.0260  226 GLU A CD    
677  O OE1   . GLU A 98  ? 0.3673 0.6256 0.5003 0.0198  0.0115  0.0329  226 GLU A OE1   
678  O OE2   . GLU A 98  ? 0.2911 0.5033 0.3911 0.0341  0.0098  0.0198  226 GLU A OE2   
679  N N     . ARG A 99  ? 0.1556 0.4308 0.2496 0.0354  0.0572  0.0387  227 ARG A N     
680  C CA    . ARG A 99  ? 0.1641 0.4541 0.2570 0.0293  0.0677  0.0481  227 ARG A CA    
681  C C     . ARG A 99  ? 0.1745 0.4385 0.2536 0.0149  0.0638  0.0518  227 ARG A C     
682  O O     . ARG A 99  ? 0.2359 0.5088 0.3229 0.0008  0.0666  0.0628  227 ARG A O     
683  C CB    . ARG A 99  ? 0.2519 0.5490 0.3302 0.0464  0.0788  0.0437  227 ARG A CB    
684  C CG    . ARG A 99  ? 0.4415 0.7520 0.5170 0.0418  0.0893  0.0533  227 ARG A CG    
685  C CD    . ARG A 99  ? 0.5059 0.8200 0.5690 0.0584  0.0965  0.0475  227 ARG A CD    
686  N NE    . ARG A 99  ? 0.5427 0.8312 0.5801 0.0704  0.0942  0.0356  227 ARG A NE    
687  C CZ    . ARG A 99  ? 0.5433 0.8208 0.5753 0.0843  0.0897  0.0234  227 ARG A CZ    
688  N NH1   . ARG A 99  ? 0.5430 0.8328 0.5923 0.0897  0.0874  0.0215  227 ARG A NH1   
689  N NH2   . ARG A 99  ? 0.5392 0.7915 0.5481 0.0922  0.0865  0.0130  227 ARG A NH2   
690  N N     . VAL A 100 ? 0.1663 0.3980 0.2254 0.0183  0.0571  0.0429  228 VAL A N     
691  C CA    . VAL A 100 ? 0.1651 0.3713 0.2114 0.0064  0.0524  0.0454  228 VAL A CA    
692  C C     . VAL A 100 ? 0.1600 0.3633 0.2208 -0.0098 0.0441  0.0507  228 VAL A C     
693  O O     . VAL A 100 ? 0.2155 0.4152 0.2772 -0.0231 0.0444  0.0594  228 VAL A O     
694  C CB    . VAL A 100 ? 0.2315 0.4073 0.2575 0.0138  0.0462  0.0341  228 VAL A CB    
695  C CG1   . VAL A 100 ? 0.2854 0.4356 0.3008 0.0026  0.0399  0.0359  228 VAL A CG1   
696  C CG2   . VAL A 100 ? 0.2044 0.3808 0.2138 0.0279  0.0533  0.0287  228 VAL A CG2   
697  N N     . ARG A 101 ? 0.1773 0.3807 0.2486 -0.0085 0.0360  0.0456  229 ARG A N     
698  C CA    . ARG A 101 ? 0.1856 0.3841 0.2680 -0.0227 0.0263  0.0485  229 ARG A CA    
699  C C     . ARG A 101 ? 0.2295 0.4489 0.3294 -0.0370 0.0295  0.0604  229 ARG A C     
700  O O     . ARG A 101 ? 0.2931 0.4982 0.3924 -0.0517 0.0242  0.0647  229 ARG A O     
701  C CB    . ARG A 101 ? 0.2231 0.4282 0.3167 -0.0171 0.0190  0.0430  229 ARG A CB    
702  C CG    . ARG A 101 ? 0.2586 0.4351 0.3372 -0.0120 0.0108  0.0336  229 ARG A CG    
703  C CD    . ARG A 101 ? 0.3205 0.5031 0.4111 -0.0115 0.0019  0.0316  229 ARG A CD    
704  N NE    . ARG A 101 ? 0.4209 0.5920 0.5028 0.0022  -0.0002 0.0236  229 ARG A NE    
705  C CZ    . ARG A 101 ? 0.4968 0.6401 0.5634 0.0028  -0.0059 0.0178  229 ARG A CZ    
706  N NH1   . ARG A 101 ? 0.4820 0.6066 0.5395 -0.0080 -0.0101 0.0182  229 ARG A NH1   
707  N NH2   . ARG A 101 ? 0.4318 0.5660 0.4922 0.0144  -0.0071 0.0119  229 ARG A NH2   
708  N N     A ARG A 102 ? 0.1927 0.4461 0.3093 -0.0331 0.0381  0.0658  230 ARG A N     
709  N N     B ARG A 102 ? 0.1903 0.4436 0.3067 -0.0330 0.0382  0.0658  230 ARG A N     
710  C CA    A ARG A 102 ? 0.2153 0.4936 0.3534 -0.0476 0.0414  0.0778  230 ARG A CA    
711  C CA    B ARG A 102 ? 0.2148 0.4937 0.3530 -0.0472 0.0416  0.0778  230 ARG A CA    
712  C C     A ARG A 102 ? 0.2127 0.4920 0.3428 -0.0536 0.0522  0.0878  230 ARG A C     
713  C C     B ARG A 102 ? 0.2251 0.5103 0.3569 -0.0509 0.0541  0.0877  230 ARG A C     
714  O O     A ARG A 102 ? 0.2461 0.5411 0.3924 -0.0686 0.0549  0.0992  230 ARG A O     
715  O O     B ARG A 102 ? 0.2444 0.5541 0.3944 -0.0610 0.0598  0.0986  230 ARG A O     
716  C CB    A ARG A 102 ? 0.2503 0.5693 0.4135 -0.0409 0.0459  0.0801  230 ARG A CB    
717  C CB    B ARG A 102 ? 0.2490 0.5664 0.4133 -0.0415 0.0437  0.0791  230 ARG A CB    
718  C CG    A ARG A 102 ? 0.2693 0.6046 0.4265 -0.0213 0.0581  0.0771  230 ARG A CG    
719  C CG    B ARG A 102 ? 0.2691 0.6047 0.4298 -0.0214 0.0551  0.0757  230 ARG A CG    
720  C CD    A ARG A 102 ? 0.2902 0.6566 0.4689 -0.0142 0.0607  0.0778  230 ARG A CD    
721  C CD    B ARG A 102 ? 0.2852 0.6497 0.4679 -0.0133 0.0545  0.0745  230 ARG A CD    
722  N NE    A ARG A 102 ? 0.2978 0.6700 0.4668 0.0073  0.0685  0.0707  230 ARG A NE    
723  N NE    B ARG A 102 ? 0.2739 0.6421 0.4471 0.0088  0.0608  0.0666  230 ARG A NE    
724  C CZ    A ARG A 102 ? 0.2861 0.6568 0.4548 0.0224  0.0640  0.0614  230 ARG A CZ    
725  C CZ    B ARG A 102 ? 0.3126 0.6871 0.4762 0.0182  0.0726  0.0671  230 ARG A CZ    
726  N NH1   A ARG A 102 ? 0.2427 0.6089 0.4206 0.0194  0.0520  0.0584  230 ARG A NH1   
727  N NH1   B ARG A 102 ? 0.2743 0.6543 0.4371 0.0079  0.0802  0.0764  230 ARG A NH1   
728  N NH2   A ARG A 102 ? 0.3438 0.7150 0.5015 0.0408  0.0709  0.0548  230 ARG A NH2   
729  N NH2   B ARG A 102 ? 0.3306 0.7033 0.4839 0.0378  0.0762  0.0583  230 ARG A NH2   
730  N N     . SER A 103 ? 0.1776 0.4405 0.2834 -0.0429 0.0579  0.0841  231 SER A N     
731  C CA    . SER A 103 ? 0.2611 0.5260 0.3568 -0.0462 0.0687  0.0940  231 SER A CA    
732  C C     . SER A 103 ? 0.2931 0.5362 0.3859 -0.0648 0.0634  0.1020  231 SER A C     
733  O O     . SER A 103 ? 0.2786 0.4920 0.3627 -0.0692 0.0520  0.0958  231 SER A O     
734  C CB    . SER A 103 ? 0.2463 0.4952 0.3144 -0.0303 0.0732  0.0867  231 SER A CB    
735  O OG    . SER A 103 ? 0.2653 0.4775 0.3146 -0.0324 0.0638  0.0807  231 SER A OG    
736  N N     . GLU A 104 ? 0.1640 0.3502 0.3463 -0.0065 0.1132  0.0294  232 GLU A N     
737  C CA    . GLU A 104 ? 0.2382 0.4088 0.4223 -0.0104 0.1214  0.0370  232 GLU A CA    
738  C C     . GLU A 104 ? 0.2359 0.3932 0.3948 -0.0034 0.1215  0.0489  232 GLU A C     
739  O O     . GLU A 104 ? 0.2361 0.3831 0.3960 -0.0045 0.1208  0.0529  232 GLU A O     
740  C CB    . GLU A 104 ? 0.2044 0.3694 0.3933 -0.0157 0.1369  0.0404  232 GLU A CB    
741  C CG    . GLU A 104 ? 0.2285 0.3765 0.4218 -0.0208 0.1459  0.0464  232 GLU A CG    
742  C CD    . GLU A 104 ? 0.3828 0.5240 0.5785 -0.0255 0.1615  0.0499  232 GLU A CD    
743  O OE1   . GLU A 104 ? 0.4932 0.6409 0.6816 -0.0235 0.1661  0.0504  232 GLU A OE1   
744  O OE2   . GLU A 104 ? 0.3639 0.4929 0.5685 -0.0313 0.1691  0.0517  232 GLU A OE2   
745  N N     . ARG A 105 ? 0.2273 0.3845 0.3626 0.0040  0.1214  0.0542  233 ARG A N     
746  C CA    . ARG A 105 ? 0.2719 0.4177 0.3806 0.0119  0.1192  0.0647  233 ARG A CA    
747  C C     . ARG A 105 ? 0.3150 0.4640 0.4238 0.0147  0.1059  0.0622  233 ARG A C     
748  O O     . ARG A 105 ? 0.2835 0.4220 0.3882 0.0154  0.1062  0.0683  233 ARG A O     
749  C CB    . ARG A 105 ? 0.2749 0.4221 0.3601 0.0192  0.1180  0.0675  233 ARG A CB    
750  C CG    . ARG A 105 ? 0.3332 0.4724 0.3905 0.0285  0.1109  0.0748  233 ARG A CG    
751  C CD    . ARG A 105 ? 0.3167 0.4381 0.3605 0.0307  0.1195  0.0862  233 ARG A CD    
752  N NE    . ARG A 105 ? 0.3194 0.4348 0.3375 0.0403  0.1112  0.0912  233 ARG A NE    
753  C CZ    . ARG A 105 ? 0.3556 0.4561 0.3579 0.0450  0.1149  0.1000  233 ARG A CZ    
754  N NH1   . ARG A 105 ? 0.4531 0.5413 0.4601 0.0410  0.1277  0.1060  233 ARG A NH1   
755  N NH2   . ARG A 105 ? 0.3151 0.4128 0.2978 0.0536  0.1053  0.1018  233 ARG A NH2   
756  N N     . TYR A 106 ? 0.2177 0.3802 0.3303 0.0163  0.0938  0.0528  234 TYR A N     
757  C CA    . TYR A 106 ? 0.1639 0.3297 0.2748 0.0188  0.0799  0.0492  234 TYR A CA    
758  C C     . TYR A 106 ? 0.1574 0.3186 0.2891 0.0122  0.0793  0.0472  234 TYR A C     
759  O O     . TYR A 106 ? 0.1223 0.2727 0.2439 0.0136  0.0737  0.0502  234 TYR A O     
760  C CB    . TYR A 106 ? 0.2010 0.3791 0.3147 0.0200  0.0671  0.0375  234 TYR A CB    
761  C CG    . TYR A 106 ? 0.2161 0.3957 0.3283 0.0213  0.0515  0.0314  234 TYR A CG    
762  C CD1   . TYR A 106 ? 0.2226 0.3989 0.3101 0.0279  0.0435  0.0341  234 TYR A CD1   
763  C CD2   . TYR A 106 ? 0.1729 0.3554 0.3073 0.0154  0.0443  0.0217  234 TYR A CD2   
764  C CE1   . TYR A 106 ? 0.2068 0.3813 0.2909 0.0282  0.0293  0.0274  234 TYR A CE1   
765  C CE2   . TYR A 106 ? 0.1851 0.3646 0.3148 0.0161  0.0293  0.0153  234 TYR A CE2   
766  C CZ    . TYR A 106 ? 0.2002 0.3747 0.3042 0.0222  0.0222  0.0182  234 TYR A CZ    
767  O OH    . TYR A 106 ? 0.2621 0.4282 0.3587 0.0217  0.0082  0.0111  234 TYR A OH    
768  N N     . GLN A 107 ? 0.1910 0.3564 0.3490 0.0042  0.0831  0.0398  235 GLN A N     
769  C CA    . GLN A 107 ? 0.2069 0.3673 0.3855 -0.0029 0.0804  0.0351  235 GLN A CA    
770  C C     . GLN A 107 ? 0.2150 0.3580 0.3875 -0.0045 0.0903  0.0458  235 GLN A C     
771  O O     . GLN A 107 ? 0.1565 0.2903 0.3306 -0.0065 0.0836  0.0445  235 GLN A O     
772  C CB    . GLN A 107 ? 0.1923 0.3589 0.3947 -0.0109 0.0817  0.0241  235 GLN A CB    
773  C CG    . GLN A 107 ? 0.2144 0.3955 0.4224 -0.0095 0.0680  0.0115  235 GLN A CG    
774  C CD    . GLN A 107 ? 0.4548 0.6420 0.6821 -0.0155 0.0687  0.0028  235 GLN A CD    
775  O OE1   . GLN A 107 ? 0.4810 0.6793 0.7096 -0.0132 0.0635  -0.0030 235 GLN A OE1   
776  N NE2   . GLN A 107 ? 0.5463 0.7253 0.7879 -0.0226 0.0750  0.0023  235 GLN A NE2   
777  N N     . THR A 108 ? 0.2287 0.3641 0.3907 -0.0033 0.1049  0.0555  236 THR A N     
778  C CA    . THR A 108 ? 0.1713 0.2880 0.3258 -0.0042 0.1148  0.0659  236 THR A CA    
779  C C     . THR A 108 ? 0.2138 0.3228 0.3424 0.0048  0.1099  0.0751  236 THR A C     
780  O O     . THR A 108 ? 0.1762 0.2717 0.3023 0.0040  0.1087  0.0785  236 THR A O     
781  C CB    . THR A 108 ? 0.2728 0.3810 0.4209 -0.0055 0.1298  0.0718  236 THR A CB    
782  O OG1   . THR A 108 ? 0.2826 0.3996 0.4535 -0.0135 0.1331  0.0621  236 THR A OG1   
783  C CG2   . THR A 108 ? 0.2530 0.3400 0.3948 -0.0068 0.1395  0.0812  236 THR A CG2   
784  N N     . MET A 109 ? 0.1679 0.2840 0.2750 0.0134  0.1047  0.0773  237 MET A N     
785  C CA    . MET A 109 ? 0.2307 0.3399 0.3115 0.0221  0.0969  0.0830  237 MET A CA    
786  C C     . MET A 109 ? 0.2275 0.3369 0.3130 0.0205  0.0808  0.0744  237 MET A C     
787  O O     . MET A 109 ? 0.2482 0.3466 0.3220 0.0235  0.0768  0.0784  237 MET A O     
788  C CB    . MET A 109 ? 0.1905 0.3090 0.2499 0.0306  0.0935  0.0845  237 MET A CB    
789  C CG    . MET A 109 ? 0.2023 0.3121 0.2485 0.0330  0.1037  0.0908  237 MET A CG    
790  S SD    . MET A 109 ? 0.2513 0.3390 0.2755 0.0391  0.1098  0.1032  237 MET A SD    
791  C CE    . MET A 109 ? 0.2522 0.3425 0.2525 0.0498  0.0935  0.1024  237 MET A CE    
792  N N     . LYS A 110 ? 0.2116 0.3321 0.3147 0.0154  0.0720  0.0623  238 LYS A N     
793  C CA    . LYS A 110 ? 0.1753 0.2947 0.2829 0.0133  0.0572  0.0536  238 LYS A CA    
794  C C     . LYS A 110 ? 0.1634 0.2702 0.2850 0.0069  0.0605  0.0545  238 LYS A C     
795  O O     . LYS A 110 ? 0.2348 0.3322 0.3476 0.0085  0.0540  0.0556  238 LYS A O     
796  C CB    . LYS A 110 ? 0.1884 0.3214 0.3109 0.0100  0.0472  0.0406  238 LYS A CB    
797  C CG    . LYS A 110 ? 0.2884 0.4217 0.4037 0.0116  0.0302  0.0324  238 LYS A CG    
798  N N     . LEU A 111 ? 0.1443 0.2505 0.2872 -0.0003 0.0715  0.0542  239 LEU A N     
799  C CA    . LEU A 111 ? 0.1403 0.2342 0.2978 -0.0071 0.0765  0.0549  239 LEU A CA    
800  C C     . LEU A 111 ? 0.2828 0.3599 0.4211 -0.0024 0.0829  0.0674  239 LEU A C     
801  O O     . LEU A 111 ? 0.2300 0.2967 0.3682 -0.0036 0.0780  0.0672  239 LEU A O     
802  C CB    . LEU A 111 ? 0.1483 0.2453 0.3303 -0.0153 0.0898  0.0531  239 LEU A CB    
803  C CG    . LEU A 111 ? 0.2457 0.3299 0.4446 -0.0233 0.0988  0.0544  239 LEU A CG    
804  C CD1   . LEU A 111 ? 0.2727 0.3593 0.4890 -0.0289 0.0859  0.0425  239 LEU A CD1   
805  C CD2   . LEU A 111 ? 0.2736 0.3572 0.4842 -0.0289 0.1118  0.0536  239 LEU A CD2   
806  N N     . PHE A 112 ? 0.1709 0.2450 0.2917 0.0037  0.0935  0.0783  240 PHE A N     
807  C CA    . PHE A 112 ? 0.2103 0.2674 0.3130 0.0088  0.1009  0.0906  240 PHE A CA    
808  C C     . PHE A 112 ? 0.1821 0.2371 0.2637 0.0171  0.0877  0.0915  240 PHE A C     
809  O O     . PHE A 112 ? 0.1878 0.2297 0.2650 0.0179  0.0864  0.0949  240 PHE A O     
810  C CB    . PHE A 112 ? 0.2090 0.2629 0.2977 0.0135  0.1158  0.1018  240 PHE A CB    
811  C CG    . PHE A 112 ? 0.2248 0.2725 0.3299 0.0055  0.1307  0.1025  240 PHE A CG    
812  C CD1   . PHE A 112 ? 0.2211 0.2670 0.3530 -0.0051 0.1323  0.0951  240 PHE A CD1   
813  C CD2   . PHE A 112 ? 0.2495 0.2919 0.3408 0.0087  0.1401  0.1078  240 PHE A CD2   
814  C CE1   . PHE A 112 ? 0.2769 0.3166 0.4209 -0.0121 0.1434  0.0931  240 PHE A CE1   
815  C CE2   . PHE A 112 ? 0.3414 0.3771 0.4453 0.0013  0.1521  0.1067  240 PHE A CE2   
816  C CZ    . PHE A 112 ? 0.3315 0.3663 0.4617 -0.0091 0.1539  0.0993  240 PHE A CZ    
817  N N     . THR A 113 ? 0.2503 0.3179 0.3188 0.0230  0.0782  0.0879  241 THR A N     
818  C CA    . THR A 113 ? 0.2544 0.3208 0.3030 0.0306  0.0666  0.0881  241 THR A CA    
819  C C     . THR A 113 ? 0.2158 0.2800 0.2746 0.0259  0.0545  0.0790  241 THR A C     
820  O O     . THR A 113 ? 0.1986 0.2565 0.2448 0.0304  0.0479  0.0803  241 THR A O     
821  C CB    . THR A 113 ? 0.2456 0.3265 0.2796 0.0370  0.0592  0.0849  241 THR A CB    
822  O OG1   . THR A 113 ? 0.1605 0.2541 0.2103 0.0312  0.0526  0.0736  241 THR A OG1   
823  C CG2   . THR A 113 ? 0.1700 0.2520 0.1895 0.0432  0.0706  0.0947  241 THR A CG2   
824  N N     . GLN A 114 ? 0.1955 0.2651 0.2769 0.0171  0.0511  0.0693  242 GLN A N     
825  C CA    . GLN A 114 ? 0.2219 0.2883 0.3126 0.0124  0.0399  0.0606  242 GLN A CA    
826  C C     . GLN A 114 ? 0.2185 0.2688 0.3134 0.0099  0.0450  0.0656  242 GLN A C     
827  O O     . GLN A 114 ? 0.1954 0.2410 0.2933 0.0075  0.0359  0.0599  242 GLN A O     
828  C CB    . GLN A 114 ? 0.1849 0.2605 0.2988 0.0043  0.0355  0.0491  242 GLN A CB    
829  N N     . ILE A 115 ? 0.1713 0.2121 0.2657 0.0103  0.0595  0.0760  243 ILE A N     
830  C CA    . ILE A 115 ? 0.2002 0.2239 0.2959 0.0090  0.0652  0.0818  243 ILE A CA    
831  C C     . ILE A 115 ? 0.2324 0.2496 0.3048 0.0183  0.0590  0.0868  243 ILE A C     
832  O O     . ILE A 115 ? 0.2287 0.2501 0.2809 0.0273  0.0588  0.0923  243 ILE A O     
833  C CB    . ILE A 115 ? 0.1921 0.2057 0.2909 0.0074  0.0835  0.0921  243 ILE A CB    
834  C CG1   . ILE A 115 ? 0.2064 0.2285 0.3297 -0.0020 0.0901  0.0860  243 ILE A CG1   
835  C CG2   . ILE A 115 ? 0.2934 0.2878 0.3940 0.0057  0.0898  0.0979  243 ILE A CG2   
836  C CD1   . ILE A 115 ? 0.2597 0.2743 0.3842 -0.0034 0.1091  0.0956  243 ILE A CD1   
837  N N     . PHE A 116 ? 0.1708 0.1784 0.2467 0.0162  0.0538  0.0843  244 PHE A N     
838  C CA    . PHE A 116 ? 0.1756 0.1756 0.2324 0.0245  0.0493  0.0890  244 PHE A CA    
839  C C     . PHE A 116 ? 0.2954 0.2823 0.3389 0.0311  0.0623  0.1031  244 PHE A C     
840  O O     . PHE A 116 ? 0.2243 0.1978 0.2776 0.0266  0.0732  0.1082  244 PHE A O     
841  C CB    . PHE A 116 ? 0.1765 0.1684 0.2429 0.0196  0.0423  0.0828  244 PHE A CB    
842  C CG    . PHE A 116 ? 0.2167 0.1991 0.2668 0.0273  0.0390  0.0875  244 PHE A CG    
843  C CD1   . PHE A 116 ? 0.1918 0.1824 0.2238 0.0355  0.0295  0.0856  244 PHE A CD1   
844  C CD2   . PHE A 116 ? 0.2259 0.1915 0.2799 0.0262  0.0455  0.0929  244 PHE A CD2   
845  C CE1   . PHE A 116 ? 0.1749 0.1580 0.1934 0.0429  0.0262  0.0888  244 PHE A CE1   
846  C CE2   . PHE A 116 ? 0.2619 0.2190 0.3016 0.0339  0.0422  0.0967  244 PHE A CE2   
847  C CZ    . PHE A 116 ? 0.2621 0.2284 0.2844 0.0423  0.0323  0.0944  244 PHE A CZ    
848  N N     . GLY A 117 ? 0.2060 0.1965 0.2269 0.0419  0.0615  0.1092  245 GLY A N     
849  C CA    . GLY A 117 ? 0.2525 0.2311 0.2571 0.0499  0.0726  0.1222  245 GLY A CA    
850  C C     . GLY A 117 ? 0.2438 0.2284 0.2430 0.0516  0.0812  0.1256  245 GLY A C     
851  O O     . GLY A 117 ? 0.2599 0.2373 0.2456 0.0576  0.0868  0.1300  245 GLY A O     
852  N N     . VAL A 118 ? 0.2255 0.2238 0.2360 0.0460  0.0809  0.1212  246 VAL A N     
853  C CA    . VAL A 118 ? 0.2995 0.3046 0.3057 0.0474  0.0895  0.1250  246 VAL A CA    
854  C C     . VAL A 118 ? 0.2789 0.3023 0.2748 0.0525  0.0786  0.1193  246 VAL A C     
855  O O     . VAL A 118 ? 0.2223 0.2574 0.2302 0.0472  0.0681  0.1078  246 VAL A O     
856  C CB    . VAL A 118 ? 0.2585 0.2657 0.2895 0.0358  0.0988  0.1217  246 VAL A CB    
857  C CG1   . VAL A 118 ? 0.2440 0.2572 0.2699 0.0375  0.1081  0.1250  246 VAL A CG1   
858  C CG2   . VAL A 118 ? 0.2551 0.2442 0.2983 0.0296  0.1094  0.1260  246 VAL A CG2   
859  N N     . GLY A 119 ? 0.2743 0.2999 0.2518 0.0611  0.0767  0.1191  247 GLY A N     
860  C CA    . GLY A 119 ? 0.2325 0.2741 0.2017 0.0651  0.0672  0.1119  247 GLY A CA    
861  C C     . GLY A 119 ? 0.2736 0.3217 0.2435 0.0645  0.0745  0.1132  247 GLY A C     
862  O O     . GLY A 119 ? 0.2414 0.2824 0.2190 0.0602  0.0871  0.1189  247 GLY A O     
863  N N     . VAL A 120 ? 0.2640 0.3253 0.2272 0.0679  0.0663  0.1063  248 VAL A N     
864  C CA    . VAL A 120 ? 0.2429 0.3113 0.2063 0.0675  0.0710  0.1061  248 VAL A CA    
865  C C     . VAL A 120 ? 0.2944 0.3512 0.2495 0.0706  0.0816  0.1136  248 VAL A C     
866  O O     . VAL A 120 ? 0.3194 0.3743 0.2811 0.0662  0.0925  0.1172  248 VAL A O     
867  C CB    . VAL A 120 ? 0.2478 0.3294 0.2046 0.0713  0.0593  0.0966  248 VAL A CB    
868  C CG1   . VAL A 120 ? 0.2155 0.3024 0.1711 0.0714  0.0642  0.0970  248 VAL A CG1   
869  C CG2   . VAL A 120 ? 0.3136 0.4069 0.2785 0.0674  0.0494  0.0881  248 VAL A CG2   
870  N N     . LYS A 121 ? 0.3357 0.3847 0.2767 0.0779  0.0790  0.1152  249 LYS A N     
871  C CA    . LYS A 121 ? 0.3810 0.4183 0.3125 0.0813  0.0893  0.1229  249 LYS A CA    
872  C C     . LYS A 121 ? 0.3362 0.3593 0.2760 0.0756  0.1026  0.1307  249 LYS A C     
873  O O     . LYS A 121 ? 0.3306 0.3482 0.2705 0.0734  0.1135  0.1351  249 LYS A O     
874  C CB    . LYS A 121 ? 0.4172 0.4488 0.3334 0.0900  0.0846  0.1232  249 LYS A CB    
875  C CG    . LYS A 121 ? 0.5173 0.5626 0.4284 0.0941  0.0741  0.1147  249 LYS A CG    
876  C CD    . LYS A 121 ? 0.5338 0.5762 0.4323 0.1020  0.0697  0.1134  249 LYS A CD    
877  C CE    . LYS A 121 ? 0.5127 0.5688 0.4104 0.1039  0.0602  0.1038  249 LYS A CE    
878  N N     . THR A 122 ? 0.3585 0.3745 0.3062 0.0724  0.1022  0.1317  250 THR A N     
879  C CA    . THR A 122 ? 0.3455 0.3470 0.3037 0.0658  0.1153  0.1377  250 THR A CA    
880  C C     . THR A 122 ? 0.3604 0.3690 0.3381 0.0556  0.1229  0.1354  250 THR A C     
881  O O     . THR A 122 ? 0.3126 0.3134 0.2950 0.0512  0.1353  0.1387  250 THR A O     
882  C CB    . THR A 122 ? 0.3569 0.3499 0.3214 0.0638  0.1123  0.1381  250 THR A CB    
883  O OG1   . THR A 122 ? 0.3415 0.3295 0.2885 0.0732  0.1050  0.1387  250 THR A OG1   
884  C CG2   . THR A 122 ? 0.3308 0.3082 0.3078 0.0562  0.1257  0.1428  250 THR A CG2   
885  N N     . ALA A 123 ? 0.2818 0.3060 0.2716 0.0516  0.1155  0.1287  251 ALA A N     
886  C CA    . ALA A 123 ? 0.2581 0.2924 0.2692 0.0420  0.1212  0.1241  251 ALA A CA    
887  C C     . ALA A 123 ? 0.3634 0.4014 0.3688 0.0430  0.1276  0.1245  251 ALA A C     
888  O O     . ALA A 123 ? 0.2963 0.3337 0.3166 0.0352  0.1381  0.1234  251 ALA A O     
889  C CB    . ALA A 123 ? 0.2288 0.2812 0.2503 0.0398  0.1102  0.1161  251 ALA A CB    
890  N N     . ASP A 124 ? 0.3272 0.3694 0.3124 0.0519  0.1209  0.1248  252 ASP A N     
891  C CA    . ASP A 124 ? 0.3415 0.3874 0.3208 0.0529  0.1261  0.1250  252 ASP A CA    
892  C C     . ASP A 124 ? 0.3178 0.3473 0.2928 0.0518  0.1402  0.1324  252 ASP A C     
893  O O     . ASP A 124 ? 0.4094 0.4402 0.3922 0.0463  0.1499  0.1318  252 ASP A O     
894  C CB    . ASP A 124 ? 0.3192 0.3714 0.2790 0.0625  0.1153  0.1231  252 ASP A CB    
895  C CG    . ASP A 124 ? 0.3618 0.4165 0.3145 0.0637  0.1205  0.1236  252 ASP A CG    
896  O OD1   . ASP A 124 ? 0.3033 0.3690 0.2676 0.0581  0.1226  0.1187  252 ASP A OD1   
897  O OD2   . ASP A 124 ? 0.4303 0.4764 0.3664 0.0703  0.1224  0.1283  252 ASP A OD2   
898  N N     A ARG A 125 ? 0.3745 0.3885 0.3372 0.0571  0.1414  0.1387  253 ARG A N     
899  N N     B ARG A 125 ? 0.3745 0.3885 0.3369 0.0572  0.1414  0.1388  253 ARG A N     
900  C CA    A ARG A 125 ? 0.4136 0.4104 0.3706 0.0566  0.1547  0.1459  253 ARG A CA    
901  C CA    B ARG A 125 ? 0.4132 0.4101 0.3704 0.0564  0.1549  0.1459  253 ARG A CA    
902  C C     A ARG A 125 ? 0.4287 0.4205 0.4077 0.0448  0.1665  0.1451  253 ARG A C     
903  C C     B ARG A 125 ? 0.4278 0.4204 0.4075 0.0446  0.1664  0.1448  253 ARG A C     
904  O O     A ARG A 125 ? 0.4460 0.4329 0.4278 0.0405  0.1784  0.1468  253 ARG A O     
905  O O     B ARG A 125 ? 0.4380 0.4267 0.4214 0.0399  0.1781  0.1460  253 ARG A O     
906  C CB    A ARG A 125 ? 0.4349 0.4167 0.3762 0.0645  0.1524  0.1517  253 ARG A CB    
907  C CB    B ARG A 125 ? 0.4388 0.4201 0.3804 0.0641  0.1534  0.1519  253 ARG A CB    
908  C CG    A ARG A 125 ? 0.4802 0.4427 0.4126 0.0653  0.1656  0.1595  253 ARG A CG    
909  C CG    B ARG A 125 ? 0.4773 0.4391 0.4131 0.0633  0.1677  0.1594  253 ARG A CG    
910  C CD    A ARG A 125 ? 0.5132 0.4631 0.4278 0.0749  0.1618  0.1644  253 ARG A CD    
911  C CD    B ARG A 125 ? 0.5219 0.4687 0.4402 0.0722  0.1661  0.1652  253 ARG A CD    
912  N NE    A ARG A 125 ? 0.4957 0.4440 0.4182 0.0739  0.1551  0.1624  253 ARG A NE    
913  N NE    B ARG A 125 ? 0.5204 0.4613 0.4477 0.0698  0.1630  0.1646  253 ARG A NE    
914  C CZ    A ARG A 125 ? 0.5331 0.4701 0.4685 0.0668  0.1622  0.1640  253 ARG A CZ    
915  C CZ    B ARG A 125 ? 0.5188 0.4649 0.4421 0.0751  0.1502  0.1618  253 ARG A CZ    
916  N NH1   A ARG A 125 ? 0.5065 0.4330 0.4494 0.0598  0.1764  0.1669  253 ARG A NH1   
917  N NH1   B ARG A 125 ? 0.4716 0.4296 0.3828 0.0831  0.1390  0.1586  253 ARG A NH1   
918  N NH2   A ARG A 125 ? 0.5550 0.4911 0.4967 0.0662  0.1550  0.1618  253 ARG A NH2   
919  N NH2   B ARG A 125 ? 0.5622 0.5018 0.4946 0.0719  0.1488  0.1614  253 ARG A NH2   
920  N N     . TRP A 126 ? 0.4399 0.4334 0.4361 0.0391  0.1632  0.1415  254 TRP A N     
921  C CA    . TRP A 126 ? 0.4459 0.4368 0.4668 0.0272  0.1726  0.1381  254 TRP A CA    
922  C C     . TRP A 126 ? 0.3444 0.3510 0.3812 0.0202  0.1759  0.1311  254 TRP A C     
923  O O     . TRP A 126 ? 0.3491 0.3522 0.3997 0.0121  0.1871  0.1293  254 TRP A O     
924  C CB    . TRP A 126 ? 0.3275 0.3199 0.3647 0.0226  0.1659  0.1339  254 TRP A CB    
925  C CG    . TRP A 126 ? 0.4007 0.3759 0.4268 0.0272  0.1650  0.1399  254 TRP A CG    
926  C CD1   . TRP A 126 ? 0.4276 0.3858 0.4345 0.0337  0.1711  0.1479  254 TRP A CD1   
927  C CD2   . TRP A 126 ? 0.3716 0.3450 0.4053 0.0259  0.1572  0.1378  254 TRP A CD2   
928  N NE1   . TRP A 126 ? 0.4235 0.3701 0.4259 0.0367  0.1675  0.1506  254 TRP A NE1   
929  C CE2   . TRP A 126 ? 0.3877 0.3430 0.4061 0.0319  0.1590  0.1446  254 TRP A CE2   
930  C CE3   . TRP A 126 ? 0.3521 0.3374 0.4042 0.0203  0.1486  0.1305  254 TRP A CE3   
931  C CZ2   . TRP A 126 ? 0.4017 0.3507 0.4227 0.0322  0.1525  0.1441  254 TRP A CZ2   
932  C CZ3   . TRP A 126 ? 0.3910 0.3691 0.4452 0.0204  0.1424  0.1305  254 TRP A CZ3   
933  C CH2   . TRP A 126 ? 0.3508 0.3109 0.3894 0.0263  0.1444  0.1372  254 TRP A CH2   
934  N N     . TYR A 127 ? 0.3179 0.3422 0.3530 0.0233  0.1659  0.1262  255 TYR A N     
935  C CA    . TYR A 127 ? 0.3067 0.3467 0.3557 0.0177  0.1680  0.1189  255 TYR A CA    
936  C C     . TYR A 127 ? 0.3846 0.4188 0.4227 0.0186  0.1789  0.1231  255 TYR A C     
937  O O     . TYR A 127 ? 0.3763 0.4143 0.4302 0.0106  0.1879  0.1189  255 TYR A O     
938  C CB    . TYR A 127 ? 0.2818 0.3401 0.3272 0.0223  0.1547  0.1133  255 TYR A CB    
939  C CG    . TYR A 127 ? 0.2747 0.3505 0.3386 0.0160  0.1553  0.1038  255 TYR A CG    
940  C CD1   . TYR A 127 ? 0.2493 0.3365 0.3399 0.0082  0.1513  0.0943  255 TYR A CD1   
941  C CD2   . TYR A 127 ? 0.2779 0.3586 0.3331 0.0178  0.1592  0.1037  255 TYR A CD2   
942  C CE1   . TYR A 127 ? 0.2937 0.3973 0.4018 0.0032  0.1507  0.0845  255 TYR A CE1   
943  C CE2   . TYR A 127 ? 0.2670 0.3638 0.3393 0.0123  0.1595  0.0945  255 TYR A CE2   
944  C CZ    . TYR A 127 ? 0.2937 0.4021 0.3923 0.0053  0.1551  0.0848  255 TYR A CZ    
945  O OH    . TYR A 127 ? 0.3212 0.4462 0.4372 0.0007  0.1541  0.0747  255 TYR A OH    
946  N N     . ARG A 128 ? 0.3868 0.4123 0.3982 0.0284  0.1777  0.1306  256 ARG A N     
947  C CA    . ARG A 128 ? 0.4506 0.4696 0.4499 0.0298  0.1876  0.1350  256 ARG A CA    
948  C C     . ARG A 128 ? 0.4999 0.5015 0.5043 0.0241  0.2026  0.1396  256 ARG A C     
949  O O     . ARG A 128 ? 0.5554 0.5549 0.5609 0.0204  0.2135  0.1402  256 ARG A O     
950  C CB    . ARG A 128 ? 0.4585 0.4724 0.4293 0.0420  0.1814  0.1409  256 ARG A CB    
951  C CG    . ARG A 128 ? 0.4813 0.5123 0.4465 0.0473  0.1673  0.1353  256 ARG A CG    
952  C CD    . ARG A 128 ? 0.5553 0.5823 0.4950 0.0585  0.1614  0.1393  256 ARG A CD    
953  N NE    . ARG A 128 ? 0.5937 0.6124 0.5227 0.0657  0.1539  0.1427  256 ARG A NE    
954  C CZ    . ARG A 128 ? 0.6502 0.6513 0.5685 0.0693  0.1602  0.1502  256 ARG A CZ    
955  N N     . GLU A 129 ? 0.4779 0.4668 0.4855 0.0233  0.2033  0.1425  257 GLU A N     
956  C CA    . GLU A 129 ? 0.4973 0.4693 0.5115 0.0172  0.2171  0.1457  257 GLU A CA    
957  C C     . GLU A 129 ? 0.5044 0.4845 0.5491 0.0041  0.2235  0.1370  257 GLU A C     
958  O O     . GLU A 129 ? 0.5264 0.4938 0.5791 -0.0022 0.2354  0.1381  257 GLU A O     
959  C CB    . GLU A 129 ? 0.5011 0.4572 0.5093 0.0205  0.2150  0.1507  257 GLU A CB    
960  C CG    . GLU A 129 ? 0.5440 0.4895 0.5226 0.0335  0.2105  0.1591  257 GLU A CG    
961  C CD    . GLU A 129 ? 0.6666 0.5983 0.6406 0.0370  0.2074  0.1629  257 GLU A CD    
962  O OE1   . GLU A 129 ? 0.6866 0.6152 0.6800 0.0288  0.2099  0.1596  257 GLU A OE1   
963  O OE2   . GLU A 129 ? 0.7061 0.6308 0.6580 0.0478  0.2020  0.1683  257 GLU A OE2   
964  N N     . GLY A 130 ? 0.3896 0.3904 0.4516 0.0001  0.2155  0.1278  258 GLY A N     
965  C CA    . GLY A 130 ? 0.4410 0.4523 0.5330 -0.0115 0.2195  0.1178  258 GLY A CA    
966  C C     . GLY A 130 ? 0.4172 0.4325 0.5310 -0.0172 0.2124  0.1107  258 GLY A C     
967  O O     . GLY A 130 ? 0.4129 0.4385 0.5529 -0.0264 0.2134  0.1008  258 GLY A O     
968  N N     . LEU A 131 ? 0.3542 0.3623 0.4583 -0.0119 0.2046  0.1150  259 LEU A N     
969  C CA    . LEU A 131 ? 0.3369 0.3473 0.4608 -0.0174 0.1977  0.1085  259 LEU A CA    
970  C C     . LEU A 131 ? 0.3876 0.4204 0.5256 -0.0186 0.1849  0.0988  259 LEU A C     
971  O O     . LEU A 131 ? 0.3584 0.4013 0.4828 -0.0116 0.1780  0.1001  259 LEU A O     
972  C CB    . LEU A 131 ? 0.3617 0.3568 0.4696 -0.0110 0.1936  0.1164  259 LEU A CB    
973  C CG    . LEU A 131 ? 0.4323 0.4043 0.5247 -0.0085 0.2051  0.1259  259 LEU A CG    
974  C CD1   . LEU A 131 ? 0.4721 0.4324 0.5401 0.0023  0.1991  0.1347  259 LEU A CD1   
975  C CD2   . LEU A 131 ? 0.4162 0.3787 0.5291 -0.0184 0.2128  0.1216  259 LEU A CD2   
976  N N     . ARG A 132 ? 0.3736 0.4140 0.5387 -0.0272 0.1809  0.0882  260 ARG A N     
977  C CA    . ARG A 132 ? 0.2633 0.3249 0.4440 -0.0289 0.1686  0.0772  260 ARG A CA    
978  C C     . ARG A 132 ? 0.3045 0.3683 0.5022 -0.0330 0.1578  0.0695  260 ARG A C     
979  O O     . ARG A 132 ? 0.2891 0.3670 0.4914 -0.0311 0.1450  0.0632  260 ARG A O     
980  C CB    . ARG A 132 ? 0.2636 0.3387 0.4630 -0.0353 0.1724  0.0678  260 ARG A CB    
981  C CG    . ARG A 132 ? 0.2768 0.3542 0.4612 -0.0315 0.1808  0.0730  260 ARG A CG    
982  C CD    . ARG A 132 ? 0.3434 0.4323 0.5115 -0.0228 0.1713  0.0745  260 ARG A CD    
983  N NE    . ARG A 132 ? 0.3177 0.4097 0.4722 -0.0195 0.1781  0.0780  260 ARG A NE    
984  C CZ    . ARG A 132 ? 0.3400 0.4187 0.4687 -0.0131 0.1848  0.0892  260 ARG A CZ    
985  N NH1   . ARG A 132 ? 0.3638 0.4251 0.4770 -0.0088 0.1857  0.0983  260 ARG A NH1   
986  N NH2   . ARG A 132 ? 0.3113 0.3940 0.4295 -0.0107 0.1899  0.0908  260 ARG A NH2   
987  N N     . THR A 133 ? 0.2851 0.3352 0.4914 -0.0383 0.1619  0.0694  261 THR A N     
988  C CA    . THR A 133 ? 0.3156 0.3679 0.5397 -0.0433 0.1516  0.0602  261 THR A CA    
989  C C     . THR A 133 ? 0.3205 0.3547 0.5340 -0.0412 0.1520  0.0679  261 THR A C     
990  O O     . THR A 133 ? 0.3442 0.3628 0.5386 -0.0366 0.1614  0.0796  261 THR A O     
991  C CB    . THR A 133 ? 0.3293 0.3847 0.5781 -0.0527 0.1546  0.0492  261 THR A CB    
992  O OG1   . THR A 133 ? 0.3891 0.4262 0.6363 -0.0560 0.1676  0.0548  261 THR A OG1   
993  C CG2   . THR A 133 ? 0.2950 0.3655 0.5522 -0.0544 0.1576  0.0435  261 THR A CG2   
994  N N     . LEU A 134 ? 0.3471 0.3828 0.5719 -0.0440 0.1407  0.0607  262 LEU A N     
995  C CA    . LEU A 134 ? 0.3531 0.3719 0.5701 -0.0427 0.1403  0.0664  262 LEU A CA    
996  C C     . LEU A 134 ? 0.3663 0.3691 0.5875 -0.0475 0.1525  0.0683  262 LEU A C     
997  O O     . LEU A 134 ? 0.3688 0.3542 0.5745 -0.0437 0.1586  0.0781  262 LEU A O     
998  C CB    . LEU A 134 ? 0.2897 0.3140 0.5185 -0.0454 0.1251  0.0567  262 LEU A CB    
999  C CG    . LEU A 134 ? 0.2914 0.3301 0.5161 -0.0408 0.1115  0.0541  262 LEU A CG    
1000 C CD1   . LEU A 134 ? 0.2736 0.3119 0.5060 -0.0432 0.0973  0.0457  262 LEU A CD1   
1001 C CD2   . LEU A 134 ? 0.3214 0.3569 0.5215 -0.0313 0.1146  0.0676  262 LEU A CD2   
1002 N N     . ASP A 135 ? 0.3370 0.3457 0.5784 -0.0553 0.1560  0.0587  263 ASP A N     
1003 C CA    . ASP A 135 ? 0.4222 0.4166 0.6681 -0.0601 0.1688  0.0601  263 ASP A CA    
1004 C C     . ASP A 135 ? 0.3585 0.3414 0.5859 -0.0559 0.1835  0.0724  263 ASP A C     
1005 O O     . ASP A 135 ? 0.3786 0.3435 0.5986 -0.0561 0.1936  0.0787  263 ASP A O     
1006 C CB    . ASP A 135 ? 0.3939 0.3989 0.6652 -0.0686 0.1694  0.0469  263 ASP A CB    
1007 C CG    . ASP A 135 ? 0.5627 0.5741 0.8499 -0.0723 0.1558  0.0350  263 ASP A CG    
1008 O OD1   . ASP A 135 ? 0.6372 0.6399 0.9173 -0.0701 0.1495  0.0374  263 ASP A OD1   
1009 O OD2   . ASP A 135 ? 0.6122 0.6371 0.9178 -0.0768 0.1510  0.0229  263 ASP A OD2   
1010 N N     . ASP A 136 ? 0.3708 0.3636 0.5891 -0.0518 0.1846  0.0756  264 ASP A N     
1011 C CA    . ASP A 136 ? 0.3456 0.3269 0.5418 -0.0462 0.1966  0.0876  264 ASP A CA    
1012 C C     . ASP A 136 ? 0.3810 0.3452 0.5529 -0.0377 0.1962  0.0994  264 ASP A C     
1013 O O     . ASP A 136 ? 0.3732 0.3201 0.5298 -0.0348 0.2071  0.1082  264 ASP A O     
1014 C CB    . ASP A 136 ? 0.3982 0.3944 0.5868 -0.0420 0.1951  0.0885  264 ASP A CB    
1015 C CG    . ASP A 136 ? 0.4528 0.4647 0.6634 -0.0495 0.1973  0.0776  264 ASP A CG    
1016 O OD1   . ASP A 136 ? 0.3716 0.3792 0.5988 -0.0573 0.2046  0.0722  264 ASP A OD1   
1017 O OD2   . ASP A 136 ? 0.4537 0.4825 0.6648 -0.0473 0.1915  0.0742  264 ASP A OD2   
1018 N N     . LEU A 137 ? 0.3262 0.2947 0.4937 -0.0334 0.1835  0.0994  265 LEU A N     
1019 C CA    . LEU A 137 ? 0.3850 0.3384 0.5305 -0.0251 0.1815  0.1093  265 LEU A CA    
1020 C C     . LEU A 137 ? 0.4437 0.3812 0.5958 -0.0292 0.1849  0.1085  265 LEU A C     
1021 O O     . LEU A 137 ? 0.4944 0.4141 0.6292 -0.0241 0.1914  0.1174  265 LEU A O     
1022 C CB    . LEU A 137 ? 0.3086 0.2724 0.4487 -0.0197 0.1669  0.1086  265 LEU A CB    
1023 C CG    . LEU A 137 ? 0.3240 0.3051 0.4569 -0.0149 0.1619  0.1086  265 LEU A CG    
1024 C CD1   . LEU A 137 ? 0.2867 0.2779 0.4176 -0.0112 0.1474  0.1065  265 LEU A CD1   
1025 C CD2   . LEU A 137 ? 0.3398 0.3137 0.4454 -0.0054 0.1685  0.1194  265 LEU A CD2   
1026 N N     . ARG A 138 ? 0.4548 0.3988 0.6314 -0.0381 0.1798  0.0973  266 ARG A N     
1027 C CA    . ARG A 138 ? 0.4505 0.3808 0.6344 -0.0424 0.1824  0.0952  266 ARG A CA    
1028 C C     . ARG A 138 ? 0.5634 0.4797 0.7456 -0.0451 0.1985  0.0992  266 ARG A C     
1029 O O     . ARG A 138 ? 0.6208 0.5202 0.7973 -0.0446 0.2037  0.1031  266 ARG A O     
1030 C CB    . ARG A 138 ? 0.4638 0.4059 0.6742 -0.0511 0.1734  0.0810  266 ARG A CB    
1031 C CG    . ARG A 138 ? 0.4816 0.4361 0.6940 -0.0490 0.1569  0.0761  266 ARG A CG    
1032 C CD    . ARG A 138 ? 0.5238 0.4863 0.7586 -0.0565 0.1472  0.0621  266 ARG A CD    
1033 N NE    . ARG A 138 ? 0.5387 0.5087 0.7725 -0.0541 0.1314  0.0580  266 ARG A NE    
1034 C CZ    . ARG A 138 ? 0.5017 0.4889 0.7459 -0.0557 0.1199  0.0484  266 ARG A CZ    
1035 N NH1   . ARG A 138 ? 0.4376 0.4376 0.6949 -0.0595 0.1216  0.0414  266 ARG A NH1   
1036 N NH2   . ARG A 138 ? 0.4753 0.4664 0.7160 -0.0533 0.1060  0.0452  266 ARG A NH2   
1037 N N     . GLU A 139 ? 0.5408 0.4635 0.7278 -0.0481 0.2068  0.0979  267 GLU A N     
1038 C CA    . GLU A 139 ? 0.6378 0.5477 0.8241 -0.0514 0.2229  0.1009  267 GLU A CA    
1039 C C     . GLU A 139 ? 0.7166 0.6093 0.8737 -0.0423 0.2315  0.1150  267 GLU A C     
1040 O O     . GLU A 139 ? 0.7499 0.6303 0.9032 -0.0442 0.2454  0.1186  267 GLU A O     
1041 C CB    . GLU A 139 ? 0.5126 0.4363 0.7149 -0.0580 0.2283  0.0937  267 GLU A CB    
1042 N N     . GLN A 140 ? 0.7152 0.6068 0.8513 -0.0321 0.2233  0.1225  268 GLN A N     
1043 C CA    . GLN A 140 ? 0.7572 0.6334 0.8638 -0.0217 0.2290  0.1352  268 GLN A CA    
1044 C C     . GLN A 140 ? 0.7819 0.6533 0.8728 -0.0128 0.2180  0.1400  268 GLN A C     
1045 O O     . GLN A 140 ? 0.8035 0.6794 0.8755 -0.0031 0.2111  0.1453  268 GLN A O     
1046 C CB    . GLN A 140 ? 0.7649 0.6497 0.8591 -0.0170 0.2312  0.1389  268 GLN A CB    
1047 N N     . PRO A 141 ? 0.7360 0.5989 0.8346 -0.0157 0.2157  0.1376  269 PRO A N     
1048 C CA    . PRO A 141 ? 0.7190 0.5798 0.8066 -0.0085 0.2038  0.1400  269 PRO A CA    
1049 C C     . PRO A 141 ? 0.7370 0.5836 0.7950 0.0039  0.2053  0.1511  269 PRO A C     
1050 O O     . PRO A 141 ? 0.7598 0.6073 0.8062 0.0114  0.1945  0.1531  269 PRO A O     
1051 C CB    . PRO A 141 ? 0.6863 0.5411 0.7916 -0.0162 0.2028  0.1335  269 PRO A CB    
1052 C CG    . PRO A 141 ? 0.7146 0.5590 0.8282 -0.0231 0.2178  0.1329  269 PRO A CG    
1053 C CD    . PRO A 141 ? 0.7127 0.5667 0.8291 -0.0253 0.2243  0.1324  269 PRO A CD    
1054 N N     . GLN A 142 ? 0.7286 0.5624 0.7739 0.0063  0.2179  0.1578  270 GLN A N     
1055 C CA    . GLN A 142 ? 0.7924 0.6130 0.8089 0.0187  0.2187  0.1677  270 GLN A CA    
1056 C C     . GLN A 142 ? 0.7735 0.6065 0.7728 0.0289  0.2089  0.1705  270 GLN A C     
1057 O O     . GLN A 142 ? 0.8320 0.6586 0.8091 0.0401  0.2045  0.1765  270 GLN A O     
1058 C CB    . GLN A 142 ? 0.7920 0.5962 0.7990 0.0186  0.2348  0.1738  270 GLN A CB    
1059 N N     . LYS A 143 ? 0.6984 0.5495 0.7079 0.0252  0.2051  0.1657  271 LYS A N     
1060 C CA    . LYS A 143 ? 0.7193 0.5835 0.7135 0.0341  0.1961  0.1673  271 LYS A CA    
1061 C C     . LYS A 143 ? 0.6860 0.5629 0.6826 0.0370  0.1804  0.1630  271 LYS A C     
1062 O O     . LYS A 143 ? 0.7776 0.6673 0.7632 0.0439  0.1717  0.1628  271 LYS A O     
1063 C CB    . LYS A 143 ? 0.7377 0.6152 0.7404 0.0291  0.2004  0.1643  271 LYS A CB    
1064 N N     . LEU A 144 ? 0.5506 0.4244 0.5608 0.0320  0.1763  0.1590  272 LEU A N     
1065 C CA    . LEU A 144 ? 0.5351 0.4208 0.5507 0.0326  0.1620  0.1538  272 LEU A CA    
1066 C C     . LEU A 144 ? 0.5580 0.4350 0.5588 0.0410  0.1547  0.1565  272 LEU A C     
1067 O O     . LEU A 144 ? 0.5099 0.3706 0.5080 0.0410  0.1606  0.1596  272 LEU A O     
1068 C CB    . LEU A 144 ? 0.4839 0.3747 0.5279 0.0200  0.1610  0.1452  272 LEU A CB    
1069 C CG    . LEU A 144 ? 0.4903 0.3913 0.5536 0.0104  0.1676  0.1401  272 LEU A CG    
1070 C CD1   . LEU A 144 ? 0.4838 0.3877 0.5753 -0.0018 0.1664  0.1304  272 LEU A CD1   
1071 C CD2   . LEU A 144 ? 0.4634 0.3830 0.5234 0.0135  0.1608  0.1386  272 LEU A CD2   
1072 N N     . THR A 145 ? 0.4392 0.3275 0.4306 0.0479  0.1417  0.1546  273 THR A N     
1073 C CA    . THR A 145 ? 0.4260 0.3096 0.4083 0.0539  0.1325  0.1543  273 THR A CA    
1074 C C     . THR A 145 ? 0.4318 0.3131 0.4342 0.0449  0.1292  0.1485  273 THR A C     
1075 O O     . THR A 145 ? 0.3805 0.2675 0.4038 0.0346  0.1311  0.1435  273 THR A O     
1076 C CB    . THR A 145 ? 0.4291 0.3275 0.3980 0.0626  0.1191  0.1517  273 THR A CB    
1077 O OG1   . THR A 145 ? 0.4140 0.3273 0.3971 0.0568  0.1119  0.1453  273 THR A OG1   
1078 C CG2   . THR A 145 ? 0.4099 0.3129 0.3612 0.0707  0.1216  0.1556  273 THR A CG2   
1079 N N     . GLN A 146 ? 0.4646 0.3377 0.4613 0.0486  0.1237  0.1483  274 GLN A N     
1080 C CA    . GLN A 146 ? 0.4328 0.3038 0.4472 0.0405  0.1191  0.1420  274 GLN A CA    
1081 C C     . GLN A 146 ? 0.3771 0.2641 0.4020 0.0370  0.1079  0.1348  274 GLN A C     
1082 O O     . GLN A 146 ? 0.4421 0.3315 0.4882 0.0269  0.1066  0.1283  274 GLN A O     
1083 C CB    . GLN A 146 ? 0.4876 0.3481 0.4918 0.0462  0.1144  0.1429  274 GLN A CB    
1084 N N     . GLN A 147 ? 0.3145 0.2131 0.3248 0.0453  0.0992  0.1349  275 GLN A N     
1085 C CA    . GLN A 147 ? 0.3493 0.2631 0.3674 0.0427  0.0887  0.1286  275 GLN A CA    
1086 C C     . GLN A 147 ? 0.4328 0.3544 0.4683 0.0339  0.0945  0.1271  275 GLN A C     
1087 O O     . GLN A 147 ? 0.3800 0.3080 0.4337 0.0259  0.0893  0.1206  275 GLN A O     
1088 C CB    . GLN A 147 ? 0.3464 0.2721 0.3442 0.0534  0.0795  0.1283  275 GLN A CB    
1089 C CG    . GLN A 147 ? 0.3628 0.3046 0.3653 0.0518  0.0685  0.1217  275 GLN A CG    
1090 C CD    . GLN A 147 ? 0.3883 0.3432 0.3714 0.0613  0.0596  0.1189  275 GLN A CD    
1091 O OE1   . GLN A 147 ? 0.4245 0.3839 0.3968 0.0661  0.0640  0.1221  275 GLN A OE1   
1092 N NE2   . GLN A 147 ? 0.4218 0.3830 0.4014 0.0631  0.0471  0.1112  275 GLN A NE2   
1093 N N     . GLN A 148 ? 0.3599 0.2814 0.3906 0.0350  0.1049  0.1322  276 GLN A N     
1094 C CA    . GLN A 148 ? 0.2842 0.2144 0.3320 0.0265  0.1110  0.1298  276 GLN A CA    
1095 C C     . GLN A 148 ? 0.3009 0.2242 0.3734 0.0142  0.1174  0.1247  276 GLN A C     
1096 O O     . GLN A 148 ? 0.2705 0.2041 0.3645 0.0049  0.1163  0.1174  276 GLN A O     
1097 C CB    . GLN A 148 ? 0.3672 0.2983 0.4022 0.0312  0.1203  0.1357  276 GLN A CB    
1098 C CG    . GLN A 148 ? 0.2952 0.2376 0.3090 0.0420  0.1125  0.1375  276 GLN A CG    
1099 C CD    . GLN A 148 ? 0.4257 0.3652 0.4231 0.0485  0.1205  0.1433  276 GLN A CD    
1100 O OE1   . GLN A 148 ? 0.3955 0.3227 0.3951 0.0455  0.1325  0.1473  276 GLN A OE1   
1101 N NE2   . GLN A 148 ? 0.3115 0.2623 0.2925 0.0570  0.1135  0.1429  276 GLN A NE2   
1102 N N     . LYS A 149 ? 0.3064 0.2137 0.3766 0.0141  0.1234  0.1272  277 LYS A N     
1103 C CA    . LYS A 149 ? 0.4108 0.3124 0.5032 0.0031  0.1275  0.1207  277 LYS A CA    
1104 C C     . LYS A 149 ? 0.2840 0.1926 0.3922 -0.0027 0.1153  0.1110  277 LYS A C     
1105 O O     . LYS A 149 ? 0.2999 0.2148 0.4307 -0.0129 0.1146  0.1018  277 LYS A O     
1106 C CB    . LYS A 149 ? 0.3508 0.2338 0.4347 0.0054  0.1347  0.1255  277 LYS A CB    
1107 C CG    . LYS A 149 ? 0.4323 0.3062 0.5029 0.0095  0.1478  0.1339  277 LYS A CG    
1108 N N     . ALA A 150 ? 0.3413 0.2492 0.4370 0.0039  0.1047  0.1119  278 ALA A N     
1109 C CA    . ALA A 150 ? 0.3260 0.2399 0.4343 -0.0011 0.0922  0.1025  278 ALA A CA    
1110 C C     . ALA A 150 ? 0.3426 0.2731 0.4636 -0.0057 0.0865  0.0968  278 ALA A C     
1111 O O     . ALA A 150 ? 0.2853 0.2223 0.4268 -0.0149 0.0809  0.0859  278 ALA A O     
1112 C CB    . ALA A 150 ? 0.2810 0.1914 0.3715 0.0079  0.0824  0.1046  278 ALA A CB    
1113 N N     . GLY A 151 ? 0.2275 0.1675 0.3342 0.0013  0.0858  0.1017  279 GLY A N     
1114 C CA    . GLY A 151 ? 0.2073 0.1672 0.3213 -0.0015 0.0773  0.0921  279 GLY A CA    
1115 C C     . GLY A 151 ? 0.2066 0.1719 0.3447 -0.0119 0.0852  0.0872  279 GLY A C     
1116 O O     . GLY A 151 ? 0.2009 0.1800 0.3535 -0.0174 0.0765  0.0758  279 GLY A O     
1117 N N     . LEU A 152 ? 0.2272 0.1817 0.3692 -0.0144 0.1014  0.0950  280 LEU A N     
1118 C CA    . LEU A 152 ? 0.2291 0.1902 0.3914 -0.0232 0.1078  0.0877  280 LEU A CA    
1119 C C     . LEU A 152 ? 0.2676 0.2258 0.4494 -0.0318 0.1038  0.0765  280 LEU A C     
1120 O O     . LEU A 152 ? 0.2641 0.2341 0.4649 -0.0388 0.0995  0.0652  280 LEU A O     
1121 C CB    . LEU A 152 ? 0.2548 0.2068 0.4074 -0.0206 0.1230  0.0962  280 LEU A CB    
1122 C CG    . LEU A 152 ? 0.4742 0.4324 0.6441 -0.0283 0.1317  0.0905  280 LEU A CG    
1123 C CD1   . LEU A 152 ? 0.4187 0.3978 0.5994 -0.0305 0.1260  0.0837  280 LEU A CD1   
1124 C CD2   . LEU A 152 ? 0.4187 0.3656 0.5735 -0.0241 0.1462  0.1006  280 LEU A CD2   
1125 N N     . GLN A 153 ? 0.2420 0.1853 0.4178 -0.0306 0.1044  0.0788  281 GLN A N     
1126 C CA    . GLN A 153 ? 0.2692 0.2105 0.4604 -0.0377 0.0998  0.0682  281 GLN A CA    
1127 C C     . GLN A 153 ? 0.2110 0.1645 0.4113 -0.0405 0.0838  0.0566  281 GLN A C     
1128 O O     . GLN A 153 ? 0.2629 0.2237 0.4787 -0.0468 0.0791  0.0450  281 GLN A O     
1129 C CB    . GLN A 153 ? 0.3134 0.2378 0.4938 -0.0347 0.1019  0.0731  281 GLN A CB    
1130 C CG    . GLN A 153 ? 0.4080 0.3195 0.5867 -0.0356 0.1167  0.0790  281 GLN A CG    
1131 C CD    . GLN A 153 ? 0.5213 0.4161 0.6835 -0.0297 0.1191  0.0868  281 GLN A CD    
1132 N N     . HIS A 154 ? 0.1979 0.1535 0.3867 -0.0353 0.0749  0.0594  282 HIS A N     
1133 C CA    . HIS A 154 ? 0.1762 0.1415 0.3699 -0.0372 0.0591  0.0485  282 HIS A CA    
1134 C C     . HIS A 154 ? 0.1599 0.1420 0.3589 -0.0377 0.0537  0.0446  282 HIS A C     
1135 O O     . HIS A 154 ? 0.1427 0.1326 0.3411 -0.0376 0.0399  0.0366  282 HIS A O     
1136 C CB    . HIS A 154 ? 0.1965 0.1538 0.3748 -0.0316 0.0515  0.0522  282 HIS A CB    
1137 C CG    . HIS A 154 ? 0.2018 0.1450 0.3752 -0.0311 0.0542  0.0536  282 HIS A CG    
1138 N ND1   . HIS A 154 ? 0.2737 0.2167 0.4555 -0.0362 0.0486  0.0430  282 HIS A ND1   
1139 C CD2   . HIS A 154 ? 0.2028 0.1324 0.3624 -0.0253 0.0619  0.0641  282 HIS A CD2   
1140 C CE1   . HIS A 154 ? 0.2513 0.1815 0.4267 -0.0347 0.0530  0.0471  282 HIS A CE1   
1141 N NE2   . HIS A 154 ? 0.2094 0.1311 0.3716 -0.0281 0.0608  0.0595  282 HIS A NE2   
1142 N N     . HIS A 155 ? 0.2036 0.1919 0.4066 -0.0380 0.0640  0.0491  283 HIS A N     
1143 C CA    . HIS A 155 ? 0.2331 0.2386 0.4345 -0.0356 0.0583  0.0454  283 HIS A CA    
1144 C C     . HIS A 155 ? 0.1718 0.1893 0.3887 -0.0408 0.0451  0.0302  283 HIS A C     
1145 O O     . HIS A 155 ? 0.1206 0.1483 0.3293 -0.0371 0.0332  0.0252  283 HIS A O     
1146 C CB    . HIS A 155 ? 0.2945 0.3047 0.5007 -0.0363 0.0725  0.0510  283 HIS A CB    
1147 C CG    . HIS A 155 ? 0.3417 0.3697 0.5452 -0.0332 0.0668  0.0465  283 HIS A CG    
1148 N ND1   . HIS A 155 ? 0.2886 0.3307 0.5131 -0.0392 0.0618  0.0347  283 HIS A ND1   
1149 C CD2   . HIS A 155 ? 0.3637 0.3977 0.5460 -0.0244 0.0649  0.0518  283 HIS A CD2   
1150 C CE1   . HIS A 155 ? 0.2764 0.3317 0.4924 -0.0342 0.0574  0.0333  283 HIS A CE1   
1151 N NE2   . HIS A 155 ? 0.3321 0.3829 0.5227 -0.0255 0.0594  0.0435  283 HIS A NE2   
1152 N N     . GLN A 156 ? 0.1418 0.1564 0.3687 -0.0456 0.0448  0.0215  284 GLN A N     
1153 C CA    . GLN A 156 ? 0.1549 0.1789 0.3862 -0.0470 0.0321  0.0076  284 GLN A CA    
1154 C C     . GLN A 156 ? 0.1582 0.1798 0.3761 -0.0438 0.0173  0.0024  284 GLN A C     
1155 O O     . GLN A 156 ? 0.1318 0.1617 0.3424 -0.0410 0.0066  -0.0041 284 GLN A O     
1156 C CB    . GLN A 156 ? 0.1550 0.1760 0.3982 -0.0517 0.0356  0.0011  284 GLN A CB    
1157 C CG    . GLN A 156 ? 0.2446 0.2741 0.4901 -0.0518 0.0239  -0.0116 284 GLN A CG    
1158 C CD    . GLN A 156 ? 0.4266 0.4553 0.6861 -0.0564 0.0282  -0.0174 284 GLN A CD    
1159 O OE1   . GLN A 156 ? 0.3939 0.4181 0.6635 -0.0602 0.0409  -0.0130 284 GLN A OE1   
1160 N NE2   . GLN A 156 ? 0.5238 0.5561 0.7824 -0.0556 0.0182  -0.0269 284 GLN A NE2   
1161 N N     . ASP A 157 ? 0.1323 0.1419 0.3442 -0.0435 0.0171  0.0052  285 ASP A N     
1162 C CA    . ASP A 157 ? 0.1200 0.1267 0.3169 -0.0402 0.0045  0.0008  285 ASP A CA    
1163 C C     . ASP A 157 ? 0.1348 0.1466 0.3220 -0.0361 -0.0009 0.0045  285 ASP A C     
1164 O O     . ASP A 157 ? 0.1413 0.1567 0.3150 -0.0329 -0.0123 -0.0024 285 ASP A O     
1165 C CB    . ASP A 157 ? 0.1589 0.1526 0.3513 -0.0403 0.0066  0.0042  285 ASP A CB    
1166 C CG    . ASP A 157 ? 0.2090 0.1999 0.4067 -0.0434 0.0069  -0.0023 285 ASP A CG    
1167 O OD1   . ASP A 157 ? 0.1709 0.1693 0.3742 -0.0449 0.0039  -0.0098 285 ASP A OD1   
1168 O OD2   . ASP A 157 ? 0.2151 0.1963 0.4108 -0.0441 0.0100  0.0002  285 ASP A OD2   
1169 N N     . LEU A 158 ? 0.1272 0.1387 0.3172 -0.0352 0.0086  0.0165  286 LEU A N     
1170 C CA    . LEU A 158 ? 0.1401 0.1565 0.3063 -0.0264 0.0032  0.0199  286 LEU A CA    
1171 C C     . LEU A 158 ? 0.1238 0.1557 0.2902 -0.0251 -0.0019 0.0144  286 LEU A C     
1172 O O     . LEU A 158 ? 0.1814 0.2186 0.3297 -0.0190 -0.0090 0.0139  286 LEU A O     
1173 C CB    . LEU A 158 ? 0.1443 0.1546 0.2959 -0.0197 0.0145  0.0336  286 LEU A CB    
1174 C CG    . LEU A 158 ? 0.2812 0.2749 0.4294 -0.0192 0.0199  0.0404  286 LEU A CG    
1175 C CD1   . LEU A 158 ? 0.2640 0.2527 0.3916 -0.0097 0.0273  0.0531  286 LEU A CD1   
1176 C CD2   . LEU A 158 ? 0.1191 0.1076 0.2642 -0.0202 0.0081  0.0332  286 LEU A CD2   
1177 N N     . SER A 159 ? 0.1184 0.1580 0.3052 -0.0306 0.0017  0.0097  287 SER A N     
1178 C CA    A SER A 159 ? 0.1387 0.1930 0.3279 -0.0296 -0.0040 0.0031  287 SER A CA    
1179 C CA    B SER A 159 ? 0.1298 0.1841 0.3190 -0.0296 -0.0040 0.0031  287 SER A CA    
1180 C C     . SER A 159 ? 0.1876 0.2376 0.3607 -0.0280 -0.0170 -0.0089 287 SER A C     
1181 O O     . SER A 159 ? 0.2044 0.2611 0.3680 -0.0251 -0.0221 -0.0137 287 SER A O     
1182 C CB    A SER A 159 ? 0.1508 0.2112 0.3561 -0.0331 0.0065  0.0032  287 SER A CB    
1183 C CB    B SER A 159 ? 0.1447 0.2052 0.3500 -0.0331 0.0065  0.0030  287 SER A CB    
1184 O OG    A SER A 159 ? 0.1527 0.2102 0.3563 -0.0315 0.0214  0.0156  287 SER A OG    
1185 O OG    B SER A 159 ? 0.2014 0.2560 0.4123 -0.0370 0.0046  -0.0054 287 SER A OG    
1186 N N     . THR A 160 ? 0.1833 0.2215 0.3507 -0.0290 -0.0203 -0.0120 288 THR A N     
1187 C CA    . THR A 160 ? 0.2101 0.2429 0.3594 -0.0263 -0.0284 -0.0195 288 THR A CA    
1188 C C     . THR A 160 ? 0.1557 0.1844 0.2815 -0.0215 -0.0340 -0.0188 288 THR A C     
1189 O O     . THR A 160 ? 0.1508 0.1747 0.2748 -0.0212 -0.0340 -0.0147 288 THR A O     
1190 C CB    . THR A 160 ? 0.2417 0.2662 0.3951 -0.0287 -0.0272 -0.0216 288 THR A CB    
1191 O OG1   . THR A 160 ? 0.2881 0.3157 0.4630 -0.0335 -0.0203 -0.0219 288 THR A OG1   
1192 C CG2   . THR A 160 ? 0.2984 0.3198 0.4359 -0.0258 -0.0330 -0.0271 288 THR A CG2   
1193 N N     . PRO A 161 ? 0.2314 0.2607 0.3386 -0.0179 -0.0374 -0.0218 289 PRO A N     
1194 C CA    . PRO A 161 ? 0.2451 0.2694 0.3303 -0.0138 -0.0393 -0.0206 289 PRO A CA    
1195 C C     . PRO A 161 ? 0.1922 0.2057 0.2734 -0.0124 -0.0407 -0.0211 289 PRO A C     
1196 O O     . PRO A 161 ? 0.1607 0.1696 0.2481 -0.0122 -0.0422 -0.0242 289 PRO A O     
1197 C CB    . PRO A 161 ? 0.2000 0.2225 0.2782 -0.0095 -0.0422 -0.0249 289 PRO A CB    
1198 C CG    . PRO A 161 ? 0.2482 0.2806 0.3388 -0.0121 -0.0410 -0.0261 289 PRO A CG    
1199 C CD    . PRO A 161 ? 0.2225 0.2569 0.3299 -0.0174 -0.0381 -0.0255 289 PRO A CD    
1200 N N     . VAL A 162 ? 0.1646 0.1614 0.2960 -0.0390 -0.0326 -0.0238 290 VAL A N     
1201 C CA    . VAL A 162 ? 0.2168 0.2135 0.3251 -0.0402 -0.0374 -0.0309 290 VAL A CA    
1202 C C     . VAL A 162 ? 0.1713 0.1731 0.2560 -0.0404 -0.0495 -0.0299 290 VAL A C     
1203 O O     . VAL A 162 ? 0.1540 0.1563 0.2295 -0.0382 -0.0483 -0.0207 290 VAL A O     
1204 C CB    . VAL A 162 ? 0.1943 0.1851 0.2867 -0.0375 -0.0247 -0.0270 290 VAL A CB    
1205 C CG1   . VAL A 162 ? 0.1753 0.1658 0.2489 -0.0390 -0.0280 -0.0358 290 VAL A CG1   
1206 C CG2   . VAL A 162 ? 0.2346 0.2193 0.3491 -0.0361 -0.0118 -0.0240 290 VAL A CG2   
1207 N N     . LEU A 163 ? 0.2297 0.2350 0.3042 -0.0431 -0.0606 -0.0394 291 LEU A N     
1208 C CA    . LEU A 163 ? 0.2843 0.2939 0.3349 -0.0433 -0.0726 -0.0381 291 LEU A CA    
1209 C C     . LEU A 163 ? 0.2831 0.2903 0.3011 -0.0434 -0.0691 -0.0399 291 LEU A C     
1210 O O     . LEU A 163 ? 0.2132 0.2170 0.2295 -0.0441 -0.0612 -0.0461 291 LEU A O     
1211 C CB    . LEU A 163 ? 0.2345 0.2512 0.2921 -0.0453 -0.0874 -0.0464 291 LEU A CB    
1212 C CG    . LEU A 163 ? 0.2492 0.2694 0.3398 -0.0444 -0.0892 -0.0454 291 LEU A CG    
1213 C CD1   . LEU A 163 ? 0.3059 0.3337 0.3967 -0.0450 -0.1013 -0.0525 291 LEU A CD1   
1214 C CD2   . LEU A 163 ? 0.2783 0.2986 0.3776 -0.0419 -0.0892 -0.0335 291 LEU A CD2   
1215 N N     . ARG A 164 ? 0.3288 0.3375 0.3223 -0.0427 -0.0747 -0.0341 292 ARG A N     
1216 C CA    . ARG A 164 ? 0.3706 0.3771 0.3336 -0.0432 -0.0705 -0.0354 292 ARG A CA    
1217 C C     . ARG A 164 ? 0.4320 0.4405 0.3873 -0.0457 -0.0737 -0.0491 292 ARG A C     
1218 O O     . ARG A 164 ? 0.4498 0.4553 0.3924 -0.0453 -0.0652 -0.0535 292 ARG A O     
1219 C CB    . ARG A 164 ? 0.5218 0.5295 0.4630 -0.0416 -0.0750 -0.0264 292 ARG A CB    
1220 C CG    . ARG A 164 ? 0.6185 0.6237 0.5352 -0.0394 -0.0646 -0.0242 292 ARG A CG    
1221 C CD    . ARG A 164 ? 0.6401 0.6408 0.5581 -0.0404 -0.0530 -0.0215 292 ARG A CD    
1222 N NE    . ARG A 164 ? 0.6969 0.6963 0.5988 -0.0372 -0.0428 -0.0194 292 ARG A NE    
1223 C CZ    . ARG A 164 ? 0.6572 0.6563 0.5513 -0.0359 -0.0381 -0.0265 292 ARG A CZ    
1224 N NH1   . ARG A 164 ? 0.6469 0.6468 0.5451 -0.0375 -0.0423 -0.0369 292 ARG A NH1   
1225 N NH2   . ARG A 164 ? 0.6444 0.6424 0.5295 -0.0330 -0.0295 -0.0237 292 ARG A NH2   
1226 N N     . SER A 165 ? 0.3481 0.3635 0.3144 -0.0469 -0.0827 -0.0557 293 SER A N     
1227 C CA    . SER A 165 ? 0.3567 0.3741 0.3172 -0.0511 -0.0828 -0.0676 293 SER A CA    
1228 C C     . SER A 165 ? 0.4308 0.4390 0.4082 -0.0518 -0.0746 -0.0741 293 SER A C     
1229 O O     . SER A 165 ? 0.4707 0.4735 0.4372 -0.0523 -0.0702 -0.0808 293 SER A O     
1230 C CB    . SER A 165 ? 0.4779 0.5021 0.4482 -0.0528 -0.0943 -0.0714 293 SER A CB    
1231 N N     . ASP A 166 ? 0.3065 0.3136 0.3138 -0.0503 -0.0711 -0.0721 294 ASP A N     
1232 C CA    . ASP A 166 ? 0.2728 0.2743 0.2998 -0.0501 -0.0599 -0.0770 294 ASP A CA    
1233 C C     . ASP A 166 ? 0.3334 0.3304 0.3429 -0.0481 -0.0486 -0.0742 294 ASP A C     
1234 O O     . ASP A 166 ? 0.3210 0.3141 0.3362 -0.0483 -0.0408 -0.0812 294 ASP A O     
1235 C CB    . ASP A 166 ? 0.3435 0.3431 0.4022 -0.0487 -0.0551 -0.0703 294 ASP A CB    
1236 C CG    . ASP A 166 ? 0.3306 0.3354 0.4091 -0.0497 -0.0638 -0.0716 294 ASP A CG    
1237 O OD1   . ASP A 166 ? 0.3533 0.3622 0.4260 -0.0516 -0.0716 -0.0797 294 ASP A OD1   
1238 O OD2   . ASP A 166 ? 0.2261 0.2309 0.3252 -0.0482 -0.0616 -0.0640 294 ASP A OD2   
1239 N N     . VAL A 167 ? 0.3675 0.3649 0.3568 -0.0459 -0.0471 -0.0634 295 VAL A N     
1240 C CA    . VAL A 167 ? 0.3003 0.2944 0.2756 -0.0434 -0.0358 -0.0588 295 VAL A CA    
1241 C C     . VAL A 167 ? 0.2768 0.2710 0.2331 -0.0455 -0.0348 -0.0693 295 VAL A C     
1242 O O     . VAL A 167 ? 0.2727 0.2638 0.2312 -0.0442 -0.0252 -0.0726 295 VAL A O     
1243 C CB    . VAL A 167 ? 0.3105 0.3058 0.2709 -0.0413 -0.0352 -0.0464 295 VAL A CB    
1244 C CG1   . VAL A 167 ? 0.2412 0.2345 0.1884 -0.0392 -0.0245 -0.0436 295 VAL A CG1   
1245 C CG2   . VAL A 167 ? 0.2375 0.2324 0.2182 -0.0391 -0.0341 -0.0371 295 VAL A CG2   
1246 N N     . ASP A 168 ? 0.2982 0.2941 0.2376 -0.0453 -0.0437 -0.0709 296 ASP A N     
1247 C CA    . ASP A 168 ? 0.3551 0.3486 0.2773 -0.0433 -0.0407 -0.0754 296 ASP A CA    
1248 C C     . ASP A 168 ? 0.4259 0.4167 0.3619 -0.0454 -0.0371 -0.0869 296 ASP A C     
1249 O O     . ASP A 168 ? 0.3835 0.3724 0.3158 -0.0440 -0.0285 -0.0905 296 ASP A O     
1250 C CB    . ASP A 168 ? 0.5002 0.4950 0.4037 -0.0415 -0.0509 -0.0747 296 ASP A CB    
1251 C CG    . ASP A 168 ? 0.5643 0.5637 0.4593 -0.0386 -0.0533 -0.0631 296 ASP A CG    
1252 N N     . ALA A 169 ? 0.4233 0.4148 0.3800 -0.0482 -0.0424 -0.0924 297 ALA A N     
1253 C CA    . ALA A 169 ? 0.3518 0.3412 0.3249 -0.0494 -0.0382 -0.1032 297 ALA A CA    
1254 C C     . ALA A 169 ? 0.2855 0.2714 0.2766 -0.0474 -0.0256 -0.1028 297 ALA A C     
1255 O O     . ALA A 169 ? 0.3757 0.3591 0.3712 -0.0466 -0.0186 -0.1093 297 ALA A O     
1256 C CB    . ALA A 169 ? 0.3619 0.3534 0.3567 -0.0522 -0.0459 -0.1083 297 ALA A CB    
1257 N N     . LEU A 170 ? 0.2497 0.2349 0.2524 -0.0465 -0.0225 -0.0951 298 LEU A N     
1258 C CA    . LEU A 170 ? 0.2758 0.2555 0.2947 -0.0437 -0.0106 -0.0921 298 LEU A CA    
1259 C C     . LEU A 170 ? 0.3097 0.2891 0.3095 -0.0412 -0.0031 -0.0905 298 LEU A C     
1260 O O     . LEU A 170 ? 0.3426 0.3179 0.3531 -0.0387 0.0056  -0.0927 298 LEU A O     
1261 C CB    . LEU A 170 ? 0.2394 0.2179 0.2696 -0.0405 -0.0085 -0.0770 298 LEU A CB    
1262 C CG    . LEU A 170 ? 0.3984 0.3750 0.4579 -0.0419 -0.0103 -0.0776 298 LEU A CG    
1263 C CD1   . LEU A 170 ? 0.3648 0.3419 0.4297 -0.0394 -0.0095 -0.0635 298 LEU A CD1   
1264 C CD2   . LEU A 170 ? 0.4211 0.3902 0.5050 -0.0405 -0.0005 -0.0808 298 LEU A CD2   
1265 N N     . GLN A 171 ? 0.2641 0.2478 0.2380 -0.0416 -0.0062 -0.0862 299 GLN A N     
1266 C CA    . GLN A 171 ? 0.2896 0.2739 0.2488 -0.0387 0.0012  -0.0833 299 GLN A CA    
1267 C C     . GLN A 171 ? 0.2618 0.2455 0.2205 -0.0382 0.0041  -0.0919 299 GLN A C     
1268 O O     . GLN A 171 ? 0.2655 0.2483 0.2280 -0.0357 0.0125  -0.0929 299 GLN A O     
1269 C CB    . GLN A 171 ? 0.3111 0.2993 0.2471 -0.0378 -0.0024 -0.0741 299 GLN A CB    
1270 C CG    . GLN A 171 ? 0.2924 0.2819 0.2192 -0.0344 0.0051  -0.0700 299 GLN A CG    
1271 C CD    . GLN A 171 ? 0.3820 0.3741 0.2980 -0.0324 0.0047  -0.0583 299 GLN A CD    
1272 O OE1   . GLN A 171 ? 0.3170 0.3097 0.2298 -0.0335 -0.0011 -0.0530 299 GLN A OE1   
1273 N NE2   . GLN A 171 ? 0.3719 0.3657 0.2856 -0.0294 0.0107  -0.0547 299 GLN A NE2   
1274 N N     . GLN A 172 ? 0.2842 0.2685 0.2390 -0.0406 -0.0029 -0.0986 300 GLN A N     
1275 C CA    . GLN A 172 ? 0.3410 0.3247 0.2947 -0.0409 0.0002  -0.1079 300 GLN A CA    
1276 C C     . GLN A 172 ? 0.3076 0.2881 0.2878 -0.0401 0.0078  -0.1143 300 GLN A C     
1277 O O     . GLN A 172 ? 0.3495 0.3296 0.3326 -0.0385 0.0153  -0.1180 300 GLN A O     
1278 C CB    . GLN A 172 ? 0.4153 0.3995 0.3594 -0.0437 -0.0095 -0.1143 300 GLN A CB    
1279 C CG    . GLN A 172 ? 0.5054 0.4908 0.4215 -0.0430 -0.0154 -0.1086 300 GLN A CG    
1280 N N     . VAL A 173 ? 0.2801 0.2579 0.2826 -0.0408 0.0063  -0.1149 301 VAL A N     
1281 C CA    . VAL A 173 ? 0.3608 0.3338 0.3911 -0.0391 0.0141  -0.1191 301 VAL A CA    
1282 C C     . VAL A 173 ? 0.3540 0.3232 0.3908 -0.0345 0.0236  -0.1119 301 VAL A C     
1283 O O     . VAL A 173 ? 0.2995 0.2656 0.3508 -0.0317 0.0312  -0.1144 301 VAL A O     
1284 C CB    . VAL A 173 ? 0.4133 0.3836 0.4683 -0.0405 0.0110  -0.1197 301 VAL A CB    
1285 C CG1   . VAL A 173 ? 0.4192 0.3944 0.4660 -0.0447 -0.0002 -0.1262 301 VAL A CG1   
1286 C CG2   . VAL A 173 ? 0.4304 0.3972 0.4944 -0.0389 0.0122  -0.1084 301 VAL A CG2   
1287 N N     . VAL A 174 ? 0.2715 0.2408 0.2979 -0.0333 0.0232  -0.1027 302 VAL A N     
1288 C CA    . VAL A 174 ? 0.2467 0.2137 0.2755 -0.0276 0.0312  -0.0942 302 VAL A CA    
1289 C C     . VAL A 174 ? 0.2882 0.2595 0.3041 -0.0266 0.0351  -0.0986 302 VAL A C     
1290 O O     . VAL A 174 ? 0.2454 0.2144 0.2739 -0.0221 0.0423  -0.0983 302 VAL A O     
1291 C CB    . VAL A 174 ? 0.2143 0.1845 0.2324 -0.0253 0.0282  -0.0788 302 VAL A CB    
1292 C CG1   . VAL A 174 ? 0.1845 0.1557 0.2011 -0.0188 0.0344  -0.0687 302 VAL A CG1   
1293 C CG2   . VAL A 174 ? 0.2217 0.1882 0.2566 -0.0252 0.0261  -0.0718 302 VAL A CG2   
1294 N N     . GLU A 175 ? 0.2736 0.2513 0.2665 -0.0296 0.0301  -0.0996 303 GLU A N     
1295 C CA    . GLU A 175 ? 0.3032 0.2850 0.2863 -0.0285 0.0339  -0.1010 303 GLU A CA    
1296 C C     . GLU A 175 ? 0.3230 0.3030 0.3213 -0.0286 0.0384  -0.1110 303 GLU A C     
1297 O O     . GLU A 175 ? 0.2718 0.2527 0.2770 -0.0257 0.0449  -0.1118 303 GLU A O     
1298 C CB    . GLU A 175 ? 0.3060 0.2919 0.2644 -0.0312 0.0282  -0.0989 303 GLU A CB    
1299 C CG    . GLU A 175 ? 0.3394 0.3278 0.2849 -0.0302 0.0254  -0.0874 303 GLU A CG    
1300 C CD    . GLU A 175 ? 0.4084 0.3987 0.3332 -0.0315 0.0201  -0.0839 303 GLU A CD    
1301 O OE1   . GLU A 175 ? 0.4990 0.4886 0.4167 -0.0335 0.0177  -0.0908 303 GLU A OE1   
1302 O OE2   . GLU A 175 ? 0.5084 0.5006 0.4249 -0.0302 0.0187  -0.0742 303 GLU A OE2   
1303 N N     A GLU A 176 ? 0.2945 0.2725 0.2999 -0.0317 0.0349  -0.1188 304 GLU A N     
1304 N N     B GLU A 176 ? 0.2649 0.2430 0.2702 -0.0317 0.0349  -0.1188 304 GLU A N     
1305 C CA    A GLU A 176 ? 0.3102 0.2868 0.3321 -0.0320 0.0395  -0.1288 304 GLU A CA    
1306 C CA    B GLU A 176 ? 0.3216 0.2982 0.3435 -0.0320 0.0395  -0.1287 304 GLU A CA    
1307 C C     A GLU A 176 ? 0.3237 0.2955 0.3719 -0.0272 0.0473  -0.1260 304 GLU A C     
1308 C C     B GLU A 176 ? 0.3409 0.3127 0.3889 -0.0272 0.0474  -0.1259 304 GLU A C     
1309 O O     A GLU A 176 ? 0.3257 0.2981 0.3826 -0.0252 0.0536  -0.1293 304 GLU A O     
1310 O O     B GLU A 176 ? 0.3213 0.2938 0.3775 -0.0251 0.0536  -0.1289 304 GLU A O     
1311 C CB    A GLU A 176 ? 0.3061 0.2816 0.3344 -0.0358 0.0338  -0.1369 304 GLU A CB    
1312 C CB    B GLU A 176 ? 0.2947 0.2701 0.3237 -0.0358 0.0339  -0.1368 304 GLU A CB    
1313 C CG    A GLU A 176 ? 0.3090 0.2883 0.3113 -0.0396 0.0256  -0.1403 304 GLU A CG    
1314 C CG    B GLU A 176 ? 0.3244 0.2990 0.3715 -0.0366 0.0387  -0.1480 304 GLU A CG    
1315 N N     . ALA A 177 ? 0.3129 0.2792 0.3749 -0.0249 0.0473  -0.1190 305 ALA A N     
1316 C CA    . ALA A 177 ? 0.2554 0.2154 0.3413 -0.0189 0.0545  -0.1128 305 ALA A CA    
1317 C C     . ALA A 177 ? 0.2453 0.2076 0.3239 -0.0136 0.0584  -0.1063 305 ALA A C     
1318 O O     . ALA A 177 ? 0.2779 0.2386 0.3723 -0.0089 0.0639  -0.1049 305 ALA A O     
1319 C CB    . ALA A 177 ? 0.2745 0.2274 0.3739 -0.0170 0.0540  -0.1037 305 ALA A CB    
1320 N N     . VAL A 178 ? 0.2718 0.2390 0.3278 -0.0142 0.0551  -0.1020 306 VAL A N     
1321 C CA    . VAL A 178 ? 0.2588 0.2306 0.3081 -0.0095 0.0580  -0.0961 306 VAL A CA    
1322 C C     . VAL A 178 ? 0.2845 0.2615 0.3320 -0.0108 0.0605  -0.1031 306 VAL A C     
1323 O O     . VAL A 178 ? 0.2383 0.2170 0.2954 -0.0057 0.0646  -0.1006 306 VAL A O     
1324 C CB    . VAL A 178 ? 0.2261 0.2029 0.2520 -0.0110 0.0537  -0.0899 306 VAL A CB    
1325 C CG1   . VAL A 178 ? 0.2561 0.2404 0.2732 -0.0081 0.0553  -0.0857 306 VAL A CG1   
1326 C CG2   . VAL A 178 ? 0.1606 0.1339 0.1910 -0.0078 0.0517  -0.0779 306 VAL A CG2   
1327 N N     . GLY A 179 ? 0.2994 0.2793 0.3347 -0.0171 0.0580  -0.1113 307 GLY A N     
1328 C CA    . GLY A 179 ? 0.2753 0.2592 0.3088 -0.0186 0.0616  -0.1182 307 GLY A CA    
1329 C C     . GLY A 179 ? 0.3286 0.3094 0.3879 -0.0160 0.0676  -0.1239 307 GLY A C     
1330 O O     . GLY A 179 ? 0.3249 0.3087 0.3898 -0.0144 0.0722  -0.1262 307 GLY A O     
1331 N N     . GLN A 180 ? 0.2862 0.2609 0.3632 -0.0159 0.0678  -0.1262 308 GLN A N     
1332 C CA    . GLN A 180 ? 0.2703 0.2409 0.3751 -0.0128 0.0736  -0.1292 308 GLN A CA    
1333 C C     . GLN A 180 ? 0.3140 0.2817 0.4329 -0.0045 0.0762  -0.1179 308 GLN A C     
1334 O O     . GLN A 180 ? 0.3760 0.3438 0.5108 -0.0008 0.0806  -0.1184 308 GLN A O     
1335 C CB    . GLN A 180 ? 0.2905 0.2554 0.4124 -0.0149 0.0730  -0.1328 308 GLN A CB    
1336 C CG    . GLN A 180 ? 0.3220 0.2909 0.4323 -0.0221 0.0699  -0.1455 308 GLN A CG    
1337 C CD    . GLN A 180 ? 0.4391 0.4042 0.5659 -0.0246 0.0681  -0.1500 308 GLN A CD    
1338 O OE1   . GLN A 180 ? 0.4373 0.3965 0.5901 -0.0214 0.0719  -0.1454 308 GLN A OE1   
1339 N NE2   . GLN A 180 ? 0.5306 0.4990 0.6426 -0.0300 0.0620  -0.1578 308 GLN A NE2   
1340 N N     . ALA A 181 ? 0.2667 0.2324 0.3791 -0.0012 0.0732  -0.1072 309 ALA A N     
1341 C CA    . ALA A 181 ? 0.2688 0.2314 0.3948 0.0079  0.0752  -0.0950 309 ALA A CA    
1342 C C     . ALA A 181 ? 0.2235 0.1940 0.3436 0.0116  0.0759  -0.0940 309 ALA A C     
1343 O O     . ALA A 181 ? 0.3395 0.3097 0.4758 0.0186  0.0779  -0.0886 309 ALA A O     
1344 C CB    . ALA A 181 ? 0.2387 0.1974 0.3596 0.0110  0.0727  -0.0833 309 ALA A CB    
1345 N N     . LEU A 182 ? 0.2169 0.1950 0.3149 0.0071  0.0736  -0.0978 310 LEU A N     
1346 C CA    . LEU A 182 ? 0.2075 0.1940 0.2998 0.0092  0.0741  -0.0970 310 LEU A CA    
1347 C C     . LEU A 182 ? 0.2299 0.2221 0.3000 0.0011  0.0730  -0.1037 310 LEU A C     
1348 O O     . LEU A 182 ? 0.2306 0.2253 0.2809 -0.0015 0.0691  -0.0995 310 LEU A O     
1349 C CB    . LEU A 182 ? 0.1736 0.1637 0.2622 0.0161  0.0713  -0.0854 310 LEU A CB    
1350 C CG    . LEU A 182 ? 0.1693 0.1697 0.2528 0.0181  0.0707  -0.0846 310 LEU A CG    
1351 C CD1   . LEU A 182 ? 0.1789 0.1811 0.2834 0.0231  0.0737  -0.0871 310 LEU A CD1   
1352 C CD2   . LEU A 182 ? 0.1842 0.1896 0.2615 0.0239  0.0671  -0.0743 310 LEU A CD2   
1353 N N     . PRO A 183 ? 0.2003 0.1943 0.2733 -0.0027 0.0767  -0.1129 311 PRO A N     
1354 C CA    . PRO A 183 ? 0.2063 0.2048 0.2579 -0.0094 0.0763  -0.1170 311 PRO A CA    
1355 C C     . PRO A 183 ? 0.2676 0.2721 0.3064 -0.0084 0.0743  -0.1096 311 PRO A C     
1356 O O     . PRO A 183 ? 0.2261 0.2344 0.2761 -0.0031 0.0753  -0.1060 311 PRO A O     
1357 C CB    . PRO A 183 ? 0.2686 0.2683 0.3314 -0.0113 0.0825  -0.1271 311 PRO A CB    
1358 C CG    . PRO A 183 ? 0.2904 0.2845 0.3771 -0.0083 0.0847  -0.1305 311 PRO A CG    
1359 C CD    . PRO A 183 ? 0.2350 0.2260 0.3312 -0.0011 0.0817  -0.1196 311 PRO A CD    
1360 N N     . GLY A 184 ? 0.2404 0.2460 0.2568 -0.0132 0.0709  -0.1071 312 GLY A N     
1361 C CA    . GLY A 184 ? 0.1900 0.2003 0.1949 -0.0130 0.0687  -0.0996 312 GLY A CA    
1362 C C     . GLY A 184 ? 0.2185 0.2286 0.2181 -0.0103 0.0633  -0.0902 312 GLY A C     
1363 O O     . GLY A 184 ? 0.2002 0.2136 0.1891 -0.0109 0.0607  -0.0837 312 GLY A O     
1364 N N     . ALA A 185 ? 0.1835 0.1895 0.1916 -0.0073 0.0622  -0.0893 313 ALA A N     
1365 C CA    . ALA A 185 ? 0.1699 0.1755 0.1723 -0.0051 0.0581  -0.0809 313 ALA A CA    
1366 C C     . ALA A 185 ? 0.2050 0.2087 0.1885 -0.0107 0.0532  -0.0784 313 ALA A C     
1367 O O     . ALA A 185 ? 0.2679 0.2690 0.2456 -0.0151 0.0526  -0.0841 313 ALA A O     
1368 C CB    . ALA A 185 ? 0.1631 0.1633 0.1816 0.0000  0.0597  -0.0802 313 ALA A CB    
1369 N N     . THR A 186 ? 0.2385 0.2441 0.2131 -0.0100 0.0493  -0.0699 314 THR A N     
1370 C CA    . THR A 186 ? 0.2073 0.2116 0.1662 -0.0141 0.0440  -0.0656 314 THR A CA    
1371 C C     . THR A 186 ? 0.1897 0.1915 0.1479 -0.0135 0.0411  -0.0612 314 THR A C     
1372 O O     . THR A 186 ? 0.1544 0.1568 0.1208 -0.0092 0.0432  -0.0582 314 THR A O     
1373 C CB    . THR A 186 ? 0.1567 0.1648 0.1073 -0.0143 0.0423  -0.0592 314 THR A CB    
1374 O OG1   . THR A 186 ? 0.1823 0.1938 0.1377 -0.0104 0.0416  -0.0531 314 THR A OG1   
1375 C CG2   . THR A 186 ? 0.2046 0.2150 0.1569 -0.0154 0.0468  -0.0642 314 THR A CG2   
1376 N N     . VAL A 187 ? 0.1492 0.1485 0.0978 -0.0175 0.0365  -0.0607 315 VAL A N     
1377 C CA    . VAL A 187 ? 0.1730 0.1697 0.1208 -0.0184 0.0336  -0.0575 315 VAL A CA    
1378 C C     . VAL A 187 ? 0.2397 0.2384 0.1756 -0.0198 0.0280  -0.0493 315 VAL A C     
1379 O O     . VAL A 187 ? 0.2113 0.2100 0.1384 -0.0219 0.0251  -0.0499 315 VAL A O     
1380 C CB    . VAL A 187 ? 0.1583 0.1497 0.1107 -0.0218 0.0324  -0.0660 315 VAL A CB    
1381 C CG1   . VAL A 187 ? 0.1473 0.1355 0.1028 -0.0227 0.0290  -0.0617 315 VAL A CG1   
1382 C CG2   . VAL A 187 ? 0.1566 0.1444 0.1264 -0.0195 0.0385  -0.0741 315 VAL A CG2   
1383 N N     . THR A 188 ? 0.1596 0.1597 0.0962 -0.0177 0.0272  -0.0417 316 THR A N     
1384 C CA    . THR A 188 ? 0.1672 0.1686 0.0977 -0.0181 0.0227  -0.0340 316 THR A CA    
1385 C C     . THR A 188 ? 0.1776 0.1769 0.1074 -0.0200 0.0203  -0.0311 316 THR A C     
1386 O O     . THR A 188 ? 0.1175 0.1162 0.0522 -0.0184 0.0237  -0.0294 316 THR A O     
1387 C CB    . THR A 188 ? 0.1955 0.2005 0.1294 -0.0140 0.0236  -0.0282 316 THR A CB    
1388 O OG1   . THR A 188 ? 0.1887 0.1952 0.1234 -0.0134 0.0264  -0.0318 316 THR A OG1   
1389 C CG2   . THR A 188 ? 0.1730 0.1779 0.1039 -0.0142 0.0202  -0.0221 316 THR A CG2   
1390 N N     . LEU A 189 ? 0.1419 0.1401 0.0655 -0.0232 0.0150  -0.0301 317 LEU A N     
1391 C CA    . LEU A 189 ? 0.1458 0.1424 0.0688 -0.0258 0.0119  -0.0271 317 LEU A CA    
1392 C C     . LEU A 189 ? 0.1480 0.1469 0.0744 -0.0225 0.0131  -0.0180 317 LEU A C     
1393 O O     . LEU A 189 ? 0.1776 0.1785 0.1043 -0.0199 0.0124  -0.0147 317 LEU A O     
1394 C CB    . LEU A 189 ? 0.1637 0.1594 0.0800 -0.0293 0.0043  -0.0281 317 LEU A CB    
1395 C CG    . LEU A 189 ? 0.1867 0.1814 0.1063 -0.0318 -0.0018 -0.0241 317 LEU A CG    
1396 C CD1   . LEU A 189 ? 0.1570 0.1493 0.0974 -0.0303 -0.0016 -0.0255 317 LEU A CD1   
1397 C CD2   . LEU A 189 ? 0.2026 0.1978 0.1129 -0.0344 -0.0104 -0.0251 317 LEU A CD2   
1398 N N     A THR A 190 ? 0.1394 0.1373 0.0712 -0.0216 0.0155  -0.0144 318 THR A N     
1399 N N     B THR A 190 ? 0.1377 0.1356 0.0695 -0.0217 0.0154  -0.0144 318 THR A N     
1400 C CA    A THR A 190 ? 0.1133 0.1137 0.0485 -0.0185 0.0166  -0.0072 318 THR A CA    
1401 C CA    B THR A 190 ? 0.1179 0.1183 0.0530 -0.0186 0.0165  -0.0072 318 THR A CA    
1402 C C     A THR A 190 ? 0.1271 0.1252 0.0688 -0.0198 0.0148  -0.0023 318 THR A C     
1403 C C     B THR A 190 ? 0.1257 0.1236 0.0685 -0.0195 0.0150  -0.0024 318 THR A C     
1404 O O     A THR A 190 ? 0.1021 0.0981 0.0469 -0.0227 0.0093  -0.0037 318 THR A O     
1405 O O     B THR A 190 ? 0.1634 0.1587 0.1117 -0.0220 0.0101  -0.0039 318 THR A O     
1406 C CB    A THR A 190 ? 0.1351 0.1379 0.0762 -0.0126 0.0211  -0.0054 318 THR A CB    
1407 C CB    B THR A 190 ? 0.1212 0.1244 0.0622 -0.0124 0.0205  -0.0056 318 THR A CB    
1408 O OG1   A THR A 190 ? 0.1611 0.1600 0.1091 -0.0115 0.0245  -0.0042 318 THR A OG1   
1409 O OG1   B THR A 190 ? 0.0858 0.0914 0.0315 -0.0082 0.0199  -0.0005 318 THR A OG1   
1410 C CG2   A THR A 190 ? 0.0947 0.0998 0.0357 -0.0101 0.0212  -0.0095 318 THR A CG2   
1411 C CG2   B THR A 190 ? 0.1132 0.1130 0.0597 -0.0111 0.0250  -0.0051 318 THR A CG2   
1412 N N     . GLY A 191 ? 0.1080 0.1073 0.0546 -0.0168 0.0184  0.0031  319 GLY A N     
1413 C CA    . GLY A 191 ? 0.1302 0.1274 0.0878 -0.0169 0.0178  0.0077  319 GLY A CA    
1414 C C     . GLY A 191 ? 0.1330 0.1303 0.0896 -0.0205 0.0119  0.0086  319 GLY A C     
1415 O O     . GLY A 191 ? 0.0981 0.0969 0.0431 -0.0225 0.0097  0.0077  319 GLY A O     
1416 N N     . GLY A 192 ? 0.1361 0.1316 0.1066 -0.0211 0.0095  0.0109  320 GLY A N     
1417 C CA    . GLY A 192 ? 0.1244 0.1203 0.0979 -0.0233 0.0038  0.0133  320 GLY A CA    
1418 C C     . GLY A 192 ? 0.1520 0.1480 0.1150 -0.0264 -0.0046 0.0105  320 GLY A C     
1419 O O     . GLY A 192 ? 0.1223 0.1187 0.0795 -0.0276 -0.0084 0.0137  320 GLY A O     
1420 N N     . PHE A 193 ? 0.1131 0.1084 0.0734 -0.0276 -0.0073 0.0046  321 PHE A N     
1421 C CA    . PHE A 193 ? 0.1336 0.1293 0.0808 -0.0306 -0.0152 0.0012  321 PHE A CA    
1422 C C     . PHE A 193 ? 0.1211 0.1172 0.0480 -0.0313 -0.0121 0.0018  321 PHE A C     
1423 O O     . PHE A 193 ? 0.1558 0.1516 0.0699 -0.0333 -0.0175 0.0033  321 PHE A O     
1424 C CB    . PHE A 193 ? 0.1240 0.1191 0.0734 -0.0320 -0.0177 -0.0072 321 PHE A CB    
1425 C CG    . PHE A 193 ? 0.1242 0.1192 0.0942 -0.0326 -0.0229 -0.0090 321 PHE A CG    
1426 C CD1   . PHE A 193 ? 0.1322 0.1294 0.1043 -0.0346 -0.0340 -0.0093 321 PHE A CD1   
1427 C CD2   . PHE A 193 ? 0.1343 0.1272 0.1227 -0.0311 -0.0168 -0.0099 321 PHE A CD2   
1428 C CE1   . PHE A 193 ? 0.1476 0.1460 0.1421 -0.0353 -0.0392 -0.0120 321 PHE A CE1   
1429 C CE2   . PHE A 193 ? 0.1183 0.1111 0.1286 -0.0322 -0.0204 -0.0119 321 PHE A CE2   
1430 C CZ    . PHE A 193 ? 0.1639 0.1599 0.1783 -0.0345 -0.0318 -0.0136 321 PHE A CZ    
1431 N N     . ARG A 194 ? 0.1459 0.1428 0.0701 -0.0295 -0.0037 0.0011  322 ARG A N     
1432 C CA    . ARG A 194 ? 0.1734 0.1717 0.0955 -0.0262 0.0001  0.0013  322 ARG A CA    
1433 C C     . ARG A 194 ? 0.1893 0.1874 0.1140 -0.0256 0.0000  0.0071  322 ARG A C     
1434 O O     . ARG A 194 ? 0.1349 0.1326 0.0569 -0.0243 0.0009  0.0077  322 ARG A O     
1435 C CB    . ARG A 194 ? 0.1035 0.1037 0.0320 -0.0218 0.0065  -0.0011 322 ARG A CB    
1436 C CG    . ARG A 194 ? 0.1168 0.1183 0.0462 -0.0187 0.0087  -0.0014 322 ARG A CG    
1437 C CD    . ARG A 194 ? 0.1331 0.1366 0.0670 -0.0150 0.0122  -0.0042 322 ARG A CD    
1438 N NE    . ARG A 194 ? 0.1320 0.1365 0.0654 -0.0152 0.0141  -0.0048 322 ARG A NE    
1439 C CZ    . ARG A 194 ? 0.1842 0.1909 0.1225 -0.0146 0.0162  -0.0045 322 ARG A CZ    
1440 N NH1   . ARG A 194 ? 0.0870 0.0951 0.0309 -0.0121 0.0163  -0.0034 322 ARG A NH1   
1441 N NH2   . ARG A 194 ? 0.1343 0.1419 0.0712 -0.0165 0.0183  -0.0057 322 ARG A NH2   
1442 N N     . ARG A 195 ? 0.1735 0.1714 0.1036 -0.0269 -0.0003 0.0115  323 ARG A N     
1443 C CA    . ARG A 195 ? 0.1739 0.1711 0.1077 -0.0269 -0.0004 0.0169  323 ARG A CA    
1444 C C     . ARG A 195 ? 0.1840 0.1787 0.1127 -0.0303 -0.0093 0.0225  323 ARG A C     
1445 O O     . ARG A 195 ? 0.1519 0.1452 0.0858 -0.0303 -0.0102 0.0285  323 ARG A O     
1446 C CB    . ARG A 195 ? 0.1405 0.1386 0.0851 -0.0263 0.0039  0.0198  323 ARG A CB    
1447 C CG    . ARG A 195 ? 0.0857 0.0865 0.0354 -0.0210 0.0105  0.0149  323 ARG A CG    
1448 C CD    . ARG A 195 ? 0.1443 0.1462 0.1036 -0.0189 0.0151  0.0169  323 ARG A CD    
1449 N NE    . ARG A 195 ? 0.1080 0.1083 0.0762 -0.0216 0.0149  0.0214  323 ARG A NE    
1450 C CZ    . ARG A 195 ? 0.1380 0.1376 0.1130 -0.0199 0.0169  0.0210  323 ARG A CZ    
1451 N NH1   . ARG A 195 ? 0.1041 0.1047 0.0720 -0.0180 0.0201  0.0187  323 ARG A NH1   
1452 N NH2   . ARG A 195 ? 0.1040 0.1020 0.0948 -0.0198 0.0161  0.0232  323 ARG A NH2   
1453 N N     . GLY A 196 ? 0.2172 0.2118 0.1396 -0.0317 -0.0165 0.0198  324 GLY A N     
1454 C CA    . GLY A 196 ? 0.1915 0.1851 0.1115 -0.0326 -0.0270 0.0235  324 GLY A CA    
1455 C C     . GLY A 196 ? 0.1872 0.1824 0.1273 -0.0317 -0.0342 0.0236  324 GLY A C     
1456 O O     . GLY A 196 ? 0.1680 0.1636 0.1092 -0.0318 -0.0444 0.0270  324 GLY A O     
1457 N N     . LYS A 197 ? 0.1275 0.1237 0.0840 -0.0305 -0.0293 0.0203  325 LYS A N     
1458 C CA    . LYS A 197 ? 0.1198 0.1175 0.0983 -0.0301 -0.0347 0.0197  325 LYS A CA    
1459 C C     . LYS A 197 ? 0.1983 0.1978 0.1737 -0.0320 -0.0454 0.0141  325 LYS A C     
1460 O O     . LYS A 197 ? 0.1930 0.1921 0.1536 -0.0335 -0.0448 0.0080  325 LYS A O     
1461 C CB    . LYS A 197 ? 0.1449 0.1423 0.1392 -0.0287 -0.0254 0.0176  325 LYS A CB    
1462 C CG    . LYS A 197 ? 0.1410 0.1378 0.1407 -0.0267 -0.0159 0.0222  325 LYS A CG    
1463 C CD    . LYS A 197 ? 0.1511 0.1473 0.1654 -0.0250 -0.0073 0.0212  325 LYS A CD    
1464 C CE    . LYS A 197 ? 0.2219 0.2186 0.2611 -0.0254 -0.0101 0.0216  325 LYS A CE    
1465 N NZ    . LYS A 197 ? 0.2433 0.2385 0.2959 -0.0238 0.0005  0.0221  325 LYS A NZ    
1466 N N     . LEU A 198 ? 0.1359 0.1379 0.1262 -0.0319 -0.0554 0.0151  326 LEU A N     
1467 C CA    . LEU A 198 ? 0.1528 0.1579 0.1437 -0.0337 -0.0670 0.0084  326 LEU A CA    
1468 C C     . LEU A 198 ? 0.2347 0.2411 0.2496 -0.0346 -0.0647 0.0012  326 LEU A C     
1469 O O     . LEU A 198 ? 0.2054 0.2142 0.2220 -0.0367 -0.0724 -0.0072 326 LEU A O     
1470 C CB    . LEU A 198 ? 0.2582 0.2667 0.2547 -0.0329 -0.0809 0.0130  326 LEU A CB    
1471 C CG    . LEU A 198 ? 0.2936 0.2997 0.2669 -0.0318 -0.0832 0.0218  326 LEU A CG    
1472 C CD1   . LEU A 198 ? 0.3509 0.3602 0.3287 -0.0303 -0.0982 0.0263  326 LEU A CD1   
1473 C CD2   . LEU A 198 ? 0.3768 0.3808 0.3180 -0.0336 -0.0811 0.0185  326 LEU A CD2   
1474 N N     . GLN A 199 ? 0.2036 0.2079 0.2362 -0.0331 -0.0537 0.0040  327 GLN A N     
1475 C CA    . GLN A 199 ? 0.1883 0.1921 0.2439 -0.0337 -0.0486 -0.0009 327 GLN A CA    
1476 C C     . GLN A 199 ? 0.2196 0.2189 0.2740 -0.0318 -0.0332 0.0021  327 GLN A C     
1477 O O     . GLN A 199 ? 0.1971 0.1952 0.2371 -0.0301 -0.0274 0.0075  327 GLN A O     
1478 C CB    . GLN A 199 ? 0.2267 0.2333 0.3123 -0.0334 -0.0518 0.0011  327 GLN A CB    
1479 C CG    . GLN A 199 ? 0.3423 0.3545 0.4375 -0.0348 -0.0676 -0.0028 327 GLN A CG    
1480 C CD    . GLN A 199 ? 0.3610 0.3763 0.4915 -0.0342 -0.0683 -0.0009 327 GLN A CD    
1481 O OE1   . GLN A 199 ? 0.4092 0.4216 0.5534 -0.0328 -0.0555 0.0039  327 GLN A OE1   
1482 N NE2   . GLN A 199 ? 0.3822 0.4033 0.5263 -0.0348 -0.0816 -0.0056 327 GLN A NE2   
1483 N N     . GLY A 200 ? 0.1389 0.1359 0.2087 -0.0321 -0.0266 -0.0014 328 GLY A N     
1484 C CA    . GLY A 200 ? 0.1071 0.0999 0.1763 -0.0295 -0.0126 0.0030  328 GLY A CA    
1485 C C     . GLY A 200 ? 0.1683 0.1578 0.2607 -0.0296 -0.0055 0.0014  328 GLY A C     
1486 O O     . GLY A 200 ? 0.1770 0.1675 0.2874 -0.0323 -0.0110 -0.0049 328 GLY A O     
1487 N N     . HIS A 201 ? 0.0957 0.0814 0.1880 -0.0267 0.0071  0.0073  329 HIS A N     
1488 C CA    . HIS A 201 ? 0.1293 0.1101 0.2407 -0.0262 0.0165  0.0080  329 HIS A CA    
1489 C C     . HIS A 201 ? 0.1151 0.0917 0.2191 -0.0254 0.0194  0.0049  329 HIS A C     
1490 O O     . HIS A 201 ? 0.1303 0.1019 0.2523 -0.0255 0.0257  0.0043  329 HIS A O     
1491 C CB    . HIS A 201 ? 0.1373 0.1160 0.2491 -0.0223 0.0288  0.0165  329 HIS A CB    
1492 C CG    . HIS A 201 ? 0.1391 0.1137 0.2351 -0.0182 0.0380  0.0211  329 HIS A CG    
1493 N ND1   . HIS A 201 ? 0.2151 0.1912 0.2877 -0.0166 0.0376  0.0228  329 HIS A ND1   
1494 C CD2   . HIS A 201 ? 0.1637 0.1346 0.2624 -0.0138 0.0464  0.0239  329 HIS A CD2   
1495 C CE1   . HIS A 201 ? 0.1609 0.1334 0.2256 -0.0125 0.0457  0.0273  329 HIS A CE1   
1496 N NE2   . HIS A 201 ? 0.2005 0.1699 0.2796 -0.0103 0.0504  0.0280  329 HIS A NE2   
1497 N N     . ASP A 202 ? 0.1020 0.0803 0.1823 -0.0246 0.0155  0.0027  330 ASP A N     
1498 C CA    . ASP A 202 ? 0.1726 0.1477 0.2465 -0.0237 0.0179  -0.0012 330 ASP A CA    
1499 C C     . ASP A 202 ? 0.1575 0.1366 0.2081 -0.0247 0.0103  -0.0063 330 ASP A C     
1500 O O     . ASP A 202 ? 0.1482 0.1317 0.1881 -0.0262 0.0036  -0.0059 330 ASP A O     
1501 C CB    . ASP A 202 ? 0.1403 0.1109 0.2103 -0.0186 0.0296  0.0069  330 ASP A CB    
1502 C CG    . ASP A 202 ? 0.1689 0.1432 0.2160 -0.0154 0.0309  0.0120  330 ASP A CG    
1503 O OD1   . ASP A 202 ? 0.1223 0.1016 0.1573 -0.0174 0.0240  0.0097  330 ASP A OD1   
1504 O OD2   . ASP A 202 ? 0.1523 0.1246 0.1938 -0.0108 0.0388  0.0184  330 ASP A OD2   
1505 N N     . VAL A 203 ? 0.1239 0.1010 0.1679 -0.0239 0.0124  -0.0109 331 VAL A N     
1506 C CA    . VAL A 203 ? 0.1140 0.0943 0.1360 -0.0245 0.0087  -0.0153 331 VAL A CA    
1507 C C     . VAL A 203 ? 0.1366 0.1155 0.1506 -0.0198 0.0169  -0.0113 331 VAL A C     
1508 O O     . VAL A 203 ? 0.1294 0.1037 0.1549 -0.0171 0.0231  -0.0103 331 VAL A O     
1509 C CB    . VAL A 203 ? 0.1815 0.1619 0.2035 -0.0283 0.0028  -0.0272 331 VAL A CB    
1510 C CG1   . VAL A 203 ? 0.1336 0.1175 0.1309 -0.0294 -0.0004 -0.0312 331 VAL A CG1   
1511 C CG2   . VAL A 203 ? 0.1279 0.1102 0.1625 -0.0323 -0.0061 -0.0317 331 VAL A CG2   
1512 N N     . ASP A 204 ? 0.1077 0.0908 0.1035 -0.0187 0.0167  -0.0088 332 ASP A N     
1513 C CA    . ASP A 204 ? 0.1600 0.1441 0.1482 -0.0140 0.0228  -0.0052 332 ASP A CA    
1514 C C     . ASP A 204 ? 0.1773 0.1642 0.1525 -0.0150 0.0215  -0.0122 332 ASP A C     
1515 O O     . ASP A 204 ? 0.1182 0.1080 0.0810 -0.0186 0.0170  -0.0155 332 ASP A O     
1516 C CB    . ASP A 204 ? 0.1048 0.0923 0.0853 -0.0120 0.0245  0.0022  332 ASP A CB    
1517 C CG    . ASP A 204 ? 0.1530 0.1382 0.1455 -0.0117 0.0265  0.0083  332 ASP A CG    
1518 O OD1   . ASP A 204 ? 0.1571 0.1383 0.1595 -0.0085 0.0326  0.0129  332 ASP A OD1   
1519 O OD2   . ASP A 204 ? 0.1400 0.1270 0.1327 -0.0145 0.0225  0.0088  332 ASP A OD2   
1520 N N     . PHE A 205 ? 0.1243 0.1099 0.1030 -0.0117 0.0260  -0.0141 333 PHE A N     
1521 C CA    . PHE A 205 ? 0.1139 0.1023 0.0834 -0.0123 0.0264  -0.0214 333 PHE A CA    
1522 C C     . PHE A 205 ? 0.1522 0.1440 0.1202 -0.0067 0.0309  -0.0177 333 PHE A C     
1523 O O     . PHE A 205 ? 0.1218 0.1117 0.0981 -0.0015 0.0341  -0.0108 333 PHE A O     
1524 C CB    . PHE A 205 ? 0.1404 0.1248 0.1189 -0.0140 0.0270  -0.0306 333 PHE A CB    
1525 C CG    . PHE A 205 ? 0.1931 0.1761 0.1716 -0.0199 0.0210  -0.0372 333 PHE A CG    
1526 C CD1   . PHE A 205 ? 0.1738 0.1604 0.1347 -0.0243 0.0162  -0.0421 333 PHE A CD1   
1527 C CD2   . PHE A 205 ? 0.1862 0.1645 0.1827 -0.0208 0.0202  -0.0387 333 PHE A CD2   
1528 C CE1   . PHE A 205 ? 0.1601 0.1463 0.1194 -0.0291 0.0091  -0.0480 333 PHE A CE1   
1529 C CE2   . PHE A 205 ? 0.2416 0.2200 0.2395 -0.0261 0.0132  -0.0460 333 PHE A CE2   
1530 C CZ    . PHE A 205 ? 0.1807 0.1635 0.1589 -0.0299 0.0069  -0.0507 333 PHE A CZ    
1531 N N     . LEU A 206 ? 0.1237 0.1207 0.0811 -0.0077 0.0312  -0.0224 334 LEU A N     
1532 C CA    . LEU A 206 ? 0.1371 0.1391 0.0946 -0.0028 0.0343  -0.0213 334 LEU A CA    
1533 C C     . LEU A 206 ? 0.1137 0.1164 0.0736 -0.0035 0.0370  -0.0307 334 LEU A C     
1534 O O     . LEU A 206 ? 0.1683 0.1714 0.1201 -0.0086 0.0359  -0.0373 334 LEU A O     
1535 C CB    . LEU A 206 ? 0.1017 0.1103 0.0497 -0.0029 0.0321  -0.0183 334 LEU A CB    
1536 C CG    . LEU A 206 ? 0.1775 0.1917 0.1279 0.0023  0.0323  -0.0174 334 LEU A CG    
1537 C CD1   . LEU A 206 ? 0.1266 0.1433 0.0816 0.0084  0.0356  -0.0130 334 LEU A CD1   
1538 C CD2   . LEU A 206 ? 0.1615 0.1748 0.1091 0.0022  0.0278  -0.0134 334 LEU A CD2   
1539 N N     . ILE A 207 ? 0.1151 0.1177 0.0870 0.0023  0.0399  -0.0302 335 ILE A N     
1540 C CA    . ILE A 207 ? 0.1213 0.1237 0.1005 0.0025  0.0435  -0.0393 335 ILE A CA    
1541 C C     . ILE A 207 ? 0.1410 0.1513 0.1235 0.0076  0.0452  -0.0392 335 ILE A C     
1542 O O     . ILE A 207 ? 0.1365 0.1497 0.1224 0.0137  0.0436  -0.0308 335 ILE A O     
1543 C CB    . ILE A 207 ? 0.1801 0.1745 0.1765 0.0052  0.0456  -0.0397 335 ILE A CB    
1544 C CG1   . ILE A 207 ? 0.1456 0.1335 0.1417 -0.0004 0.0433  -0.0419 335 ILE A CG1   
1545 C CG2   . ILE A 207 ? 0.2067 0.2008 0.2133 0.0061  0.0501  -0.0497 335 ILE A CG2   
1546 C CD1   . ILE A 207 ? 0.1905 0.1699 0.2058 0.0022  0.0455  -0.0396 335 ILE A CD1   
1547 N N     . THR A 208 ? 0.1219 0.1356 0.1037 0.0051  0.0474  -0.0476 336 THR A N     
1548 C CA    . THR A 208 ? 0.1391 0.1604 0.1278 0.0096  0.0482  -0.0481 336 THR A CA    
1549 C C     . THR A 208 ? 0.1738 0.1940 0.1688 0.0074  0.0508  -0.0562 336 THR A C     
1550 O O     . THR A 208 ? 0.1593 0.1736 0.1527 0.0029  0.0518  -0.0612 336 THR A O     
1551 C CB    . THR A 208 ? 0.1668 0.1932 0.1454 0.0081  0.0437  -0.0428 336 THR A CB    
1552 O OG1   . THR A 208 ? 0.1645 0.1993 0.1524 0.0128  0.0446  -0.0442 336 THR A OG1   
1553 C CG2   . THR A 208 ? 0.1942 0.2172 0.1636 0.0013  0.0416  -0.0438 336 THR A CG2   
1554 N N     . HIS A 209 ? 0.1717 0.1986 0.1746 0.0103  0.0520  -0.0579 337 HIS A N     
1555 C CA    . HIS A 209 ? 0.1820 0.2090 0.1919 0.0082  0.0554  -0.0653 337 HIS A CA    
1556 C C     . HIS A 209 ? 0.2056 0.2402 0.2157 0.0075  0.0550  -0.0651 337 HIS A C     
1557 O O     . HIS A 209 ? 0.1698 0.2112 0.1840 0.0121  0.0528  -0.0615 337 HIS A O     
1558 C CB    . HIS A 209 ? 0.1402 0.1663 0.1709 0.0144  0.0592  -0.0693 337 HIS A CB    
1559 C CG    . HIS A 209 ? 0.1771 0.2024 0.2153 0.0113  0.0632  -0.0777 337 HIS A CG    
1560 N ND1   . HIS A 209 ? 0.2053 0.2376 0.2505 0.0118  0.0649  -0.0806 337 HIS A ND1   
1561 C CD2   . HIS A 209 ? 0.1599 0.1789 0.2005 0.0074  0.0663  -0.0844 337 HIS A CD2   
1562 C CE1   . HIS A 209 ? 0.1917 0.2215 0.2427 0.0083  0.0695  -0.0883 337 HIS A CE1   
1563 N NE2   . HIS A 209 ? 0.1675 0.1896 0.2152 0.0057  0.0702  -0.0909 337 HIS A NE2   
1564 N N     . PRO A 210 ? 0.1964 0.2304 0.2029 0.0020  0.0574  -0.0693 338 PRO A N     
1565 C CA    . PRO A 210 ? 0.2329 0.2729 0.2401 0.0003  0.0578  -0.0691 338 PRO A CA    
1566 C C     . PRO A 210 ? 0.2643 0.3133 0.2903 0.0056  0.0594  -0.0729 338 PRO A C     
1567 O O     . PRO A 210 ? 0.2637 0.3193 0.2927 0.0051  0.0587  -0.0728 338 PRO A O     
1568 C CB    . PRO A 210 ? 0.2187 0.2552 0.2187 -0.0062 0.0616  -0.0730 338 PRO A CB    
1569 C CG    . PRO A 210 ? 0.2393 0.2703 0.2398 -0.0070 0.0638  -0.0779 338 PRO A CG    
1570 C CD    . PRO A 210 ? 0.1618 0.1896 0.1614 -0.0036 0.0598  -0.0740 338 PRO A CD    
1571 N N     A LYS A 211 ? 0.1790 0.2284 0.2199 0.0110  0.0613  -0.0763 339 LYS A N     
1572 N N     B LYS A 211 ? 0.1944 0.2438 0.2353 0.0110  0.0614  -0.0764 339 LYS A N     
1573 C CA    A LYS A 211 ? 0.1859 0.2442 0.2479 0.0178  0.0616  -0.0790 339 LYS A CA    
1574 C CA    B LYS A 211 ? 0.1964 0.2548 0.2583 0.0178  0.0616  -0.0790 339 LYS A CA    
1575 C C     A LYS A 211 ? 0.2204 0.2835 0.2884 0.0271  0.0566  -0.0727 339 LYS A C     
1576 C C     B LYS A 211 ? 0.2032 0.2661 0.2708 0.0270  0.0565  -0.0726 339 LYS A C     
1577 O O     A LYS A 211 ? 0.1704 0.2280 0.2422 0.0318  0.0566  -0.0698 339 LYS A O     
1578 O O     B LYS A 211 ? 0.1783 0.2357 0.2492 0.0315  0.0565  -0.0697 339 LYS A O     
1579 C CB    A LYS A 211 ? 0.2439 0.2995 0.3215 0.0191  0.0664  -0.0855 339 LYS A CB    
1580 C CB    B LYS A 211 ? 0.2314 0.2871 0.3090 0.0192  0.0663  -0.0855 339 LYS A CB    
1581 C CG    A LYS A 211 ? 0.2450 0.3096 0.3467 0.0264  0.0661  -0.0879 339 LYS A CG    
1582 C CG    B LYS A 211 ? 0.1946 0.2472 0.2671 0.0106  0.0720  -0.0924 339 LYS A CG    
1583 N N     . GLU A 212 ? 0.1500 0.2234 0.2197 0.0297  0.0522  -0.0705 340 GLU A N     
1584 C CA    . GLU A 212 ? 0.1198 0.2005 0.1936 0.0390  0.0462  -0.0644 340 GLU A CA    
1585 C C     . GLU A 212 ? 0.1933 0.2742 0.2866 0.0498  0.0453  -0.0618 340 GLU A C     
1586 O O     . GLU A 212 ? 0.1919 0.2754 0.3027 0.0525  0.0465  -0.0655 340 GLU A O     
1587 C CB    . GLU A 212 ? 0.1746 0.2694 0.2527 0.0408  0.0407  -0.0655 340 GLU A CB    
1588 C CG    . GLU A 212 ? 0.1927 0.2980 0.2709 0.0509  0.0320  -0.0590 340 GLU A CG    
1589 C CD    . GLU A 212 ? 0.2195 0.3222 0.2752 0.0469  0.0304  -0.0543 340 GLU A CD    
1590 O OE1   . GLU A 212 ? 0.1772 0.2692 0.2194 0.0360  0.0351  -0.0556 340 GLU A OE1   
1591 O OE2   . GLU A 212 ? 0.1925 0.2990 0.2413 0.0532  0.0228  -0.0462 340 GLU A OE2   
1592 N N     . GLY A 213 ? 0.1794 0.2561 0.2698 0.0559  0.0430  -0.0541 341 GLY A N     
1593 C CA    . GLY A 213 ? 0.2209 0.2929 0.3263 0.0657  0.0407  -0.0461 341 GLY A CA    
1594 C C     . GLY A 213 ? 0.1660 0.2232 0.2776 0.0633  0.0481  -0.0482 341 GLY A C     
1595 O O     . GLY A 213 ? 0.1774 0.2260 0.2961 0.0698  0.0468  -0.0385 341 GLY A O     
1596 N N     . GLN A 214 ? 0.1765 0.2284 0.2807 0.0526  0.0541  -0.0582 342 GLN A N     
1597 C CA    . GLN A 214 ? 0.1927 0.2313 0.3000 0.0488  0.0591  -0.0613 342 GLN A CA    
1598 C C     . GLN A 214 ? 0.1578 0.1867 0.2571 0.0484  0.0594  -0.0552 342 GLN A C     
1599 O O     . GLN A 214 ? 0.1984 0.2162 0.3064 0.0484  0.0622  -0.0548 342 GLN A O     
1600 C CB    . GLN A 214 ? 0.1899 0.2262 0.2868 0.0373  0.0634  -0.0721 342 GLN A CB    
1601 C CG    . GLN A 214 ? 0.2089 0.2508 0.3191 0.0370  0.0658  -0.0789 342 GLN A CG    
1602 C CD    . GLN A 214 ? 0.3203 0.3578 0.4536 0.0430  0.0678  -0.0796 342 GLN A CD    
1603 O OE1   . GLN A 214 ? 0.2933 0.3215 0.4293 0.0389  0.0719  -0.0844 342 GLN A OE1   
1604 N NE2   . GLN A 214 ? 0.2515 0.2960 0.4022 0.0529  0.0641  -0.0744 342 GLN A NE2   
1605 N N     . GLU A 215 ? 0.2386 0.2703 0.3195 0.0466  0.0553  -0.0489 343 GLU A N     
1606 C CA    . GLU A 215 ? 0.2597 0.2813 0.3292 0.0445  0.0538  -0.0405 343 GLU A CA    
1607 C C     . GLU A 215 ? 0.1771 0.1934 0.2554 0.0541  0.0511  -0.0262 343 GLU A C     
1608 O O     . GLU A 215 ? 0.1704 0.1771 0.2442 0.0529  0.0517  -0.0191 343 GLU A O     
1609 C CB    . GLU A 215 ? 0.2742 0.3003 0.3209 0.0391  0.0499  -0.0376 343 GLU A CB    
1610 C CG    . GLU A 215 ? 0.1466 0.1805 0.1872 0.0456  0.0434  -0.0270 343 GLU A CG    
1611 C CD    . GLU A 215 ? 0.2245 0.2712 0.2751 0.0511  0.0409  -0.0303 343 GLU A CD    
1612 O OE1   . GLU A 215 ? 0.2138 0.2654 0.2713 0.0472  0.0448  -0.0420 343 GLU A OE1   
1613 O OE2   . GLU A 215 ? 0.2346 0.2870 0.2864 0.0594  0.0349  -0.0214 343 GLU A OE2   
1614 N N     . ALA A 216 ? 0.1860 0.2086 0.2768 0.0636  0.0482  -0.0213 344 ALA A N     
1615 C CA    . ALA A 216 ? 0.2177 0.2349 0.3153 0.0736  0.0457  -0.0061 344 ALA A CA    
1616 C C     . ALA A 216 ? 0.2551 0.2569 0.3682 0.0736  0.0524  -0.0048 344 ALA A C     
1617 O O     . ALA A 216 ? 0.2103 0.2089 0.3395 0.0709  0.0578  -0.0164 344 ALA A O     
1618 C CB    . ALA A 216 ? 0.2002 0.2273 0.3117 0.0842  0.0410  -0.0027 344 ALA A CB    
1619 N N     . GLY A 217 ? 0.2574 0.2497 0.3664 0.0763  0.0527  0.0085  345 GLY A N     
1620 C CA    . GLY A 217 ? 0.2811 0.2581 0.4070 0.0763  0.0594  0.0108  345 GLY A CA    
1621 C C     . GLY A 217 ? 0.2094 0.1801 0.3354 0.0649  0.0641  -0.0026 345 GLY A C     
1622 O O     . GLY A 217 ? 0.1814 0.1420 0.3216 0.0618  0.0680  -0.0051 345 GLY A O     
1623 N N     . LEU A 218 ? 0.1630 0.1408 0.2694 0.0563  0.0614  -0.0107 346 LEU A N     
1624 C CA    . LEU A 218 ? 0.1709 0.1447 0.2757 0.0459  0.0644  -0.0246 346 LEU A CA    
1625 C C     . LEU A 218 ? 0.1984 0.1617 0.3034 0.0421  0.0658  -0.0197 346 LEU A C     
1626 O O     . LEU A 218 ? 0.2026 0.1582 0.3192 0.0369  0.0695  -0.0290 346 LEU A O     
1627 C CB    . LEU A 218 ? 0.2223 0.2065 0.3057 0.0388  0.0610  -0.0330 346 LEU A CB    
1628 C CG    . LEU A 218 ? 0.2327 0.2142 0.3076 0.0281  0.0622  -0.0456 346 LEU A CG    
1629 C CD1   . LEU A 218 ? 0.2075 0.1835 0.2992 0.0259  0.0679  -0.0591 346 LEU A CD1   
1630 C CD2   . LEU A 218 ? 0.2235 0.2149 0.2778 0.0228  0.0596  -0.0512 346 LEU A CD2   
1631 N N     . LEU A 219 ? 0.1786 0.1417 0.2720 0.0444  0.0633  -0.0062 347 LEU A N     
1632 C CA    . LEU A 219 ? 0.1947 0.1502 0.2866 0.0389  0.0645  -0.0038 347 LEU A CA    
1633 C C     . LEU A 219 ? 0.2298 0.1719 0.3459 0.0407  0.0709  -0.0009 347 LEU A C     
1634 O O     . LEU A 219 ? 0.1852 0.1214 0.3089 0.0337  0.0726  -0.0082 347 LEU A O     
1635 C CB    . LEU A 219 ? 0.2258 0.1843 0.3008 0.0409  0.0617  0.0094  347 LEU A CB    
1636 C CG    . LEU A 219 ? 0.2717 0.2259 0.3423 0.0339  0.0619  0.0097  347 LEU A CG    
1637 C CD1   . LEU A 219 ? 0.2451 0.2030 0.3100 0.0242  0.0585  -0.0055 347 LEU A CD1   
1638 C CD2   . LEU A 219 ? 0.2956 0.2544 0.3486 0.0358  0.0597  0.0208  347 LEU A CD2   
1639 N N     . PRO A 220 ? 0.2384 0.1760 0.3673 0.0494  0.0738  0.0097  348 PRO A N     
1640 C CA    . PRO A 220 ? 0.2566 0.1850 0.4050 0.0471  0.0779  0.0116  348 PRO A CA    
1641 C C     . PRO A 220 ? 0.2485 0.1758 0.4110 0.0398  0.0793  -0.0061 348 PRO A C     
1642 O O     . PRO A 220 ? 0.2036 0.1253 0.3799 0.0340  0.0822  -0.0099 348 PRO A O     
1643 C CB    . PRO A 220 ? 0.2421 0.1702 0.3957 0.0564  0.0781  0.0247  348 PRO A CB    
1644 C CG    . PRO A 220 ? 0.2990 0.2349 0.4325 0.0634  0.0734  0.0341  348 PRO A CG    
1645 C CD    . PRO A 220 ? 0.2599 0.2036 0.3819 0.0594  0.0709  0.0214  348 PRO A CD    
1646 N N     . ARG A 221 ? 0.2371 0.1713 0.3963 0.0397  0.0774  -0.0177 349 ARG A N     
1647 C CA    . ARG A 221 ? 0.1999 0.1345 0.3684 0.0323  0.0787  -0.0352 349 ARG A CA    
1648 C C     . ARG A 221 ? 0.1896 0.1247 0.3489 0.0229  0.0769  -0.0469 349 ARG A C     
1649 O O     . ARG A 221 ? 0.1961 0.1293 0.3657 0.0162  0.0778  -0.0580 349 ARG A O     
1650 C CB    . ARG A 221 ? 0.1932 0.1362 0.3577 0.0341  0.0777  -0.0437 349 ARG A CB    
1651 C CG    . ARG A 221 ? 0.2004 0.1433 0.3778 0.0432  0.0785  -0.0342 349 ARG A CG    
1652 C CD    . ARG A 221 ? 0.2494 0.2023 0.4235 0.0454  0.0769  -0.0416 349 ARG A CD    
1653 N NE    . ARG A 221 ? 0.1997 0.1555 0.3730 0.0365  0.0790  -0.0597 349 ARG A NE    
1654 C CZ    . ARG A 221 ? 0.3711 0.3231 0.5616 0.0333  0.0829  -0.0680 349 ARG A CZ    
1655 N NH1   . ARG A 221 ? 0.2205 0.1651 0.4319 0.0379  0.0854  -0.0599 349 ARG A NH1   
1656 N NH2   . ARG A 221 ? 0.2138 0.1698 0.4000 0.0253  0.0845  -0.0839 349 ARG A NH2   
1657 N N     . VAL A 222 ? 0.2231 0.1618 0.3630 0.0224  0.0738  -0.0449 350 VAL A N     
1658 C CA    . VAL A 222 ? 0.1996 0.1384 0.3297 0.0139  0.0709  -0.0544 350 VAL A CA    
1659 C C     . VAL A 222 ? 0.2270 0.1583 0.3715 0.0115  0.0718  -0.0490 350 VAL A C     
1660 O O     . VAL A 222 ? 0.2197 0.1507 0.3708 0.0041  0.0701  -0.0599 350 VAL A O     
1661 C CB    . VAL A 222 ? 0.1916 0.1400 0.2940 0.0125  0.0647  -0.0489 350 VAL A CB    
1662 C CG1   . VAL A 222 ? 0.1799 0.1296 0.2717 0.0040  0.0595  -0.0547 350 VAL A CG1   
1663 C CG2   . VAL A 222 ? 0.1797 0.1375 0.2685 0.0128  0.0637  -0.0556 350 VAL A CG2   
1664 N N     . MET A 223 ? 0.2039 0.1307 0.3526 0.0175  0.0744  -0.0317 351 MET A N     
1665 C CA    . MET A 223 ? 0.1820 0.1037 0.3421 0.0144  0.0761  -0.0256 351 MET A CA    
1666 C C     . MET A 223 ? 0.2603 0.1793 0.4443 0.0115  0.0795  -0.0311 351 MET A C     
1667 O O     . MET A 223 ? 0.2598 0.1787 0.4554 0.0054  0.0792  -0.0369 351 MET A O     
1668 C CB    . MET A 223 ? 0.2046 0.1236 0.3606 0.0211  0.0790  -0.0054 351 MET A CB    
1669 C CG    . MET A 223 ? 0.2313 0.1537 0.3650 0.0237  0.0761  0.0013  351 MET A CG    
1670 S SD    . MET A 223 ? 0.2982 0.2273 0.4199 0.0129  0.0687  -0.0105 351 MET A SD    
1671 C CE    . MET A 223 ? 0.3504 0.2703 0.4976 0.0097  0.0741  -0.0071 351 MET A CE    
1672 N N     A CYS A 224 ? 0.2496 0.1676 0.4426 0.0158  0.0826  -0.0301 352 CYS A N     
1673 N N     B CYS A 224 ? 0.2686 0.1864 0.4622 0.0158  0.0828  -0.0299 352 CYS A N     
1674 C CA    A CYS A 224 ? 0.3109 0.2262 0.5285 0.0135  0.0870  -0.0349 352 CYS A CA    
1675 C CA    B CYS A 224 ? 0.3109 0.2261 0.5294 0.0129  0.0871  -0.0349 352 CYS A CA    
1676 C C     A CYS A 224 ? 0.2987 0.2183 0.5203 0.0052  0.0842  -0.0556 352 CYS A C     
1677 C C     B CYS A 224 ? 0.2977 0.2173 0.5199 0.0051  0.0843  -0.0559 352 CYS A C     
1678 O O     A CYS A 224 ? 0.3217 0.2409 0.5622 0.0007  0.0862  -0.0616 352 CYS A O     
1679 O O     B CYS A 224 ? 0.3203 0.2395 0.5626 0.0009  0.0867  -0.0627 352 CYS A O     
1680 C CB    A CYS A 224 ? 0.3635 0.2766 0.5897 0.0204  0.0906  -0.0289 352 CYS A CB    
1681 C CB    B CYS A 224 ? 0.3773 0.2892 0.6069 0.0198  0.0915  -0.0268 352 CYS A CB    
1682 S SG    A CYS A 224 ? 0.4914 0.3986 0.7207 0.0292  0.0952  -0.0036 352 CYS A SG    
1683 S SG    B CYS A 224 ? 0.3871 0.3039 0.6113 0.0217  0.0894  -0.0379 352 CYS A SG    
1684 N N     . ARG A 225 ? 0.2358 0.1610 0.4386 0.0031  0.0796  -0.0664 353 ARG A N     
1685 C CA    . ARG A 225 ? 0.2300 0.1608 0.4303 -0.0047 0.0760  -0.0852 353 ARG A CA    
1686 C C     . ARG A 225 ? 0.2958 0.2284 0.4917 -0.0106 0.0706  -0.0892 353 ARG A C     
1687 O O     . ARG A 225 ? 0.3086 0.2441 0.5143 -0.0159 0.0687  -0.1007 353 ARG A O     
1688 C CB    . ARG A 225 ? 0.2695 0.2065 0.4477 -0.0052 0.0732  -0.0935 353 ARG A CB    
1689 C CG    . ARG A 225 ? 0.3484 0.2852 0.5377 -0.0009 0.0785  -0.0939 353 ARG A CG    
1690 C CD    . ARG A 225 ? 0.3686 0.3121 0.5394 0.0007  0.0775  -0.0978 353 ARG A CD    
1691 N NE    . ARG A 225 ? 0.3144 0.2577 0.5022 0.0036  0.0825  -0.1003 353 ARG A NE    
1692 C CZ    . ARG A 225 ? 0.3443 0.2829 0.5475 0.0113  0.0857  -0.0883 353 ARG A CZ    
1693 N NH1   . ARG A 225 ? 0.3341 0.2686 0.5354 0.0174  0.0847  -0.0722 353 ARG A NH1   
1694 N NH2   . ARG A 225 ? 0.2895 0.2279 0.5101 0.0131  0.0899  -0.0921 353 ARG A NH2   
1695 N N     . LEU A 226 ? 0.2336 0.1654 0.4149 -0.0094 0.0676  -0.0803 354 LEU A N     
1696 C CA    . LEU A 226 ? 0.2232 0.1566 0.4031 -0.0145 0.0623  -0.0824 354 LEU A CA    
1697 C C     . LEU A 226 ? 0.2274 0.1581 0.4346 -0.0149 0.0664  -0.0784 354 LEU A C     
1698 O O     . LEU A 226 ? 0.2759 0.2105 0.4917 -0.0202 0.0623  -0.0878 354 LEU A O     
1699 C CB    . LEU A 226 ? 0.2183 0.1504 0.3811 -0.0125 0.0600  -0.0714 354 LEU A CB    
1700 C CG    . LEU A 226 ? 0.2152 0.1517 0.3506 -0.0134 0.0556  -0.0768 354 LEU A CG    
1701 C CD1   . LEU A 226 ? 0.1952 0.1333 0.3153 -0.0100 0.0543  -0.0620 354 LEU A CD1   
1702 C CD2   . LEU A 226 ? 0.2131 0.1572 0.3360 -0.0213 0.0468  -0.0912 354 LEU A CD2   
1703 N N     . GLN A 227 ? 0.2035 0.1284 0.4237 -0.0091 0.0743  -0.0638 355 GLN A N     
1704 C CA    . GLN A 227 ? 0.3518 0.2745 0.5979 -0.0095 0.0799  -0.0589 355 GLN A CA    
1705 C C     . GLN A 227 ? 0.3376 0.2627 0.6039 -0.0133 0.0811  -0.0737 355 GLN A C     
1706 O O     . GLN A 227 ? 0.2829 0.2106 0.5668 -0.0172 0.0809  -0.0799 355 GLN A O     
1707 C CB    . GLN A 227 ? 0.3322 0.2488 0.5846 -0.0025 0.0882  -0.0400 355 GLN A CB    
1708 N N     . ASP A 228 ? 0.3903 0.3157 0.6537 -0.0126 0.0818  -0.0813 356 ASP A N     
1709 C CA    . ASP A 228 ? 0.4726 0.4009 0.7548 -0.0163 0.0834  -0.0964 356 ASP A CA    
1710 C C     . ASP A 228 ? 0.4363 0.3720 0.7115 -0.0230 0.0752  -0.1133 356 ASP A C     
1711 O O     . ASP A 228 ? 0.4344 0.3729 0.7292 -0.0265 0.0760  -0.1243 356 ASP A O     
1712 C CB    . ASP A 228 ? 0.5448 0.4728 0.8237 -0.0142 0.0860  -0.1012 356 ASP A CB    
1713 C CG    . ASP A 228 ? 0.6820 0.6029 0.9752 -0.0076 0.0939  -0.0864 356 ASP A CG    
1714 O OD1   . ASP A 228 ? 0.7389 0.6557 1.0511 -0.0063 0.0991  -0.0763 356 ASP A OD1   
1715 O OD2   . ASP A 228 ? 0.7253 0.6453 1.0105 -0.0035 0.0948  -0.0844 356 ASP A OD2   
1716 N N     . GLN A 229 ? 0.3311 0.2704 0.5774 -0.0247 0.0670  -0.1159 357 GLN A N     
1717 C CA    . GLN A 229 ? 0.3109 0.2572 0.5477 -0.0306 0.0579  -0.1297 357 GLN A CA    
1718 C C     . GLN A 229 ? 0.3224 0.2697 0.5720 -0.0325 0.0545  -0.1263 357 GLN A C     
1719 O O     . GLN A 229 ? 0.3049 0.2581 0.5451 -0.0368 0.0452  -0.1361 357 GLN A O     
1720 C CB    . GLN A 229 ? 0.3715 0.3216 0.5737 -0.0320 0.0503  -0.1323 357 GLN A CB    
1721 C CG    . GLN A 229 ? 0.4368 0.3895 0.6237 -0.0320 0.0518  -0.1402 357 GLN A CG    
1722 C CD    . GLN A 229 ? 0.4254 0.3816 0.5781 -0.0326 0.0459  -0.1387 357 GLN A CD    
1723 N N     . GLY A 230 ? 0.2698 0.2120 0.5386 -0.0291 0.0617  -0.1125 358 GLY A N     
1724 C CA    . GLY A 230 ? 0.2491 0.1929 0.5311 -0.0305 0.0601  -0.1088 358 GLY A CA    
1725 C C     . GLY A 230 ? 0.2933 0.2388 0.5548 -0.0312 0.0527  -0.1029 358 GLY A C     
1726 O O     . GLY A 230 ? 0.2602 0.2089 0.5309 -0.0331 0.0491  -0.1029 358 GLY A O     
1727 N N     . LEU A 231 ? 0.2449 0.1886 0.4805 -0.0295 0.0506  -0.0976 359 LEU A N     
1728 C CA    . LEU A 231 ? 0.2008 0.1470 0.4159 -0.0310 0.0427  -0.0940 359 LEU A CA    
1729 C C     . LEU A 231 ? 0.1973 0.1389 0.4130 -0.0270 0.0483  -0.0762 359 LEU A C     
1730 O O     . LEU A 231 ? 0.2491 0.1927 0.4514 -0.0281 0.0429  -0.0721 359 LEU A O     
1731 C CB    . LEU A 231 ? 0.2152 0.1636 0.4002 -0.0322 0.0370  -0.0999 359 LEU A CB    
1732 C CG    . LEU A 231 ? 0.3508 0.3056 0.5265 -0.0365 0.0302  -0.1168 359 LEU A CG    
1733 C CD1   . LEU A 231 ? 0.4052 0.3622 0.5504 -0.0366 0.0275  -0.1195 359 LEU A CD1   
1734 C CD2   . LEU A 231 ? 0.4113 0.3724 0.5869 -0.0410 0.0196  -0.1237 359 LEU A CD2   
1735 N N     . ILE A 232 ? 0.1915 0.1275 0.4211 -0.0221 0.0589  -0.0650 360 ILE A N     
1736 C CA    . ILE A 232 ? 0.2196 0.1518 0.4453 -0.0174 0.0650  -0.0470 360 ILE A CA    
1737 C C     . ILE A 232 ? 0.2412 0.1742 0.4905 -0.0171 0.0709  -0.0413 360 ILE A C     
1738 O O     . ILE A 232 ? 0.2150 0.1462 0.4854 -0.0161 0.0779  -0.0415 360 ILE A O     
1739 C CB    . ILE A 232 ? 0.2342 0.1605 0.4532 -0.0111 0.0722  -0.0365 360 ILE A CB    
1740 C CG1   . ILE A 232 ? 0.2209 0.1473 0.4193 -0.0110 0.0673  -0.0440 360 ILE A CG1   
1741 C CG2   . ILE A 232 ? 0.2233 0.1472 0.4338 -0.0059 0.0776  -0.0180 360 ILE A CG2   
1742 C CD1   . ILE A 232 ? 0.2618 0.1903 0.4368 -0.0127 0.0606  -0.0439 360 ILE A CD1   
1743 N N     . LEU A 233 ? 0.2141 0.1502 0.4611 -0.0180 0.0687  -0.0366 361 LEU A N     
1744 C CA    . LEU A 233 ? 0.2808 0.2179 0.5485 -0.0169 0.0756  -0.0301 361 LEU A CA    
1745 C C     . LEU A 233 ? 0.2865 0.2194 0.5483 -0.0108 0.0861  -0.0122 361 LEU A C     
1746 O O     . LEU A 233 ? 0.2842 0.2160 0.5642 -0.0087 0.0954  -0.0060 361 LEU A O     
1747 C CB    . LEU A 233 ? 0.1818 0.1249 0.4511 -0.0202 0.0685  -0.0341 361 LEU A CB    
1748 C CG    . LEU A 233 ? 0.2081 0.1567 0.4844 -0.0258 0.0572  -0.0517 361 LEU A CG    
1749 C CD1   . LEU A 233 ? 0.2250 0.1792 0.4945 -0.0285 0.0474  -0.0538 361 LEU A CD1   
1750 C CD2   . LEU A 233 ? 0.2144 0.1646 0.5216 -0.0269 0.0613  -0.0593 361 LEU A CD2   
1751 N N     . TYR A 234 ? 0.2634 0.1941 0.4996 -0.0076 0.0849  -0.0041 362 TYR A N     
1752 C CA    . TYR A 234 ? 0.2688 0.1962 0.4949 -0.0011 0.0935  0.0122  362 TYR A CA    
1753 C C     . TYR A 234 ? 0.2801 0.2054 0.4805 0.0023  0.0902  0.0166  362 TYR A C     
1754 O O     . TYR A 234 ? 0.1705 0.0977 0.3562 -0.0004 0.0823  0.0107  362 TYR A O     
1755 C CB    . TYR A 234 ? 0.2767 0.2070 0.4999 0.0002  0.0967  0.0200  362 TYR A CB    
1756 C CG    . TYR A 234 ? 0.2769 0.2050 0.4802 0.0071  0.1026  0.0349  362 TYR A CG    
1757 C CD1   . TYR A 234 ? 0.3609 0.2906 0.5382 0.0088  0.0975  0.0382  362 TYR A CD1   
1758 C CD2   . TYR A 234 ? 0.3352 0.2600 0.5456 0.0121  0.1131  0.0453  362 TYR A CD2   
1759 C CE1   . TYR A 234 ? 0.3324 0.2614 0.4907 0.0154  0.1017  0.0502  362 TYR A CE1   
1760 C CE2   . TYR A 234 ? 0.3241 0.2474 0.5141 0.0189  0.1173  0.0580  362 TYR A CE2   
1761 C CZ    . TYR A 234 ? 0.3883 0.3142 0.5522 0.0205  0.1111  0.0598  362 TYR A CZ    
1762 O OH    . TYR A 234 ? 0.4660 0.3916 0.6092 0.0273  0.1139  0.0708  362 TYR A OH    
1763 N N     . HIS A 235 ? 0.2971 0.2186 0.4926 0.0085  0.0962  0.0271  363 HIS A N     
1764 C CA    . HIS A 235 ? 0.2995 0.2202 0.4702 0.0137  0.0942  0.0346  363 HIS A CA    
1765 C C     . HIS A 235 ? 0.3538 0.2720 0.5219 0.0212  0.1019  0.0490  363 HIS A C     
1766 O O     . HIS A 235 ? 0.3931 0.3086 0.5796 0.0219  0.1089  0.0521  363 HIS A O     
1767 C CB    . HIS A 235 ? 0.3195 0.2387 0.4852 0.0128  0.0882  0.0249  363 HIS A CB    
1768 C CG    . HIS A 235 ? 0.4571 0.3726 0.6365 0.0152  0.0915  0.0236  363 HIS A CG    
1769 N ND1   . HIS A 235 ? 0.5355 0.4494 0.7050 0.0217  0.0916  0.0291  363 HIS A ND1   
1770 C CD2   . HIS A 235 ? 0.5385 0.4524 0.7420 0.0120  0.0947  0.0168  363 HIS A CD2   
1771 C CE1   . HIS A 235 ? 0.5403 0.4511 0.7274 0.0223  0.0947  0.0263  363 HIS A CE1   
1772 N NE2   . HIS A 235 ? 0.5591 0.4697 0.7668 0.0163  0.0971  0.0188  363 HIS A NE2   
1773 N N     . GLN A 236 ? 0.3299 0.2494 0.4751 0.0271  0.1001  0.0575  364 GLN A N     
1774 C CA    . GLN A 236 ? 0.4718 0.3902 0.6095 0.0349  0.1055  0.0714  364 GLN A CA    
1775 C C     . GLN A 236 ? 0.4584 0.3722 0.6068 0.0385  0.1073  0.0735  364 GLN A C     
1776 O O     . GLN A 236 ? 0.5782 0.4897 0.7261 0.0446  0.1123  0.0848  364 GLN A O     
1777 C CB    . GLN A 236 ? 0.4921 0.4153 0.6016 0.0401  0.1014  0.0779  364 GLN A CB    
1778 N N     . ALA A 256 ? 0.4481 0.3859 0.5486 0.0897  0.0693  0.0923  384 ALA A N     
1779 C CA    . ALA A 256 ? 0.4834 0.4312 0.5738 0.0891  0.0634  0.0825  384 ALA A CA    
1780 C C     . ALA A 256 ? 0.5106 0.4612 0.5804 0.0855  0.0636  0.0844  384 ALA A C     
1781 O O     . ALA A 256 ? 0.5297 0.4807 0.5850 0.0874  0.0644  0.0953  384 ALA A O     
1782 C CB    . ALA A 256 ? 0.4867 0.4456 0.5714 0.0981  0.0550  0.0849  384 ALA A CB    
1783 N N     . PHE A 257 ? 0.3719 0.3249 0.4407 0.0800  0.0632  0.0727  385 PHE A N     
1784 C CA    . PHE A 257 ? 0.2765 0.2319 0.3274 0.0764  0.0631  0.0733  385 PHE A CA    
1785 C C     . PHE A 257 ? 0.2934 0.2585 0.3398 0.0675  0.0583  0.0558  385 PHE A C     
1786 O O     . PHE A 257 ? 0.3438 0.3094 0.4033 0.0650  0.0583  0.0444  385 PHE A O     
1787 C CB    . PHE A 257 ? 0.2882 0.2336 0.3438 0.0693  0.0699  0.0763  385 PHE A CB    
1788 C CG    . PHE A 257 ? 0.4159 0.3528 0.4944 0.0627  0.0742  0.0664  385 PHE A CG    
1789 C CD1   . PHE A 257 ? 0.5132 0.4443 0.6102 0.0639  0.0775  0.0681  385 PHE A CD1   
1790 C CD2   . PHE A 257 ? 0.4654 0.4012 0.5463 0.0547  0.0742  0.0545  385 PHE A CD2   
1791 C CE1   . PHE A 257 ? 0.4752 0.4000 0.5928 0.0571  0.0810  0.0574  385 PHE A CE1   
1792 C CE2   . PHE A 257 ? 0.4502 0.3794 0.5510 0.0484  0.0770  0.0437  385 PHE A CE2   
1793 C CZ    . PHE A 257 ? 0.4661 0.3906 0.5851 0.0492  0.0803  0.0447  385 PHE A CZ    
1794 N N     . GLU A 258 ? 0.2411 0.2135 0.2685 0.0630  0.0551  0.0540  386 GLU A N     
1795 C CA    . GLU A 258 ? 0.2584 0.2398 0.2788 0.0552  0.0508  0.0398  386 GLU A CA    
1796 C C     . GLU A 258 ? 0.2775 0.2570 0.2898 0.0466  0.0515  0.0368  386 GLU A C     
1797 O O     . GLU A 258 ? 0.2175 0.2032 0.2231 0.0399  0.0483  0.0265  386 GLU A O     
1798 C CB    . GLU A 258 ? 0.2960 0.2913 0.3030 0.0588  0.0444  0.0387  386 GLU A CB    
1799 C CG    . GLU A 258 ? 0.3076 0.3072 0.2963 0.0613  0.0425  0.0474  386 GLU A CG    
1800 C CD    . GLU A 258 ? 0.4178 0.4304 0.3976 0.0680  0.0359  0.0485  386 GLU A CD    
1801 O OE1   . GLU A 258 ? 0.5327 0.5472 0.5220 0.0754  0.0338  0.0508  386 GLU A OE1   
1802 O OE2   . GLU A 258 ? 0.3788 0.3998 0.3436 0.0661  0.0326  0.0464  386 GLU A OE2   
1803 N N     . ARG A 259 ? 0.2113 0.1826 0.2251 0.0468  0.0561  0.0460  387 ARG A N     
1804 C CA    . ARG A 259 ? 0.1435 0.1124 0.1552 0.0390  0.0572  0.0433  387 ARG A CA    
1805 C C     . ARG A 259 ? 0.2552 0.2114 0.2849 0.0379  0.0639  0.0473  387 ARG A C     
1806 O O     . ARG A 259 ? 0.2267 0.1759 0.2630 0.0445  0.0692  0.0585  387 ARG A O     
1807 C CB    . ARG A 259 ? 0.1639 0.1375 0.1587 0.0400  0.0569  0.0501  387 ARG A CB    
1808 C CG    . ARG A 259 ? 0.2564 0.2426 0.2351 0.0412  0.0508  0.0462  387 ARG A CG    
1809 C CD    . ARG A 259 ? 0.3132 0.3032 0.2770 0.0415  0.0512  0.0512  387 ARG A CD    
1810 N NE    . ARG A 259 ? 0.3925 0.3948 0.3448 0.0426  0.0444  0.0459  387 ARG A NE    
1811 C CZ    . ARG A 259 ? 0.4889 0.4962 0.4354 0.0411  0.0397  0.0438  387 ARG A CZ    
1812 N NH1   . ARG A 259 ? 0.4543 0.4566 0.4021 0.0396  0.0421  0.0470  387 ARG A NH1   
1813 N NH2   . ARG A 259 ? 0.4621 0.4794 0.4029 0.0409  0.0336  0.0378  387 ARG A NH2   
1814 N N     A SER A 260 ? 0.1811 0.1346 0.2199 0.0298  0.0634  0.0384  388 SER A N     
1815 N N     B SER A 260 ? 0.1905 0.1442 0.2288 0.0298  0.0634  0.0386  388 SER A N     
1816 C CA    A SER A 260 ? 0.2007 0.1433 0.2591 0.0276  0.0694  0.0405  388 SER A CA    
1817 C CA    B SER A 260 ? 0.2097 0.1525 0.2683 0.0272  0.0691  0.0397  388 SER A CA    
1818 C C     A SER A 260 ? 0.2540 0.1979 0.3128 0.0201  0.0678  0.0364  388 SER A C     
1819 C C     B SER A 260 ? 0.2427 0.1865 0.3018 0.0199  0.0677  0.0361  388 SER A C     
1820 O O     A SER A 260 ? 0.2065 0.1572 0.2572 0.0146  0.0609  0.0267  388 SER A O     
1821 O O     B SER A 260 ? 0.2183 0.1688 0.2699 0.0143  0.0608  0.0262  388 SER A O     
1822 C CB    A SER A 260 ? 0.2326 0.1697 0.3103 0.0257  0.0703  0.0311  388 SER A CB    
1823 C CB    B SER A 260 ? 0.2361 0.1747 0.3121 0.0249  0.0690  0.0290  388 SER A CB    
1824 O OG    A SER A 260 ? 0.2671 0.2092 0.3433 0.0179  0.0642  0.0161  388 SER A OG    
1825 O OG    B SER A 260 ? 0.1971 0.1260 0.2952 0.0215  0.0741  0.0280  388 SER A OG    
1826 N N     . PHE A 261 ? 0.2275 0.1645 0.2962 0.0202  0.0745  0.0448  389 PHE A N     
1827 C CA    . PHE A 261 ? 0.1875 0.1249 0.2626 0.0137  0.0740  0.0418  389 PHE A CA    
1828 C C     . PHE A 261 ? 0.2363 0.1696 0.3369 0.0103  0.0762  0.0361  389 PHE A C     
1829 O O     . PHE A 261 ? 0.2412 0.1739 0.3517 0.0134  0.0824  0.0419  389 PHE A O     
1830 C CB    . PHE A 261 ? 0.2444 0.1877 0.3091 0.0168  0.0762  0.0494  389 PHE A CB    
1831 C CG    . PHE A 261 ? 0.2967 0.2454 0.3383 0.0227  0.0747  0.0552  389 PHE A CG    
1832 C CD1   . PHE A 261 ? 0.2806 0.2358 0.3060 0.0207  0.0691  0.0516  389 PHE A CD1   
1833 C CD2   . PHE A 261 ? 0.3642 0.3132 0.4008 0.0300  0.0782  0.0632  389 PHE A CD2   
1834 C CE1   . PHE A 261 ? 0.2760 0.2387 0.2825 0.0259  0.0659  0.0541  389 PHE A CE1   
1835 C CE2   . PHE A 261 ? 0.3689 0.3243 0.3854 0.0353  0.0748  0.0666  389 PHE A CE2   
1836 C CZ    . PHE A 261 ? 0.3110 0.2736 0.3137 0.0331  0.0682  0.0612  389 PHE A CZ    
1837 N N     A CYS A 262 ? 0.1925 0.1243 0.3028 0.0036  0.0709  0.0237  390 CYS A N     
1838 N N     B CYS A 262 ? 0.2054 0.1371 0.3161 0.0037  0.0710  0.0237  390 CYS A N     
1839 C CA    A CYS A 262 ? 0.2170 0.1472 0.3503 0.0000  0.0710  0.0148  390 CYS A CA    
1840 C CA    B CYS A 262 ? 0.2168 0.1471 0.3511 0.0005  0.0718  0.0161  390 CYS A CA    
1841 C C     A CYS A 262 ? 0.1615 0.0962 0.3057 -0.0066 0.0659  0.0074  390 CYS A C     
1842 C C     B CYS A 262 ? 0.1763 0.1108 0.3203 -0.0068 0.0654  0.0065  390 CYS A C     
1843 O O     A CYS A 262 ? 0.1701 0.1085 0.3042 -0.0089 0.0615  0.0081  390 CYS A O     
1844 O O     B CYS A 262 ? 0.1469 0.0846 0.2796 -0.0099 0.0599  0.0052  390 CYS A O     
1845 C CB    A CYS A 262 ? 0.2393 0.1662 0.3743 -0.0015 0.0675  0.0031  390 CYS A CB    
1846 C CB    B CYS A 262 ? 0.2468 0.1732 0.3864 0.0005  0.0707  0.0072  390 CYS A CB    
1847 S SG    A CYS A 262 ? 0.2924 0.2225 0.4059 0.0061  0.0676  0.0081  390 CYS A SG    
1848 S SG    B CYS A 262 ? 0.2958 0.2295 0.4168 -0.0041 0.0597  -0.0073 390 CYS A SG    
1849 N N     . ILE A 263 ? 0.1520 0.0871 0.3181 -0.0093 0.0661  0.0000  391 ILE A N     
1850 C CA    . ILE A 263 ? 0.1506 0.0907 0.3294 -0.0151 0.0593  -0.0097 391 ILE A CA    
1851 C C     . ILE A 263 ? 0.2074 0.1478 0.3947 -0.0192 0.0537  -0.0247 391 ILE A C     
1852 O O     . ILE A 263 ? 0.1724 0.1101 0.3737 -0.0176 0.0592  -0.0265 391 ILE A O     
1853 C CB    . ILE A 263 ? 0.2448 0.1872 0.4437 -0.0139 0.0654  -0.0051 391 ILE A CB    
1854 C CG1   . ILE A 263 ? 0.2157 0.1583 0.4029 -0.0093 0.0716  0.0084  391 ILE A CG1   
1855 C CG2   . ILE A 263 ? 0.2098 0.1580 0.4230 -0.0192 0.0571  -0.0156 391 ILE A CG2   
1856 C CD1   . ILE A 263 ? 0.1888 0.1329 0.3940 -0.0073 0.0796  0.0131  391 ILE A CD1   
1857 N N     . PHE A 264 ? 0.1881 0.1324 0.3658 -0.0244 0.0429  -0.0357 392 PHE A N     
1858 C CA    . PHE A 264 ? 0.2059 0.1523 0.3843 -0.0282 0.0365  -0.0513 392 PHE A CA    
1859 C C     . PHE A 264 ? 0.2401 0.1927 0.4349 -0.0321 0.0297  -0.0608 392 PHE A C     
1860 O O     . PHE A 264 ? 0.1979 0.1548 0.3962 -0.0335 0.0252  -0.0582 392 PHE A O     
1861 C CB    . PHE A 264 ? 0.2209 0.1700 0.3739 -0.0313 0.0280  -0.0586 392 PHE A CB    
1862 C CG    . PHE A 264 ? 0.2246 0.1701 0.3627 -0.0281 0.0327  -0.0583 392 PHE A CG    
1863 C CD1   . PHE A 264 ? 0.1959 0.1378 0.3289 -0.0214 0.0411  -0.0439 392 PHE A CD1   
1864 C CD2   . PHE A 264 ? 0.3422 0.2915 0.4670 -0.0307 0.0277  -0.0716 392 PHE A CD2   
1865 C CE1   . PHE A 264 ? 0.2905 0.2330 0.4086 -0.0172 0.0436  -0.0432 392 PHE A CE1   
1866 C CE2   . PHE A 264 ? 0.3166 0.2658 0.4270 -0.0269 0.0318  -0.0708 392 PHE A CE2   
1867 C CZ    . PHE A 264 ? 0.3196 0.2657 0.4280 -0.0201 0.0394  -0.0566 392 PHE A CZ    
1868 N N     . ARG A 265 ? 0.2117 0.1655 0.4155 -0.0339 0.0283  -0.0727 393 ARG A N     
1869 C CA    . ARG A 265 ? 0.2208 0.1812 0.4364 -0.0378 0.0201  -0.0847 393 ARG A CA    
1870 C C     . ARG A 265 ? 0.3054 0.2718 0.4963 -0.0419 0.0069  -0.0949 393 ARG A C     
1871 O O     . ARG A 265 ? 0.3561 0.3223 0.5321 -0.0427 0.0059  -0.1026 393 ARG A O     
1872 C CB    . ARG A 265 ? 0.2548 0.2138 0.4912 -0.0375 0.0259  -0.0926 393 ARG A CB    
1873 C CG    . ARG A 265 ? 0.3126 0.2770 0.5705 -0.0402 0.0215  -0.1020 393 ARG A CG    
1874 C CD    . ARG A 265 ? 0.3557 0.3179 0.6364 -0.0395 0.0298  -0.1080 393 ARG A CD    
1875 N NE    . ARG A 265 ? 0.2697 0.2383 0.5618 -0.0433 0.0222  -0.1237 393 ARG A NE    
1876 C CZ    . ARG A 265 ? 0.2364 0.2065 0.5597 -0.0435 0.0266  -0.1283 393 ARG A CZ    
1877 N NH1   . ARG A 265 ? 0.2330 0.1986 0.5790 -0.0401 0.0395  -0.1175 393 ARG A NH1   
1878 N NH2   . ARG A 265 ? 0.2986 0.2752 0.6295 -0.0471 0.0182  -0.1438 393 ARG A NH2   
1879 N N     . LEU A 266 ? 0.2193 0.1914 0.4049 -0.0440 -0.0030 -0.0944 394 LEU A N     
1880 C CA    . LEU A 266 ? 0.2198 0.1982 0.3793 -0.0473 -0.0157 -0.1014 394 LEU A CA    
1881 C C     . LEU A 266 ? 0.2659 0.2511 0.4320 -0.0504 -0.0261 -0.1125 394 LEU A C     
1882 O O     . LEU A 266 ? 0.2858 0.2745 0.4700 -0.0506 -0.0296 -0.1107 394 LEU A O     
1883 C CB    . LEU A 266 ? 0.2106 0.1912 0.3551 -0.0472 -0.0207 -0.0919 394 LEU A CB    
1884 C CG    . LEU A 266 ? 0.3656 0.3526 0.4804 -0.0499 -0.0334 -0.0974 394 LEU A CG    
1885 C CD1   . LEU A 266 ? 0.4000 0.3847 0.4914 -0.0498 -0.0301 -0.1025 394 LEU A CD1   
1886 C CD2   . LEU A 266 ? 0.3264 0.3166 0.4303 -0.0496 -0.0388 -0.0880 394 LEU A CD2   
1887 N N     . PRO A 267 ? 0.3802 0.3678 0.5317 -0.0526 -0.0311 -0.1241 395 PRO A N     
1888 C CA    . PRO A 267 ? 0.4467 0.4411 0.6027 -0.0557 -0.0415 -0.1352 395 PRO A CA    
1889 C C     . PRO A 267 ? 0.4237 0.4249 0.5679 -0.0572 -0.0547 -0.1319 395 PRO A C     
1890 O O     . PRO A 267 ? 0.5293 0.5310 0.6508 -0.0567 -0.0581 -0.1239 395 PRO A O     
1891 C CB    . PRO A 267 ? 0.4762 0.4707 0.6113 -0.0575 -0.0429 -0.1460 395 PRO A CB    
1892 C CG    . PRO A 267 ? 0.4052 0.3925 0.5454 -0.0547 -0.0291 -0.1434 395 PRO A CG    
1893 C CD    . PRO A 267 ? 0.3712 0.3545 0.5116 -0.0518 -0.0238 -0.1284 395 PRO A CD    
1894 N N     . GLN A 268 ? 0.3591 0.3659 0.5214 -0.0586 -0.0617 -0.1384 396 GLN A N     
1895 C CA    . GLN A 268 ? 0.3711 0.3854 0.5346 -0.0594 -0.0739 -0.1362 396 GLN A CA    
1896 C C     . GLN A 268 ? 0.5097 0.5306 0.6776 -0.0624 -0.0837 -0.1501 396 GLN A C     
1897 O O     . GLN A 268 ? 0.4787 0.4976 0.6577 -0.0634 -0.0787 -0.1606 396 GLN A O     
1898 C CB    . GLN A 268 ? 0.3978 0.4116 0.5927 -0.0568 -0.0688 -0.1280 396 GLN A CB    
1899 C CG    . GLN A 268 ? 0.3358 0.3441 0.5288 -0.0539 -0.0600 -0.1135 396 GLN A CG    
1900 C CD    . GLN A 268 ? 0.4582 0.4716 0.6360 -0.0536 -0.0696 -0.1059 396 GLN A CD    
1901 O OE1   . GLN A 268 ? 0.4731 0.4895 0.6688 -0.0522 -0.0718 -0.1008 396 GLN A OE1   
1902 N NE2   . GLN A 268 ? 0.4222 0.4364 0.5668 -0.0547 -0.0748 -0.1046 396 GLN A NE2   
1903 N N     . PRO A 269 ? 0.5979 0.6271 0.7586 -0.0637 -0.0979 -0.1507 397 PRO A N     
1904 C CA    . PRO A 269 ? 0.6045 0.6409 0.7699 -0.0667 -0.1084 -0.1644 397 PRO A CA    
1905 C C     . PRO A 269 ? 0.5463 0.5824 0.7521 -0.0664 -0.1023 -0.1735 397 PRO A C     
1906 O O     . PRO A 269 ? 0.4614 0.4994 0.6961 -0.0644 -0.1013 -0.1698 397 PRO A O     
1907 C CB    . PRO A 269 ? 0.6023 0.6478 0.7624 -0.0666 -0.1231 -0.1597 397 PRO A CB    
1908 C CG    . PRO A 269 ? 0.5979 0.6404 0.7646 -0.0631 -0.1176 -0.1446 397 PRO A CG    
1909 C CD    . PRO A 269 ? 0.5967 0.6299 0.7469 -0.0623 -0.1053 -0.1391 397 PRO A CD    
1910 N N     . GLY A 270 ? 0.5069 0.5407 0.7165 -0.0681 -0.0973 -0.1853 410 GLY A N     
1911 C CA    . GLY A 270 ? 0.4616 0.4961 0.7111 -0.0678 -0.0916 -0.1944 410 GLY A CA    
1912 C C     . GLY A 270 ? 0.3508 0.3775 0.6282 -0.0642 -0.0750 -0.1852 410 GLY A C     
1913 O O     . GLY A 270 ? 0.3172 0.3437 0.6301 -0.0635 -0.0681 -0.1903 410 GLY A O     
1914 N N     . SER A 271 ? 0.3423 0.3626 0.6043 -0.0619 -0.0679 -0.1716 411 SER A N     
1915 C CA    . SER A 271 ? 0.2706 0.2835 0.5559 -0.0584 -0.0523 -0.1614 411 SER A CA    
1916 C C     . SER A 271 ? 0.3604 0.3662 0.6217 -0.0565 -0.0451 -0.1493 411 SER A C     
1917 O O     . SER A 271 ? 0.3313 0.3357 0.5660 -0.0578 -0.0468 -0.1528 411 SER A O     
1918 C CB    . SER A 271 ? 0.3110 0.3266 0.6202 -0.0565 -0.0529 -0.1545 411 SER A CB    
1919 O OG    . SER A 271 ? 0.2763 0.2853 0.6107 -0.0531 -0.0369 -0.1460 411 SER A OG    
1920 N N     . TRP A 272 ? 0.3060 0.3074 0.5763 -0.0533 -0.0366 -0.1356 412 TRP A N     
1921 C CA    . TRP A 272 ? 0.2237 0.2188 0.4733 -0.0514 -0.0298 -0.1239 412 TRP A CA    
1922 C C     . TRP A 272 ? 0.2087 0.2016 0.4696 -0.0483 -0.0237 -0.1098 412 TRP A C     
1923 O O     . TRP A 272 ? 0.2095 0.2045 0.4967 -0.0473 -0.0217 -0.1090 412 TRP A O     
1924 C CB    . TRP A 272 ? 0.2377 0.2254 0.4900 -0.0499 -0.0174 -0.1244 412 TRP A CB    
1925 C CG    . TRP A 272 ? 0.2555 0.2401 0.5427 -0.0478 -0.0055 -0.1235 412 TRP A CG    
1926 C CD1   . TRP A 272 ? 0.2377 0.2247 0.5476 -0.0492 -0.0046 -0.1356 412 TRP A CD1   
1927 C CD2   . TRP A 272 ? 0.2402 0.2192 0.5430 -0.0438 0.0078  -0.1096 412 TRP A CD2   
1928 N NE1   . TRP A 272 ? 0.2352 0.2184 0.5752 -0.0463 0.0086  -0.1297 412 TRP A NE1   
1929 C CE2   . TRP A 272 ? 0.2211 0.1994 0.5559 -0.0429 0.0164  -0.1133 412 TRP A CE2   
1930 C CE3   . TRP A 272 ? 0.2374 0.2124 0.5294 -0.0408 0.0135  -0.0942 412 TRP A CE3   
1931 C CZ2   . TRP A 272 ? 0.2164 0.1901 0.5708 -0.0391 0.0306  -0.1013 412 TRP A CZ2   
1932 C CZ3   . TRP A 272 ? 0.2407 0.2112 0.5507 -0.0369 0.0273  -0.0828 412 TRP A CZ3   
1933 C CH2   . TRP A 272 ? 0.2043 0.1742 0.5443 -0.0360 0.0357  -0.0860 412 TRP A CH2   
1934 N N     . LYS A 273 ? 0.2020 0.1909 0.4428 -0.0469 -0.0203 -0.0990 413 LYS A N     
1935 C CA    . LYS A 273 ? 0.2043 0.1903 0.4524 -0.0437 -0.0124 -0.0850 413 LYS A CA    
1936 C C     . LYS A 273 ? 0.1741 0.1521 0.4099 -0.0410 -0.0008 -0.0754 413 LYS A C     
1937 O O     . LYS A 273 ? 0.1751 0.1508 0.3911 -0.0420 -0.0022 -0.0788 413 LYS A O     
1938 C CB    . LYS A 273 ? 0.1776 0.1690 0.4138 -0.0444 -0.0225 -0.0804 413 LYS A CB    
1939 C CG    . LYS A 273 ? 0.2275 0.2196 0.4308 -0.0460 -0.0295 -0.0793 413 LYS A CG    
1940 C CD    . LYS A 273 ? 0.1864 0.1837 0.3819 -0.0459 -0.0380 -0.0729 413 LYS A CD    
1941 C CE    . LYS A 273 ? 0.1711 0.1699 0.3344 -0.0474 -0.0452 -0.0720 413 LYS A CE    
1942 N NZ    . LYS A 273 ? 0.2055 0.2082 0.3630 -0.0465 -0.0509 -0.0633 413 LYS A NZ    
1943 N N     . ALA A 274 ? 0.1670 0.1411 0.4139 -0.0373 0.0108  -0.0633 414 ALA A N     
1944 C CA    . ALA A 274 ? 0.2148 0.1819 0.4489 -0.0339 0.0214  -0.0522 414 ALA A CA    
1945 C C     . ALA A 274 ? 0.2125 0.1804 0.4228 -0.0342 0.0170  -0.0455 414 ALA A C     
1946 O O     . ALA A 274 ? 0.1461 0.1187 0.3577 -0.0348 0.0118  -0.0430 414 ALA A O     
1947 C CB    . ALA A 274 ? 0.1937 0.1574 0.4451 -0.0294 0.0354  -0.0414 414 ALA A CB    
1948 N N     . VAL A 275 ? 0.1467 0.1101 0.3371 -0.0335 0.0194  -0.0430 415 VAL A N     
1949 C CA    . VAL A 275 ? 0.1453 0.1093 0.3138 -0.0340 0.0163  -0.0373 415 VAL A CA    
1950 C C     . VAL A 275 ? 0.1452 0.1020 0.3030 -0.0295 0.0277  -0.0268 415 VAL A C     
1951 O O     . VAL A 275 ? 0.1464 0.0981 0.3049 -0.0276 0.0331  -0.0285 415 VAL A O     
1952 C CB    . VAL A 275 ? 0.1404 0.1087 0.2904 -0.0385 0.0038  -0.0483 415 VAL A CB    
1953 C CG1   . VAL A 275 ? 0.1331 0.1047 0.2555 -0.0362 0.0018  -0.0399 415 VAL A CG1   
1954 C CG2   . VAL A 275 ? 0.1838 0.1602 0.3405 -0.0417 -0.0089 -0.0572 415 VAL A CG2   
1955 N N     . ARG A 276 ? 0.1269 0.0840 0.2746 -0.0272 0.0312  -0.0159 416 ARG A N     
1956 C CA    . ARG A 276 ? 0.1249 0.0779 0.2567 -0.0218 0.0400  -0.0055 416 ARG A CA    
1957 C C     . ARG A 276 ? 0.1381 0.0960 0.2424 -0.0208 0.0338  -0.0092 416 ARG A C     
1958 O O     . ARG A 276 ? 0.1198 0.0844 0.2104 -0.0233 0.0247  -0.0128 416 ARG A O     
1959 C CB    . ARG A 276 ? 0.1201 0.0749 0.2468 -0.0188 0.0451  0.0059  416 ARG A CB    
1960 C CG    . ARG A 276 ? 0.1360 0.0903 0.2767 -0.0144 0.0537  0.0117  416 ARG A CG    
1961 C CD    . ARG A 276 ? 0.1710 0.1209 0.3023 -0.0079 0.0634  0.0209  416 ARG A CD    
1962 N NE    . ARG A 276 ? 0.1281 0.0798 0.2356 -0.0047 0.0641  0.0278  416 ARG A NE    
1963 C CZ    . ARG A 276 ? 0.1504 0.1008 0.2406 -0.0031 0.0633  0.0296  416 ARG A CZ    
1964 N NH1   . ARG A 276 ? 0.1275 0.0732 0.2210 -0.0041 0.0623  0.0250  416 ARG A NH1   
1965 N NH2   . ARG A 276 ? 0.1218 0.0764 0.1916 -0.0002 0.0632  0.0347  416 ARG A NH2   
1966 N N     . VAL A 277 ? 0.1457 0.1000 0.2438 -0.0170 0.0390  -0.0078 417 VAL A N     
1967 C CA    . VAL A 277 ? 0.1583 0.1170 0.2339 -0.0158 0.0351  -0.0116 417 VAL A CA    
1968 C C     . VAL A 277 ? 0.1670 0.1240 0.2331 -0.0090 0.0425  -0.0015 417 VAL A C     
1969 O O     . VAL A 277 ? 0.1648 0.1150 0.2434 -0.0051 0.0503  0.0040  417 VAL A O     
1970 C CB    . VAL A 277 ? 0.1414 0.0988 0.2218 -0.0185 0.0323  -0.0245 417 VAL A CB    
1971 C CG1   . VAL A 277 ? 0.1553 0.1171 0.2137 -0.0172 0.0304  -0.0281 417 VAL A CG1   
1972 C CG2   . VAL A 277 ? 0.1359 0.0961 0.2239 -0.0251 0.0235  -0.0354 417 VAL A CG2   
1973 N N     . ASP A 278 ? 0.1244 0.0878 0.1692 -0.0073 0.0399  0.0010  418 ASP A N     
1974 C CA    . ASP A 278 ? 0.1709 0.1354 0.2047 -0.0010 0.0445  0.0086  418 ASP A CA    
1975 C C     . ASP A 278 ? 0.1186 0.0872 0.1414 -0.0004 0.0416  0.0016  418 ASP A C     
1976 O O     . ASP A 278 ? 0.1488 0.1226 0.1602 -0.0046 0.0359  -0.0054 418 ASP A O     
1977 C CB    . ASP A 278 ? 0.1498 0.1191 0.1704 0.0005  0.0446  0.0159  418 ASP A CB    
1978 C CG    . ASP A 278 ? 0.1959 0.1608 0.2272 0.0012  0.0502  0.0240  418 ASP A CG    
1979 O OD1   . ASP A 278 ? 0.2153 0.1727 0.2618 0.0031  0.0564  0.0279  418 ASP A OD1   
1980 O OD2   . ASP A 278 ? 0.1554 0.1238 0.1811 -0.0001 0.0495  0.0266  418 ASP A OD2   
1981 N N     . LEU A 279 ? 0.1282 0.0944 0.1550 0.0049  0.0459  0.0040  419 LEU A N     
1982 C CA    . LEU A 279 ? 0.1418 0.1122 0.1618 0.0064  0.0446  -0.0023 419 LEU A CA    
1983 C C     . LEU A 279 ? 0.1828 0.1576 0.1939 0.0134  0.0462  0.0060  419 LEU A C     
1984 O O     . LEU A 279 ? 0.2223 0.1933 0.2385 0.0191  0.0503  0.0161  419 LEU A O     
1985 C CB    . LEU A 279 ? 0.1882 0.1525 0.2246 0.0069  0.0477  -0.0087 419 LEU A CB    
1986 C CG    . LEU A 279 ? 0.2022 0.1622 0.2504 0.0003  0.0461  -0.0188 419 LEU A CG    
1987 C CD1   . LEU A 279 ? 0.2327 0.1870 0.2977 0.0015  0.0502  -0.0258 419 LEU A CD1   
1988 C CD2   . LEU A 279 ? 0.2104 0.1766 0.2434 -0.0064 0.0391  -0.0285 419 LEU A CD2   
1989 N N     . VAL A 280 ? 0.1429 0.1261 0.1409 0.0128  0.0430  0.0016  420 VAL A N     
1990 C CA    . VAL A 280 ? 0.1160 0.1057 0.1064 0.0190  0.0429  0.0067  420 VAL A CA    
1991 C C     . VAL A 280 ? 0.1532 0.1482 0.1440 0.0194  0.0421  -0.0019 420 VAL A C     
1992 O O     . VAL A 280 ? 0.1293 0.1262 0.1156 0.0134  0.0409  -0.0113 420 VAL A O     
1993 C CB    . VAL A 280 ? 0.1988 0.1951 0.1746 0.0175  0.0403  0.0095  420 VAL A CB    
1994 C CG1   . VAL A 280 ? 0.1905 0.1955 0.1590 0.0232  0.0390  0.0118  420 VAL A CG1   
1995 C CG2   . VAL A 280 ? 0.1975 0.1889 0.1745 0.0174  0.0424  0.0176  420 VAL A CG2   
1996 N N     . VAL A 281 ? 0.1198 0.1172 0.1161 0.0268  0.0431  0.0017  421 VAL A N     
1997 C CA    . VAL A 281 ? 0.1200 0.1235 0.1199 0.0282  0.0428  -0.0060 421 VAL A CA    
1998 C C     . VAL A 281 ? 0.2036 0.2181 0.1952 0.0324  0.0395  -0.0031 421 VAL A C     
1999 O O     . VAL A 281 ? 0.1405 0.1562 0.1290 0.0385  0.0380  0.0067  421 VAL A O     
2000 C CB    . VAL A 281 ? 0.1625 0.1606 0.1804 0.0338  0.0460  -0.0055 421 VAL A CB    
2001 C CG1   . VAL A 281 ? 0.1928 0.1986 0.2167 0.0360  0.0461  -0.0135 421 VAL A CG1   
2002 C CG2   . VAL A 281 ? 0.1793 0.1672 0.2075 0.0288  0.0495  -0.0110 421 VAL A CG2   
2003 N N     . ALA A 282 ? 0.1418 0.1644 0.1298 0.0290  0.0387  -0.0120 422 ALA A N     
2004 C CA    . ALA A 282 ? 0.1089 0.1431 0.0926 0.0322  0.0354  -0.0120 422 ALA A CA    
2005 C C     . ALA A 282 ? 0.1087 0.1498 0.1015 0.0321  0.0368  -0.0218 422 ALA A C     
2006 O O     . ALA A 282 ? 0.1165 0.1542 0.1110 0.0263  0.0408  -0.0302 422 ALA A O     
2007 C CB    . ALA A 282 ? 0.1023 0.1403 0.0719 0.0265  0.0338  -0.0129 422 ALA A CB    
2008 N N     . PRO A 283 ? 0.1093 0.1605 0.1083 0.0385  0.0336  -0.0214 423 PRO A N     
2009 C CA    . PRO A 283 ? 0.2169 0.2766 0.2262 0.0376  0.0354  -0.0317 423 PRO A CA    
2010 C C     . PRO A 283 ? 0.1694 0.2323 0.1690 0.0285  0.0371  -0.0385 423 PRO A C     
2011 O O     . PRO A 283 ? 0.1108 0.1715 0.0984 0.0248  0.0338  -0.0337 423 PRO A O     
2012 C CB    . PRO A 283 ? 0.2323 0.3032 0.2502 0.0469  0.0294  -0.0284 423 PRO A CB    
2013 C CG    . PRO A 283 ? 0.2146 0.2851 0.2190 0.0502  0.0244  -0.0181 423 PRO A CG    
2014 C CD    . PRO A 283 ? 0.1592 0.2155 0.1559 0.0468  0.0280  -0.0120 423 PRO A CD    
2015 N N     . VAL A 284 ? 0.1307 0.1123 0.1246 0.0519  0.0592  0.0556  424 VAL A N     
2016 C CA    . VAL A 284 ? 0.1271 0.1089 0.1292 0.0411  0.0582  0.0486  424 VAL A CA    
2017 C C     . VAL A 284 ? 0.1848 0.1879 0.2008 0.0416  0.0465  0.0417  424 VAL A C     
2018 O O     . VAL A 284 ? 0.1389 0.1416 0.1563 0.0332  0.0431  0.0358  424 VAL A O     
2019 C CB    . VAL A 284 ? 0.1616 0.1361 0.1738 0.0372  0.0688  0.0486  424 VAL A CB    
2020 C CG1   . VAL A 284 ? 0.2162 0.2081 0.2495 0.0455  0.0681  0.0487  424 VAL A CG1   
2021 C CG2   . VAL A 284 ? 0.2104 0.1797 0.2255 0.0254  0.0681  0.0416  424 VAL A CG2   
2022 N N     . SER A 285 ? 0.1955 0.2172 0.2215 0.0514  0.0399  0.0424  425 SER A N     
2023 C CA    . SER A 285 ? 0.1899 0.2330 0.2283 0.0515  0.0282  0.0349  425 SER A CA    
2024 C C     . SER A 285 ? 0.2804 0.3215 0.3045 0.0480  0.0212  0.0317  425 SER A C     
2025 O O     . SER A 285 ? 0.2347 0.2852 0.2667 0.0424  0.0148  0.0236  425 SER A O     
2026 C CB    . SER A 285 ? 0.2328 0.2966 0.2811 0.0639  0.0211  0.0369  425 SER A CB    
2027 O OG    . SER A 285 ? 0.1801 0.2384 0.2098 0.0732  0.0200  0.0448  425 SER A OG    
2028 N N     . GLN A 286 ? 0.1425 0.1712 0.1464 0.0510  0.0233  0.0376  426 GLN A N     
2029 C CA    . GLN A 286 ? 0.1242 0.1506 0.1148 0.0483  0.0180  0.0349  426 GLN A CA    
2030 C C     . GLN A 286 ? 0.1740 0.1821 0.1556 0.0386  0.0237  0.0341  426 GLN A C     
2031 O O     . GLN A 286 ? 0.1896 0.1952 0.1620 0.0359  0.0203  0.0316  426 GLN A O     
2032 C CB    . GLN A 286 ? 0.1693 0.1939 0.1431 0.0575  0.0168  0.0412  426 GLN A CB    
2033 C CG    . GLN A 286 ? 0.1524 0.1952 0.1312 0.0687  0.0094  0.0430  426 GLN A CG    
2034 C CD    . GLN A 286 ? 0.2600 0.2965 0.2192 0.0773  0.0103  0.0501  426 GLN A CD    
2035 O OE1   . GLN A 286 ? 0.3101 0.3303 0.2564 0.0711  0.0165  0.0494  426 GLN A OE1   
2036 N NE2   . GLN A 286 ? 0.2641 0.3125 0.2257 0.0855  0.0052  0.0515  426 GLN A NE2   
2037 N N     . PHE A 287 ? 0.1732 0.1691 0.1573 0.0336  0.0323  0.0361  427 PHE A N     
2038 C CA    . PHE A 287 ? 0.1507 0.1292 0.1241 0.0253  0.0372  0.0364  427 PHE A CA    
2039 C C     . PHE A 287 ? 0.2004 0.1809 0.1756 0.0188  0.0311  0.0299  427 PHE A C     
2040 O O     . PHE A 287 ? 0.1367 0.1094 0.1006 0.0162  0.0306  0.0301  427 PHE A O     
2041 C CB    . PHE A 287 ? 0.2071 0.1758 0.1856 0.0200  0.0437  0.0354  427 PHE A CB    
2042 C CG    . PHE A 287 ? 0.1447 0.1057 0.1193 0.0111  0.0394  0.0280  427 PHE A CG    
2043 C CD1   . PHE A 287 ? 0.1929 0.1514 0.1626 0.0100  0.0369  0.0251  427 PHE A CD1   
2044 C CD2   . PHE A 287 ? 0.1647 0.1236 0.1420 0.0049  0.0379  0.0249  427 PHE A CD2   
2045 C CE1   . PHE A 287 ? 0.1642 0.1175 0.1309 0.0056  0.0354  0.0208  427 PHE A CE1   
2046 C CE2   . PHE A 287 ? 0.2219 0.1783 0.1958 -0.0002 0.0331  0.0206  427 PHE A CE2   
2047 C CZ    . PHE A 287 ? 0.2136 0.1665 0.1818 0.0012  0.0334  0.0189  427 PHE A CZ    
2048 N N     . PRO A 288 ? 0.1760 0.1663 0.1655 0.0160  0.0269  0.0238  428 PRO A N     
2049 C CA    . PRO A 288 ? 0.1066 0.0965 0.0969 0.0102  0.0221  0.0179  428 PRO A CA    
2050 C C     . PRO A 288 ? 0.0918 0.0873 0.0742 0.0136  0.0159  0.0161  428 PRO A C     
2051 O O     . PRO A 288 ? 0.1225 0.1109 0.0987 0.0099  0.0149  0.0145  428 PRO A O     
2052 C CB    . PRO A 288 ? 0.0957 0.0973 0.1040 0.0078  0.0195  0.0113  428 PRO A CB    
2053 C CG    . PRO A 288 ? 0.1549 0.1586 0.1719 0.0098  0.0251  0.0143  428 PRO A CG    
2054 C CD    . PRO A 288 ? 0.1419 0.1441 0.1485 0.0177  0.0270  0.0216  428 PRO A CD    
2055 N N     . PHE A 289 ? 0.1448 0.1530 0.1269 0.0210  0.0117  0.0165  429 PHE A N     
2056 C CA    . PHE A 289 ? 0.1420 0.1547 0.1144 0.0242  0.0066  0.0148  429 PHE A CA    
2057 C C     . PHE A 289 ? 0.2100 0.2093 0.1664 0.0250  0.0117  0.0204  429 PHE A C     
2058 O O     . PHE A 289 ? 0.1289 0.1257 0.0784 0.0234  0.0101  0.0179  429 PHE A O     
2059 C CB    . PHE A 289 ? 0.1120 0.1407 0.0855 0.0325  0.0008  0.0147  429 PHE A CB    
2060 C CG    . PHE A 289 ? 0.1484 0.1937 0.1391 0.0313  -0.0054 0.0075  429 PHE A CG    
2061 C CD1   . PHE A 289 ? 0.1731 0.2261 0.1679 0.0272  -0.0115 -0.0015 429 PHE A CD1   
2062 C CD2   . PHE A 289 ? 0.1645 0.2178 0.1683 0.0338  -0.0044 0.0090  429 PHE A CD2   
2063 C CE1   . PHE A 289 ? 0.1602 0.2287 0.1716 0.0249  -0.0166 -0.0094 429 PHE A CE1   
2064 C CE2   . PHE A 289 ? 0.1435 0.2137 0.1653 0.0320  -0.0099 0.0013  429 PHE A CE2   
2065 C CZ    . PHE A 289 ? 0.1064 0.1843 0.1318 0.0271  -0.0160 -0.0082 429 PHE A CZ    
2066 N N     . ALA A 290 ? 0.1309 0.1214 0.0820 0.0271  0.0186  0.0274  430 ALA A N     
2067 C CA    . ALA A 290 ? 0.1245 0.1049 0.0701 0.0240  0.0216  0.0274  430 ALA A CA    
2068 C C     . ALA A 290 ? 0.1205 0.0939 0.0697 0.0152  0.0215  0.0237  430 ALA A C     
2069 O O     . ALA A 290 ? 0.1403 0.1127 0.0887 0.0123  0.0200  0.0211  430 ALA A O     
2070 C CB    . ALA A 290 ? 0.1379 0.1143 0.0863 0.0258  0.0257  0.0298  430 ALA A CB    
2071 N N     . LEU A 291 ? 0.1246 0.0944 0.0785 0.0114  0.0230  0.0237  431 LEU A N     
2072 C CA    . LEU A 291 ? 0.1505 0.1161 0.1075 0.0047  0.0212  0.0204  431 LEU A CA    
2073 C C     . LEU A 291 ? 0.1924 0.1573 0.1449 0.0044  0.0190  0.0190  431 LEU A C     
2074 O O     . LEU A 291 ? 0.1431 0.1074 0.0960 0.0021  0.0171  0.0169  431 LEU A O     
2075 C CB    . LEU A 291 ? 0.1270 0.0889 0.0892 0.0013  0.0229  0.0203  431 LEU A CB    
2076 C CG    . LEU A 291 ? 0.2035 0.1633 0.1684 -0.0035 0.0200  0.0175  431 LEU A CG    
2077 C CD1   . LEU A 291 ? 0.1446 0.1027 0.1067 -0.0033 0.0202  0.0156  431 LEU A CD1   
2078 C CD2   . LEU A 291 ? 0.1583 0.1153 0.1274 -0.0060 0.0216  0.0171  431 LEU A CD2   
2079 N N     . LEU A 292 ? 0.1628 0.1333 0.1175 0.0065  0.0165  0.0170  432 LEU A N     
2080 C CA    . LEU A 292 ? 0.1747 0.1496 0.1319 0.0056  0.0114  0.0111  432 LEU A CA    
2081 C C     . LEU A 292 ? 0.1543 0.1309 0.1021 0.0089  0.0112  0.0114  432 LEU A C     
2082 O O     . LEU A 292 ? 0.1099 0.0832 0.0562 0.0069  0.0107  0.0092  432 LEU A O     
2083 C CB    . LEU A 292 ? 0.1475 0.1344 0.1153 0.0064  0.0065  0.0051  432 LEU A CB    
2084 C CG    . LEU A 292 ? 0.1516 0.1429 0.1235 0.0048  0.0020  -0.0024 432 LEU A CG    
2085 C CD1   . LEU A 292 ? 0.0965 0.0772 0.0726 -0.0005 0.0031  -0.0036 432 LEU A CD1   
2086 C CD2   . LEU A 292 ? 0.0932 0.0981 0.0743 0.0055  -0.0026 -0.0088 432 LEU A CD2   
2087 N N     . GLY A 293 ? 0.1532 0.1344 0.0945 0.0144  0.0123  0.0142  433 GLY A N     
2088 C CA    . GLY A 293 ? 0.1838 0.1666 0.1172 0.0171  0.0125  0.0138  433 GLY A CA    
2089 C C     . GLY A 293 ? 0.1813 0.1585 0.1192 0.0122  0.0153  0.0141  433 GLY A C     
2090 O O     . GLY A 293 ? 0.1842 0.1622 0.1200 0.0118  0.0154  0.0119  433 GLY A O     
2091 N N     . HIS A 294 ? 0.1480 0.1213 0.0921 0.0089  0.0169  0.0158  434 HIS A N     
2092 C CA    . HIS A 294 ? 0.1749 0.1466 0.1229 0.0055  0.0179  0.0149  434 HIS A CA    
2093 C C     . HIS A 294 ? 0.0999 0.0689 0.0513 0.0018  0.0168  0.0136  434 HIS A C     
2094 O O     . HIS A 294 ? 0.1878 0.1542 0.1397 0.0001  0.0179  0.0125  434 HIS A O     
2095 C CB    . HIS A 294 ? 0.1698 0.1365 0.1180 0.0069  0.0211  0.0163  434 HIS A CB    
2096 C CG    . HIS A 294 ? 0.2181 0.1853 0.1620 0.0116  0.0229  0.0183  434 HIS A CG    
2097 N ND1   . HIS A 294 ? 0.2451 0.2090 0.1848 0.0131  0.0255  0.0182  434 HIS A ND1   
2098 C CD2   . HIS A 294 ? 0.2547 0.2251 0.1972 0.0155  0.0226  0.0208  434 HIS A CD2   
2099 C CE1   . HIS A 294 ? 0.3669 0.3312 0.3022 0.0181  0.0267  0.0208  434 HIS A CE1   
2100 N NE2   . HIS A 294 ? 0.3362 0.3051 0.2733 0.0199  0.0247  0.0224  434 HIS A NE2   
2101 N N     . THR A 295 ? 0.1105 0.0767 0.0612 0.0011  0.0155  0.0135  435 THR A N     
2102 C CA    . THR A 295 ? 0.1129 0.0748 0.0652 -0.0021 0.0141  0.0126  435 THR A CA    
2103 C C     . THR A 295 ? 0.1500 0.1085 0.0967 -0.0019 0.0137  0.0111  435 THR A C     
2104 O O     . THR A 295 ? 0.1744 0.1295 0.1216 -0.0043 0.0127  0.0109  435 THR A O     
2105 C CB    . THR A 295 ? 0.1593 0.1173 0.1137 -0.0038 0.0131  0.0132  435 THR A CB    
2106 O OG1   . THR A 295 ? 0.1414 0.1026 0.1006 -0.0041 0.0139  0.0140  435 THR A OG1   
2107 C CG2   . THR A 295 ? 0.0938 0.0475 0.0497 -0.0064 0.0107  0.0127  435 THR A CG2   
2108 N N     . GLY A 296 ? 0.1408 0.1013 0.0811 0.0012  0.0143  0.0094  436 GLY A N     
2109 C CA    . GLY A 296 ? 0.1378 0.1025 0.0820 0.0020  0.0126  0.0045  436 GLY A CA    
2110 C C     . GLY A 296 ? 0.1416 0.1059 0.0957 0.0008  0.0080  0.0009  436 GLY A C     
2111 O O     . GLY A 296 ? 0.1324 0.0948 0.0903 -0.0002 0.0060  0.0010  436 GLY A O     
2112 N N     . SER A 297 ? 0.1337 0.0995 0.0930 0.0011  0.0071  -0.0025 437 SER A N     
2113 C CA    . SER A 297 ? 0.1142 0.0834 0.0712 0.0019  0.0104  -0.0040 437 SER A CA    
2114 C C     . SER A 297 ? 0.1531 0.1271 0.1031 0.0046  0.0131  -0.0066 437 SER A C     
2115 O O     . SER A 297 ? 0.1290 0.1056 0.0776 0.0062  0.0108  -0.0081 437 SER A O     
2116 C CB    . SER A 297 ? 0.1132 0.0844 0.0805 0.0023  0.0086  -0.0081 437 SER A CB    
2117 O OG    . SER A 297 ? 0.1029 0.0766 0.0750 0.0043  0.0073  -0.0138 437 SER A OG    
2118 N N     . LYS A 298 ? 0.1530 0.1280 0.0982 0.0050  0.0179  -0.0072 438 LYS A N     
2119 C CA    . LYS A 298 ? 0.1756 0.1535 0.1114 0.0079  0.0210  -0.0093 438 LYS A CA    
2120 C C     . LYS A 298 ? 0.1530 0.1358 0.0931 0.0094  0.0176  -0.0161 438 LYS A C     
2121 O O     . LYS A 298 ? 0.1420 0.1281 0.0755 0.0115  0.0156  -0.0176 438 LYS A O     
2122 C CB    . LYS A 298 ? 0.2329 0.2118 0.1682 0.0068  0.0265  -0.0094 438 LYS A CB    
2123 C CG    . LYS A 298 ? 0.4856 0.4696 0.4173 0.0085  0.0276  -0.0117 438 LYS A CG    
2124 N N     . LEU A 299 ? 0.1074 0.0907 0.0587 0.0083  0.0166  -0.0207 439 LEU A N     
2125 C CA    . LEU A 299 ? 0.1338 0.1201 0.0895 0.0091  0.0146  -0.0279 439 LEU A CA    
2126 C C     . LEU A 299 ? 0.1058 0.0924 0.0647 0.0085  0.0092  -0.0283 439 LEU A C     
2127 O O     . LEU A 299 ? 0.1276 0.1183 0.0839 0.0089  0.0074  -0.0334 439 LEU A O     
2128 C CB    . LEU A 299 ? 0.1040 0.0897 0.0728 0.0088  0.0153  -0.0322 439 LEU A CB    
2129 C CG    . LEU A 299 ? 0.1487 0.1353 0.1231 0.0093  0.0145  -0.0402 439 LEU A CG    
2130 C CD1   . LEU A 299 ? 0.1485 0.1386 0.1117 0.0101  0.0181  -0.0456 439 LEU A CD1   
2131 C CD2   . LEU A 299 ? 0.1167 0.1017 0.1058 0.0100  0.0155  -0.0430 439 LEU A CD2   
2132 N N     . PHE A 300 ? 0.1341 0.1164 0.0982 0.0069  0.0069  -0.0233 440 PHE A N     
2133 C CA    . PHE A 300 ? 0.1026 0.0844 0.0706 0.0056  0.0032  -0.0238 440 PHE A CA    
2134 C C     . PHE A 300 ? 0.1275 0.1154 0.0875 0.0069  0.0020  -0.0236 440 PHE A C     
2135 O O     . PHE A 300 ? 0.1191 0.1118 0.0824 0.0062  -0.0009 -0.0287 440 PHE A O     
2136 C CB    . PHE A 300 ? 0.1343 0.1091 0.1058 0.0036  0.0023  -0.0175 440 PHE A CB    
2137 C CG    . PHE A 300 ? 0.1658 0.1382 0.1426 0.0016  0.0001  -0.0183 440 PHE A CG    
2138 C CD1   . PHE A 300 ? 0.1283 0.1042 0.1021 0.0012  -0.0004 -0.0166 440 PHE A CD1   
2139 C CD2   . PHE A 300 ? 0.1048 0.0712 0.0903 0.0002  -0.0009 -0.0209 440 PHE A CD2   
2140 C CE1   . PHE A 300 ? 0.1302 0.1047 0.1107 -0.0014 -0.0015 -0.0182 440 PHE A CE1   
2141 C CE2   . PHE A 300 ? 0.1434 0.1063 0.1336 -0.0025 -0.0014 -0.0220 440 PHE A CE2   
2142 C CZ    . PHE A 300 ? 0.1769 0.1444 0.1652 -0.0038 -0.0016 -0.0211 440 PHE A CZ    
2143 N N     . GLN A 301 ? 0.1607 0.1490 0.1110 0.0088  0.0043  -0.0179 441 GLN A N     
2144 C CA    . GLN A 301 ? 0.1753 0.1695 0.1181 0.0116  0.0028  -0.0164 441 GLN A CA    
2145 C C     . GLN A 301 ? 0.1580 0.1593 0.0942 0.0138  0.0014  -0.0225 441 GLN A C     
2146 O O     . GLN A 301 ? 0.1589 0.1682 0.0950 0.0149  -0.0031 -0.0256 441 GLN A O     
2147 C CB    . GLN A 301 ? 0.1615 0.1519 0.0945 0.0137  0.0069  -0.0084 441 GLN A CB    
2148 C CG    . GLN A 301 ? 0.2224 0.2065 0.1597 0.0114  0.0081  -0.0026 441 GLN A CG    
2149 C CD    . GLN A 301 ? 0.2442 0.2314 0.1901 0.0102  0.0043  -0.0036 441 GLN A CD    
2150 O OE1   . GLN A 301 ? 0.2593 0.2540 0.2044 0.0131  0.0020  -0.0040 441 GLN A OE1   
2151 N NE2   . GLN A 301 ? 0.2808 0.2625 0.2352 0.0062  0.0037  -0.0042 441 GLN A NE2   
2152 N N     . ARG A 302 ? 0.1757 0.1749 0.1064 0.0144  0.0052  -0.0248 442 ARG A N     
2153 C CA    . ARG A 302 ? 0.1707 0.1750 0.0934 0.0158  0.0046  -0.0310 442 ARG A CA    
2154 C C     . ARG A 302 ? 0.2080 0.2171 0.1398 0.0133  0.0001  -0.0401 442 ARG A C     
2155 O O     . ARG A 302 ? 0.1375 0.1537 0.0652 0.0137  -0.0038 -0.0441 442 ARG A O     
2156 C CB    . ARG A 302 ? 0.1530 0.1522 0.0731 0.0146  0.0110  -0.0316 442 ARG A CB    
2157 C CG    . ARG A 302 ? 0.2259 0.2211 0.1419 0.0143  0.0160  -0.0235 442 ARG A CG    
2158 C CD    . ARG A 302 ? 0.2513 0.2450 0.1685 0.0122  0.0223  -0.0260 442 ARG A CD    
2159 N NE    . ARG A 302 ? 0.2359 0.2310 0.1452 0.0116  0.0240  -0.0297 442 ARG A NE    
2160 C CZ    . ARG A 302 ? 0.2981 0.2951 0.2063 0.0106  0.0293  -0.0308 442 ARG A CZ    
2161 N NH1   . ARG A 302 ? 0.2416 0.2387 0.1565 0.0111  0.0327  -0.0280 442 ARG A NH1   
2162 N NH2   . ARG A 302 ? 0.2065 0.2043 0.1057 0.0098  0.0308  -0.0344 442 ARG A NH2   
2163 N N     . GLU A 303 ? 0.1793 0.1835 0.1249 0.0101  0.0008  -0.0425 443 GLU A N     
2164 C CA    . GLU A 303 ? 0.1263 0.1323 0.0813 0.0070  -0.0018 -0.0510 443 GLU A CA    
2165 C C     . GLU A 303 ? 0.1573 0.1693 0.1166 0.0056  -0.0069 -0.0515 443 GLU A C     
2166 O O     . GLU A 303 ? 0.1672 0.1860 0.1285 0.0036  -0.0101 -0.0597 443 GLU A O     
2167 C CB    . GLU A 303 ? 0.1782 0.1755 0.1462 0.0050  0.0005  -0.0516 443 GLU A CB    
2168 C CG    . GLU A 303 ? 0.1745 0.1684 0.1424 0.0063  0.0053  -0.0536 443 GLU A CG    
2169 C CD    . GLU A 303 ? 0.2942 0.2898 0.2621 0.0054  0.0070  -0.0642 443 GLU A CD    
2170 O OE1   . GLU A 303 ? 0.2685 0.2602 0.2472 0.0033  0.0069  -0.0691 443 GLU A OE1   
2171 O OE2   . GLU A 303 ? 0.2465 0.2450 0.2032 0.0064  0.0088  -0.0649 443 GLU A OE2   
2172 N N     . LEU A 304 ? 0.1610 0.1711 0.1225 0.0061  -0.0073 -0.0435 444 LEU A N     
2173 C CA    . LEU A 304 ? 0.1203 0.1366 0.0879 0.0048  -0.0111 -0.0437 444 LEU A CA    
2174 C C     . LEU A 304 ? 0.1581 0.1873 0.1175 0.0081  -0.0156 -0.0456 444 LEU A C     
2175 O O     . LEU A 304 ? 0.1605 0.1994 0.1262 0.0062  -0.0201 -0.0520 444 LEU A O     
2176 C CB    . LEU A 304 ? 0.1745 0.1847 0.1446 0.0049  -0.0093 -0.0344 444 LEU A CB    
2177 C CG    . LEU A 304 ? 0.2291 0.2439 0.2079 0.0031  -0.0113 -0.0342 444 LEU A CG    
2178 C CD1   . LEU A 304 ? 0.2410 0.2525 0.2325 -0.0025 -0.0112 -0.0409 444 LEU A CD1   
2179 C CD2   . LEU A 304 ? 0.1886 0.1965 0.1660 0.0038  -0.0082 -0.0246 444 LEU A CD2   
2180 N N     . ARG A 305 ? 0.1497 0.1791 0.0948 0.0130  -0.0144 -0.0401 445 ARG A N     
2181 C CA    . ARG A 305 ? 0.1595 0.2001 0.0941 0.0175  -0.0190 -0.0406 445 ARG A CA    
2182 C C     . ARG A 305 ? 0.1825 0.2277 0.1150 0.0154  -0.0212 -0.0492 445 ARG A C     
2183 O O     . ARG A 305 ? 0.1760 0.2321 0.1094 0.0157  -0.0269 -0.0525 445 ARG A O     
2184 C CB    . ARG A 305 ? 0.1848 0.2194 0.1056 0.0226  -0.0149 -0.0306 445 ARG A CB    
2185 C CG    . ARG A 305 ? 0.1277 0.1583 0.0503 0.0248  -0.0127 -0.0218 445 ARG A CG    
2186 C CD    . ARG A 305 ? 0.1319 0.1517 0.0457 0.0267  -0.0059 -0.0126 445 ARG A CD    
2187 N NE    . ARG A 305 ? 0.2268 0.2414 0.1434 0.0275  -0.0029 -0.0052 445 ARG A NE    
2188 C CZ    . ARG A 305 ? 0.2931 0.2986 0.2077 0.0273  0.0029  0.0021  445 ARG A CZ    
2189 N NH1   . ARG A 305 ? 0.1843 0.1858 0.0936 0.0268  0.0060  0.0031  445 ARG A NH1   
2190 N NH2   . ARG A 305 ? 0.2384 0.2390 0.1573 0.0268  0.0056  0.0074  445 ARG A NH2   
2191 N N     . ARG A 306 ? 0.1435 0.1803 0.0747 0.0128  -0.0164 -0.0525 446 ARG A N     
2192 C CA    . ARG A 306 ? 0.1543 0.1929 0.0844 0.0099  -0.0171 -0.0606 446 ARG A CA    
2193 C C     . ARG A 306 ? 0.1902 0.2348 0.1345 0.0050  -0.0208 -0.0693 446 ARG A C     
2194 O O     . ARG A 306 ? 0.2293 0.2820 0.1729 0.0035  -0.0247 -0.0748 446 ARG A O     
2195 C CB    . ARG A 306 ? 0.1962 0.2240 0.1245 0.0086  -0.0103 -0.0623 446 ARG A CB    
2196 C CG    . ARG A 306 ? 0.2290 0.2565 0.1542 0.0060  -0.0094 -0.0701 446 ARG A CG    
2197 C CD    . ARG A 306 ? 0.2058 0.2231 0.1281 0.0060  -0.0020 -0.0705 446 ARG A CD    
2198 N NE    . ARG A 306 ? 0.2226 0.2343 0.1599 0.0042  0.0012  -0.0727 446 ARG A NE    
2199 C CZ    . ARG A 306 ? 0.3558 0.3640 0.3023 0.0013  0.0033  -0.0798 446 ARG A CZ    
2200 N NH1   . ARG A 306 ? 0.3220 0.3323 0.2642 -0.0008 0.0028  -0.0864 446 ARG A NH1   
2201 N NH2   . ARG A 306 ? 0.2382 0.2402 0.1982 0.0008  0.0061  -0.0799 446 ARG A NH2   
2202 N N     . PHE A 307 ? 0.1420 0.1816 0.0993 0.0020  -0.0191 -0.0706 447 PHE A N     
2203 C CA    . PHE A 307 ? 0.1465 0.1889 0.1184 -0.0035 -0.0207 -0.0778 447 PHE A CA    
2204 C C     . PHE A 307 ? 0.2211 0.2782 0.1964 -0.0033 -0.0272 -0.0789 447 PHE A C     
2205 O O     . PHE A 307 ? 0.2252 0.2899 0.2057 -0.0067 -0.0298 -0.0860 447 PHE A O     
2206 C CB    . PHE A 307 ? 0.1380 0.1698 0.1217 -0.0062 -0.0171 -0.0766 447 PHE A CB    
2207 C CG    . PHE A 307 ? 0.1486 0.1805 0.1473 -0.0121 -0.0171 -0.0820 447 PHE A CG    
2208 C CD1   . PHE A 307 ? 0.1945 0.2343 0.2007 -0.0136 -0.0202 -0.0818 447 PHE A CD1   
2209 C CD2   . PHE A 307 ? 0.1862 0.2100 0.1917 -0.0159 -0.0130 -0.0871 447 PHE A CD2   
2210 C CE1   . PHE A 307 ? 0.1732 0.2125 0.1936 -0.0195 -0.0186 -0.0865 447 PHE A CE1   
2211 C CE2   . PHE A 307 ? 0.2212 0.2437 0.2393 -0.0212 -0.0115 -0.0911 447 PHE A CE2   
2212 C CZ    . PHE A 307 ? 0.2057 0.2357 0.2311 -0.0233 -0.0140 -0.0909 447 PHE A CZ    
2213 N N     . SER A 308 ? 0.2032 0.2647 0.1760 0.0009  -0.0295 -0.0719 448 SER A N     
2214 C CA    A SER A 308 ? 0.1657 0.2422 0.1441 0.0022  -0.0357 -0.0722 448 SER A CA    
2215 C CA    B SER A 308 ? 0.1750 0.2514 0.1535 0.0021  -0.0357 -0.0723 448 SER A CA    
2216 C C     . SER A 308 ? 0.1977 0.2847 0.1682 0.0043  -0.0405 -0.0748 448 SER A C     
2217 O O     . SER A 308 ? 0.2349 0.3337 0.2146 0.0016  -0.0449 -0.0809 448 SER A O     
2218 C CB    A SER A 308 ? 0.1512 0.2279 0.1256 0.0081  -0.0358 -0.0614 448 SER A CB    
2219 C CB    B SER A 308 ? 0.1792 0.2562 0.1542 0.0079  -0.0359 -0.0616 448 SER A CB    
2220 O OG    A SER A 308 ? 0.2504 0.3427 0.2316 0.0105  -0.0418 -0.0612 448 SER A OG    
2221 O OG    B SER A 308 ? 0.2178 0.2950 0.1748 0.0151  -0.0366 -0.0550 448 SER A OG    
2222 N N     . ARG A 309 ? 0.2261 0.3082 0.1796 0.0087  -0.0392 -0.0702 449 ARG A N     
2223 C CA    . ARG A 309 ? 0.2633 0.3534 0.2064 0.0110  -0.0437 -0.0717 449 ARG A CA    
2224 C C     . ARG A 309 ? 0.2868 0.3773 0.2326 0.0046  -0.0436 -0.0825 449 ARG A C     
2225 O O     . ARG A 309 ? 0.1943 0.2968 0.1432 0.0029  -0.0492 -0.0883 449 ARG A O     
2226 C CB    . ARG A 309 ? 0.2922 0.3738 0.2159 0.0166  -0.0408 -0.0634 449 ARG A CB    
2227 C CG    . ARG A 309 ? 0.2997 0.3874 0.2099 0.0193  -0.0454 -0.0638 449 ARG A CG    
2228 C CD    . ARG A 309 ? 0.3015 0.3785 0.1928 0.0241  -0.0411 -0.0552 449 ARG A CD    
2229 N NE    . ARG A 309 ? 0.3879 0.4639 0.2774 0.0305  -0.0405 -0.0443 449 ARG A NE    
2230 C CZ    . ARG A 309 ? 0.4428 0.5252 0.3254 0.0368  -0.0451 -0.0386 449 ARG A CZ    
2231 N NH1   . ARG A 309 ? 0.4770 0.5682 0.3528 0.0375  -0.0516 -0.0426 449 ARG A NH1   
2232 N NH2   . ARG A 309 ? 0.4799 0.5592 0.3622 0.0425  -0.0429 -0.0287 449 ARG A NH2   
2233 N N     . LYS A 310 ? 0.1830 0.2607 0.1283 0.0011  -0.0371 -0.0854 450 LYS A N     
2234 C CA    . LYS A 310 ? 0.2373 0.3130 0.1820 -0.0039 -0.0357 -0.0946 450 LYS A CA    
2235 C C     . LYS A 310 ? 0.2264 0.3058 0.1891 -0.0106 -0.0359 -0.1032 450 LYS A C     
2236 O O     . LYS A 310 ? 0.2195 0.3044 0.1830 -0.0146 -0.0378 -0.1114 450 LYS A O     
2237 C CB    . LYS A 310 ? 0.2629 0.3235 0.2017 -0.0044 -0.0279 -0.0942 450 LYS A CB    
2238 C CG    . LYS A 310 ? 0.4283 0.4830 0.3496 0.0011  -0.0256 -0.0863 450 LYS A CG    
2239 C CD    . LYS A 310 ? 0.4744 0.5358 0.3798 0.0036  -0.0305 -0.0858 450 LYS A CD    
2240 C CE    . LYS A 310 ? 0.4607 0.5129 0.3482 0.0081  -0.0263 -0.0778 450 LYS A CE    
2241 N NZ    . LYS A 310 ? 0.5073 0.5651 0.3787 0.0113  -0.0314 -0.0753 450 LYS A NZ    
2242 N N     . GLU A 311 ? 0.2076 0.2830 0.1842 -0.0124 -0.0333 -0.1015 451 GLU A N     
2243 C CA    . GLU A 311 ? 0.2061 0.2813 0.1995 -0.0192 -0.0313 -0.1088 451 GLU A CA    
2244 C C     . GLU A 311 ? 0.2919 0.3813 0.2967 -0.0205 -0.0363 -0.1104 451 GLU A C     
2245 O O     . GLU A 311 ? 0.2599 0.3535 0.2761 -0.0264 -0.0359 -0.1182 451 GLU A O     
2246 C CB    . GLU A 311 ? 0.1890 0.2486 0.1909 -0.0210 -0.0243 -0.1060 451 GLU A CB    
2247 C CG    . GLU A 311 ? 0.1695 0.2157 0.1632 -0.0192 -0.0190 -0.1044 451 GLU A CG    
2248 C CD    . GLU A 311 ? 0.3098 0.3547 0.3003 -0.0222 -0.0170 -0.1124 451 GLU A CD    
2249 O OE1   . GLU A 311 ? 0.2911 0.3402 0.2901 -0.0274 -0.0173 -0.1197 451 GLU A OE1   
2250 O OE2   . GLU A 311 ? 0.2932 0.3328 0.2728 -0.0197 -0.0146 -0.1116 451 GLU A OE2   
2251 N N     . LYS A 312 ? 0.2222 0.3191 0.2248 -0.0152 -0.0406 -0.1033 452 LYS A N     
2252 C CA    . LYS A 312 ? 0.1645 0.2750 0.1800 -0.0158 -0.0448 -0.1042 452 LYS A CA    
2253 C C     . LYS A 312 ? 0.2501 0.3772 0.2585 -0.0099 -0.0532 -0.1020 452 LYS A C     
2254 O O     . LYS A 312 ? 0.2778 0.4186 0.2982 -0.0100 -0.0574 -0.1035 452 LYS A O     
2255 C CB    . LYS A 312 ? 0.2020 0.3068 0.2248 -0.0147 -0.0420 -0.0975 452 LYS A CB    
2256 C CG    . LYS A 312 ? 0.2054 0.2923 0.2350 -0.0201 -0.0339 -0.0983 452 LYS A CG    
2257 C CD    . LYS A 312 ? 0.2429 0.3292 0.2876 -0.0277 -0.0305 -0.1063 452 LYS A CD    
2258 C CE    . LYS A 312 ? 0.3412 0.4073 0.3889 -0.0316 -0.0221 -0.1058 452 LYS A CE    
2259 N NZ    . LYS A 312 ? 0.3082 0.3717 0.3699 -0.0385 -0.0174 -0.1119 452 LYS A NZ    
2260 N N     . GLY A 313 ? 0.2358 0.3616 0.2255 -0.0046 -0.0554 -0.0980 453 GLY A N     
2261 C CA    . GLY A 313 ? 0.2476 0.3866 0.2289 0.0019  -0.0630 -0.0943 453 GLY A CA    
2262 C C     . GLY A 313 ? 0.2539 0.3978 0.2371 0.0090  -0.0651 -0.0846 453 GLY A C     
2263 O O     . GLY A 313 ? 0.2084 0.3658 0.1916 0.0140  -0.0718 -0.0824 453 GLY A O     
2264 N N     . LEU A 314 ? 0.1966 0.3296 0.1812 0.0099  -0.0597 -0.0787 454 LEU A N     
2265 C CA    . LEU A 314 ? 0.1935 0.3291 0.1794 0.0165  -0.0604 -0.0691 454 LEU A CA    
2266 C C     . LEU A 314 ? 0.2050 0.3267 0.1723 0.0225  -0.0560 -0.0589 454 LEU A C     
2267 O O     . LEU A 314 ? 0.2054 0.3137 0.1651 0.0196  -0.0507 -0.0599 454 LEU A O     
2268 C CB    . LEU A 314 ? 0.1748 0.3097 0.1797 0.0117  -0.0573 -0.0709 454 LEU A CB    
2269 C CG    . LEU A 314 ? 0.1957 0.3406 0.2209 0.0041  -0.0587 -0.0812 454 LEU A CG    
2270 C CD1   . LEU A 314 ? 0.2136 0.3531 0.2559 -0.0015 -0.0532 -0.0821 454 LEU A CD1   
2271 C CD2   . LEU A 314 ? 0.1534 0.3178 0.1846 0.0081  -0.0662 -0.0819 454 LEU A CD2   
2272 N N     . TRP A 315 ? 0.1684 0.2924 0.1291 0.0309  -0.0574 -0.0490 455 TRP A N     
2273 C CA    . TRP A 315 ? 0.1667 0.2764 0.1096 0.0365  -0.0519 -0.0386 455 TRP A CA    
2274 C C     . TRP A 315 ? 0.2177 0.3205 0.1649 0.0382  -0.0471 -0.0313 455 TRP A C     
2275 O O     . TRP A 315 ? 0.1467 0.2575 0.1023 0.0424  -0.0493 -0.0270 455 TRP A O     
2276 C CB    . TRP A 315 ? 0.2126 0.3258 0.1432 0.0445  -0.0550 -0.0318 455 TRP A CB    
2277 C CG    . TRP A 315 ? 0.2532 0.3731 0.1769 0.0430  -0.0603 -0.0383 455 TRP A CG    
2278 C CD1   . TRP A 315 ? 0.2518 0.3720 0.1773 0.0355  -0.0608 -0.0486 455 TRP A CD1   
2279 C CD2   . TRP A 315 ? 0.3176 0.4441 0.2308 0.0492  -0.0657 -0.0349 455 TRP A CD2   
2280 N NE1   . TRP A 315 ? 0.3413 0.4680 0.2573 0.0363  -0.0661 -0.0520 455 TRP A NE1   
2281 C CE2   . TRP A 315 ? 0.3523 0.4832 0.2601 0.0447  -0.0698 -0.0437 455 TRP A CE2   
2282 C CE3   . TRP A 315 ? 0.3777 0.5057 0.2849 0.0583  -0.0673 -0.0251 455 TRP A CE3   
2283 C CZ2   . TRP A 315 ? 0.4176 0.5553 0.3134 0.0487  -0.0762 -0.0430 455 TRP A CZ2   
2284 C CZ3   . TRP A 315 ? 0.4274 0.5619 0.3234 0.0627  -0.0736 -0.0243 455 TRP A CZ3   
2285 C CH2   . TRP A 315 ? 0.3887 0.5282 0.2785 0.0579  -0.0784 -0.0331 455 TRP A CH2   
2286 N N     . LEU A 316 ? 0.1899 0.2777 0.1315 0.0351  -0.0404 -0.0300 456 LEU A N     
2287 C CA    . LEU A 316 ? 0.1320 0.2084 0.0784 0.0342  -0.0338 -0.0231 456 LEU A CA    
2288 C C     . LEU A 316 ? 0.1490 0.2122 0.0781 0.0394  -0.0274 -0.0129 456 LEU A C     
2289 O O     . LEU A 316 ? 0.1806 0.2356 0.0996 0.0383  -0.0242 -0.0131 456 LEU A O     
2290 C CB    . LEU A 316 ? 0.1225 0.1888 0.0789 0.0252  -0.0293 -0.0283 456 LEU A CB    
2291 C CG    . LEU A 316 ? 0.1261 0.1774 0.0867 0.0227  -0.0218 -0.0212 456 LEU A CG    
2292 C CD1   . LEU A 316 ? 0.1076 0.1631 0.0816 0.0224  -0.0216 -0.0185 456 LEU A CD1   
2293 C CD2   . LEU A 316 ? 0.1076 0.1485 0.0736 0.0157  -0.0185 -0.0258 456 LEU A CD2   
2294 N N     . ASN A 317 ? 0.1510 0.2086 0.0818 0.0425  -0.0231 -0.0039 457 ASN A N     
2295 C CA    . ASN A 317 ? 0.1522 0.1935 0.0719 0.0442  -0.0145 0.0049  457 ASN A CA    
2296 C C     . ASN A 317 ? 0.1925 0.2262 0.1186 0.0432  -0.0090 0.0108  457 ASN A C     
2297 O O     . ASN A 317 ? 0.1880 0.2263 0.1301 0.0392  -0.0106 0.0076  457 ASN A O     
2298 C CB    . ASN A 317 ? 0.1888 0.2293 0.1004 0.0500  -0.0139 0.0099  457 ASN A CB    
2299 C CG    . ASN A 317 ? 0.2110 0.2622 0.1274 0.0572  -0.0180 0.0139  457 ASN A CG    
2300 O OD1   . ASN A 317 ? 0.2306 0.2851 0.1562 0.0581  -0.0178 0.0161  457 ASN A OD1   
2301 N ND2   . ASN A 317 ? 0.2145 0.2711 0.1246 0.0627  -0.0216 0.0152  457 ASN A ND2   
2302 N N     A SER A 318 ? 0.1883 0.2075 0.1095 0.0428  -0.0009 0.0174  458 SER A N     
2303 N N     B SER A 318 ? 0.1890 0.2082 0.1102 0.0428  -0.0008 0.0174  458 SER A N     
2304 C CA    A SER A 318 ? 0.1823 0.1921 0.1086 0.0404  0.0054  0.0222  458 SER A CA    
2305 C CA    B SER A 318 ? 0.1735 0.1833 0.0998 0.0404  0.0054  0.0222  458 SER A CA    
2306 C C     A SER A 318 ? 0.2174 0.2334 0.1476 0.0471  0.0051  0.0275  458 SER A C     
2307 C C     B SER A 318 ? 0.2255 0.2413 0.1557 0.0472  0.0052  0.0276  458 SER A C     
2308 O O     A SER A 318 ? 0.2010 0.2088 0.1360 0.0451  0.0111  0.0313  458 SER A O     
2309 O O     B SER A 318 ? 0.2041 0.2115 0.1389 0.0451  0.0113  0.0314  458 SER A O     
2310 C CB    A SER A 318 ? 0.2031 0.1986 0.1289 0.0357  0.0122  0.0239  458 SER A CB    
2311 C CB    B SER A 318 ? 0.2003 0.1957 0.1262 0.0354  0.0123  0.0238  458 SER A CB    
2312 O OG    A SER A 318 ? 0.2295 0.2217 0.1538 0.0303  0.0122  0.0197  458 SER A OG    
2313 O OG    B SER A 318 ? 0.2040 0.1979 0.1253 0.0401  0.0139  0.0267  458 SER A OG    
2314 N N     . HIS A 319 ? 0.1830 0.2136 0.1132 0.0546  -0.0020 0.0273  459 HIS A N     
2315 C CA    . HIS A 319 ? 0.1752 0.2149 0.1137 0.0617  -0.0036 0.0317  459 HIS A CA    
2316 C C     . HIS A 319 ? 0.2080 0.2651 0.1670 0.0587  -0.0110 0.0238  459 HIS A C     
2317 O O     . HIS A 319 ? 0.2288 0.2918 0.2013 0.0611  -0.0101 0.0257  459 HIS A O     
2318 C CB    . HIS A 319 ? 0.2145 0.2580 0.1463 0.0692  -0.0056 0.0343  459 HIS A CB    
2319 C CG    . HIS A 319 ? 0.3610 0.3866 0.2829 0.0684  0.0036  0.0383  459 HIS A CG    
2320 N ND1   . HIS A 319 ? 0.4293 0.4398 0.3533 0.0636  0.0130  0.0406  459 HIS A ND1   
2321 C CD2   . HIS A 319 ? 0.4710 0.4926 0.3829 0.0712  0.0042  0.0394  459 HIS A CD2   
2322 C CE1   . HIS A 319 ? 0.4980 0.4978 0.4156 0.0634  0.0180  0.0418  459 HIS A CE1   
2323 N NE2   . HIS A 319 ? 0.5468 0.5522 0.4562 0.0684  0.0135  0.0419  459 HIS A NE2   
2324 N N     . GLY A 320 ? 0.1844 0.2496 0.1469 0.0534  -0.0174 0.0145  460 GLY A N     
2325 C CA    . GLY A 320 ? 0.1905 0.2734 0.1721 0.0505  -0.0244 0.0060  460 GLY A CA    
2326 C C     . GLY A 320 ? 0.1940 0.2844 0.1744 0.0457  -0.0311 -0.0041 460 GLY A C     
2327 O O     . GLY A 320 ? 0.1676 0.2489 0.1334 0.0444  -0.0297 -0.0046 460 GLY A O     
2328 N N     . LEU A 321 ? 0.1526 0.2601 0.1500 0.0427  -0.0375 -0.0129 461 LEU A N     
2329 C CA    . LEU A 321 ? 0.1554 0.2716 0.1547 0.0372  -0.0437 -0.0244 461 LEU A CA    
2330 C C     . LEU A 321 ? 0.1289 0.2701 0.1356 0.0418  -0.0546 -0.0298 461 LEU A C     
2331 O O     . LEU A 321 ? 0.1724 0.3266 0.1983 0.0418  -0.0566 -0.0317 461 LEU A O     
2332 C CB    . LEU A 321 ? 0.1202 0.2306 0.1350 0.0262  -0.0396 -0.0318 461 LEU A CB    
2333 C CG    . LEU A 321 ? 0.1799 0.2962 0.1986 0.0191  -0.0438 -0.0444 461 LEU A CG    
2334 C CD1   . LEU A 321 ? 0.1376 0.2456 0.1368 0.0203  -0.0440 -0.0448 461 LEU A CD1   
2335 C CD2   . LEU A 321 ? 0.1261 0.2323 0.1591 0.0093  -0.0375 -0.0492 461 LEU A CD2   
2336 N N     . PHE A 322 ? 0.1709 0.3147 0.1627 0.0442  -0.0594 -0.0319 462 PHE A N     
2337 C CA    . PHE A 322 ? 0.1998 0.3578 0.1929 0.0485  -0.0665 -0.0331 462 PHE A CA    
2338 C C     . PHE A 322 ? 0.2504 0.4172 0.2483 0.0409  -0.0715 -0.0457 462 PHE A C     
2339 O O     . PHE A 322 ? 0.2129 0.3702 0.1998 0.0364  -0.0694 -0.0498 462 PHE A O     
2340 C CB    . PHE A 322 ? 0.1817 0.3314 0.1525 0.0572  -0.0659 -0.0234 462 PHE A CB    
2341 C CG    . PHE A 322 ? 0.2111 0.3746 0.1814 0.0630  -0.0738 -0.0230 462 PHE A CG    
2342 C CD1   . PHE A 322 ? 0.2688 0.4444 0.2532 0.0684  -0.0770 -0.0195 462 PHE A CD1   
2343 C CD2   . PHE A 322 ? 0.2868 0.4510 0.2425 0.0632  -0.0780 -0.0259 462 PHE A CD2   
2344 C CE1   . PHE A 322 ? 0.2546 0.4435 0.2387 0.0742  -0.0850 -0.0189 462 PHE A CE1   
2345 C CE2   . PHE A 322 ? 0.3229 0.5001 0.2768 0.0688  -0.0861 -0.0252 462 PHE A CE2   
2346 C CZ    . PHE A 322 ? 0.2845 0.4744 0.2527 0.0744  -0.0900 -0.0217 462 PHE A CZ    
2347 N N     . ASP A 323 ? 0.1907 0.3748 0.2056 0.0393  -0.0772 -0.0518 463 ASP A N     
2348 C CA    . ASP A 323 ? 0.2578 0.4518 0.2770 0.0330  -0.0823 -0.0632 463 ASP A CA    
2349 C C     . ASP A 323 ? 0.2993 0.5014 0.3048 0.0401  -0.0898 -0.0604 463 ASP A C     
2350 O O     . ASP A 323 ? 0.3123 0.5279 0.3253 0.0460  -0.0953 -0.0572 463 ASP A O     
2351 C CB    . ASP A 323 ? 0.2476 0.4553 0.2931 0.0265  -0.0836 -0.0718 463 ASP A CB    
2352 C CG    . ASP A 323 ? 0.3476 0.5645 0.3982 0.0190  -0.0876 -0.0843 463 ASP A CG    
2353 O OD1   . ASP A 323 ? 0.3168 0.5357 0.3518 0.0212  -0.0925 -0.0854 463 ASP A OD1   
2354 O OD2   . ASP A 323 ? 0.3294 0.5505 0.3992 0.0105  -0.0850 -0.0930 463 ASP A OD2   
2355 N N     . PRO A 324 ? 0.2535 0.4476 0.2393 0.0398  -0.0900 -0.0612 464 PRO A N     
2356 C CA    . PRO A 324 ? 0.2933 0.4928 0.2635 0.0470  -0.0967 -0.0571 464 PRO A CA    
2357 C C     . PRO A 324 ? 0.3764 0.5958 0.3556 0.0447  -0.1063 -0.0660 464 PRO A C     
2358 O O     . PRO A 324 ? 0.4358 0.6631 0.4053 0.0516  -0.1135 -0.0621 464 PRO A O     
2359 C CB    . PRO A 324 ? 0.3532 0.5365 0.3011 0.0455  -0.0924 -0.0565 464 PRO A CB    
2360 C CG    . PRO A 324 ? 0.2830 0.4605 0.2397 0.0352  -0.0873 -0.0660 464 PRO A CG    
2361 C CD    . PRO A 324 ? 0.3028 0.4827 0.2805 0.0327  -0.0842 -0.0663 464 PRO A CD    
2362 N N     . GLU A 325 ? 0.4085 0.6354 0.4055 0.0351  -0.1063 -0.0778 465 GLU A N     
2363 C CA    . GLU A 325 ? 0.4090 0.6557 0.4170 0.0320  -0.1149 -0.0870 465 GLU A CA    
2364 C C     . GLU A 325 ? 0.4900 0.7533 0.5179 0.0364  -0.1194 -0.0845 465 GLU A C     
2365 O O     . GLU A 325 ? 0.6125 0.8906 0.6396 0.0424  -0.1286 -0.0827 465 GLU A O     
2366 C CB    . GLU A 325 ? 0.3909 0.6374 0.4104 0.0196  -0.1116 -0.1007 465 GLU A CB    
2367 N N     . GLN A 326 ? 0.4718 0.7325 0.5179 0.0334  -0.1130 -0.0841 466 GLN A N     
2368 C CA    . GLN A 326 ? 0.3609 0.6358 0.4274 0.0373  -0.1155 -0.0813 466 GLN A CA    
2369 C C     . GLN A 326 ? 0.3953 0.6656 0.4530 0.0497  -0.1154 -0.0665 466 GLN A C     
2370 O O     . GLN A 326 ? 0.4182 0.7005 0.4914 0.0548  -0.1181 -0.0628 466 GLN A O     
2371 C CB    . GLN A 326 ? 0.3541 0.6263 0.4430 0.0288  -0.1074 -0.0865 466 GLN A CB    
2372 N N     . LYS A 327 ? 0.3191 0.5719 0.3530 0.0545  -0.1117 -0.0583 467 LYS A N     
2373 C CA    . LYS A 327 ? 0.3386 0.5833 0.3621 0.0658  -0.1095 -0.0441 467 LYS A CA    
2374 C C     . LYS A 327 ? 0.3139 0.5577 0.3562 0.0667  -0.1034 -0.0397 467 LYS A C     
2375 O O     . LYS A 327 ? 0.3252 0.5760 0.3757 0.0747  -0.1051 -0.0325 467 LYS A O     
2376 C CB    . LYS A 327 ? 0.3950 0.6519 0.4124 0.0753  -0.1189 -0.0392 467 LYS A CB    
2377 C CG    . LYS A 327 ? 0.3894 0.6453 0.3848 0.0755  -0.1245 -0.0417 467 LYS A CG    
2378 N N     . THR A 328 ? 0.2381 0.4727 0.2874 0.0584  -0.0958 -0.0439 468 THR A N     
2379 C CA    . THR A 328 ? 0.2412 0.4737 0.3083 0.0576  -0.0891 -0.0408 468 THR A CA    
2380 C C     . THR A 328 ? 0.2214 0.4335 0.2775 0.0553  -0.0800 -0.0368 468 THR A C     
2381 O O     . THR A 328 ? 0.2857 0.4880 0.3280 0.0504  -0.0788 -0.0406 468 THR A O     
2382 C CB    . THR A 328 ? 0.2349 0.4804 0.3294 0.0478  -0.0890 -0.0523 468 THR A CB    
2383 O OG1   . THR A 328 ? 0.3422 0.5830 0.4338 0.0372  -0.0880 -0.0631 468 THR A OG1   
2384 C CG2   . THR A 328 ? 0.2413 0.5085 0.3498 0.0506  -0.0977 -0.0556 468 THR A CG2   
2385 N N     . PHE A 329 ? 0.1808 0.3868 0.2438 0.0589  -0.0733 -0.0289 469 PHE A N     
2386 C CA    . PHE A 329 ? 0.1906 0.3793 0.2469 0.0566  -0.0647 -0.0249 469 PHE A CA    
2387 C C     . PHE A 329 ? 0.2202 0.4119 0.3004 0.0475  -0.0595 -0.0320 469 PHE A C     
2388 O O     . PHE A 329 ? 0.2324 0.4348 0.3339 0.0472  -0.0584 -0.0334 469 PHE A O     
2389 C CB    . PHE A 329 ? 0.2471 0.4236 0.2924 0.0667  -0.0586 -0.0107 469 PHE A CB    
2390 C CG    . PHE A 329 ? 0.3023 0.4682 0.3208 0.0737  -0.0597 -0.0032 469 PHE A CG    
2391 C CD1   . PHE A 329 ? 0.3021 0.4501 0.2999 0.0719  -0.0549 -0.0005 469 PHE A CD1   
2392 C CD2   . PHE A 329 ? 0.3203 0.4936 0.3352 0.0818  -0.0648 0.0011  469 PHE A CD2   
2393 C CE1   . PHE A 329 ? 0.2540 0.3911 0.2292 0.0770  -0.0537 0.0056  469 PHE A CE1   
2394 C CE2   . PHE A 329 ? 0.2626 0.4251 0.2536 0.0877  -0.0645 0.0076  469 PHE A CE2   
2395 C CZ    . PHE A 329 ? 0.2883 0.4323 0.2598 0.0848  -0.0583 0.0096  469 PHE A CZ    
2396 N N     A PHE A 330 ? 0.1627 0.3374 0.2369 0.0381  -0.0536 -0.0355 470 PHE A N     
2397 N N     B PHE A 330 ? 0.1636 0.3377 0.2376 0.0383  -0.0533 -0.0351 470 PHE A N     
2398 C CA    A PHE A 330 ? 0.1606 0.3257 0.2505 0.0277  -0.0447 -0.0395 470 PHE A CA    
2399 C CA    B PHE A 330 ? 0.1603 0.3256 0.2506 0.0276  -0.0447 -0.0397 470 PHE A CA    
2400 C C     A PHE A 330 ? 0.1896 0.3374 0.2773 0.0301  -0.0341 -0.0283 470 PHE A C     
2401 C C     B PHE A 330 ? 0.1890 0.3357 0.2767 0.0292  -0.0337 -0.0287 470 PHE A C     
2402 O O     A PHE A 330 ? 0.2463 0.3774 0.3144 0.0343  -0.0302 -0.0190 470 PHE A O     
2403 O O     B PHE A 330 ? 0.2559 0.3842 0.3240 0.0321  -0.0292 -0.0201 470 PHE A O     
2404 C CB    A PHE A 330 ? 0.1637 0.3130 0.2456 0.0181  -0.0413 -0.0452 470 PHE A CB    
2405 C CB    B PHE A 330 ? 0.1723 0.3238 0.2555 0.0178  -0.0422 -0.0464 470 PHE A CB    
2406 C CG    A PHE A 330 ? 0.1880 0.3519 0.2734 0.0136  -0.0496 -0.0579 470 PHE A CG    
2407 C CG    B PHE A 330 ? 0.1439 0.2792 0.2368 0.0081  -0.0319 -0.0477 470 PHE A CG    
2408 C CD1   A PHE A 330 ? 0.1353 0.3061 0.2040 0.0191  -0.0579 -0.0587 470 PHE A CD1   
2409 C CD1   B PHE A 330 ? 0.1346 0.2797 0.2505 0.0009  -0.0302 -0.0565 470 PHE A CD1   
2410 C CD2   A PHE A 330 ? 0.2077 0.3769 0.3122 0.0032  -0.0482 -0.0696 470 PHE A CD2   
2411 C CD2   B PHE A 330 ? 0.1851 0.2954 0.2636 0.0061  -0.0238 -0.0404 470 PHE A CD2   
2412 C CE1   A PHE A 330 ? 0.1581 0.3342 0.2257 0.0140  -0.0621 -0.0686 470 PHE A CE1   
2413 C CE1   B PHE A 330 ? 0.1322 0.2602 0.2546 -0.0078 -0.0199 -0.0571 470 PHE A CE1   
2414 C CE2   A PHE A 330 ? 0.2467 0.4223 0.3505 -0.0015 -0.0529 -0.0798 470 PHE A CE2   
2415 C CE2   B PHE A 330 ? 0.1631 0.2578 0.2480 -0.0021 -0.0150 -0.0410 470 PHE A CE2   
2416 C CZ    A PHE A 330 ? 0.1892 0.3677 0.2743 0.0039  -0.0596 -0.0790 470 PHE A CZ    
2417 C CZ    B PHE A 330 ? 0.1626 0.2651 0.2684 -0.0089 -0.0126 -0.0489 470 PHE A CZ    
2418 N N     . GLN A 331 ? 0.1414 0.2931 0.2494 0.0269  -0.0288 -0.0298 471 GLN A N     
2419 C CA    . GLN A 331 ? 0.2458 0.3797 0.3523 0.0272  -0.0174 -0.0208 471 GLN A CA    
2420 C C     . GLN A 331 ? 0.2940 0.4053 0.3951 0.0162  -0.0088 -0.0223 471 GLN A C     
2421 O O     . GLN A 331 ? 0.4633 0.5769 0.5772 0.0073  -0.0078 -0.0313 471 GLN A O     
2422 C CB    . GLN A 331 ? 0.3746 0.5221 0.5049 0.0290  -0.0145 -0.0217 471 GLN A CB    
2423 C CG    . GLN A 331 ? 0.5281 0.6996 0.6659 0.0412  -0.0237 -0.0196 471 GLN A CG    
2424 C CD    . GLN A 331 ? 0.6911 0.8532 0.8056 0.0525  -0.0247 -0.0076 471 GLN A CD    
2425 O OE1   . GLN A 331 ? 0.7827 0.9231 0.8852 0.0533  -0.0147 0.0012  471 GLN A OE1   
2426 N NE2   . GLN A 331 ? 0.6824 0.8599 0.7893 0.0609  -0.0364 -0.0076 471 GLN A NE2   
2427 N N     . ALA A 332 ? 0.1850 0.2748 0.2670 0.0170  -0.0029 -0.0137 472 ALA A N     
2428 C CA    . ALA A 332 ? 0.1406 0.2087 0.2152 0.0082  0.0043  -0.0135 472 ALA A CA    
2429 C C     . ALA A 332 ? 0.1515 0.2032 0.2223 0.0076  0.0148  -0.0056 472 ALA A C     
2430 O O     . ALA A 332 ? 0.1665 0.2154 0.2290 0.0146  0.0168  0.0022  472 ALA A O     
2431 C CB    . ALA A 332 ? 0.0876 0.1450 0.1426 0.0085  0.0014  -0.0118 472 ALA A CB    
2432 N N     . ALA A 333 ? 0.1477 0.1873 0.2237 -0.0011 0.0222  -0.0077 473 ALA A N     
2433 C CA    . ALA A 333 ? 0.1617 0.1828 0.2308 -0.0035 0.0327  -0.0010 473 ALA A CA    
2434 C C     . ALA A 333 ? 0.1728 0.1719 0.2222 -0.0080 0.0353  0.0027  473 ALA A C     
2435 O O     . ALA A 333 ? 0.1522 0.1349 0.1918 -0.0101 0.0431  0.0084  473 ALA A O     
2436 C CB    . ALA A 333 ? 0.2020 0.2226 0.2879 -0.0100 0.0405  -0.0052 473 ALA A CB    
2437 N N     . SER A 334 ? 0.1448 0.1439 0.1886 -0.0094 0.0289  -0.0006 474 SER A N     
2438 C CA    . SER A 334 ? 0.1721 0.1527 0.2006 -0.0135 0.0304  0.0022  474 SER A CA    
2439 C C     . SER A 334 ? 0.1191 0.1051 0.1431 -0.0116 0.0222  -0.0012 474 SER A C     
2440 O O     . SER A 334 ? 0.1113 0.1134 0.1443 -0.0095 0.0162  -0.0072 474 SER A O     
2441 C CB    . SER A 334 ? 0.1387 0.1061 0.1705 -0.0218 0.0362  0.0000  474 SER A CB    
2442 O OG    . SER A 334 ? 0.1650 0.1414 0.2106 -0.0250 0.0331  -0.0085 474 SER A OG    
2443 N N     . GLU A 335 ? 0.1377 0.1105 0.1478 -0.0127 0.0222  0.0023  475 GLU A N     
2444 C CA    . GLU A 335 ? 0.1002 0.0755 0.1075 -0.0120 0.0162  -0.0016 475 GLU A CA    
2445 C C     . GLU A 335 ? 0.1551 0.1319 0.1738 -0.0169 0.0151  -0.0093 475 GLU A C     
2446 O O     . GLU A 335 ? 0.1167 0.1039 0.1400 -0.0159 0.0099  -0.0158 475 GLU A O     
2447 C CB    . GLU A 335 ? 0.1049 0.0662 0.0983 -0.0126 0.0169  0.0032  475 GLU A CB    
2448 C CG    . GLU A 335 ? 0.1391 0.0992 0.1212 -0.0085 0.0181  0.0093  475 GLU A CG    
2449 C CD    . GLU A 335 ? 0.1989 0.1483 0.1698 -0.0097 0.0179  0.0124  475 GLU A CD    
2450 O OE1   . GLU A 335 ? 0.1330 0.0766 0.1046 -0.0127 0.0176  0.0125  475 GLU A OE1   
2451 O OE2   . GLU A 335 ? 0.1835 0.1363 0.1479 -0.0064 0.0163  0.0134  475 GLU A OE2   
2452 N N     . GLU A 336 ? 0.1329 0.0983 0.1553 -0.0226 0.0210  -0.0090 476 GLU A N     
2453 C CA    . GLU A 336 ? 0.1525 0.1174 0.1862 -0.0279 0.0219  -0.0164 476 GLU A CA    
2454 C C     . GLU A 336 ? 0.1243 0.1102 0.1737 -0.0276 0.0181  -0.0250 476 GLU A C     
2455 O O     . GLU A 336 ? 0.1215 0.1125 0.1776 -0.0300 0.0151  -0.0330 476 GLU A O     
2456 C CB    . GLU A 336 ? 0.2080 0.1588 0.2423 -0.0332 0.0298  -0.0140 476 GLU A CB    
2457 C CG    . GLU A 336 ? 0.2224 0.1616 0.2386 -0.0298 0.0278  -0.0060 476 GLU A CG    
2458 C CD    . GLU A 336 ? 0.2396 0.1734 0.2535 -0.0310 0.0308  -0.0042 476 GLU A CD    
2459 O OE1   . GLU A 336 ? 0.2050 0.1363 0.2106 -0.0292 0.0315  0.0008  476 GLU A OE1   
2460 O OE2   . GLU A 336 ? 0.1292 0.0618 0.1501 -0.0339 0.0327  -0.0087 476 GLU A OE2   
2461 N N     . ASP A 337 ? 0.1315 0.1298 0.1871 -0.0245 0.0181  -0.0236 477 ASP A N     
2462 C CA    . ASP A 337 ? 0.1052 0.1264 0.1756 -0.0229 0.0127  -0.0313 477 ASP A CA    
2463 C C     . ASP A 337 ? 0.1551 0.1866 0.2196 -0.0188 0.0040  -0.0351 477 ASP A C     
2464 O O     . ASP A 337 ? 0.1176 0.1623 0.1922 -0.0211 -0.0006 -0.0447 477 ASP A O     
2465 C CB    . ASP A 337 ? 0.1395 0.1722 0.2150 -0.0174 0.0130  -0.0272 477 ASP A CB    
2466 C CG    . ASP A 337 ? 0.1596 0.1964 0.2532 -0.0220 0.0193  -0.0304 477 ASP A CG    
2467 O OD1   . ASP A 337 ? 0.1566 0.1885 0.2593 -0.0301 0.0233  -0.0369 477 ASP A OD1   
2468 O OD2   . ASP A 337 ? 0.1472 0.1917 0.2463 -0.0175 0.0210  -0.0266 477 ASP A OD2   
2469 N N     . ILE A 338 ? 0.1311 0.1568 0.1793 -0.0133 0.0021  -0.0282 478 ILE A N     
2470 C CA    . ILE A 338 ? 0.0895 0.1246 0.1304 -0.0089 -0.0050 -0.0311 478 ILE A CA    
2471 C C     . ILE A 338 ? 0.1630 0.1929 0.2043 -0.0137 -0.0060 -0.0384 478 ILE A C     
2472 O O     . ILE A 338 ? 0.1310 0.1732 0.1759 -0.0139 -0.0113 -0.0468 478 ILE A O     
2473 C CB    . ILE A 338 ? 0.1353 0.1637 0.1591 -0.0027 -0.0047 -0.0220 478 ILE A CB    
2474 C CG1   . ILE A 338 ? 0.1201 0.1529 0.1439 0.0024  -0.0028 -0.0151 478 ILE A CG1   
2475 C CG2   . ILE A 338 ? 0.1150 0.1514 0.1299 0.0015  -0.0107 -0.0250 478 ILE A CG2   
2476 C CD1   . ILE A 338 ? 0.1039 0.1271 0.1115 0.0073  0.0000  -0.0060 478 ILE A CD1   
2477 N N     . PHE A 339 ? 0.1268 0.1381 0.1639 -0.0172 -0.0010 -0.0353 479 PHE A N     
2478 C CA    . PHE A 339 ? 0.0977 0.1020 0.1369 -0.0213 -0.0007 -0.0418 479 PHE A CA    
2479 C C     . PHE A 339 ? 0.1321 0.1448 0.1870 -0.0272 -0.0006 -0.0524 479 PHE A C     
2480 O O     . PHE A 339 ? 0.1370 0.1551 0.1949 -0.0291 -0.0034 -0.0613 479 PHE A O     
2481 C CB    . PHE A 339 ? 0.1001 0.0832 0.1338 -0.0236 0.0047  -0.0358 479 PHE A CB    
2482 C CG    . PHE A 339 ? 0.1346 0.1106 0.1548 -0.0190 0.0035  -0.0289 479 PHE A CG    
2483 C CD1   . PHE A 339 ? 0.1667 0.1392 0.1781 -0.0162 0.0048  -0.0201 479 PHE A CD1   
2484 C CD2   . PHE A 339 ? 0.1196 0.0922 0.1371 -0.0179 0.0017  -0.0320 479 PHE A CD2   
2485 C CE1   . PHE A 339 ? 0.2038 0.1708 0.2043 -0.0129 0.0040  -0.0150 479 PHE A CE1   
2486 C CE2   . PHE A 339 ? 0.1376 0.1053 0.1450 -0.0140 0.0009  -0.0264 479 PHE A CE2   
2487 C CZ    . PHE A 339 ? 0.0942 0.0596 0.0935 -0.0119 0.0019  -0.0182 479 PHE A CZ    
2488 N N     . ARG A 340 ? 0.1630 0.1768 0.2284 -0.0308 0.0034  -0.0524 480 ARG A N     
2489 C CA    . ARG A 340 ? 0.1202 0.1425 0.2027 -0.0376 0.0045  -0.0633 480 ARG A CA    
2490 C C     . ARG A 340 ? 0.1365 0.1838 0.2258 -0.0356 -0.0039 -0.0718 480 ARG A C     
2491 O O     . ARG A 340 ? 0.1879 0.2422 0.2858 -0.0407 -0.0056 -0.0831 480 ARG A O     
2492 C CB    . ARG A 340 ? 0.1105 0.1300 0.2037 -0.0417 0.0114  -0.0613 480 ARG A CB    
2493 C CG    . ARG A 340 ? 0.2146 0.2089 0.3007 -0.0451 0.0203  -0.0551 480 ARG A CG    
2494 C CD    . ARG A 340 ? 0.1941 0.1866 0.2879 -0.0480 0.0276  -0.0535 480 ARG A CD    
2495 N NE    . ARG A 340 ? 0.1681 0.1654 0.2652 -0.0467 0.0290  -0.0489 480 ARG A NE    
2496 C CZ    . ARG A 340 ? 0.1790 0.1602 0.2626 -0.0446 0.0341  -0.0384 480 ARG A CZ    
2497 N NH1   . ARG A 340 ? 0.1457 0.1085 0.2118 -0.0431 0.0361  -0.0314 480 ARG A NH1   
2498 N NH2   . ARG A 340 ? 0.2467 0.2331 0.3334 -0.0429 0.0361  -0.0343 480 ARG A NH2   
2499 N N     A HIS A 341 ? 0.1674 0.2278 0.2522 -0.0282 -0.0092 -0.0664 481 HIS A N     
2500 N N     B HIS A 341 ? 0.1661 0.2264 0.2504 -0.0281 -0.0094 -0.0665 481 HIS A N     
2501 C CA    A HIS A 341 ? 0.1894 0.2731 0.2768 -0.0245 -0.0185 -0.0728 481 HIS A CA    
2502 C CA    B HIS A 341 ? 0.1866 0.2708 0.2754 -0.0253 -0.0184 -0.0738 481 HIS A CA    
2503 C C     A HIS A 341 ? 0.2044 0.2879 0.2827 -0.0252 -0.0225 -0.0795 481 HIS A C     
2504 C C     B HIS A 341 ? 0.1994 0.2843 0.2766 -0.0242 -0.0233 -0.0789 481 HIS A C     
2505 O O     A HIS A 341 ? 0.1126 0.2109 0.1976 -0.0281 -0.0276 -0.0904 481 HIS A O     
2506 O O     B HIS A 341 ? 0.1117 0.2143 0.1931 -0.0250 -0.0302 -0.0885 481 HIS A O     
2507 C CB    A HIS A 341 ? 0.1966 0.2878 0.2743 -0.0146 -0.0225 -0.0630 481 HIS A CB    
2508 C CB    B HIS A 341 ? 0.1967 0.2927 0.2814 -0.0162 -0.0226 -0.0657 481 HIS A CB    
2509 C CG    A HIS A 341 ? 0.1932 0.2912 0.2827 -0.0128 -0.0200 -0.0587 481 HIS A CG    
2510 C CG    B HIS A 341 ? 0.1789 0.3018 0.2737 -0.0135 -0.0317 -0.0727 481 HIS A CG    
2511 N ND1   A HIS A 341 ? 0.2128 0.3227 0.3237 -0.0184 -0.0190 -0.0665 481 HIS A ND1   
2512 N ND1   B HIS A 341 ? 0.1972 0.3352 0.3144 -0.0183 -0.0320 -0.0806 481 HIS A ND1   
2513 C CD2   A HIS A 341 ? 0.1516 0.2458 0.2352 -0.0063 -0.0175 -0.0478 481 HIS A CD2   
2514 C CD2   B HIS A 341 ? 0.1862 0.3242 0.2718 -0.0065 -0.0410 -0.0734 481 HIS A CD2   
2515 C CE1   A HIS A 341 ? 0.1614 0.2751 0.2797 -0.0149 -0.0160 -0.0604 481 HIS A CE1   
2516 C CE1   B HIS A 341 ? 0.2245 0.3850 0.3450 -0.0138 -0.0415 -0.0848 481 HIS A CE1   
2517 N NE2   A HIS A 341 ? 0.1784 0.2822 0.2799 -0.0075 -0.0150 -0.0489 481 HIS A NE2   
2518 N NE2   B HIS A 341 ? 0.1970 0.3584 0.2982 -0.0065 -0.0476 -0.0807 481 HIS A NE2   
2519 N N     . LEU A 342 ? 0.1881 0.2550 0.2513 -0.0227 -0.0199 -0.0732 482 LEU A N     
2520 C CA    . LEU A 342 ? 0.1855 0.2506 0.2391 -0.0224 -0.0224 -0.0785 482 LEU A CA    
2521 C C     . LEU A 342 ? 0.1588 0.2122 0.2194 -0.0301 -0.0174 -0.0865 482 LEU A C     
2522 O O     . LEU A 342 ? 0.2223 0.2709 0.2751 -0.0293 -0.0171 -0.0888 482 LEU A O     
2523 C CB    . LEU A 342 ? 0.1378 0.1911 0.1742 -0.0162 -0.0210 -0.0685 482 LEU A CB    
2524 C CG    . LEU A 342 ? 0.1303 0.1913 0.1565 -0.0082 -0.0243 -0.0597 482 LEU A CG    
2525 C CD1   . LEU A 342 ? 0.1801 0.2269 0.1914 -0.0042 -0.0208 -0.0507 482 LEU A CD1   
2526 C CD2   . LEU A 342 ? 0.1446 0.2244 0.1665 -0.0046 -0.0323 -0.0654 482 LEU A CD2   
2527 N N     . GLY A 343 ? 0.1968 0.2428 0.2691 -0.0354 -0.0113 -0.0865 483 GLY A N     
2528 C CA    . GLY A 343 ? 0.1738 0.2057 0.2488 -0.0397 -0.0047 -0.0886 483 GLY A CA    
2529 C C     . GLY A 343 ? 0.2125 0.2240 0.2776 -0.0377 -0.0007 -0.0822 483 GLY A C     
2530 O O     . GLY A 343 ? 0.2149 0.2185 0.2790 -0.0388 0.0022  -0.0847 483 GLY A O     
2531 N N     . LEU A 344 ? 0.1298 0.1332 0.1881 -0.0346 -0.0006 -0.0741 484 LEU A N     
2532 C CA    . LEU A 344 ? 0.1556 0.1412 0.2050 -0.0318 0.0023  -0.0670 484 LEU A CA    
2533 C C     . LEU A 344 ? 0.2409 0.2108 0.2896 -0.0329 0.0078  -0.0579 484 LEU A C     
2534 O O     . LEU A 344 ? 0.1854 0.1575 0.2371 -0.0345 0.0090  -0.0552 484 LEU A O     
2535 C CB    . LEU A 344 ? 0.1140 0.1029 0.1519 -0.0256 -0.0016 -0.0618 484 LEU A CB    
2536 C CG    . LEU A 344 ? 0.1758 0.1775 0.2077 -0.0224 -0.0065 -0.0673 484 LEU A CG    
2537 C CD1   . LEU A 344 ? 0.1847 0.1905 0.2045 -0.0158 -0.0090 -0.0584 484 LEU A CD1   
2538 C CD2   . LEU A 344 ? 0.1451 0.1383 0.1761 -0.0228 -0.0044 -0.0722 484 LEU A CD2   
2539 N N     A GLU A 345 ? 0.2294 0.1840 0.2734 -0.0316 0.0109  -0.0530 485 GLU A N     
2540 N N     B GLU A 345 ? 0.2279 0.1825 0.2717 -0.0316 0.0108  -0.0529 485 GLU A N     
2541 C CA    A GLU A 345 ? 0.2183 0.1586 0.2564 -0.0310 0.0141  -0.0428 485 GLU A CA    
2542 C CA    B GLU A 345 ? 0.2140 0.1543 0.2521 -0.0310 0.0141  -0.0428 485 GLU A CA    
2543 C C     A GLU A 345 ? 0.1901 0.1291 0.2203 -0.0279 0.0120  -0.0356 485 GLU A C     
2544 C C     B GLU A 345 ? 0.1980 0.1363 0.2279 -0.0278 0.0121  -0.0353 485 GLU A C     
2545 O O     A GLU A 345 ? 0.1884 0.1304 0.2150 -0.0249 0.0089  -0.0365 485 GLU A O     
2546 O O     B GLU A 345 ? 0.1929 0.1333 0.2188 -0.0246 0.0090  -0.0357 485 GLU A O     
2547 C CB    A GLU A 345 ? 0.2024 0.1290 0.2361 -0.0289 0.0156  -0.0392 485 GLU A CB    
2548 C CB    B GLU A 345 ? 0.2110 0.1376 0.2450 -0.0290 0.0158  -0.0394 485 GLU A CB    
2549 C CG    A GLU A 345 ? 0.2308 0.1556 0.2716 -0.0322 0.0194  -0.0455 485 GLU A CG    
2550 C CG    B GLU A 345 ? 0.2306 0.1442 0.2572 -0.0281 0.0176  -0.0298 485 GLU A CG    
2551 N N     . TYR A 346 ? 0.1880 0.1224 0.2148 -0.0288 0.0144  -0.0288 486 TYR A N     
2552 C CA    . TYR A 346 ? 0.1977 0.1304 0.2161 -0.0264 0.0134  -0.0216 486 TYR A CA    
2553 C C     . TYR A 346 ? 0.2224 0.1467 0.2313 -0.0222 0.0107  -0.0152 486 TYR A C     
2554 O O     . TYR A 346 ? 0.1839 0.1005 0.1912 -0.0212 0.0102  -0.0127 486 TYR A O     
2555 C CB    . TYR A 346 ? 0.1777 0.1081 0.1938 -0.0279 0.0167  -0.0158 486 TYR A CB    
2556 C CG    . TYR A 346 ? 0.2185 0.1476 0.2247 -0.0251 0.0158  -0.0080 486 TYR A CG    
2557 C CD1   . TYR A 346 ? 0.2262 0.1608 0.2323 -0.0249 0.0164  -0.0088 486 TYR A CD1   
2558 C CD2   . TYR A 346 ? 0.2095 0.1335 0.2078 -0.0229 0.0143  -0.0007 486 TYR A CD2   
2559 C CE1   . TYR A 346 ? 0.2585 0.1920 0.2544 -0.0222 0.0163  -0.0015 486 TYR A CE1   
2560 C CE2   . TYR A 346 ? 0.2351 0.1619 0.2267 -0.0206 0.0134  0.0046  486 TYR A CE2   
2561 C CZ    . TYR A 346 ? 0.2644 0.1958 0.2542 -0.0201 0.0145  0.0044  486 TYR A CZ    
2562 O OH    . TYR A 346 ? 0.3014 0.2364 0.2848 -0.0178 0.0140  0.0088  486 TYR A OH    
2563 N N     . LEU A 347 ? 0.1367 0.0630 0.1400 -0.0199 0.0090  -0.0130 487 LEU A N     
2564 C CA    . LEU A 347 ? 0.1461 0.0676 0.1425 -0.0161 0.0063  -0.0073 487 LEU A CA    
2565 C C     . LEU A 347 ? 0.1686 0.0924 0.1573 -0.0152 0.0064  0.0000  487 LEU A C     
2566 O O     . LEU A 347 ? 0.1847 0.1117 0.1691 -0.0156 0.0075  -0.0002 487 LEU A O     
2567 C CB    . LEU A 347 ? 0.1464 0.0739 0.1437 -0.0130 0.0039  -0.0118 487 LEU A CB    
2568 C CG    . LEU A 347 ? 0.1467 0.0738 0.1526 -0.0132 0.0041  -0.0196 487 LEU A CG    
2569 C CD1   . LEU A 347 ? 0.1621 0.1005 0.1685 -0.0099 0.0016  -0.0245 487 LEU A CD1   
2570 C CD2   . LEU A 347 ? 0.2213 0.1359 0.2266 -0.0117 0.0040  -0.0155 487 LEU A CD2   
2571 N N     . PRO A 348 ? 0.2031 0.1262 0.1901 -0.0141 0.0056  0.0057  488 PRO A N     
2572 C CA    . PRO A 348 ? 0.2079 0.1361 0.1889 -0.0134 0.0059  0.0101  488 PRO A CA    
2573 C C     . PRO A 348 ? 0.1604 0.0907 0.1361 -0.0115 0.0041  0.0106  488 PRO A C     
2574 O O     . PRO A 348 ? 0.1266 0.0533 0.1032 -0.0101 0.0020  0.0085  488 PRO A O     
2575 C CB    . PRO A 348 ? 0.2388 0.1646 0.2192 -0.0131 0.0055  0.0138  488 PRO A CB    
2576 C CG    . PRO A 348 ? 0.2626 0.1816 0.2471 -0.0121 0.0041  0.0131  488 PRO A CG    
2577 C CD    . PRO A 348 ? 0.2178 0.1353 0.2078 -0.0136 0.0047  0.0075  488 PRO A CD    
2578 N N     . PRO A 349 ? 0.1480 0.0841 0.1191 -0.0112 0.0049  0.0125  489 PRO A N     
2579 C CA    . PRO A 349 ? 0.1529 0.0909 0.1191 -0.0100 0.0038  0.0126  489 PRO A CA    
2580 C C     . PRO A 349 ? 0.1654 0.0999 0.1314 -0.0089 0.0004  0.0133  489 PRO A C     
2581 O O     . PRO A 349 ? 0.1440 0.0762 0.1081 -0.0078 -0.0010 0.0119  489 PRO A O     
2582 C CB    . PRO A 349 ? 0.1065 0.0514 0.0710 -0.0102 0.0055  0.0140  489 PRO A CB    
2583 C CG    . PRO A 349 ? 0.1770 0.1230 0.1443 -0.0109 0.0077  0.0140  489 PRO A CG    
2584 C CD    . PRO A 349 ? 0.1672 0.1077 0.1382 -0.0120 0.0071  0.0139  489 PRO A CD    
2585 N N     A GLU A 350 ? 0.1216 0.0540 0.0887 -0.0089 -0.0008 0.0155  490 GLU A N     
2586 N N     B GLU A 350 ? 0.1273 0.0597 0.0944 -0.0088 -0.0009 0.0155  490 GLU A N     
2587 C CA    A GLU A 350 ? 0.1427 0.0706 0.1091 -0.0072 -0.0048 0.0171  490 GLU A CA    
2588 C CA    B GLU A 350 ? 0.1329 0.0610 0.0992 -0.0072 -0.0049 0.0170  490 GLU A CA    
2589 C C     A GLU A 350 ? 0.1556 0.0779 0.1278 -0.0046 -0.0069 0.0147  490 GLU A C     
2590 C C     B GLU A 350 ? 0.1562 0.0783 0.1285 -0.0046 -0.0069 0.0148  490 GLU A C     
2591 O O     A GLU A 350 ? 0.1907 0.1103 0.1648 -0.0018 -0.0112 0.0151  490 GLU A O     
2592 O O     B GLU A 350 ? 0.1744 0.0932 0.1487 -0.0016 -0.0111 0.0157  490 GLU A O     
2593 C CB    A GLU A 350 ? 0.1592 0.0840 0.1235 -0.0072 -0.0055 0.0203  490 GLU A CB    
2594 C CB    B GLU A 350 ? 0.1699 0.0955 0.1330 -0.0073 -0.0060 0.0204  490 GLU A CB    
2595 C CG    A GLU A 350 ? 0.2070 0.1356 0.1654 -0.0094 -0.0043 0.0213  490 GLU A CG    
2596 C CG    B GLU A 350 ? 0.1553 0.0757 0.1216 -0.0069 -0.0043 0.0215  490 GLU A CG    
2597 C CD    A GLU A 350 ? 0.2953 0.2270 0.2550 -0.0110 0.0000  0.0200  490 GLU A CD    
2598 C CD    B GLU A 350 ? 0.2527 0.1761 0.2194 -0.0093 -0.0003 0.0212  490 GLU A CD    
2599 O OE1   A GLU A 350 ? 0.2416 0.1735 0.2070 -0.0109 0.0019  0.0188  490 GLU A OE1   
2600 O OE1   B GLU A 350 ? 0.2587 0.1882 0.2241 -0.0106 0.0013  0.0196  490 GLU A OE1   
2601 O OE2   A GLU A 350 ? 0.3150 0.2457 0.2672 -0.0130 0.0010  0.0196  490 GLU A OE2   
2602 O OE2   B GLU A 350 ? 0.1886 0.1068 0.1561 -0.0098 0.0010  0.0226  490 GLU A OE2   
2603 N N     . GLN A 351 ? 0.1771 0.0980 0.1537 -0.0052 -0.0043 0.0112  491 GLN A N     
2604 C CA    . GLN A 351 ? 0.1546 0.0708 0.1379 -0.0031 -0.0053 0.0064  491 GLN A CA    
2605 C C     . GLN A 351 ? 0.1541 0.0810 0.1406 -0.0026 -0.0043 0.0000  491 GLN A C     
2606 O O     . GLN A 351 ? 0.1779 0.1071 0.1716 -0.0016 -0.0035 -0.0061 491 GLN A O     
2607 C CB    . GLN A 351 ? 0.1862 0.0986 0.1754 -0.0045 -0.0020 0.0050  491 GLN A CB    
2608 C CG    . GLN A 351 ? 0.1693 0.0777 0.1585 -0.0038 -0.0016 0.0107  491 GLN A CG    
2609 C CD    . GLN A 351 ? 0.2802 0.1839 0.2691 0.0008  -0.0048 0.0131  491 GLN A CD    
2610 O OE1   . GLN A 351 ? 0.2363 0.1392 0.2302 0.0038  -0.0066 0.0092  491 GLN A OE1   
2611 N NE2   . GLN A 351 ? 0.2940 0.1954 0.2779 0.0019  -0.0064 0.0190  491 GLN A NE2   
2612 N N     . ARG A 352 ? 0.1631 0.0974 0.1438 -0.0033 -0.0034 0.0013  492 ARG A N     
2613 C CA    . ARG A 352 ? 0.1151 0.0604 0.0964 -0.0020 -0.0021 -0.0035 492 ARG A CA    
2614 C C     . ARG A 352 ? 0.1481 0.0992 0.1296 0.0001  -0.0022 -0.0040 492 ARG A C     
2615 O O     . ARG A 352 ? 0.1750 0.1330 0.1525 0.0006  0.0001  -0.0056 492 ARG A O     
2616 C CB    . ARG A 352 ? 0.1238 0.0721 0.0983 -0.0036 0.0002  -0.0015 492 ARG A CB    
2617 C CG    . ARG A 352 ? 0.1228 0.0676 0.0995 -0.0060 0.0010  -0.0017 492 ARG A CG    
2618 C CD    . ARG A 352 ? 0.1549 0.1038 0.1267 -0.0064 0.0033  0.0007  492 ARG A CD    
2619 N NE    . ARG A 352 ? 0.1289 0.0724 0.1030 -0.0095 0.0051  0.0021  492 ARG A NE    
2620 C CZ    . ARG A 352 ? 0.1513 0.0952 0.1223 -0.0103 0.0081  0.0054  492 ARG A CZ    
2621 N NH1   . ARG A 352 ? 0.1666 0.1151 0.1314 -0.0079 0.0093  0.0081  492 ARG A NH1   
2622 N NH2   . ARG A 352 ? 0.1560 0.0947 0.1305 -0.0135 0.0107  0.0059  492 ARG A NH2   
2623 N N     . ASN A 353 ? 0.1261 0.0746 0.1123 0.0014  -0.0047 -0.0027 493 ASN A N     
2624 C CA    . ASN A 353 ? 0.1605 0.1159 0.1497 0.0029  -0.0047 -0.0037 493 ASN A CA    
2625 C C     . ASN A 353 ? 0.1914 0.1524 0.1893 0.0059  -0.0033 -0.0104 493 ASN A C     
2626 O O     . ASN A 353 ? 0.1441 0.1075 0.1510 0.0084  -0.0046 -0.0119 493 ASN A O     
2627 C CB    . ASN A 353 ? 0.1115 0.0639 0.1028 0.0033  -0.0089 0.0008  493 ASN A CB    
2628 C CG    . ASN A 353 ? 0.1882 0.1369 0.1689 -0.0006 -0.0090 0.0063  493 ASN A CG    
2629 O OD1   . ASN A 353 ? 0.1634 0.1168 0.1396 -0.0028 -0.0062 0.0061  493 ASN A OD1   
2630 N ND2   . ASN A 353 ? 0.1800 0.1189 0.1557 -0.0017 -0.0113 0.0109  493 ASN A ND2   
2631 N N     . ALA A 354 ? 0.1634 0.1269 0.1586 0.0056  -0.0007 -0.0150 494 ALA A N     
2632 C CA    . ALA A 354 ? 0.1852 0.1532 0.1859 0.0077  0.0016  -0.0223 494 ALA A CA    
2633 C C     . ALA A 354 ? 0.2065 0.1814 0.2074 0.0085  0.0048  -0.0238 494 ALA A C     
2634 O O     . ALA A 354 ? 0.1459 0.1230 0.1387 0.0069  0.0067  -0.0207 494 ALA A O     
2635 C CB    . ALA A 354 ? 0.1366 0.1068 0.1318 0.0067  0.0029  -0.0268 494 ALA A CB    
2636 O OXT   . ALA A 354 ? 0.2356 0.2133 0.2452 0.0106  0.0065  -0.0285 494 ALA A OXT   
2637 O "O5'" . DC  B 1   ? 0.5366 0.5776 0.2810 0.0180  -0.0149 -0.1054 1   DC  T "O5'" 
2638 C "C5'" . DC  B 1   ? 0.5405 0.5834 0.2753 0.0167  -0.0224 -0.1059 1   DC  T "C5'" 
2639 C "C4'" . DC  B 1   ? 0.5637 0.6098 0.3113 0.0174  -0.0300 -0.1061 1   DC  T "C4'" 
2640 O "O4'" . DC  B 1   ? 0.5606 0.6050 0.3224 0.0173  -0.0282 -0.1127 1   DC  T "O4'" 
2641 C "C3'" . DC  B 1   ? 0.4412 0.4896 0.1977 0.0196  -0.0318 -0.0989 1   DC  T "C3'" 
2642 O "O3'" . DC  B 1   ? 0.4791 0.5303 0.2259 0.0199  -0.0379 -0.0927 1   DC  T "O3'" 
2643 C "C2'" . DC  B 1   ? 0.4212 0.4706 0.1960 0.0202  -0.0351 -0.1023 1   DC  T "C2'" 
2644 C "C1'" . DC  B 1   ? 0.4848 0.5312 0.2623 0.0186  -0.0320 -0.1109 1   DC  T "C1'" 
2645 N N1    . DC  B 1   ? 0.4202 0.4637 0.2117 0.0196  -0.0261 -0.1133 1   DC  T N1    
2646 C C2    . DC  B 1   ? 0.4471 0.4910 0.2554 0.0203  -0.0286 -0.1139 1   DC  T C2    
2647 O O2    . DC  B 1   ? 0.4076 0.4544 0.2192 0.0202  -0.0355 -0.1125 1   DC  T O2    
2648 N N3    . DC  B 1   ? 0.3395 0.3806 0.1599 0.0210  -0.0235 -0.1157 1   DC  T N3    
2649 C C4    . DC  B 1   ? 0.3433 0.3818 0.1604 0.0212  -0.0163 -0.1171 1   DC  T C4    
2650 N N4    . DC  B 1   ? 0.3311 0.3671 0.1608 0.0221  -0.0118 -0.1185 1   DC  T N4    
2651 C C5    . DC  B 1   ? 0.3604 0.3986 0.1611 0.0206  -0.0132 -0.1168 1   DC  T C5    
2652 C C6    . DC  B 1   ? 0.4762 0.5167 0.2642 0.0196  -0.0182 -0.1149 1   DC  T C6    
2653 P P     . DG  B 2   ? 0.5513 0.6037 0.2984 0.0222  -0.0377 -0.0831 2   DG  T P     
2654 O OP1   . DG  B 2   ? 0.6083 0.6620 0.3400 0.0219  -0.0425 -0.0773 2   DG  T OP1   
2655 O OP2   . DG  B 2   ? 0.4726 0.5221 0.2223 0.0227  -0.0286 -0.0822 2   DG  T OP2   
2656 O "O5'" . DG  B 2   ? 0.4836 0.5387 0.2480 0.0241  -0.0431 -0.0823 2   DG  T "O5'" 
2657 C "C5'" . DG  B 2   ? 0.4433 0.5012 0.2119 0.0235  -0.0509 -0.0853 2   DG  T "C5'" 
2658 C "C4'" . DG  B 2   ? 0.3874 0.4471 0.1733 0.0252  -0.0543 -0.0842 2   DG  T "C4'" 
2659 O "O4'" . DG  B 2   ? 0.3479 0.4050 0.1469 0.0249  -0.0492 -0.0895 2   DG  T "O4'" 
2660 C "C3'" . DG  B 2   ? 0.3533 0.4137 0.1413 0.0280  -0.0543 -0.0758 2   DG  T "C3'" 
2661 O "O3'" . DG  B 2   ? 0.5051 0.5684 0.3043 0.0295  -0.0610 -0.0738 2   DG  T "O3'" 
2662 C "C2'" . DG  B 2   ? 0.3490 0.4063 0.1443 0.0285  -0.0459 -0.0769 2   DG  T "C2'" 
2663 C "C1'" . DG  B 2   ? 0.3643 0.4204 0.1706 0.0269  -0.0449 -0.0853 2   DG  T "C1'" 
2664 N N9    . DG  B 2   ? 0.4011 0.4537 0.2092 0.0262  -0.0367 -0.0890 2   DG  T N9    
2665 C C8    . DG  B 2   ? 0.3417 0.3922 0.1381 0.0255  -0.0305 -0.0888 2   DG  T C8    
2666 N N7    . DG  B 2   ? 0.3930 0.4406 0.1956 0.0251  -0.0239 -0.0927 2   DG  T N7    
2667 C C5    . DG  B 2   ? 0.3440 0.3915 0.1628 0.0255  -0.0260 -0.0954 2   DG  T C5    
2668 C C6    . DG  B 2   ? 0.3612 0.4060 0.1926 0.0254  -0.0216 -0.0994 2   DG  T C6    
2669 O O6    . DG  B 2   ? 0.3453 0.3875 0.1767 0.0252  -0.0150 -0.1015 2   DG  T O6    
2670 N N1    . DG  B 2   ? 0.2960 0.3411 0.1415 0.0256  -0.0258 -0.1005 2   DG  T N1    
2671 C C2    . DG  B 2   ? 0.2970 0.3450 0.1447 0.0258  -0.0330 -0.0985 2   DG  T C2    
2672 N N2    . DG  B 2   ? 0.3259 0.3735 0.1881 0.0256  -0.0356 -0.1001 2   DG  T N2    
2673 N N3    . DG  B 2   ? 0.3514 0.4023 0.1880 0.0262  -0.0374 -0.0949 2   DG  T N3    
2674 C C4    . DG  B 2   ? 0.3895 0.4399 0.2118 0.0260  -0.0336 -0.0934 2   DG  T C4    
2675 P P     . DG  B 3   ? 0.5323 0.5965 0.3355 0.0327  -0.0625 -0.0651 3   DG  T P     
2676 O OP1   . DG  B 3   ? 0.5594 0.6274 0.3686 0.0336  -0.0713 -0.0632 3   DG  T OP1   
2677 O OP2   . DG  B 3   ? 0.5642 0.6265 0.3532 0.0334  -0.0583 -0.0588 3   DG  T OP2   
2678 O "O5'" . DG  B 3   ? 0.4195 0.4817 0.2380 0.0334  -0.0576 -0.0672 3   DG  T "O5'" 
2679 C "C5'" . DG  B 3   ? 0.3186 0.3809 0.1510 0.0321  -0.0590 -0.0737 3   DG  T "C5'" 
2680 C "C4'" . DG  B 3   ? 0.3615 0.4213 0.2063 0.0327  -0.0537 -0.0744 3   DG  T "C4'" 
2681 O "O4'" . DG  B 3   ? 0.3551 0.4118 0.1970 0.0313  -0.0464 -0.0786 3   DG  T "O4'" 
2682 C "C3'" . DG  B 3   ? 0.3328 0.3923 0.1776 0.0353  -0.0519 -0.0670 3   DG  T "C3'" 
2683 O "O3'" . DG  B 3   ? 0.3655 0.4256 0.2247 0.0363  -0.0550 -0.0661 3   DG  T "O3'" 
2684 C "C2'" . DG  B 3   ? 0.3575 0.4138 0.1997 0.0349  -0.0429 -0.0676 3   DG  T "C2'" 
2685 C "C1'" . DG  B 3   ? 0.3629 0.4176 0.2092 0.0324  -0.0405 -0.0758 3   DG  T "C1'" 
2686 N N9    . DG  B 3   ? 0.3648 0.4172 0.2035 0.0314  -0.0332 -0.0776 3   DG  T N9    
2687 C C8    . DG  B 3   ? 0.2990 0.3512 0.1221 0.0311  -0.0307 -0.0750 3   DG  T C8    
2688 N N7    . DG  B 3   ? 0.3105 0.3604 0.1309 0.0299  -0.0237 -0.0779 3   DG  T N7    
2689 C C5    . DG  B 3   ? 0.2921 0.3405 0.1273 0.0297  -0.0216 -0.0823 3   DG  T C5    
2690 C C6    . DG  B 3   ? 0.3052 0.3508 0.1455 0.0288  -0.0150 -0.0863 3   DG  T C6    
2691 O O6    . DG  B 3   ? 0.2953 0.3394 0.1282 0.0281  -0.0091 -0.0872 3   DG  T O6    
2692 N N1    . DG  B 3   ? 0.2699 0.3143 0.1259 0.0289  -0.0155 -0.0892 3   DG  T N1    
2693 C C2    . DG  B 3   ? 0.2763 0.3219 0.1419 0.0293  -0.0213 -0.0886 3   DG  T C2    
2694 N N2    . DG  B 3   ? 0.2612 0.3048 0.1411 0.0288  -0.0206 -0.0912 3   DG  T N2    
2695 N N3    . DG  B 3   ? 0.2947 0.3430 0.1561 0.0301  -0.0274 -0.0853 3   DG  T N3    
2696 C C4    . DG  B 3   ? 0.2769 0.3266 0.1231 0.0304  -0.0274 -0.0821 3   DG  T C4    
2697 P P     . DC  B 4   ? 0.3073 0.3676 0.1684 0.0392  -0.0555 -0.0582 4   DC  T P     
2698 O OP1   . DC  B 4   ? 0.3119 0.3743 0.1857 0.0397  -0.0620 -0.0580 4   DC  T OP1   
2699 O OP2   . DC  B 4   ? 0.3262 0.3864 0.1717 0.0408  -0.0549 -0.0513 4   DC  T OP2   
2700 O "O5'" . DC  B 4   ? 0.3305 0.3877 0.1981 0.0390  -0.0478 -0.0592 4   DC  T "O5'" 
2701 C "C5'" . DC  B 4   ? 0.2852 0.3410 0.1659 0.0370  -0.0461 -0.0656 4   DC  T "C5'" 
2702 C "C4'" . DC  B 4   ? 0.2529 0.3057 0.1358 0.0366  -0.0379 -0.0662 4   DC  T "C4'" 
2703 O "O4'" . DC  B 4   ? 0.2902 0.3420 0.1633 0.0355  -0.0331 -0.0685 4   DC  T "O4'" 
2704 C "C3'" . DC  B 4   ? 0.2254 0.2778 0.1054 0.0387  -0.0347 -0.0594 4   DC  T "C3'" 
2705 O "O3'" . DC  B 4   ? 0.2050 0.2547 0.1000 0.0374  -0.0310 -0.0592 4   DC  T "O3'" 
2706 C "C2'" . DC  B 4   ? 0.2316 0.2829 0.0988 0.0385  -0.0281 -0.0575 4   DC  T "C2'" 
2707 C "C1'" . DC  B 4   ? 0.2550 0.3053 0.1245 0.0361  -0.0260 -0.0650 4   DC  T "C1'" 
2708 N N1    . DC  B 4   ? 0.2783 0.3281 0.1349 0.0352  -0.0216 -0.0654 4   DC  T N1    
2709 C C2    . DC  B 4   ? 0.2554 0.3032 0.1151 0.0334  -0.0161 -0.0706 4   DC  T C2    
2710 O O2    . DC  B 4   ? 0.2362 0.2827 0.1091 0.0328  -0.0152 -0.0741 4   DC  T O2    
2711 N N3    . DC  B 4   ? 0.2608 0.3079 0.1092 0.0324  -0.0119 -0.0713 4   DC  T N3    
2712 C C4    . DC  B 4   ? 0.3130 0.3611 0.1471 0.0328  -0.0130 -0.0670 4   DC  T C4    
2713 N N4    . DC  B 4   ? 0.3425 0.3894 0.1657 0.0314  -0.0085 -0.0680 4   DC  T N4    
2714 C C5    . DC  B 4   ? 0.2922 0.3420 0.1226 0.0346  -0.0187 -0.0610 4   DC  T C5    
2715 C C6    . DC  B 4   ? 0.3760 0.4267 0.2182 0.0359  -0.0229 -0.0605 4   DC  T C6    
2716 P P     . DA  B 5   ? 0.2106 0.2575 0.1131 0.0374  -0.0283 -0.0501 5   DA  T P     
2717 O OP1   . DA  B 5   ? 0.2442 0.2899 0.1348 0.0382  -0.0235 -0.0438 5   DA  T OP1   
2718 O OP2   . DA  B 5   ? 0.1906 0.2353 0.1077 0.0355  -0.0247 -0.0523 5   DA  T OP2   
2719 O "O5'" . DA  B 5   ? 0.2438 0.2923 0.1504 0.0386  -0.0363 -0.0471 5   DA  T "O5'" 
2720 C "C5'" . DA  B 5   ? 0.1878 0.2377 0.1064 0.0376  -0.0414 -0.0520 5   DA  T "C5'" 
2721 C "C4'" . DA  B 5   ? 0.1818 0.2318 0.1099 0.0383  -0.0453 -0.0465 5   DA  T "C4'" 
2722 O "O4'" . DA  B 5   ? 0.1725 0.2186 0.1075 0.0375  -0.0392 -0.0407 5   DA  T "O4'" 
2723 C "C3'" . DA  B 5   ? 0.2175 0.2697 0.1366 0.0410  -0.0505 -0.0411 5   DA  T "C3'" 
2724 O "O3'" . DA  B 5   ? 0.2603 0.3147 0.1899 0.0415  -0.0569 -0.0404 5   DA  T "O3'" 
2725 C "C2'" . DA  B 5   ? 0.1954 0.2438 0.1099 0.0417  -0.0445 -0.0325 5   DA  T "C2'" 
2726 C "C1'" . DA  B 5   ? 0.1958 0.2408 0.1246 0.0395  -0.0391 -0.0323 5   DA  T "C1'" 
2727 N N9    . DA  B 5   ? 0.1827 0.2241 0.1083 0.0387  -0.0309 -0.0281 5   DA  T N9    
2728 C C8    . DA  B 5   ? 0.2131 0.2540 0.1256 0.0389  -0.0264 -0.0276 5   DA  T C8    
2729 N N7    . DA  B 5   ? 0.2292 0.2669 0.1427 0.0377  -0.0190 -0.0237 5   DA  T N7    
2730 C C5    . DA  B 5   ? 0.1858 0.2216 0.1137 0.0366  -0.0188 -0.0216 5   DA  T C5    
2731 C C6    . DA  B 5   ? 0.2403 0.2728 0.1762 0.0348  -0.0127 -0.0176 5   DA  T C6    
2732 N N6    . DA  B 5   ? 0.2039 0.2346 0.1345 0.0338  -0.0055 -0.0149 5   DA  T N6    
2733 N N1    . DA  B 5   ? 0.2210 0.2524 0.1706 0.0338  -0.0141 -0.0168 5   DA  T N1    
2734 C C2    . DA  B 5   ? 0.2564 0.2901 0.2117 0.0346  -0.0211 -0.0197 5   DA  T C2    
2735 N N3    . DA  B 5   ? 0.2571 0.2943 0.2066 0.0362  -0.0273 -0.0235 5   DA  T N3    
2736 C C4    . DA  B 5   ? 0.2044 0.2424 0.1399 0.0372  -0.0259 -0.0242 5   DA  T C4    
2737 P P     . DT  B 6   ? 0.2668 0.3243 0.1909 0.0447  -0.0639 -0.0348 6   DT  T P     
2738 O OP1   . DT  B 6   ? 0.3349 0.3968 0.2695 0.0445  -0.0713 -0.0393 6   DT  T OP1   
2739 O OP2   . DT  B 6   ? 0.2695 0.3280 0.1751 0.0462  -0.0644 -0.0334 6   DT  T OP2   
2740 O "O5'" . DT  B 6   ? 0.2580 0.3115 0.1881 0.0457  -0.0603 -0.0256 6   DT  T "O5'" 
2741 C "C5'" . DT  B 6   ? 0.1978 0.2496 0.1447 0.0442  -0.0586 -0.0257 6   DT  T "C5'" 
2742 C "C4'" . DT  B 6   ? 0.1924 0.2394 0.1421 0.0448  -0.0536 -0.0172 6   DT  T "C4'" 
2743 O "O4'" . DT  B 6   ? 0.2664 0.3093 0.2107 0.0431  -0.0453 -0.0162 6   DT  T "O4'" 
2744 C "C3'" . DT  B 6   ? 0.2631 0.3098 0.2037 0.0484  -0.0565 -0.0093 6   DT  T "C3'" 
2745 O "O3'" . DT  B 6   ? 0.2337 0.2830 0.1839 0.0504  -0.0629 -0.0074 6   DT  T "O3'" 
2746 C "C2'" . DT  B 6   ? 0.3000 0.3404 0.2388 0.0479  -0.0483 -0.0025 6   DT  T "C2'" 
2747 C "C1'" . DT  B 6   ? 0.3181 0.3569 0.2610 0.0442  -0.0415 -0.0077 6   DT  T "C1'" 
2748 N N1    . DT  B 6   ? 0.3009 0.3368 0.2320 0.0434  -0.0346 -0.0057 6   DT  T N1    
2749 C C2    . DT  B 6   ? 0.2577 0.2893 0.1934 0.0414  -0.0269 -0.0025 6   DT  T C2    
2750 O O2    . DT  B 6   ? 0.2326 0.2623 0.1811 0.0402  -0.0254 -0.0012 6   DT  T O2    
2751 N N3    . DT  B 6   ? 0.2941 0.3238 0.2187 0.0407  -0.0209 -0.0011 6   DT  T N3    
2752 C C4    . DT  B 6   ? 0.2924 0.3241 0.2019 0.0417  -0.0215 -0.0025 6   DT  T C4    
2753 O O4    . DT  B 6   ? 0.3626 0.3927 0.2633 0.0407  -0.0153 -0.0013 6   DT  T O4    
2754 C C5    . DT  B 6   ? 0.2553 0.2913 0.1601 0.0436  -0.0297 -0.0060 6   DT  T C5    
2755 C C7    . DT  B 6   ? 0.2958 0.3343 0.1837 0.0445  -0.0310 -0.0083 6   DT  T C7    
2756 C C6    . DT  B 6   ? 0.2646 0.3026 0.1804 0.0444  -0.0360 -0.0074 6   DT  T C6    
2757 P P     . DA  B 7   ? 0.2701 0.3201 0.2127 0.0548  -0.0683 0.0004  7   DA  T P     
2758 O OP1   . DA  B 7   ? 0.2467 0.3025 0.1996 0.0563  -0.0767 -0.0020 7   DA  T OP1   
2759 O OP2   . DA  B 7   ? 0.2974 0.3473 0.2207 0.0559  -0.0683 0.0023  7   DA  T OP2   
2760 O "O5'" . DA  B 7   ? 0.2510 0.2946 0.1997 0.0554  -0.0626 0.0085  7   DA  T "O5'" 
2761 C "C5'" . DA  B 7   ? 0.3164 0.3590 0.2827 0.0538  -0.0606 0.0073  7   DA  T "C5'" 
2762 C "C4'" . DA  B 7   ? 0.3000 0.3358 0.2693 0.0537  -0.0537 0.0144  7   DA  T "C4'" 
2763 O "O4'" . DA  B 7   ? 0.3224 0.3543 0.2831 0.0510  -0.0459 0.0144  7   DA  T "O4'" 
2764 C "C3'" . DA  B 7   ? 0.3967 0.4299 0.3600 0.0578  -0.0560 0.0235  7   DA  T "C3'" 
2765 O "O3'" . DA  B 7   ? 0.4909 0.5205 0.4675 0.0583  -0.0537 0.0274  7   DA  T "O3'" 
2766 C "C2'" . DA  B 7   ? 0.4290 0.4575 0.3760 0.0573  -0.0502 0.0277  7   DA  T "C2'" 
2767 C "C1'" . DA  B 7   ? 0.3652 0.3919 0.3164 0.0527  -0.0424 0.0227  7   DA  T "C1'" 
2768 N N9    . DA  B 7   ? 0.3946 0.4201 0.3316 0.0511  -0.0377 0.0219  7   DA  T N9    
2769 C C8    . DA  B 7   ? 0.2932 0.3219 0.2157 0.0522  -0.0409 0.0200  7   DA  T C8    
2770 N N7    . DA  B 7   ? 0.3096 0.3365 0.2221 0.0502  -0.0346 0.0193  7   DA  T N7    
2771 C C5    . DA  B 7   ? 0.2743 0.2968 0.1957 0.0477  -0.0271 0.0209  7   DA  T C5    
2772 C C6    . DA  B 7   ? 0.2864 0.3059 0.2047 0.0447  -0.0184 0.0210  7   DA  T C6    
2773 N N6    . DA  B 7   ? 0.2445 0.2649 0.1496 0.0440  -0.0154 0.0193  7   DA  T N6    
2774 N N1    . DA  B 7   ? 0.3068 0.3227 0.2363 0.0425  -0.0129 0.0226  7   DA  T N1    
2775 C C2    . DA  B 7   ? 0.3242 0.3392 0.2668 0.0431  -0.0155 0.0240  7   DA  T C2    
2776 N N3    . DA  B 7   ? 0.3930 0.4106 0.3402 0.0458  -0.0232 0.0239  7   DA  T N3    
2777 C C4    . DA  B 7   ? 0.2766 0.2980 0.2126 0.0481  -0.0289 0.0224  7   DA  T C4    
2778 P P     . DC  B 8   ? 0.3775 0.4038 0.3536 0.0629  -0.0563 0.0368  8   DC  T P     
2779 O OP1   . DC  B 8   ? 0.5492 0.5798 0.5411 0.0647  -0.0620 0.0351  8   DC  T OP1   
2780 O OP2   . DC  B 8   ? 0.3844 0.4105 0.3424 0.0658  -0.0594 0.0418  8   DC  T OP2   
2781 O "O5'" . DC  B 8   ? 0.3369 0.3548 0.3168 0.0608  -0.0467 0.0415  8   DC  T "O5'" 
2782 C "C5'" . DC  B 8   ? 0.3383 0.3553 0.3310 0.0566  -0.0411 0.0366  8   DC  T "C5'" 
2783 C "C4'" . DC  B 8   ? 0.2944 0.3042 0.2842 0.0538  -0.0316 0.0402  8   DC  T "C4'" 
2784 O "O4'" . DC  B 8   ? 0.2933 0.3032 0.2687 0.0520  -0.0285 0.0388  8   DC  T "O4'" 
2785 C "C3'" . DC  B 8   ? 0.2515 0.2544 0.2382 0.0565  -0.0293 0.0496  8   DC  T "C3'" 
2786 O "O3'" . DC  B 8   ? 0.2385 0.2358 0.2340 0.0534  -0.0214 0.0508  8   DC  T "O3'" 
2787 C "C2'" . DC  B 8   ? 0.2337 0.2348 0.2012 0.0572  -0.0281 0.0534  8   DC  T "C2'" 
2788 C "C1'" . DC  B 8   ? 0.2649 0.2687 0.2296 0.0528  -0.0240 0.0463  8   DC  T "C1'" 
2789 N N1    . DC  B 8   ? 0.2434 0.2489 0.1907 0.0530  -0.0243 0.0460  8   DC  T N1    
2790 C C2    . DC  B 8   ? 0.2902 0.2927 0.2298 0.0497  -0.0164 0.0459  8   DC  T C2    
2791 O O2    . DC  B 8   ? 0.2484 0.2472 0.1959 0.0467  -0.0096 0.0464  8   DC  T O2    
2792 N N3    . DC  B 8   ? 0.2534 0.2577 0.1775 0.0498  -0.0163 0.0452  8   DC  T N3    
2793 C C4    . DC  B 8   ? 0.3219 0.3304 0.2374 0.0528  -0.0239 0.0445  8   DC  T C4    
2794 N N4    . DC  B 8   ? 0.2687 0.2787 0.1685 0.0524  -0.0232 0.0435  8   DC  T N4    
2795 C C5    . DC  B 8   ? 0.3291 0.3408 0.2520 0.0561  -0.0324 0.0446  8   DC  T C5    
2796 C C6    . DC  B 8   ? 0.3706 0.3808 0.3096 0.0561  -0.0323 0.0453  8   DC  T C6    
2797 P P     . DG  B 9   ? 0.2737 0.2621 0.2667 0.0547  -0.0163 0.0599  9   DG  T P     
2798 O OP1   . DG  B 9   ? 0.2810 0.2663 0.2895 0.0518  -0.0110 0.0584  9   DG  T OP1   
2799 O OP2   . DG  B 9   ? 0.2162 0.2038 0.2035 0.0603  -0.0228 0.0665  9   DG  T OP2   
2800 O "O5'" . DG  B 9   ? 0.2063 0.1913 0.1846 0.0518  -0.0095 0.0616  9   DG  T "O5'" 
2801 C "C5'" . DG  B 9   ? 0.1889 0.1731 0.1708 0.0465  -0.0020 0.0575  9   DG  T "C5'" 
2802 C "C4'" . DG  B 9   ? 0.2464 0.2232 0.2214 0.0445  0.0062  0.0633  9   DG  T "C4'" 
2803 O "O4'" . DG  B 9   ? 0.2796 0.2572 0.2381 0.0443  0.0074  0.0643  9   DG  T "O4'" 
2804 C "C3'" . DG  B 9   ? 0.3158 0.2853 0.2904 0.0477  0.0064  0.0720  9   DG  T "C3'" 
2805 O "O3'" . DG  B 9   ? 0.4081 0.3705 0.3845 0.0444  0.0152  0.0752  9   DG  T "O3'" 
2806 C "C2'" . DG  B 9   ? 0.2679 0.2373 0.2253 0.0513  0.0024  0.0770  9   DG  T "C2'" 
2807 C "C1'" . DG  B 9   ? 0.2776 0.2506 0.2247 0.0478  0.0058  0.0725  9   DG  T "C1'" 
2808 N N9    . DG  B 9   ? 0.3262 0.3043 0.2605 0.0503  -0.0003 0.0712  9   DG  T N9    
2809 C C8    . DG  B 9   ? 0.3017 0.2857 0.2376 0.0538  -0.0095 0.0687  9   DG  T C8    
2810 N N7    . DG  B 9   ? 0.2858 0.2736 0.2079 0.0550  -0.0132 0.0676  9   DG  T N7    
2811 C C5    . DG  B 9   ? 0.2603 0.2446 0.1710 0.0522  -0.0057 0.0695  9   DG  T C5    
2812 C C6    . DG  B 9   ? 0.3061 0.2923 0.1998 0.0518  -0.0050 0.0691  9   DG  T C6    
2813 O O6    . DG  B 9   ? 0.3099 0.3010 0.1944 0.0538  -0.0112 0.0669  9   DG  T O6    
2814 N N1    . DG  B 9   ? 0.2660 0.2478 0.1535 0.0484  0.0041  0.0713  9   DG  T N1    
2815 C C2    . DG  B 9   ? 0.3051 0.2816 0.2016 0.0456  0.0114  0.0735  9   DG  T C2    
2816 N N2    . DG  B 9   ? 0.2480 0.2214 0.1369 0.0423  0.0197  0.0752  9   DG  T N2    
2817 N N3    . DG  B 9   ? 0.2764 0.2508 0.1883 0.0459  0.0108  0.0738  9   DG  T N3    
2818 C C4    . DG  B 9   ? 0.3121 0.2907 0.2304 0.0493  0.0022  0.0718  9   DG  T C4    
2819 O "O5'" . DC  C 1   ? 0.4383 0.4351 0.2370 0.0375  0.0266  0.0563  1   DC  P "O5'" 
2820 C "C5'" . DC  C 1   ? 0.3561 0.3480 0.1551 0.0331  0.0344  0.0602  1   DC  P "C5'" 
2821 C "C4'" . DC  C 1   ? 0.3915 0.3777 0.2022 0.0332  0.0368  0.0659  1   DC  P "C4'" 
2822 O "O4'" . DC  C 1   ? 0.3762 0.3583 0.1848 0.0376  0.0300  0.0730  1   DC  P "O4'" 
2823 C "C3'" . DC  C 1   ? 0.3577 0.3465 0.1839 0.0336  0.0378  0.0612  1   DC  P "C3'" 
2824 O "O3'" . DC  C 1   ? 0.3719 0.3628 0.2043 0.0290  0.0457  0.0564  1   DC  P "O3'" 
2825 C "C2'" . DC  C 1   ? 0.3400 0.3225 0.1758 0.0347  0.0365  0.0678  1   DC  P "C2'" 
2826 C "C1'" . DC  C 1   ? 0.3832 0.3631 0.2073 0.0388  0.0295  0.0742  1   DC  P "C1'" 
2827 N N1    . DC  C 1   ? 0.3317 0.3157 0.1628 0.0423  0.0194  0.0710  1   DC  P N1    
2828 C C2    . DC  C 1   ? 0.3061 0.2880 0.1529 0.0436  0.0165  0.0724  1   DC  P C2    
2829 O O2    . DC  C 1   ? 0.3273 0.3036 0.1814 0.0418  0.0222  0.0763  1   DC  P O2    
2830 N N3    . DC  C 1   ? 0.3064 0.2926 0.1601 0.0467  0.0076  0.0692  1   DC  P N3    
2831 C C4    . DC  C 1   ? 0.3008 0.2930 0.1462 0.0482  0.0017  0.0647  1   DC  P C4    
2832 N N4    . DC  C 1   ? 0.2743 0.2708 0.1273 0.0509  -0.0069 0.0614  1   DC  P N4    
2833 C C5    . DC  C 1   ? 0.3315 0.3256 0.1605 0.0469  0.0046  0.0630  1   DC  P C5    
2834 C C6    . DC  C 1   ? 0.2953 0.2853 0.1178 0.0440  0.0135  0.0663  1   DC  P C6    
2835 P P     . DG  C 2   ? 0.3516 0.3485 0.1977 0.0282  0.0459  0.0475  2   DG  P P     
2836 O OP1   . DG  C 2   ? 0.3656 0.3642 0.2160 0.0234  0.0540  0.0441  2   DG  P OP1   
2837 O OP2   . DG  C 2   ? 0.2672 0.2697 0.1104 0.0308  0.0385  0.0413  2   DG  P OP2   
2838 O "O5'" . DG  C 2   ? 0.2944 0.2883 0.1572 0.0285  0.0435  0.0494  2   DG  P "O5'" 
2839 C "C5'" . DG  C 2   ? 0.2768 0.2652 0.1456 0.0259  0.0498  0.0545  2   DG  P "C5'" 
2840 C "C4'" . DG  C 2   ? 0.2433 0.2290 0.1267 0.0268  0.0462  0.0558  2   DG  P "C4'" 
2841 O "O4'" . DG  C 2   ? 0.3326 0.3158 0.2115 0.0310  0.0388  0.0604  2   DG  P "O4'" 
2842 C "C3'" . DG  C 2   ? 0.2295 0.2206 0.1267 0.0264  0.0426  0.0480  2   DG  P "C3'" 
2843 O "O3'" . DG  C 2   ? 0.2453 0.2378 0.1520 0.0224  0.0490  0.0446  2   DG  P "O3'" 
2844 C "C2'" . DG  C 2   ? 0.2285 0.2164 0.1347 0.0287  0.0370  0.0510  2   DG  P "C2'" 
2845 C "C1'" . DG  C 2   ? 0.2631 0.2479 0.1561 0.0324  0.0329  0.0574  2   DG  P "C1'" 
2846 N N9    . DG  C 2   ? 0.2497 0.2394 0.1385 0.0358  0.0244  0.0540  2   DG  P N9    
2847 C C8    . DG  C 2   ? 0.3493 0.3431 0.2249 0.0367  0.0226  0.0512  2   DG  P C8    
2848 N N7    . DG  C 2   ? 0.3364 0.3343 0.2114 0.0395  0.0143  0.0479  2   DG  P N7    
2849 C C5    . DG  C 2   ? 0.2835 0.2803 0.1727 0.0407  0.0104  0.0487  2   DG  P C5    
2850 C C6    . DG  C 2   ? 0.3129 0.3131 0.2086 0.0435  0.0017  0.0460  2   DG  P C6    
2851 O O6    . DG  C 2   ? 0.3143 0.3194 0.2043 0.0454  -0.0048 0.0424  2   DG  P O6    
2852 N N1    . DG  C 2   ? 0.2142 0.2121 0.1249 0.0436  0.0009  0.0477  2   DG  P N1    
2853 C C2    . DG  C 2   ? 0.2874 0.2799 0.2053 0.0413  0.0077  0.0512  2   DG  P C2    
2854 N N2    . DG  C 2   ? 0.1997 0.1906 0.1319 0.0417  0.0060  0.0519  2   DG  P N2    
2855 N N3    . DG  C 2   ? 0.2422 0.2313 0.1540 0.0385  0.0158  0.0537  2   DG  P N3    
2856 C C4    . DG  C 2   ? 0.2596 0.2513 0.1572 0.0384  0.0166  0.0523  2   DG  P C4    
2857 P P     . DT  C 3   ? 0.2365 0.2355 0.1540 0.0214  0.0469  0.0356  3   DT  P P     
2858 O OP1   . DT  C 3   ? 0.2305 0.2302 0.1557 0.0172  0.0542  0.0338  3   DT  P OP1   
2859 O OP2   . DT  C 3   ? 0.1991 0.2028 0.1074 0.0236  0.0430  0.0310  3   DT  P OP2   
2860 O "O5'" . DT  C 3   ? 0.2112 0.2093 0.1405 0.0230  0.0403  0.0349  3   DT  P "O5'" 
2861 C "C5'" . DT  C 3   ? 0.2029 0.1965 0.1425 0.0214  0.0425  0.0385  3   DT  P "C5'" 
2862 C "C4'" . DT  C 3   ? 0.1931 0.1870 0.1428 0.0234  0.0356  0.0372  3   DT  P "C4'" 
2863 O "O4'" . DT  C 3   ? 0.2105 0.2036 0.1522 0.0277  0.0293  0.0404  3   DT  P "O4'" 
2864 C "C3'" . DT  C 3   ? 0.1477 0.1472 0.1051 0.0230  0.0316  0.0292  3   DT  P "C3'" 
2865 O "O3'" . DT  C 3   ? 0.1710 0.1710 0.1403 0.0192  0.0354  0.0263  3   DT  P "O3'" 
2866 C "C2'" . DT  C 3   ? 0.1625 0.1622 0.1239 0.0263  0.0237  0.0295  3   DT  P "C2'" 
2867 C "C1'" . DT  C 3   ? 0.2139 0.2108 0.1625 0.0297  0.0218  0.0358  3   DT  P "C1'" 
2868 N N1    . DT  C 3   ? 0.2107 0.2119 0.1483 0.0322  0.0168  0.0329  3   DT  P N1    
2869 C C2    . DT  C 3   ? 0.2334 0.2376 0.1734 0.0350  0.0086  0.0305  3   DT  P C2    
2870 O O2    . DT  C 3   ? 0.2004 0.2042 0.1514 0.0357  0.0053  0.0307  3   DT  P O2    
2871 N N3    . DT  C 3   ? 0.1818 0.1900 0.1108 0.0368  0.0046  0.0276  3   DT  P N3    
2872 C C4    . DT  C 3   ? 0.2539 0.2631 0.1702 0.0362  0.0081  0.0267  3   DT  P C4    
2873 O O4    . DT  C 3   ? 0.3299 0.3427 0.2368 0.0378  0.0042  0.0235  3   DT  P O4    
2874 C C5    . DT  C 3   ? 0.2272 0.2333 0.1421 0.0333  0.0170  0.0293  3   DT  P C5    
2875 C C7    . DT  C 3   ? 0.2378 0.2451 0.1399 0.0322  0.0219  0.0284  3   DT  P C7    
2876 C C6    . DT  C 3   ? 0.2318 0.2341 0.1574 0.0314  0.0207  0.0323  3   DT  P C6    
2877 P P     . DA  C 4   ? 0.2092 0.2133 0.1794 0.0163  0.0398  0.0210  4   DA  P P     
2878 O OP1   . DA  C 4   ? 0.1753 0.1804 0.1593 0.0135  0.0399  0.0174  4   DA  P OP1   
2879 O OP2   . DA  C 4   ? 0.2962 0.2987 0.2588 0.0146  0.0469  0.0247  4   DA  P OP2   
2880 O "O5'" . DA  C 4   ? 0.2192 0.2280 0.1825 0.0189  0.0348  0.0159  4   DA  P "O5'" 
2881 C "C5'" . DA  C 4   ? 0.2021 0.2153 0.1680 0.0174  0.0361  0.0096  4   DA  P "C5'" 
2882 C "C4'" . DA  C 4   ? 0.2594 0.2758 0.2139 0.0198  0.0344  0.0065  4   DA  P "C4'" 
2883 O "O4'" . DA  C 4   ? 0.2551 0.2727 0.2087 0.0226  0.0265  0.0038  4   DA  P "O4'" 
2884 C "C3'" . DA  C 4   ? 0.2898 0.3044 0.2302 0.0210  0.0373  0.0114  4   DA  P "C3'" 
2885 O "O3'" . DA  C 4   ? 0.3163 0.3347 0.2481 0.0215  0.0390  0.0074  4   DA  P "O3'" 
2886 C "C2'" . DA  C 4   ? 0.2715 0.2842 0.2074 0.0242  0.0307  0.0146  4   DA  P "C2'" 
2887 C "C1'" . DA  C 4   ? 0.2863 0.3027 0.2278 0.0254  0.0241  0.0078  4   DA  P "C1'" 
2888 N N9    . DA  C 4   ? 0.2682 0.2838 0.2139 0.0275  0.0171  0.0090  4   DA  P N9    
2889 C C8    . DA  C 4   ? 0.2400 0.2533 0.1974 0.0267  0.0162  0.0111  4   DA  P C8    
2890 N N7    . DA  C 4   ? 0.2174 0.2312 0.1771 0.0291  0.0094  0.0112  4   DA  P N7    
2891 C C5    . DA  C 4   ? 0.2123 0.2291 0.1609 0.0315  0.0053  0.0090  4   DA  P C5    
2892 C C6    . DA  C 4   ? 0.2772 0.2965 0.2223 0.0345  -0.0026 0.0079  4   DA  P C6    
2893 N N6    . DA  C 4   ? 0.2422 0.2616 0.1959 0.0359  -0.0079 0.0089  4   DA  P N6    
2894 N N1    . DA  C 4   ? 0.1959 0.2179 0.1287 0.0360  -0.0048 0.0053  4   DA  P N1    
2895 C C2    . DA  C 4   ? 0.2222 0.2444 0.1470 0.0346  0.0009  0.0040  4   DA  P C2    
2896 N N3    . DA  C 4   ? 0.2413 0.2618 0.1691 0.0320  0.0085  0.0049  4   DA  P N3    
2897 C C4    . DA  C 4   ? 0.2553 0.2730 0.1950 0.0305  0.0101  0.0075  4   DA  P C4    
2898 P P     . U   C 5   ? 0.3179 0.3368 0.2426 0.0195  0.0474  0.0090  5   U   P P     
2899 O OP1   . U   C 5   ? 0.2784 0.2925 0.2033 0.0177  0.0520  0.0164  5   U   P OP1   
2900 O OP2   . U   C 5   ? 0.3710 0.3918 0.2813 0.0218  0.0461  0.0075  5   U   P OP2   
2901 O "O5'" . U   C 5   ? 0.3550 0.3782 0.2895 0.0175  0.0504  0.0027  5   U   P "O5'" 
2902 C "C5'" . U   C 5   ? 0.3992 0.4223 0.3468 0.0145  0.0531  0.0025  5   U   P "C5'" 
2903 C "C4'" . U   C 5   ? 0.5232 0.5513 0.4748 0.0135  0.0563  -0.0033 5   U   P "C4'" 
2904 O OP3   . DG  D 1   ? 0.3026 0.3347 0.1874 0.0300  0.0433  -0.0926 1   DG  D OP3   
2905 P P     . DG  D 1   ? 0.3475 0.3808 0.2204 0.0289  0.0419  -0.0887 1   DG  D P     
2906 O OP1   . DG  D 1   ? 0.2636 0.2976 0.1353 0.0284  0.0475  -0.0833 1   DG  D OP1   
2907 O OP2   . DG  D 1   ? 0.3360 0.3688 0.1954 0.0284  0.0403  -0.0923 1   DG  D OP2   
2908 O "O5'" . DG  D 1   ? 0.3579 0.3923 0.2367 0.0289  0.0352  -0.0865 1   DG  D "O5'" 
2909 C "C5'" . DG  D 1   ? 0.2762 0.3109 0.1682 0.0292  0.0350  -0.0835 1   DG  D "C5'" 
2910 C "C4'" . DG  D 1   ? 0.2777 0.3116 0.1793 0.0295  0.0289  -0.0861 1   DG  D "C4'" 
2911 O "O4'" . DG  D 1   ? 0.2648 0.3000 0.1611 0.0293  0.0232  -0.0849 1   DG  D "O4'" 
2912 C "C3'" . DG  D 1   ? 0.2335 0.2654 0.1367 0.0298  0.0275  -0.0923 1   DG  D "C3'" 
2913 O "O3'" . DG  D 1   ? 0.2436 0.2741 0.1598 0.0300  0.0242  -0.0934 1   DG  D "O3'" 
2914 C "C2'" . DG  D 1   ? 0.2455 0.2781 0.1365 0.0293  0.0233  -0.0945 1   DG  D "C2'" 
2915 C "C1'" . DG  D 1   ? 0.2385 0.2733 0.1288 0.0292  0.0193  -0.0898 1   DG  D "C1'" 
2916 N N9    . DG  D 1   ? 0.3048 0.3413 0.1803 0.0289  0.0177  -0.0879 1   DG  D N9    
2917 C C8    . DG  D 1   ? 0.3330 0.3695 0.1955 0.0284  0.0217  -0.0875 1   DG  D C8    
2918 N N7    . DG  D 1   ? 0.2735 0.3116 0.1241 0.0281  0.0187  -0.0848 1   DG  D N7    
2919 C C5    . DG  D 1   ? 0.2930 0.3325 0.1496 0.0288  0.0122  -0.0835 1   DG  D C5    
2920 C C6    . DG  D 1   ? 0.2849 0.3265 0.1345 0.0293  0.0063  -0.0803 1   DG  D C6    
2921 O O6    . DG  D 1   ? 0.2846 0.3271 0.1204 0.0291  0.0053  -0.0775 1   DG  D O6    
2922 N N1    . DG  D 1   ? 0.2551 0.2975 0.1154 0.0301  0.0009  -0.0802 1   DG  D N1    
2923 C C2    . DG  D 1   ? 0.2492 0.2901 0.1245 0.0300  0.0013  -0.0827 1   DG  D C2    
2924 N N2    . DG  D 1   ? 0.2386 0.2803 0.1224 0.0305  -0.0041 -0.0822 1   DG  D N2    
2925 N N3    . DG  D 1   ? 0.2380 0.2769 0.1197 0.0295  0.0066  -0.0852 1   DG  D N3    
2926 C C4    . DG  D 1   ? 0.2800 0.3184 0.1520 0.0291  0.0118  -0.0855 1   DG  D C4    
2927 P P     . DC  D 2   ? 0.2939 0.3216 0.2158 0.0303  0.0234  -0.0990 2   DC  D P     
2928 O OP1   . DC  D 2   ? 0.2830 0.3095 0.2189 0.0307  0.0240  -0.0972 2   DC  D OP1   
2929 O OP2   . DC  D 2   ? 0.3014 0.3286 0.2143 0.0308  0.0274  -0.1027 2   DC  D OP2   
2930 O "O5'" . DC  D 2   ? 0.2305 0.2576 0.1514 0.0295  0.0166  -0.1014 2   DC  D "O5'" 
2931 C "C5'" . DC  D 2   ? 0.2501 0.2774 0.1792 0.0290  0.0122  -0.0988 2   DC  D "C5'" 
2932 C "C4'" . DC  D 2   ? 0.2814 0.3102 0.2045 0.0283  0.0064  -0.0994 2   DC  D "C4'" 
2933 O "O4'" . DC  D 2   ? 0.2767 0.3079 0.1860 0.0285  0.0072  -0.0984 2   DC  D "O4'" 
2934 C "C3'" . DC  D 2   ? 0.2422 0.2692 0.1651 0.0275  0.0027  -0.1046 2   DC  D "C3'" 
2935 O "O3'" . DC  D 2   ? 0.2720 0.2975 0.2063 0.0268  -0.0011 -0.1042 2   DC  D "O3'" 
2936 C "C2'" . DC  D 2   ? 0.2984 0.3279 0.2083 0.0272  -0.0006 -0.1054 2   DC  D "C2'" 
2937 C "C1'" . DC  D 2   ? 0.2765 0.3088 0.1808 0.0279  0.0013  -0.1001 2   DC  D "C1'" 
2938 N N1    . DC  D 2   ? 0.2570 0.2913 0.1455 0.0279  0.0016  -0.0998 2   DC  D N1    
2939 C C2    . DC  D 2   ? 0.2578 0.2949 0.1396 0.0279  -0.0037 -0.0973 2   DC  D C2    
2940 O O2    . DC  D 2   ? 0.2437 0.2815 0.1333 0.0280  -0.0084 -0.0960 2   DC  D O2    
2941 N N3    . DC  D 2   ? 0.2654 0.3041 0.1323 0.0278  -0.0036 -0.0962 2   DC  D N3    
2942 C C4    . DC  D 2   ? 0.3602 0.3977 0.2189 0.0275  0.0019  -0.0978 2   DC  D C4    
2943 N N4    . DC  D 2   ? 0.2909 0.3297 0.1343 0.0270  0.0018  -0.0963 2   DC  D N4    
2944 C C5    . DC  D 2   ? 0.2731 0.3080 0.1389 0.0275  0.0075  -0.1007 2   DC  D C5    
2945 C C6    . DC  D 2   ? 0.3039 0.3374 0.1845 0.0279  0.0070  -0.1014 2   DC  D C6    
2946 P P     A DC  D 3   ? 0.2731 0.2957 0.2114 0.0257  -0.0042 -0.1090 3   DC  D P     
2947 P P     B DC  D 3   ? 0.2612 0.2846 0.1978 0.0256  -0.0054 -0.1087 3   DC  D P     
2948 O OP1   A DC  D 3   ? 0.2464 0.2664 0.1981 0.0253  -0.0044 -0.1074 3   DC  D OP1   
2949 O OP1   B DC  D 3   ? 0.2381 0.2591 0.1881 0.0249  -0.0067 -0.1073 3   DC  D OP1   
2950 O OP2   A DC  D 3   ? 0.3061 0.3275 0.2364 0.0260  -0.0015 -0.1138 3   DC  D OP2   
2951 O OP2   B DC  D 3   ? 0.3032 0.3250 0.2326 0.0257  -0.0030 -0.1138 3   DC  D OP2   
2952 O "O5'" A DC  D 3   ? 0.2630 0.2878 0.1977 0.0247  -0.0104 -0.1092 3   DC  D "O5'" 
2953 O "O5'" B DC  D 3   ? 0.2450 0.2715 0.1753 0.0249  -0.0109 -0.1082 3   DC  D "O5'" 
2954 C "C5'" A DC  D 3   ? 0.2502 0.2767 0.1910 0.0244  -0.0136 -0.1051 3   DC  D "C5'" 
2955 C "C5'" B DC  D 3   ? 0.2302 0.2590 0.1641 0.0251  -0.0133 -0.1035 3   DC  D "C5'" 
2956 C "C4'" A DC  D 3   ? 0.2913 0.3206 0.2264 0.0239  -0.0192 -0.1056 3   DC  D "C4'" 
2957 C "C4'" B DC  D 3   ? 0.2864 0.3173 0.2184 0.0243  -0.0196 -0.1041 3   DC  D "C4'" 
2958 O "O4'" A DC  D 3   ? 0.2701 0.3023 0.1919 0.0249  -0.0186 -0.1048 3   DC  D "O4'" 
2959 O "O4'" B DC  D 3   ? 0.3035 0.3376 0.2217 0.0250  -0.0208 -0.1037 3   DC  D "O4'" 
2960 C "C3'" A DC  D 3   ? 0.3269 0.3549 0.2611 0.0224  -0.0221 -0.1105 3   DC  D "C3'" 
2961 C "C3'" B DC  D 3   ? 0.3244 0.3533 0.2588 0.0228  -0.0223 -0.1087 3   DC  D "C3'" 
2962 O "O3'" A DC  D 3   ? 0.3913 0.4184 0.3360 0.0210  -0.0259 -0.1100 3   DC  D "O3'" 
2963 O "O3'" B DC  D 3   ? 0.3603 0.3903 0.3011 0.0217  -0.0274 -0.1078 3   DC  D "O3'" 
2964 C "C2'" A DC  D 3   ? 0.3203 0.3517 0.2411 0.0225  -0.0249 -0.1119 3   DC  D "C2'" 
2965 C "C2'" B DC  D 3   ? 0.3010 0.3313 0.2217 0.0227  -0.0225 -0.1122 3   DC  D "C2'" 
2966 C "C1'" A DC  D 3   ? 0.3233 0.3573 0.2370 0.0241  -0.0229 -0.1075 3   DC  D "C1'" 
2967 C "C1'" B DC  D 3   ? 0.3356 0.3698 0.2470 0.0240  -0.0232 -0.1082 3   DC  D "C1'" 
2968 N N1    A DC  D 3   ? 0.3220 0.3568 0.2215 0.0245  -0.0200 -0.1089 3   DC  D N1    
2969 N N1    B DC  D 3   ? 0.3163 0.3512 0.2136 0.0245  -0.0198 -0.1092 3   DC  D N1    
2970 C C2    A DC  D 3   ? 0.3060 0.3442 0.1932 0.0248  -0.0230 -0.1071 3   DC  D C2    
2971 C C2    B DC  D 3   ? 0.2892 0.3275 0.1742 0.0249  -0.0224 -0.1069 3   DC  D C2    
2972 O O2    A DC  D 3   ? 0.3105 0.3513 0.1992 0.0250  -0.0282 -0.1044 3   DC  D O2    
2973 O O2    B DC  D 3   ? 0.3132 0.3542 0.1996 0.0251  -0.0278 -0.1044 3   DC  D O2    
2974 N N3    A DC  D 3   ? 0.2736 0.3120 0.1475 0.0248  -0.0200 -0.1080 3   DC  D N3    
2975 N N3    B DC  D 3   ? 0.2745 0.3131 0.1465 0.0251  -0.0190 -0.1073 3   DC  D N3    
2976 C C4    A DC  D 3   ? 0.2985 0.3341 0.1719 0.0247  -0.0142 -0.1110 3   DC  D C4    
2977 C C4    B DC  D 3   ? 0.2779 0.3138 0.1495 0.0250  -0.0131 -0.1101 3   DC  D C4    
2978 N N4    A DC  D 3   ? 0.3154 0.3512 0.1754 0.0246  -0.0110 -0.1118 3   DC  D N4    
2979 N N4    B DC  D 3   ? 0.2913 0.3274 0.1497 0.0249  -0.0095 -0.1103 3   DC  D N4    
2980 C C5    A DC  D 3   ? 0.2792 0.3115 0.1655 0.0248  -0.0113 -0.1129 3   DC  D C5    
2981 C C5    B DC  D 3   ? 0.2684 0.3010 0.1529 0.0250  -0.0105 -0.1125 3   DC  D C5    
2982 C C6    A DC  D 3   ? 0.2924 0.3244 0.1912 0.0247  -0.0145 -0.1116 3   DC  D C6    
2983 C C6    B DC  D 3   ? 0.2880 0.3201 0.1847 0.0247  -0.0141 -0.1117 3   DC  D C6    
2984 P P     A DG  D 4   ? 0.3602 0.3910 0.3068 0.0208  -0.0312 -0.1070 4   DG  D P     
2985 P P     B DG  D 4   ? 0.4151 0.4428 0.3614 0.0197  -0.0302 -0.1116 4   DG  D P     
2986 O OP1   A DG  D 4   ? 0.3198 0.3535 0.2608 0.0225  -0.0306 -0.1030 4   DG  D OP1   
2987 O OP1   B DG  D 4   ? 0.3642 0.3912 0.3228 0.0187  -0.0320 -0.1087 4   DG  D OP1   
2988 O OP2   A DG  D 4   ? 0.3711 0.3998 0.3307 0.0194  -0.0324 -0.1058 4   DG  D OP2   
2989 O OP2   B DG  D 4   ? 0.4168 0.4409 0.3615 0.0195  -0.0265 -0.1157 4   DG  D OP2   
2990 O "O5'" A DG  D 4   ? 0.4194 0.4523 0.3578 0.0198  -0.0357 -0.1107 4   DG  D "O5'" 
2991 O "O5'" B DG  D 4   ? 0.4566 0.4880 0.3938 0.0191  -0.0352 -0.1137 4   DG  D "O5'" 
2992 C "C5'" A DG  D 4   ? 0.3952 0.4326 0.3261 0.0205  -0.0399 -0.1088 4   DG  D "C5'" 
2993 C "C5'" B DG  D 4   ? 0.4059 0.4417 0.3390 0.0200  -0.0386 -0.1101 4   DG  D "C5'" 
2994 C "C4'" A DG  D 4   ? 0.3634 0.4025 0.2845 0.0194  -0.0430 -0.1128 4   DG  D "C4'" 
2995 C "C4'" B DG  D 4   ? 0.3624 0.4014 0.2843 0.0196  -0.0428 -0.1123 4   DG  D "C4'" 
2996 O "O4'" A DG  D 4   ? 0.3478 0.3873 0.2556 0.0204  -0.0402 -0.1136 4   DG  D "O4'" 
2997 O "O4'" B DG  D 4   ? 0.3452 0.3846 0.2540 0.0206  -0.0398 -0.1130 4   DG  D "O4'" 
2998 C "C3'" A DG  D 4   ? 0.3599 0.3958 0.2851 0.0173  -0.0430 -0.1180 4   DG  D "C3'" 
2999 C "C3'" B DG  D 4   ? 0.3669 0.4045 0.2896 0.0173  -0.0449 -0.1176 4   DG  D "C3'" 
3000 O "O3'" A DG  D 4   ? 0.3657 0.4041 0.2899 0.0157  -0.0486 -0.1198 4   DG  D "O3'" 
3001 O "O3'" B DG  D 4   ? 0.3756 0.4173 0.2949 0.0165  -0.0510 -0.1177 4   DG  D "O3'" 
3002 C "C2'" A DG  D 4   ? 0.3512 0.3850 0.2666 0.0175  -0.0390 -0.1217 4   DG  D "C2'" 
3003 C "C2'" B DG  D 4   ? 0.3626 0.3982 0.2754 0.0173  -0.0412 -0.1215 4   DG  D "C2'" 
3004 C "C1'" A DG  D 4   ? 0.3660 0.4036 0.2686 0.0189  -0.0396 -0.1191 4   DG  D "C1'" 
3005 C "C1'" B DG  D 4   ? 0.3618 0.4002 0.2635 0.0191  -0.0402 -0.1182 4   DG  D "C1'" 
3006 N N9    A DG  D 4   ? 0.3533 0.3894 0.2467 0.0197  -0.0343 -0.1203 4   DG  D N9    
3007 N N9    B DG  D 4   ? 0.3636 0.3999 0.2576 0.0198  -0.0344 -0.1199 4   DG  D N9    
3008 C C8    A DG  D 4   ? 0.3114 0.3434 0.2085 0.0200  -0.0286 -0.1225 4   DG  D C8    
3009 C C8    B DG  D 4   ? 0.3016 0.3336 0.2012 0.0199  -0.0292 -0.1222 4   DG  D C8    
3010 N N7    A DG  D 4   ? 0.2934 0.3252 0.1806 0.0207  -0.0244 -0.1232 4   DG  D N7    
3011 N N7    B DG  D 4   ? 0.2858 0.3169 0.1766 0.0206  -0.0245 -0.1233 4   DG  D N7    
3012 C C5    A DG  D 4   ? 0.3099 0.3455 0.1851 0.0208  -0.0275 -0.1212 4   DG  D C5    
3013 C C5    B DG  D 4   ? 0.3002 0.3350 0.1782 0.0208  -0.0268 -0.1215 4   DG  D C5    
3014 C C6    A DG  D 4   ? 0.3214 0.3582 0.1820 0.0212  -0.0250 -0.1204 4   DG  D C6    
3015 C C6    B DG  D 4   ? 0.3120 0.3475 0.1761 0.0212  -0.0235 -0.1214 4   DG  D C6    
3016 O O6    A DG  D 4   ? 0.3252 0.3599 0.1808 0.0215  -0.0192 -0.1219 4   DG  D O6    
3017 O O6    B DG  D 4   ? 0.3155 0.3485 0.1763 0.0216  -0.0176 -0.1232 4   DG  D O6    
3018 N N1    A DG  D 4   ? 0.3196 0.3603 0.1709 0.0211  -0.0300 -0.1174 4   DG  D N1    
3019 N N1    B DG  D 4   ? 0.3263 0.3656 0.1795 0.0211  -0.0277 -0.1185 4   DG  D N1    
3020 C C2    A DG  D 4   ? 0.3425 0.3860 0.1990 0.0209  -0.0367 -0.1156 4   DG  D C2    
3021 C C2    B DG  D 4   ? 0.3509 0.3933 0.2071 0.0210  -0.0344 -0.1161 4   DG  D C2    
3022 N N2    A DG  D 4   ? 0.3403 0.3876 0.1866 0.0211  -0.0412 -0.1123 4   DG  D N2    
3023 N N2    B DG  D 4   ? 0.3252 0.3712 0.1697 0.0212  -0.0381 -0.1129 4   DG  D N2    
3024 N N3    A DG  D 4   ? 0.3192 0.3618 0.1899 0.0204  -0.0387 -0.1166 4   DG  D N3    
3025 N N3    B DG  D 4   ? 0.3221 0.3642 0.1920 0.0206  -0.0373 -0.1166 4   DG  D N3    
3026 C C4    A DG  D 4   ? 0.3358 0.3742 0.2148 0.0203  -0.0338 -0.1193 4   DG  D C4    
3027 C C4    B DG  D 4   ? 0.3396 0.3777 0.2194 0.0204  -0.0331 -0.1193 4   DG  D C4    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   129 ?   ?   ?   A . n 
A 1 2   SER 2   130 ?   ?   ?   A . n 
A 1 3   ALA 3   131 ?   ?   ?   A . n 
A 1 4   ALA 4   132 ?   ?   ?   A . n 
A 1 5   ALA 5   133 ?   ?   ?   A . n 
A 1 6   SER 6   134 ?   ?   ?   A . n 
A 1 7   PRO 7   135 ?   ?   ?   A . n 
A 1 8   ALA 8   136 ?   ?   ?   A . n 
A 1 9   TRP 9   137 ?   ?   ?   A . n 
A 1 10  MET 10  138 138 MET MET A . n 
A 1 11  PRO 11  139 139 PRO PRO A . n 
A 1 12  ALA 12  140 140 ALA ALA A . n 
A 1 13  TYR 13  141 141 TYR TYR A . n 
A 1 14  ALA 14  142 142 ALA ALA A . n 
A 1 15  CYS 15  143 143 CYS CYS A . n 
A 1 16  GLN 16  144 144 GLN GLN A . n 
A 1 17  ARG 17  145 145 ARG ARG A . n 
A 1 18  PRO 18  146 146 PRO PRO A . n 
A 1 19  THR 19  147 147 THR THR A . n 
A 1 20  PRO 20  148 148 PRO PRO A . n 
A 1 21  LEU 21  149 149 LEU LEU A . n 
A 1 22  THR 22  150 150 THR THR A . n 
A 1 23  HIS 23  151 151 HIS HIS A . n 
A 1 24  HIS 24  152 152 HIS HIS A . n 
A 1 25  ASN 25  153 153 ASN ASN A . n 
A 1 26  THR 26  154 154 THR THR A . n 
A 1 27  GLY 27  155 155 GLY GLY A . n 
A 1 28  LEU 28  156 156 LEU LEU A . n 
A 1 29  SER 29  157 157 SER SER A . n 
A 1 30  GLU 30  158 158 GLU GLU A . n 
A 1 31  ALA 31  159 159 ALA ALA A . n 
A 1 32  LEU 32  160 160 LEU LEU A . n 
A 1 33  GLU 33  161 161 GLU GLU A . n 
A 1 34  ILE 34  162 162 ILE ILE A . n 
A 1 35  LEU 35  163 163 LEU LEU A . n 
A 1 36  ALA 36  164 164 ALA ALA A . n 
A 1 37  GLU 37  165 165 GLU GLU A . n 
A 1 38  ALA 38  166 166 ALA ALA A . n 
A 1 39  ALA 39  167 167 ALA ALA A . n 
A 1 40  GLY 40  168 168 GLY GLY A . n 
A 1 41  PHE 41  169 169 PHE PHE A . n 
A 1 42  GLU 42  170 170 GLU GLU A . n 
A 1 43  GLY 43  171 171 GLY GLY A . n 
A 1 44  SER 44  172 172 SER SER A . n 
A 1 45  GLU 45  173 173 GLU GLU A . n 
A 1 46  GLY 46  174 174 GLY GLY A . n 
A 1 47  ARG 47  175 175 ARG ARG A . n 
A 1 48  LEU 48  176 176 LEU LEU A . n 
A 1 49  LEU 49  177 177 LEU LEU A . n 
A 1 50  THR 50  178 178 THR THR A . n 
A 1 51  PHE 51  179 179 PHE PHE A . n 
A 1 52  CYS 52  180 180 CYS CYS A . n 
A 1 53  ARG 53  181 181 ARG ARG A . n 
A 1 54  ALA 54  182 182 ALA ALA A . n 
A 1 55  ALA 55  183 183 ALA ALA A . n 
A 1 56  SER 56  184 184 SER SER A . n 
A 1 57  VAL 57  185 185 VAL VAL A . n 
A 1 58  LEU 58  186 186 LEU LEU A . n 
A 1 59  LYS 59  187 187 LYS LYS A . n 
A 1 60  ALA 60  188 188 ALA ALA A . n 
A 1 61  LEU 61  189 189 LEU LEU A . n 
A 1 62  PRO 62  190 190 PRO PRO A . n 
A 1 63  SER 63  191 191 SER SER A . n 
A 1 64  PRO 64  192 192 PRO PRO A . n 
A 1 65  VAL 65  193 193 VAL VAL A . n 
A 1 66  THR 66  194 194 THR THR A . n 
A 1 67  THR 67  195 195 THR THR A . n 
A 1 68  LEU 68  196 196 LEU LEU A . n 
A 1 69  SER 69  197 197 SER SER A . n 
A 1 70  GLN 70  198 198 GLN GLN A . n 
A 1 71  LEU 71  199 199 LEU LEU A . n 
A 1 72  GLN 72  200 200 GLN GLN A . n 
A 1 73  GLY 73  201 201 GLY GLY A . n 
A 1 74  LEU 74  202 202 LEU LEU A . n 
A 1 75  PRO 75  203 203 PRO PRO A . n 
A 1 76  HIS 76  204 204 HIS HIS A . n 
A 1 77  PHE 77  205 205 PHE PHE A . n 
A 1 78  GLY 78  206 206 GLY GLY A . n 
A 1 79  GLU 79  207 207 GLU GLU A . n 
A 1 80  HIS 80  208 208 HIS HIS A . n 
A 1 81  SER 81  209 209 SER SER A . n 
A 1 82  SER 82  210 210 SER SER A . n 
A 1 83  ARG 83  211 211 ARG ARG A . n 
A 1 84  VAL 84  212 212 VAL VAL A . n 
A 1 85  VAL 85  213 213 VAL VAL A . n 
A 1 86  GLN 86  214 214 GLN GLN A . n 
A 1 87  GLU 87  215 215 GLU GLU A . n 
A 1 88  LEU 88  216 216 LEU LEU A . n 
A 1 89  LEU 89  217 217 LEU LEU A . n 
A 1 90  GLU 90  218 218 GLU GLU A . n 
A 1 91  HIS 91  219 219 HIS HIS A . n 
A 1 92  GLY 92  220 220 GLY GLY A . n 
A 1 93  VAL 93  221 221 VAL VAL A . n 
A 1 94  CYS 94  222 222 CYS CYS A . n 
A 1 95  GLU 95  223 223 GLU GLU A . n 
A 1 96  GLU 96  224 224 GLU GLU A . n 
A 1 97  VAL 97  225 225 VAL VAL A . n 
A 1 98  GLU 98  226 226 GLU GLU A . n 
A 1 99  ARG 99  227 227 ARG ARG A . n 
A 1 100 VAL 100 228 228 VAL VAL A . n 
A 1 101 ARG 101 229 229 ARG ARG A . n 
A 1 102 ARG 102 230 230 ARG ARG A . n 
A 1 103 SER 103 231 231 SER SER A . n 
A 1 104 GLU 104 232 232 GLU GLU A . n 
A 1 105 ARG 105 233 233 ARG ARG A . n 
A 1 106 TYR 106 234 234 TYR TYR A . n 
A 1 107 GLN 107 235 235 GLN GLN A . n 
A 1 108 THR 108 236 236 THR THR A . n 
A 1 109 MET 109 237 237 MET MET A . n 
A 1 110 LYS 110 238 238 LYS LYS A . n 
A 1 111 LEU 111 239 239 LEU LEU A . n 
A 1 112 PHE 112 240 240 PHE PHE A . n 
A 1 113 THR 113 241 241 THR THR A . n 
A 1 114 GLN 114 242 242 GLN GLN A . n 
A 1 115 ILE 115 243 243 ILE ILE A . n 
A 1 116 PHE 116 244 244 PHE PHE A . n 
A 1 117 GLY 117 245 245 GLY GLY A . n 
A 1 118 VAL 118 246 246 VAL VAL A . n 
A 1 119 GLY 119 247 247 GLY GLY A . n 
A 1 120 VAL 120 248 248 VAL VAL A . n 
A 1 121 LYS 121 249 249 LYS LYS A . n 
A 1 122 THR 122 250 250 THR THR A . n 
A 1 123 ALA 123 251 251 ALA ALA A . n 
A 1 124 ASP 124 252 252 ASP ASP A . n 
A 1 125 ARG 125 253 253 ARG ARG A . n 
A 1 126 TRP 126 254 254 TRP TRP A . n 
A 1 127 TYR 127 255 255 TYR TYR A . n 
A 1 128 ARG 128 256 256 ARG ARG A . n 
A 1 129 GLU 129 257 257 GLU GLU A . n 
A 1 130 GLY 130 258 258 GLY GLY A . n 
A 1 131 LEU 131 259 259 LEU LEU A . n 
A 1 132 ARG 132 260 260 ARG ARG A . n 
A 1 133 THR 133 261 261 THR THR A . n 
A 1 134 LEU 134 262 262 LEU LEU A . n 
A 1 135 ASP 135 263 263 ASP ASP A . n 
A 1 136 ASP 136 264 264 ASP ASP A . n 
A 1 137 LEU 137 265 265 LEU LEU A . n 
A 1 138 ARG 138 266 266 ARG ARG A . n 
A 1 139 GLU 139 267 267 GLU GLU A . n 
A 1 140 GLN 140 268 268 GLN GLN A . n 
A 1 141 PRO 141 269 269 PRO PRO A . n 
A 1 142 GLN 142 270 270 GLN GLN A . n 
A 1 143 LYS 143 271 271 LYS LYS A . n 
A 1 144 LEU 144 272 272 LEU LEU A . n 
A 1 145 THR 145 273 273 THR THR A . n 
A 1 146 GLN 146 274 274 GLN GLN A . n 
A 1 147 GLN 147 275 275 GLN GLN A . n 
A 1 148 GLN 148 276 276 GLN GLN A . n 
A 1 149 LYS 149 277 277 LYS LYS A . n 
A 1 150 ALA 150 278 278 ALA ALA A . n 
A 1 151 GLY 151 279 279 GLY GLY A . n 
A 1 152 LEU 152 280 280 LEU LEU A . n 
A 1 153 GLN 153 281 281 GLN GLN A . n 
A 1 154 HIS 154 282 282 HIS HIS A . n 
A 1 155 HIS 155 283 283 HIS HIS A . n 
A 1 156 GLN 156 284 284 GLN GLN A . n 
A 1 157 ASP 157 285 285 ASP ASP A . n 
A 1 158 LEU 158 286 286 LEU LEU A . n 
A 1 159 SER 159 287 287 SER SER A . n 
A 1 160 THR 160 288 288 THR THR A . n 
A 1 161 PRO 161 289 289 PRO PRO A . n 
A 1 162 VAL 162 290 290 VAL VAL A . n 
A 1 163 LEU 163 291 291 LEU LEU A . n 
A 1 164 ARG 164 292 292 ARG ARG A . n 
A 1 165 SER 165 293 293 SER SER A . n 
A 1 166 ASP 166 294 294 ASP ASP A . n 
A 1 167 VAL 167 295 295 VAL VAL A . n 
A 1 168 ASP 168 296 296 ASP ASP A . n 
A 1 169 ALA 169 297 297 ALA ALA A . n 
A 1 170 LEU 170 298 298 LEU LEU A . n 
A 1 171 GLN 171 299 299 GLN GLN A . n 
A 1 172 GLN 172 300 300 GLN GLN A . n 
A 1 173 VAL 173 301 301 VAL VAL A . n 
A 1 174 VAL 174 302 302 VAL VAL A . n 
A 1 175 GLU 175 303 303 GLU GLU A . n 
A 1 176 GLU 176 304 304 GLU GLU A . n 
A 1 177 ALA 177 305 305 ALA ALA A . n 
A 1 178 VAL 178 306 306 VAL VAL A . n 
A 1 179 GLY 179 307 307 GLY GLY A . n 
A 1 180 GLN 180 308 308 GLN GLN A . n 
A 1 181 ALA 181 309 309 ALA ALA A . n 
A 1 182 LEU 182 310 310 LEU LEU A . n 
A 1 183 PRO 183 311 311 PRO PRO A . n 
A 1 184 GLY 184 312 312 GLY GLY A . n 
A 1 185 ALA 185 313 313 ALA ALA A . n 
A 1 186 THR 186 314 314 THR THR A . n 
A 1 187 VAL 187 315 315 VAL VAL A . n 
A 1 188 THR 188 316 316 THR THR A . n 
A 1 189 LEU 189 317 317 LEU LEU A . n 
A 1 190 THR 190 318 318 THR THR A . n 
A 1 191 GLY 191 319 319 GLY GLY A . n 
A 1 192 GLY 192 320 320 GLY GLY A . n 
A 1 193 PHE 193 321 321 PHE PHE A . n 
A 1 194 ARG 194 322 322 ARG ARG A . n 
A 1 195 ARG 195 323 323 ARG ARG A . n 
A 1 196 GLY 196 324 324 GLY GLY A . n 
A 1 197 LYS 197 325 325 LYS LYS A . n 
A 1 198 LEU 198 326 326 LEU LEU A . n 
A 1 199 GLN 199 327 327 GLN GLN A . n 
A 1 200 GLY 200 328 328 GLY GLY A . n 
A 1 201 HIS 201 329 329 HIS HIS A . n 
A 1 202 ASP 202 330 330 ASP ASP A . n 
A 1 203 VAL 203 331 331 VAL VAL A . n 
A 1 204 ASP 204 332 332 ASP ASP A . n 
A 1 205 PHE 205 333 333 PHE PHE A . n 
A 1 206 LEU 206 334 334 LEU LEU A . n 
A 1 207 ILE 207 335 335 ILE ILE A . n 
A 1 208 THR 208 336 336 THR THR A . n 
A 1 209 HIS 209 337 337 HIS HIS A . n 
A 1 210 PRO 210 338 338 PRO PRO A . n 
A 1 211 LYS 211 339 339 LYS LYS A . n 
A 1 212 GLU 212 340 340 GLU GLU A . n 
A 1 213 GLY 213 341 341 GLY GLY A . n 
A 1 214 GLN 214 342 342 GLN GLN A . n 
A 1 215 GLU 215 343 343 GLU GLU A . n 
A 1 216 ALA 216 344 344 ALA ALA A . n 
A 1 217 GLY 217 345 345 GLY GLY A . n 
A 1 218 LEU 218 346 346 LEU LEU A . n 
A 1 219 LEU 219 347 347 LEU LEU A . n 
A 1 220 PRO 220 348 348 PRO PRO A . n 
A 1 221 ARG 221 349 349 ARG ARG A . n 
A 1 222 VAL 222 350 350 VAL VAL A . n 
A 1 223 MET 223 351 351 MET MET A . n 
A 1 224 CYS 224 352 352 CYS CYS A . n 
A 1 225 ARG 225 353 353 ARG ARG A . n 
A 1 226 LEU 226 354 354 LEU LEU A . n 
A 1 227 GLN 227 355 355 GLN GLN A . n 
A 1 228 ASP 228 356 356 ASP ASP A . n 
A 1 229 GLN 229 357 357 GLN GLN A . n 
A 1 230 GLY 230 358 358 GLY GLY A . n 
A 1 231 LEU 231 359 359 LEU LEU A . n 
A 1 232 ILE 232 360 360 ILE ILE A . n 
A 1 233 LEU 233 361 361 LEU LEU A . n 
A 1 234 TYR 234 362 362 TYR TYR A . n 
A 1 235 HIS 235 363 363 HIS HIS A . n 
A 1 236 GLN 236 364 364 GLN GLN A . n 
A 1 237 HIS 237 365 ?   ?   ?   A . n 
A 1 238 GLN 238 366 ?   ?   ?   A . n 
A 1 239 HIS 239 367 ?   ?   ?   A . n 
A 1 240 SER 240 368 ?   ?   ?   A . n 
A 1 241 CYS 241 369 ?   ?   ?   A . n 
A 1 242 CYS 242 370 ?   ?   ?   A . n 
A 1 243 GLU 243 371 ?   ?   ?   A . n 
A 1 244 SER 244 372 ?   ?   ?   A . n 
A 1 245 PRO 245 373 ?   ?   ?   A . n 
A 1 246 THR 246 374 ?   ?   ?   A . n 
A 1 247 ARG 247 375 ?   ?   ?   A . n 
A 1 248 LEU 248 376 ?   ?   ?   A . n 
A 1 249 ALA 249 377 ?   ?   ?   A . n 
A 1 250 GLN 250 378 ?   ?   ?   A . n 
A 1 251 GLN 251 379 ?   ?   ?   A . n 
A 1 252 SER 252 380 ?   ?   ?   A . n 
A 1 253 HIS 253 381 ?   ?   ?   A . n 
A 1 254 MET 254 382 ?   ?   ?   A . n 
A 1 255 ASP 255 383 ?   ?   ?   A . n 
A 1 256 ALA 256 384 384 ALA ALA A . n 
A 1 257 PHE 257 385 385 PHE PHE A . n 
A 1 258 GLU 258 386 386 GLU GLU A . n 
A 1 259 ARG 259 387 387 ARG ARG A . n 
A 1 260 SER 260 388 388 SER SER A . n 
A 1 261 PHE 261 389 389 PHE PHE A . n 
A 1 262 CYS 262 390 390 CYS CYS A . n 
A 1 263 ILE 263 391 391 ILE ILE A . n 
A 1 264 PHE 264 392 392 PHE PHE A . n 
A 1 265 ARG 265 393 393 ARG ARG A . n 
A 1 266 LEU 266 394 394 LEU LEU A . n 
A 1 267 PRO 267 395 395 PRO PRO A . n 
A 1 268 GLN 268 396 396 GLN GLN A . n 
A 1 269 PRO 269 397 397 PRO PRO A . n 
A 1 270 GLY 270 410 410 GLY GLY A . n 
A 1 271 SER 271 411 411 SER SER A . n 
A 1 272 TRP 272 412 412 TRP TRP A . n 
A 1 273 LYS 273 413 413 LYS LYS A . n 
A 1 274 ALA 274 414 414 ALA ALA A . n 
A 1 275 VAL 275 415 415 VAL VAL A . n 
A 1 276 ARG 276 416 416 ARG ARG A . n 
A 1 277 VAL 277 417 417 VAL VAL A . n 
A 1 278 ASP 278 418 418 ASP ASP A . n 
A 1 279 LEU 279 419 419 LEU LEU A . n 
A 1 280 VAL 280 420 420 VAL VAL A . n 
A 1 281 VAL 281 421 421 VAL VAL A . n 
A 1 282 ALA 282 422 422 ALA ALA A . n 
A 1 283 PRO 283 423 423 PRO PRO A . n 
A 1 284 VAL 284 424 424 VAL VAL A . n 
A 1 285 SER 285 425 425 SER SER A . n 
A 1 286 GLN 286 426 426 GLN GLN A . n 
A 1 287 PHE 287 427 427 PHE PHE A . n 
A 1 288 PRO 288 428 428 PRO PRO A . n 
A 1 289 PHE 289 429 429 PHE PHE A . n 
A 1 290 ALA 290 430 430 ALA ALA A . n 
A 1 291 LEU 291 431 431 LEU LEU A . n 
A 1 292 LEU 292 432 432 LEU LEU A . n 
A 1 293 GLY 293 433 433 GLY GLY A . n 
A 1 294 HIS 294 434 434 HIS HIS A . n 
A 1 295 THR 295 435 435 THR THR A . n 
A 1 296 GLY 296 436 436 GLY GLY A . n 
A 1 297 SER 297 437 437 SER SER A . n 
A 1 298 LYS 298 438 438 LYS LYS A . n 
A 1 299 LEU 299 439 439 LEU LEU A . n 
A 1 300 PHE 300 440 440 PHE PHE A . n 
A 1 301 GLN 301 441 441 GLN GLN A . n 
A 1 302 ARG 302 442 442 ARG ARG A . n 
A 1 303 GLU 303 443 443 GLU GLU A . n 
A 1 304 LEU 304 444 444 LEU LEU A . n 
A 1 305 ARG 305 445 445 ARG ARG A . n 
A 1 306 ARG 306 446 446 ARG ARG A . n 
A 1 307 PHE 307 447 447 PHE PHE A . n 
A 1 308 SER 308 448 448 SER SER A . n 
A 1 309 ARG 309 449 449 ARG ARG A . n 
A 1 310 LYS 310 450 450 LYS LYS A . n 
A 1 311 GLU 311 451 451 GLU GLU A . n 
A 1 312 LYS 312 452 452 LYS LYS A . n 
A 1 313 GLY 313 453 453 GLY GLY A . n 
A 1 314 LEU 314 454 454 LEU LEU A . n 
A 1 315 TRP 315 455 455 TRP TRP A . n 
A 1 316 LEU 316 456 456 LEU LEU A . n 
A 1 317 ASN 317 457 457 ASN ASN A . n 
A 1 318 SER 318 458 458 SER SER A . n 
A 1 319 HIS 319 459 459 HIS HIS A . n 
A 1 320 GLY 320 460 460 GLY GLY A . n 
A 1 321 LEU 321 461 461 LEU LEU A . n 
A 1 322 PHE 322 462 462 PHE PHE A . n 
A 1 323 ASP 323 463 463 ASP ASP A . n 
A 1 324 PRO 324 464 464 PRO PRO A . n 
A 1 325 GLU 325 465 465 GLU GLU A . n 
A 1 326 GLN 326 466 466 GLN GLN A . n 
A 1 327 LYS 327 467 467 LYS LYS A . n 
A 1 328 THR 328 468 468 THR THR A . n 
A 1 329 PHE 329 469 469 PHE PHE A . n 
A 1 330 PHE 330 470 470 PHE PHE A . n 
A 1 331 GLN 331 471 471 GLN GLN A . n 
A 1 332 ALA 332 472 472 ALA ALA A . n 
A 1 333 ALA 333 473 473 ALA ALA A . n 
A 1 334 SER 334 474 474 SER SER A . n 
A 1 335 GLU 335 475 475 GLU GLU A . n 
A 1 336 GLU 336 476 476 GLU GLU A . n 
A 1 337 ASP 337 477 477 ASP ASP A . n 
A 1 338 ILE 338 478 478 ILE ILE A . n 
A 1 339 PHE 339 479 479 PHE PHE A . n 
A 1 340 ARG 340 480 480 ARG ARG A . n 
A 1 341 HIS 341 481 481 HIS HIS A . n 
A 1 342 LEU 342 482 482 LEU LEU A . n 
A 1 343 GLY 343 483 483 GLY GLY A . n 
A 1 344 LEU 344 484 484 LEU LEU A . n 
A 1 345 GLU 345 485 485 GLU GLU A . n 
A 1 346 TYR 346 486 486 TYR TYR A . n 
A 1 347 LEU 347 487 487 LEU LEU A . n 
A 1 348 PRO 348 488 488 PRO PRO A . n 
A 1 349 PRO 349 489 489 PRO PRO A . n 
A 1 350 GLU 350 490 490 GLU GLU A . n 
A 1 351 GLN 351 491 491 GLN GLN A . n 
A 1 352 ARG 352 492 492 ARG ARG A . n 
A 1 353 ASN 353 493 493 ASN ASN A . n 
A 1 354 ALA 354 494 494 ALA ALA A . n 
B 2 1   DC  1   1   1   DC  DC  T . n 
B 2 2   DG  2   2   2   DG  DG  T . n 
B 2 3   DG  3   3   3   DG  DG  T . n 
B 2 4   DC  4   4   4   DC  DC  T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DA  7   7   7   DA  DA  T . n 
B 2 8   DC  8   8   8   DC  DC  T . n 
B 2 9   DG  9   9   9   DG  DG  T . n 
C 3 1   DC  1   1   1   DC  DC  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DT  3   3   3   DT  DT  P . n 
C 3 4   DA  4   4   4   DA  DA  P . n 
C 3 5   U   5   5   5   U   U   P . n 
D 4 1   DG  1   1   1   DG  DG  D . n 
D 4 2   DC  2   2   2   DC  DC  D . n 
D 4 3   DC  3   3   3   DC  DC  D . n 
D 4 4   DG  4   4   4   DG  DG  D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5  MG  1   501 1   MG  MG  A . 
F 5  MG  1   502 2   MG  MG  A . 
G 6  NA  1   503 5   NA  NA  A . 
H 7  CL  1   504 6   CL  CL  A . 
I 7  CL  1   505 7   CL  CL  A . 
J 8  UTP 1   506 701 UTP UTP A . 
K 9  GOA 1   507 1   GOA GOA A . 
L 10 EDO 1   508 3   EDO EDO A . 
M 11 HOH 1   601 172 HOH HOH A . 
M 11 HOH 2   602 261 HOH HOH A . 
M 11 HOH 3   603 155 HOH HOH A . 
M 11 HOH 4   604 33  HOH HOH A . 
M 11 HOH 5   605 85  HOH HOH A . 
M 11 HOH 6   606 83  HOH HOH A . 
M 11 HOH 7   607 182 HOH HOH A . 
M 11 HOH 8   608 65  HOH HOH A . 
M 11 HOH 9   609 35  HOH HOH A . 
M 11 HOH 10  610 128 HOH HOH A . 
M 11 HOH 11  611 46  HOH HOH A . 
M 11 HOH 12  612 61  HOH HOH A . 
M 11 HOH 13  613 50  HOH HOH A . 
M 11 HOH 14  614 87  HOH HOH A . 
M 11 HOH 15  615 22  HOH HOH A . 
M 11 HOH 16  616 51  HOH HOH A . 
M 11 HOH 17  617 232 HOH HOH A . 
M 11 HOH 18  618 229 HOH HOH A . 
M 11 HOH 19  619 132 HOH HOH A . 
M 11 HOH 20  620 17  HOH HOH A . 
M 11 HOH 21  621 338 HOH HOH A . 
M 11 HOH 22  622 111 HOH HOH A . 
M 11 HOH 23  623 10  HOH HOH A . 
M 11 HOH 24  624 19  HOH HOH A . 
M 11 HOH 25  625 93  HOH HOH A . 
M 11 HOH 26  626 193 HOH HOH A . 
M 11 HOH 27  627 250 HOH HOH A . 
M 11 HOH 28  628 165 HOH HOH A . 
M 11 HOH 29  629 6   HOH HOH A . 
M 11 HOH 30  630 126 HOH HOH A . 
M 11 HOH 31  631 59  HOH HOH A . 
M 11 HOH 32  632 43  HOH HOH A . 
M 11 HOH 33  633 8   HOH HOH A . 
M 11 HOH 34  634 67  HOH HOH A . 
M 11 HOH 35  635 280 HOH HOH A . 
M 11 HOH 36  636 45  HOH HOH A . 
M 11 HOH 37  637 196 HOH HOH A . 
M 11 HOH 38  638 131 HOH HOH A . 
M 11 HOH 39  639 104 HOH HOH A . 
M 11 HOH 40  640 12  HOH HOH A . 
M 11 HOH 41  641 23  HOH HOH A . 
M 11 HOH 42  642 13  HOH HOH A . 
M 11 HOH 43  643 32  HOH HOH A . 
M 11 HOH 44  644 247 HOH HOH A . 
M 11 HOH 45  645 179 HOH HOH A . 
M 11 HOH 46  646 78  HOH HOH A . 
M 11 HOH 47  647 163 HOH HOH A . 
M 11 HOH 48  648 4   HOH HOH A . 
M 11 HOH 49  649 312 HOH HOH A . 
M 11 HOH 50  650 102 HOH HOH A . 
M 11 HOH 51  651 157 HOH HOH A . 
M 11 HOH 52  652 314 HOH HOH A . 
M 11 HOH 53  653 77  HOH HOH A . 
M 11 HOH 54  654 75  HOH HOH A . 
M 11 HOH 55  655 91  HOH HOH A . 
M 11 HOH 56  656 16  HOH HOH A . 
M 11 HOH 57  657 134 HOH HOH A . 
M 11 HOH 58  658 293 HOH HOH A . 
M 11 HOH 59  659 58  HOH HOH A . 
M 11 HOH 60  660 49  HOH HOH A . 
M 11 HOH 61  661 44  HOH HOH A . 
M 11 HOH 62  662 56  HOH HOH A . 
M 11 HOH 63  663 79  HOH HOH A . 
M 11 HOH 64  664 29  HOH HOH A . 
M 11 HOH 65  665 30  HOH HOH A . 
M 11 HOH 66  666 95  HOH HOH A . 
M 11 HOH 67  667 5   HOH HOH A . 
M 11 HOH 68  668 330 HOH HOH A . 
M 11 HOH 69  669 253 HOH HOH A . 
M 11 HOH 70  670 73  HOH HOH A . 
M 11 HOH 71  671 203 HOH HOH A . 
M 11 HOH 72  672 212 HOH HOH A . 
M 11 HOH 73  673 26  HOH HOH A . 
M 11 HOH 74  674 218 HOH HOH A . 
M 11 HOH 75  675 14  HOH HOH A . 
M 11 HOH 76  676 142 HOH HOH A . 
M 11 HOH 77  677 164 HOH HOH A . 
M 11 HOH 78  678 71  HOH HOH A . 
M 11 HOH 79  679 31  HOH HOH A . 
M 11 HOH 80  680 122 HOH HOH A . 
M 11 HOH 81  681 63  HOH HOH A . 
M 11 HOH 82  682 289 HOH HOH A . 
M 11 HOH 83  683 215 HOH HOH A . 
M 11 HOH 84  684 150 HOH HOH A . 
M 11 HOH 85  685 313 HOH HOH A . 
M 11 HOH 86  686 80  HOH HOH A . 
M 11 HOH 87  687 2   HOH HOH A . 
M 11 HOH 88  688 60  HOH HOH A . 
M 11 HOH 89  689 233 HOH HOH A . 
M 11 HOH 90  690 189 HOH HOH A . 
M 11 HOH 91  691 158 HOH HOH A . 
M 11 HOH 92  692 82  HOH HOH A . 
M 11 HOH 93  693 277 HOH HOH A . 
M 11 HOH 94  694 211 HOH HOH A . 
M 11 HOH 95  695 175 HOH HOH A . 
M 11 HOH 96  696 25  HOH HOH A . 
M 11 HOH 97  697 39  HOH HOH A . 
M 11 HOH 98  698 178 HOH HOH A . 
M 11 HOH 99  699 224 HOH HOH A . 
M 11 HOH 100 700 156 HOH HOH A . 
M 11 HOH 101 701 120 HOH HOH A . 
M 11 HOH 102 702 97  HOH HOH A . 
M 11 HOH 103 703 343 HOH HOH A . 
M 11 HOH 104 704 36  HOH HOH A . 
M 11 HOH 105 705 339 HOH HOH A . 
M 11 HOH 106 706 99  HOH HOH A . 
M 11 HOH 107 707 84  HOH HOH A . 
M 11 HOH 108 708 151 HOH HOH A . 
M 11 HOH 109 709 115 HOH HOH A . 
M 11 HOH 110 710 18  HOH HOH A . 
M 11 HOH 111 711 353 HOH HOH A . 
M 11 HOH 112 712 52  HOH HOH A . 
M 11 HOH 113 713 15  HOH HOH A . 
M 11 HOH 114 714 238 HOH HOH A . 
M 11 HOH 115 715 21  HOH HOH A . 
M 11 HOH 116 716 94  HOH HOH A . 
M 11 HOH 117 717 334 HOH HOH A . 
M 11 HOH 118 718 28  HOH HOH A . 
M 11 HOH 119 719 37  HOH HOH A . 
M 11 HOH 120 720 54  HOH HOH A . 
M 11 HOH 121 721 341 HOH HOH A . 
M 11 HOH 122 722 48  HOH HOH A . 
M 11 HOH 123 723 11  HOH HOH A . 
M 11 HOH 124 724 136 HOH HOH A . 
M 11 HOH 125 725 348 HOH HOH A . 
M 11 HOH 126 726 105 HOH HOH A . 
M 11 HOH 127 727 148 HOH HOH A . 
M 11 HOH 128 728 221 HOH HOH A . 
M 11 HOH 129 729 282 HOH HOH A . 
M 11 HOH 130 730 270 HOH HOH A . 
M 11 HOH 131 731 244 HOH HOH A . 
M 11 HOH 132 732 146 HOH HOH A . 
M 11 HOH 133 733 220 HOH HOH A . 
M 11 HOH 134 734 109 HOH HOH A . 
M 11 HOH 135 735 124 HOH HOH A . 
M 11 HOH 136 736 349 HOH HOH A . 
M 11 HOH 137 737 55  HOH HOH A . 
M 11 HOH 138 738 38  HOH HOH A . 
M 11 HOH 139 739 315 HOH HOH A . 
M 11 HOH 140 740 127 HOH HOH A . 
M 11 HOH 141 741 138 HOH HOH A . 
M 11 HOH 142 742 190 HOH HOH A . 
M 11 HOH 143 743 342 HOH HOH A . 
M 11 HOH 144 744 345 HOH HOH A . 
M 11 HOH 145 745 195 HOH HOH A . 
M 11 HOH 146 746 214 HOH HOH A . 
M 11 HOH 147 747 57  HOH HOH A . 
M 11 HOH 148 748 123 HOH HOH A . 
M 11 HOH 149 749 41  HOH HOH A . 
M 11 HOH 150 750 76  HOH HOH A . 
M 11 HOH 151 751 24  HOH HOH A . 
M 11 HOH 152 752 140 HOH HOH A . 
M 11 HOH 153 753 92  HOH HOH A . 
M 11 HOH 154 754 227 HOH HOH A . 
M 11 HOH 155 755 103 HOH HOH A . 
M 11 HOH 156 756 237 HOH HOH A . 
M 11 HOH 157 757 181 HOH HOH A . 
M 11 HOH 158 758 281 HOH HOH A . 
M 11 HOH 159 759 319 HOH HOH A . 
M 11 HOH 160 760 129 HOH HOH A . 
M 11 HOH 161 761 9   HOH HOH A . 
M 11 HOH 162 762 40  HOH HOH A . 
M 11 HOH 163 763 335 HOH HOH A . 
M 11 HOH 164 764 347 HOH HOH A . 
M 11 HOH 165 765 177 HOH HOH A . 
M 11 HOH 166 766 173 HOH HOH A . 
M 11 HOH 167 767 333 HOH HOH A . 
M 11 HOH 168 768 346 HOH HOH A . 
M 11 HOH 169 769 223 HOH HOH A . 
M 11 HOH 170 770 202 HOH HOH A . 
M 11 HOH 171 771 86  HOH HOH A . 
M 11 HOH 172 772 186 HOH HOH A . 
M 11 HOH 173 773 119 HOH HOH A . 
M 11 HOH 174 774 192 HOH HOH A . 
M 11 HOH 175 775 141 HOH HOH A . 
M 11 HOH 176 776 114 HOH HOH A . 
M 11 HOH 177 777 226 HOH HOH A . 
M 11 HOH 178 778 298 HOH HOH A . 
M 11 HOH 179 779 258 HOH HOH A . 
M 11 HOH 180 780 240 HOH HOH A . 
M 11 HOH 181 781 197 HOH HOH A . 
M 11 HOH 182 782 236 HOH HOH A . 
M 11 HOH 183 783 88  HOH HOH A . 
M 11 HOH 184 784 191 HOH HOH A . 
M 11 HOH 185 785 64  HOH HOH A . 
M 11 HOH 186 786 340 HOH HOH A . 
M 11 HOH 187 787 327 HOH HOH A . 
M 11 HOH 188 788 252 HOH HOH A . 
M 11 HOH 189 789 147 HOH HOH A . 
M 11 HOH 190 790 209 HOH HOH A . 
M 11 HOH 191 791 286 HOH HOH A . 
M 11 HOH 192 792 118 HOH HOH A . 
M 11 HOH 193 793 228 HOH HOH A . 
M 11 HOH 194 794 194 HOH HOH A . 
M 11 HOH 195 795 307 HOH HOH A . 
M 11 HOH 196 796 125 HOH HOH A . 
M 11 HOH 197 797 336 HOH HOH A . 
M 11 HOH 198 798 248 HOH HOH A . 
M 11 HOH 199 799 278 HOH HOH A . 
M 11 HOH 200 800 169 HOH HOH A . 
M 11 HOH 201 801 285 HOH HOH A . 
M 11 HOH 202 802 300 HOH HOH A . 
M 11 HOH 203 803 291 HOH HOH A . 
M 11 HOH 204 804 308 HOH HOH A . 
M 11 HOH 205 805 187 HOH HOH A . 
M 11 HOH 206 806 143 HOH HOH A . 
M 11 HOH 207 807 98  HOH HOH A . 
M 11 HOH 208 808 137 HOH HOH A . 
M 11 HOH 209 809 106 HOH HOH A . 
M 11 HOH 210 810 100 HOH HOH A . 
M 11 HOH 211 811 107 HOH HOH A . 
M 11 HOH 212 812 174 HOH HOH A . 
M 11 HOH 213 813 283 HOH HOH A . 
M 11 HOH 214 814 225 HOH HOH A . 
N 11 HOH 1   101 274 HOH HOH T . 
N 11 HOH 2   102 249 HOH HOH T . 
N 11 HOH 3   103 81  HOH HOH T . 
N 11 HOH 4   104 306 HOH HOH T . 
N 11 HOH 5   105 259 HOH HOH T . 
N 11 HOH 6   106 110 HOH HOH T . 
N 11 HOH 7   107 117 HOH HOH T . 
N 11 HOH 8   108 210 HOH HOH T . 
N 11 HOH 9   109 53  HOH HOH T . 
N 11 HOH 10  110 34  HOH HOH T . 
N 11 HOH 11  111 154 HOH HOH T . 
N 11 HOH 12  112 101 HOH HOH T . 
N 11 HOH 13  113 108 HOH HOH T . 
N 11 HOH 14  114 72  HOH HOH T . 
N 11 HOH 15  115 217 HOH HOH T . 
N 11 HOH 16  116 185 HOH HOH T . 
N 11 HOH 17  117 205 HOH HOH T . 
N 11 HOH 18  118 199 HOH HOH T . 
N 11 HOH 19  119 256 HOH HOH T . 
N 11 HOH 20  120 149 HOH HOH T . 
O 11 HOH 1   101 70  HOH HOH P . 
O 11 HOH 2   102 47  HOH HOH P . 
O 11 HOH 3   103 184 HOH HOH P . 
O 11 HOH 4   104 96  HOH HOH P . 
O 11 HOH 5   105 42  HOH HOH P . 
O 11 HOH 6   106 139 HOH HOH P . 
O 11 HOH 7   107 162 HOH HOH P . 
O 11 HOH 8   108 27  HOH HOH P . 
O 11 HOH 9   109 130 HOH HOH P . 
O 11 HOH 10  110 144 HOH HOH P . 
O 11 HOH 11  111 69  HOH HOH P . 
P 11 HOH 1   101 241 HOH HOH D . 
P 11 HOH 2   102 245 HOH HOH D . 
P 11 HOH 3   103 116 HOH HOH D . 
P 11 HOH 4   104 325 HOH HOH D . 
P 11 HOH 5   105 200 HOH HOH D . 
P 11 HOH 6   106 153 HOH HOH D . 
P 11 HOH 7   107 145 HOH HOH D . 
P 11 HOH 8   108 62  HOH HOH D . 
P 11 HOH 9   109 66  HOH HOH D . 
P 11 HOH 10  110 168 HOH HOH D . 
P 11 HOH 11  111 263 HOH HOH D . 
P 11 HOH 12  112 180 HOH HOH D . 
P 11 HOH 13  113 272 HOH HOH D . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5850  ? 
1 MORE         -66   ? 
1 'SSA (A^2)'  15480 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A THR 113 ? A THR 241 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 O   ? A ILE 115 ? A ILE 243 ? 1_555 85.9  ? 
2  O   ? A THR 113 ? A THR 241 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 O   ? A VAL 118 ? A VAL 246 ? 1_555 84.1  ? 
3  O   ? A ILE 115 ? A ILE 243 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 O   ? A VAL 118 ? A VAL 246 ? 1_555 88.9  ? 
4  O   ? A THR 113 ? A THR 241 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 OP1 ? C DT  3   ? P DT  3   ? 1_555 175.5 ? 
5  O   ? A ILE 115 ? A ILE 243 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 OP1 ? C DT  3   ? P DT  3   ? 1_555 91.0  ? 
6  O   ? A VAL 118 ? A VAL 246 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 OP1 ? C DT  3   ? P DT  3   ? 1_555 92.5  ? 
7  O   ? A THR 113 ? A THR 241 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 OP1 ? C U   5   ? P U   5   ? 1_555 83.9  ? 
8  O   ? A ILE 115 ? A ILE 243 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 OP1 ? C U   5   ? P U   5   ? 1_555 168.7 ? 
9  O   ? A VAL 118 ? A VAL 246 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 OP1 ? C U   5   ? P U   5   ? 1_555 95.0  ? 
10 OP1 ? C DT  3   ? P DT  3   ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 OP1 ? C U   5   ? P U   5   ? 1_555 99.4  ? 
11 O   ? A THR 113 ? A THR 241 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 O   ? O HOH .   ? P HOH 105 ? 1_555 102.7 ? 
12 O   ? A ILE 115 ? A ILE 243 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 O   ? O HOH .   ? P HOH 105 ? 1_555 89.1  ? 
13 O   ? A VAL 118 ? A VAL 246 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 O   ? O HOH .   ? P HOH 105 ? 1_555 172.7 ? 
14 OP1 ? C DT  3   ? P DT  3   ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 O   ? O HOH .   ? P HOH 105 ? 1_555 80.5  ? 
15 OP1 ? C U   5   ? P U   5   ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 O   ? O HOH .   ? P HOH 105 ? 1_555 88.3  ? 
16 OD1 ? A ASP 202 ? A ASP 330 ? 1_555 MG ? F MG . ? A MG 502 ? 1_555 OD2 ? A ASP 204 ? A ASP 332 ? 1_555 93.1  ? 
17 OD1 ? A ASP 202 ? A ASP 330 ? 1_555 MG ? F MG . ? A MG 502 ? 1_555 O2A ? J UTP .   ? A UTP 506 ? 1_555 93.5  ? 
18 OD2 ? A ASP 204 ? A ASP 332 ? 1_555 MG ? F MG . ? A MG 502 ? 1_555 O2A ? J UTP .   ? A UTP 506 ? 1_555 92.2  ? 
19 OD1 ? A ASP 202 ? A ASP 330 ? 1_555 MG ? F MG . ? A MG 502 ? 1_555 O1B ? J UTP .   ? A UTP 506 ? 1_555 173.3 ? 
20 OD2 ? A ASP 204 ? A ASP 332 ? 1_555 MG ? F MG . ? A MG 502 ? 1_555 O1B ? J UTP .   ? A UTP 506 ? 1_555 91.1  ? 
21 O2A ? J UTP .   ? A UTP 506 ? 1_555 MG ? F MG . ? A MG 502 ? 1_555 O1B ? J UTP .   ? A UTP 506 ? 1_555 91.6  ? 
22 OD1 ? A ASP 202 ? A ASP 330 ? 1_555 MG ? F MG . ? A MG 502 ? 1_555 O1G ? J UTP .   ? A UTP 506 ? 1_555 88.8  ? 
23 OD2 ? A ASP 204 ? A ASP 332 ? 1_555 MG ? F MG . ? A MG 502 ? 1_555 O1G ? J UTP .   ? A UTP 506 ? 1_555 176.4 ? 
24 O2A ? J UTP .   ? A UTP 506 ? 1_555 MG ? F MG . ? A MG 502 ? 1_555 O1G ? J UTP .   ? A UTP 506 ? 1_555 90.7  ? 
25 O1B ? J UTP .   ? A UTP 506 ? 1_555 MG ? F MG . ? A MG 502 ? 1_555 O1G ? J UTP .   ? A UTP 506 ? 1_555 86.7  ? 
26 OD1 ? A ASP 202 ? A ASP 330 ? 1_555 MG ? F MG . ? A MG 502 ? 1_555 O   ? M HOH .   ? A HOH 656 ? 1_555 81.8  ? 
27 OD2 ? A ASP 204 ? A ASP 332 ? 1_555 MG ? F MG . ? A MG 502 ? 1_555 O   ? M HOH .   ? A HOH 656 ? 1_555 87.1  ? 
28 O2A ? J UTP .   ? A UTP 506 ? 1_555 MG ? F MG . ? A MG 502 ? 1_555 O   ? M HOH .   ? A HOH 656 ? 1_555 175.2 ? 
29 O1B ? J UTP .   ? A UTP 506 ? 1_555 MG ? F MG . ? A MG 502 ? 1_555 O   ? M HOH .   ? A HOH 656 ? 1_555 93.2  ? 
30 O1G ? J UTP .   ? A UTP 506 ? 1_555 MG ? F MG . ? A MG 502 ? 1_555 O   ? M HOH .   ? A HOH 656 ? 1_555 90.2  ? 
31 OD2 ? A ASP 202 ? A ASP 330 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 OD1 ? A ASP 204 ? A ASP 332 ? 1_555 95.8  ? 
32 OD2 ? A ASP 202 ? A ASP 330 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 OD2 ? A ASP 278 ? A ASP 418 ? 1_555 92.5  ? 
33 OD1 ? A ASP 204 ? A ASP 332 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 OD2 ? A ASP 278 ? A ASP 418 ? 1_555 100.7 ? 
34 OD2 ? A ASP 202 ? A ASP 330 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 O2A ? J UTP .   ? A UTP 506 ? 1_555 84.1  ? 
35 OD1 ? A ASP 204 ? A ASP 332 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 O2A ? J UTP .   ? A UTP 506 ? 1_555 89.9  ? 
36 OD2 ? A ASP 278 ? A ASP 418 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 O2A ? J UTP .   ? A UTP 506 ? 1_555 169.2 ? 
37 OD2 ? A ASP 202 ? A ASP 330 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 O12 ? K GOA .   ? A GOA 507 ? 1_555 175.0 ? 
38 OD1 ? A ASP 204 ? A ASP 332 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 O12 ? K GOA .   ? A GOA 507 ? 1_555 89.2  ? 
39 OD2 ? A ASP 278 ? A ASP 418 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 O12 ? K GOA .   ? A GOA 507 ? 1_555 87.3  ? 
40 O2A ? J UTP .   ? A UTP 506 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 O12 ? K GOA .   ? A GOA 507 ? 1_555 95.2  ? 
41 OD2 ? A ASP 202 ? A ASP 330 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 O2  ? K GOA .   ? A GOA 507 ? 1_555 92.2  ? 
42 OD1 ? A ASP 204 ? A ASP 332 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 O2  ? K GOA .   ? A GOA 507 ? 1_555 168.5 ? 
43 OD2 ? A ASP 278 ? A ASP 418 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 O2  ? K GOA .   ? A GOA 507 ? 1_555 87.2  ? 
44 O2A ? J UTP .   ? A UTP 506 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 O2  ? K GOA .   ? A GOA 507 ? 1_555 82.7  ? 
45 O12 ? K GOA .   ? A GOA 507 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 O2  ? K GOA .   ? A GOA 507 ? 1_555 82.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-07-05 
2 'Structure model' 1 1 2017-09-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Author supporting evidence' 
2 2 'Structure model' 'Database references'        
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation           
2 2 'Structure model' pdbx_audit_support 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_volume'                 
2 2 'Structure model' '_citation.page_first'                     
3 2 'Structure model' '_citation.page_last'                      
4 2 'Structure model' '_citation.pdbx_database_id_PubMed'        
5 2 'Structure model' '_citation.title'                          
6 2 'Structure model' '_pdbx_audit_support.funding_organization' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 12.9077  -18.7988 -14.5260 0.1538 0.1456 0.1213 0.0505  -0.0033 -0.0422 1.3652 1.3780 1.7738 
-0.4353 0.2495  -0.1294 0.0822 0.2364  -0.1757 -0.1148 -0.1229 -0.1228 0.1905  0.3077  0.0035  
'X-RAY DIFFRACTION' 2 ? refined 17.0659  7.9652   -17.1260 0.2319 0.2479 0.3429 0.0013  0.1276  0.1073  0.3683 0.7904 0.7065 
-0.1555 -0.2519 0.5569  0.2401 0.2905  0.4500  -0.3670 -0.0146 -0.4848 -0.3899 0.1315  0.0811  
'X-RAY DIFFRACTION' 3 ? refined -2.1805  8.7186   -0.5538  0.1393 0.1048 0.1755 -0.0138 0.0340  -0.0419 1.8307 1.7290 0.4969 
-0.1001 -0.3990 0.3458  0.1437 -0.1752 0.5447  0.1271  -0.0937 -0.1990 -0.1340 -0.0518 -0.0242 
'X-RAY DIFFRACTION' 4 ? refined -11.0254 -10.3923 -11.1875 0.0955 0.1280 0.0853 0.0077  -0.0135 -0.0233 0.9393 1.4023 1.0759 
0.0709  -0.6687 0.3412  0.0685 0.3498  -0.1841 -0.1099 -0.0809 0.2168  -0.0046 -0.2369 -0.0207 
'X-RAY DIFFRACTION' 5 ? refined 0.6007   -8.8663  -23.2273 0.2186 0.2655 0.0948 0.0390  -0.0224 -0.0440 0.4854 0.4560 0.3962 
0.1568  -0.0970 0.1124  0.0358 0.3818  -0.0150 -0.3393 -0.0129 0.0702  -0.0410 -0.0316 0.0302  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? 'chain A and resid 138:231'     
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? 'chain A and resid 232:289'     
'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? 'chain A and resid 290:423'     
'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? 'chain A and resid 424:494'     
'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? 'chain T or chain P or chain D' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? '(1.10.1_2155: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? .                    2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? .                    3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .                    4 
# 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.entry_id             5VZH 
_pdbx_entry_details.nonpolymer_details   
;Anomalous signal is observed at one position in this structure--at the metal occupying the HhH2 site (peak greater than 6.5 sigma). No known anomalous scatterers were added, so this position has been putatively modeled as sodium (in the HhH2 site), which is consistent with its identity in other reported structures
;
_pdbx_entry_details.sequence_details     ? 
_pdbx_entry_details.source_details       ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OE1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   GLU 
_pdbx_validate_close_contact.auth_seq_id_1    161 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    601 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.19 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            P 
_pdbx_validate_rmsd_bond.auth_asym_id_1            D 
_pdbx_validate_rmsd_bond.auth_comp_id_1            DG 
_pdbx_validate_rmsd_bond.auth_seq_id_1             1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OP3 
_pdbx_validate_rmsd_bond.auth_asym_id_2            D 
_pdbx_validate_rmsd_bond.auth_comp_id_2            DG 
_pdbx_validate_rmsd_bond.auth_seq_id_2             1 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.481 
_pdbx_validate_rmsd_bond.bond_target_value         1.607 
_pdbx_validate_rmsd_bond.bond_deviation            -0.126 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.012 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 153 ? ? -144.41 41.23   
2 1 THR A 318 ? A -126.64 -151.37 
3 1 THR A 318 ? B -133.18 -158.67 
4 1 PRO A 397 ? ? -53.05  107.88  
5 1 SER A 411 ? ? -163.63 -142.69 
6 1 ASN A 493 ? ? -86.76  49.73   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A LEU 196 ? CD1   ? A LEU 68  CD1   
2   1 Y 1 A LEU 196 ? CD2   ? A LEU 68  CD2   
3   1 Y 1 A GLN 200 ? CG    ? A GLN 72  CG    
4   1 Y 1 A GLN 200 ? CD    ? A GLN 72  CD    
5   1 Y 1 A GLN 200 ? OE1   ? A GLN 72  OE1   
6   1 Y 1 A GLN 200 ? NE2   ? A GLN 72  NE2   
7   1 Y 1 A GLU 207 ? CD    ? A GLU 79  CD    
8   1 Y 1 A GLU 207 ? OE1   ? A GLU 79  OE1   
9   1 Y 1 A GLU 207 ? OE2   ? A GLU 79  OE2   
10  1 Y 1 A GLN 214 ? CD    ? A GLN 86  CD    
11  1 Y 1 A GLN 214 ? OE1   ? A GLN 86  OE1   
12  1 Y 1 A GLN 214 ? NE2   ? A GLN 86  NE2   
13  1 Y 1 A GLU 218 ? CG    ? A GLU 90  CG    
14  1 Y 1 A GLU 218 ? CD    ? A GLU 90  CD    
15  1 Y 1 A GLU 218 ? OE1   ? A GLU 90  OE1   
16  1 Y 1 A GLU 218 ? OE2   ? A GLU 90  OE2   
17  1 Y 1 A GLU 223 ? CD    ? A GLU 95  CD    
18  1 Y 1 A GLU 223 ? OE1   ? A GLU 95  OE1   
19  1 Y 1 A GLU 223 ? OE2   ? A GLU 95  OE2   
20  1 Y 1 A LYS 238 ? CD    ? A LYS 110 CD    
21  1 Y 1 A LYS 238 ? CE    ? A LYS 110 CE    
22  1 Y 1 A LYS 238 ? NZ    ? A LYS 110 NZ    
23  1 Y 1 A GLN 242 ? CG    ? A GLN 114 CG    
24  1 Y 1 A GLN 242 ? CD    ? A GLN 114 CD    
25  1 Y 1 A GLN 242 ? OE1   ? A GLN 114 OE1   
26  1 Y 1 A GLN 242 ? NE2   ? A GLN 114 NE2   
27  1 Y 1 A LYS 249 ? NZ    ? A LYS 121 NZ    
28  1 Y 1 A ARG 256 ? NH1   ? A ARG 128 NH1   
29  1 Y 1 A ARG 256 ? NH2   ? A ARG 128 NH2   
30  1 Y 1 A GLU 267 ? CG    ? A GLU 139 CG    
31  1 Y 1 A GLU 267 ? CD    ? A GLU 139 CD    
32  1 Y 1 A GLU 267 ? OE1   ? A GLU 139 OE1   
33  1 Y 1 A GLU 267 ? OE2   ? A GLU 139 OE2   
34  1 Y 1 A GLN 268 ? CG    ? A GLN 140 CG    
35  1 Y 1 A GLN 268 ? CD    ? A GLN 140 CD    
36  1 Y 1 A GLN 268 ? OE1   ? A GLN 140 OE1   
37  1 Y 1 A GLN 268 ? NE2   ? A GLN 140 NE2   
38  1 Y 1 A GLN 270 ? CG    ? A GLN 142 CG    
39  1 Y 1 A GLN 270 ? CD    ? A GLN 142 CD    
40  1 Y 1 A GLN 270 ? OE1   ? A GLN 142 OE1   
41  1 Y 1 A GLN 270 ? NE2   ? A GLN 142 NE2   
42  1 Y 1 A LYS 271 ? CG    ? A LYS 143 CG    
43  1 Y 1 A LYS 271 ? CD    ? A LYS 143 CD    
44  1 Y 1 A LYS 271 ? CE    ? A LYS 143 CE    
45  1 Y 1 A LYS 271 ? NZ    ? A LYS 143 NZ    
46  1 Y 1 A GLN 274 ? CG    ? A GLN 146 CG    
47  1 Y 1 A GLN 274 ? CD    ? A GLN 146 CD    
48  1 Y 1 A GLN 274 ? OE1   ? A GLN 146 OE1   
49  1 Y 1 A GLN 274 ? NE2   ? A GLN 146 NE2   
50  1 Y 1 A LYS 277 ? CD    ? A LYS 149 CD    
51  1 Y 1 A LYS 277 ? CE    ? A LYS 149 CE    
52  1 Y 1 A LYS 277 ? NZ    ? A LYS 149 NZ    
53  1 Y 1 A GLN 281 ? OE1   ? A GLN 153 OE1   
54  1 Y 1 A GLN 281 ? NE2   ? A GLN 153 NE2   
55  1 Y 1 A SER 293 ? OG    ? A SER 165 OG    
56  1 Y 1 A ASP 296 ? OD1   ? A ASP 168 OD1   
57  1 Y 1 A ASP 296 ? OD2   ? A ASP 168 OD2   
58  1 Y 1 A GLN 300 ? CD    ? A GLN 172 CD    
59  1 Y 1 A GLN 300 ? OE1   ? A GLN 172 OE1   
60  1 Y 1 A GLN 300 ? NE2   ? A GLN 172 NE2   
61  1 Y 1 A GLU 304 ? CD    ? A GLU 176 CD    
62  1 Y 1 A GLU 304 ? OE1   ? A GLU 176 OE1   
63  1 Y 1 A GLU 304 ? OE2   ? A GLU 176 OE2   
64  1 Y 1 A LYS 339 ? CD    ? A LYS 211 CD    
65  1 Y 1 A LYS 339 ? CE    ? A LYS 211 CE    
66  1 Y 1 A LYS 339 ? NZ    ? A LYS 211 NZ    
67  1 Y 1 A GLN 355 ? CG    ? A GLN 227 CG    
68  1 Y 1 A GLN 355 ? CD    ? A GLN 227 CD    
69  1 Y 1 A GLN 355 ? OE1   ? A GLN 227 OE1   
70  1 Y 1 A GLN 355 ? NE2   ? A GLN 227 NE2   
71  1 Y 1 A GLN 357 ? OE1   ? A GLN 229 OE1   
72  1 Y 1 A GLN 357 ? NE2   ? A GLN 229 NE2   
73  1 Y 1 A GLN 364 ? CG    ? A GLN 236 CG    
74  1 Y 1 A GLN 364 ? CD    ? A GLN 236 CD    
75  1 Y 1 A GLN 364 ? OE1   ? A GLN 236 OE1   
76  1 Y 1 A GLN 364 ? NE2   ? A GLN 236 NE2   
77  1 Y 1 A LYS 438 ? CD    ? A LYS 298 CD    
78  1 Y 1 A LYS 438 ? CE    ? A LYS 298 CE    
79  1 Y 1 A LYS 438 ? NZ    ? A LYS 298 NZ    
80  1 Y 1 A GLU 465 ? CG    ? A GLU 325 CG    
81  1 Y 1 A GLU 465 ? CD    ? A GLU 325 CD    
82  1 Y 1 A GLU 465 ? OE1   ? A GLU 325 OE1   
83  1 Y 1 A GLU 465 ? OE2   ? A GLU 325 OE2   
84  1 Y 1 A GLN 466 ? CG    ? A GLN 326 CG    
85  1 Y 1 A GLN 466 ? CD    ? A GLN 326 CD    
86  1 Y 1 A GLN 466 ? OE1   ? A GLN 326 OE1   
87  1 Y 1 A GLN 466 ? NE2   ? A GLN 326 NE2   
88  1 Y 1 A LYS 467 ? CD    ? A LYS 327 CD    
89  1 Y 1 A LYS 467 ? CE    ? A LYS 327 CE    
90  1 Y 1 A LYS 467 ? NZ    ? A LYS 327 NZ    
91  1 Y 1 A GLU 485 ? CD    ? A GLU 345 CD    
92  1 Y 1 A GLU 485 ? OE1   ? A GLU 345 OE1   
93  1 Y 1 A GLU 485 ? OE2   ? A GLU 345 OE2   
94  1 Y 1 P U   5   ? "O4'" ? C U   5   "O4'" 
95  1 Y 1 P U   5   ? "C3'" ? C U   5   "C3'" 
96  1 Y 1 P U   5   ? "O3'" ? C U   5   "O3'" 
97  1 Y 1 P U   5   ? "C2'" ? C U   5   "C2'" 
98  1 Y 1 P U   5   ? "O2'" ? C U   5   "O2'" 
99  1 Y 1 P U   5   ? "C1'" ? C U   5   "C1'" 
100 1 Y 1 P U   5   ? N1    ? C U   5   N1    
101 1 Y 1 P U   5   ? C2    ? C U   5   C2    
102 1 Y 1 P U   5   ? O2    ? C U   5   O2    
103 1 Y 1 P U   5   ? N3    ? C U   5   N3    
104 1 Y 1 P U   5   ? C4    ? C U   5   C4    
105 1 Y 1 P U   5   ? O4    ? C U   5   O4    
106 1 Y 1 P U   5   ? C5    ? C U   5   C5    
107 1 Y 1 P U   5   ? C6    ? C U   5   C6    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 129 ? A GLY 1   
2  1 Y 1 A SER 130 ? A SER 2   
3  1 Y 1 A ALA 131 ? A ALA 3   
4  1 Y 1 A ALA 132 ? A ALA 4   
5  1 Y 1 A ALA 133 ? A ALA 5   
6  1 Y 1 A SER 134 ? A SER 6   
7  1 Y 1 A PRO 135 ? A PRO 7   
8  1 Y 1 A ALA 136 ? A ALA 8   
9  1 Y 1 A TRP 137 ? A TRP 9   
10 1 Y 1 A HIS 365 ? A HIS 237 
11 1 Y 1 A GLN 366 ? A GLN 238 
12 1 Y 1 A HIS 367 ? A HIS 239 
13 1 Y 1 A SER 368 ? A SER 240 
14 1 Y 1 A CYS 369 ? A CYS 241 
15 1 Y 1 A CYS 370 ? A CYS 242 
16 1 Y 1 A GLU 371 ? A GLU 243 
17 1 Y 1 A SER 372 ? A SER 244 
18 1 Y 1 A PRO 373 ? A PRO 245 
19 1 Y 1 A THR 374 ? A THR 246 
20 1 Y 1 A ARG 375 ? A ARG 247 
21 1 Y 1 A LEU 376 ? A LEU 248 
22 1 Y 1 A ALA 377 ? A ALA 249 
23 1 Y 1 A GLN 378 ? A GLN 250 
24 1 Y 1 A GLN 379 ? A GLN 251 
25 1 Y 1 A SER 380 ? A SER 252 
26 1 Y 1 A HIS 381 ? A HIS 253 
27 1 Y 1 A MET 382 ? A MET 254 
28 1 Y 1 A ASP 383 ? A ASP 255 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5VZH 'double helix'        
5VZH 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DC 1 1_555 D DG 4 1_555 0.383  -0.267 0.445  -14.352 -12.093 -6.925   1 T_DC1:DG4_D T 1 ? D 4 ? 19 1 
1 B DG 2 1_555 D DC 3 1_555 0.016  0.040  0.552  2.438   -16.461 0.736    2 T_DG2:DC3_D T 2 ? D 3 ? 19 1 
1 B DG 3 1_555 D DC 2 1_555 -0.299 -0.248 0.281  2.595   -8.393  -2.868   3 T_DG3:DC2_D T 3 ? D 2 ? 19 1 
1 B DC 4 1_555 D DG 1 1_555 0.348  0.005  -0.368 17.560  1.664   0.050    4 T_DC4:DG1_D T 4 ? D 1 ? 19 1 
1 B DT 6 1_555 C DA 4 1_555 -0.072 -1.058 -0.145 -16.051 8.446   -171.868 5 T_DT6:DA4_P T 6 ? P 4 ? 21 2 
1 B DA 7 1_555 C DT 3 1_555 0.431  -0.039 0.098  18.701  -2.669  4.648    6 T_DA7:DT3_P T 7 ? P 3 ? 20 1 
1 B DC 8 1_555 C DG 2 1_555 0.317  -0.154 -0.064 16.758  -16.379 0.957    7 T_DC8:DG2_P T 8 ? P 2 ? 19 1 
1 B DG 9 1_555 C DC 1 1_555 -0.299 -0.147 0.098  -1.248  -12.454 -0.288   8 T_DG9:DC1_P T 9 ? P 1 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DC 1 1_555 D DG 4 1_555 B DG 2 1_555 D DC 3 1_555 -0.258 0.361  3.022 2.265  8.680  31.235  -0.781 0.834  2.987 15.718 -4.101  
32.467  1 TT_DC1DG2:DC3DG4_DD T 1 ? D 4 ? T 2 ? D 3 ? 
1 B DG 2 1_555 D DC 3 1_555 B DG 3 1_555 D DC 2 1_555 0.551  -0.216 3.417 -0.924 2.050  33.584  -0.720 -1.108 3.382 3.543  1.597   
33.657  2 TT_DG2DG3:DC2DC3_DD T 2 ? D 3 ? T 3 ? D 2 ? 
1 B DG 3 1_555 D DC 2 1_555 B DC 4 1_555 D DG 1 1_555 0.512  0.120  3.016 6.346  2.753  26.731  -0.382 0.386  3.051 5.832  -13.442 
27.596  3 TT_DG3DC4:DG1DC2_DD T 3 ? D 2 ? T 4 ? D 1 ? 
1 B DT 6 1_555 C DA 4 1_555 B DA 7 1_555 C DT 3 1_555 -0.581 0.799  2.821 1.562  4.751  -71.963 -0.814 -0.449 2.782 -4.039 1.328   
-72.114 4 TT_DT6DA7:DT3DA4_PP T 6 ? P 4 ? T 7 ? P 3 ? 
1 B DA 7 1_555 C DT 3 1_555 B DC 8 1_555 C DG 2 1_555 -0.631 -0.734 3.498 -3.126 -0.451 33.292  -1.196 0.539  3.550 -0.785 5.440   
33.438  5 TT_DA7DC8:DG2DT3_PP T 7 ? P 3 ? T 8 ? P 2 ? 
1 B DC 8 1_555 C DG 2 1_555 B DG 9 1_555 C DC 1 1_555 -0.742 -1.223 3.584 -6.504 9.677  36.264  -3.194 0.254  3.245 15.075 10.132  
38.032  6 TT_DC8DG9:DC1DG2_PP T 8 ? P 2 ? T 9 ? P 1 ? 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Institute of Environmental Health Sciences' 'United States' '1ZIA ES 102645'  1 
'National Institutes of Health/National Institute of Environmental Health Sciences' 'United States' 'Z01 ES065070'    2 
'American Cancer Society'                                                           'United States' PF-14-0438-01-DMC 3 
'National Institutes of Health/National Cancer Institute'                           'United States' CA097096          4 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5  'MAGNESIUM ION'           MG  
6  'SODIUM ION'              NA  
7  'CHLORIDE ION'            CL  
8  
;URIDINE 5'-TRIPHOSPHATE
;
UTP 
9  'GLYCOLIC ACID'           GOA 
10 1,2-ETHANEDIOL            EDO 
11 water                     HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#