data_5W0N
# 
_entry.id   5W0N 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.284 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5W0N         
WWPDB D_1000226240 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5W0N 
_pdbx_database_status.recvd_initial_deposition_date   2017-05-31 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Faehnle, C.R.'    1 ? 
'Walleshauser, J.' 2 ? 
'Joshua-Tor, L.'   3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat. Struct. Mol. Biol.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1545-9985 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            24 
_citation.language                  ? 
_citation.page_first                658 
_citation.page_last                 665 
_citation.title                     'Multi-domain utilization by TUT4 and TUT7 in control of let-7 biogenesis.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nsmb.3428 
_citation.pdbx_database_id_PubMed   28671666 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Faehnle, C.R.'    1 
primary 'Walleshauser, J.' 2 
primary 'Joshua-Tor, L.'   3 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5W0N 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     135.972 
_cell.length_a_esd                 ? 
_cell.length_b                     135.972 
_cell.length_b_esd                 ? 
_cell.length_c                     181.574 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        18 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5W0N 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Terminal uridylyltransferase 7' 46659.129 3   2.7.7.52 ? 
'nucleotidyltransferase domain (UNP residues 963-1365)' ? 
2 non-polymer syn 'MAGNESIUM ION' 24.305    3   ?        ? ?                                                       ? 
3 non-polymer syn "5'-O-[(S)-hydroxy{[(S)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]uridine" 483.156   3   ?        ? ? ? 
4 non-polymer syn 
;[(2R,3S,4R,5R)-5-(2,4-DIOXO-3,4-DIHYDROPYRIMIDIN-1(2H)-YL)-3,4-DIHYDROXYTETRAHYDROFURAN-2-YL]METHYL (2R,3S,4R,5R)-5-(2,4-DIOXO-3,4-DIHYDROPYRIMIDIN-1(2H)-YL)-4-HYDROXY-2-(HYDROXYMETHYL)TETRAHYDROFURAN-3-YL HYDROGEN (S)-PHOSPHATE
;
550.367   3   ?        ? ?                                                       ? 
5 non-polymer syn 'ZINC ION' 65.409    2   ?        ? ?                                                       ? 
6 non-polymer syn 'IODIDE ION' 126.904   3   ?        ? ?                                                       ? 
7 non-polymer syn 'SULFATE ION' 96.063    1   ?        ? ?                                                       ? 
8 water       nat water 18.015    218 ?        ? ?                                                       ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'TUT7, TUTase 7, Zinc finger CCHC domain-containing protein 6' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;VVCSLCKREGHLKKDCPEDFKRIQLEPLPPLTPKFLNILDQVCIQCYKDFSPTIIEDQAREHIRQNLESFIRQDFPGTKL
SLFGSSKNGFGFKQSDLDVCMTINGLETAEGLDCVRTIEELARVLRKHSGLRNILPITTAKVPIVKFFHLRSGLEVDISL
YNTLALHNTRLLSAYSAIDPRVKYLCYTMKVFTKMCDIGDASRGSLSSYAYTLMVLYFLQQRNPPVIPVLQEIYKGEKKP
EIFVDGWNIYFFDQIDELPTYWSECGKNTESVGQLWLGLLRFYTEEFDFKEHVISIRRKSLLTTFKKQWTSKYIVIEDPF
DLNHNLGAGLSRKMTNFIMKAFINGRRVFGIPVKGFPKDYPSKMEYFFDPDVLTEGELAPNDRCCRICGKIGHFMKDCPM
RRK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;VVCSLCKREGHLKKDCPEDFKRIQLEPLPPLTPKFLNILDQVCIQCYKDFSPTIIEDQAREHIRQNLESFIRQDFPGTKL
SLFGSSKNGFGFKQSDLDVCMTINGLETAEGLDCVRTIEELARVLRKHSGLRNILPITTAKVPIVKFFHLRSGLEVDISL
YNTLALHNTRLLSAYSAIDPRVKYLCYTMKVFTKMCDIGDASRGSLSSYAYTLMVLYFLQQRNPPVIPVLQEIYKGEKKP
EIFVDGWNIYFFDQIDELPTYWSECGKNTESVGQLWLGLLRFYTEEFDFKEHVISIRRKSLLTTFKKQWTSKYIVIEDPF
DLNHNLGAGLSRKMTNFIMKAFINGRRVFGIPVKGFPKDYPSKMEYFFDPDVLTEGELAPNDRCCRICGKIGHFMKDCPM
RRK
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   VAL n 
1 3   CYS n 
1 4   SER n 
1 5   LEU n 
1 6   CYS n 
1 7   LYS n 
1 8   ARG n 
1 9   GLU n 
1 10  GLY n 
1 11  HIS n 
1 12  LEU n 
1 13  LYS n 
1 14  LYS n 
1 15  ASP n 
1 16  CYS n 
1 17  PRO n 
1 18  GLU n 
1 19  ASP n 
1 20  PHE n 
1 21  LYS n 
1 22  ARG n 
1 23  ILE n 
1 24  GLN n 
1 25  LEU n 
1 26  GLU n 
1 27  PRO n 
1 28  LEU n 
1 29  PRO n 
1 30  PRO n 
1 31  LEU n 
1 32  THR n 
1 33  PRO n 
1 34  LYS n 
1 35  PHE n 
1 36  LEU n 
1 37  ASN n 
1 38  ILE n 
1 39  LEU n 
1 40  ASP n 
1 41  GLN n 
1 42  VAL n 
1 43  CYS n 
1 44  ILE n 
1 45  GLN n 
1 46  CYS n 
1 47  TYR n 
1 48  LYS n 
1 49  ASP n 
1 50  PHE n 
1 51  SER n 
1 52  PRO n 
1 53  THR n 
1 54  ILE n 
1 55  ILE n 
1 56  GLU n 
1 57  ASP n 
1 58  GLN n 
1 59  ALA n 
1 60  ARG n 
1 61  GLU n 
1 62  HIS n 
1 63  ILE n 
1 64  ARG n 
1 65  GLN n 
1 66  ASN n 
1 67  LEU n 
1 68  GLU n 
1 69  SER n 
1 70  PHE n 
1 71  ILE n 
1 72  ARG n 
1 73  GLN n 
1 74  ASP n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  THR n 
1 79  LYS n 
1 80  LEU n 
1 81  SER n 
1 82  LEU n 
1 83  PHE n 
1 84  GLY n 
1 85  SER n 
1 86  SER n 
1 87  LYS n 
1 88  ASN n 
1 89  GLY n 
1 90  PHE n 
1 91  GLY n 
1 92  PHE n 
1 93  LYS n 
1 94  GLN n 
1 95  SER n 
1 96  ASP n 
1 97  LEU n 
1 98  ASP n 
1 99  VAL n 
1 100 CYS n 
1 101 MET n 
1 102 THR n 
1 103 ILE n 
1 104 ASN n 
1 105 GLY n 
1 106 LEU n 
1 107 GLU n 
1 108 THR n 
1 109 ALA n 
1 110 GLU n 
1 111 GLY n 
1 112 LEU n 
1 113 ASP n 
1 114 CYS n 
1 115 VAL n 
1 116 ARG n 
1 117 THR n 
1 118 ILE n 
1 119 GLU n 
1 120 GLU n 
1 121 LEU n 
1 122 ALA n 
1 123 ARG n 
1 124 VAL n 
1 125 LEU n 
1 126 ARG n 
1 127 LYS n 
1 128 HIS n 
1 129 SER n 
1 130 GLY n 
1 131 LEU n 
1 132 ARG n 
1 133 ASN n 
1 134 ILE n 
1 135 LEU n 
1 136 PRO n 
1 137 ILE n 
1 138 THR n 
1 139 THR n 
1 140 ALA n 
1 141 LYS n 
1 142 VAL n 
1 143 PRO n 
1 144 ILE n 
1 145 VAL n 
1 146 LYS n 
1 147 PHE n 
1 148 PHE n 
1 149 HIS n 
1 150 LEU n 
1 151 ARG n 
1 152 SER n 
1 153 GLY n 
1 154 LEU n 
1 155 GLU n 
1 156 VAL n 
1 157 ASP n 
1 158 ILE n 
1 159 SER n 
1 160 LEU n 
1 161 TYR n 
1 162 ASN n 
1 163 THR n 
1 164 LEU n 
1 165 ALA n 
1 166 LEU n 
1 167 HIS n 
1 168 ASN n 
1 169 THR n 
1 170 ARG n 
1 171 LEU n 
1 172 LEU n 
1 173 SER n 
1 174 ALA n 
1 175 TYR n 
1 176 SER n 
1 177 ALA n 
1 178 ILE n 
1 179 ASP n 
1 180 PRO n 
1 181 ARG n 
1 182 VAL n 
1 183 LYS n 
1 184 TYR n 
1 185 LEU n 
1 186 CYS n 
1 187 TYR n 
1 188 THR n 
1 189 MET n 
1 190 LYS n 
1 191 VAL n 
1 192 PHE n 
1 193 THR n 
1 194 LYS n 
1 195 MET n 
1 196 CYS n 
1 197 ASP n 
1 198 ILE n 
1 199 GLY n 
1 200 ASP n 
1 201 ALA n 
1 202 SER n 
1 203 ARG n 
1 204 GLY n 
1 205 SER n 
1 206 LEU n 
1 207 SER n 
1 208 SER n 
1 209 TYR n 
1 210 ALA n 
1 211 TYR n 
1 212 THR n 
1 213 LEU n 
1 214 MET n 
1 215 VAL n 
1 216 LEU n 
1 217 TYR n 
1 218 PHE n 
1 219 LEU n 
1 220 GLN n 
1 221 GLN n 
1 222 ARG n 
1 223 ASN n 
1 224 PRO n 
1 225 PRO n 
1 226 VAL n 
1 227 ILE n 
1 228 PRO n 
1 229 VAL n 
1 230 LEU n 
1 231 GLN n 
1 232 GLU n 
1 233 ILE n 
1 234 TYR n 
1 235 LYS n 
1 236 GLY n 
1 237 GLU n 
1 238 LYS n 
1 239 LYS n 
1 240 PRO n 
1 241 GLU n 
1 242 ILE n 
1 243 PHE n 
1 244 VAL n 
1 245 ASP n 
1 246 GLY n 
1 247 TRP n 
1 248 ASN n 
1 249 ILE n 
1 250 TYR n 
1 251 PHE n 
1 252 PHE n 
1 253 ASP n 
1 254 GLN n 
1 255 ILE n 
1 256 ASP n 
1 257 GLU n 
1 258 LEU n 
1 259 PRO n 
1 260 THR n 
1 261 TYR n 
1 262 TRP n 
1 263 SER n 
1 264 GLU n 
1 265 CYS n 
1 266 GLY n 
1 267 LYS n 
1 268 ASN n 
1 269 THR n 
1 270 GLU n 
1 271 SER n 
1 272 VAL n 
1 273 GLY n 
1 274 GLN n 
1 275 LEU n 
1 276 TRP n 
1 277 LEU n 
1 278 GLY n 
1 279 LEU n 
1 280 LEU n 
1 281 ARG n 
1 282 PHE n 
1 283 TYR n 
1 284 THR n 
1 285 GLU n 
1 286 GLU n 
1 287 PHE n 
1 288 ASP n 
1 289 PHE n 
1 290 LYS n 
1 291 GLU n 
1 292 HIS n 
1 293 VAL n 
1 294 ILE n 
1 295 SER n 
1 296 ILE n 
1 297 ARG n 
1 298 ARG n 
1 299 LYS n 
1 300 SER n 
1 301 LEU n 
1 302 LEU n 
1 303 THR n 
1 304 THR n 
1 305 PHE n 
1 306 LYS n 
1 307 LYS n 
1 308 GLN n 
1 309 TRP n 
1 310 THR n 
1 311 SER n 
1 312 LYS n 
1 313 TYR n 
1 314 ILE n 
1 315 VAL n 
1 316 ILE n 
1 317 GLU n 
1 318 ASP n 
1 319 PRO n 
1 320 PHE n 
1 321 ASP n 
1 322 LEU n 
1 323 ASN n 
1 324 HIS n 
1 325 ASN n 
1 326 LEU n 
1 327 GLY n 
1 328 ALA n 
1 329 GLY n 
1 330 LEU n 
1 331 SER n 
1 332 ARG n 
1 333 LYS n 
1 334 MET n 
1 335 THR n 
1 336 ASN n 
1 337 PHE n 
1 338 ILE n 
1 339 MET n 
1 340 LYS n 
1 341 ALA n 
1 342 PHE n 
1 343 ILE n 
1 344 ASN n 
1 345 GLY n 
1 346 ARG n 
1 347 ARG n 
1 348 VAL n 
1 349 PHE n 
1 350 GLY n 
1 351 ILE n 
1 352 PRO n 
1 353 VAL n 
1 354 LYS n 
1 355 GLY n 
1 356 PHE n 
1 357 PRO n 
1 358 LYS n 
1 359 ASP n 
1 360 TYR n 
1 361 PRO n 
1 362 SER n 
1 363 LYS n 
1 364 MET n 
1 365 GLU n 
1 366 TYR n 
1 367 PHE n 
1 368 PHE n 
1 369 ASP n 
1 370 PRO n 
1 371 ASP n 
1 372 VAL n 
1 373 LEU n 
1 374 THR n 
1 375 GLU n 
1 376 GLY n 
1 377 GLU n 
1 378 LEU n 
1 379 ALA n 
1 380 PRO n 
1 381 ASN n 
1 382 ASP n 
1 383 ARG n 
1 384 CYS n 
1 385 CYS n 
1 386 ARG n 
1 387 ILE n 
1 388 CYS n 
1 389 GLY n 
1 390 LYS n 
1 391 ILE n 
1 392 GLY n 
1 393 HIS n 
1 394 PHE n 
1 395 MET n 
1 396 LYS n 
1 397 ASP n 
1 398 CYS n 
1 399 PRO n 
1 400 MET n 
1 401 ARG n 
1 402 ARG n 
1 403 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   403 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ZCCHC6, HS2, KIAA1711, TUT7' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               Sf9 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          baculovirus 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'Multi-Bac, pFL' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TUT7_HUMAN 
_struct_ref.pdbx_db_accession          Q5VYS8 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;VVCSLCKREGHLKKDCPEDFKRIQLEPLPPLTPKFLNILDQVCIQCYKDFSPTIIEDQAREHIRQNLESFIRQDFPGTKL
SLFGSSKNGFGFKQSDLDVCMTINGLETAEGLDCVRTIEELARVLRKHSGLRNILPITTAKVPIVKFFHLRSGLEVDISL
YNTLALHNTRLLSAYSAIDPRVKYLCYTMKVFTKMCDIGDASRGSLSSYAYTLMVLYFLQQRNPPVIPVLQEIYKGEKKP
EIFVDGWNIYFFDQIDELPTYWSECGKNTESVGQLWLGLLRFYTEEFDFKEHVISIRRKSLLTTFKKQWTSKYIVIEDPF
DLNHNLGAGLSRKMTNFIMKAFINGRRVFGIPVKGFPKDYPSKMEYFFDPDVLTEGELAPNDRCCRICGKIGHFMKDCPM
RRK
;
_struct_ref.pdbx_align_begin           963 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5W0N A 1 ? 403 ? Q5VYS8 963 ? 1365 ? 963 1365 
2 1 5W0N B 1 ? 403 ? Q5VYS8 963 ? 1365 ? 963 1365 
3 1 5W0N C 1 ? 403 ? Q5VYS8 963 ? 1365 ? 963 1365 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2KH non-polymer         . "5'-O-[(S)-hydroxy{[(S)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]uridine" ? 'C9 H16 N3 O14 P3' 
483.156 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'      131.173 
IOD non-polymer         . 'IODIDE ION' ? 'I -1'             126.904 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'    149.211 
MG  non-polymer         . 'MAGNESIUM ION' ? 'Mg 2'             24.305  
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'       105.093 
SO4 non-polymer         . 'SULFATE ION' ? 'O4 S -2'          96.063  
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'      181.189 
UPU non-polymer         . 
;[(2R,3S,4R,5R)-5-(2,4-DIOXO-3,4-DIHYDROPYRIMIDIN-1(2H)-YL)-3,4-DIHYDROXYTETRAHYDROFURAN-2-YL]METHYL (2R,3S,4R,5R)-5-(2,4-DIOXO-3,4-DIHYDROPYRIMIDIN-1(2H)-YL)-4-HYDROXY-2-(HYDROXYMETHYL)TETRAHYDROFURAN-3-YL HYDROGEN (S)-PHOSPHATE
;
? 'C18 H23 N4 O14 P' 550.367 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'      117.146 
ZN  non-polymer         . 'ZINC ION' ? 'Zn 2'             65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5W0N 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.46 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         64.47 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.8-1.0 M lithium sulfate, 0.075-0.2 M potassium iodide, 0.05-0.2 M trisodium citrate, pH 5-6' 
_exptl_crystal_grow.pdbx_pH_range   5.0-6.0 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-11-22 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.979 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            48.740 
_reflns.entry_id                         5W0N 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.497 
_reflns.d_resolution_low                 98.798 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       65579 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.6 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.4 
_reflns.pdbx_Rmerge_I_obs                0.063 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            15.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.998 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.497 
_reflns_shell.d_res_low                   2.51 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.872 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                172.460 
_refine.B_iso_mean                               69.0815 
_refine.B_iso_min                                27.290 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5W0N 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.4970 
_refine.ls_d_res_low                             58.8780 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     65534 
_refine.ls_number_reflns_R_free                  3249 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.5000 
_refine.ls_percent_reflns_R_free                 4.9600 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1881 
_refine.ls_R_factor_R_free                       0.2151 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1867 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.350 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 5W0B' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 23.2600 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.2900 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.4970 
_refine_hist.d_res_low                        58.8780 
_refine_hist.pdbx_number_atoms_ligand         313 
_refine_hist.number_atoms_solvent             218 
_refine_hist.number_atoms_total               9467 
_refine_hist.pdbx_number_residues_total       1101 
_refine_hist.pdbx_B_iso_mean_ligand           56.72 
_refine_hist.pdbx_B_iso_mean_solvent          51.01 
_refine_hist.pdbx_number_atoms_protein        8936 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.005  ? 9393  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.585  ? 12699 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.041  ? 1394  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003  ? 1585  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 11.323 ? 5524  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 'X-RAY DIFFRACTION' 1 1 TORSIONAL A 6319 5.759 ? ? ? ? ? 
2 'X-RAY DIFFRACTION' 1 2 TORSIONAL B 6319 5.759 ? ? ? ? ? 
3 'X-RAY DIFFRACTION' 1 3 TORSIONAL C 6319 5.759 ? ? ? ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.4972 2.5345  2888 . 138 2750 100.0000 . . . 0.3000 0.0000 0.2605 . . . . . . 23 . . . 
'X-RAY DIFFRACTION' 2.5345 2.5741  2849 . 150 2699 100.0000 . . . 0.3140 0.0000 0.2577 . . . . . . 23 . . . 
'X-RAY DIFFRACTION' 2.5741 2.6163  2860 . 166 2694 100.0000 . . . 0.2726 0.0000 0.2520 . . . . . . 23 . . . 
'X-RAY DIFFRACTION' 2.6163 2.6614  2844 . 166 2678 100.0000 . . . 0.2856 0.0000 0.2482 . . . . . . 23 . . . 
'X-RAY DIFFRACTION' 2.6614 2.7098  2845 . 136 2709 100.0000 . . . 0.2369 0.0000 0.2350 . . . . . . 23 . . . 
'X-RAY DIFFRACTION' 2.7098 2.7619  2840 . 129 2711 100.0000 . . . 0.2686 0.0000 0.2251 . . . . . . 23 . . . 
'X-RAY DIFFRACTION' 2.7619 2.8183  2849 . 147 2702 100.0000 . . . 0.2529 0.0000 0.2247 . . . . . . 23 . . . 
'X-RAY DIFFRACTION' 2.8183 2.8796  2844 . 122 2722 100.0000 . . . 0.2435 0.0000 0.2300 . . . . . . 23 . . . 
'X-RAY DIFFRACTION' 2.8796 2.9466  2869 . 141 2728 100.0000 . . . 0.2693 0.0000 0.2308 . . . . . . 23 . . . 
'X-RAY DIFFRACTION' 2.9466 3.0202  2864 . 123 2741 100.0000 . . . 0.2693 0.0000 0.2431 . . . . . . 23 . . . 
'X-RAY DIFFRACTION' 3.0202 3.1019  2847 . 154 2693 100.0000 . . . 0.2728 0.0000 0.2324 . . . . . . 23 . . . 
'X-RAY DIFFRACTION' 3.1019 3.1932  2824 . 150 2674 100.0000 . . . 0.2465 0.0000 0.2252 . . . . . . 23 . . . 
'X-RAY DIFFRACTION' 3.1932 3.2962  2873 . 139 2734 100.0000 . . . 0.2642 0.0000 0.2139 . . . . . . 23 . . . 
'X-RAY DIFFRACTION' 3.2962 3.4140  2836 . 133 2703 100.0000 . . . 0.2495 0.0000 0.2178 . . . . . . 23 . . . 
'X-RAY DIFFRACTION' 3.4140 3.5507  2842 . 127 2715 100.0000 . . . 0.2486 0.0000 0.2068 . . . . . . 23 . . . 
'X-RAY DIFFRACTION' 3.5507 3.7123  2851 . 158 2693 99.0000  . . . 0.2434 0.0000 0.1961 . . . . . . 23 . . . 
'X-RAY DIFFRACTION' 3.7123 3.9080  2852 . 131 2721 100.0000 . . . 0.2155 0.0000 0.1758 . . . . . . 23 . . . 
'X-RAY DIFFRACTION' 3.9080 4.1527  2827 . 115 2712 99.0000  . . . 0.1638 0.0000 0.1510 . . . . . . 23 . . . 
'X-RAY DIFFRACTION' 4.1527 4.4733  2840 . 153 2687 99.0000  . . . 0.1610 0.0000 0.1488 . . . . . . 23 . . . 
'X-RAY DIFFRACTION' 4.4733 4.9232  2847 . 138 2709 99.0000  . . . 0.1653 0.0000 0.1404 . . . . . . 23 . . . 
'X-RAY DIFFRACTION' 4.9232 5.6351  2858 . 113 2745 99.0000  . . . 0.1822 0.0000 0.1532 . . . . . . 23 . . . 
'X-RAY DIFFRACTION' 5.6351 7.0978  2845 . 182 2663 99.0000  . . . 0.1939 0.0000 0.1789 . . . . . . 23 . . . 
'X-RAY DIFFRACTION' 7.0978 58.8939 2840 . 138 2702 98.0000  . . . 0.1777 0.0000 0.1543 . . . . . . 23 . . . 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 
;(chain A and ((resid 987 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name HA or name HB2 or name HB3 or name HG or name HD11 or name HD12 or name HD13 or name HD21 or name HD22 or name HD23)) or resseq 988:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name N or name CA or name C or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
1 2 
;(chain B and (resseq 987:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name O or name N or name CA or name C or name CB or name CG or name OE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD2 or name HD1 or name HE2 or name HE1 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name O or name N or name CA or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
1 3 
;(chain C and (resseq 987:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name O or name N or name CA or name C or name H or name HA2)) or (resid 1071 and (name O or name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2)) or (resid 1072 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name O or name N or name CA or name C )) or resseq 1324:1343))
;
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 1  ? A 987  A 987  
;(chain A and ((resid 987 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name HA or name HB2 or name HB3 or name HG or name HD11 or name HD12 or name HD13 or name HD21 or name HD22 or name HD23)) or resseq 988:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name N or name CA or name C or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
? ? ? ? ? ? ? ? 
1 1 2  ? A 985  A 1363 
;(chain A and ((resid 987 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name HA or name HB2 or name HB3 or name HG or name HD11 or name HD12 or name HD13 or name HD21 or name HD22 or name HD23)) or resseq 988:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name N or name CA or name C or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
? ? ? ? ? ? ? ? 
1 1 3  ? A 985  A 1363 
;(chain A and ((resid 987 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name HA or name HB2 or name HB3 or name HG or name HD11 or name HD12 or name HD13 or name HD21 or name HD22 or name HD23)) or resseq 988:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name N or name CA or name C or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
? ? ? ? ? ? ? ? 
1 1 4  ? A 985  A 1363 
;(chain A and ((resid 987 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name HA or name HB2 or name HB3 or name HG or name HD11 or name HD12 or name HD13 or name HD21 or name HD22 or name HD23)) or resseq 988:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name N or name CA or name C or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
? ? ? ? ? ? ? ? 
1 1 5  ? A 985  A 1363 
;(chain A and ((resid 987 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name HA or name HB2 or name HB3 or name HG or name HD11 or name HD12 or name HD13 or name HD21 or name HD22 or name HD23)) or resseq 988:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name N or name CA or name C or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
? ? ? ? ? ? ? ? 
1 1 6  ? A 985  A 1363 
;(chain A and ((resid 987 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name HA or name HB2 or name HB3 or name HG or name HD11 or name HD12 or name HD13 or name HD21 or name HD22 or name HD23)) or resseq 988:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name N or name CA or name C or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
? ? ? ? ? ? ? ? 
1 1 7  ? A 985  A 1363 
;(chain A and ((resid 987 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name HA or name HB2 or name HB3 or name HG or name HD11 or name HD12 or name HD13 or name HD21 or name HD22 or name HD23)) or resseq 988:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name N or name CA or name C or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
? ? ? ? ? ? ? ? 
1 1 8  ? A 985  A 1363 
;(chain A and ((resid 987 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name HA or name HB2 or name HB3 or name HG or name HD11 or name HD12 or name HD13 or name HD21 or name HD22 or name HD23)) or resseq 988:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name N or name CA or name C or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
? ? ? ? ? ? ? ? 
1 1 9  ? A 985  A 1363 
;(chain A and ((resid 987 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name HA or name HB2 or name HB3 or name HG or name HD11 or name HD12 or name HD13 or name HD21 or name HD22 or name HD23)) or resseq 988:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name N or name CA or name C or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
? ? ? ? ? ? ? ? 
1 1 10 ? A 985  A 1363 
;(chain A and ((resid 987 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name HA or name HB2 or name HB3 or name HG or name HD11 or name HD12 or name HD13 or name HD21 or name HD22 or name HD23)) or resseq 988:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name N or name CA or name C or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
? ? ? ? ? ? ? ? 
1 1 11 ? A 985  A 1363 
;(chain A and ((resid 987 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name HA or name HB2 or name HB3 or name HG or name HD11 or name HD12 or name HD13 or name HD21 or name HD22 or name HD23)) or resseq 988:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name N or name CA or name C or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
? ? ? ? ? ? ? ? 
1 1 12 ? A 985  A 1363 
;(chain A and ((resid 987 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name HA or name HB2 or name HB3 or name HG or name HD11 or name HD12 or name HD13 or name HD21 or name HD22 or name HD23)) or resseq 988:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name N or name CA or name C or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
? ? ? ? ? ? ? ? 
1 1 13 ? A 985  A 1363 
;(chain A and ((resid 987 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name HA or name HB2 or name HB3 or name HG or name HD11 or name HD12 or name HD13 or name HD21 or name HD22 or name HD23)) or resseq 988:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name N or name CA or name C or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
? ? ? ? ? ? ? ? 
1 1 14 ? A 985  A 1363 
;(chain A and ((resid 987 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name HA or name HB2 or name HB3 or name HG or name HD11 or name HD12 or name HD13 or name HD21 or name HD22 or name HD23)) or resseq 988:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name N or name CA or name C or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
? ? ? ? ? ? ? ? 
1 1 15 ? A 985  A 1363 
;(chain A and ((resid 987 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name HA or name HB2 or name HB3 or name HG or name HD11 or name HD12 or name HD13 or name HD21 or name HD22 or name HD23)) or resseq 988:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name N or name CA or name C or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
? ? ? ? ? ? ? ? 
1 1 16 ? A 985  A 1363 
;(chain A and ((resid 987 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name HA or name HB2 or name HB3 or name HG or name HD11 or name HD12 or name HD13 or name HD21 or name HD22 or name HD23)) or resseq 988:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name N or name CA or name C or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
? ? ? ? ? ? ? ? 
1 1 17 ? A 985  A 1363 
;(chain A and ((resid 987 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name HA or name HB2 or name HB3 or name HG or name HD11 or name HD12 or name HD13 or name HD21 or name HD22 or name HD23)) or resseq 988:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name N or name CA or name C or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
? ? ? ? ? ? ? ? 
1 1 18 ? A 985  A 1363 
;(chain A and ((resid 987 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2 or name HA or name HB2 or name HB3 or name HG or name HD11 or name HD12 or name HD13 or name HD21 or name HD22 or name HD23)) or resseq 988:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name N or name CA or name C or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
? ? ? ? ? ? ? ? 
1 2 1  ? B 987  B 995  
;(chain B and (resseq 987:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name O or name N or name CA or name C or name CB or name CG or name OE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD2 or name HD1 or name HE2 or name HE1 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name O or name N or name CA or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
? ? ? ? ? ? ? ? 
1 2 2  ? B 997  B 997  
;(chain B and (resseq 987:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name O or name N or name CA or name C or name CB or name CG or name OE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD2 or name HD1 or name HE2 or name HE1 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name O or name N or name CA or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
? ? ? ? ? ? ? ? 
1 2 3  ? B 999  B 1006 
;(chain B and (resseq 987:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name O or name N or name CA or name C or name CB or name CG or name OE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD2 or name HD1 or name HE2 or name HE1 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name O or name N or name CA or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
? ? ? ? ? ? ? ? 
1 2 4  ? B 1008 B 1023 
;(chain B and (resseq 987:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name O or name N or name CA or name C or name CB or name CG or name OE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD2 or name HD1 or name HE2 or name HE1 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name O or name N or name CA or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
? ? ? ? ? ? ? ? 
1 2 5  ? B 1025 B 1027 
;(chain B and (resseq 987:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name O or name N or name CA or name C or name CB or name CG or name OE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD2 or name HD1 or name HE2 or name HE1 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name O or name N or name CA or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
? ? ? ? ? ? ? ? 
1 2 6  ? B 1029 B 1040 
;(chain B and (resseq 987:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name O or name N or name CA or name C or name CB or name CG or name OE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD2 or name HD1 or name HE2 or name HE1 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name O or name N or name CA or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
? ? ? ? ? ? ? ? 
1 2 7  ? B 1042 B 1066 
;(chain B and (resseq 987:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name O or name N or name CA or name C or name CB or name CG or name OE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD2 or name HD1 or name HE2 or name HE1 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name O or name N or name CA or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
? ? ? ? ? ? ? ? 
1 2 8  ? B 1067 B 1067 
;(chain B and (resseq 987:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name O or name N or name CA or name C or name CB or name CG or name OE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD2 or name HD1 or name HE2 or name HE1 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name O or name N or name CA or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
? ? ? ? ? ? ? ? 
1 2 9  ? B 987  B 1362 
;(chain B and (resseq 987:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name O or name N or name CA or name C or name CB or name CG or name OE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD2 or name HD1 or name HE2 or name HE1 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name O or name N or name CA or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
? ? ? ? ? ? ? ? 
1 2 10 ? B 987  B 1362 
;(chain B and (resseq 987:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name O or name N or name CA or name C or name CB or name CG or name OE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD2 or name HD1 or name HE2 or name HE1 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name O or name N or name CA or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
? ? ? ? ? ? ? ? 
1 2 11 ? B 987  B 1362 
;(chain B and (resseq 987:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name O or name N or name CA or name C or name CB or name CG or name OE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD2 or name HD1 or name HE2 or name HE1 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name O or name N or name CA or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
? ? ? ? ? ? ? ? 
1 2 12 ? B 987  B 1362 
;(chain B and (resseq 987:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name O or name N or name CA or name C or name CB or name CG or name OE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD2 or name HD1 or name HE2 or name HE1 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name O or name N or name CA or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
? ? ? ? ? ? ? ? 
1 2 13 ? B 987  B 1362 
;(chain B and (resseq 987:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name N or name CA or name C or name H or name HA2 or name HA3)) or (resid 1071 and (name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2 or name HB3)) or (resid 1072 and (name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name O or name N or name CA or name C or name CB or name CG or name OE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD2 or name HD1 or name HE2 or name HE1 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name O or name N or name CA or name CB )) or (resid 1324 and (name N or name CA or name C or name O or name CB or name OG or name HA or name HB2 or name HB3 or name HG )) or resseq 1325:1343))
;
? ? ? ? ? ? ? ? 
1 3 1  ? C 987  C 995  
;(chain C and (resseq 987:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name O or name N or name CA or name C or name H or name HA2)) or (resid 1071 and (name O or name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2)) or (resid 1072 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name O or name N or name CA or name C )) or resseq 1324:1343))
;
? ? ? ? ? ? ? ? 
1 3 2  ? C 997  C 997  
;(chain C and (resseq 987:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name O or name N or name CA or name C or name H or name HA2)) or (resid 1071 and (name O or name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2)) or (resid 1072 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name O or name N or name CA or name C )) or resseq 1324:1343))
;
? ? ? ? ? ? ? ? 
1 3 3  ? C 999  C 1006 
;(chain C and (resseq 987:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name O or name N or name CA or name C or name H or name HA2)) or (resid 1071 and (name O or name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2)) or (resid 1072 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name O or name N or name CA or name C )) or resseq 1324:1343))
;
? ? ? ? ? ? ? ? 
1 3 4  ? C 1008 C 1023 
;(chain C and (resseq 987:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name O or name N or name CA or name C or name H or name HA2)) or (resid 1071 and (name O or name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2)) or (resid 1072 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name O or name N or name CA or name C )) or resseq 1324:1343))
;
? ? ? ? ? ? ? ? 
1 3 5  ? C 1025 C 1027 
;(chain C and (resseq 987:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name O or name N or name CA or name C or name H or name HA2)) or (resid 1071 and (name O or name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2)) or (resid 1072 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name O or name N or name CA or name C )) or resseq 1324:1343))
;
? ? ? ? ? ? ? ? 
1 3 6  ? C 1029 C 1040 
;(chain C and (resseq 987:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name O or name N or name CA or name C or name H or name HA2)) or (resid 1071 and (name O or name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2)) or (resid 1072 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name O or name N or name CA or name C )) or resseq 1324:1343))
;
? ? ? ? ? ? ? ? 
1 3 7  ? C 1042 C 1066 
;(chain C and (resseq 987:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name O or name N or name CA or name C or name H or name HA2)) or (resid 1071 and (name O or name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2)) or (resid 1072 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name O or name N or name CA or name C )) or resseq 1324:1343))
;
? ? ? ? ? ? ? ? 
1 3 8  ? C 1067 C 1067 
;(chain C and (resseq 987:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name O or name N or name CA or name C or name H or name HA2)) or (resid 1071 and (name O or name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2)) or (resid 1072 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name O or name N or name CA or name C )) or resseq 1324:1343))
;
? ? ? ? ? ? ? ? 
1 3 9  ? C 987  C 1344 
;(chain C and (resseq 987:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name O or name N or name CA or name C or name H or name HA2)) or (resid 1071 and (name O or name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2)) or (resid 1072 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name O or name N or name CA or name C )) or resseq 1324:1343))
;
? ? ? ? ? ? ? ? 
1 3 10 ? C 987  C 1344 
;(chain C and (resseq 987:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name O or name N or name CA or name C or name H or name HA2)) or (resid 1071 and (name O or name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2)) or (resid 1072 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name O or name N or name CA or name C )) or resseq 1324:1343))
;
? ? ? ? ? ? ? ? 
1 3 11 ? C 987  C 1344 
;(chain C and (resseq 987:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name O or name N or name CA or name C or name H or name HA2)) or (resid 1071 and (name O or name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2)) or (resid 1072 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name O or name N or name CA or name C )) or resseq 1324:1343))
;
? ? ? ? ? ? ? ? 
1 3 12 ? C 987  C 1344 
;(chain C and (resseq 987:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name O or name N or name CA or name C or name H or name HA2)) or (resid 1071 and (name O or name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2)) or (resid 1072 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name O or name N or name CA or name C )) or resseq 1324:1343))
;
? ? ? ? ? ? ? ? 
1 3 13 ? C 987  C 1344 
;(chain C and (resseq 987:995 or resseq 997 or resseq 999:1006 or resseq 1008:1023 or resseq 1025:1027 or resseq 1029:1040 or resseq 1042:1066 or (resid 1067 and (name O or name N or name CA or name C or name H or name HA2)) or (resid 1071 and (name O or name N or name CA or name C or name CB or name H or name HA or name HB1 or name HB2)) or (resid 1072 and (name O or name N or name CA or name C or name CB or name CG or name CD or name OE1 or name OE2 or name H or name HA or name HB2 or name HB3 or name HG2)) or resseq 1073:1081 or resseq 1083:1128 or (resid 1129 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name ND1 or name CE1 or name NE2 or name H or name HA or name HB2 or name HB3 or name HD2 or name HE1)) or resseq 1130:1164 or resseq 1166:1204 or resseq 1206:1212 or (resid 1213 and (name N or name CA or name C or name O or name CB or name CG or name CD2 or name CE2 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1214:1269 or (resid 1270 and (name N or name CA or name C or name CB or name CG or name CD or name NE2 or name H or name HA or name HB2 or name HB3 or name HG2 or name HG3 or name HE21 or name HE22)) or resseq 1271:1279 or (resid 1280 and (name N or name CA or name C or name O or name CB or name CG or name OD2 or name H or name HA or name HB2 or name HB3)) or resseq 1281:1293 or resseq 1295:1303 or (resid 1304 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1305:1310 or (resid 1311 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ or name H or name HA or name HB2 or name HB3 or name HD1 or name HD2 or name HE1 or name HE2 or name HZ )) or resseq 1312:1314 or (resid 1315 and (name O or name N or name CA or name C )) or resseq 1324:1343))
;
? ? ? ? ? ? ? ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                     5W0N 
_struct.title                        'Structure of human TUT7 catalytic module (CM) in complex with UMPNPP and U2 RNA' 
_struct.pdbx_descriptor              'Terminal uridylyltransferase 7 (E.C.2.7.7.52)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5W0N 
_struct_keywords.text            'terminal uridyltransferase, TUTase, TRANSFERASE' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 6 ? 
I N N 7 ? 
J N N 2 ? 
K N N 3 ? 
L N N 4 ? 
M N N 5 ? 
N N N 6 ? 
O N N 2 ? 
P N N 3 ? 
Q N N 4 ? 
R N N 6 ? 
S N N 8 ? 
T N N 8 ? 
U N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 32  ? SER A 51  ? THR A 994  SER A 1013 1 ? 20 
HELX_P HELX_P2  AA2 THR A 53  ? GLN A 73  ? THR A 1015 GLN A 1035 1 ? 21 
HELX_P HELX_P3  AA3 GLY A 84  ? LYS A 87  ? GLY A 1046 LYS A 1049 5 ? 4  
HELX_P HELX_P4  AA4 ASP A 113 ? ARG A 126 ? ASP A 1075 ARG A 1088 1 ? 14 
HELX_P HELX_P5  AA5 ASN A 162 ? ASP A 179 ? ASN A 1124 ASP A 1141 1 ? 18 
HELX_P HELX_P6  AA6 ASP A 179 ? ASP A 197 ? ASP A 1141 ASP A 1159 1 ? 19 
HELX_P HELX_P7  AA7 ASP A 200 ? GLY A 204 ? ASP A 1162 GLY A 1166 5 ? 5  
HELX_P HELX_P8  AA8 SER A 207 ? ARG A 222 ? SER A 1169 ARG A 1184 1 ? 16 
HELX_P HELX_P9  AA9 VAL A 229 ? ILE A 233 ? VAL A 1191 ILE A 1195 5 ? 5  
HELX_P HELX_P10 AB1 GLN A 254 ? ASP A 256 ? GLN A 1216 ASP A 1218 5 ? 3  
HELX_P HELX_P11 AB2 GLU A 257 ? TRP A 262 ? GLU A 1219 TRP A 1224 1 ? 6  
HELX_P HELX_P12 AB3 SER A 271 ? GLU A 286 ? SER A 1233 GLU A 1248 1 ? 16 
HELX_P HELX_P13 AB4 THR A 304 ? GLN A 308 ? THR A 1266 GLN A 1270 1 ? 5  
HELX_P HELX_P14 AB5 SER A 331 ? ILE A 351 ? SER A 1293 ILE A 1313 1 ? 21 
HELX_P HELX_P15 AB6 SER A 362 ? PHE A 368 ? SER A 1324 PHE A 1330 1 ? 7  
HELX_P HELX_P16 AB7 ASP A 369 ? THR A 374 ? ASP A 1331 THR A 1336 1 ? 6  
HELX_P HELX_P17 AB8 PHE A 394 ? CYS A 398 ? PHE A 1356 CYS A 1360 5 ? 5  
HELX_P HELX_P18 AB9 THR B 32  ? SER B 51  ? THR B 994  SER B 1013 1 ? 20 
HELX_P HELX_P19 AC1 THR B 53  ? GLN B 73  ? THR B 1015 GLN B 1035 1 ? 21 
HELX_P HELX_P20 AC2 GLY B 84  ? LYS B 87  ? GLY B 1046 LYS B 1049 5 ? 4  
HELX_P HELX_P21 AC3 ASP B 113 ? ARG B 126 ? ASP B 1075 ARG B 1088 1 ? 14 
HELX_P HELX_P22 AC4 ASN B 162 ? ASP B 179 ? ASN B 1124 ASP B 1141 1 ? 18 
HELX_P HELX_P23 AC5 ASP B 179 ? ASP B 197 ? ASP B 1141 ASP B 1159 1 ? 19 
HELX_P HELX_P24 AC6 ASP B 200 ? GLY B 204 ? ASP B 1162 GLY B 1166 5 ? 5  
HELX_P HELX_P25 AC7 SER B 207 ? ARG B 222 ? SER B 1169 ARG B 1184 1 ? 16 
HELX_P HELX_P26 AC8 VAL B 229 ? ILE B 233 ? VAL B 1191 ILE B 1195 5 ? 5  
HELX_P HELX_P27 AC9 GLN B 254 ? ASP B 256 ? GLN B 1216 ASP B 1218 5 ? 3  
HELX_P HELX_P28 AD1 GLU B 257 ? TRP B 262 ? GLU B 1219 TRP B 1224 1 ? 6  
HELX_P HELX_P29 AD2 SER B 271 ? GLU B 286 ? SER B 1233 GLU B 1248 1 ? 16 
HELX_P HELX_P30 AD3 THR B 304 ? GLN B 308 ? THR B 1266 GLN B 1270 1 ? 5  
HELX_P HELX_P31 AD4 SER B 331 ? ILE B 351 ? SER B 1293 ILE B 1313 1 ? 21 
HELX_P HELX_P32 AD5 SER B 362 ? PHE B 368 ? SER B 1324 PHE B 1330 1 ? 7  
HELX_P HELX_P33 AD6 ASP B 369 ? THR B 374 ? ASP B 1331 THR B 1336 1 ? 6  
HELX_P HELX_P34 AD7 PHE B 394 ? CYS B 398 ? PHE B 1356 CYS B 1360 5 ? 5  
HELX_P HELX_P35 AD8 THR C 32  ? SER C 51  ? THR C 994  SER C 1013 1 ? 20 
HELX_P HELX_P36 AD9 THR C 53  ? ARG C 72  ? THR C 1015 ARG C 1034 1 ? 20 
HELX_P HELX_P37 AE1 GLY C 84  ? LYS C 87  ? GLY C 1046 LYS C 1049 5 ? 4  
HELX_P HELX_P38 AE2 ASP C 113 ? ARG C 126 ? ASP C 1075 ARG C 1088 1 ? 14 
HELX_P HELX_P39 AE3 ASN C 162 ? ASP C 179 ? ASN C 1124 ASP C 1141 1 ? 18 
HELX_P HELX_P40 AE4 ASP C 179 ? ASP C 197 ? ASP C 1141 ASP C 1159 1 ? 19 
HELX_P HELX_P41 AE5 ASP C 200 ? GLY C 204 ? ASP C 1162 GLY C 1166 5 ? 5  
HELX_P HELX_P42 AE6 SER C 207 ? ARG C 222 ? SER C 1169 ARG C 1184 1 ? 16 
HELX_P HELX_P43 AE7 VAL C 229 ? ILE C 233 ? VAL C 1191 ILE C 1195 5 ? 5  
HELX_P HELX_P44 AE8 GLN C 254 ? ASP C 256 ? GLN C 1216 ASP C 1218 5 ? 3  
HELX_P HELX_P45 AE9 GLU C 257 ? TRP C 262 ? GLU C 1219 TRP C 1224 1 ? 6  
HELX_P HELX_P46 AF1 SER C 271 ? GLU C 286 ? SER C 1233 GLU C 1248 1 ? 16 
HELX_P HELX_P47 AF2 THR C 304 ? GLN C 308 ? THR C 1266 GLN C 1270 1 ? 5  
HELX_P HELX_P48 AF3 SER C 331 ? ILE C 351 ? SER C 1293 ILE C 1313 1 ? 21 
HELX_P HELX_P49 AF4 LYS C 363 ? PHE C 368 ? LYS C 1325 PHE C 1330 1 ? 6  
HELX_P HELX_P50 AF5 ASP C 369 ? THR C 374 ? ASP C 1331 THR C 1336 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 96  OD1 ? ? ? 1_555 D MG  . MG  ? ? A ASP 1058 A MG  1401 1_555 ? ? ? ? ? ? ? 2.059 ? 
metalc2  metalc ? ? A ASP 98  OD2 ? ? ? 1_555 D MG  . MG  ? ? A ASP 1060 A MG  1401 1_555 ? ? ? ? ? ? ? 2.111 ? 
metalc3  metalc ? ? A CYS 385 SG  ? ? ? 1_555 G ZN  . ZN  ? ? A CYS 1347 A ZN  1404 1_555 ? ? ? ? ? ? ? 2.449 ? 
metalc4  metalc ? ? A CYS 388 SG  ? ? ? 1_555 G ZN  . ZN  ? ? A CYS 1350 A ZN  1404 1_555 ? ? ? ? ? ? ? 2.327 ? 
metalc5  metalc ? ? A HIS 393 NE2 ? ? ? 1_555 G ZN  . ZN  ? ? A HIS 1355 A ZN  1404 1_555 ? ? ? ? ? ? ? 2.040 ? 
metalc6  metalc ? ? A CYS 398 SG  ? ? ? 1_555 G ZN  . ZN  ? ? A CYS 1360 A ZN  1404 1_555 ? ? ? ? ? ? ? 2.318 ? 
metalc7  metalc ? ? B ASP 96  OD1 ? ? ? 1_555 J MG  . MG  ? ? B ASP 1058 B MG  1401 1_555 ? ? ? ? ? ? ? 2.017 ? 
metalc8  metalc ? ? B ASP 98  OD2 ? ? ? 1_555 J MG  . MG  ? ? B ASP 1060 B MG  1401 1_555 ? ? ? ? ? ? ? 2.148 ? 
metalc9  metalc ? ? B CYS 385 SG  ? ? ? 1_555 M ZN  . ZN  ? ? B CYS 1347 B ZN  1404 1_555 ? ? ? ? ? ? ? 2.356 ? 
metalc10 metalc ? ? B CYS 388 SG  ? ? ? 1_555 M ZN  . ZN  ? ? B CYS 1350 B ZN  1404 1_555 ? ? ? ? ? ? ? 2.320 ? 
metalc11 metalc ? ? B HIS 393 NE2 ? ? ? 1_555 M ZN  . ZN  ? ? B HIS 1355 B ZN  1404 1_555 ? ? ? ? ? ? ? 2.007 ? 
metalc12 metalc ? ? B CYS 398 SG  ? ? ? 1_555 M ZN  . ZN  ? ? B CYS 1360 B ZN  1404 1_555 ? ? ? ? ? ? ? 2.370 ? 
metalc13 metalc ? ? C ASP 96  OD1 ? ? ? 1_555 O MG  . MG  ? ? C ASP 1058 C MG  1401 1_555 ? ? ? ? ? ? ? 2.070 ? 
metalc14 metalc ? ? C ASP 98  OD2 ? ? ? 1_555 O MG  . MG  ? ? C ASP 1060 C MG  1401 1_555 ? ? ? ? ? ? ? 2.095 ? 
metalc15 metalc ? ? D MG  .   MG  ? ? ? 1_555 E 2KH . O1B ? ? A MG  1401 A 2KH 1402 1_555 ? ? ? ? ? ? ? 2.074 ? 
metalc16 metalc ? ? D MG  .   MG  ? ? ? 1_555 E 2KH . O2A ? ? A MG  1401 A 2KH 1402 1_555 ? ? ? ? ? ? ? 1.997 ? 
metalc17 metalc ? ? D MG  .   MG  ? ? ? 1_555 E 2KH . O3G ? ? A MG  1401 A 2KH 1402 1_555 ? ? ? ? ? ? ? 2.162 ? 
metalc18 metalc ? ? D MG  .   MG  ? ? ? 1_555 S HOH . O   ? ? A MG  1401 A HOH 1512 1_555 ? ? ? ? ? ? ? 1.999 ? 
metalc19 metalc ? ? J MG  .   MG  ? ? ? 1_555 K 2KH . O2B ? ? B MG  1401 B 2KH 1402 1_555 ? ? ? ? ? ? ? 2.022 ? 
metalc20 metalc ? ? J MG  .   MG  ? ? ? 1_555 T HOH . O   ? ? B MG  1401 B HOH 1502 1_555 ? ? ? ? ? ? ? 2.108 ? 
metalc21 metalc ? ? J MG  .   MG  ? ? ? 1_555 K 2KH . O3G ? ? B MG  1401 B 2KH 1402 1_555 ? ? ? ? ? ? ? 2.167 ? 
metalc22 metalc ? ? J MG  .   MG  ? ? ? 1_555 K 2KH . O1A ? ? B MG  1401 B 2KH 1402 1_555 ? ? ? ? ? ? ? 2.178 ? 
metalc23 metalc ? ? O MG  .   MG  ? ? ? 1_555 P 2KH . O1B ? ? C MG  1401 C 2KH 1402 1_555 ? ? ? ? ? ? ? 2.173 ? 
metalc24 metalc ? ? O MG  .   MG  ? ? ? 1_555 P 2KH . O1A ? ? C MG  1401 C 2KH 1402 1_555 ? ? ? ? ? ? ? 2.070 ? 
metalc25 metalc ? ? O MG  .   MG  ? ? ? 1_555 P 2KH . O1G ? ? C MG  1401 C 2KH 1402 1_555 ? ? ? ? ? ? ? 2.100 ? 
metalc26 metalc ? ? O MG  .   MG  ? ? ? 1_555 U HOH . O   ? ? C MG  1401 C HOH 1504 1_555 ? ? ? ? ? ? ? 2.002 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASN 223 A . ? ASN 1185 A PRO 224 A ? PRO 1186 A 1 -3.64  
2 GLY 236 A . ? GLY 1198 A GLU 237 A ? GLU 1199 A 1 1.55   
3 PHE 356 A . ? PHE 1318 A PRO 357 A ? PRO 1319 A 1 -0.59  
4 ASN 223 B . ? ASN 1185 B PRO 224 B ? PRO 1186 B 1 -4.43  
5 GLY 236 B . ? GLY 1198 B GLU 237 B ? GLU 1199 B 1 3.75   
6 GLU 110 C . ? GLU 1072 C GLY 111 C ? GLY 1073 C 1 -11.29 
7 ASN 223 C . ? ASN 1185 C PRO 224 C ? PRO 1186 C 1 -4.48  
8 GLY 236 C . ? GLY 1198 C GLU 237 C ? GLU 1199 C 1 2.68   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 5 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 5 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? parallel      
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? parallel      
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? parallel      
AA7 3 4 ? anti-parallel 
AA7 4 5 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 THR A 78  ? PHE A 83  ? THR A 1040 PHE A 1045 
AA1 2 LEU A 97  ? ILE A 103 ? LEU A 1059 ILE A 1065 
AA1 3 LEU A 154 ? LEU A 160 ? LEU A 1116 LEU A 1122 
AA1 4 ILE A 144 ? HIS A 149 ? ILE A 1106 HIS A 1111 
AA1 5 LEU A 131 ? ILE A 137 ? LEU A 1093 ILE A 1099 
AA2 1 PHE A 243 ? VAL A 244 ? PHE A 1205 VAL A 1206 
AA2 2 TRP A 247 ? ASN A 248 ? TRP A 1209 ASN A 1210 
AA3 1 HIS A 292 ? VAL A 293 ? HIS A 1254 VAL A 1255 
AA3 2 LEU A 302 ? THR A 303 ? LEU A 1264 THR A 1265 
AA4 1 THR B 78  ? PHE B 83  ? THR B 1040 PHE B 1045 
AA4 2 LEU B 97  ? ILE B 103 ? LEU B 1059 ILE B 1065 
AA4 3 LEU B 154 ? LEU B 160 ? LEU B 1116 LEU B 1122 
AA4 4 ILE B 144 ? HIS B 149 ? ILE B 1106 HIS B 1111 
AA4 5 LEU B 131 ? ILE B 137 ? LEU B 1093 ILE B 1099 
AA5 1 PHE B 243 ? VAL B 244 ? PHE B 1205 VAL B 1206 
AA5 2 TRP B 247 ? ASN B 248 ? TRP B 1209 ASN B 1210 
AA6 1 HIS B 292 ? VAL B 293 ? HIS B 1254 VAL B 1255 
AA6 2 LEU B 302 ? THR B 303 ? LEU B 1264 THR B 1265 
AA7 1 THR C 78  ? PHE C 83  ? THR C 1040 PHE C 1045 
AA7 2 LEU C 97  ? ILE C 103 ? LEU C 1059 ILE C 1065 
AA7 3 LEU C 154 ? LEU C 160 ? LEU C 1116 LEU C 1122 
AA7 4 ILE C 144 ? HIS C 149 ? ILE C 1106 HIS C 1111 
AA7 5 LEU C 131 ? ILE C 137 ? LEU C 1093 ILE C 1099 
AA8 1 PHE C 243 ? VAL C 244 ? PHE C 1205 VAL C 1206 
AA8 2 TRP C 247 ? ASN C 248 ? TRP C 1209 ASN C 1210 
AA9 1 HIS C 292 ? VAL C 293 ? HIS C 1254 VAL C 1255 
AA9 2 LEU C 302 ? THR C 303 ? LEU C 1264 THR C 1265 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N SER A 81  ? N SER A 1043 O CYS A 100 ? O CYS A 1062 
AA1 2 3 N MET A 101 ? N MET A 1063 O SER A 159 ? O SER A 1121 
AA1 3 4 O LEU A 154 ? O LEU A 1116 N HIS A 149 ? N HIS A 1111 
AA1 4 5 O ILE A 144 ? O ILE A 1106 N ILE A 137 ? N ILE A 1099 
AA2 1 2 N VAL A 244 ? N VAL A 1206 O TRP A 247 ? O TRP A 1209 
AA3 1 2 N VAL A 293 ? N VAL A 1255 O LEU A 302 ? O LEU A 1264 
AA4 1 2 N LYS B 79  ? N LYS B 1041 O THR B 102 ? O THR B 1064 
AA4 2 3 N MET B 101 ? N MET B 1063 O SER B 159 ? O SER B 1121 
AA4 3 4 O LEU B 154 ? O LEU B 1116 N HIS B 149 ? N HIS B 1111 
AA4 4 5 O ILE B 144 ? O ILE B 1106 N ILE B 137 ? N ILE B 1099 
AA5 1 2 N VAL B 244 ? N VAL B 1206 O TRP B 247 ? O TRP B 1209 
AA6 1 2 N VAL B 293 ? N VAL B 1255 O LEU B 302 ? O LEU B 1264 
AA7 1 2 N SER C 81  ? N SER C 1043 O CYS C 100 ? O CYS C 1062 
AA7 2 3 N LEU C 97  ? N LEU C 1059 O GLU C 155 ? O GLU C 1117 
AA7 3 4 O LEU C 154 ? O LEU C 1116 N HIS C 149 ? N HIS C 1111 
AA7 4 5 O ILE C 144 ? O ILE C 1106 N ILE C 137 ? N ILE C 1099 
AA8 1 2 N VAL C 244 ? N VAL C 1206 O TRP C 247 ? O TRP C 1209 
AA9 1 2 N VAL C 293 ? N VAL C 1255 O LEU C 302 ? O LEU C 1264 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG  1401 ? 4  'binding site for residue MG A 1401'  
AC2 Software A 2KH 1402 ? 26 'binding site for residue 2KH A 1402' 
AC3 Software A UPU 1403 ? 21 'binding site for residue UPU A 1403' 
AC4 Software A ZN  1404 ? 4  'binding site for residue ZN A 1404'  
AC5 Software A IOD 1405 ? 2  'binding site for residue IOD A 1405' 
AC6 Software A SO4 1406 ? 3  'binding site for residue SO4 A 1406' 
AC7 Software B MG  1401 ? 5  'binding site for residue MG B 1401'  
AC8 Software B 2KH 1402 ? 27 'binding site for residue 2KH B 1402' 
AC9 Software B UPU 1403 ? 25 'binding site for residue UPU B 1403' 
AD1 Software B ZN  1404 ? 4  'binding site for residue ZN B 1404'  
AD2 Software B IOD 1405 ? 1  'binding site for residue IOD B 1405' 
AD3 Software C MG  1401 ? 5  'binding site for residue MG C 1401'  
AD4 Software C 2KH 1402 ? 25 'binding site for residue 2KH C 1402' 
AD5 Software C UPU 1403 ? 15 'binding site for residue UPU C 1403' 
AD6 Software C IOD 1404 ? 2  'binding site for residue IOD C 1404' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 4  ASP A 96  ? ASP A 1058 . ? 1_555 ? 
2   AC1 4  ASP A 98  ? ASP A 1060 . ? 1_555 ? 
3   AC1 4  2KH E .   ? 2KH A 1402 . ? 1_555 ? 
4   AC1 4  HOH S .   ? HOH A 1512 . ? 1_555 ? 
5   AC2 26 PHE A 83  ? PHE A 1045 . ? 1_555 ? 
6   AC2 26 GLY A 84  ? GLY A 1046 . ? 1_555 ? 
7   AC2 26 SER A 85  ? SER A 1047 . ? 1_555 ? 
8   AC2 26 ASN A 88  ? ASN A 1050 . ? 1_555 ? 
9   AC2 26 SER A 95  ? SER A 1057 . ? 1_555 ? 
10  AC2 26 ASP A 96  ? ASP A 1058 . ? 1_555 ? 
11  AC2 26 ASP A 98  ? ASP A 1060 . ? 1_555 ? 
12  AC2 26 ALA A 165 ? ALA A 1127 . ? 1_555 ? 
13  AC2 26 ASN A 168 ? ASN A 1130 . ? 1_555 ? 
14  AC2 26 LYS A 190 ? LYS A 1152 . ? 1_555 ? 
15  AC2 26 SER A 208 ? SER A 1170 . ? 1_555 ? 
16  AC2 26 TYR A 209 ? TYR A 1171 . ? 1_555 ? 
17  AC2 26 HIS A 324 ? HIS A 1286 . ? 1_555 ? 
18  AC2 26 LEU A 326 ? LEU A 1288 . ? 1_555 ? 
19  AC2 26 MG  D .   ? MG  A 1401 . ? 1_555 ? 
20  AC2 26 UPU F .   ? UPU A 1403 . ? 1_555 ? 
21  AC2 26 HOH S .   ? HOH A 1506 . ? 1_555 ? 
22  AC2 26 HOH S .   ? HOH A 1507 . ? 1_555 ? 
23  AC2 26 HOH S .   ? HOH A 1511 . ? 1_555 ? 
24  AC2 26 HOH S .   ? HOH A 1512 . ? 1_555 ? 
25  AC2 26 HOH S .   ? HOH A 1513 . ? 1_555 ? 
26  AC2 26 HOH S .   ? HOH A 1520 . ? 1_555 ? 
27  AC2 26 HOH S .   ? HOH A 1523 . ? 1_555 ? 
28  AC2 26 HOH S .   ? HOH A 1544 . ? 1_555 ? 
29  AC2 26 HOH S .   ? HOH A 1555 . ? 1_555 ? 
30  AC2 26 HOH S .   ? HOH A 1558 . ? 1_555 ? 
31  AC3 21 PHE A 83  ? PHE A 1045 . ? 1_555 ? 
32  AC3 21 ASP A 96  ? ASP A 1058 . ? 1_555 ? 
33  AC3 21 ASP A 98  ? ASP A 1060 . ? 1_555 ? 
34  AC3 21 VAL A 142 ? VAL A 1104 . ? 1_555 ? 
35  AC3 21 ILE A 144 ? ILE A 1106 . ? 1_555 ? 
36  AC3 21 ASP A 157 ? ASP A 1119 . ? 1_555 ? 
37  AC3 21 ASN A 162 ? ASN A 1124 . ? 1_555 ? 
38  AC3 21 ALA A 201 ? ALA A 1163 . ? 1_555 ? 
39  AC3 21 SER A 202 ? SER A 1164 . ? 1_555 ? 
40  AC3 21 ILE A 391 ? ILE A 1353 . ? 1_555 ? 
41  AC3 21 GLY A 392 ? GLY A 1354 . ? 1_555 ? 
42  AC3 21 HIS A 393 ? HIS A 1355 . ? 1_555 ? 
43  AC3 21 2KH E .   ? 2KH A 1402 . ? 1_555 ? 
44  AC3 21 HOH S .   ? HOH A 1513 . ? 1_555 ? 
45  AC3 21 HOH S .   ? HOH A 1519 . ? 1_555 ? 
46  AC3 21 HOH S .   ? HOH A 1529 . ? 1_555 ? 
47  AC3 21 HOH S .   ? HOH A 1530 . ? 1_555 ? 
48  AC3 21 HOH S .   ? HOH A 1547 . ? 1_555 ? 
49  AC3 21 HOH S .   ? HOH A 1549 . ? 1_555 ? 
50  AC3 21 HOH S .   ? HOH A 1564 . ? 1_555 ? 
51  AC3 21 HOH S .   ? HOH A 1569 . ? 1_555 ? 
52  AC4 4  CYS A 385 ? CYS A 1347 . ? 1_555 ? 
53  AC4 4  CYS A 388 ? CYS A 1350 . ? 1_555 ? 
54  AC4 4  HIS A 393 ? HIS A 1355 . ? 1_555 ? 
55  AC4 4  CYS A 398 ? CYS A 1360 . ? 1_555 ? 
56  AC5 2  SER A 331 ? SER A 1293 . ? 1_555 ? 
57  AC5 2  ASP A 382 ? ASP A 1344 . ? 1_555 ? 
58  AC6 3  ARG A 132 ? ARG A 1094 . ? 1_555 ? 
59  AC6 3  ARG B 132 ? ARG B 1094 . ? 1_555 ? 
60  AC6 3  ARG C 132 ? ARG C 1094 . ? 1_555 ? 
61  AC7 5  SER B 85  ? SER B 1047 . ? 1_555 ? 
62  AC7 5  ASP B 96  ? ASP B 1058 . ? 1_555 ? 
63  AC7 5  ASP B 98  ? ASP B 1060 . ? 1_555 ? 
64  AC7 5  2KH K .   ? 2KH B 1402 . ? 1_555 ? 
65  AC7 5  HOH T .   ? HOH B 1502 . ? 1_555 ? 
66  AC8 27 PHE B 83  ? PHE B 1045 . ? 1_555 ? 
67  AC8 27 GLY B 84  ? GLY B 1046 . ? 1_555 ? 
68  AC8 27 SER B 85  ? SER B 1047 . ? 1_555 ? 
69  AC8 27 ASN B 88  ? ASN B 1050 . ? 1_555 ? 
70  AC8 27 SER B 95  ? SER B 1057 . ? 1_555 ? 
71  AC8 27 ASP B 96  ? ASP B 1058 . ? 1_555 ? 
72  AC8 27 ASP B 98  ? ASP B 1060 . ? 1_555 ? 
73  AC8 27 ALA B 165 ? ALA B 1127 . ? 1_555 ? 
74  AC8 27 ASN B 168 ? ASN B 1130 . ? 1_555 ? 
75  AC8 27 THR B 169 ? THR B 1131 . ? 1_555 ? 
76  AC8 27 LYS B 190 ? LYS B 1152 . ? 1_555 ? 
77  AC8 27 SER B 208 ? SER B 1170 . ? 1_555 ? 
78  AC8 27 TYR B 209 ? TYR B 1171 . ? 1_555 ? 
79  AC8 27 HIS B 324 ? HIS B 1286 . ? 1_555 ? 
80  AC8 27 LEU B 326 ? LEU B 1288 . ? 1_555 ? 
81  AC8 27 MG  J .   ? MG  B 1401 . ? 1_555 ? 
82  AC8 27 UPU L .   ? UPU B 1403 . ? 1_555 ? 
83  AC8 27 HOH T .   ? HOH B 1505 . ? 1_555 ? 
84  AC8 27 HOH T .   ? HOH B 1509 . ? 1_555 ? 
85  AC8 27 HOH T .   ? HOH B 1515 . ? 1_555 ? 
86  AC8 27 HOH T .   ? HOH B 1518 . ? 1_555 ? 
87  AC8 27 HOH T .   ? HOH B 1523 . ? 1_555 ? 
88  AC8 27 HOH T .   ? HOH B 1524 . ? 1_555 ? 
89  AC8 27 HOH T .   ? HOH B 1525 . ? 1_555 ? 
90  AC8 27 HOH T .   ? HOH B 1558 . ? 1_555 ? 
91  AC8 27 HOH T .   ? HOH B 1571 . ? 1_555 ? 
92  AC8 27 HOH T .   ? HOH B 1573 . ? 1_555 ? 
93  AC9 25 PHE B 83  ? PHE B 1045 . ? 1_555 ? 
94  AC9 25 ASP B 96  ? ASP B 1058 . ? 1_555 ? 
95  AC9 25 ASP B 98  ? ASP B 1060 . ? 1_555 ? 
96  AC9 25 ILE B 137 ? ILE B 1099 . ? 1_555 ? 
97  AC9 25 THR B 139 ? THR B 1101 . ? 1_555 ? 
98  AC9 25 ALA B 140 ? ALA B 1102 . ? 1_555 ? 
99  AC9 25 VAL B 142 ? VAL B 1104 . ? 1_555 ? 
100 AC9 25 ILE B 144 ? ILE B 1106 . ? 1_555 ? 
101 AC9 25 ASP B 157 ? ASP B 1119 . ? 1_555 ? 
102 AC9 25 ASN B 162 ? ASN B 1124 . ? 1_555 ? 
103 AC9 25 ALA B 201 ? ALA B 1163 . ? 1_555 ? 
104 AC9 25 SER B 202 ? SER B 1164 . ? 1_555 ? 
105 AC9 25 LYS B 390 ? LYS B 1352 . ? 1_555 ? 
106 AC9 25 ILE B 391 ? ILE B 1353 . ? 1_555 ? 
107 AC9 25 GLY B 392 ? GLY B 1354 . ? 1_555 ? 
108 AC9 25 HIS B 393 ? HIS B 1355 . ? 1_555 ? 
109 AC9 25 2KH K .   ? 2KH B 1402 . ? 1_555 ? 
110 AC9 25 HOH T .   ? HOH B 1514 . ? 1_555 ? 
111 AC9 25 HOH T .   ? HOH B 1516 . ? 1_555 ? 
112 AC9 25 HOH T .   ? HOH B 1518 . ? 1_555 ? 
113 AC9 25 HOH T .   ? HOH B 1523 . ? 1_555 ? 
114 AC9 25 HOH T .   ? HOH B 1527 . ? 1_555 ? 
115 AC9 25 HOH T .   ? HOH B 1534 . ? 1_555 ? 
116 AC9 25 HOH T .   ? HOH B 1544 . ? 1_555 ? 
117 AC9 25 HOH T .   ? HOH B 1547 . ? 1_555 ? 
118 AD1 4  CYS B 385 ? CYS B 1347 . ? 1_555 ? 
119 AD1 4  CYS B 388 ? CYS B 1350 . ? 1_555 ? 
120 AD1 4  HIS B 393 ? HIS B 1355 . ? 1_555 ? 
121 AD1 4  CYS B 398 ? CYS B 1360 . ? 1_555 ? 
122 AD2 1  SER B 331 ? SER B 1293 . ? 1_555 ? 
123 AD3 5  SER C 85  ? SER C 1047 . ? 1_555 ? 
124 AD3 5  ASP C 96  ? ASP C 1058 . ? 1_555 ? 
125 AD3 5  ASP C 98  ? ASP C 1060 . ? 1_555 ? 
126 AD3 5  2KH P .   ? 2KH C 1402 . ? 1_555 ? 
127 AD3 5  HOH U .   ? HOH C 1504 . ? 1_555 ? 
128 AD4 25 PHE C 83  ? PHE C 1045 . ? 1_555 ? 
129 AD4 25 GLY C 84  ? GLY C 1046 . ? 1_555 ? 
130 AD4 25 SER C 85  ? SER C 1047 . ? 1_555 ? 
131 AD4 25 ASN C 88  ? ASN C 1050 . ? 1_555 ? 
132 AD4 25 SER C 95  ? SER C 1057 . ? 1_555 ? 
133 AD4 25 ASP C 96  ? ASP C 1058 . ? 1_555 ? 
134 AD4 25 ASP C 98  ? ASP C 1060 . ? 1_555 ? 
135 AD4 25 ASN C 168 ? ASN C 1130 . ? 1_555 ? 
136 AD4 25 THR C 169 ? THR C 1131 . ? 1_555 ? 
137 AD4 25 LYS C 190 ? LYS C 1152 . ? 1_555 ? 
138 AD4 25 SER C 208 ? SER C 1170 . ? 1_555 ? 
139 AD4 25 TYR C 209 ? TYR C 1171 . ? 1_555 ? 
140 AD4 25 HIS C 324 ? HIS C 1286 . ? 1_555 ? 
141 AD4 25 LEU C 326 ? LEU C 1288 . ? 1_555 ? 
142 AD4 25 MG  O .   ? MG  C 1401 . ? 1_555 ? 
143 AD4 25 UPU Q .   ? UPU C 1403 . ? 1_555 ? 
144 AD4 25 HOH U .   ? HOH C 1501 . ? 1_555 ? 
145 AD4 25 HOH U .   ? HOH C 1504 . ? 1_555 ? 
146 AD4 25 HOH U .   ? HOH C 1509 . ? 1_555 ? 
147 AD4 25 HOH U .   ? HOH C 1511 . ? 1_555 ? 
148 AD4 25 HOH U .   ? HOH C 1513 . ? 1_555 ? 
149 AD4 25 HOH U .   ? HOH C 1517 . ? 1_555 ? 
150 AD4 25 HOH U .   ? HOH C 1518 . ? 1_555 ? 
151 AD4 25 HOH U .   ? HOH C 1520 . ? 1_555 ? 
152 AD4 25 HOH U .   ? HOH C 1538 . ? 1_555 ? 
153 AD5 15 PHE C 83  ? PHE C 1045 . ? 1_555 ? 
154 AD5 15 ASP C 96  ? ASP C 1058 . ? 1_555 ? 
155 AD5 15 ASP C 98  ? ASP C 1060 . ? 1_555 ? 
156 AD5 15 ILE C 137 ? ILE C 1099 . ? 1_555 ? 
157 AD5 15 THR C 139 ? THR C 1101 . ? 1_555 ? 
158 AD5 15 VAL C 142 ? VAL C 1104 . ? 1_555 ? 
159 AD5 15 ILE C 144 ? ILE C 1106 . ? 1_555 ? 
160 AD5 15 ASP C 157 ? ASP C 1119 . ? 1_555 ? 
161 AD5 15 ASN C 162 ? ASN C 1124 . ? 1_555 ? 
162 AD5 15 ALA C 201 ? ALA C 1163 . ? 1_555 ? 
163 AD5 15 SER C 202 ? SER C 1164 . ? 1_555 ? 
164 AD5 15 2KH P .   ? 2KH C 1402 . ? 1_555 ? 
165 AD5 15 HOH U .   ? HOH C 1507 . ? 1_555 ? 
166 AD5 15 HOH U .   ? HOH C 1513 . ? 1_555 ? 
167 AD5 15 HOH U .   ? HOH C 1530 . ? 1_555 ? 
168 AD6 2  SER C 331 ? SER C 1293 . ? 1_555 ? 
169 AD6 2  ASP C 382 ? ASP C 1344 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5W0N 
_atom_sites.fract_transf_matrix[1][1]   0.007354 
_atom_sites.fract_transf_matrix[1][2]   0.004246 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008492 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005507 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
H  
I  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N      . ILE A 1 23  ? -57.207  58.533  -37.213 1.00 136.43 ? 985  ILE A N      1 
ATOM   2     C  CA     . ILE A 1 23  ? -58.264  57.807  -36.523 1.00 131.76 ? 985  ILE A CA     1 
ATOM   3     C  C      . ILE A 1 23  ? -59.599  58.515  -36.734 1.00 126.51 ? 985  ILE A C      1 
ATOM   4     O  O      . ILE A 1 23  ? -59.735  59.701  -36.432 1.00 127.20 ? 985  ILE A O      1 
ATOM   5     C  CB     . ILE A 1 23  ? -57.962  57.666  -35.017 1.00 128.80 ? 985  ILE A CB     1 
ATOM   6     C  CG1    . ILE A 1 23  ? -56.562  57.081  -34.797 1.00 132.80 ? 985  ILE A CG1    1 
ATOM   7     C  CG2    . ILE A 1 23  ? -59.014  56.787  -34.347 1.00 124.49 ? 985  ILE A CG2    1 
ATOM   8     C  CD1    . ILE A 1 23  ? -56.094  57.127  -33.352 1.00 128.56 ? 985  ILE A CD1    1 
ATOM   9     H  HA     . ILE A 1 23  ? -58.334  56.915  -36.899 1.00 158.11 ? 985  ILE A HA     1 
ATOM   10    H  HB     . ILE A 1 23  ? -57.994  58.547  -34.613 1.00 154.56 ? 985  ILE A HB     1 
ATOM   11    H  HG12   . ILE A 1 23  ? -56.564  56.153  -35.078 1.00 159.36 ? 985  ILE A HG12   1 
ATOM   12    H  HG13   . ILE A 1 23  ? -55.926  57.584  -35.330 1.00 159.36 ? 985  ILE A HG13   1 
ATOM   13    H  HG21   . ILE A 1 23  ? -58.807  56.711  -33.402 1.00 149.38 ? 985  ILE A HG21   1 
ATOM   14    H  HG22   . ILE A 1 23  ? -59.887  57.195  -34.462 1.00 149.38 ? 985  ILE A HG22   1 
ATOM   15    H  HG23   . ILE A 1 23  ? -59.002  55.909  -34.760 1.00 149.38 ? 985  ILE A HG23   1 
ATOM   16    H  HD11   . ILE A 1 23  ? -55.206  56.741  -33.296 1.00 154.27 ? 985  ILE A HD11   1 
ATOM   17    H  HD12   . ILE A 1 23  ? -56.073  58.050  -33.057 1.00 154.27 ? 985  ILE A HD12   1 
ATOM   18    H  HD13   . ILE A 1 23  ? -56.712  56.617  -32.805 1.00 154.27 ? 985  ILE A HD13   1 
ATOM   19    N  N      . GLN A 1 24  ? -60.581  57.783  -37.250 1.00 119.72 ? 986  GLN A N      1 
ATOM   20    C  CA     . GLN A 1 24  ? -61.923  58.305  -37.456 1.00 109.89 ? 986  GLN A CA     1 
ATOM   21    C  C      . GLN A 1 24  ? -62.808  57.924  -36.276 1.00 100.71 ? 986  GLN A C      1 
ATOM   22    O  O      . GLN A 1 24  ? -62.586  56.907  -35.616 1.00 104.59 ? 986  GLN A O      1 
ATOM   23    C  CB     . GLN A 1 24  ? -62.524  57.768  -38.754 1.00 114.05 ? 986  GLN A CB     1 
ATOM   24    C  CG     . GLN A 1 24  ? -61.558  57.766  -39.921 1.00 119.30 ? 986  GLN A CG     1 
ATOM   25    C  CD     . GLN A 1 24  ? -62.188  57.232  -41.184 1.00 123.98 ? 986  GLN A CD     1 
ATOM   26    O  OE1    . GLN A 1 24  ? -63.334  57.550  -41.503 1.00 121.59 ? 986  GLN A OE1    1 
ATOM   27    N  NE2    . GLN A 1 24  ? -61.445  56.405  -41.910 1.00 129.68 ? 986  GLN A NE2    1 
ATOM   28    H  H      . GLN A 1 24  ? -60.490  56.963  -37.493 1.00 143.67 ? 986  GLN A H      1 
ATOM   29    H  HA     . GLN A 1 24  ? -61.887  59.273  -37.512 1.00 131.86 ? 986  GLN A HA     1 
ATOM   30    H  HB2    . GLN A 1 24  ? -62.815  56.854  -38.609 1.00 136.86 ? 986  GLN A HB2    1 
ATOM   31    H  HB3    . GLN A 1 24  ? -63.284  58.319  -38.998 1.00 136.86 ? 986  GLN A HB3    1 
ATOM   32    H  HG2    . GLN A 1 24  ? -61.265  58.675  -40.091 1.00 143.16 ? 986  GLN A HG2    1 
ATOM   33    H  HG3    . GLN A 1 24  ? -60.798  57.205  -39.703 1.00 143.16 ? 986  GLN A HG3    1 
ATOM   34    H  HE21   . GLN A 1 24  ? -60.651  56.201  -41.650 1.00 155.61 ? 986  GLN A HE21   1 
ATOM   35    H  HE22   . GLN A 1 24  ? -61.758  56.073  -42.639 1.00 155.61 ? 986  GLN A HE22   1 
ATOM   36    N  N      . LEU A 1 25  ? -63.823  58.748  -36.019 1.00 84.17  ? 987  LEU A N      1 
ATOM   37    C  CA     . LEU A 1 25  ? -64.629  58.625  -34.815 1.00 71.37  ? 987  LEU A CA     1 
ATOM   38    C  C      . LEU A 1 25  ? -66.086  58.338  -35.155 1.00 72.26  ? 987  LEU A C      1 
ATOM   39    O  O      . LEU A 1 25  ? -66.604  58.781  -36.183 1.00 67.32  ? 987  LEU A O      1 
ATOM   40    C  CB     . LEU A 1 25  ? -64.549  59.906  -33.976 1.00 64.17  ? 987  LEU A CB     1 
ATOM   41    C  CG     . LEU A 1 25  ? -63.160  60.310  -33.476 1.00 64.50  ? 987  LEU A CG     1 
ATOM   42    C  CD1    . LEU A 1 25  ? -63.259  61.561  -32.616 1.00 61.68  ? 987  LEU A CD1    1 
ATOM   43    C  CD2    . LEU A 1 25  ? -62.491  59.178  -32.712 1.00 67.49  ? 987  LEU A CD2    1 
ATOM   44    H  H      . LEU A 1 25  ? -64.064  59.393  -36.535 1.00 101.01 ? 987  LEU A H      1 
ATOM   45    H  HA     . LEU A 1 25  ? -64.292  57.890  -34.279 1.00 85.64  ? 987  LEU A HA     1 
ATOM   46    H  HB2    . LEU A 1 25  ? -64.885  60.641  -34.513 1.00 77.01  ? 987  LEU A HB2    1 
ATOM   47    H  HB3    . LEU A 1 25  ? -65.114  59.794  -33.196 1.00 77.01  ? 987  LEU A HB3    1 
ATOM   48    H  HG     . LEU A 1 25  ? -62.603  60.521  -34.241 1.00 77.40  ? 987  LEU A HG     1 
ATOM   49    H  HD11   . LEU A 1 25  ? -62.371  61.802  -32.308 1.00 74.02  ? 987  LEU A HD11   1 
ATOM   50    H  HD12   . LEU A 1 25  ? -63.631  62.281  -33.148 1.00 74.02  ? 987  LEU A HD12   1 
ATOM   51    H  HD13   . LEU A 1 25  ? -63.834  61.377  -31.857 1.00 74.02  ? 987  LEU A HD13   1 
ATOM   52    H  HD21   . LEU A 1 25  ? -61.616  59.474  -32.413 1.00 80.99  ? 987  LEU A HD21   1 
ATOM   53    H  HD22   . LEU A 1 25  ? -63.041  58.945  -31.948 1.00 80.99  ? 987  LEU A HD22   1 
ATOM   54    H  HD23   . LEU A 1 25  ? -62.398  58.412  -33.300 1.00 80.99  ? 987  LEU A HD23   1 
ATOM   55    N  N      . GLU A 1 26  ? -66.744  57.615  -34.257 1.00 90.18  ? 988  GLU A N      1 
ATOM   56    C  CA     . GLU A 1 26  ? -68.156  57.311  -34.426 1.00 90.78  ? 988  GLU A CA     1 
ATOM   57    C  C      . GLU A 1 26  ? -68.973  58.601  -34.464 1.00 84.37  ? 988  GLU A C      1 
ATOM   58    O  O      . GLU A 1 26  ? -68.715  59.520  -33.677 1.00 84.59  ? 988  GLU A O      1 
ATOM   59    C  CB     . GLU A 1 26  ? -68.661  56.427  -33.284 1.00 93.60  ? 988  GLU A CB     1 
ATOM   60    C  CG     . GLU A 1 26  ? -67.849  55.174  -33.033 1.00 98.40  ? 988  GLU A CG     1 
ATOM   61    C  CD     . GLU A 1 26  ? -68.336  54.417  -31.815 1.00 99.19  ? 988  GLU A CD     1 
ATOM   62    O  OE1    . GLU A 1 26  ? -69.566  54.371  -31.598 1.00 97.50  ? 988  GLU A OE1    1 
ATOM   63    O  OE2    . GLU A 1 26  ? -67.491  53.876  -31.072 1.00 102.39 1 988  GLU A OE2    1 
ATOM   64    H  H      . GLU A 1 26  ? -66.395  57.289  -33.541 1.00 108.21 ? 988  GLU A H      1 
ATOM   65    H  HA     . GLU A 1 26  ? -68.287  56.838  -35.263 1.00 108.94 ? 988  GLU A HA     1 
ATOM   66    H  HB2    . GLU A 1 26  ? -68.655  56.948  -32.466 1.00 112.32 ? 988  GLU A HB2    1 
ATOM   67    H  HB3    . GLU A 1 26  ? -69.569  56.151  -33.487 1.00 112.32 ? 988  GLU A HB3    1 
ATOM   68    H  HG2    . GLU A 1 26  ? -67.921  54.588  -33.803 1.00 118.08 ? 988  GLU A HG2    1 
ATOM   69    H  HG3    . GLU A 1 26  ? -66.922  55.419  -32.886 1.00 118.08 ? 988  GLU A HG3    1 
ATOM   70    N  N      . PRO A 1 27  ? -69.965  58.707  -35.347 1.00 77.88  ? 989  PRO A N      1 
ATOM   71    C  CA     . PRO A 1 27  ? -70.885  59.847  -35.267 1.00 72.57  ? 989  PRO A CA     1 
ATOM   72    C  C      . PRO A 1 27  ? -71.731  59.749  -34.007 1.00 65.67  ? 989  PRO A C      1 
ATOM   73    O  O      . PRO A 1 27  ? -72.123  58.658  -33.587 1.00 66.90  ? 989  PRO A O      1 
ATOM   74    C  CB     . PRO A 1 27  ? -71.734  59.714  -36.536 1.00 72.67  ? 989  PRO A CB     1 
ATOM   75    C  CG     . PRO A 1 27  ? -71.701  58.259  -36.849 1.00 76.11  ? 989  PRO A CG     1 
ATOM   76    C  CD     . PRO A 1 27  ? -70.338  57.778  -36.430 1.00 78.23  ? 989  PRO A CD     1 
ATOM   77    H  HA     . PRO A 1 27  ? -70.400  60.687  -35.278 1.00 87.09  ? 989  PRO A HA     1 
ATOM   78    H  HB2    . PRO A 1 27  ? -72.641  60.009  -36.358 1.00 87.21  ? 989  PRO A HB2    1 
ATOM   79    H  HB3    . PRO A 1 27  ? -71.336  60.231  -37.254 1.00 87.21  ? 989  PRO A HB3    1 
ATOM   80    H  HG2    . PRO A 1 27  ? -72.393  57.803  -36.345 1.00 91.33  ? 989  PRO A HG2    1 
ATOM   81    H  HG3    . PRO A 1 27  ? -71.831  58.129  -37.801 1.00 91.33  ? 989  PRO A HG3    1 
ATOM   82    H  HD2    . PRO A 1 27  ? -70.389  56.870  -36.094 1.00 93.88  ? 989  PRO A HD2    1 
ATOM   83    H  HD3    . PRO A 1 27  ? -69.713  57.850  -37.168 1.00 93.88  ? 989  PRO A HD3    1 
ATOM   84    N  N      . LEU A 1 28  ? -72.008  60.902  -33.401 1.00 59.69  ? 990  LEU A N      1 
ATOM   85    C  CA     . LEU A 1 28  ? -72.754  60.884  -32.146 1.00 56.69  ? 990  LEU A CA     1 
ATOM   86    C  C      . LEU A 1 28  ? -74.253  60.967  -32.423 1.00 54.98  ? 990  LEU A C      1 
ATOM   87    O  O      . LEU A 1 28  ? -74.681  61.797  -33.233 1.00 56.27  ? 990  LEU A O      1 
ATOM   88    C  CB     . LEU A 1 28  ? -72.324  62.037  -31.251 1.00 51.93  ? 990  LEU A CB     1 
ATOM   89    C  CG     . LEU A 1 28  ? -70.877  61.965  -30.748 1.00 52.76  ? 990  LEU A CG     1 
ATOM   90    C  CD1    . LEU A 1 28  ? -70.552  63.176  -29.887 1.00 54.56  ? 990  LEU A CD1    1 
ATOM   91    C  CD2    . LEU A 1 28  ? -70.598  60.674  -29.976 1.00 53.63  ? 990  LEU A CD2    1 
ATOM   92    H  H      . LEU A 1 28  ? -71.785  61.683  -33.684 1.00 71.63  ? 990  LEU A H      1 
ATOM   93    H  HA     . LEU A 1 28  ? -72.576  60.052  -31.679 1.00 68.02  ? 990  LEU A HA     1 
ATOM   94    H  HB2    . LEU A 1 28  ? -72.420  62.864  -31.747 1.00 62.32  ? 990  LEU A HB2    1 
ATOM   95    H  HB3    . LEU A 1 28  ? -72.903  62.056  -30.473 1.00 62.32  ? 990  LEU A HB3    1 
ATOM   96    H  HG     . LEU A 1 28  ? -70.283  61.983  -31.514 1.00 63.31  ? 990  LEU A HG     1 
ATOM   97    H  HD11   . LEU A 1 28  ? -69.634  63.108  -29.582 1.00 65.48  ? 990  LEU A HD11   1 
ATOM   98    H  HD12   . LEU A 1 28  ? -70.666  63.980  -30.419 1.00 65.48  ? 990  LEU A HD12   1 
ATOM   99    H  HD13   . LEU A 1 28  ? -71.154  63.193  -29.127 1.00 65.48  ? 990  LEU A HD13   1 
ATOM   100   H  HD21   . LEU A 1 28  ? -69.674  60.677  -29.681 1.00 64.36  ? 990  LEU A HD21   1 
ATOM   101   H  HD22   . LEU A 1 28  ? -71.191  60.630  -29.210 1.00 64.36  ? 990  LEU A HD22   1 
ATOM   102   H  HD23   . LEU A 1 28  ? -70.756  59.917  -30.562 1.00 64.36  ? 990  LEU A HD23   1 
ATOM   103   N  N      . PRO A 1 29  ? -75.074  60.129  -31.780 1.00 54.34  ? 991  PRO A N      1 
ATOM   104   C  CA     . PRO A 1 29  ? -76.514  60.203  -32.017 1.00 54.40  ? 991  PRO A CA     1 
ATOM   105   C  C      . PRO A 1 29  ? -77.118  61.416  -31.336 1.00 54.17  ? 991  PRO A C      1 
ATOM   106   O  O      . PRO A 1 29  ? -76.573  61.923  -30.341 1.00 53.85  ? 991  PRO A O      1 
ATOM   107   C  CB     . PRO A 1 29  ? -77.038  58.896  -31.392 1.00 56.44  ? 991  PRO A CB     1 
ATOM   108   C  CG     . PRO A 1 29  ? -76.066  58.611  -30.305 1.00 55.41  ? 991  PRO A CG     1 
ATOM   109   C  CD     . PRO A 1 29  ? -74.730  59.079  -30.806 1.00 53.12  ? 991  PRO A CD     1 
ATOM   110   H  HA     . PRO A 1 29  ? -76.711  60.220  -32.966 1.00 65.28  ? 991  PRO A HA     1 
ATOM   111   H  HB2    . PRO A 1 29  ? -77.929  59.035  -31.033 1.00 67.72  ? 991  PRO A HB2    1 
ATOM   112   H  HB3    . PRO A 1 29  ? -77.035  58.188  -32.055 1.00 67.72  ? 991  PRO A HB3    1 
ATOM   113   H  HG2    . PRO A 1 29  ? -76.320  59.100  -29.507 1.00 66.50  ? 991  PRO A HG2    1 
ATOM   114   H  HG3    . PRO A 1 29  ? -76.048  57.657  -30.129 1.00 66.50  ? 991  PRO A HG3    1 
ATOM   115   H  HD2    . PRO A 1 29  ? -74.208  59.452  -30.079 1.00 63.74  ? 991  PRO A HD2    1 
ATOM   116   H  HD3    . PRO A 1 29  ? -74.260  58.353  -31.245 1.00 63.74  ? 991  PRO A HD3    1 
ATOM   117   N  N      . PRO A 1 30  ? -78.248  61.918  -31.835 1.00 53.64  ? 992  PRO A N      1 
ATOM   118   C  CA     . PRO A 1 30  ? -78.879  63.069  -31.181 1.00 51.45  ? 992  PRO A CA     1 
ATOM   119   C  C      . PRO A 1 30  ? -79.361  62.718  -29.778 1.00 50.14  ? 992  PRO A C      1 
ATOM   120   O  O      . PRO A 1 30  ? -79.845  61.614  -29.520 1.00 51.20  ? 992  PRO A O      1 
ATOM   121   C  CB     . PRO A 1 30  ? -80.040  63.421  -32.120 1.00 53.94  ? 992  PRO A CB     1 
ATOM   122   C  CG     . PRO A 1 30  ? -80.301  62.177  -32.892 1.00 57.27  ? 992  PRO A CG     1 
ATOM   123   C  CD     . PRO A 1 30  ? -78.972  61.508  -33.048 1.00 53.98  ? 992  PRO A CD     1 
ATOM   124   H  HA     . PRO A 1 30  ? -78.261  63.815  -31.135 1.00 61.74  ? 992  PRO A HA     1 
ATOM   125   H  HB2    . PRO A 1 30  ? -80.819  63.670  -31.598 1.00 64.73  ? 992  PRO A HB2    1 
ATOM   126   H  HB3    . PRO A 1 30  ? -79.776  64.143  -32.711 1.00 64.73  ? 992  PRO A HB3    1 
ATOM   127   H  HG2    . PRO A 1 30  ? -80.913  61.610  -32.398 1.00 68.73  ? 992  PRO A HG2    1 
ATOM   128   H  HG3    . PRO A 1 30  ? -80.671  62.405  -33.759 1.00 68.73  ? 992  PRO A HG3    1 
ATOM   129   H  HD2    . PRO A 1 30  ? -79.079  60.544  -33.070 1.00 64.77  ? 992  PRO A HD2    1 
ATOM   130   H  HD3    . PRO A 1 30  ? -78.519  61.835  -33.840 1.00 64.77  ? 992  PRO A HD3    1 
ATOM   131   N  N      . LEU A 1 31  ? -79.214  63.677  -28.871 1.00 52.36  ? 993  LEU A N      1 
ATOM   132   C  CA     . LEU A 1 31  ? -79.575  63.533  -27.468 1.00 50.59  ? 993  LEU A CA     1 
ATOM   133   C  C      . LEU A 1 31  ? -80.999  64.003  -27.181 1.00 52.29  ? 993  LEU A C      1 
ATOM   134   O  O      . LEU A 1 31  ? -81.569  64.817  -27.912 1.00 54.25  ? 993  LEU A O      1 
ATOM   135   C  CB     . LEU A 1 31  ? -78.581  64.304  -26.602 1.00 50.75  ? 993  LEU A CB     1 
ATOM   136   C  CG     . LEU A 1 31  ? -77.135  63.799  -26.706 1.00 52.33  ? 993  LEU A CG     1 
ATOM   137   C  CD1    . LEU A 1 31  ? -76.230  64.542  -25.741 1.00 48.70  ? 993  LEU A CD1    1 
ATOM   138   C  CD2    . LEU A 1 31  ? -77.019  62.283  -26.507 1.00 53.23  ? 993  LEU A CD2    1 
ATOM   139   H  H      . LEU A 1 31  ? -78.893  64.454  -29.055 1.00 62.83  ? 993  LEU A H      1 
ATOM   140   H  HA     . LEU A 1 31  ? -79.517  62.596  -27.225 1.00 60.71  ? 993  LEU A HA     1 
ATOM   141   H  HB2    . LEU A 1 31  ? -78.588  65.236  -26.873 1.00 60.90  ? 993  LEU A HB2    1 
ATOM   142   H  HB3    . LEU A 1 31  ? -78.853  64.231  -25.674 1.00 60.90  ? 993  LEU A HB3    1 
ATOM   143   H  HG     . LEU A 1 31  ? -76.815  63.992  -27.601 1.00 62.79  ? 993  LEU A HG     1 
ATOM   144   H  HD11   . LEU A 1 31  ? -75.326  64.201  -25.830 1.00 58.45  ? 993  LEU A HD11   1 
ATOM   145   H  HD12   . LEU A 1 31  ? -76.250  65.488  -25.955 1.00 58.45  ? 993  LEU A HD12   1 
ATOM   146   H  HD13   . LEU A 1 31  ? -76.550  64.401  -24.836 1.00 58.45  ? 993  LEU A HD13   1 
ATOM   147   H  HD21   . LEU A 1 31  ? -76.086  62.026  -26.584 1.00 63.88  ? 993  LEU A HD21   1 
ATOM   148   H  HD22   . LEU A 1 31  ? -77.354  62.054  -25.626 1.00 63.88  ? 993  LEU A HD22   1 
ATOM   149   H  HD23   . LEU A 1 31  ? -77.543  61.834  -27.188 1.00 63.88  ? 993  LEU A HD23   1 
ATOM   150   N  N      . THR A 1 32  ? -81.583  63.449  -26.117 1.00 53.22  ? 994  THR A N      1 
ATOM   151   C  CA     . THR A 1 32  ? -82.849  63.914  -25.568 1.00 55.59  ? 994  THR A CA     1 
ATOM   152   C  C      . THR A 1 32  ? -82.600  64.844  -24.389 1.00 55.97  ? 994  THR A C      1 
ATOM   153   O  O      . THR A 1 32  ? -81.550  64.779  -23.743 1.00 54.69  ? 994  THR A O      1 
ATOM   154   C  CB     . THR A 1 32  ? -83.710  62.738  -25.098 1.00 56.19  ? 994  THR A CB     1 
ATOM   155   O  OG1    . THR A 1 32  ? -83.024  62.013  -24.071 1.00 58.10  ? 994  THR A OG1    1 
ATOM   156   C  CG2    . THR A 1 32  ? -84.011  61.808  -26.238 1.00 60.42  ? 994  THR A CG2    1 
ATOM   157   H  H      . THR A 1 32  ? -81.250  62.783  -25.687 1.00 63.87  ? 994  THR A H      1 
ATOM   158   H  HA     . THR A 1 32  ? -83.338  64.402  -26.249 1.00 66.71  ? 994  THR A HA     1 
ATOM   159   H  HB     . THR A 1 32  ? -84.550  63.074  -24.748 1.00 67.42  ? 994  THR A HB     1 
ATOM   160   H  HG1    . THR A 1 32  ? -83.494  61.368  -23.812 1.00 69.73  ? 994  THR A HG1    1 
ATOM   161   H  HG21   . THR A 1 32  ? -84.557  61.069  -25.927 1.00 72.50  ? 994  THR A HG21   1 
ATOM   162   H  HG22   . THR A 1 32  ? -84.491  62.283  -26.935 1.00 72.50  ? 994  THR A HG22   1 
ATOM   163   H  HG23   . THR A 1 32  ? -83.185  61.457  -26.606 1.00 72.50  ? 994  THR A HG23   1 
ATOM   164   N  N      . PRO A 1 33  ? -83.544  65.737  -24.076 1.00 56.70  ? 995  PRO A N      1 
ATOM   165   C  CA     . PRO A 1 33  ? -83.377  66.558  -22.863 1.00 54.92  ? 995  PRO A CA     1 
ATOM   166   C  C      . PRO A 1 33  ? -83.220  65.732  -21.600 1.00 56.97  ? 995  PRO A C      1 
ATOM   167   O  O      . PRO A 1 33  ? -82.486  66.134  -20.688 1.00 56.30  ? 995  PRO A O      1 
ATOM   168   C  CB     . PRO A 1 33  ? -84.654  67.411  -22.833 1.00 57.59  ? 995  PRO A CB     1 
ATOM   169   C  CG     . PRO A 1 33  ? -85.173  67.385  -24.233 1.00 60.91  ? 995  PRO A CG     1 
ATOM   170   C  CD     . PRO A 1 33  ? -84.788  66.057  -24.796 1.00 57.44  ? 995  PRO A CD     1 
ATOM   171   H  HA     . PRO A 1 33  ? -82.608  67.142  -22.959 1.00 65.91  ? 995  PRO A HA     1 
ATOM   172   H  HB2    . PRO A 1 33  ? -85.295  67.017  -22.222 1.00 69.10  ? 995  PRO A HB2    1 
ATOM   173   H  HB3    . PRO A 1 33  ? -84.435  68.317  -22.565 1.00 69.10  ? 995  PRO A HB3    1 
ATOM   174   H  HG2    . PRO A 1 33  ? -86.138  67.482  -24.222 1.00 73.09  ? 995  PRO A HG2    1 
ATOM   175   H  HG3    . PRO A 1 33  ? -84.765  68.101  -24.743 1.00 73.09  ? 995  PRO A HG3    1 
ATOM   176   H  HD2    . PRO A 1 33  ? -85.471  65.395  -24.602 1.00 68.92  ? 995  PRO A HD2    1 
ATOM   177   H  HD3    . PRO A 1 33  ? -84.620  66.128  -25.748 1.00 68.92  ? 995  PRO A HD3    1 
ATOM   178   N  N      . LYS A 1 34  ? -83.896  64.584  -21.515 1.00 59.64  ? 996  LYS A N      1 
ATOM   179   C  CA     . LYS A 1 34  ? -83.757  63.731  -20.340 1.00 61.33  ? 996  LYS A CA     1 
ATOM   180   C  C      . LYS A 1 34  ? -82.319  63.263  -20.169 1.00 58.24  ? 996  LYS A C      1 
ATOM   181   O  O      . LYS A 1 34  ? -81.808  63.196  -19.045 1.00 55.75  ? 996  LYS A O      1 
ATOM   182   C  CB     . LYS A 1 34  ? -84.700  62.534  -20.446 1.00 67.23  ? 996  LYS A CB     1 
ATOM   183   C  CG     . LYS A 1 34  ? -84.519  61.496  -19.341 1.00 69.97  ? 996  LYS A CG     1 
ATOM   184   C  CD     . LYS A 1 34  ? -85.537  60.370  -19.452 1.00 76.52  ? 996  LYS A CD     1 
ATOM   185   C  CE     . LYS A 1 34  ? -86.811  60.671  -18.672 1.00 84.58  ? 996  LYS A CE     1 
ATOM   186   N  NZ     . LYS A 1 34  ? -87.423  61.982  -19.034 1.00 87.09  1 996  LYS A NZ     1 
ATOM   187   H  H      . LYS A 1 34  ? -84.433  64.283  -22.116 1.00 71.57  ? 996  LYS A H      1 
ATOM   188   H  HA     . LYS A 1 34  ? -84.003  64.238  -19.550 1.00 73.59  ? 996  LYS A HA     1 
ATOM   189   H  HB2    . LYS A 1 34  ? -85.615  62.853  -20.403 1.00 80.67  ? 996  LYS A HB2    1 
ATOM   190   H  HB3    . LYS A 1 34  ? -84.547  62.091  -21.295 1.00 80.67  ? 996  LYS A HB3    1 
ATOM   191   H  HG2    . LYS A 1 34  ? -83.631  61.110  -19.408 1.00 83.97  ? 996  LYS A HG2    1 
ATOM   192   H  HG3    . LYS A 1 34  ? -84.633  61.925  -18.478 1.00 83.97  ? 996  LYS A HG3    1 
ATOM   193   H  HD2    . LYS A 1 34  ? -85.775  60.247  -20.384 1.00 91.83  ? 996  LYS A HD2    1 
ATOM   194   H  HD3    . LYS A 1 34  ? -85.150  59.555  -19.095 1.00 91.83  ? 996  LYS A HD3    1 
ATOM   195   H  HE2    . LYS A 1 34  ? -87.463  59.976  -18.855 1.00 101.49 ? 996  LYS A HE2    1 
ATOM   196   H  HE3    . LYS A 1 34  ? -86.604  60.689  -17.725 1.00 101.49 ? 996  LYS A HE3    1 
ATOM   197   H  HZ1    . LYS A 1 34  ? -88.162  62.115  -18.556 1.00 104.51 ? 996  LYS A HZ1    1 
ATOM   198   H  HZ2    . LYS A 1 34  ? -86.849  62.641  -18.868 1.00 104.51 ? 996  LYS A HZ2    1 
ATOM   199   H  HZ3    . LYS A 1 34  ? -87.633  61.991  -19.899 1.00 104.51 ? 996  LYS A HZ3    1 
ATOM   200   N  N      . PHE A 1 35  ? -81.646  62.930  -21.272 1.00 56.80  ? 997  PHE A N      1 
ATOM   201   C  CA     . PHE A 1 35  ? -80.257  62.499  -21.171 1.00 54.48  ? 997  PHE A CA     1 
ATOM   202   C  C      . PHE A 1 35  ? -79.343  63.682  -20.881 1.00 53.75  ? 997  PHE A C      1 
ATOM   203   O  O      . PHE A 1 35  ? -78.366  63.553  -20.133 1.00 48.61  ? 997  PHE A O      1 
ATOM   204   C  CB     . PHE A 1 35  ? -79.824  61.797  -22.456 1.00 53.03  ? 997  PHE A CB     1 
ATOM   205   C  CG     . PHE A 1 35  ? -78.439  61.223  -22.388 1.00 50.56  ? 997  PHE A CG     1 
ATOM   206   C  CD1    . PHE A 1 35  ? -78.200  60.041  -21.702 1.00 51.26  ? 997  PHE A CD1    1 
ATOM   207   C  CD2    . PHE A 1 35  ? -77.373  61.873  -22.982 1.00 47.49  ? 997  PHE A CD2    1 
ATOM   208   C  CE1    . PHE A 1 35  ? -76.927  59.509  -21.629 1.00 48.09  ? 997  PHE A CE1    1 
ATOM   209   C  CE2    . PHE A 1 35  ? -76.098  61.348  -22.913 1.00 48.32  ? 997  PHE A CE2    1 
ATOM   210   C  CZ     . PHE A 1 35  ? -75.874  60.164  -22.229 1.00 48.51  ? 997  PHE A CZ     1 
ATOM   211   H  H      . PHE A 1 35  ? -81.964  62.945  -22.071 1.00 68.15  ? 997  PHE A H      1 
ATOM   212   H  HA     . PHE A 1 35  ? -80.174  61.867  -20.439 1.00 65.37  ? 997  PHE A HA     1 
ATOM   213   H  HB2    . PHE A 1 35  ? -80.438  61.069  -22.638 1.00 63.64  ? 997  PHE A HB2    1 
ATOM   214   H  HB3    . PHE A 1 35  ? -79.845  62.436  -23.185 1.00 63.64  ? 997  PHE A HB3    1 
ATOM   215   H  HD1    . PHE A 1 35  ? -78.908  59.596  -21.295 1.00 61.51  ? 997  PHE A HD1    1 
ATOM   216   H  HD2    . PHE A 1 35  ? -77.519  62.669  -23.442 1.00 56.98  ? 997  PHE A HD2    1 
ATOM   217   H  HE1    . PHE A 1 35  ? -76.780  58.714  -21.169 1.00 57.70  ? 997  PHE A HE1    1 
ATOM   218   H  HE2    . PHE A 1 35  ? -75.389  61.792  -23.320 1.00 57.99  ? 997  PHE A HE2    1 
ATOM   219   H  HZ     . PHE A 1 35  ? -75.016  59.808  -22.182 1.00 58.21  ? 997  PHE A HZ     1 
ATOM   220   N  N      . LEU A 1 36  ? -79.641  64.844  -21.469 1.00 55.43  ? 998  LEU A N      1 
ATOM   221   C  CA     . LEU A 1 36  ? -78.842  66.033  -21.195 1.00 57.23  ? 998  LEU A CA     1 
ATOM   222   C  C      . LEU A 1 36  ? -78.909  66.416  -19.725 1.00 58.49  ? 998  LEU A C      1 
ATOM   223   O  O      . LEU A 1 36  ? -77.920  66.897  -19.162 1.00 53.69  ? 998  LEU A O      1 
ATOM   224   C  CB     . LEU A 1 36  ? -79.314  67.195  -22.071 1.00 60.15  ? 998  LEU A CB     1 
ATOM   225   C  CG     . LEU A 1 36  ? -79.073  67.037  -23.577 1.00 61.02  ? 998  LEU A CG     1 
ATOM   226   C  CD1    . LEU A 1 36  ? -79.822  68.105  -24.362 1.00 61.43  ? 998  LEU A CD1    1 
ATOM   227   C  CD2    . LEU A 1 36  ? -77.587  67.092  -23.892 1.00 56.43  ? 998  LEU A CD2    1 
ATOM   228   H  H      . LEU A 1 36  ? -80.289  64.966  -22.021 1.00 66.52  ? 998  LEU A H      1 
ATOM   229   H  HA     . LEU A 1 36  ? -77.916  65.849  -21.415 1.00 68.68  ? 998  LEU A HA     1 
ATOM   230   H  HB2    . LEU A 1 36  ? -80.269  67.308  -21.941 1.00 72.19  ? 998  LEU A HB2    1 
ATOM   231   H  HB3    . LEU A 1 36  ? -78.853  68.000  -21.787 1.00 72.19  ? 998  LEU A HB3    1 
ATOM   232   H  HG     . LEU A 1 36  ? -79.405  66.170  -23.859 1.00 73.22  ? 998  LEU A HG     1 
ATOM   233   H  HD11   . LEU A 1 36  ? -79.651  67.979  -25.308 1.00 73.72  ? 998  LEU A HD11   1 
ATOM   234   H  HD12   . LEU A 1 36  ? -80.772  68.019  -24.183 1.00 73.72  ? 998  LEU A HD12   1 
ATOM   235   H  HD13   . LEU A 1 36  ? -79.510  68.979  -24.082 1.00 73.72  ? 998  LEU A HD13   1 
ATOM   236   H  HD21   . LEU A 1 36  ? -77.463  66.990  -24.849 1.00 67.72  ? 998  LEU A HD21   1 
ATOM   237   H  HD22   . LEU A 1 36  ? -77.235  67.949  -23.603 1.00 67.72  ? 998  LEU A HD22   1 
ATOM   238   H  HD23   . LEU A 1 36  ? -77.137  66.373  -23.421 1.00 67.72  ? 998  LEU A HD23   1 
ATOM   239   N  N      . ASN A 1 37  ? -80.060  66.209  -19.084 1.00 65.21  ? 999  ASN A N      1 
ATOM   240   C  CA     . ASN A 1 37  ? -80.163  66.506  -17.662 1.00 68.46  ? 999  ASN A CA     1 
ATOM   241   C  C      . ASN A 1 37  ? -79.332  65.531  -16.838 1.00 66.30  ? 999  ASN A C      1 
ATOM   242   O  O      . ASN A 1 37  ? -78.783  65.909  -15.795 1.00 64.24  ? 999  ASN A O      1 
ATOM   243   C  CB     . ASN A 1 37  ? -81.626  66.481  -17.227 1.00 75.43  ? 999  ASN A CB     1 
ATOM   244   C  CG     . ASN A 1 37  ? -81.821  67.033  -15.835 1.00 84.79  ? 999  ASN A CG     1 
ATOM   245   O  OD1    . ASN A 1 37  ? -82.114  66.297  -14.891 1.00 88.28  ? 999  ASN A OD1    1 
ATOM   246   N  ND2    . ASN A 1 37  ? -81.638  68.341  -15.693 1.00 86.53  ? 999  ASN A ND2    1 
ATOM   247   H  H      . ASN A 1 37  ? -80.779  65.902  -19.442 1.00 78.25  ? 999  ASN A H      1 
ATOM   248   H  HA     . ASN A 1 37  ? -79.819  67.400  -17.503 1.00 82.15  ? 999  ASN A HA     1 
ATOM   249   H  HB2    . ASN A 1 37  ? -82.149  67.019  -17.841 1.00 90.51  ? 999  ASN A HB2    1 
ATOM   250   H  HB3    . ASN A 1 37  ? -81.943  65.564  -17.235 1.00 90.51  ? 999  ASN A HB3    1 
ATOM   251   H  HD21   . ASN A 1 37  ? -81.736  68.708  -14.922 1.00 103.83 ? 999  ASN A HD21   1 
ATOM   252   H  HD22   . ASN A 1 37  ? -81.422  68.820  -16.373 1.00 103.83 ? 999  ASN A HD22   1 
ATOM   253   N  N      . ILE A 1 38  ? -79.220  64.279  -17.292 1.00 57.87  ? 1000 ILE A N      1 
ATOM   254   C  CA     . ILE A 1 38  ? -78.372  63.306  -16.608 1.00 47.75  ? 1000 ILE A CA     1 
ATOM   255   C  C      . ILE A 1 38  ? -76.909  63.725  -16.680 1.00 45.35  ? 1000 ILE A C      1 
ATOM   256   O  O      . ILE A 1 38  ? -76.178  63.647  -15.684 1.00 46.47  ? 1000 ILE A O      1 
ATOM   257   C  CB     . ILE A 1 38  ? -78.594  61.901  -17.203 1.00 47.30  ? 1000 ILE A CB     1 
ATOM   258   C  CG1    . ILE A 1 38  ? -79.931  61.330  -16.717 1.00 51.12  ? 1000 ILE A CG1    1 
ATOM   259   C  CG2    . ILE A 1 38  ? -77.434  60.964  -16.858 1.00 44.19  ? 1000 ILE A CG2    1 
ATOM   260   C  CD1    . ILE A 1 38  ? -80.355  60.052  -17.415 1.00 52.47  ? 1000 ILE A CD1    1 
ATOM   261   H  H      . ILE A 1 38  ? -79.621  63.974  -17.989 1.00 69.44  ? 1000 ILE A H      1 
ATOM   262   H  HA     . ILE A 1 38  ? -78.626  63.274  -15.672 1.00 57.30  ? 1000 ILE A HA     1 
ATOM   263   H  HB     . ILE A 1 38  ? -78.635  61.986  -18.168 1.00 56.76  ? 1000 ILE A HB     1 
ATOM   264   H  HG12   . ILE A 1 38  ? -79.861  61.140  -15.769 1.00 61.35  ? 1000 ILE A HG12   1 
ATOM   265   H  HG13   . ILE A 1 38  ? -80.624  61.992  -16.868 1.00 61.35  ? 1000 ILE A HG13   1 
ATOM   266   H  HG21   . ILE A 1 38  ? -77.607  60.092  -17.247 1.00 53.03  ? 1000 ILE A HG21   1 
ATOM   267   H  HG22   . ILE A 1 38  ? -76.613  61.331  -17.221 1.00 53.03  ? 1000 ILE A HG22   1 
ATOM   268   H  HG23   . ILE A 1 38  ? -77.366  60.888  -15.894 1.00 53.03  ? 1000 ILE A HG23   1 
ATOM   269   H  HD11   . ILE A 1 38  ? -81.205  59.761  -17.050 1.00 62.97  ? 1000 ILE A HD11   1 
ATOM   270   H  HD12   . ILE A 1 38  ? -80.444  60.225  -18.365 1.00 62.97  ? 1000 ILE A HD12   1 
ATOM   271   H  HD13   . ILE A 1 38  ? -79.680  59.372  -17.264 1.00 62.97  ? 1000 ILE A HD13   1 
ATOM   272   N  N      . LEU A 1 39  ? -76.453  64.174  -17.853 1.00 43.76  ? 1001 LEU A N      1 
ATOM   273   C  CA     . LEU A 1 39  ? -75.073  64.637  -17.967 1.00 43.88  ? 1001 LEU A CA     1 
ATOM   274   C  C      . LEU A 1 39  ? -74.814  65.822  -17.045 1.00 45.89  ? 1001 LEU A C      1 
ATOM   275   O  O      . LEU A 1 39  ? -73.755  65.903  -16.411 1.00 44.32  ? 1001 LEU A O      1 
ATOM   276   C  CB     . LEU A 1 39  ? -74.750  65.003  -19.417 1.00 43.89  ? 1001 LEU A CB     1 
ATOM   277   C  CG     . LEU A 1 39  ? -74.718  63.859  -20.435 1.00 46.21  ? 1001 LEU A CG     1 
ATOM   278   C  CD1    . LEU A 1 39  ? -74.468  64.402  -21.835 1.00 47.22  ? 1001 LEU A CD1    1 
ATOM   279   C  CD2    . LEU A 1 39  ? -73.664  62.820  -20.077 1.00 44.53  ? 1001 LEU A CD2    1 
ATOM   280   H  H      . LEU A 1 39  ? -76.912  64.219  -18.579 1.00 52.51  ? 1001 LEU A H      1 
ATOM   281   H  HA     . LEU A 1 39  ? -74.479  63.918  -17.702 1.00 52.65  ? 1001 LEU A HA     1 
ATOM   282   H  HB2    . LEU A 1 39  ? -75.416  65.639  -19.723 1.00 52.67  ? 1001 LEU A HB2    1 
ATOM   283   H  HB3    . LEU A 1 39  ? -73.876  65.424  -19.433 1.00 52.67  ? 1001 LEU A HB3    1 
ATOM   284   H  HG     . LEU A 1 39  ? -75.582  63.417  -20.437 1.00 55.45  ? 1001 LEU A HG     1 
ATOM   285   H  HD11   . LEU A 1 39  ? -74.452  63.662  -22.462 1.00 56.67  ? 1001 LEU A HD11   1 
ATOM   286   H  HD12   . LEU A 1 39  ? -75.181  65.017  -22.067 1.00 56.67  ? 1001 LEU A HD12   1 
ATOM   287   H  HD13   . LEU A 1 39  ? -73.615  64.864  -21.846 1.00 56.67  ? 1001 LEU A HD13   1 
ATOM   288   H  HD21   . LEU A 1 39  ? -73.677  62.116  -20.743 1.00 53.43  ? 1001 LEU A HD21   1 
ATOM   289   H  HD22   . LEU A 1 39  ? -72.793  63.247  -20.062 1.00 53.43  ? 1001 LEU A HD22   1 
ATOM   290   H  HD23   . LEU A 1 39  ? -73.868  62.452  -19.203 1.00 53.43  ? 1001 LEU A HD23   1 
ATOM   291   N  N      . ASP A 1 40  ? -75.769  66.751  -16.957 1.00 50.46  ? 1002 ASP A N      1 
ATOM   292   C  CA     . ASP A 1 40  ? -75.630  67.878  -16.040 1.00 52.78  ? 1002 ASP A CA     1 
ATOM   293   C  C      . ASP A 1 40  ? -75.458  67.395  -14.606 1.00 54.06  ? 1002 ASP A C      1 
ATOM   294   O  O      . ASP A 1 40  ? -74.582  67.871  -13.875 1.00 55.92  ? 1002 ASP A O      1 
ATOM   295   C  CB     . ASP A 1 40  ? -76.853  68.792  -16.146 1.00 56.78  ? 1002 ASP A CB     1 
ATOM   296   C  CG     . ASP A 1 40  ? -76.984  69.446  -17.507 1.00 58.24  ? 1002 ASP A CG     1 
ATOM   297   O  OD1    . ASP A 1 40  ? -75.965  69.563  -18.218 1.00 61.11  ? 1002 ASP A OD1    1 
ATOM   298   O  OD2    . ASP A 1 40  ? -78.110  69.845  -17.869 1.00 63.19  1 1002 ASP A OD2    1 
ATOM   299   H  H      . ASP A 1 40  ? -76.499  66.750  -17.412 1.00 60.56  ? 1002 ASP A H      1 
ATOM   300   H  HA     . ASP A 1 40  ? -74.844  68.393  -16.283 1.00 63.33  ? 1002 ASP A HA     1 
ATOM   301   H  HB2    . ASP A 1 40  ? -77.654  68.268  -15.987 1.00 68.14  ? 1002 ASP A HB2    1 
ATOM   302   H  HB3    . ASP A 1 40  ? -76.780  69.495  -15.481 1.00 68.14  ? 1002 ASP A HB3    1 
ATOM   303   N  N      . GLN A 1 41  ? -76.280  66.429  -14.193 1.00 54.41  ? 1003 GLN A N      1 
ATOM   304   C  CA     . GLN A 1 41  ? -76.247  65.954  -12.815 1.00 51.03  ? 1003 GLN A CA     1 
ATOM   305   C  C      . GLN A 1 41  ? -74.923  65.273  -12.494 1.00 45.58  ? 1003 GLN A C      1 
ATOM   306   O  O      . GLN A 1 41  ? -74.385  65.440  -11.392 1.00 43.63  ? 1003 GLN A O      1 
ATOM   307   C  CB     . GLN A 1 41  ? -77.416  65.002  -12.576 1.00 56.03  ? 1003 GLN A CB     1 
ATOM   308   C  CG     . GLN A 1 41  ? -78.773  65.683  -12.594 1.00 64.17  ? 1003 GLN A CG     1 
ATOM   309   C  CD     . GLN A 1 41  ? -79.949  64.711  -12.683 1.00 74.66  ? 1003 GLN A CD     1 
ATOM   310   O  OE1    . GLN A 1 41  ? -81.099  65.139  -12.776 1.00 80.82  ? 1003 GLN A OE1    1 
ATOM   311   N  NE2    . GLN A 1 41  ? -79.670  63.407  -12.665 1.00 75.10  ? 1003 GLN A NE2    1 
ATOM   312   H  H      . GLN A 1 41  ? -76.862  66.036  -14.690 1.00 65.29  ? 1003 GLN A H      1 
ATOM   313   H  HA     . GLN A 1 41  ? -76.348  66.711  -12.217 1.00 61.24  ? 1003 GLN A HA     1 
ATOM   314   H  HB2    . GLN A 1 41  ? -77.414  64.324  -13.270 1.00 67.24  ? 1003 GLN A HB2    1 
ATOM   315   H  HB3    . GLN A 1 41  ? -77.305  64.583  -11.708 1.00 67.24  ? 1003 GLN A HB3    1 
ATOM   316   H  HG2    . GLN A 1 41  ? -78.875  66.198  -11.779 1.00 77.00  ? 1003 GLN A HG2    1 
ATOM   317   H  HG3    . GLN A 1 41  ? -78.817  66.272  -13.363 1.00 77.00  ? 1003 GLN A HG3    1 
ATOM   318   H  HE21   . GLN A 1 41  ? -78.853  63.143  -12.605 1.00 90.12  ? 1003 GLN A HE21   1 
ATOM   319   H  HE22   . GLN A 1 41  ? -80.306  62.830  -12.713 1.00 90.12  ? 1003 GLN A HE22   1 
ATOM   320   N  N      . VAL A 1 42  ? -74.381  64.502  -13.438 1.00 44.04  ? 1004 VAL A N      1 
ATOM   321   C  CA     . VAL A 1 42  ? -73.118  63.810  -13.195 1.00 42.61  ? 1004 VAL A CA     1 
ATOM   322   C  C      . VAL A 1 42  ? -71.996  64.813  -12.966 1.00 42.55  ? 1004 VAL A C      1 
ATOM   323   O  O      . VAL A 1 42  ? -71.174  64.646  -12.058 1.00 48.65  ? 1004 VAL A O      1 
ATOM   324   C  CB     . VAL A 1 42  ? -72.796  62.852  -14.357 1.00 44.00  ? 1004 VAL A CB     1 
ATOM   325   C  CG1    . VAL A 1 42  ? -71.394  62.273  -14.210 1.00 45.55  ? 1004 VAL A CG1    1 
ATOM   326   C  CG2    . VAL A 1 42  ? -73.812  61.730  -14.399 1.00 46.84  ? 1004 VAL A CG2    1 
ATOM   327   H  H      . VAL A 1 42  ? -74.720  64.366  -14.217 1.00 52.85  ? 1004 VAL A H      1 
ATOM   328   H  HA     . VAL A 1 42  ? -73.205  63.277  -12.390 1.00 51.13  ? 1004 VAL A HA     1 
ATOM   329   H  HB     . VAL A 1 42  ? -72.841  63.337  -15.196 1.00 52.80  ? 1004 VAL A HB     1 
ATOM   330   H  HG11   . VAL A 1 42  ? -71.220  61.676  -14.954 1.00 54.67  ? 1004 VAL A HG11   1 
ATOM   331   H  HG12   . VAL A 1 42  ? -70.751  63.000  -14.211 1.00 54.67  ? 1004 VAL A HG12   1 
ATOM   332   H  HG13   . VAL A 1 42  ? -71.340  61.785  -13.374 1.00 54.67  ? 1004 VAL A HG13   1 
ATOM   333   H  HG21   . VAL A 1 42  ? -73.596  61.136  -15.135 1.00 56.21  ? 1004 VAL A HG21   1 
ATOM   334   H  HG22   . VAL A 1 42  ? -73.779  61.243  -13.560 1.00 56.21  ? 1004 VAL A HG22   1 
ATOM   335   H  HG23   . VAL A 1 42  ? -74.696  62.109  -14.527 1.00 56.21  ? 1004 VAL A HG23   1 
ATOM   336   N  N      . CYS A 1 43  ? -71.931  65.860  -13.789 1.00 42.07  ? 1005 CYS A N      1 
ATOM   337   C  CA     . CYS A 1 43  ? -70.892  66.870  -13.608 1.00 43.84  ? 1005 CYS A CA     1 
ATOM   338   C  C      . CYS A 1 43  ? -71.020  67.551  -12.253 1.00 45.17  ? 1005 CYS A C      1 
ATOM   339   O  O      . CYS A 1 43  ? -70.015  67.823  -11.584 1.00 41.61  ? 1005 CYS A O      1 
ATOM   340   C  CB     . CYS A 1 43  ? -70.962  67.905  -14.731 1.00 48.72  ? 1005 CYS A CB     1 
ATOM   341   S  SG     . CYS A 1 43  ? -70.544  67.244  -16.351 1.00 46.67  ? 1005 CYS A SG     1 
ATOM   342   H  H      . CYS A 1 43  ? -72.465  66.006  -14.447 1.00 50.49  ? 1005 CYS A H      1 
ATOM   343   H  HA     . CYS A 1 43  ? -70.023  66.441  -13.648 1.00 52.61  ? 1005 CYS A HA     1 
ATOM   344   H  HB2    . CYS A 1 43  ? -71.865  68.256  -14.777 1.00 58.46  ? 1005 CYS A HB2    1 
ATOM   345   H  HB3    . CYS A 1 43  ? -70.340  68.623  -14.534 1.00 58.46  ? 1005 CYS A HB3    1 
ATOM   346   H  HG     . CYS A 1 43  ? -71.311  66.363  -16.623 1.00 56.00  ? 1005 CYS A HG     1 
ATOM   347   N  N      . ILE A 1 44  ? -72.252  67.837  -11.831 1.00 43.78  ? 1006 ILE A N      1 
ATOM   348   C  CA     . ILE A 1 44  ? -72.452  68.507  -10.556 1.00 44.48  ? 1006 ILE A CA     1 
ATOM   349   C  C      . ILE A 1 44  ? -72.159  67.563  -9.397  1.00 47.74  ? 1006 ILE A C      1 
ATOM   350   O  O      . ILE A 1 44  ? -71.653  67.994  -8.354  1.00 42.69  ? 1006 ILE A O      1 
ATOM   351   C  CB     . ILE A 1 44  ? -73.878  69.081  -10.489 1.00 48.07  ? 1006 ILE A CB     1 
ATOM   352   C  CG1    . ILE A 1 44  ? -74.043  70.170  -11.550 1.00 46.36  ? 1006 ILE A CG1    1 
ATOM   353   C  CG2    . ILE A 1 44  ? -74.176  69.642  -9.092  1.00 50.03  ? 1006 ILE A CG2    1 
ATOM   354   C  CD1    . ILE A 1 44  ? -75.466  70.638  -11.741 1.00 52.26  ? 1006 ILE A CD1    1 
ATOM   355   H  H      . ILE A 1 44  ? -72.975  67.656  -12.260 1.00 52.54  ? 1006 ILE A H      1 
ATOM   356   H  HA     . ILE A 1 44  ? -71.832  69.250  -10.494 1.00 53.37  ? 1006 ILE A HA     1 
ATOM   357   H  HB     . ILE A 1 44  ? -74.509  68.368  -10.677 1.00 57.68  ? 1006 ILE A HB     1 
ATOM   358   H  HG12   . ILE A 1 44  ? -73.511  70.940  -11.291 1.00 55.63  ? 1006 ILE A HG12   1 
ATOM   359   H  HG13   . ILE A 1 44  ? -73.728  69.826  -12.401 1.00 55.63  ? 1006 ILE A HG13   1 
ATOM   360   H  HG21   . ILE A 1 44  ? -75.079  69.996  -9.080  1.00 60.03  ? 1006 ILE A HG21   1 
ATOM   361   H  HG22   . ILE A 1 44  ? -74.091  68.929  -8.441  1.00 60.03  ? 1006 ILE A HG22   1 
ATOM   362   H  HG23   . ILE A 1 44  ? -73.540  70.348  -8.895  1.00 60.03  ? 1006 ILE A HG23   1 
ATOM   363   H  HD11   . ILE A 1 44  ? -75.483  71.324  -12.427 1.00 62.71  ? 1006 ILE A HD11   1 
ATOM   364   H  HD12   . ILE A 1 44  ? -76.012  69.884  -12.014 1.00 62.71  ? 1006 ILE A HD12   1 
ATOM   365   H  HD13   . ILE A 1 44  ? -75.795  70.999  -10.903 1.00 62.71  ? 1006 ILE A HD13   1 
ATOM   366   N  N      . GLN A 1 45  ? -72.457  66.270  -9.549  1.00 54.70  ? 1007 GLN A N      1 
ATOM   367   C  CA     . GLN A 1 45  ? -72.147  65.324  -8.482  1.00 58.01  ? 1007 GLN A CA     1 
ATOM   368   C  C      . GLN A 1 45  ? -70.644  65.162  -8.295  1.00 53.14  ? 1007 GLN A C      1 
ATOM   369   O  O      . GLN A 1 45  ? -70.185  64.923  -7.174  1.00 55.56  ? 1007 GLN A O      1 
ATOM   370   C  CB     . GLN A 1 45  ? -72.795  63.969  -8.762  1.00 62.01  ? 1007 GLN A CB     1 
ATOM   371   C  CG     . GLN A 1 45  ? -74.288  63.932  -8.485  1.00 69.86  ? 1007 GLN A CG     1 
ATOM   372   C  CD     . GLN A 1 45  ? -74.621  64.211  -7.030  1.00 78.51  ? 1007 GLN A CD     1 
ATOM   373   O  OE1    . GLN A 1 45  ? -73.881  63.824  -6.124  1.00 78.51  ? 1007 GLN A OE1    1 
ATOM   374   N  NE2    . GLN A 1 45  ? -75.738  64.893  -6.799  1.00 81.84  ? 1007 GLN A NE2    1 
ATOM   375   H  H      . GLN A 1 45  ? -72.829  65.924  -10.243 1.00 65.64  ? 1007 GLN A H      1 
ATOM   376   H  HA     . GLN A 1 45  ? -72.514  65.662  -7.650  1.00 69.61  ? 1007 GLN A HA     1 
ATOM   377   H  HB2    . GLN A 1 45  ? -72.662  63.746  -9.697  1.00 74.41  ? 1007 GLN A HB2    1 
ATOM   378   H  HB3    . GLN A 1 45  ? -72.373  63.299  -8.201  1.00 74.41  ? 1007 GLN A HB3    1 
ATOM   379   H  HG2    . GLN A 1 45  ? -74.727  64.605  -9.028  1.00 83.83  ? 1007 GLN A HG2    1 
ATOM   380   H  HG3    . GLN A 1 45  ? -74.629  63.051  -8.708  1.00 83.83  ? 1007 GLN A HG3    1 
ATOM   381   H  HE21   . GLN A 1 45  ? -76.227  65.152  -7.457  1.00 98.21  ? 1007 GLN A HE21   1 
ATOM   382   H  HE22   . GLN A 1 45  ? -75.970  65.077  -5.991  1.00 98.21  ? 1007 GLN A HE22   1 
ATOM   383   N  N      . CYS A 1 46  ? -69.864  65.289  -9.368  1.00 47.93  ? 1008 CYS A N      1 
ATOM   384   C  CA     . CYS A 1 46  ? -68.412  65.251  -9.227  1.00 44.08  ? 1008 CYS A CA     1 
ATOM   385   C  C      . CYS A 1 46  ? -67.927  66.331  -8.268  1.00 39.61  ? 1008 CYS A C      1 
ATOM   386   O  O      . CYS A 1 46  ? -66.973  66.118  -7.512  1.00 42.15  ? 1008 CYS A O      1 
ATOM   387   C  CB     . CYS A 1 46  ? -67.749  65.401  -10.597 1.00 41.13  ? 1008 CYS A CB     1 
ATOM   388   S  SG     . CYS A 1 46  ? -67.896  63.930  -11.646 1.00 40.37  ? 1008 CYS A SG     1 
ATOM   389   H  H      . CYS A 1 46  ? -70.145  65.396  -10.174 1.00 57.52  ? 1008 CYS A H      1 
ATOM   390   H  HA     . CYS A 1 46  ? -68.154  64.390  -8.863  1.00 52.89  ? 1008 CYS A HA     1 
ATOM   391   H  HB2    . CYS A 1 46  ? -68.164  66.142  -11.066 1.00 49.36  ? 1008 CYS A HB2    1 
ATOM   392   H  HB3    . CYS A 1 46  ? -66.805  65.581  -10.469 1.00 49.36  ? 1008 CYS A HB3    1 
ATOM   393   H  HG     . CYS A 1 46  ? -69.058  63.696  -11.831 1.00 48.44  ? 1008 CYS A HG     1 
ATOM   394   N  N      . TYR A 1 47  ? -68.565  67.501  -8.289  1.00 40.98  ? 1009 TYR A N      1 
ATOM   395   C  CA     . TYR A 1 47  ? -68.203  68.569  -7.363  1.00 42.44  ? 1009 TYR A CA     1 
ATOM   396   C  C      . TYR A 1 47  ? -68.726  68.285  -5.960  1.00 44.60  ? 1009 TYR A C      1 
ATOM   397   O  O      . TYR A 1 47  ? -67.970  68.343  -4.984  1.00 46.00  ? 1009 TYR A O      1 
ATOM   398   C  CB     . TYR A 1 47  ? -68.738  69.906  -7.881  1.00 48.12  ? 1009 TYR A CB     1 
ATOM   399   C  CG     . TYR A 1 47  ? -68.662  71.043  -6.886  1.00 52.47  ? 1009 TYR A CG     1 
ATOM   400   C  CD1    . TYR A 1 47  ? -67.445  71.616  -6.542  1.00 54.12  ? 1009 TYR A CD1    1 
ATOM   401   C  CD2    . TYR A 1 47  ? -69.815  71.562  -6.308  1.00 57.66  ? 1009 TYR A CD2    1 
ATOM   402   C  CE1    . TYR A 1 47  ? -67.376  72.657  -5.635  1.00 54.70  ? 1009 TYR A CE1    1 
ATOM   403   C  CE2    . TYR A 1 47  ? -69.755  72.606  -5.403  1.00 61.16  ? 1009 TYR A CE2    1 
ATOM   404   C  CZ     . TYR A 1 47  ? -68.533  73.149  -5.073  1.00 60.96  ? 1009 TYR A CZ     1 
ATOM   405   O  OH     . TYR A 1 47  ? -68.464  74.187  -4.175  1.00 66.99  ? 1009 TYR A OH     1 
ATOM   406   H  H      . TYR A 1 47  ? -69.206  67.700  -8.826  1.00 49.17  ? 1009 TYR A H      1 
ATOM   407   H  HA     . TYR A 1 47  ? -67.237  68.631  -7.315  1.00 50.92  ? 1009 TYR A HA     1 
ATOM   408   H  HB2    . TYR A 1 47  ? -68.224  70.164  -8.662  1.00 57.74  ? 1009 TYR A HB2    1 
ATOM   409   H  HB3    . TYR A 1 47  ? -69.670  69.793  -8.127  1.00 57.74  ? 1009 TYR A HB3    1 
ATOM   410   H  HD1    . TYR A 1 47  ? -66.662  71.285  -6.918  1.00 64.94  ? 1009 TYR A HD1    1 
ATOM   411   H  HD2    . TYR A 1 47  ? -70.641  71.195  -6.529  1.00 69.19  ? 1009 TYR A HD2    1 
ATOM   412   H  HE1    . TYR A 1 47  ? -66.553  73.027  -5.411  1.00 65.64  ? 1009 TYR A HE1    1 
ATOM   413   H  HE2    . TYR A 1 47  ? -70.534  72.939  -5.021  1.00 73.40  ? 1009 TYR A HE2    1 
ATOM   414   H  HH     . TYR A 1 47  ? -69.235  74.390  -3.910  1.00 80.39  ? 1009 TYR A HH     1 
ATOM   415   N  N      . LYS A 1 48  ? -70.013  67.957  -5.843  1.00 45.76  ? 1010 LYS A N      1 
ATOM   416   C  CA     . LYS A 1 48  ? -70.603  67.758  -4.525  1.00 54.86  ? 1010 LYS A CA     1 
ATOM   417   C  C      . LYS A 1 48  ? -70.010  66.541  -3.823  1.00 51.46  ? 1010 LYS A C      1 
ATOM   418   O  O      . LYS A 1 48  ? -69.836  66.550  -2.600  1.00 49.82  ? 1010 LYS A O      1 
ATOM   419   C  CB     . LYS A 1 48  ? -72.121  67.620  -4.640  1.00 60.25  ? 1010 LYS A CB     1 
ATOM   420   C  CG     . LYS A 1 48  ? -72.818  68.877  -5.125  1.00 64.46  ? 1010 LYS A CG     1 
ATOM   421   C  CD     . LYS A 1 48  ? -74.303  68.858  -4.793  1.00 73.25  ? 1010 LYS A CD     1 
ATOM   422   C  CE     . LYS A 1 48  ? -75.043  67.748  -5.517  1.00 77.42  ? 1010 LYS A CE     1 
ATOM   423   N  NZ     . LYS A 1 48  ? -76.502  67.776  -5.198  1.00 83.87  1 1010 LYS A NZ     1 
ATOM   424   H  H      . LYS A 1 48  ? -70.556  67.846  -6.500  1.00 54.92  ? 1010 LYS A H      1 
ATOM   425   H  HA     . LYS A 1 48  ? -70.416  68.537  -3.977  1.00 65.83  ? 1010 LYS A HA     1 
ATOM   426   H  HB2    . LYS A 1 48  ? -72.323  66.908  -5.268  1.00 72.30  ? 1010 LYS A HB2    1 
ATOM   427   H  HB3    . LYS A 1 48  ? -72.482  67.400  -3.767  1.00 72.30  ? 1010 LYS A HB3    1 
ATOM   428   H  HG2    . LYS A 1 48  ? -72.420  69.650  -4.695  1.00 77.35  ? 1010 LYS A HG2    1 
ATOM   429   H  HG3    . LYS A 1 48  ? -72.724  68.943  -6.089  1.00 77.35  ? 1010 LYS A HG3    1 
ATOM   430   H  HD2    . LYS A 1 48  ? -74.412  68.720  -3.839  1.00 87.90  ? 1010 LYS A HD2    1 
ATOM   431   H  HD3    . LYS A 1 48  ? -74.697  69.704  -5.055  1.00 87.90  ? 1010 LYS A HD3    1 
ATOM   432   H  HE2    . LYS A 1 48  ? -74.937  67.863  -6.475  1.00 92.91  ? 1010 LYS A HE2    1 
ATOM   433   H  HE3    . LYS A 1 48  ? -74.686  66.890  -5.240  1.00 92.91  ? 1010 LYS A HE3    1 
ATOM   434   H  HZ1    . LYS A 1 48  ? -76.921  67.120  -5.630  1.00 100.64 ? 1010 LYS A HZ1    1 
ATOM   435   H  HZ2    . LYS A 1 48  ? -76.624  67.669  -4.323  1.00 100.64 ? 1010 LYS A HZ2    1 
ATOM   436   H  HZ3    . LYS A 1 48  ? -76.853  68.555  -5.446  1.00 100.64 ? 1010 LYS A HZ3    1 
ATOM   437   N  N      . ASP A 1 49  ? -69.706  65.481  -4.575  1.00 45.95  ? 1011 ASP A N      1 
ATOM   438   C  CA     . ASP A 1 49  ? -69.261  64.240  -3.951  1.00 45.24  ? 1011 ASP A CA     1 
ATOM   439   C  C      . ASP A 1 49  ? -67.834  64.338  -3.427  1.00 44.19  ? 1011 ASP A C      1 
ATOM   440   O  O      . ASP A 1 49  ? -67.514  63.737  -2.395  1.00 43.16  ? 1011 ASP A O      1 
ATOM   441   C  CB     . ASP A 1 49  ? -69.363  63.086  -4.949  1.00 44.03  ? 1011 ASP A CB     1 
ATOM   442   C  CG     . ASP A 1 49  ? -70.775  62.532  -5.067  1.00 51.10  ? 1011 ASP A CG     1 
ATOM   443   O  OD1    . ASP A 1 49  ? -71.715  63.173  -4.550  1.00 54.68  ? 1011 ASP A OD1    1 
ATOM   444   O  OD2    . ASP A 1 49  ? -70.948  61.465  -5.697  1.00 52.32  1 1011 ASP A OD2    1 
ATOM   445   H  H      . ASP A 1 49  ? -69.748  65.457  -5.434  1.00 55.14  ? 1011 ASP A H      1 
ATOM   446   H  HA     . ASP A 1 49  ? -69.841  64.039  -3.200  1.00 54.29  ? 1011 ASP A HA     1 
ATOM   447   H  HB2    . ASP A 1 49  ? -69.091  63.402  -5.825  1.00 52.84  ? 1011 ASP A HB2    1 
ATOM   448   H  HB3    . ASP A 1 49  ? -68.782  62.366  -4.661  1.00 52.84  ? 1011 ASP A HB3    1 
ATOM   449   N  N      . PHE A 1 50  ? -66.973  65.103  -4.094  1.00 40.54  ? 1012 PHE A N      1 
ATOM   450   C  CA     . PHE A 1 50  ? -65.542  65.011  -3.856  1.00 41.96  ? 1012 PHE A CA     1 
ATOM   451   C  C      . PHE A 1 50  ? -64.901  66.300  -3.370  1.00 39.77  ? 1012 PHE A C      1 
ATOM   452   O  O      . PHE A 1 50  ? -63.713  66.282  -3.029  1.00 37.01  ? 1012 PHE A O      1 
ATOM   453   C  CB     . PHE A 1 50  ? -64.833  64.534  -5.132  1.00 39.29  ? 1012 PHE A CB     1 
ATOM   454   C  CG     . PHE A 1 50  ? -65.368  63.233  -5.652  1.00 41.91  ? 1012 PHE A CG     1 
ATOM   455   C  CD1    . PHE A 1 50  ? -65.307  62.089  -4.873  1.00 40.24  ? 1012 PHE A CD1    1 
ATOM   456   C  CD2    . PHE A 1 50  ? -65.947  63.155  -6.905  1.00 37.14  ? 1012 PHE A CD2    1 
ATOM   457   C  CE1    . PHE A 1 50  ? -65.810  60.890  -5.339  1.00 44.21  ? 1012 PHE A CE1    1 
ATOM   458   C  CE2    . PHE A 1 50  ? -66.447  61.958  -7.374  1.00 39.53  ? 1012 PHE A CE2    1 
ATOM   459   C  CZ     . PHE A 1 50  ? -66.377  60.825  -6.591  1.00 41.59  ? 1012 PHE A CZ     1 
ATOM   460   H  H      . PHE A 1 50  ? -67.195  65.682  -4.690  1.00 48.64  ? 1012 PHE A H      1 
ATOM   461   H  HA     . PHE A 1 50  ? -65.390  64.340  -3.173  1.00 50.35  ? 1012 PHE A HA     1 
ATOM   462   H  HB2    . PHE A 1 50  ? -64.948  65.203  -5.825  1.00 47.15  ? 1012 PHE A HB2    1 
ATOM   463   H  HB3    . PHE A 1 50  ? -63.889  64.414  -4.942  1.00 47.15  ? 1012 PHE A HB3    1 
ATOM   464   H  HD1    . PHE A 1 50  ? -64.925  62.128  -4.026  1.00 48.29  ? 1012 PHE A HD1    1 
ATOM   465   H  HD2    . PHE A 1 50  ? -65.997  63.915  -7.437  1.00 44.57  ? 1012 PHE A HD2    1 
ATOM   466   H  HE1    . PHE A 1 50  ? -65.760  60.126  -4.810  1.00 53.06  ? 1012 PHE A HE1    1 
ATOM   467   H  HE2    . PHE A 1 50  ? -66.831  61.915  -8.220  1.00 47.43  ? 1012 PHE A HE2    1 
ATOM   468   H  HZ     . PHE A 1 50  ? -66.714  60.018  -6.909  1.00 49.91  ? 1012 PHE A HZ     1 
ATOM   469   N  N      . SER A 1 51  ? -65.629  67.397  -3.323  1.00 37.45  ? 1013 SER A N      1 
ATOM   470   C  CA     . SER A 1 51  ? -65.065  68.605  -2.752  1.00 39.61  ? 1013 SER A CA     1 
ATOM   471   C  C      . SER A 1 51  ? -65.053  68.503  -1.224  1.00 45.12  ? 1013 SER A C      1 
ATOM   472   O  O      . SER A 1 51  ? -65.907  67.835  -0.634  1.00 41.42  ? 1013 SER A O      1 
ATOM   473   C  CB     . SER A 1 51  ? -65.869  69.822  -3.185  1.00 38.46  ? 1013 SER A CB     1 
ATOM   474   O  OG     . SER A 1 51  ? -67.211  69.705  -2.760  1.00 45.16  ? 1013 SER A OG     1 
ATOM   475   H  H      . SER A 1 51  ? -66.437  67.470  -3.607  1.00 44.94  ? 1013 SER A H      1 
ATOM   476   H  HA     . SER A 1 51  ? -64.152  68.714  -3.060  1.00 47.53  ? 1013 SER A HA     1 
ATOM   477   H  HB2    . SER A 1 51  ? -65.479  70.616  -2.788  1.00 46.15  ? 1013 SER A HB2    1 
ATOM   478   H  HB3    . SER A 1 51  ? -65.847  69.888  -4.152  1.00 46.15  ? 1013 SER A HB3    1 
ATOM   479   H  HG     . SER A 1 51  ? -67.560  69.019  -3.095  1.00 54.19  ? 1013 SER A HG     1 
ATOM   480   N  N      . PRO A 1 52  ? -64.091  69.137  -0.556  1.00 51.87  ? 1014 PRO A N      1 
ATOM   481   C  CA     . PRO A 1 52  ? -64.031  69.029  0.906   1.00 49.44  ? 1014 PRO A CA     1 
ATOM   482   C  C      . PRO A 1 52  ? -65.174  69.768  1.580   1.00 49.94  ? 1014 PRO A C      1 
ATOM   483   O  O      . PRO A 1 52  ? -65.697  70.759  1.065   1.00 52.03  ? 1014 PRO A O      1 
ATOM   484   C  CB     . PRO A 1 52  ? -62.682  69.671  1.260   1.00 51.74  ? 1014 PRO A CB     1 
ATOM   485   C  CG     . PRO A 1 52  ? -61.925  69.755  -0.029  1.00 51.41  ? 1014 PRO A CG     1 
ATOM   486   C  CD     . PRO A 1 52  ? -62.952  69.903  -1.091  1.00 50.39  ? 1014 PRO A CD     1 
ATOM   487   H  HA     . PRO A 1 52  ? -64.034  68.099  1.182   1.00 59.32  ? 1014 PRO A HA     1 
ATOM   488   H  HB2    . PRO A 1 52  ? -62.829  70.556  1.629   1.00 62.09  ? 1014 PRO A HB2    1 
ATOM   489   H  HB3    . PRO A 1 52  ? -62.211  69.109  1.896   1.00 62.09  ? 1014 PRO A HB3    1 
ATOM   490   H  HG2    . PRO A 1 52  ? -61.339  70.528  -0.012  1.00 61.70  ? 1014 PRO A HG2    1 
ATOM   491   H  HG3    . PRO A 1 52  ? -61.414  68.942  -0.160  1.00 61.70  ? 1014 PRO A HG3    1 
ATOM   492   H  HD2    . PRO A 1 52  ? -63.193  70.836  -1.203  1.00 60.47  ? 1014 PRO A HD2    1 
ATOM   493   H  HD3    . PRO A 1 52  ? -62.640  69.512  -1.922  1.00 60.47  ? 1014 PRO A HD3    1 
ATOM   494   N  N      . THR A 1 53  ? -65.550  69.282  2.761   1.00 45.76  ? 1015 THR A N      1 
ATOM   495   C  CA     . THR A 1 53  ? -66.460  70.044  3.596   1.00 46.02  ? 1015 THR A CA     1 
ATOM   496   C  C      . THR A 1 53  ? -65.738  71.277  4.126   1.00 45.56  ? 1015 THR A C      1 
ATOM   497   O  O      . THR A 1 53  ? -64.511  71.390  4.060   1.00 42.11  ? 1015 THR A O      1 
ATOM   498   C  CB     . THR A 1 53  ? -66.985  69.198  4.764   1.00 48.09  ? 1015 THR A CB     1 
ATOM   499   O  OG1    . THR A 1 53  ? -65.913  68.869  5.660   1.00 44.56  ? 1015 THR A OG1    1 
ATOM   500   C  CG2    . THR A 1 53  ? -67.625  67.919  4.260   1.00 48.36  ? 1015 THR A CG2    1 
ATOM   501   H  H      . THR A 1 53  ? -65.297  68.529  3.092   1.00 54.91  ? 1015 THR A H      1 
ATOM   502   H  HA     . THR A 1 53  ? -67.217  70.336  3.065   1.00 55.23  ? 1015 THR A HA     1 
ATOM   503   H  HB     . THR A 1 53  ? -67.659  69.704  5.245   1.00 57.70  ? 1015 THR A HB     1 
ATOM   504   H  HG1    . THR A 1 53  ? -66.204  68.407  6.298   1.00 53.47  ? 1015 THR A HG1    1 
ATOM   505   H  HG21   . THR A 1 53  ? -67.953  67.395  5.008   1.00 58.03  ? 1015 THR A HG21   1 
ATOM   506   H  HG22   . THR A 1 53  ? -68.369  68.129  3.673   1.00 58.03  ? 1015 THR A HG22   1 
ATOM   507   H  HG23   . THR A 1 53  ? -66.974  67.394  3.769   1.00 58.03  ? 1015 THR A HG23   1 
ATOM   508   N  N      . ILE A 1 54  ? -66.516  72.219  4.659   1.00 42.33  ? 1016 ILE A N      1 
ATOM   509   C  CA     . ILE A 1 54  ? -65.906  73.410  5.237   1.00 43.41  ? 1016 ILE A CA     1 
ATOM   510   C  C      . ILE A 1 54  ? -65.009  73.030  6.405   1.00 43.62  ? 1016 ILE A C      1 
ATOM   511   O  O      . ILE A 1 54  ? -63.997  73.695  6.661   1.00 44.54  ? 1016 ILE A O      1 
ATOM   512   C  CB     . ILE A 1 54  ? -66.989  74.429  5.644   1.00 45.65  ? 1016 ILE A CB     1 
ATOM   513   C  CG1    . ILE A 1 54  ? -67.977  73.812  6.640   1.00 46.09  ? 1016 ILE A CG1    1 
ATOM   514   C  CG2    . ILE A 1 54  ? -67.711  74.946  4.391   1.00 44.26  ? 1016 ILE A CG2    1 
ATOM   515   C  CD1    . ILE A 1 54  ? -69.004  74.792  7.180   1.00 49.48  ? 1016 ILE A CD1    1 
ATOM   516   H  H      . ILE A 1 54  ? -67.375  72.194  4.697   1.00 50.79  ? 1016 ILE A H      1 
ATOM   517   H  HA     . ILE A 1 54  ? -65.348  73.830  4.563   1.00 52.10  ? 1016 ILE A HA     1 
ATOM   518   H  HB     . ILE A 1 54  ? -66.553  75.181  6.076   1.00 54.78  ? 1016 ILE A HB     1 
ATOM   519   H  HG12   . ILE A 1 54  ? -68.457  73.094  6.198   1.00 55.30  ? 1016 ILE A HG12   1 
ATOM   520   H  HG13   . ILE A 1 54  ? -67.480  73.458  7.394   1.00 55.30  ? 1016 ILE A HG13   1 
ATOM   521   H  HG21   . ILE A 1 54  ? -68.389  75.586  4.658   1.00 53.12  ? 1016 ILE A HG21   1 
ATOM   522   H  HG22   . ILE A 1 54  ? -67.063  75.374  3.808   1.00 53.12  ? 1016 ILE A HG22   1 
ATOM   523   H  HG23   . ILE A 1 54  ? -68.124  74.197  3.933   1.00 53.12  ? 1016 ILE A HG23   1 
ATOM   524   H  HD11   . ILE A 1 54  ? -69.588  74.327  7.799   1.00 59.38  ? 1016 ILE A HD11   1 
ATOM   525   H  HD12   . ILE A 1 54  ? -68.543  75.512  7.637   1.00 59.38  ? 1016 ILE A HD12   1 
ATOM   526   H  HD13   . ILE A 1 54  ? -69.521  75.147  6.440   1.00 59.38  ? 1016 ILE A HD13   1 
ATOM   527   N  N      . ILE A 1 55  ? -65.343  71.947  7.115   1.00 48.46  ? 1017 ILE A N      1 
ATOM   528   C  CA     . ILE A 1 55  ? -64.511  71.486  8.225   1.00 50.94  ? 1017 ILE A CA     1 
ATOM   529   C  C      . ILE A 1 55  ? -63.195  70.916  7.709   1.00 49.87  ? 1017 ILE A C      1 
ATOM   530   O  O      . ILE A 1 55  ? -62.136  71.122  8.314   1.00 46.51  ? 1017 ILE A O      1 
ATOM   531   C  CB     . ILE A 1 55  ? -65.274  70.450  9.073   1.00 53.12  ? 1017 ILE A CB     1 
ATOM   532   C  CG1    . ILE A 1 55  ? -66.560  71.048  9.651   1.00 55.89  ? 1017 ILE A CG1    1 
ATOM   533   C  CG2    . ILE A 1 55  ? -64.385  69.891  10.182  1.00 50.38  ? 1017 ILE A CG2    1 
ATOM   534   C  CD1    . ILE A 1 55  ? -66.339  72.155  10.652  1.00 58.69  ? 1017 ILE A CD1    1 
ATOM   535   H  H      . ILE A 1 55  ? -66.043  71.467  6.974   1.00 58.15  ? 1017 ILE A H      1 
ATOM   536   H  HA     . ILE A 1 55  ? -64.304  72.242  8.796   1.00 61.12  ? 1017 ILE A HA     1 
ATOM   537   H  HB     . ILE A 1 55  ? -65.522  69.714  8.491   1.00 63.75  ? 1017 ILE A HB     1 
ATOM   538   H  HG12   . ILE A 1 55  ? -67.088  71.412  8.923   1.00 67.07  ? 1017 ILE A HG12   1 
ATOM   539   H  HG13   . ILE A 1 55  ? -67.057  70.344  10.096  1.00 67.07  ? 1017 ILE A HG13   1 
ATOM   540   H  HG21   . ILE A 1 55  ? -64.892  69.244  10.696  1.00 60.46  ? 1017 ILE A HG21   1 
ATOM   541   H  HG22   . ILE A 1 55  ? -63.612  69.464  9.782   1.00 60.46  ? 1017 ILE A HG22   1 
ATOM   542   H  HG23   . ILE A 1 55  ? -64.101  70.620  10.756  1.00 60.46  ? 1017 ILE A HG23   1 
ATOM   543   H  HD11   . ILE A 1 55  ? -67.200  72.474  10.965  1.00 70.42  ? 1017 ILE A HD11   1 
ATOM   544   H  HD12   . ILE A 1 55  ? -65.824  71.808  11.397  1.00 70.42  ? 1017 ILE A HD12   1 
ATOM   545   H  HD13   . ILE A 1 55  ? -65.854  72.877  10.223  1.00 70.42  ? 1017 ILE A HD13   1 
ATOM   546   N  N      . GLU A 1 56  ? -63.236  70.184  6.594   1.00 55.52  ? 1018 GLU A N      1 
ATOM   547   C  CA     . GLU A 1 56  ? -62.006  69.633  6.033   1.00 55.17  ? 1018 GLU A CA     1 
ATOM   548   C  C      . GLU A 1 56  ? -61.086  70.728  5.506   1.00 51.28  ? 1018 GLU A C      1 
ATOM   549   O  O      . GLU A 1 56  ? -59.861  70.602  5.605   1.00 51.12  ? 1018 GLU A O      1 
ATOM   550   C  CB     . GLU A 1 56  ? -62.335  68.626  4.928   1.00 53.98  ? 1018 GLU A CB     1 
ATOM   551   C  CG     . GLU A 1 56  ? -62.835  67.282  5.458   1.00 57.02  ? 1018 GLU A CG     1 
ATOM   552   C  CD     . GLU A 1 56  ? -63.523  66.432  4.396   1.00 60.68  ? 1018 GLU A CD     1 
ATOM   553   O  OE1    . GLU A 1 56  ? -63.811  66.953  3.296   1.00 54.00  ? 1018 GLU A OE1    1 
ATOM   554   O  OE2    . GLU A 1 56  ? -63.785  65.241  4.669   1.00 61.55  1 1018 GLU A OE2    1 
ATOM   555   H  H      . GLU A 1 56  ? -63.949  69.995  6.152   1.00 66.62  ? 1018 GLU A H      1 
ATOM   556   H  HA     . GLU A 1 56  ? -61.530  69.159  6.733   1.00 66.21  ? 1018 GLU A HA     1 
ATOM   557   H  HB2    . GLU A 1 56  ? -63.027  68.999  4.360   1.00 64.77  ? 1018 GLU A HB2    1 
ATOM   558   H  HB3    . GLU A 1 56  ? -61.534  68.461  4.406   1.00 64.77  ? 1018 GLU A HB3    1 
ATOM   559   H  HG2    . GLU A 1 56  ? -62.080  66.778  5.799   1.00 68.43  ? 1018 GLU A HG2    1 
ATOM   560   H  HG3    . GLU A 1 56  ? -63.474  67.443  6.170   1.00 68.43  ? 1018 GLU A HG3    1 
ATOM   561   N  N      . ASP A 1 57  ? -61.646  71.808  4.961   1.00 49.16  ? 1019 ASP A N      1 
ATOM   562   C  CA     . ASP A 1 57  ? -60.810  72.927  4.535   1.00 51.40  ? 1019 ASP A CA     1 
ATOM   563   C  C      . ASP A 1 57  ? -60.137  73.598  5.724   1.00 49.97  ? 1019 ASP A C      1 
ATOM   564   O  O      . ASP A 1 57  ? -58.942  73.907  5.671   1.00 49.92  ? 1019 ASP A O      1 
ATOM   565   C  CB     . ASP A 1 57  ? -61.634  73.941  3.742   1.00 53.28  ? 1019 ASP A CB     1 
ATOM   566   C  CG     . ASP A 1 57  ? -61.894  73.490  2.319   1.00 56.04  ? 1019 ASP A CG     1 
ATOM   567   O  OD1    . ASP A 1 57  ? -61.060  72.735  1.773   1.00 53.01  ? 1019 ASP A OD1    1 
ATOM   568   O  OD2    . ASP A 1 57  ? -62.925  73.898  1.742   1.00 59.77  1 1019 ASP A OD2    1 
ATOM   569   H  H      . ASP A 1 57  ? -62.489  71.917  4.830   1.00 59.00  ? 1019 ASP A H      1 
ATOM   570   H  HA     . ASP A 1 57  ? -60.112  72.590  3.951   1.00 61.68  ? 1019 ASP A HA     1 
ATOM   571   H  HB2    . ASP A 1 57  ? -62.490  74.065  4.179   1.00 63.93  ? 1019 ASP A HB2    1 
ATOM   572   H  HB3    . ASP A 1 57  ? -61.152  74.782  3.707   1.00 63.93  ? 1019 ASP A HB3    1 
ATOM   573   N  N      . GLN A 1 58  ? -60.887  73.841  6.801   1.00 48.65  ? 1020 GLN A N      1 
ATOM   574   C  CA     . GLN A 1 58  ? -60.295  74.460  7.981   1.00 50.26  ? 1020 GLN A CA     1 
ATOM   575   C  C      . GLN A 1 58  ? -59.167  73.604  8.541   1.00 48.50  ? 1020 GLN A C      1 
ATOM   576   O  O      . GLN A 1 58  ? -58.139  74.130  8.982   1.00 47.07  ? 1020 GLN A O      1 
ATOM   577   C  CB     . GLN A 1 58  ? -61.368  74.690  9.046   1.00 52.34  ? 1020 GLN A CB     1 
ATOM   578   C  CG     . GLN A 1 58  ? -60.939  75.637  10.154  1.00 57.89  ? 1020 GLN A CG     1 
ATOM   579   C  CD     . GLN A 1 58  ? -61.767  75.483  11.420  1.00 61.81  ? 1020 GLN A CD     1 
ATOM   580   O  OE1    . GLN A 1 58  ? -62.079  74.370  11.847  1.00 58.69  ? 1020 GLN A OE1    1 
ATOM   581   N  NE2    . GLN A 1 58  ? -62.140  76.609  12.018  1.00 63.62  ? 1020 GLN A NE2    1 
ATOM   582   H  H      . GLN A 1 58  ? -61.725  73.660  6.871   1.00 58.38  ? 1020 GLN A H      1 
ATOM   583   H  HA     . GLN A 1 58  ? -59.925  75.323  7.735   1.00 60.31  ? 1020 GLN A HA     1 
ATOM   584   H  HB2    . GLN A 1 58  ? -62.154  75.067  8.621   1.00 62.81  ? 1020 GLN A HB2    1 
ATOM   585   H  HB3    . GLN A 1 58  ? -61.590  73.838  9.454   1.00 62.81  ? 1020 GLN A HB3    1 
ATOM   586   H  HG2    . GLN A 1 58  ? -60.012  75.460  10.379  1.00 69.47  ? 1020 GLN A HG2    1 
ATOM   587   H  HG3    . GLN A 1 58  ? -61.036  76.551  9.842   1.00 69.47  ? 1020 GLN A HG3    1 
ATOM   588   H  HE21   . GLN A 1 58  ? -61.912  77.369  11.686  1.00 76.34  ? 1020 GLN A HE21   1 
ATOM   589   H  HE22   . GLN A 1 58  ? -62.610  76.578  12.738  1.00 76.34  ? 1020 GLN A HE22   1 
ATOM   590   N  N      . ALA A 1 59  ? -59.332  72.280  8.512   1.00 50.78  ? 1021 ALA A N      1 
ATOM   591   C  CA     . ALA A 1 59  ? -58.278  71.391  8.991   1.00 52.56  ? 1021 ALA A CA     1 
ATOM   592   C  C      . ALA A 1 59  ? -56.989  71.594  8.203   1.00 52.15  ? 1021 ALA A C      1 
ATOM   593   O  O      . ALA A 1 59  ? -55.891  71.530  8.769   1.00 53.84  ? 1021 ALA A O      1 
ATOM   594   C  CB     . ALA A 1 59  ? -58.738  69.937  8.904   1.00 48.91  ? 1021 ALA A CB     1 
ATOM   595   H  H      . ALA A 1 59  ? -60.036  71.878  8.225   1.00 60.94  ? 1021 ALA A H      1 
ATOM   596   H  HA     . ALA A 1 59  ? -58.095  71.593  9.922   1.00 63.07  ? 1021 ALA A HA     1 
ATOM   597   H  HB1    . ALA A 1 59  ? -58.026  69.362  9.226   1.00 58.69  ? 1021 ALA A HB1    1 
ATOM   598   H  HB2    . ALA A 1 59  ? -59.529  69.823  9.454   1.00 58.69  ? 1021 ALA A HB2    1 
ATOM   599   H  HB3    . ALA A 1 59  ? -58.943  69.725  7.980   1.00 58.69  ? 1021 ALA A HB3    1 
ATOM   600   N  N      . ARG A 1 60  ? -57.099  71.842  6.896   1.00 44.75  ? 1022 ARG A N      1 
ATOM   601   C  CA     . ARG A 1 60  ? -55.902  72.076  6.095   1.00 47.79  ? 1022 ARG A CA     1 
ATOM   602   C  C      . ARG A 1 60  ? -55.177  73.333  6.555   1.00 45.72  ? 1022 ARG A C      1 
ATOM   603   O  O      . ARG A 1 60  ? -53.944  73.349  6.650   1.00 45.83  ? 1022 ARG A O      1 
ATOM   604   C  CB     . ARG A 1 60  ? -56.270  72.177  4.611   1.00 44.21  ? 1022 ARG A CB     1 
ATOM   605   C  CG     . ARG A 1 60  ? -56.670  70.844  3.992   1.00 43.54  ? 1022 ARG A CG     1 
ATOM   606   C  CD     . ARG A 1 60  ? -57.228  70.975  2.569   1.00 46.08  ? 1022 ARG A CD     1 
ATOM   607   N  NE     . ARG A 1 60  ? -57.560  69.658  2.030   1.00 44.44  ? 1022 ARG A NE     1 
ATOM   608   C  CZ     . ARG A 1 60  ? -56.773  68.938  1.234   1.00 45.95  ? 1022 ARG A CZ     1 
ATOM   609   N  NH1    . ARG A 1 60  ? -55.595  69.400  0.838   1.00 46.32  1 1022 ARG A NH1    1 
ATOM   610   N  NH2    . ARG A 1 60  ? -57.172  67.743  0.824   1.00 45.98  ? 1022 ARG A NH2    1 
ATOM   611   H  H      . ARG A 1 60  ? -57.839  71.880  6.459   1.00 53.70  ? 1022 ARG A H      1 
ATOM   612   H  HA     . ARG A 1 60  ? -55.297  71.325  6.203   1.00 57.34  ? 1022 ARG A HA     1 
ATOM   613   H  HB2    . ARG A 1 60  ? -57.019  72.786  4.515   1.00 53.05  ? 1022 ARG A HB2    1 
ATOM   614   H  HB3    . ARG A 1 60  ? -55.505  72.515  4.120   1.00 53.05  ? 1022 ARG A HB3    1 
ATOM   615   H  HG2    . ARG A 1 60  ? -55.889  70.269  3.953   1.00 52.24  ? 1022 ARG A HG2    1 
ATOM   616   H  HG3    . ARG A 1 60  ? -57.354  70.434  4.544   1.00 52.24  ? 1022 ARG A HG3    1 
ATOM   617   H  HD2    . ARG A 1 60  ? -58.036  71.513  2.587   1.00 55.29  ? 1022 ARG A HD2    1 
ATOM   618   H  HD3    . ARG A 1 60  ? -56.561  71.383  1.996   1.00 55.29  ? 1022 ARG A HD3    1 
ATOM   619   H  HE     . ARG A 1 60  ? -58.322  69.322  2.243   1.00 53.32  ? 1022 ARG A HE     1 
ATOM   620   H  HH11   . ARG A 1 60  ? -55.325  70.172  1.103   1.00 55.58  ? 1022 ARG A HH11   1 
ATOM   621   H  HH12   . ARG A 1 60  ? -55.098  68.926  0.320   1.00 55.58  ? 1022 ARG A HH12   1 
ATOM   622   H  HH21   . ARG A 1 60  ? -57.938  67.437  1.070   1.00 55.18  ? 1022 ARG A HH21   1 
ATOM   623   H  HH22   . ARG A 1 60  ? -56.672  67.278  0.301   1.00 55.18  ? 1022 ARG A HH22   1 
ATOM   624   N  N      . GLU A 1 61  ? -55.925  74.393  6.864   1.00 45.28  ? 1023 GLU A N      1 
ATOM   625   C  CA     . GLU A 1 61  ? -55.302  75.603  7.387   1.00 47.21  ? 1023 GLU A CA     1 
ATOM   626   C  C      . GLU A 1 61  ? -54.666  75.349  8.748   1.00 48.15  ? 1023 GLU A C      1 
ATOM   627   O  O      . GLU A 1 61  ? -53.595  75.888  9.047   1.00 49.86  ? 1023 GLU A O      1 
ATOM   628   C  CB     . GLU A 1 61  ? -56.335  76.727  7.463   1.00 50.18  ? 1023 GLU A CB     1 
ATOM   629   C  CG     . GLU A 1 61  ? -55.884  77.966  8.233   1.00 55.42  ? 1023 GLU A CG     1 
ATOM   630   C  CD     . GLU A 1 61  ? -54.555  78.519  7.749   1.00 58.17  ? 1023 GLU A CD     1 
ATOM   631   O  OE1    . GLU A 1 61  ? -54.173  78.237  6.595   1.00 56.90  ? 1023 GLU A OE1    1 
ATOM   632   O  OE2    . GLU A 1 61  ? -53.896  79.244  8.524   1.00 61.99  1 1023 GLU A OE2    1 
ATOM   633   H  H      . GLU A 1 61  ? -56.780  74.435  6.782   1.00 54.34  ? 1023 GLU A H      1 
ATOM   634   H  HA     . GLU A 1 61  ? -54.600  75.883  6.778   1.00 56.65  ? 1023 GLU A HA     1 
ATOM   635   H  HB2    . GLU A 1 61  ? -56.553  77.008  6.560   1.00 60.22  ? 1023 GLU A HB2    1 
ATOM   636   H  HB3    . GLU A 1 61  ? -57.131  76.386  7.898   1.00 60.22  ? 1023 GLU A HB3    1 
ATOM   637   H  HG2    . GLU A 1 61  ? -56.552  78.661  8.130   1.00 66.50  ? 1023 GLU A HG2    1 
ATOM   638   H  HG3    . GLU A 1 61  ? -55.788  77.735  9.171   1.00 66.50  ? 1023 GLU A HG3    1 
ATOM   639   N  N      . HIS A 1 62  ? -55.307  74.528  9.585   1.00 51.29  ? 1024 HIS A N      1 
ATOM   640   C  CA     . HIS A 1 62  ? -54.739  74.212  10.892  1.00 52.05  ? 1024 HIS A CA     1 
ATOM   641   C  C      . HIS A 1 62  ? -53.422  73.459  10.752  1.00 49.09  ? 1024 HIS A C      1 
ATOM   642   O  O      . HIS A 1 62  ? -52.496  73.663  11.545  1.00 49.49  ? 1024 HIS A O      1 
ATOM   643   C  CB     . HIS A 1 62  ? -55.736  73.397  11.716  1.00 53.86  ? 1024 HIS A CB     1 
ATOM   644   C  CG     . HIS A 1 62  ? -56.890  74.197  12.238  1.00 61.90  ? 1024 HIS A CG     1 
ATOM   645   N  ND1    . HIS A 1 62  ? -56.878  75.574  12.295  1.00 67.65  ? 1024 HIS A ND1    1 
ATOM   646   C  CD2    . HIS A 1 62  ? -58.092  73.811  12.729  1.00 64.60  ? 1024 HIS A CD2    1 
ATOM   647   C  CE1    . HIS A 1 62  ? -58.022  76.002  12.800  1.00 69.22  ? 1024 HIS A CE1    1 
ATOM   648   N  NE2    . HIS A 1 62  ? -58.776  74.953  13.071  1.00 67.48  ? 1024 HIS A NE2    1 
ATOM   649   H  H      . HIS A 1 62  ? -56.061  74.148  9.420   1.00 61.55  ? 1024 HIS A H      1 
ATOM   650   H  HA     . HIS A 1 62  ? -54.562  75.039  11.368  1.00 62.47  ? 1024 HIS A HA     1 
ATOM   651   H  HB2    . HIS A 1 62  ? -56.095  72.688  11.160  1.00 64.63  ? 1024 HIS A HB2    1 
ATOM   652   H  HB3    . HIS A 1 62  ? -55.273  73.014  12.478  1.00 64.63  ? 1024 HIS A HB3    1 
ATOM   653   H  HD2    . HIS A 1 62  ? -58.397  72.937  12.819  1.00 77.51  ? 1024 HIS A HD2    1 
ATOM   654   H  HE1    . HIS A 1 62  ? -58.256  76.891  12.939  1.00 83.06  ? 1024 HIS A HE1    1 
ATOM   655   H  HE2    . HIS A 1 62  ? -59.568  74.979  13.406  1.00 80.98  ? 1024 HIS A HE2    1 
ATOM   656   N  N      . ILE A 1 63  ? -53.320  72.583  9.750   1.00 46.01  ? 1025 ILE A N      1 
ATOM   657   C  CA     . ILE A 1 63  ? -52.069  71.865  9.509   1.00 48.30  ? 1025 ILE A CA     1 
ATOM   658   C  C      . ILE A 1 63  ? -50.959  72.843  9.142   1.00 51.76  ? 1025 ILE A C      1 
ATOM   659   O  O      . ILE A 1 63  ? -49.870  72.822  9.730   1.00 48.53  ? 1025 ILE A O      1 
ATOM   660   C  CB     . ILE A 1 63  ? -52.269  70.794  8.421   1.00 48.91  ? 1025 ILE A CB     1 
ATOM   661   C  CG1    . ILE A 1 63  ? -53.193  69.688  8.939   1.00 48.06  ? 1025 ILE A CG1    1 
ATOM   662   C  CG2    . ILE A 1 63  ? -50.927  70.210  7.968   1.00 48.53  ? 1025 ILE A CG2    1 
ATOM   663   C  CD1    . ILE A 1 63  ? -53.653  68.712  7.871   1.00 47.99  ? 1025 ILE A CD1    1 
ATOM   664   H  H      . ILE A 1 63  ? -53.953  72.389  9.201   1.00 55.21  ? 1025 ILE A H      1 
ATOM   665   H  HA     . ILE A 1 63  ? -51.807  71.412  10.326  1.00 57.96  ? 1025 ILE A HA     1 
ATOM   666   H  HB     . ILE A 1 63  ? -52.693  71.212  7.655   1.00 58.69  ? 1025 ILE A HB     1 
ATOM   667   H  HG12   . ILE A 1 63  ? -52.721  69.181  9.618   1.00 57.67  ? 1025 ILE A HG12   1 
ATOM   668   H  HG13   . ILE A 1 63  ? -53.983  70.098  9.324   1.00 57.67  ? 1025 ILE A HG13   1 
ATOM   669   H  HG21   . ILE A 1 63  ? -51.088  69.541  7.285   1.00 58.23  ? 1025 ILE A HG21   1 
ATOM   670   H  HG22   . ILE A 1 63  ? -50.377  70.924  7.609   1.00 58.23  ? 1025 ILE A HG22   1 
ATOM   671   H  HG23   . ILE A 1 63  ? -50.486  69.804  8.731   1.00 58.23  ? 1025 ILE A HG23   1 
ATOM   672   H  HD11   . ILE A 1 63  ? -54.230  68.048  8.279   1.00 57.59  ? 1025 ILE A HD11   1 
ATOM   673   H  HD12   . ILE A 1 63  ? -54.139  69.199  7.188   1.00 57.59  ? 1025 ILE A HD12   1 
ATOM   674   H  HD13   . ILE A 1 63  ? -52.876  68.281  7.482   1.00 57.59  ? 1025 ILE A HD13   1 
ATOM   675   N  N      . ARG A 1 64  ? -51.218  73.714  8.160   1.00 48.61  ? 1026 ARG A N      1 
ATOM   676   C  CA     . ARG A 1 64  ? -50.245  74.743  7.805   1.00 50.18  ? 1026 ARG A CA     1 
ATOM   677   C  C      . ARG A 1 64  ? -49.803  75.514  9.042   1.00 54.31  ? 1026 ARG A C      1 
ATOM   678   O  O      . ARG A 1 64  ? -48.609  75.758  9.252   1.00 55.78  ? 1026 ARG A O      1 
ATOM   679   C  CB     . ARG A 1 64  ? -50.847  75.701  6.776   1.00 49.84  ? 1026 ARG A CB     1 
ATOM   680   C  CG     . ARG A 1 64  ? -49.875  76.759  6.263   1.00 51.82  ? 1026 ARG A CG     1 
ATOM   681   C  CD     . ARG A 1 64  ? -50.584  78.045  5.867   1.00 51.19  ? 1026 ARG A CD     1 
ATOM   682   N  NE     . ARG A 1 64  ? -51.216  78.689  7.013   1.00 54.79  ? 1026 ARG A NE     1 
ATOM   683   C  CZ     . ARG A 1 64  ? -50.565  79.402  7.927   1.00 54.56  ? 1026 ARG A CZ     1 
ATOM   684   N  NH1    . ARG A 1 64  ? -49.250  79.564  7.842   1.00 55.88  1 1026 ARG A NH1    1 
ATOM   685   N  NH2    . ARG A 1 64  ? -51.227  79.949  8.937   1.00 54.98  ? 1026 ARG A NH2    1 
ATOM   686   H  H      . ARG A 1 64  ? -51.939  73.727  7.693   1.00 58.34  ? 1026 ARG A H      1 
ATOM   687   H  HA     . ARG A 1 64  ? -49.464  74.325  7.411   1.00 60.21  ? 1026 ARG A HA     1 
ATOM   688   H  HB2    . ARG A 1 64  ? -51.153  75.186  6.013   1.00 59.80  ? 1026 ARG A HB2    1 
ATOM   689   H  HB3    . ARG A 1 64  ? -51.598  76.162  7.182   1.00 59.80  ? 1026 ARG A HB3    1 
ATOM   690   H  HG2    . ARG A 1 64  ? -49.236  76.969  6.962   1.00 62.19  ? 1026 ARG A HG2    1 
ATOM   691   H  HG3    . ARG A 1 64  ? -49.414  76.415  5.482   1.00 62.19  ? 1026 ARG A HG3    1 
ATOM   692   H  HD2    . ARG A 1 64  ? -49.939  78.663  5.490   1.00 61.43  ? 1026 ARG A HD2    1 
ATOM   693   H  HD3    . ARG A 1 64  ? -51.274  77.842  5.215   1.00 61.43  ? 1026 ARG A HD3    1 
ATOM   694   H  HE     . ARG A 1 64  ? -52.067  78.601  7.104   1.00 65.75  ? 1026 ARG A HE     1 
ATOM   695   H  HH11   . ARG A 1 64  ? -48.815  79.210  7.190   1.00 67.06  ? 1026 ARG A HH11   1 
ATOM   696   H  HH12   . ARG A 1 64  ? -48.834  80.025  8.437   1.00 67.06  ? 1026 ARG A HH12   1 
ATOM   697   H  HH21   . ARG A 1 64  ? -52.079  79.846  8.998   1.00 65.98  ? 1026 ARG A HH21   1 
ATOM   698   H  HH22   . ARG A 1 64  ? -50.806  80.408  9.529   1.00 65.98  ? 1026 ARG A HH22   1 
ATOM   699   N  N      . GLN A 1 65  ? -50.766  75.899  9.879   1.00 50.20  ? 1027 GLN A N      1 
ATOM   700   C  CA     . GLN A 1 65  ? -50.460  76.681  11.070  1.00 53.51  ? 1027 GLN A CA     1 
ATOM   701   C  C      . GLN A 1 65  ? -49.573  75.894  12.026  1.00 52.02  ? 1027 GLN A C      1 
ATOM   702   O  O      . GLN A 1 65  ? -48.601  76.429  12.571  1.00 47.09  ? 1027 GLN A O      1 
ATOM   703   C  CB     . GLN A 1 65  ? -51.765  77.091  11.749  1.00 55.28  ? 1027 GLN A CB     1 
ATOM   704   C  CG     . GLN A 1 65  ? -51.627  78.166  12.803  1.00 64.19  ? 1027 GLN A CG     1 
ATOM   705   C  CD     . GLN A 1 65  ? -52.976  78.694  13.257  1.00 70.80  ? 1027 GLN A CD     1 
ATOM   706   O  OE1    . GLN A 1 65  ? -54.015  78.360  12.680  1.00 70.08  ? 1027 GLN A OE1    1 
ATOM   707   N  NE2    . GLN A 1 65  ? -52.969  79.511  14.304  1.00 76.71  ? 1027 GLN A NE2    1 
ATOM   708   H  H      . GLN A 1 65  ? -51.601  75.720  9.779   1.00 60.24  ? 1027 GLN A H      1 
ATOM   709   H  HA     . GLN A 1 65  ? -49.986  77.487  10.810  1.00 64.21  ? 1027 GLN A HA     1 
ATOM   710   H  HB2    . GLN A 1 65  ? -52.375  77.422  11.071  1.00 66.34  ? 1027 GLN A HB2    1 
ATOM   711   H  HB3    . GLN A 1 65  ? -52.148  76.309  12.177  1.00 66.34  ? 1027 GLN A HB3    1 
ATOM   712   H  HG2    . GLN A 1 65  ? -51.171  77.798  13.576  1.00 77.03  ? 1027 GLN A HG2    1 
ATOM   713   H  HG3    . GLN A 1 65  ? -51.120  78.907  12.437  1.00 77.03  ? 1027 GLN A HG3    1 
ATOM   714   H  HE21   . GLN A 1 65  ? -52.226  79.714  14.686  1.00 92.06  ? 1027 GLN A HE21   1 
ATOM   715   H  HE22   . GLN A 1 65  ? -53.708  79.838  14.600  1.00 92.06  ? 1027 GLN A HE22   1 
ATOM   716   N  N      . ASN A 1 66  ? -49.885  74.612  12.224  1.00 55.01  ? 1028 ASN A N      1 
ATOM   717   C  CA     . ASN A 1 66  ? -49.103  73.771  13.122  1.00 54.73  ? 1028 ASN A CA     1 
ATOM   718   C  C      . ASN A 1 66  ? -47.684  73.566  12.602  1.00 55.62  ? 1028 ASN A C      1 
ATOM   719   O  O      . ASN A 1 66  ? -46.714  73.671  13.361  1.00 61.08  ? 1028 ASN A O      1 
ATOM   720   C  CB     . ASN A 1 66  ? -49.807  72.429  13.307  1.00 56.51  ? 1028 ASN A CB     1 
ATOM   721   C  CG     . ASN A 1 66  ? -48.985  71.450  14.111  1.00 59.94  ? 1028 ASN A CG     1 
ATOM   722   O  OD1    . ASN A 1 66  ? -48.112  70.766  13.577  1.00 58.69  ? 1028 ASN A OD1    1 
ATOM   723   N  ND2    . ASN A 1 66  ? -49.262  71.374  15.407  1.00 64.77  ? 1028 ASN A ND2    1 
ATOM   724   H  H      . ASN A 1 66  ? -50.545  74.208  11.848  1.00 66.02  ? 1028 ASN A H      1 
ATOM   725   H  HA     . ASN A 1 66  ? -49.046  74.202  13.989  1.00 65.68  ? 1028 ASN A HA     1 
ATOM   726   H  HB2    . ASN A 1 66  ? -50.645  72.572  13.773  1.00 67.81  ? 1028 ASN A HB2    1 
ATOM   727   H  HB3    . ASN A 1 66  ? -49.974  72.036  12.436  1.00 67.81  ? 1028 ASN A HB3    1 
ATOM   728   H  HD21   . ASN A 1 66  ? -48.822  70.832  15.909  1.00 77.73  ? 1028 ASN A HD21   1 
ATOM   729   H  HD22   . ASN A 1 66  ? -49.880  71.868  15.744  1.00 77.73  ? 1028 ASN A HD22   1 
ATOM   730   N  N      . LEU A 1 67  ? -47.539  73.262  11.309  1.00 55.32  ? 1029 LEU A N      1 
ATOM   731   C  CA     . LEU A 1 67  ? -46.209  73.033  10.752  1.00 52.55  ? 1029 LEU A CA     1 
ATOM   732   C  C      . LEU A 1 67  ? -45.355  74.293  10.827  1.00 52.11  ? 1029 LEU A C      1 
ATOM   733   O  O      . LEU A 1 67  ? -44.146  74.221  11.077  1.00 53.47  ? 1029 LEU A O      1 
ATOM   734   C  CB     . LEU A 1 67  ? -46.322  72.554  9.305   1.00 49.38  ? 1029 LEU A CB     1 
ATOM   735   C  CG     . LEU A 1 67  ? -46.979  71.191  9.074   1.00 50.33  ? 1029 LEU A CG     1 
ATOM   736   C  CD1    . LEU A 1 67  ? -47.185  70.947  7.577   1.00 49.32  ? 1029 LEU A CD1    1 
ATOM   737   C  CD2    . LEU A 1 67  ? -46.156  70.068  9.690   1.00 49.26  ? 1029 LEU A CD2    1 
ATOM   738   H  H      . LEU A 1 67  ? -48.184  73.185  10.746  1.00 66.39  ? 1029 LEU A H      1 
ATOM   739   H  HA     . LEU A 1 67  ? -45.766  72.339  11.264  1.00 63.06  ? 1029 LEU A HA     1 
ATOM   740   H  HB2    . LEU A 1 67  ? -46.840  73.208  8.810   1.00 59.26  ? 1029 LEU A HB2    1 
ATOM   741   H  HB3    . LEU A 1 67  ? -45.428  72.507  8.932   1.00 59.26  ? 1029 LEU A HB3    1 
ATOM   742   H  HG     . LEU A 1 67  ? -47.851  71.187  9.498   1.00 60.40  ? 1029 LEU A HG     1 
ATOM   743   H  HD11   . LEU A 1 67  ? -47.601  70.080  7.453   1.00 59.18  ? 1029 LEU A HD11   1 
ATOM   744   H  HD12   . LEU A 1 67  ? -47.757  71.643  7.220   1.00 59.18  ? 1029 LEU A HD12   1 
ATOM   745   H  HD13   . LEU A 1 67  ? -46.323  70.966  7.133   1.00 59.18  ? 1029 LEU A HD13   1 
ATOM   746   H  HD21   . LEU A 1 67  ? -46.601  69.223  9.525   1.00 59.11  ? 1029 LEU A HD21   1 
ATOM   747   H  HD22   . LEU A 1 67  ? -45.275  70.064  9.284   1.00 59.11  ? 1029 LEU A HD22   1 
ATOM   748   H  HD23   . LEU A 1 67  ? -46.079  70.221  10.645  1.00 59.11  ? 1029 LEU A HD23   1 
ATOM   749   N  N      . GLU A 1 68  ? -45.966  75.457  10.602  1.00 49.86  ? 1030 GLU A N      1 
ATOM   750   C  CA     . GLU A 1 68  ? -45.223  76.711  10.657  1.00 52.29  ? 1030 GLU A CA     1 
ATOM   751   C  C      . GLU A 1 68  ? -44.652  76.954  12.052  1.00 52.60  ? 1030 GLU A C      1 
ATOM   752   O  O      . GLU A 1 68  ? -43.491  77.357  12.196  1.00 51.37  ? 1030 GLU A O      1 
ATOM   753   C  CB     . GLU A 1 68  ? -46.133  77.864  10.230  1.00 50.19  ? 1030 GLU A CB     1 
ATOM   754   C  CG     . GLU A 1 68  ? -45.430  79.192  10.038  1.00 53.26  ? 1030 GLU A CG     1 
ATOM   755   C  CD     . GLU A 1 68  ? -46.392  80.299  9.648   1.00 58.10  ? 1030 GLU A CD     1 
ATOM   756   O  OE1    . GLU A 1 68  ? -47.291  80.621  10.456  1.00 60.80  ? 1030 GLU A OE1    1 
ATOM   757   O  OE2    . GLU A 1 68  ? -46.256  80.840  8.530   1.00 57.95  1 1030 GLU A OE2    1 
ATOM   758   H  H      . GLU A 1 68  ? -46.801  75.546  10.417  1.00 59.84  ? 1030 GLU A H      1 
ATOM   759   H  HA     . GLU A 1 68  ? -44.481  76.667  10.033  1.00 62.75  ? 1030 GLU A HA     1 
ATOM   760   H  HB2    . GLU A 1 68  ? -46.553  77.630  9.388   1.00 60.22  ? 1030 GLU A HB2    1 
ATOM   761   H  HB3    . GLU A 1 68  ? -46.813  77.988  10.910  1.00 60.22  ? 1030 GLU A HB3    1 
ATOM   762   H  HG2    . GLU A 1 68  ? -44.998  79.446  10.869  1.00 63.92  ? 1030 GLU A HG2    1 
ATOM   763   H  HG3    . GLU A 1 68  ? -44.770  79.103  9.333   1.00 63.92  ? 1030 GLU A HG3    1 
ATOM   764   N  N      . SER A 1 69  ? -45.454  76.720  13.094  1.00 53.46  ? 1031 SER A N      1 
ATOM   765   C  CA     . SER A 1 69  ? -44.962  76.895  14.458  1.00 59.00  ? 1031 SER A CA     1 
ATOM   766   C  C      . SER A 1 69  ? -43.880  75.875  14.791  1.00 56.13  ? 1031 SER A C      1 
ATOM   767   O  O      . SER A 1 69  ? -42.871  76.216  15.419  1.00 53.24  ? 1031 SER A O      1 
ATOM   768   C  CB     . SER A 1 69  ? -46.116  76.794  15.454  1.00 59.96  ? 1031 SER A CB     1 
ATOM   769   O  OG     . SER A 1 69  ? -47.067  77.821  15.233  1.00 63.04  ? 1031 SER A OG     1 
ATOM   770   H  H      . SER A 1 69  ? -46.273  76.464  13.038  1.00 64.15  ? 1031 SER A H      1 
ATOM   771   H  HA     . SER A 1 69  ? -44.573  77.779  14.541  1.00 70.80  ? 1031 SER A HA     1 
ATOM   772   H  HB2    . SER A 1 69  ? -46.550  75.934  15.347  1.00 71.95  ? 1031 SER A HB2    1 
ATOM   773   H  HB3    . SER A 1 69  ? -45.764  76.879  16.354  1.00 71.95  ? 1031 SER A HB3    1 
ATOM   774   H  HG     . SER A 1 69  ? -47.695  77.755  15.786  1.00 75.65  ? 1031 SER A HG     1 
ATOM   775   N  N      . PHE A 1 70  ? -44.068  74.621  14.379  1.00 55.51  ? 1032 PHE A N      1 
ATOM   776   C  CA     . PHE A 1 70  ? -43.077  73.595  14.682  1.00 54.10  ? 1032 PHE A CA     1 
ATOM   777   C  C      . PHE A 1 70  ? -41.752  73.905  13.998  1.00 54.77  ? 1032 PHE A C      1 
ATOM   778   O  O      . PHE A 1 70  ? -40.684  73.824  14.617  1.00 56.10  ? 1032 PHE A O      1 
ATOM   779   C  CB     . PHE A 1 70  ? -43.591  72.221  14.259  1.00 49.05  ? 1032 PHE A CB     1 
ATOM   780   C  CG     . PHE A 1 70  ? -42.623  71.111  14.537  1.00 50.43  ? 1032 PHE A CG     1 
ATOM   781   C  CD1    . PHE A 1 70  ? -42.608  70.483  15.772  1.00 50.79  ? 1032 PHE A CD1    1 
ATOM   782   C  CD2    . PHE A 1 70  ? -41.719  70.706  13.573  1.00 50.12  ? 1032 PHE A CD2    1 
ATOM   783   C  CE1    . PHE A 1 70  ? -41.716  69.469  16.036  1.00 48.59  ? 1032 PHE A CE1    1 
ATOM   784   C  CE2    . PHE A 1 70  ? -40.822  69.690  13.833  1.00 52.13  ? 1032 PHE A CE2    1 
ATOM   785   C  CZ     . PHE A 1 70  ? -40.821  69.073  15.070  1.00 51.28  ? 1032 PHE A CZ     1 
ATOM   786   H  H      . PHE A 1 70  ? -44.748  74.344  13.930  1.00 66.61  ? 1032 PHE A H      1 
ATOM   787   H  HA     . PHE A 1 70  ? -42.924  73.577  15.640  1.00 64.92  ? 1032 PHE A HA     1 
ATOM   788   H  HB2    . PHE A 1 70  ? -44.410  72.029  14.742  1.00 58.86  ? 1032 PHE A HB2    1 
ATOM   789   H  HB3    . PHE A 1 70  ? -43.766  72.231  13.305  1.00 58.86  ? 1032 PHE A HB3    1 
ATOM   790   H  HD1    . PHE A 1 70  ? -43.210  70.749  16.430  1.00 60.95  ? 1032 PHE A HD1    1 
ATOM   791   H  HD2    . PHE A 1 70  ? -41.716  71.120  12.741  1.00 60.15  ? 1032 PHE A HD2    1 
ATOM   792   H  HE1    . PHE A 1 70  ? -41.717  69.054  16.868  1.00 58.31  ? 1032 PHE A HE1    1 
ATOM   793   H  HE2    . PHE A 1 70  ? -40.219  69.422  13.178  1.00 62.55  ? 1032 PHE A HE2    1 
ATOM   794   H  HZ     . PHE A 1 70  ? -40.219  68.386  15.246  1.00 61.54  ? 1032 PHE A HZ     1 
ATOM   795   N  N      . ILE A 1 71  ? -41.800  74.263  12.714  1.00 52.44  ? 1033 ILE A N      1 
ATOM   796   C  CA     . ILE A 1 71  ? -40.569  74.567  11.995  1.00 53.89  ? 1033 ILE A CA     1 
ATOM   797   C  C      . ILE A 1 71  ? -39.927  75.831  12.548  1.00 53.93  ? 1033 ILE A C      1 
ATOM   798   O  O      . ILE A 1 71  ? -38.699  75.978  12.514  1.00 55.45  ? 1033 ILE A O      1 
ATOM   799   C  CB     . ILE A 1 71  ? -40.862  74.691  10.486  1.00 52.99  ? 1033 ILE A CB     1 
ATOM   800   C  CG1    . ILE A 1 71  ? -41.286  73.335  9.917   1.00 49.60  ? 1033 ILE A CG1    1 
ATOM   801   C  CG2    . ILE A 1 71  ? -39.643  75.233  9.736   1.00 54.20  ? 1033 ILE A CG2    1 
ATOM   802   C  CD1    . ILE A 1 71  ? -41.842  73.405  8.518   1.00 47.73  ? 1033 ILE A CD1    1 
ATOM   803   H  H      . ILE A 1 71  ? -42.519  74.336  12.247  1.00 62.93  ? 1033 ILE A H      1 
ATOM   804   H  HA     . ILE A 1 71  ? -39.944  73.835  12.118  1.00 64.66  ? 1033 ILE A HA     1 
ATOM   805   H  HB     . ILE A 1 71  ? -41.596  75.315  10.368  1.00 63.58  ? 1033 ILE A HB     1 
ATOM   806   H  HG12   . ILE A 1 71  ? -40.513  72.749  9.899   1.00 59.51  ? 1033 ILE A HG12   1 
ATOM   807   H  HG13   . ILE A 1 71  ? -41.972  72.957  10.490  1.00 59.51  ? 1033 ILE A HG13   1 
ATOM   808   H  HG21   . ILE A 1 71  ? -39.857  75.300  8.792   1.00 65.04  ? 1033 ILE A HG21   1 
ATOM   809   H  HG22   . ILE A 1 71  ? -39.419  76.109  10.088  1.00 65.04  ? 1033 ILE A HG22   1 
ATOM   810   H  HG23   . ILE A 1 71  ? -38.898  74.624  9.864   1.00 65.04  ? 1033 ILE A HG23   1 
ATOM   811   H  HD11   . ILE A 1 71  ? -42.086  72.511  8.231   1.00 57.28  ? 1033 ILE A HD11   1 
ATOM   812   H  HD12   . ILE A 1 71  ? -42.625  73.978  8.518   1.00 57.28  ? 1033 ILE A HD12   1 
ATOM   813   H  HD13   . ILE A 1 71  ? -41.165  73.770  7.927   1.00 57.28  ? 1033 ILE A HD13   1 
ATOM   814   N  N      . ARG A 1 72  ? -40.731  76.759  13.070  1.00 55.88  ? 1034 ARG A N      1 
ATOM   815   C  CA     . ARG A 1 72  ? -40.183  77.992  13.620  1.00 60.33  ? 1034 ARG A CA     1 
ATOM   816   C  C      . ARG A 1 72  ? -39.349  77.749  14.868  1.00 61.22  ? 1034 ARG A C      1 
ATOM   817   O  O      . ARG A 1 72  ? -38.530  78.603  15.225  1.00 66.37  ? 1034 ARG A O      1 
ATOM   818   C  CB     . ARG A 1 72  ? -41.305  78.978  13.933  1.00 60.57  ? 1034 ARG A CB     1 
ATOM   819   C  CG     . ARG A 1 72  ? -41.677  79.851  12.758  1.00 62.68  ? 1034 ARG A CG     1 
ATOM   820   C  CD     . ARG A 1 72  ? -42.842  80.753  13.085  1.00 66.46  ? 1034 ARG A CD     1 
ATOM   821   N  NE     . ARG A 1 72  ? -43.181  81.612  11.958  1.00 71.39  ? 1034 ARG A NE     1 
ATOM   822   C  CZ     . ARG A 1 72  ? -44.266  82.376  11.896  1.00 75.48  ? 1034 ARG A CZ     1 
ATOM   823   N  NH1    . ARG A 1 72  ? -45.134  82.394  12.900  1.00 76.12  1 1034 ARG A NH1    1 
ATOM   824   N  NH2    . ARG A 1 72  ? -44.485  83.123  10.822  1.00 77.88  ? 1034 ARG A NH2    1 
ATOM   825   H  H      . ARG A 1 72  ? -41.588  76.697  13.116  1.00 67.05  ? 1034 ARG A H      1 
ATOM   826   H  HA     . ARG A 1 72  ? -39.607  78.401  12.955  1.00 72.40  ? 1034 ARG A HA     1 
ATOM   827   H  HB2    . ARG A 1 72  ? -42.095  78.481  14.198  1.00 72.69  ? 1034 ARG A HB2    1 
ATOM   828   H  HB3    . ARG A 1 72  ? -41.022  79.558  14.657  1.00 72.69  ? 1034 ARG A HB3    1 
ATOM   829   H  HG2    . ARG A 1 72  ? -40.919  80.407  12.520  1.00 75.22  ? 1034 ARG A HG2    1 
ATOM   830   H  HG3    . ARG A 1 72  ? -41.929  79.288  12.009  1.00 75.22  ? 1034 ARG A HG3    1 
ATOM   831   H  HD2    . ARG A 1 72  ? -43.618  80.210  13.298  1.00 79.76  ? 1034 ARG A HD2    1 
ATOM   832   H  HD3    . ARG A 1 72  ? -42.609  81.317  13.839  1.00 79.76  ? 1034 ARG A HD3    1 
ATOM   833   H  HE     . ARG A 1 72  ? -42.641  81.626  11.289  1.00 85.67  ? 1034 ARG A HE     1 
ATOM   834   H  HH11   . ARG A 1 72  ? -44.995  81.910  13.597  1.00 91.34  ? 1034 ARG A HH11   1 
ATOM   835   H  HH12   . ARG A 1 72  ? -45.834  82.891  12.854  1.00 91.34  ? 1034 ARG A HH12   1 
ATOM   836   H  HH21   . ARG A 1 72  ? -43.924  83.113  10.170  1.00 93.46  ? 1034 ARG A HH21   1 
ATOM   837   H  HH22   . ARG A 1 72  ? -45.186  83.619  10.779  1.00 93.46  ? 1034 ARG A HH22   1 
ATOM   838   N  N      . GLN A 1 73  ? -39.529  76.608  15.535  1.00 61.58  ? 1035 GLN A N      1 
ATOM   839   C  CA     . GLN A 1 73  ? -38.702  76.300  16.695  1.00 67.03  ? 1035 GLN A CA     1 
ATOM   840   C  C      . GLN A 1 73  ? -37.233  76.243  16.311  1.00 67.62  ? 1035 GLN A C      1 
ATOM   841   O  O      . GLN A 1 73  ? -36.368  76.644  17.098  1.00 68.09  ? 1035 GLN A O      1 
ATOM   842   C  CB     . GLN A 1 73  ? -39.144  74.979  17.323  1.00 66.61  ? 1035 GLN A CB     1 
ATOM   843   C  CG     . GLN A 1 73  ? -40.564  74.997  17.864  1.00 70.97  ? 1035 GLN A CG     1 
ATOM   844   C  CD     . GLN A 1 73  ? -40.987  73.659  18.443  1.00 74.94  ? 1035 GLN A CD     1 
ATOM   845   O  OE1    . GLN A 1 73  ? -40.186  72.727  18.534  1.00 76.42  ? 1035 GLN A OE1    1 
ATOM   846   N  NE2    . GLN A 1 73  ? -42.255  73.555  18.828  1.00 75.46  ? 1035 GLN A NE2    1 
ATOM   847   H  H      . GLN A 1 73  ? -40.112  76.007  15.338  1.00 73.90  ? 1035 GLN A H      1 
ATOM   848   H  HA     . GLN A 1 73  ? -38.813  77.000  17.358  1.00 80.44  ? 1035 GLN A HA     1 
ATOM   849   H  HB2    . GLN A 1 73  ? -39.092  74.281  16.650  1.00 79.94  ? 1035 GLN A HB2    1 
ATOM   850   H  HB3    . GLN A 1 73  ? -38.549  74.769  18.060  1.00 79.94  ? 1035 GLN A HB3    1 
ATOM   851   H  HG2    . GLN A 1 73  ? -40.626  75.662  18.568  1.00 85.16  ? 1035 GLN A HG2    1 
ATOM   852   H  HG3    . GLN A 1 73  ? -41.174  75.219  17.143  1.00 85.16  ? 1035 GLN A HG3    1 
ATOM   853   H  HE21   . GLN A 1 73  ? -42.787  74.225  18.742  1.00 90.55  ? 1035 GLN A HE21   1 
ATOM   854   H  HE22   . GLN A 1 73  ? -42.544  72.817  19.162  1.00 90.55  ? 1035 GLN A HE22   1 
ATOM   855   N  N      . ASP A 1 74  ? -36.934  75.764  15.106  1.00 70.34  ? 1036 ASP A N      1 
ATOM   856   C  CA     . ASP A 1 74  ? -35.561  75.679  14.631  1.00 70.83  ? 1036 ASP A CA     1 
ATOM   857   C  C      . ASP A 1 74  ? -35.212  76.778  13.644  1.00 66.64  ? 1036 ASP A C      1 
ATOM   858   O  O      . ASP A 1 74  ? -34.058  77.219  13.605  1.00 64.27  ? 1036 ASP A O      1 
ATOM   859   C  CB     . ASP A 1 74  ? -35.322  74.332  13.941  1.00 70.59  ? 1036 ASP A CB     1 
ATOM   860   C  CG     . ASP A 1 74  ? -35.497  73.155  14.873  1.00 74.53  ? 1036 ASP A CG     1 
ATOM   861   O  OD1    . ASP A 1 74  ? -36.640  72.662  14.995  1.00 74.76  ? 1036 ASP A OD1    1 
ATOM   862   O  OD2    . ASP A 1 74  ? -34.494  72.718  15.476  1.00 76.58  1 1036 ASP A OD2    1 
ATOM   863   H  H      . ASP A 1 74  ? -37.516  75.479  14.541  1.00 84.40  ? 1036 ASP A H      1 
ATOM   864   H  HA     . ASP A 1 74  ? -34.957  75.746  15.387  1.00 85.00  ? 1036 ASP A HA     1 
ATOM   865   H  HB2    . ASP A 1 74  ? -35.954  74.233  13.212  1.00 84.71  ? 1036 ASP A HB2    1 
ATOM   866   H  HB3    . ASP A 1 74  ? -34.415  74.309  13.598  1.00 84.71  ? 1036 ASP A HB3    1 
ATOM   867   N  N      . PHE A 1 75  ? -36.185  77.244  12.864  1.00 65.20  ? 1037 PHE A N      1 
ATOM   868   C  CA     . PHE A 1 75  ? -35.965  78.264  11.841  1.00 63.20  ? 1037 PHE A CA     1 
ATOM   869   C  C      . PHE A 1 75  ? -36.954  79.403  12.043  1.00 61.24  ? 1037 PHE A C      1 
ATOM   870   O  O      . PHE A 1 75  ? -37.968  79.494  11.337  1.00 59.65  ? 1037 PHE A O      1 
ATOM   871   C  CB     . PHE A 1 75  ? -36.086  77.647  10.449  1.00 57.37  ? 1037 PHE A CB     1 
ATOM   872   C  CG     . PHE A 1 75  ? -35.056  76.584  10.175  1.00 58.31  ? 1037 PHE A CG     1 
ATOM   873   C  CD1    . PHE A 1 75  ? -33.781  76.678  10.712  1.00 58.69  ? 1037 PHE A CD1    1 
ATOM   874   C  CD2    . PHE A 1 75  ? -35.370  75.479  9.400   1.00 57.23  ? 1037 PHE A CD2    1 
ATOM   875   C  CE1    . PHE A 1 75  ? -32.836  75.702  10.473  1.00 60.28  ? 1037 PHE A CE1    1 
ATOM   876   C  CE2    . PHE A 1 75  ? -34.427  74.497  9.156   1.00 57.93  ? 1037 PHE A CE2    1 
ATOM   877   C  CZ     . PHE A 1 75  ? -33.157  74.609  9.695   1.00 60.81  ? 1037 PHE A CZ     1 
ATOM   878   H  H      . PHE A 1 75  ? -37.001  76.977  12.910  1.00 78.24  ? 1037 PHE A H      1 
ATOM   879   H  HA     . PHE A 1 75  ? -35.068  78.622  11.937  1.00 75.84  ? 1037 PHE A HA     1 
ATOM   880   H  HB2    . PHE A 1 75  ? -36.963  77.242  10.360  1.00 68.85  ? 1037 PHE A HB2    1 
ATOM   881   H  HB3    . PHE A 1 75  ? -35.976  78.345  9.785   1.00 68.85  ? 1037 PHE A HB3    1 
ATOM   882   H  HD1    . PHE A 1 75  ? -33.558  77.413  11.238  1.00 70.42  ? 1037 PHE A HD1    1 
ATOM   883   H  HD2    . PHE A 1 75  ? -36.222  75.399  9.036   1.00 68.68  ? 1037 PHE A HD2    1 
ATOM   884   H  HE1    . PHE A 1 75  ? -31.983  75.780  10.836  1.00 72.33  ? 1037 PHE A HE1    1 
ATOM   885   H  HE2    . PHE A 1 75  ? -34.646  73.761  8.631   1.00 69.52  ? 1037 PHE A HE2    1 
ATOM   886   H  HZ     . PHE A 1 75  ? -32.522  73.950  9.532   1.00 72.97  ? 1037 PHE A HZ     1 
ATOM   887   N  N      . PRO A 1 76  ? -36.703  80.281  13.011  1.00 68.16  ? 1038 PRO A N      1 
ATOM   888   C  CA     . PRO A 1 76  ? -37.617  81.405  13.227  1.00 71.43  ? 1038 PRO A CA     1 
ATOM   889   C  C      . PRO A 1 76  ? -37.710  82.267  11.979  1.00 68.86  ? 1038 PRO A C      1 
ATOM   890   O  O      . PRO A 1 76  ? -36.762  82.377  11.197  1.00 73.18  ? 1038 PRO A O      1 
ATOM   891   C  CB     . PRO A 1 76  ? -36.988  82.166  14.401  1.00 71.10  ? 1038 PRO A CB     1 
ATOM   892   C  CG     . PRO A 1 76  ? -35.570  81.739  14.426  1.00 71.59  ? 1038 PRO A CG     1 
ATOM   893   C  CD     . PRO A 1 76  ? -35.545  80.332  13.920  1.00 72.02  ? 1038 PRO A CD     1 
ATOM   894   H  HA     . PRO A 1 76  ? -38.499  81.089  13.476  1.00 85.71  ? 1038 PRO A HA     1 
ATOM   895   H  HB2    . PRO A 1 76  ? -37.055  83.121  14.245  1.00 85.32  ? 1038 PRO A HB2    1 
ATOM   896   H  HB3    . PRO A 1 76  ? -37.434  81.921  15.226  1.00 85.32  ? 1038 PRO A HB3    1 
ATOM   897   H  HG2    . PRO A 1 76  ? -35.047  82.317  13.848  1.00 85.91  ? 1038 PRO A HG2    1 
ATOM   898   H  HG3    . PRO A 1 76  ? -35.236  81.778  15.336  1.00 85.91  ? 1038 PRO A HG3    1 
ATOM   899   H  HD2    . PRO A 1 76  ? -34.723  80.162  13.432  1.00 86.43  ? 1038 PRO A HD2    1 
ATOM   900   H  HD3    . PRO A 1 76  ? -35.661  79.706  14.652  1.00 86.43  ? 1038 PRO A HD3    1 
ATOM   901   N  N      . GLY A 1 77  ? -38.884  82.852  11.780  1.00 63.46  ? 1039 GLY A N      1 
ATOM   902   C  CA     . GLY A 1 77  ? -39.154  83.613  10.582  1.00 64.93  ? 1039 GLY A CA     1 
ATOM   903   C  C      . GLY A 1 77  ? -39.582  82.783  9.395   1.00 60.92  ? 1039 GLY A C      1 
ATOM   904   O  O      . GLY A 1 77  ? -39.803  83.345  8.314   1.00 59.69  ? 1039 GLY A O      1 
ATOM   905   H  H      . GLY A 1 77  ? -39.543  82.820  12.331  1.00 76.16  ? 1039 GLY A H      1 
ATOM   906   H  HA2    . GLY A 1 77  ? -39.857  84.255  10.768  1.00 77.92  ? 1039 GLY A HA2    1 
ATOM   907   H  HA3    . GLY A 1 77  ? -38.356  84.103  10.333  1.00 77.92  ? 1039 GLY A HA3    1 
ATOM   908   N  N      . THR A 1 78  ? -39.686  81.465  9.550   1.00 58.54  ? 1040 THR A N      1 
ATOM   909   C  CA     . THR A 1 78  ? -40.256  80.636  8.500   1.00 58.12  ? 1040 THR A CA     1 
ATOM   910   C  C      . THR A 1 78  ? -41.695  81.065  8.251   1.00 60.50  ? 1040 THR A C      1 
ATOM   911   O  O      . THR A 1 78  ? -42.445  81.351  9.188   1.00 60.04  ? 1040 THR A O      1 
ATOM   912   C  CB     . THR A 1 78  ? -40.199  79.157  8.899   1.00 55.34  ? 1040 THR A CB     1 
ATOM   913   O  OG1    . THR A 1 78  ? -38.846  78.692  8.835   1.00 55.60  ? 1040 THR A OG1    1 
ATOM   914   C  CG2    . THR A 1 78  ? -41.064  78.299  7.979   1.00 53.21  ? 1040 THR A CG2    1 
ATOM   915   H  H      . THR A 1 78  ? -39.434  81.032  10.249  1.00 70.25  ? 1040 THR A H      1 
ATOM   916   H  HA     . THR A 1 78  ? -39.751  80.755  7.681   1.00 69.74  ? 1040 THR A HA     1 
ATOM   917   H  HB     . THR A 1 78  ? -40.529  79.058  9.806   1.00 66.41  ? 1040 THR A HB     1 
ATOM   918   H  HG1    . THR A 1 78  ? -38.364  79.137  9.360   1.00 66.72  ? 1040 THR A HG1    1 
ATOM   919   H  HG21   . THR A 1 78  ? -41.013  77.368  8.249   1.00 63.85  ? 1040 THR A HG21   1 
ATOM   920   H  HG22   . THR A 1 78  ? -41.988  78.590  8.025   1.00 63.85  ? 1040 THR A HG22   1 
ATOM   921   H  HG23   . THR A 1 78  ? -40.753  78.378  7.063   1.00 63.85  ? 1040 THR A HG23   1 
ATOM   922   N  N      . LYS A 1 79  ? -42.083  81.119  6.982   1.00 66.50  ? 1041 LYS A N      1 
ATOM   923   C  CA     . LYS A 1 79  ? -43.472  81.350  6.615   1.00 69.69  ? 1041 LYS A CA     1 
ATOM   924   C  C      . LYS A 1 79  ? -43.927  80.231  5.694   1.00 64.13  ? 1041 LYS A C      1 
ATOM   925   O  O      . LYS A 1 79  ? -43.262  79.936  4.696   1.00 65.37  ? 1041 LYS A O      1 
ATOM   926   C  CB     . LYS A 1 79  ? -43.666  82.706  5.932   1.00 73.32  ? 1041 LYS A CB     1 
ATOM   927   C  CG     . LYS A 1 79  ? -45.114  82.972  5.541   1.00 77.18  ? 1041 LYS A CG     1 
ATOM   928   C  CD     . LYS A 1 79  ? -45.288  84.304  4.837   1.00 81.06  ? 1041 LYS A CD     1 
ATOM   929   C  CE     . LYS A 1 79  ? -46.708  84.455  4.309   1.00 82.11  ? 1041 LYS A CE     1 
ATOM   930   N  NZ     . LYS A 1 79  ? -46.922  85.763  3.632   1.00 85.31  1 1041 LYS A NZ     1 
ATOM   931   H  H      . LYS A 1 79  ? -41.555  81.025  6.310   1.00 79.80  ? 1041 LYS A H      1 
ATOM   932   H  HA     . LYS A 1 79  ? -44.023  81.330  7.414   1.00 83.63  ? 1041 LYS A HA     1 
ATOM   933   H  HB2    . LYS A 1 79  ? -43.386  83.408  6.539   1.00 87.98  ? 1041 LYS A HB2    1 
ATOM   934   H  HB3    . LYS A 1 79  ? -43.129  82.732  5.125   1.00 87.98  ? 1041 LYS A HB3    1 
ATOM   935   H  HG2    . LYS A 1 79  ? -45.413  82.272  4.939   1.00 92.62  ? 1041 LYS A HG2    1 
ATOM   936   H  HG3    . LYS A 1 79  ? -45.662  82.980  6.341   1.00 92.62  ? 1041 LYS A HG3    1 
ATOM   937   H  HD2    . LYS A 1 79  ? -45.116  85.024  5.464   1.00 97.28  ? 1041 LYS A HD2    1 
ATOM   938   H  HD3    . LYS A 1 79  ? -44.675  84.355  4.087   1.00 97.28  ? 1041 LYS A HD3    1 
ATOM   939   H  HE2    . LYS A 1 79  ? -46.885  83.750  3.666   1.00 98.53  ? 1041 LYS A HE2    1 
ATOM   940   H  HE3    . LYS A 1 79  ? -47.331  84.393  5.050   1.00 98.53  ? 1041 LYS A HE3    1 
ATOM   941   H  HZ1    . LYS A 1 79  ? -47.760  85.819  3.336   1.00 102.37 ? 1041 LYS A HZ1    1 
ATOM   942   H  HZ2    . LYS A 1 79  ? -46.772  86.429  4.203   1.00 102.37 ? 1041 LYS A HZ2    1 
ATOM   943   H  HZ3    . LYS A 1 79  ? -46.366  85.843  2.942   1.00 102.37 ? 1041 LYS A HZ3    1 
ATOM   944   N  N      . LEU A 1 80  ? -45.050  79.608  6.035   1.00 53.39  ? 1042 LEU A N      1 
ATOM   945   C  CA     . LEU A 1 80  ? -45.668  78.587  5.203   1.00 49.74  ? 1042 LEU A CA     1 
ATOM   946   C  C      . LEU A 1 80  ? -46.920  79.165  4.559   1.00 46.82  ? 1042 LEU A C      1 
ATOM   947   O  O      . LEU A 1 80  ? -47.716  79.833  5.226   1.00 45.55  ? 1042 LEU A O      1 
ATOM   948   C  CB     . LEU A 1 80  ? -46.014  77.341  6.022   1.00 46.99  ? 1042 LEU A CB     1 
ATOM   949   C  CG     . LEU A 1 80  ? -44.851  76.632  6.726   1.00 46.71  ? 1042 LEU A CG     1 
ATOM   950   C  CD1    . LEU A 1 80  ? -45.339  75.356  7.385   1.00 47.71  ? 1042 LEU A CD1    1 
ATOM   951   C  CD2    . LEU A 1 80  ? -43.717  76.320  5.761   1.00 49.83  ? 1042 LEU A CD2    1 
ATOM   952   H  H      . LEU A 1 80  ? -45.482  79.765  6.763   1.00 64.06  ? 1042 LEU A H      1 
ATOM   953   H  HA     . LEU A 1 80  ? -45.053  78.330  4.499   1.00 59.69  ? 1042 LEU A HA     1 
ATOM   954   H  HB2    . LEU A 1 80  ? -46.651  77.597  6.708   1.00 56.39  ? 1042 LEU A HB2    1 
ATOM   955   H  HB3    . LEU A 1 80  ? -46.426  76.694  5.428   1.00 56.39  ? 1042 LEU A HB3    1 
ATOM   956   H  HG     . LEU A 1 80  ? -44.502  77.213  7.420   1.00 56.06  ? 1042 LEU A HG     1 
ATOM   957   H  HD11   . LEU A 1 80  ? -44.591  74.922  7.825   1.00 57.25  ? 1042 LEU A HD11   1 
ATOM   958   H  HD12   . LEU A 1 80  ? -46.023  75.579  8.037   1.00 57.25  ? 1042 LEU A HD12   1 
ATOM   959   H  HD13   . LEU A 1 80  ? -45.709  74.771  6.705   1.00 57.25  ? 1042 LEU A HD13   1 
ATOM   960   H  HD21   . LEU A 1 80  ? -43.005  75.874  6.246   1.00 59.80  ? 1042 LEU A HD21   1 
ATOM   961   H  HD22   . LEU A 1 80  ? -44.052  75.742  5.058   1.00 59.80  ? 1042 LEU A HD22   1 
ATOM   962   H  HD23   . LEU A 1 80  ? -43.389  77.150  5.381   1.00 59.80  ? 1042 LEU A HD23   1 
ATOM   963   N  N      . SER A 1 81  ? -47.078  78.922  3.262   1.00 48.89  ? 1043 SER A N      1 
ATOM   964   C  CA     . SER A 1 81  ? -48.234  79.389  2.511   1.00 49.63  ? 1043 SER A CA     1 
ATOM   965   C  C      . SER A 1 81  ? -48.802  78.224  1.719   1.00 50.15  ? 1043 SER A C      1 
ATOM   966   O  O      . SER A 1 81  ? -48.055  77.505  1.046   1.00 48.24  ? 1043 SER A O      1 
ATOM   967   C  CB     . SER A 1 81  ? -47.856  80.536  1.569   1.00 52.47  ? 1043 SER A CB     1 
ATOM   968   O  OG     . SER A 1 81  ? -47.218  81.585  2.275   1.00 59.46  ? 1043 SER A OG     1 
ATOM   969   H  H      . SER A 1 81  ? -46.516  78.478  2.786   1.00 58.67  ? 1043 SER A H      1 
ATOM   970   H  HA     . SER A 1 81  ? -48.914  79.706  3.125   1.00 59.55  ? 1043 SER A HA     1 
ATOM   971   H  HB2    . SER A 1 81  ? -47.251  80.200  0.890   1.00 62.97  ? 1043 SER A HB2    1 
ATOM   972   H  HB3    . SER A 1 81  ? -48.662  80.881  1.153   1.00 62.97  ? 1043 SER A HB3    1 
ATOM   973   H  HG     . SER A 1 81  ? -47.017  82.206  1.746   1.00 71.35  ? 1043 SER A HG     1 
ATOM   974   N  N      . LEU A 1 82  ? -50.114  78.032  1.804   1.00 48.75  ? 1044 LEU A N      1 
ATOM   975   C  CA     . LEU A 1 82  ? -50.776  77.012  1.007   1.00 50.01  ? 1044 LEU A CA     1 
ATOM   976   C  C      . LEU A 1 82  ? -50.933  77.480  -0.431  1.00 48.03  ? 1044 LEU A C      1 
ATOM   977   O  O      . LEU A 1 82  ? -51.155  78.665  -0.695  1.00 50.75  ? 1044 LEU A O      1 
ATOM   978   C  CB     . LEU A 1 82  ? -52.152  76.679  1.586   1.00 50.55  ? 1044 LEU A CB     1 
ATOM   979   C  CG     . LEU A 1 82  ? -52.203  75.968  2.938   1.00 55.23  ? 1044 LEU A CG     1 
ATOM   980   C  CD1    . LEU A 1 82  ? -53.644  75.677  3.323   1.00 54.91  ? 1044 LEU A CD1    1 
ATOM   981   C  CD2    . LEU A 1 82  ? -51.385  74.683  2.918   1.00 55.34  ? 1044 LEU A CD2    1 
ATOM   982   H  H      . LEU A 1 82  ? -50.641  78.480  2.316   1.00 58.50  ? 1044 LEU A H      1 
ATOM   983   H  HA     . LEU A 1 82  ? -50.240  76.203  1.009   1.00 60.01  ? 1044 LEU A HA     1 
ATOM   984   H  HB2    . LEU A 1 82  ? -52.643  77.510  1.684   1.00 60.66  ? 1044 LEU A HB2    1 
ATOM   985   H  HB3    . LEU A 1 82  ? -52.614  76.111  0.950   1.00 60.66  ? 1044 LEU A HB3    1 
ATOM   986   H  HG     . LEU A 1 82  ? -51.825  76.552  3.615   1.00 66.28  ? 1044 LEU A HG     1 
ATOM   987   H  HD11   . LEU A 1 82  ? -53.657  75.227  4.182   1.00 65.90  ? 1044 LEU A HD11   1 
ATOM   988   H  HD12   . LEU A 1 82  ? -54.130  76.515  3.381   1.00 65.90  ? 1044 LEU A HD12   1 
ATOM   989   H  HD13   . LEU A 1 82  ? -54.043  75.109  2.646   1.00 65.90  ? 1044 LEU A HD13   1 
ATOM   990   H  HD21   . LEU A 1 82  ? -51.440  74.260  3.789   1.00 66.41  ? 1044 LEU A HD21   1 
ATOM   991   H  HD22   . LEU A 1 82  ? -51.744  74.091  2.239   1.00 66.41  ? 1044 LEU A HD22   1 
ATOM   992   H  HD23   . LEU A 1 82  ? -50.462  74.900  2.713   1.00 66.41  ? 1044 LEU A HD23   1 
ATOM   993   N  N      . PHE A 1 83  ? -50.799  76.541  -1.363  1.00 45.28  ? 1045 PHE A N      1 
ATOM   994   C  CA     . PHE A 1 83  ? -51.127  76.786  -2.759  1.00 42.50  ? 1045 PHE A CA     1 
ATOM   995   C  C      . PHE A 1 83  ? -51.713  75.498  -3.327  1.00 42.08  ? 1045 PHE A C      1 
ATOM   996   O  O      . PHE A 1 83  ? -52.039  74.563  -2.590  1.00 40.35  ? 1045 PHE A O      1 
ATOM   997   C  CB     . PHE A 1 83  ? -49.899  77.291  -3.533  1.00 43.70  ? 1045 PHE A CB     1 
ATOM   998   C  CG     . PHE A 1 83  ? -48.818  76.266  -3.723  1.00 43.57  ? 1045 PHE A CG     1 
ATOM   999   C  CD1    . PHE A 1 83  ? -47.949  75.958  -2.693  1.00 36.42  ? 1045 PHE A CD1    1 
ATOM   1000  C  CD2    . PHE A 1 83  ? -48.648  75.636  -4.953  1.00 42.63  ? 1045 PHE A CD2    1 
ATOM   1001  C  CE1    . PHE A 1 83  ? -46.943  75.027  -2.870  1.00 38.30  ? 1045 PHE A CE1    1 
ATOM   1002  C  CE2    . PHE A 1 83  ? -47.644  74.703  -5.137  1.00 37.80  ? 1045 PHE A CE2    1 
ATOM   1003  C  CZ     . PHE A 1 83  ? -46.790  74.398  -4.092  1.00 42.55  ? 1045 PHE A CZ     1 
ATOM   1004  H  H      . PHE A 1 83  ? -50.516  75.744  -1.207  1.00 54.34  ? 1045 PHE A H      1 
ATOM   1005  H  HA     . PHE A 1 83  ? -51.811  77.472  -2.806  1.00 51.00  ? 1045 PHE A HA     1 
ATOM   1006  H  HB2    . PHE A 1 83  ? -50.186  77.583  -4.413  1.00 52.44  ? 1045 PHE A HB2    1 
ATOM   1007  H  HB3    . PHE A 1 83  ? -49.514  78.039  -3.050  1.00 52.44  ? 1045 PHE A HB3    1 
ATOM   1008  H  HD1    . PHE A 1 83  ? -48.047  76.376  -1.868  1.00 43.70  ? 1045 PHE A HD1    1 
ATOM   1009  H  HD2    . PHE A 1 83  ? -49.222  75.839  -5.656  1.00 51.15  ? 1045 PHE A HD2    1 
ATOM   1010  H  HE1    . PHE A 1 83  ? -46.370  74.823  -2.167  1.00 45.96  ? 1045 PHE A HE1    1 
ATOM   1011  H  HE2    . PHE A 1 83  ? -47.544  74.282  -5.960  1.00 45.36  ? 1045 PHE A HE2    1 
ATOM   1012  H  HZ     . PHE A 1 83  ? -46.114  73.771  -4.211  1.00 51.06  ? 1045 PHE A HZ     1 
ATOM   1013  N  N      . GLY A 1 84  ? -51.863  75.448  -4.650  1.00 47.99  ? 1046 GLY A N      1 
ATOM   1014  C  CA     . GLY A 1 84  ? -52.450  74.273  -5.259  1.00 45.59  ? 1046 GLY A CA     1 
ATOM   1015  C  C      . GLY A 1 84  ? -53.952  74.198  -5.029  1.00 44.85  ? 1046 GLY A C      1 
ATOM   1016  O  O      . GLY A 1 84  ? -54.630  75.197  -4.772  1.00 47.89  ? 1046 GLY A O      1 
ATOM   1017  H  H      . GLY A 1 84  ? -51.637  76.069  -5.200  1.00 57.59  ? 1046 GLY A H      1 
ATOM   1018  H  HA2    . GLY A 1 84  ? -52.284  74.286  -6.215  1.00 54.71  ? 1046 GLY A HA2    1 
ATOM   1019  H  HA3    . GLY A 1 84  ? -52.041  73.476  -4.886  1.00 54.71  ? 1046 GLY A HA3    1 
ATOM   1020  N  N      . SER A 1 85  ? -54.473  72.972  -5.112  1.00 41.68  ? 1047 SER A N      1 
ATOM   1021  C  CA     . SER A 1 85  ? -55.918  72.782  -5.097  1.00 39.87  ? 1047 SER A CA     1 
ATOM   1022  C  C      . SER A 1 85  ? -56.548  73.065  -3.738  1.00 40.90  ? 1047 SER A C      1 
ATOM   1023  O  O      . SER A 1 85  ? -57.775  73.183  -3.666  1.00 39.56  ? 1047 SER A O      1 
ATOM   1024  C  CB     . SER A 1 85  ? -56.266  71.366  -5.547  1.00 33.23  ? 1047 SER A CB     1 
ATOM   1025  O  OG     . SER A 1 85  ? -55.919  70.411  -4.568  1.00 37.48  ? 1047 SER A OG     1 
ATOM   1026  H  H      . SER A 1 85  ? -54.016  72.247  -5.177  1.00 50.01  ? 1047 SER A H      1 
ATOM   1027  H  HA     . SER A 1 85  ? -56.314  73.396  -5.734  1.00 47.85  ? 1047 SER A HA     1 
ATOM   1028  H  HB2    . SER A 1 85  ? -57.220  71.314  -5.711  1.00 39.87  ? 1047 SER A HB2    1 
ATOM   1029  H  HB3    . SER A 1 85  ? -55.780  71.168  -6.363  1.00 39.87  ? 1047 SER A HB3    1 
ATOM   1030  H  HG     . SER A 1 85  ? -56.118  69.640  -4.835  1.00 44.97  ? 1047 SER A HG     1 
ATOM   1031  N  N      . SER A 1 86  ? -55.757  73.171  -2.666  1.00 40.36  ? 1048 SER A N      1 
ATOM   1032  C  CA     . SER A 1 86  ? -56.304  73.634  -1.395  1.00 45.64  ? 1048 SER A CA     1 
ATOM   1033  C  C      . SER A 1 86  ? -56.757  75.085  -1.465  1.00 48.49  ? 1048 SER A C      1 
ATOM   1034  O  O      . SER A 1 86  ? -57.536  75.518  -0.611  1.00 53.27  ? 1048 SER A O      1 
ATOM   1035  C  CB     . SER A 1 86  ? -55.274  73.484  -0.272  1.00 47.05  ? 1048 SER A CB     1 
ATOM   1036  O  OG     . SER A 1 86  ? -54.956  72.125  -0.029  1.00 49.39  ? 1048 SER A OG     1 
ATOM   1037  H  H      . SER A 1 86  ? -54.918  72.985  -2.651  1.00 48.43  ? 1048 SER A H      1 
ATOM   1038  H  HA     . SER A 1 86  ? -57.075  73.091  -1.167  1.00 54.77  ? 1048 SER A HA     1 
ATOM   1039  H  HB2    . SER A 1 86  ? -54.464  73.954  -0.525  1.00 56.46  ? 1048 SER A HB2    1 
ATOM   1040  H  HB3    . SER A 1 86  ? -55.637  73.870  0.540   1.00 56.46  ? 1048 SER A HB3    1 
ATOM   1041  H  HG     . SER A 1 86  ? -54.637  71.776  -0.723  1.00 59.27  ? 1048 SER A HG     1 
ATOM   1042  N  N      . LYS A 1 87  ? -56.285  75.842  -2.462  1.00 49.22  ? 1049 LYS A N      1 
ATOM   1043  C  CA     . LYS A 1 87  ? -56.559  77.269  -2.551  1.00 49.11  ? 1049 LYS A CA     1 
ATOM   1044  C  C      . LYS A 1 87  ? -57.044  77.737  -3.917  1.00 48.87  ? 1049 LYS A C      1 
ATOM   1045  O  O      . LYS A 1 87  ? -57.535  78.866  -4.014  1.00 50.35  ? 1049 LYS A O      1 
ATOM   1046  C  CB     . LYS A 1 87  ? -55.298  78.071  -2.188  1.00 50.83  ? 1049 LYS A CB     1 
ATOM   1047  C  CG     . LYS A 1 87  ? -54.900  78.012  -0.725  1.00 53.93  ? 1049 LYS A CG     1 
ATOM   1048  C  CD     . LYS A 1 87  ? -55.976  78.616  0.154   1.00 57.23  ? 1049 LYS A CD     1 
ATOM   1049  C  CE     . LYS A 1 87  ? -55.415  79.076  1.482   1.00 60.39  ? 1049 LYS A CE     1 
ATOM   1050  N  NZ     . LYS A 1 87  ? -56.474  79.687  2.341   1.00 66.42  1 1049 LYS A NZ     1 
ATOM   1051  H  H      . LYS A 1 87  ? -55.799  75.542  -3.105  1.00 59.06  ? 1049 LYS A H      1 
ATOM   1052  H  HA     . LYS A 1 87  ? -57.246  77.492  -1.904  1.00 58.94  ? 1049 LYS A HA     1 
ATOM   1053  H  HB2    . LYS A 1 87  ? -54.554  77.728  -2.707  1.00 61.00  ? 1049 LYS A HB2    1 
ATOM   1054  H  HB3    . LYS A 1 87  ? -55.450  79.002  -2.412  1.00 61.00  ? 1049 LYS A HB3    1 
ATOM   1055  H  HG2    . LYS A 1 87  ? -54.774  77.086  -0.463  1.00 64.72  ? 1049 LYS A HG2    1 
ATOM   1056  H  HG3    . LYS A 1 87  ? -54.080  78.514  -0.594  1.00 64.72  ? 1049 LYS A HG3    1 
ATOM   1057  H  HD2    . LYS A 1 87  ? -56.362  79.384  -0.296  1.00 68.67  ? 1049 LYS A HD2    1 
ATOM   1058  H  HD3    . LYS A 1 87  ? -56.659  77.949  0.326   1.00 68.67  ? 1049 LYS A HD3    1 
ATOM   1059  H  HE2    . LYS A 1 87  ? -55.044  78.314  1.954   1.00 72.46  ? 1049 LYS A HE2    1 
ATOM   1060  H  HE3    . LYS A 1 87  ? -54.728  79.742  1.326   1.00 72.46  ? 1049 LYS A HE3    1 
ATOM   1061  H  HZ1    . LYS A 1 87  ? -56.123  79.950  3.115   1.00 79.71  ? 1049 LYS A HZ1    1 
ATOM   1062  H  HZ2    . LYS A 1 87  ? -56.829  80.392  1.930   1.00 79.71  ? 1049 LYS A HZ2    1 
ATOM   1063  H  HZ3    . LYS A 1 87  ? -57.117  79.092  2.501   1.00 79.71  ? 1049 LYS A HZ3    1 
ATOM   1064  N  N      . ASN A 1 88  ? -56.928  76.928  -4.966  1.00 48.66  ? 1050 ASN A N      1 
ATOM   1065  C  CA     . ASN A 1 88  ? -57.334  77.365  -6.295  1.00 50.18  ? 1050 ASN A CA     1 
ATOM   1066  C  C      . ASN A 1 88  ? -58.794  77.061  -6.598  1.00 51.12  ? 1050 ASN A C      1 
ATOM   1067  O  O      . ASN A 1 88  ? -59.254  77.361  -7.705  1.00 52.79  ? 1050 ASN A O      1 
ATOM   1068  C  CB     . ASN A 1 88  ? -56.441  76.727  -7.366  1.00 42.89  ? 1050 ASN A CB     1 
ATOM   1069  C  CG     . ASN A 1 88  ? -56.637  75.229  -7.485  1.00 45.18  ? 1050 ASN A CG     1 
ATOM   1070  O  OD1    . ASN A 1 88  ? -57.636  74.675  -7.023  1.00 45.05  ? 1050 ASN A OD1    1 
ATOM   1071  N  ND2    . ASN A 1 88  ? -55.679  74.561  -8.119  1.00 43.97  ? 1050 ASN A ND2    1 
ATOM   1072  H  H      . ASN A 1 88  ? -56.620  76.126  -4.934  1.00 58.39  ? 1050 ASN A H      1 
ATOM   1073  H  HA     . ASN A 1 88  ? -57.218  78.326  -6.351  1.00 60.22  ? 1050 ASN A HA     1 
ATOM   1074  H  HB2    . ASN A 1 88  ? -56.648  77.125  -8.226  1.00 51.47  ? 1050 ASN A HB2    1 
ATOM   1075  H  HB3    . ASN A 1 88  ? -55.512  76.891  -7.140  1.00 51.47  ? 1050 ASN A HB3    1 
ATOM   1076  H  HD21   . ASN A 1 88  ? -55.740  73.709  -8.215  1.00 52.77  ? 1050 ASN A HD21   1 
ATOM   1077  H  HD22   . ASN A 1 88  ? -54.998  74.982  -8.434  1.00 52.77  ? 1050 ASN A HD22   1 
ATOM   1078  N  N      . GLY A 1 89  ? -59.527  76.473  -5.655  1.00 48.90  ? 1051 GLY A N      1 
ATOM   1079  C  CA     . GLY A 1 89  ? -60.940  76.217  -5.833  1.00 49.13  ? 1051 GLY A CA     1 
ATOM   1080  C  C      . GLY A 1 89  ? -61.297  74.881  -6.445  1.00 47.26  ? 1051 GLY A C      1 
ATOM   1081  O  O      . GLY A 1 89  ? -62.470  74.672  -6.775  1.00 51.09  ? 1051 GLY A O      1 
ATOM   1082  H  H      . GLY A 1 89  ? -59.218  76.212  -4.896  1.00 58.67  ? 1051 GLY A H      1 
ATOM   1083  H  HA2    . GLY A 1 89  ? -61.378  76.272  -4.968  1.00 58.95  ? 1051 GLY A HA2    1 
ATOM   1084  H  HA3    . GLY A 1 89  ? -61.313  76.911  -6.399  1.00 58.95  ? 1051 GLY A HA3    1 
ATOM   1085  N  N      . PHE A 1 90  ? -60.333  73.970  -6.613  1.00 42.04  ? 1052 PHE A N      1 
ATOM   1086  C  CA     . PHE A 1 90  ? -60.576  72.701  -7.294  1.00 44.36  ? 1052 PHE A CA     1 
ATOM   1087  C  C      . PHE A 1 90  ? -60.062  71.511  -6.489  1.00 41.50  ? 1052 PHE A C      1 
ATOM   1088  O  O      . PHE A 1 90  ? -59.679  70.491  -7.065  1.00 41.24  ? 1052 PHE A O      1 
ATOM   1089  C  CB     . PHE A 1 90  ? -59.934  72.702  -8.684  1.00 44.33  ? 1052 PHE A CB     1 
ATOM   1090  C  CG     . PHE A 1 90  ? -60.291  73.897  -9.524  1.00 40.76  ? 1052 PHE A CG     1 
ATOM   1091  C  CD1    . PHE A 1 90  ? -61.612  74.257  -9.722  1.00 45.93  ? 1052 PHE A CD1    1 
ATOM   1092  C  CD2    . PHE A 1 90  ? -59.300  74.663  -10.108 1.00 41.29  ? 1052 PHE A CD2    1 
ATOM   1093  C  CE1    . PHE A 1 90  ? -61.936  75.357  -10.496 1.00 48.42  ? 1052 PHE A CE1    1 
ATOM   1094  C  CE2    . PHE A 1 90  ? -59.616  75.761  -10.878 1.00 47.14  ? 1052 PHE A CE2    1 
ATOM   1095  C  CZ     . PHE A 1 90  ? -60.937  76.109  -11.073 1.00 49.13  ? 1052 PHE A CZ     1 
ATOM   1096  H  H      . PHE A 1 90  ? -59.524  74.067  -6.337  1.00 50.45  ? 1052 PHE A H      1 
ATOM   1097  H  HA     . PHE A 1 90  ? -61.532  72.589  -7.410  1.00 53.24  ? 1052 PHE A HA     1 
ATOM   1098  H  HB2    . PHE A 1 90  ? -58.969  72.690  -8.582  1.00 53.19  ? 1052 PHE A HB2    1 
ATOM   1099  H  HB3    . PHE A 1 90  ? -60.223  71.909  -9.162  1.00 53.19  ? 1052 PHE A HB3    1 
ATOM   1100  H  HD1    . PHE A 1 90  ? -62.289  73.751  -9.335  1.00 55.12  ? 1052 PHE A HD1    1 
ATOM   1101  H  HD2    . PHE A 1 90  ? -58.408  74.433  -9.981  1.00 49.55  ? 1052 PHE A HD2    1 
ATOM   1102  H  HE1    . PHE A 1 90  ? -62.828  75.590  -10.624 1.00 58.11  ? 1052 PHE A HE1    1 
ATOM   1103  H  HE2    . PHE A 1 90  ? -58.940  76.267  -11.267 1.00 56.57  ? 1052 PHE A HE2    1 
ATOM   1104  H  HZ     . PHE A 1 90  ? -61.152  76.850  -11.592 1.00 58.96  ? 1052 PHE A HZ     1 
ATOM   1105  N  N      . GLY A 1 91  ? -60.064  71.603  -5.161  1.00 49.39  ? 1053 GLY A N      1 
ATOM   1106  C  CA     . GLY A 1 91  ? -59.498  70.539  -4.349  1.00 49.05  ? 1053 GLY A CA     1 
ATOM   1107  C  C      . GLY A 1 91  ? -60.462  69.390  -4.109  1.00 44.86  ? 1053 GLY A C      1 
ATOM   1108  O  O      . GLY A 1 91  ? -61.676  69.564  -4.037  1.00 49.23  ? 1053 GLY A O      1 
ATOM   1109  H  H      . GLY A 1 91  ? -60.385  72.264  -4.714  1.00 59.27  ? 1053 GLY A H      1 
ATOM   1110  H  HA2    . GLY A 1 91  ? -58.708  70.187  -4.788  1.00 58.86  ? 1053 GLY A HA2    1 
ATOM   1111  H  HA3    . GLY A 1 91  ? -59.233  70.899  -3.488  1.00 58.86  ? 1053 GLY A HA3    1 
ATOM   1112  N  N      . PHE A 1 92  ? -59.895  68.192  -3.996  1.00 39.38  ? 1054 PHE A N      1 
ATOM   1113  C  CA     . PHE A 1 92  ? -60.624  67.011  -3.555  1.00 44.98  ? 1054 PHE A CA     1 
ATOM   1114  C  C      . PHE A 1 92  ? -60.371  66.759  -2.075  1.00 42.57  ? 1054 PHE A C      1 
ATOM   1115  O  O      . PHE A 1 92  ? -59.394  67.237  -1.492  1.00 45.37  ? 1054 PHE A O      1 
ATOM   1116  C  CB     . PHE A 1 92  ? -60.226  65.757  -4.345  1.00 43.87  ? 1054 PHE A CB     1 
ATOM   1117  C  CG     . PHE A 1 92  ? -60.858  65.648  -5.707  1.00 40.31  ? 1054 PHE A CG     1 
ATOM   1118  C  CD1    . PHE A 1 92  ? -61.362  66.761  -6.361  1.00 42.64  ? 1054 PHE A CD1    1 
ATOM   1119  C  CD2    . PHE A 1 92  ? -60.956  64.411  -6.329  1.00 44.24  ? 1054 PHE A CD2    1 
ATOM   1120  C  CE1    . PHE A 1 92  ? -61.937  66.641  -7.621  1.00 46.48  ? 1054 PHE A CE1    1 
ATOM   1121  C  CE2    . PHE A 1 92  ? -61.528  64.285  -7.587  1.00 46.34  ? 1054 PHE A CE2    1 
ATOM   1122  C  CZ     . PHE A 1 92  ? -62.023  65.400  -8.231  1.00 44.05  ? 1054 PHE A CZ     1 
ATOM   1123  H  H      . PHE A 1 92  ? -59.069  68.036  -4.175  1.00 47.26  ? 1054 PHE A H      1 
ATOM   1124  H  HA     . PHE A 1 92  ? -61.575  67.159  -3.679  1.00 53.98  ? 1054 PHE A HA     1 
ATOM   1125  H  HB2    . PHE A 1 92  ? -59.264  65.761  -4.467  1.00 52.64  ? 1054 PHE A HB2    1 
ATOM   1126  H  HB3    . PHE A 1 92  ? -60.488  64.974  -3.836  1.00 52.64  ? 1054 PHE A HB3    1 
ATOM   1127  H  HD1    . PHE A 1 92  ? -61.305  67.597  -5.958  1.00 51.16  ? 1054 PHE A HD1    1 
ATOM   1128  H  HD2    . PHE A 1 92  ? -60.621  63.656  -5.902  1.00 53.09  ? 1054 PHE A HD2    1 
ATOM   1129  H  HE1    . PHE A 1 92  ? -62.271  67.394  -8.052  1.00 55.78  ? 1054 PHE A HE1    1 
ATOM   1130  H  HE2    . PHE A 1 92  ? -61.585  63.450  -7.992  1.00 55.60  ? 1054 PHE A HE2    1 
ATOM   1131  H  HZ     . PHE A 1 92  ? -62.411  65.319  -9.072  1.00 52.86  ? 1054 PHE A HZ     1 
ATOM   1132  N  N      . LYS A 1 93  ? -61.271  65.979  -1.475  1.00 42.12  ? 1055 LYS A N      1 
ATOM   1133  C  CA     . LYS A 1 93  ? -61.154  65.654  -0.058  1.00 41.96  ? 1055 LYS A CA     1 
ATOM   1134  C  C      . LYS A 1 93  ? -59.776  65.100  0.279   1.00 45.05  ? 1055 LYS A C      1 
ATOM   1135  O  O      . LYS A 1 93  ? -59.189  65.458  1.308   1.00 43.34  ? 1055 LYS A O      1 
ATOM   1136  C  CB     . LYS A 1 93  ? -62.236  64.650  0.337   1.00 39.38  ? 1055 LYS A CB     1 
ATOM   1137  C  CG     . LYS A 1 93  ? -63.644  65.194  0.238   1.00 46.78  ? 1055 LYS A CG     1 
ATOM   1138  C  CD     . LYS A 1 93  ? -64.679  64.133  0.561   1.00 48.60  ? 1055 LYS A CD     1 
ATOM   1139  C  CE     . LYS A 1 93  ? -66.080  64.693  0.466   1.00 50.08  ? 1055 LYS A CE     1 
ATOM   1140  N  NZ     . LYS A 1 93  ? -66.363  65.624  1.592   1.00 60.92  1 1055 LYS A NZ     1 
ATOM   1141  H  H      . LYS A 1 93  ? -61.953  65.629  -1.865  1.00 50.55  ? 1055 LYS A H      1 
ATOM   1142  H  HA     . LYS A 1 93  ? -61.289  66.461  0.463   1.00 50.35  ? 1055 LYS A HA     1 
ATOM   1143  H  HB2    . LYS A 1 93  ? -62.175  63.879  -0.249  1.00 47.26  ? 1055 LYS A HB2    1 
ATOM   1144  H  HB3    . LYS A 1 93  ? -62.088  64.376  1.255   1.00 47.26  ? 1055 LYS A HB3    1 
ATOM   1145  H  HG2    . LYS A 1 93  ? -63.750  65.923  0.870   1.00 56.14  ? 1055 LYS A HG2    1 
ATOM   1146  H  HG3    . LYS A 1 93  ? -63.803  65.508  -0.666  1.00 56.14  ? 1055 LYS A HG3    1 
ATOM   1147  H  HD2    . LYS A 1 93  ? -64.598  63.402  -0.073  1.00 58.32  ? 1055 LYS A HD2    1 
ATOM   1148  H  HD3    . LYS A 1 93  ? -64.538  63.811  1.465   1.00 58.32  ? 1055 LYS A HD3    1 
ATOM   1149  H  HE2    . LYS A 1 93  ? -66.175  65.183  -0.366  1.00 60.09  ? 1055 LYS A HE2    1 
ATOM   1150  H  HE3    . LYS A 1 93  ? -66.720  63.965  0.504   1.00 60.09  ? 1055 LYS A HE3    1 
ATOM   1151  H  HZ1    . LYS A 1 93  ? -67.190  65.944  1.521   1.00 73.10  ? 1055 LYS A HZ1    1 
ATOM   1152  H  HZ2    . LYS A 1 93  ? -66.284  65.195  2.368   1.00 73.10  ? 1055 LYS A HZ2    1 
ATOM   1153  H  HZ3    . LYS A 1 93  ? -65.788  66.303  1.576   1.00 73.10  ? 1055 LYS A HZ3    1 
ATOM   1154  N  N      . GLN A 1 94  ? -59.238  64.231  -0.578  1.00 47.74  ? 1056 GLN A N      1 
ATOM   1155  C  CA     . GLN A 1 94  ? -57.975  63.556  -0.311  1.00 49.81  ? 1056 GLN A CA     1 
ATOM   1156  C  C      . GLN A 1 94  ? -56.822  64.116  -1.141  1.00 48.46  ? 1056 GLN A C      1 
ATOM   1157  O  O      . GLN A 1 94  ? -55.801  63.441  -1.307  1.00 51.88  ? 1056 GLN A O      1 
ATOM   1158  C  CB     . GLN A 1 94  ? -58.124  62.055  -0.557  1.00 52.91  ? 1056 GLN A CB     1 
ATOM   1159  C  CG     . GLN A 1 94  ? -59.132  61.372  0.361   1.00 58.71  ? 1056 GLN A CG     1 
ATOM   1160  C  CD     . GLN A 1 94  ? -58.772  61.487  1.827   1.00 64.30  ? 1056 GLN A CD     1 
ATOM   1161  O  OE1    . GLN A 1 94  ? -57.618  61.303  2.215   1.00 66.96  ? 1056 GLN A OE1    1 
ATOM   1162  N  NE2    . GLN A 1 94  ? -59.765  61.793  2.654   1.00 67.10  ? 1056 GLN A NE2    1 
ATOM   1163  H  H      . GLN A 1 94  ? -59.593  64.016  -1.332  1.00 57.28  ? 1056 GLN A H      1 
ATOM   1164  H  HA     . GLN A 1 94  ? -57.750  63.680  0.625   1.00 59.77  ? 1056 GLN A HA     1 
ATOM   1165  H  HB2    . GLN A 1 94  ? -58.416  61.917  -1.472  1.00 63.49  ? 1056 GLN A HB2    1 
ATOM   1166  H  HB3    . GLN A 1 94  ? -57.263  61.630  -0.420  1.00 63.49  ? 1056 GLN A HB3    1 
ATOM   1167  H  HG2    . GLN A 1 94  ? -60.002  61.782  0.234   1.00 70.45  ? 1056 GLN A HG2    1 
ATOM   1168  H  HG3    . GLN A 1 94  ? -59.174  60.429  0.137   1.00 70.45  ? 1056 GLN A HG3    1 
ATOM   1169  H  HE21   . GLN A 1 94  ? -60.559  61.913  2.346   1.00 80.52  ? 1056 GLN A HE21   1 
ATOM   1170  H  HE22   . GLN A 1 94  ? -59.615  61.871  3.497   1.00 80.52  ? 1056 GLN A HE22   1 
ATOM   1171  N  N      . SER A 1 95  ? -56.966  65.321  -1.688  1.00 40.06  ? 1057 SER A N      1 
ATOM   1172  C  CA     . SER A 1 95  ? -55.846  65.955  -2.370  1.00 37.76  ? 1057 SER A CA     1 
ATOM   1173  C  C      . SER A 1 95  ? -54.720  66.244  -1.384  1.00 40.60  ? 1057 SER A C      1 
ATOM   1174  O  O      . SER A 1 95  ? -54.946  66.461  -0.190  1.00 39.57  ? 1057 SER A O      1 
ATOM   1175  C  CB     . SER A 1 95  ? -56.292  67.252  -3.048  1.00 38.86  ? 1057 SER A CB     1 
ATOM   1176  O  OG     . SER A 1 95  ? -57.158  66.997  -4.145  1.00 39.33  ? 1057 SER A OG     1 
ATOM   1177  H  H      . SER A 1 95  ? -57.691  65.784  -1.679  1.00 48.08  ? 1057 SER A H      1 
ATOM   1178  H  HA     . SER A 1 95  ? -55.507  65.356  -3.053  1.00 45.31  ? 1057 SER A HA     1 
ATOM   1179  H  HB2    . SER A 1 95  ? -56.760  67.801  -2.399  1.00 46.63  ? 1057 SER A HB2    1 
ATOM   1180  H  HB3    . SER A 1 95  ? -55.507  67.722  -3.371  1.00 46.63  ? 1057 SER A HB3    1 
ATOM   1181  H  HG     . SER A 1 95  ? -56.766  66.524  -4.717  1.00 47.20  ? 1057 SER A HG     1 
ATOM   1182  N  N      . ASP A 1 96  ? -53.494  66.265  -1.899  1.00 41.01  ? 1058 ASP A N      1 
ATOM   1183  C  CA     . ASP A 1 96  ? -52.345  66.568  -1.065  1.00 44.32  ? 1058 ASP A CA     1 
ATOM   1184  C  C      . ASP A 1 96  ? -52.396  68.027  -0.607  1.00 42.25  ? 1058 ASP A C      1 
ATOM   1185  O  O      . ASP A 1 96  ? -53.202  68.833  -1.081  1.00 37.24  ? 1058 ASP A O      1 
ATOM   1186  C  CB     . ASP A 1 96  ? -51.043  66.258  -1.813  1.00 44.68  ? 1058 ASP A CB     1 
ATOM   1187  C  CG     . ASP A 1 96  ? -50.816  67.156  -3.015  1.00 42.35  ? 1058 ASP A CG     1 
ATOM   1188  O  OD1    . ASP A 1 96  ? -51.694  67.985  -3.323  1.00 51.69  ? 1058 ASP A OD1    1 
ATOM   1189  O  OD2    . ASP A 1 96  ? -49.758  67.016  -3.668  1.00 40.67  1 1058 ASP A OD2    1 
ATOM   1190  H  H      . ASP A 1 96  ? -53.305  66.108  -2.723  1.00 49.21  ? 1058 ASP A H      1 
ATOM   1191  H  HA     . ASP A 1 96  ? -52.375  66.007  -0.274  1.00 53.19  ? 1058 ASP A HA     1 
ATOM   1192  H  HB2    . ASP A 1 96  ? -50.296  66.377  -1.206  1.00 53.62  ? 1058 ASP A HB2    1 
ATOM   1193  H  HB3    . ASP A 1 96  ? -51.072  65.341  -2.127  1.00 53.62  ? 1058 ASP A HB3    1 
ATOM   1194  N  N      . LEU A 1 97  ? -51.535  68.355  0.352   1.00 40.69  ? 1059 LEU A N      1 
ATOM   1195  C  CA     . LEU A 1 97  ? -51.437  69.699  0.910   1.00 42.53  ? 1059 LEU A CA     1 
ATOM   1196  C  C      . LEU A 1 97  ? -50.155  70.327  0.373   1.00 43.10  ? 1059 LEU A C      1 
ATOM   1197  O  O      . LEU A 1 97  ? -49.054  69.959  0.797   1.00 45.93  ? 1059 LEU A O      1 
ATOM   1198  C  CB     . LEU A 1 97  ? -51.442  69.655  2.438   1.00 44.65  ? 1059 LEU A CB     1 
ATOM   1199  C  CG     . LEU A 1 97  ? -51.685  70.974  3.175   1.00 45.25  ? 1059 LEU A CG     1 
ATOM   1200  C  CD1    . LEU A 1 97  ? -53.133  71.402  3.032   1.00 47.52  ? 1059 LEU A CD1    1 
ATOM   1201  C  CD2    . LEU A 1 97  ? -51.308  70.859  4.647   1.00 48.75  ? 1059 LEU A CD2    1 
ATOM   1202  H  H      . LEU A 1 97  ? -50.982  67.799  0.706   1.00 48.83  ? 1059 LEU A H      1 
ATOM   1203  H  HA     . LEU A 1 97  ? -52.191  70.231  0.612   1.00 51.04  ? 1059 LEU A HA     1 
ATOM   1204  H  HB2    . LEU A 1 97  ? -52.137  69.040  2.719   1.00 53.58  ? 1059 LEU A HB2    1 
ATOM   1205  H  HB3    . LEU A 1 97  ? -50.581  69.319  2.732   1.00 53.58  ? 1059 LEU A HB3    1 
ATOM   1206  H  HG     . LEU A 1 97  ? -51.129  71.663  2.777   1.00 54.30  ? 1059 LEU A HG     1 
ATOM   1207  H  HD11   . LEU A 1 97  ? -53.263  72.238  3.506   1.00 57.02  ? 1059 LEU A HD11   1 
ATOM   1208  H  HD12   . LEU A 1 97  ? -53.336  71.520  2.091   1.00 57.02  ? 1059 LEU A HD12   1 
ATOM   1209  H  HD13   . LEU A 1 97  ? -53.704  70.715  3.411   1.00 57.02  ? 1059 LEU A HD13   1 
ATOM   1210  H  HD21   . LEU A 1 97  ? -51.474  71.709  5.082   1.00 58.50  ? 1059 LEU A HD21   1 
ATOM   1211  H  HD22   . LEU A 1 97  ? -51.849  70.166  5.057   1.00 58.50  ? 1059 LEU A HD22   1 
ATOM   1212  H  HD23   . LEU A 1 97  ? -50.368  70.629  4.715   1.00 58.50  ? 1059 LEU A HD23   1 
ATOM   1213  N  N      . ASP A 1 98  ? -50.297  71.256  -0.568  1.00 40.84  ? 1060 ASP A N      1 
ATOM   1214  C  CA     . ASP A 1 98  ? -49.155  71.904  -1.202  1.00 42.34  ? 1060 ASP A CA     1 
ATOM   1215  C  C      . ASP A 1 98  ? -48.769  73.149  -0.416  1.00 39.91  ? 1060 ASP A C      1 
ATOM   1216  O  O      . ASP A 1 98  ? -49.579  74.071  -0.264  1.00 39.93  ? 1060 ASP A O      1 
ATOM   1217  C  CB     . ASP A 1 98  ? -49.480  72.254  -2.652  1.00 41.37  ? 1060 ASP A CB     1 
ATOM   1218  C  CG     . ASP A 1 98  ? -49.891  71.047  -3.454  1.00 39.02  ? 1060 ASP A CG     1 
ATOM   1219  O  OD1    . ASP A 1 98  ? -49.015  70.207  -3.743  1.00 40.78  ? 1060 ASP A OD1    1 
ATOM   1220  O  OD2    . ASP A 1 98  ? -51.089  70.930  -3.787  1.00 47.07  1 1060 ASP A OD2    1 
ATOM   1221  H  H      . ASP A 1 98  ? -51.057  71.532  -0.861  1.00 49.01  ? 1060 ASP A H      1 
ATOM   1222  H  HA     . ASP A 1 98  ? -48.400  71.296  -1.198  1.00 50.80  ? 1060 ASP A HA     1 
ATOM   1223  H  HB2    . ASP A 1 98  ? -50.211  72.891  -2.669  1.00 49.64  ? 1060 ASP A HB2    1 
ATOM   1224  H  HB3    . ASP A 1 98  ? -48.693  72.639  -3.069  1.00 49.64  ? 1060 ASP A HB3    1 
ATOM   1225  N  N      . VAL A 1 99  ? -47.526  73.182  0.056   1.00 42.09  ? 1061 VAL A N      1 
ATOM   1226  C  CA     . VAL A 1 99  ? -47.056  74.196  0.991   1.00 44.99  ? 1061 VAL A CA     1 
ATOM   1227  C  C      . VAL A 1 99  ? -45.809  74.857  0.423   1.00 43.18  ? 1061 VAL A C      1 
ATOM   1228  O  O      . VAL A 1 99  ? -44.883  74.171  -0.021  1.00 41.76  ? 1061 VAL A O      1 
ATOM   1229  C  CB     . VAL A 1 99  ? -46.755  73.588  2.374   1.00 44.88  ? 1061 VAL A CB     1 
ATOM   1230  C  CG1    . VAL A 1 99  ? -46.283  74.665  3.346   1.00 46.38  ? 1061 VAL A CG1    1 
ATOM   1231  C  CG2    . VAL A 1 99  ? -47.979  72.869  2.912   1.00 41.59  ? 1061 VAL A CG2    1 
ATOM   1232  H  H      . VAL A 1 99  ? -46.920  72.609  -0.158  1.00 50.50  ? 1061 VAL A H      1 
ATOM   1233  H  HA     . VAL A 1 99  ? -47.739  74.875  1.098   1.00 53.99  ? 1061 VAL A HA     1 
ATOM   1234  H  HB     . VAL A 1 99  ? -46.043  72.936  2.282   1.00 53.86  ? 1061 VAL A HB     1 
ATOM   1235  H  HG11   . VAL A 1 99  ? -46.101  74.255  4.206   1.00 55.65  ? 1061 VAL A HG11   1 
ATOM   1236  H  HG12   . VAL A 1 99  ? -45.475  75.073  2.996   1.00 55.65  ? 1061 VAL A HG12   1 
ATOM   1237  H  HG13   . VAL A 1 99  ? -46.979  75.334  3.438   1.00 55.65  ? 1061 VAL A HG13   1 
ATOM   1238  H  HG21   . VAL A 1 99  ? -47.768  72.495  3.782   1.00 49.91  ? 1061 VAL A HG21   1 
ATOM   1239  H  HG22   . VAL A 1 99  ? -48.708  73.504  2.993   1.00 49.91  ? 1061 VAL A HG22   1 
ATOM   1240  H  HG23   . VAL A 1 99  ? -48.224  72.160  2.297   1.00 49.91  ? 1061 VAL A HG23   1 
ATOM   1241  N  N      . CYS A 1 100 ? -45.783  76.183  0.456   1.00 45.93  ? 1062 CYS A N      1 
ATOM   1242  C  CA     . CYS A 1 100 ? -44.635  76.969  0.026   1.00 48.82  ? 1062 CYS A CA     1 
ATOM   1243  C  C      . CYS A 1 100 ? -43.963  77.576  1.250   1.00 48.00  ? 1062 CYS A C      1 
ATOM   1244  O  O      . CYS A 1 100 ? -44.608  78.293  2.023   1.00 46.63  ? 1062 CYS A O      1 
ATOM   1245  C  CB     . CYS A 1 100 ? -45.061  78.069  -0.945  1.00 47.27  ? 1062 CYS A CB     1 
ATOM   1246  S  SG     . CYS A 1 100 ? -43.763  79.269  -1.267  1.00 55.88  ? 1062 CYS A SG     1 
ATOM   1247  H  H      . CYS A 1 100 ? -46.440  76.665  0.733   1.00 55.12  ? 1062 CYS A H      1 
ATOM   1248  H  HA     . CYS A 1 100 ? -43.997  76.393  -0.422  1.00 58.58  ? 1062 CYS A HA     1 
ATOM   1249  H  HB2    . CYS A 1 100 ? -45.309  77.663  -1.791  1.00 56.73  ? 1062 CYS A HB2    1 
ATOM   1250  H  HB3    . CYS A 1 100 ? -45.820  78.543  -0.571  1.00 56.73  ? 1062 CYS A HB3    1 
ATOM   1251  H  HG     . CYS A 1 100 ? -44.175  80.094  -2.035  1.00 67.06  ? 1062 CYS A HG     1 
ATOM   1252  N  N      . MET A 1 101 ? -42.669  77.311  1.409   1.00 47.70  ? 1063 MET A N      1 
ATOM   1253  C  CA     . MET A 1 101 ? -41.904  77.828  2.536   1.00 50.10  ? 1063 MET A CA     1 
ATOM   1254  C  C      . MET A 1 101 ? -41.055  79.008  2.087   1.00 50.93  ? 1063 MET A C      1 
ATOM   1255  O  O      . MET A 1 101 ? -40.379  78.939  1.054   1.00 55.22  ? 1063 MET A O      1 
ATOM   1256  C  CB     . MET A 1 101 ? -41.008  76.750  3.142   1.00 50.62  ? 1063 MET A CB     1 
ATOM   1257  C  CG     . MET A 1 101 ? -40.037  77.301  4.169   1.00 51.99  ? 1063 MET A CG     1 
ATOM   1258  S  SD     . MET A 1 101 ? -39.172  76.032  5.098   1.00 56.86  ? 1063 MET A SD     1 
ATOM   1259  C  CE     . MET A 1 101 ? -38.036  77.044  6.048   1.00 56.09  ? 1063 MET A CE     1 
ATOM   1260  H  H      . MET A 1 101 ? -42.206  76.828  0.869   1.00 57.24  ? 1063 MET A H      1 
ATOM   1261  H  HA     . MET A 1 101 ? -42.520  78.127  3.224   1.00 60.12  ? 1063 MET A HA     1 
ATOM   1262  H  HB2    . MET A 1 101 ? -41.564  76.087  3.581   1.00 60.74  ? 1063 MET A HB2    1 
ATOM   1263  H  HB3    . MET A 1 101 ? -40.492  76.334  2.434   1.00 60.74  ? 1063 MET A HB3    1 
ATOM   1264  H  HG2    . MET A 1 101 ? -39.372  77.841  3.714   1.00 62.39  ? 1063 MET A HG2    1 
ATOM   1265  H  HG3    . MET A 1 101 ? -40.528  77.849  4.802   1.00 62.39  ? 1063 MET A HG3    1 
ATOM   1266  H  HE1    . MET A 1 101 ? -37.493  76.467  6.609   1.00 67.31  ? 1063 MET A HE1    1 
ATOM   1267  H  HE2    . MET A 1 101 ? -37.469  77.540  5.437   1.00 67.31  ? 1063 MET A HE2    1 
ATOM   1268  H  HE3    . MET A 1 101 ? -38.546  77.657  6.600   1.00 67.31  ? 1063 MET A HE3    1 
ATOM   1269  N  N      . THR A 1 102 ? -41.098  80.086  2.866   1.00 50.55  ? 1064 THR A N      1 
ATOM   1270  C  CA     . THR A 1 102 ? -40.240  81.247  2.687   1.00 51.84  ? 1064 THR A CA     1 
ATOM   1271  C  C      . THR A 1 102 ? -39.683  81.682  4.038   1.00 53.83  ? 1064 THR A C      1 
ATOM   1272  O  O      . THR A 1 102 ? -40.040  81.144  5.089   1.00 51.13  ? 1064 THR A O      1 
ATOM   1273  C  CB     . THR A 1 102 ? -40.999  82.403  2.022   1.00 52.60  ? 1064 THR A CB     1 
ATOM   1274  O  OG1    . THR A 1 102 ? -42.146  82.740  2.809   1.00 54.56  ? 1064 THR A OG1    1 
ATOM   1275  C  CG2    . THR A 1 102 ? -41.446  82.013  0.622   1.00 52.29  ? 1064 THR A CG2    1 
ATOM   1276  H  H      . THR A 1 102 ? -41.638  80.167  3.531   1.00 60.66  ? 1064 THR A H      1 
ATOM   1277  H  HA     . THR A 1 102 ? -39.494  81.006  2.116   1.00 62.21  ? 1064 THR A HA     1 
ATOM   1278  H  HB     . THR A 1 102 ? -40.415  83.175  1.954   1.00 63.12  ? 1064 THR A HB     1 
ATOM   1279  H  HG1    . THR A 1 102 ? -42.565  83.373  2.450   1.00 65.48  ? 1064 THR A HG1    1 
ATOM   1280  H  HG21   . THR A 1 102 ? -41.924  82.749  0.210   1.00 62.75  ? 1064 THR A HG21   1 
ATOM   1281  H  HG22   . THR A 1 102 ? -40.674  81.793  0.077   1.00 62.75  ? 1064 THR A HG22   1 
ATOM   1282  H  HG23   . THR A 1 102 ? -42.031  81.241  0.665   1.00 62.75  ? 1064 THR A HG23   1 
ATOM   1283  N  N      . ILE A 1 103 ? -38.784  82.664  3.992   1.00 61.03  ? 1065 ILE A N      1 
ATOM   1284  C  CA     . ILE A 1 103 ? -38.097  83.197  5.166   1.00 61.91  ? 1065 ILE A CA     1 
ATOM   1285  C  C      . ILE A 1 103 ? -38.301  84.706  5.170   1.00 65.39  ? 1065 ILE A C      1 
ATOM   1286  O  O      . ILE A 1 103 ? -37.884  85.392  4.228   1.00 69.01  ? 1065 ILE A O      1 
ATOM   1287  C  CB     . ILE A 1 103 ? -36.600  82.844  5.178   1.00 64.44  ? 1065 ILE A CB     1 
ATOM   1288  C  CG1    . ILE A 1 103 ? -36.426  81.323  5.184   1.00 62.84  ? 1065 ILE A CG1    1 
ATOM   1289  C  CG2    . ILE A 1 103 ? -35.907  83.478  6.385   1.00 65.33  ? 1065 ILE A CG2    1 
ATOM   1290  C  CD1    . ILE A 1 103 ? -34.986  80.856  5.133   1.00 64.94  ? 1065 ILE A CD1    1 
ATOM   1291  H  H      . ILE A 1 103 ? -38.547  83.051  3.262   1.00 73.23  ? 1065 ILE A H      1 
ATOM   1292  H  HA     . ILE A 1 103 ? -38.503  82.833  5.968   1.00 74.30  ? 1065 ILE A HA     1 
ATOM   1293  H  HB     . ILE A 1 103 ? -36.195  83.197  4.370   1.00 77.33  ? 1065 ILE A HB     1 
ATOM   1294  H  HG12   . ILE A 1 103 ? -36.821  80.969  5.996   1.00 75.41  ? 1065 ILE A HG12   1 
ATOM   1295  H  HG13   . ILE A 1 103 ? -36.882  80.955  4.411   1.00 75.41  ? 1065 ILE A HG13   1 
ATOM   1296  H  HG21   . ILE A 1 103 ? -34.967  83.241  6.369   1.00 78.40  ? 1065 ILE A HG21   1 
ATOM   1297  H  HG22   . ILE A 1 103 ? -36.007  84.442  6.335   1.00 78.40  ? 1065 ILE A HG22   1 
ATOM   1298  H  HG23   . ILE A 1 103 ? -36.320  83.144  7.196   1.00 78.40  ? 1065 ILE A HG23   1 
ATOM   1299  H  HD11   . ILE A 1 103 ? -34.969  79.886  5.141   1.00 77.93  ? 1065 ILE A HD11   1 
ATOM   1300  H  HD12   . ILE A 1 103 ? -34.576  81.188  4.319   1.00 77.93  ? 1065 ILE A HD12   1 
ATOM   1301  H  HD13   . ILE A 1 103 ? -34.515  81.201  5.907   1.00 77.93  ? 1065 ILE A HD13   1 
ATOM   1302  N  N      . ASN A 1 104 ? -38.938  85.221  6.222   1.00 66.35  ? 1066 ASN A N      1 
ATOM   1303  C  CA     . ASN A 1 104 ? -39.226  86.648  6.299   1.00 68.96  ? 1066 ASN A CA     1 
ATOM   1304  C  C      . ASN A 1 104 ? -37.953  87.472  6.169   1.00 69.06  ? 1066 ASN A C      1 
ATOM   1305  O  O      . ASN A 1 104 ? -36.897  87.115  6.699   1.00 72.42  ? 1066 ASN A O      1 
ATOM   1306  C  CB     . ASN A 1 104 ? -39.913  86.986  7.624   1.00 72.40  ? 1066 ASN A CB     1 
ATOM   1307  C  CG     . ASN A 1 104 ? -41.303  86.396  7.731   1.00 75.38  ? 1066 ASN A CG     1 
ATOM   1308  O  OD1    . ASN A 1 104 ? -41.913  86.015  6.729   1.00 73.99  ? 1066 ASN A OD1    1 
ATOM   1309  N  ND2    . ASN A 1 104 ? -41.821  86.333  8.953   1.00 75.72  ? 1066 ASN A ND2    1 
ATOM   1310  H  H      . ASN A 1 104 ? -39.213  84.766  6.898   1.00 79.63  ? 1066 ASN A H      1 
ATOM   1311  H  HA     . ASN A 1 104 ? -39.823  86.894  5.575   1.00 82.75  ? 1066 ASN A HA     1 
ATOM   1312  H  HB2    . ASN A 1 104 ? -39.381  86.634  8.354   1.00 86.88  ? 1066 ASN A HB2    1 
ATOM   1313  H  HB3    . ASN A 1 104 ? -39.989  87.949  7.703   1.00 86.88  ? 1066 ASN A HB3    1 
ATOM   1314  H  HD21   . ASN A 1 104 ? -42.609  86.007  9.070   1.00 90.87  ? 1066 ASN A HD21   1 
ATOM   1315  H  HD22   . ASN A 1 104 ? -41.370  86.619  9.627   1.00 90.87  ? 1066 ASN A HD22   1 
ATOM   1316  N  N      . GLY A 1 105 ? -38.070  88.595  5.461   1.00 64.62  ? 1067 GLY A N      1 
ATOM   1317  C  CA     . GLY A 1 105 ? -36.949  89.456  5.176   1.00 63.98  ? 1067 GLY A CA     1 
ATOM   1318  C  C      . GLY A 1 105 ? -36.166  89.074  3.939   1.00 61.27  ? 1067 GLY A C      1 
ATOM   1319  O  O      . GLY A 1 105 ? -35.409  89.901  3.421   1.00 64.71  ? 1067 GLY A O      1 
ATOM   1320  H  H      . GLY A 1 105 ? -38.812  88.877  5.131   1.00 77.55  ? 1067 GLY A H      1 
ATOM   1321  H  HA2    . GLY A 1 105 ? -37.269  90.364  5.060   1.00 76.78  ? 1067 GLY A HA2    1 
ATOM   1322  H  HA3    . GLY A 1 105 ? -36.341  89.444  5.931   1.00 76.78  ? 1067 GLY A HA3    1 
ATOM   1323  N  N      . LEU A 1 106 ? -36.329  87.850  3.453   1.00 59.79  ? 1068 LEU A N      1 
ATOM   1324  C  CA     . LEU A 1 106 ? -35.585  87.331  2.309   1.00 64.33  ? 1068 LEU A CA     1 
ATOM   1325  C  C      . LEU A 1 106 ? -36.556  87.237  1.134   1.00 62.94  ? 1068 LEU A C      1 
ATOM   1326  O  O      . LEU A 1 106 ? -37.371  86.314  1.064   1.00 57.82  ? 1068 LEU A O      1 
ATOM   1327  C  CB     . LEU A 1 106 ? -34.969  85.979  2.662   1.00 63.05  ? 1068 LEU A CB     1 
ATOM   1328  C  CG     . LEU A 1 106 ? -33.711  85.525  1.927   1.00 65.08  ? 1068 LEU A CG     1 
ATOM   1329  C  CD1    . LEU A 1 106 ? -32.558  86.483  2.179   1.00 66.57  ? 1068 LEU A CD1    1 
ATOM   1330  C  CD2    . LEU A 1 106 ? -33.343  84.117  2.371   1.00 62.14  ? 1068 LEU A CD2    1 
ATOM   1331  H  H      . LEU A 1 106 ? -36.884  87.281  3.781   1.00 71.74  ? 1068 LEU A H      1 
ATOM   1332  H  HA     . LEU A 1 106 ? -34.872  87.946  2.076   1.00 77.19  ? 1068 LEU A HA     1 
ATOM   1333  H  HB2    . LEU A 1 106 ? -34.750  85.993  3.607   1.00 75.66  ? 1068 LEU A HB2    1 
ATOM   1334  H  HB3    . LEU A 1 106 ? -35.643  85.299  2.507   1.00 75.66  ? 1068 LEU A HB3    1 
ATOM   1335  H  HG     . LEU A 1 106 ? -33.888  85.507  0.974   1.00 78.10  ? 1068 LEU A HG     1 
ATOM   1336  H  HD11   . LEU A 1 106 ? -31.776  86.168  1.700   1.00 79.88  ? 1068 LEU A HD11   1 
ATOM   1337  H  HD12   . LEU A 1 106 ? -32.807  87.366  1.863   1.00 79.88  ? 1068 LEU A HD12   1 
ATOM   1338  H  HD13   . LEU A 1 106 ? -32.374  86.511  3.131   1.00 79.88  ? 1068 LEU A HD13   1 
ATOM   1339  H  HD21   . LEU A 1 106 ? -32.543  83.836  1.900   1.00 74.57  ? 1068 LEU A HD21   1 
ATOM   1340  H  HD22   . LEU A 1 106 ? -33.180  84.120  3.327   1.00 74.57  ? 1068 LEU A HD22   1 
ATOM   1341  H  HD23   . LEU A 1 106 ? -34.078  83.518  2.162   1.00 74.57  ? 1068 LEU A HD23   1 
ATOM   1342  N  N      . GLU A 1 107 ? -36.464  88.197  0.210   1.00 69.68  ? 1069 GLU A N      1 
ATOM   1343  C  CA     . GLU A 1 107 ? -37.499  88.343  -0.810  1.00 75.43  ? 1069 GLU A CA     1 
ATOM   1344  C  C      . GLU A 1 107 ? -37.474  87.193  -1.811  1.00 75.55  ? 1069 GLU A C      1 
ATOM   1345  O  O      . GLU A 1 107 ? -38.531  86.731  -2.257  1.00 70.97  ? 1069 GLU A O      1 
ATOM   1346  C  CB     . GLU A 1 107 ? -37.339  89.679  -1.535  1.00 81.18  ? 1069 GLU A CB     1 
ATOM   1347  C  CG     . GLU A 1 107 ? -38.467  89.980  -2.518  1.00 83.60  ? 1069 GLU A CG     1 
ATOM   1348  C  CD     . GLU A 1 107 ? -38.234  91.251  -3.314  1.00 91.01  ? 1069 GLU A CD     1 
ATOM   1349  O  OE1    . GLU A 1 107 ? -39.086  91.584  -4.167  1.00 92.93  ? 1069 GLU A OE1    1 
ATOM   1350  O  OE2    . GLU A 1 107 ? -37.200  91.917  -3.090  1.00 94.14  1 1069 GLU A OE2    1 
ATOM   1351  H  H      . GLU A 1 107 ? -35.823  88.767  0.154   1.00 83.61  ? 1069 GLU A H      1 
ATOM   1352  H  HA     . GLU A 1 107 ? -38.367  88.341  -0.378  1.00 90.51  ? 1069 GLU A HA     1 
ATOM   1353  H  HB2    . GLU A 1 107 ? -37.319  90.392  -0.877  1.00 97.41  ? 1069 GLU A HB2    1 
ATOM   1354  H  HB3    . GLU A 1 107 ? -36.506  89.667  -2.033  1.00 97.41  ? 1069 GLU A HB3    1 
ATOM   1355  H  HG2    . GLU A 1 107 ? -38.544  89.244  -3.145  1.00 100.33 ? 1069 GLU A HG2    1 
ATOM   1356  H  HG3    . GLU A 1 107 ? -39.296  90.083  -2.025  1.00 100.33 ? 1069 GLU A HG3    1 
ATOM   1357  N  N      . THR A 1 108 ? -36.287  86.726  -2.188  1.00 78.30  ? 1070 THR A N      1 
ATOM   1358  C  CA     . THR A 1 108 ? -36.149  85.654  -3.161  1.00 77.72  ? 1070 THR A CA     1 
ATOM   1359  C  C      . THR A 1 108 ? -35.202  84.593  -2.618  1.00 76.01  ? 1070 THR A C      1 
ATOM   1360  O  O      . THR A 1 108 ? -34.552  84.771  -1.584  1.00 77.83  ? 1070 THR A O      1 
ATOM   1361  C  CB     . THR A 1 108 ? -35.630  86.176  -4.507  1.00 82.13  ? 1070 THR A CB     1 
ATOM   1362  O  OG1    . THR A 1 108 ? -34.257  86.564  -4.378  1.00 86.60  ? 1070 THR A OG1    1 
ATOM   1363  C  CG2    . THR A 1 108 ? -36.452  87.370  -4.976  1.00 83.91  ? 1070 THR A CG2    1 
ATOM   1364  H  H      . THR A 1 108 ? -35.536  87.021  -1.888  1.00 93.96  ? 1070 THR A H      1 
ATOM   1365  H  HA     . THR A 1 108 ? -37.015  85.242  -3.308  1.00 93.27  ? 1070 THR A HA     1 
ATOM   1366  H  HB     . THR A 1 108 ? -35.704  85.475  -5.174  1.00 98.56  ? 1070 THR A HB     1 
ATOM   1367  H  HG1    . THR A 1 108 ? -33.968  86.850  -5.113  1.00 103.92 ? 1070 THR A HG1    1 
ATOM   1368  H  HG21   . THR A 1 108 ? -36.115  87.690  -5.827  1.00 100.69 ? 1070 THR A HG21   1 
ATOM   1369  H  HG22   . THR A 1 108 ? -37.381  87.111  -5.082  1.00 100.69 ? 1070 THR A HG22   1 
ATOM   1370  H  HG23   . THR A 1 108 ? -36.397  88.086  -4.324  1.00 100.69 ? 1070 THR A HG23   1 
ATOM   1371  N  N      . ALA A 1 109 ? -35.132  83.474  -3.335  1.00 70.88  ? 1071 ALA A N      1 
ATOM   1372  C  CA     . ALA A 1 109 ? -34.218  82.385  -2.996  1.00 67.98  ? 1071 ALA A CA     1 
ATOM   1373  C  C      . ALA A 1 109 ? -32.872  82.539  -3.679  1.00 69.70  ? 1071 ALA A C      1 
ATOM   1374  O  O      . ALA A 1 109 ? -32.264  81.549  -4.095  1.00 72.59  ? 1071 ALA A O      1 
ATOM   1375  C  CB     . ALA A 1 109 ? -34.854  81.048  -3.356  1.00 64.84  ? 1071 ALA A CB     1 
ATOM   1376  H  H      . ALA A 1 109 ? -35.610  83.319  -4.032  1.00 85.06  ? 1071 ALA A H      1 
ATOM   1377  H  HA     . ALA A 1 109 ? -34.066  82.393  -2.038  1.00 81.58  ? 1071 ALA A HA     1 
ATOM   1378  H  HB1    . ALA A 1 109 ? -34.238  80.334  -3.126  1.00 77.81  ? 1071 ALA A HB1    1 
ATOM   1379  H  HB2    . ALA A 1 109 ? -35.679  80.946  -2.857  1.00 77.81  ? 1071 ALA A HB2    1 
ATOM   1380  H  HB3    . ALA A 1 109 ? -35.038  81.033  -4.308  1.00 77.81  ? 1071 ALA A HB3    1 
ATOM   1381  N  N      . GLU A 1 110 ? -32.354  83.760  -3.762  1.00 73.28  ? 1072 GLU A N      1 
ATOM   1382  C  CA     . GLU A 1 110 ? -31.126  84.014  -4.500  1.00 78.28  ? 1072 GLU A CA     1 
ATOM   1383  C  C      . GLU A 1 110 ? -29.896  83.921  -3.613  1.00 80.11  ? 1072 GLU A C      1 
ATOM   1384  O  O      . GLU A 1 110 ? -28.796  83.679  -4.122  1.00 84.25  ? 1072 GLU A O      1 
ATOM   1385  C  CB     . GLU A 1 110 ? -31.189  85.404  -5.150  1.00 82.71  ? 1072 GLU A CB     1 
ATOM   1386  C  CG     . GLU A 1 110 ? -29.918  85.841  -5.877  1.00 91.45  ? 1072 GLU A CG     1 
ATOM   1387  C  CD     . GLU A 1 110 ? -29.947  87.305  -6.273  1.00 98.19  ? 1072 GLU A CD     1 
ATOM   1388  O  OE1    . GLU A 1 110 ? -30.871  88.022  -5.833  1.00 98.98  ? 1072 GLU A OE1    1 
ATOM   1389  O  OE2    . GLU A 1 110 ? -29.041  87.741  -7.017  1.00 102.42 1 1072 GLU A OE2    1 
ATOM   1390  H  H      . GLU A 1 110 ? -32.696  84.460  -3.397  1.00 87.93  ? 1072 GLU A H      1 
ATOM   1391  H  HA     . GLU A 1 110 ? -31.039  83.355  -5.206  1.00 93.94  ? 1072 GLU A HA     1 
ATOM   1392  H  HB2    . GLU A 1 110 ? -31.912  85.408  -5.797  1.00 99.26  ? 1072 GLU A HB2    1 
ATOM   1393  H  HB3    . GLU A 1 110 ? -31.370  86.059  -4.457  1.00 99.26  ? 1072 GLU A HB3    1 
ATOM   1394  H  HG2    . GLU A 1 110 ? -29.156  85.702  -5.293  1.00 109.74 ? 1072 GLU A HG2    1 
ATOM   1395  H  HG3    . GLU A 1 110 ? -29.819  85.313  -6.685  1.00 109.74 ? 1072 GLU A HG3    1 
ATOM   1396  N  N      . GLY A 1 111 ? -30.060  84.085  -2.304  1.00 75.88  ? 1073 GLY A N      1 
ATOM   1397  C  CA     . GLY A 1 111 ? -28.996  83.805  -1.364  1.00 76.30  ? 1073 GLY A CA     1 
ATOM   1398  C  C      . GLY A 1 111 ? -29.249  82.523  -0.597  1.00 73.49  ? 1073 GLY A C      1 
ATOM   1399  O  O      . GLY A 1 111 ? -28.404  82.088  0.189   1.00 73.70  ? 1073 GLY A O      1 
ATOM   1400  H  H      . GLY A 1 111 ? -30.788  84.360  -1.937  1.00 91.06  ? 1073 GLY A H      1 
ATOM   1401  H  HA2    . GLY A 1 111 ? -28.155  83.721  -1.840  1.00 91.56  ? 1073 GLY A HA2    1 
ATOM   1402  H  HA3    . GLY A 1 111 ? -28.922  84.536  -0.730  1.00 91.56  ? 1073 GLY A HA3    1 
ATOM   1403  N  N      . LEU A 1 112 ? -30.427  81.933  -0.775  1.00 70.72  ? 1074 LEU A N      1 
ATOM   1404  C  CA     . LEU A 1 112 ? -30.804  80.723  -0.057  1.00 68.17  ? 1074 LEU A CA     1 
ATOM   1405  C  C      . LEU A 1 112 ? -30.313  79.480  -0.795  1.00 69.16  ? 1074 LEU A C      1 
ATOM   1406  O  O      . LEU A 1 112 ? -30.595  79.305  -1.985  1.00 70.84  ? 1074 LEU A O      1 
ATOM   1407  C  CB     . LEU A 1 112 ? -32.321  80.673  0.123   1.00 65.67  ? 1074 LEU A CB     1 
ATOM   1408  C  CG     . LEU A 1 112 ? -32.871  79.509  0.946   1.00 62.99  ? 1074 LEU A CG     1 
ATOM   1409  C  CD1    . LEU A 1 112 ? -32.419  79.623  2.391   1.00 63.70  ? 1074 LEU A CD1    1 
ATOM   1410  C  CD2    . LEU A 1 112 ? -34.382  79.485  0.862   1.00 59.97  ? 1074 LEU A CD2    1 
ATOM   1411  H  H      . LEU A 1 112 ? -31.033  82.220  -1.314  1.00 84.87  ? 1074 LEU A H      1 
ATOM   1412  H  HA     . LEU A 1 112 ? -30.395  80.735  0.823   1.00 81.81  ? 1074 LEU A HA     1 
ATOM   1413  H  HB2    . LEU A 1 112 ? -32.602  81.492  0.561   1.00 78.81  ? 1074 LEU A HB2    1 
ATOM   1414  H  HB3    . LEU A 1 112 ? -32.729  80.623  -0.755  1.00 78.81  ? 1074 LEU A HB3    1 
ATOM   1415  H  HG     . LEU A 1 112 ? -32.533  78.675  0.586   1.00 75.58  ? 1074 LEU A HG     1 
ATOM   1416  H  HD11   . LEU A 1 112 ? -32.779  78.875  2.894   1.00 76.45  ? 1074 LEU A HD11   1 
ATOM   1417  H  HD12   . LEU A 1 112 ? -31.450  79.605  2.420   1.00 76.45  ? 1074 LEU A HD12   1 
ATOM   1418  H  HD13   . LEU A 1 112 ? -32.747  80.458  2.759   1.00 76.45  ? 1074 LEU A HD13   1 
ATOM   1419  H  HD21   . LEU A 1 112 ? -34.715  78.741  1.389   1.00 71.96  ? 1074 LEU A HD21   1 
ATOM   1420  H  HD22   . LEU A 1 112 ? -34.731  80.320  1.211   1.00 71.96  ? 1074 LEU A HD22   1 
ATOM   1421  H  HD23   . LEU A 1 112 ? -34.645  79.378  -0.065  1.00 71.96  ? 1074 LEU A HD23   1 
ATOM   1422  N  N      . ASP A 1 113 ? -29.591  78.615  -0.084  1.00 67.94  ? 1075 ASP A N      1 
ATOM   1423  C  CA     . ASP A 1 113 ? -29.162  77.319  -0.615  1.00 67.42  ? 1075 ASP A CA     1 
ATOM   1424  C  C      . ASP A 1 113 ? -30.343  76.356  -0.534  1.00 63.98  ? 1075 ASP A C      1 
ATOM   1425  O  O      . ASP A 1 113 ? -30.603  75.761  0.514   1.00 60.90  ? 1075 ASP A O      1 
ATOM   1426  C  CB     . ASP A 1 113 ? -27.959  76.795  0.160   1.00 71.15  ? 1075 ASP A CB     1 
ATOM   1427  C  CG     . ASP A 1 113 ? -27.325  75.580  -0.491  1.00 74.12  ? 1075 ASP A CG     1 
ATOM   1428  O  OD1    . ASP A 1 113 ? -28.011  74.896  -1.279  1.00 73.48  ? 1075 ASP A OD1    1 
ATOM   1429  O  OD2    . ASP A 1 113 ? -26.140  75.306  -0.210  1.00 78.39  1 1075 ASP A OD2    1 
ATOM   1430  H  H      . ASP A 1 113 ? -29.332  78.757  0.724   1.00 81.52  ? 1075 ASP A H      1 
ATOM   1431  H  HA     . ASP A 1 113 ? -28.909  77.418  -1.547  1.00 80.90  ? 1075 ASP A HA     1 
ATOM   1432  H  HB2    . ASP A 1 113 ? -27.287  77.493  0.210   1.00 85.38  ? 1075 ASP A HB2    1 
ATOM   1433  H  HB3    . ASP A 1 113 ? -28.243  76.543  1.053   1.00 85.38  ? 1075 ASP A HB3    1 
ATOM   1434  N  N      . CYS A 1 114 ? -31.060  76.187  -1.646  1.00 62.42  ? 1076 CYS A N      1 
ATOM   1435  C  CA     . CYS A 1 114 ? -32.336  75.474  -1.602  1.00 60.52  ? 1076 CYS A CA     1 
ATOM   1436  C  C      . CYS A 1 114 ? -32.161  73.977  -1.371  1.00 59.86  ? 1076 CYS A C      1 
ATOM   1437  O  O      . CYS A 1 114 ? -32.931  73.373  -0.617  1.00 57.12  ? 1076 CYS A O      1 
ATOM   1438  C  CB     . CYS A 1 114 ? -33.112  75.718  -2.893  1.00 61.49  ? 1076 CYS A CB     1 
ATOM   1439  S  SG     . CYS A 1 114 ? -33.710  77.406  -3.069  1.00 66.49  ? 1076 CYS A SG     1 
ATOM   1440  H  H      . CYS A 1 114 ? -30.835  76.471  -2.426  1.00 74.91  ? 1076 CYS A H      1 
ATOM   1441  H  HA     . CYS A 1 114 ? -32.863  75.827  -0.868  1.00 72.63  ? 1076 CYS A HA     1 
ATOM   1442  H  HB2    . CYS A 1 114 ? -32.533  75.527  -3.647  1.00 73.79  ? 1076 CYS A HB2    1 
ATOM   1443  H  HB3    . CYS A 1 114 ? -33.881  75.127  -2.911  1.00 73.79  ? 1076 CYS A HB3    1 
ATOM   1444  H  HG     . CYS A 1 114 ? -34.305  77.504  -4.107  1.00 79.78  ? 1076 CYS A HG     1 
ATOM   1445  N  N      . VAL A 1 115 ? -31.178  73.349  -2.019  1.00 64.01  ? 1077 VAL A N      1 
ATOM   1446  C  CA     . VAL A 1 115 ? -30.995  71.909  -1.842  1.00 65.87  ? 1077 VAL A CA     1 
ATOM   1447  C  C      . VAL A 1 115 ? -30.599  71.591  -0.405  1.00 65.48  ? 1077 VAL A C      1 
ATOM   1448  O  O      . VAL A 1 115 ? -31.157  70.686  0.227   1.00 64.29  ? 1077 VAL A O      1 
ATOM   1449  C  CB     . VAL A 1 115 ? -29.964  71.363  -2.849  1.00 66.57  ? 1077 VAL A CB     1 
ATOM   1450  C  CG1    . VAL A 1 115 ? -30.544  71.379  -4.250  1.00 66.41  ? 1077 VAL A CG1    1 
ATOM   1451  C  CG2    . VAL A 1 115 ? -28.650  72.147  -2.796  1.00 72.39  ? 1077 VAL A CG2    1 
ATOM   1452  H  H      . VAL A 1 115 ? -30.617  73.723  -2.553  1.00 76.81  ? 1077 VAL A H      1 
ATOM   1453  H  HA     . VAL A 1 115 ? -31.839  71.466  -2.018  1.00 79.04  ? 1077 VAL A HA     1 
ATOM   1454  H  HB     . VAL A 1 115 ? -29.766  70.440  -2.623  1.00 79.88  ? 1077 VAL A HB     1 
ATOM   1455  H  HG11   . VAL A 1 115 ? -29.883  71.033  -4.869  1.00 79.69  ? 1077 VAL A HG11   1 
ATOM   1456  H  HG12   . VAL A 1 115 ? -31.339  70.823  -4.268  1.00 79.69  ? 1077 VAL A HG12   1 
ATOM   1457  H  HG13   . VAL A 1 115 ? -30.773  72.292  -4.485  1.00 79.69  ? 1077 VAL A HG13   1 
ATOM   1458  H  HG21   . VAL A 1 115 ? -28.032  71.772  -3.443  1.00 86.87  ? 1077 VAL A HG21   1 
ATOM   1459  H  HG22   . VAL A 1 115 ? -28.829  73.076  -3.009  1.00 86.87  ? 1077 VAL A HG22   1 
ATOM   1460  H  HG23   . VAL A 1 115 ? -28.277  72.078  -1.903  1.00 86.87  ? 1077 VAL A HG23   1 
ATOM   1461  N  N      . ARG A 1 116 ? -29.636  72.336  0.136   1.00 68.73  ? 1078 ARG A N      1 
ATOM   1462  C  CA     . ARG A 1 116 ? -29.215  72.113  1.513   1.00 69.32  ? 1078 ARG A CA     1 
ATOM   1463  C  C      . ARG A 1 116 ? -30.327  72.481  2.492   1.00 66.17  ? 1078 ARG A C      1 
ATOM   1464  O  O      . ARG A 1 116 ? -30.465  71.845  3.544   1.00 66.39  ? 1078 ARG A O      1 
ATOM   1465  C  CB     . ARG A 1 116 ? -27.921  72.883  1.783   1.00 78.28  ? 1078 ARG A CB     1 
ATOM   1466  C  CG     . ARG A 1 116 ? -27.253  72.555  3.106   1.00 85.71  ? 1078 ARG A CG     1 
ATOM   1467  C  CD     . ARG A 1 116 ? -25.846  73.147  3.175   1.00 92.82  ? 1078 ARG A CD     1 
ATOM   1468  N  NE     . ARG A 1 116 ? -25.262  73.024  4.509   1.00 98.41  ? 1078 ARG A NE     1 
ATOM   1469  C  CZ     . ARG A 1 116 ? -24.045  73.446  4.842   1.00 105.24 ? 1078 ARG A CZ     1 
ATOM   1470  N  NH1    . ARG A 1 116 ? -23.266  74.029  3.940   1.00 107.46 1 1078 ARG A NH1    1 
ATOM   1471  N  NH2    . ARG A 1 116 ? -23.604  73.288  6.083   1.00 107.74 ? 1078 ARG A NH2    1 
ATOM   1472  H  H      . ARG A 1 116 ? -29.217  72.969  -0.268  1.00 82.48  ? 1078 ARG A H      1 
ATOM   1473  H  HA     . ARG A 1 116 ? -29.024  71.169  1.629   1.00 83.18  ? 1078 ARG A HA     1 
ATOM   1474  H  HB2    . ARG A 1 116 ? -27.288  72.682  1.076   1.00 93.94  ? 1078 ARG A HB2    1 
ATOM   1475  H  HB3    . ARG A 1 116 ? -28.120  73.832  1.782   1.00 93.94  ? 1078 ARG A HB3    1 
ATOM   1476  H  HG2    . ARG A 1 116 ? -27.777  72.929  3.831   1.00 102.85 ? 1078 ARG A HG2    1 
ATOM   1477  H  HG3    . ARG A 1 116 ? -27.185  71.593  3.201   1.00 102.85 ? 1078 ARG A HG3    1 
ATOM   1478  H  HD2    . ARG A 1 116 ? -25.272  72.676  2.550   1.00 111.38 ? 1078 ARG A HD2    1 
ATOM   1479  H  HD3    . ARG A 1 116 ? -25.885  74.089  2.948   1.00 111.38 ? 1078 ARG A HD3    1 
ATOM   1480  H  HE     . ARG A 1 116 ? -25.738  72.652  5.121   1.00 118.09 ? 1078 ARG A HE     1 
ATOM   1481  H  HH11   . ARG A 1 116 ? -23.546  74.135  3.133   1.00 128.95 ? 1078 ARG A HH11   1 
ATOM   1482  H  HH12   . ARG A 1 116 ? -22.480  74.301  4.161   1.00 128.95 ? 1078 ARG A HH12   1 
ATOM   1483  H  HH21   . ARG A 1 116 ? -24.105  72.911  6.672   1.00 129.28 ? 1078 ARG A HH21   1 
ATOM   1484  H  HH22   . ARG A 1 116 ? -22.818  73.562  6.299   1.00 129.28 ? 1078 ARG A HH22   1 
ATOM   1485  N  N      . THR A 1 117 ? -31.129  73.499  2.161   1.00 58.46  ? 1079 THR A N      1 
ATOM   1486  C  CA     . THR A 1 117 ? -32.268  73.858  3.003   1.00 51.54  ? 1079 THR A CA     1 
ATOM   1487  C  C      . THR A 1 117 ? -33.290  72.730  3.057   1.00 50.38  ? 1079 THR A C      1 
ATOM   1488  O  O      . THR A 1 117 ? -33.864  72.455  4.118   1.00 48.09  ? 1079 THR A O      1 
ATOM   1489  C  CB     . THR A 1 117 ? -32.926  75.138  2.481   1.00 49.09  ? 1079 THR A CB     1 
ATOM   1490  O  OG1    . THR A 1 117 ? -31.979  76.213  2.497   1.00 53.95  ? 1079 THR A OG1    1 
ATOM   1491  C  CG2    . THR A 1 117 ? -34.137  75.519  3.319   1.00 46.61  ? 1079 THR A CG2    1 
ATOM   1492  H  H      . THR A 1 117 ? -31.034  73.990  1.462   1.00 70.15  ? 1079 THR A H      1 
ATOM   1493  H  HA     . THR A 1 117 ? -31.955  74.025  3.906   1.00 61.85  ? 1079 THR A HA     1 
ATOM   1494  H  HB     . THR A 1 117 ? -33.224  74.993  1.570   1.00 58.91  ? 1079 THR A HB     1 
ATOM   1495  H  HG1    . THR A 1 117 ? -31.322  76.025  2.009   1.00 64.74  ? 1079 THR A HG1    1 
ATOM   1496  H  HG21   . THR A 1 117 ? -34.538  76.331  2.972   1.00 55.93  ? 1079 THR A HG21   1 
ATOM   1497  H  HG22   . THR A 1 117 ? -34.795  74.807  3.293   1.00 55.93  ? 1079 THR A HG22   1 
ATOM   1498  H  HG23   . THR A 1 117 ? -33.870  75.667  4.240   1.00 55.93  ? 1079 THR A HG23   1 
ATOM   1499  N  N      . ILE A 1 118 ? -33.540  72.071  1.922   1.00 54.52  ? 1080 ILE A N      1 
ATOM   1500  C  CA     . ILE A 1 118 ? -34.487  70.959  1.900   1.00 51.45  ? 1080 ILE A CA     1 
ATOM   1501  C  C      . ILE A 1 118 ? -34.043  69.867  2.863   1.00 55.38  ? 1080 ILE A C      1 
ATOM   1502  O  O      . ILE A 1 118 ? -34.856  69.299  3.601   1.00 50.90  ? 1080 ILE A O      1 
ATOM   1503  C  CB     . ILE A 1 118 ? -34.641  70.422  0.462   1.00 51.69  ? 1080 ILE A CB     1 
ATOM   1504  C  CG1    . ILE A 1 118 ? -35.453  71.401  -0.391  1.00 47.63  ? 1080 ILE A CG1    1 
ATOM   1505  C  CG2    . ILE A 1 118 ? -35.261  69.013  0.445   1.00 51.09  ? 1080 ILE A CG2    1 
ATOM   1506  C  CD1    . ILE A 1 118 ? -36.937  71.433  -0.069  1.00 46.27  ? 1080 ILE A CD1    1 
ATOM   1507  H  H      . ILE A 1 118 ? -33.178  72.248  1.162   1.00 65.42  ? 1080 ILE A H      1 
ATOM   1508  H  HA     . ILE A 1 118 ? -35.355  71.279  2.193   1.00 61.74  ? 1080 ILE A HA     1 
ATOM   1509  H  HB     . ILE A 1 118 ? -33.754  70.359  0.074   1.00 62.02  ? 1080 ILE A HB     1 
ATOM   1510  H  HG12   . ILE A 1 118 ? -35.103  72.296  -0.254  1.00 57.15  ? 1080 ILE A HG12   1 
ATOM   1511  H  HG13   . ILE A 1 118 ? -35.359  71.152  -1.323  1.00 57.15  ? 1080 ILE A HG13   1 
ATOM   1512  H  HG21   . ILE A 1 118 ? -35.340  68.714  -0.475  1.00 61.31  ? 1080 ILE A HG21   1 
ATOM   1513  H  HG22   . ILE A 1 118 ? -34.686  68.409  0.941   1.00 61.31  ? 1080 ILE A HG22   1 
ATOM   1514  H  HG23   . ILE A 1 118 ? -36.138  69.049  0.858   1.00 61.31  ? 1080 ILE A HG23   1 
ATOM   1515  H  HD11   . ILE A 1 118 ? -37.372  72.075  -0.651  1.00 55.52  ? 1080 ILE A HD11   1 
ATOM   1516  H  HD12   . ILE A 1 118 ? -37.310  70.549  -0.213  1.00 55.52  ? 1080 ILE A HD12   1 
ATOM   1517  H  HD13   . ILE A 1 118 ? -37.053  71.695  0.858   1.00 55.52  ? 1080 ILE A HD13   1 
ATOM   1518  N  N      . GLU A 1 119 ? -32.746  69.558  2.870   1.00 66.18  ? 1081 GLU A N      1 
ATOM   1519  C  CA     . GLU A 1 119 ? -32.240  68.499  3.736   1.00 71.02  ? 1081 GLU A CA     1 
ATOM   1520  C  C      . GLU A 1 119 ? -32.284  68.917  5.201   1.00 70.12  ? 1081 GLU A C      1 
ATOM   1521  O  O      . GLU A 1 119 ? -32.586  68.097  6.076   1.00 73.69  ? 1081 GLU A O      1 
ATOM   1522  C  CB     . GLU A 1 119 ? -30.824  68.125  3.307   1.00 77.51  ? 1081 GLU A CB     1 
ATOM   1523  C  CG     . GLU A 1 119 ? -30.788  67.429  1.950   1.00 81.31  ? 1081 GLU A CG     1 
ATOM   1524  C  CD     . GLU A 1 119 ? -29.392  67.318  1.367   1.00 89.34  ? 1081 GLU A CD     1 
ATOM   1525  O  OE1    . GLU A 1 119 ? -28.436  67.835  1.986   1.00 93.38  ? 1081 GLU A OE1    1 
ATOM   1526  O  OE2    . GLU A 1 119 ? -29.254  66.717  0.280   1.00 90.15  1 1081 GLU A OE2    1 
ATOM   1527  H  H      . GLU A 1 119 ? -32.146  69.942  2.389   1.00 79.42  ? 1081 GLU A H      1 
ATOM   1528  H  HA     . GLU A 1 119 ? -32.801  67.714  3.633   1.00 85.23  ? 1081 GLU A HA     1 
ATOM   1529  H  HB2    . GLU A 1 119 ? -30.288  68.931  3.245   1.00 93.01  ? 1081 GLU A HB2    1 
ATOM   1530  H  HB3    . GLU A 1 119 ? -30.443  67.522  3.964   1.00 93.01  ? 1081 GLU A HB3    1 
ATOM   1531  H  HG2    . GLU A 1 119 ? -31.142  66.531  2.049   1.00 97.57  ? 1081 GLU A HG2    1 
ATOM   1532  H  HG3    . GLU A 1 119 ? -31.333  67.932  1.325   1.00 97.57  ? 1081 GLU A HG3    1 
ATOM   1533  N  N      . GLU A 1 120 ? -31.990  70.188  5.489   1.00 63.84  ? 1082 GLU A N      1 
ATOM   1534  C  CA     . GLU A 1 120 ? -32.145  70.687  6.853   1.00 58.71  ? 1082 GLU A CA     1 
ATOM   1535  C  C      . GLU A 1 120 ? -33.602  70.624  7.289   1.00 54.90  ? 1082 GLU A C      1 
ATOM   1536  O  O      . GLU A 1 120 ? -33.907  70.231  8.421   1.00 53.60  ? 1082 GLU A O      1 
ATOM   1537  C  CB     . GLU A 1 120 ? -31.619  72.121  6.956   1.00 58.95  ? 1082 GLU A CB     1 
ATOM   1538  C  CG     . GLU A 1 120 ? -30.111  72.251  6.800   1.00 66.53  ? 1082 GLU A CG     1 
ATOM   1539  C  CD     . GLU A 1 120 ? -29.637  73.695  6.831   1.00 70.21  ? 1082 GLU A CD     1 
ATOM   1540  O  OE1    . GLU A 1 120 ? -30.475  74.594  7.052   1.00 68.78  ? 1082 GLU A OE1    1 
ATOM   1541  O  OE2    . GLU A 1 120 ? -28.427  73.931  6.631   1.00 74.84  1 1082 GLU A OE2    1 
ATOM   1542  H  H      . GLU A 1 120 ? -31.704  70.769  4.924   1.00 76.61  ? 1082 GLU A H      1 
ATOM   1543  H  HA     . GLU A 1 120 ? -31.626  70.132  7.455   1.00 70.45  ? 1082 GLU A HA     1 
ATOM   1544  H  HB2    . GLU A 1 120 ? -32.034  72.654  6.260   1.00 70.74  ? 1082 GLU A HB2    1 
ATOM   1545  H  HB3    . GLU A 1 120 ? -31.857  72.477  7.826   1.00 70.74  ? 1082 GLU A HB3    1 
ATOM   1546  H  HG2    . GLU A 1 120 ? -29.676  71.777  7.526   1.00 79.84  ? 1082 GLU A HG2    1 
ATOM   1547  H  HG3    . GLU A 1 120 ? -29.847  71.867  5.949   1.00 79.84  ? 1082 GLU A HG3    1 
ATOM   1548  N  N      . LEU A 1 121 ? -34.519  71.004  6.398   1.00 59.03  ? 1083 LEU A N      1 
ATOM   1549  C  CA     . LEU A 1 121 ? -35.939  70.964  6.730   1.00 59.60  ? 1083 LEU A CA     1 
ATOM   1550  C  C      . LEU A 1 121 ? -36.401  69.540  7.017   1.00 58.05  ? 1083 LEU A C      1 
ATOM   1551  O  O      . LEU A 1 121 ? -37.159  69.305  7.966   1.00 55.96  ? 1083 LEU A O      1 
ATOM   1552  C  CB     . LEU A 1 121 ? -36.750  71.572  5.586   1.00 56.11  ? 1083 LEU A CB     1 
ATOM   1553  C  CG     . LEU A 1 121 ? -38.268  71.575  5.747   1.00 55.74  ? 1083 LEU A CG     1 
ATOM   1554  C  CD1    . LEU A 1 121 ? -38.688  72.339  7.001   1.00 58.75  ? 1083 LEU A CD1    1 
ATOM   1555  C  CD2    . LEU A 1 121 ? -38.906  72.180  4.516   1.00 55.68  ? 1083 LEU A CD2    1 
ATOM   1556  H  H      . LEU A 1 121 ? -34.346  71.286  5.604   1.00 70.84  ? 1083 LEU A H      1 
ATOM   1557  H  HA     . LEU A 1 121 ? -36.094  71.497  7.525   1.00 71.51  ? 1083 LEU A HA     1 
ATOM   1558  H  HB2    . LEU A 1 121 ? -36.471  72.495  5.475   1.00 67.33  ? 1083 LEU A HB2    1 
ATOM   1559  H  HB3    . LEU A 1 121 ? -36.548  71.077  4.776   1.00 67.33  ? 1083 LEU A HB3    1 
ATOM   1560  H  HG     . LEU A 1 121 ? -38.581  70.660  5.831   1.00 66.88  ? 1083 LEU A HG     1 
ATOM   1561  H  HD11   . LEU A 1 121 ? -39.656  72.320  7.072   1.00 70.51  ? 1083 LEU A HD11   1 
ATOM   1562  H  HD12   . LEU A 1 121 ? -38.291  71.913  7.777   1.00 70.51  ? 1083 LEU A HD12   1 
ATOM   1563  H  HD13   . LEU A 1 121 ? -38.379  73.255  6.931   1.00 70.51  ? 1083 LEU A HD13   1 
ATOM   1564  H  HD21   . LEU A 1 121 ? -39.870  72.178  4.627   1.00 66.81  ? 1083 LEU A HD21   1 
ATOM   1565  H  HD22   . LEU A 1 121 ? -38.587  73.090  4.411   1.00 66.81  ? 1083 LEU A HD22   1 
ATOM   1566  H  HD23   . LEU A 1 121 ? -38.661  71.651  3.741   1.00 66.81  ? 1083 LEU A HD23   1 
ATOM   1567  N  N      . ALA A 1 122 ? -35.945  68.574  6.215   1.00 54.05  ? 1084 ALA A N      1 
ATOM   1568  C  CA     . ALA A 1 122 ? -36.335  67.185  6.436   1.00 52.45  ? 1084 ALA A CA     1 
ATOM   1569  C  C      . ALA A 1 122 ? -35.913  66.705  7.820   1.00 54.13  ? 1084 ALA A C      1 
ATOM   1570  O  O      . ALA A 1 122 ? -36.681  66.024  8.509   1.00 50.17  ? 1084 ALA A O      1 
ATOM   1571  C  CB     . ALA A 1 122 ? -35.733  66.293  5.351   1.00 49.99  ? 1084 ALA A CB     1 
ATOM   1572  H  H      . ALA A 1 122 ? -35.418  68.696  5.547   1.00 64.86  ? 1084 ALA A H      1 
ATOM   1573  H  HA     . ALA A 1 122 ? -37.301  67.116  6.378   1.00 62.94  ? 1084 ALA A HA     1 
ATOM   1574  H  HB1    . ALA A 1 122 ? -36.001  65.375  5.512   1.00 59.98  ? 1084 ALA A HB1    1 
ATOM   1575  H  HB2    . ALA A 1 122 ? -36.058  66.586  4.485   1.00 59.98  ? 1084 ALA A HB2    1 
ATOM   1576  H  HB3    . ALA A 1 122 ? -34.766  66.366  5.383   1.00 59.98  ? 1084 ALA A HB3    1 
ATOM   1577  N  N      . ARG A 1 123 ? -34.698  67.055  8.250   1.00 63.29  ? 1085 ARG A N      1 
ATOM   1578  C  CA     . ARG A 1 123 ? -34.247  66.658  9.580   1.00 71.15  ? 1085 ARG A CA     1 
ATOM   1579  C  C      . ARG A 1 123 ? -35.151  67.233  10.663  1.00 69.58  ? 1085 ARG A C      1 
ATOM   1580  O  O      . ARG A 1 123 ? -35.454  66.555  11.652  1.00 69.29  ? 1085 ARG A O      1 
ATOM   1581  C  CB     . ARG A 1 123 ? -32.793  67.080  9.800   1.00 78.51  ? 1085 ARG A CB     1 
ATOM   1582  C  CG     . ARG A 1 123 ? -31.797  66.229  9.025   1.00 86.35  ? 1085 ARG A CG     1 
ATOM   1583  C  CD     . ARG A 1 123 ? -30.375  66.764  9.109   1.00 94.62  ? 1085 ARG A CD     1 
ATOM   1584  N  NE     . ARG A 1 123 ? -29.502  66.105  8.137   1.00 98.98  ? 1085 ARG A NE     1 
ATOM   1585  C  CZ     . ARG A 1 123 ? -28.821  66.717  7.170   1.00 101.97 ? 1085 ARG A CZ     1 
ATOM   1586  N  NH1    . ARG A 1 123 ? -28.882  68.033  7.016   1.00 101.55 1 1085 ARG A NH1    1 
ATOM   1587  N  NH2    . ARG A 1 123 ? -28.063  66.002  6.348   1.00 104.44 ? 1085 ARG A NH2    1 
ATOM   1588  H  H      . ARG A 1 123 ? -34.127  67.514  7.798   1.00 75.95  ? 1085 ARG A H      1 
ATOM   1589  H  HA     . ARG A 1 123 ? -34.286  65.691  9.646   1.00 85.37  ? 1085 ARG A HA     1 
ATOM   1590  H  HB2    . ARG A 1 123 ? -32.686  68.000  9.512   1.00 94.21  ? 1085 ARG A HB2    1 
ATOM   1591  H  HB3    . ARG A 1 123 ? -32.582  67.002  10.743  1.00 94.21  ? 1085 ARG A HB3    1 
ATOM   1592  H  HG2    . ARG A 1 123 ? -31.801  65.330  9.388   1.00 103.62 ? 1085 ARG A HG2    1 
ATOM   1593  H  HG3    . ARG A 1 123 ? -32.057  66.211  8.091   1.00 103.62 ? 1085 ARG A HG3    1 
ATOM   1594  H  HD2    . ARG A 1 123 ? -30.378  67.715  8.919   1.00 113.54 ? 1085 ARG A HD2    1 
ATOM   1595  H  HD3    . ARG A 1 123 ? -30.021  66.599  9.997   1.00 113.54 ? 1085 ARG A HD3    1 
ATOM   1596  H  HE     . ARG A 1 123 ? -29.422  65.250  8.195   1.00 118.77 ? 1085 ARG A HE     1 
ATOM   1597  H  HH11   . ARG A 1 123 ? -29.371  68.506  7.543   1.00 121.85 ? 1085 ARG A HH11   1 
ATOM   1598  H  HH12   . ARG A 1 123 ? -28.436  68.414  6.388   1.00 121.85 ? 1085 ARG A HH12   1 
ATOM   1599  H  HH21   . ARG A 1 123 ? -28.015  65.148  6.441   1.00 125.33 ? 1085 ARG A HH21   1 
ATOM   1600  H  HH22   . ARG A 1 123 ? -27.619  66.392  5.723   1.00 125.33 ? 1085 ARG A HH22   1 
ATOM   1601  N  N      . VAL A 1 124 ? -35.585  68.484  10.501  1.00 66.35  ? 1086 VAL A N      1 
ATOM   1602  C  CA     . VAL A 1 124 ? -36.488  69.087  11.478  1.00 66.07  ? 1086 VAL A CA     1 
ATOM   1603  C  C      . VAL A 1 124 ? -37.802  68.315  11.528  1.00 62.65  ? 1086 VAL A C      1 
ATOM   1604  O  O      . VAL A 1 124 ? -38.316  67.994  12.606  1.00 63.22  ? 1086 VAL A O      1 
ATOM   1605  C  CB     . VAL A 1 124 ? -36.722  70.573  11.147  1.00 66.43  ? 1086 VAL A CB     1 
ATOM   1606  C  CG1    . VAL A 1 124 ? -37.825  71.167  12.027  1.00 66.20  ? 1086 VAL A CG1    1 
ATOM   1607  C  CG2    . VAL A 1 124 ? -35.432  71.364  11.308  1.00 70.66  ? 1086 VAL A CG2    1 
ATOM   1608  H  H      . VAL A 1 124 ? -35.374  68.997  9.844   1.00 79.61  ? 1086 VAL A H      1 
ATOM   1609  H  HA     . VAL A 1 124 ? -36.080  69.038  12.357  1.00 79.28  ? 1086 VAL A HA     1 
ATOM   1610  H  HB     . VAL A 1 124 ? -37.005  70.649  10.222  1.00 79.72  ? 1086 VAL A HB     1 
ATOM   1611  H  HG11   . VAL A 1 124 ? -37.947  72.100  11.794  1.00 79.44  ? 1086 VAL A HG11   1 
ATOM   1612  H  HG12   . VAL A 1 124 ? -38.648  70.677  11.874  1.00 79.44  ? 1086 VAL A HG12   1 
ATOM   1613  H  HG13   . VAL A 1 124 ? -37.562  71.089  12.958  1.00 79.44  ? 1086 VAL A HG13   1 
ATOM   1614  H  HG21   . VAL A 1 124 ? -35.603  72.294  11.094  1.00 84.79  ? 1086 VAL A HG21   1 
ATOM   1615  H  HG22   . VAL A 1 124 ? -35.126  71.285  12.225  1.00 84.79  ? 1086 VAL A HG22   1 
ATOM   1616  H  HG23   . VAL A 1 124 ? -34.764  71.003  10.704  1.00 84.79  ? 1086 VAL A HG23   1 
ATOM   1617  N  N      . LEU A 1 125 ? -38.355  67.990  10.357  1.00 60.04  ? 1087 LEU A N      1 
ATOM   1618  C  CA     . LEU A 1 125 ? -39.662  67.348  10.293  1.00 57.61  ? 1087 LEU A CA     1 
ATOM   1619  C  C      . LEU A 1 125 ? -39.645  65.928  10.841  1.00 59.95  ? 1087 LEU A C      1 
ATOM   1620  O  O      . LEU A 1 125 ? -40.700  65.415  11.229  1.00 57.55  ? 1087 LEU A O      1 
ATOM   1621  C  CB     . LEU A 1 125 ? -40.164  67.346  8.849   1.00 57.21  ? 1087 LEU A CB     1 
ATOM   1622  C  CG     . LEU A 1 125 ? -40.487  68.724  8.266   1.00 56.64  ? 1087 LEU A CG     1 
ATOM   1623  C  CD1    . LEU A 1 125 ? -40.691  68.635  6.761   1.00 55.03  ? 1087 LEU A CD1    1 
ATOM   1624  C  CD2    . LEU A 1 125 ? -41.716  69.325  8.939   1.00 55.41  ? 1087 LEU A CD2    1 
ATOM   1625  H  H      . LEU A 1 125 ? -37.993  68.132  9.590   1.00 72.05  ? 1087 LEU A H      1 
ATOM   1626  H  HA     . LEU A 1 125 ? -40.289  67.863  10.825  1.00 69.14  ? 1087 LEU A HA     1 
ATOM   1627  H  HB2    . LEU A 1 125 ? -39.482  66.944  8.288   1.00 68.65  ? 1087 LEU A HB2    1 
ATOM   1628  H  HB3    . LEU A 1 125 ? -40.974  66.814  8.806   1.00 68.65  ? 1087 LEU A HB3    1 
ATOM   1629  H  HG     . LEU A 1 125 ? -39.737  69.318  8.429   1.00 67.97  ? 1087 LEU A HG     1 
ATOM   1630  H  HD11   . LEU A 1 125 ? -40.894  69.519  6.417   1.00 66.04  ? 1087 LEU A HD11   1 
ATOM   1631  H  HD12   . LEU A 1 125 ? -39.879  68.298  6.352   1.00 66.04  ? 1087 LEU A HD12   1 
ATOM   1632  H  HD13   . LEU A 1 125 ? -41.428  68.031  6.579   1.00 66.04  ? 1087 LEU A HD13   1 
ATOM   1633  H  HD21   . LEU A 1 125 ? -41.895  70.195  8.550   1.00 66.49  ? 1087 LEU A HD21   1 
ATOM   1634  H  HD22   . LEU A 1 125 ? -42.473  68.736  8.797   1.00 66.49  ? 1087 LEU A HD22   1 
ATOM   1635  H  HD23   . LEU A 1 125 ? -41.541  69.417  9.889   1.00 66.49  ? 1087 LEU A HD23   1 
ATOM   1636  N  N      . ARG A 1 126 ? -38.482  65.280  10.888  1.00 65.36  ? 1088 ARG A N      1 
ATOM   1637  C  CA     . ARG A 1 126 ? -38.404  63.944  11.465  1.00 68.14  ? 1088 ARG A CA     1 
ATOM   1638  C  C      . ARG A 1 126 ? -38.637  63.947  12.972  1.00 66.93  ? 1088 ARG A C      1 
ATOM   1639  O  O      . ARG A 1 126 ? -38.900  62.885  13.545  1.00 70.56  ? 1088 ARG A O      1 
ATOM   1640  C  CB     . ARG A 1 126 ? -37.050  63.314  11.133  1.00 71.22  ? 1088 ARG A CB     1 
ATOM   1641  C  CG     . ARG A 1 126 ? -36.918  62.930  9.665   1.00 71.63  ? 1088 ARG A CG     1 
ATOM   1642  C  CD     . ARG A 1 126 ? -35.546  62.365  9.326   1.00 73.92  ? 1088 ARG A CD     1 
ATOM   1643  N  NE     . ARG A 1 126 ? -35.432  62.066  7.898   1.00 75.73  ? 1088 ARG A NE     1 
ATOM   1644  C  CZ     . ARG A 1 126 ? -34.625  62.689  7.039   1.00 75.69  ? 1088 ARG A CZ     1 
ATOM   1645  N  NH1    . ARG A 1 126 ? -33.822  63.667  7.438   1.00 78.18  1 1088 ARG A NH1    1 
ATOM   1646  N  NH2    . ARG A 1 126 ? -34.618  62.323  5.764   1.00 74.19  ? 1088 ARG A NH2    1 
ATOM   1647  H  H      . ARG A 1 126 ? -37.734  65.588  10.595  1.00 78.44  ? 1088 ARG A H      1 
ATOM   1648  H  HA     . ARG A 1 126 ? -39.092  63.392  11.063  1.00 81.77  ? 1088 ARG A HA     1 
ATOM   1649  H  HB2    . ARG A 1 126 ? -36.347  63.950  11.340  1.00 85.47  ? 1088 ARG A HB2    1 
ATOM   1650  H  HB3    . ARG A 1 126 ? -36.937  62.511  11.664  1.00 85.47  ? 1088 ARG A HB3    1 
ATOM   1651  H  HG2    . ARG A 1 126 ? -37.581  62.254  9.455   1.00 85.96  ? 1088 ARG A HG2    1 
ATOM   1652  H  HG3    . ARG A 1 126 ? -37.061  63.718  9.118   1.00 85.96  ? 1088 ARG A HG3    1 
ATOM   1653  H  HD2    . ARG A 1 126 ? -34.865  63.017  9.556   1.00 88.70  ? 1088 ARG A HD2    1 
ATOM   1654  H  HD3    . ARG A 1 126 ? -35.406  61.543  9.822   1.00 88.70  ? 1088 ARG A HD3    1 
ATOM   1655  H  HE     . ARG A 1 126 ? -35.926  61.435  7.587   1.00 90.87  ? 1088 ARG A HE     1 
ATOM   1656  H  HH11   . ARG A 1 126 ? -33.820  63.912  8.262   1.00 93.81  ? 1088 ARG A HH11   1 
ATOM   1657  H  HH12   . ARG A 1 126 ? -33.307  64.058  6.871   1.00 93.81  ? 1088 ARG A HH12   1 
ATOM   1658  H  HH21   . ARG A 1 126 ? -35.133  61.689  5.496   1.00 89.02  ? 1088 ARG A HH21   1 
ATOM   1659  H  HH22   . ARG A 1 126 ? -34.098  62.719  5.206   1.00 89.02  ? 1088 ARG A HH22   1 
ATOM   1660  N  N      . LYS A 1 127 ? -38.555  65.106  13.622  1.00 59.28  ? 1089 LYS A N      1 
ATOM   1661  C  CA     . LYS A 1 127 ? -38.817  65.227  15.051  1.00 57.64  ? 1089 LYS A CA     1 
ATOM   1662  C  C      . LYS A 1 127 ? -40.290  65.454  15.380  1.00 56.73  ? 1089 LYS A C      1 
ATOM   1663  O  O      . LYS A 1 127 ? -40.636  65.536  16.563  1.00 58.56  ? 1089 LYS A O      1 
ATOM   1664  C  CB     . LYS A 1 127 ? -37.989  66.377  15.633  1.00 62.25  ? 1089 LYS A CB     1 
ATOM   1665  C  CG     . LYS A 1 127 ? -36.488  66.242  15.398  1.00 67.58  ? 1089 LYS A CG     1 
ATOM   1666  C  CD     . LYS A 1 127 ? -35.700  67.394  16.013  1.00 72.12  ? 1089 LYS A CD     1 
ATOM   1667  C  CE     . LYS A 1 127 ? -36.148  68.738  15.452  1.00 73.46  ? 1089 LYS A CE     1 
ATOM   1668  N  NZ     . LYS A 1 127 ? -35.189  69.837  15.753  1.00 76.23  1 1089 LYS A NZ     1 
ATOM   1669  H  H      . LYS A 1 127 ? -38.346  65.852  13.247  1.00 71.14  ? 1089 LYS A H      1 
ATOM   1670  H  HA     . LYS A 1 127 ? -38.538  64.408  15.489  1.00 69.17  ? 1089 LYS A HA     1 
ATOM   1671  H  HB2    . LYS A 1 127 ? -38.278  67.208  15.224  1.00 74.70  ? 1089 LYS A HB2    1 
ATOM   1672  H  HB3    . LYS A 1 127 ? -38.136  66.414  16.591  1.00 74.70  ? 1089 LYS A HB3    1 
ATOM   1673  H  HG2    . LYS A 1 127 ? -36.177  65.416  15.800  1.00 81.10  ? 1089 LYS A HG2    1 
ATOM   1674  H  HG3    . LYS A 1 127 ? -36.315  66.235  14.444  1.00 81.10  ? 1089 LYS A HG3    1 
ATOM   1675  H  HD2    . LYS A 1 127 ? -35.842  67.402  16.973  1.00 86.54  ? 1089 LYS A HD2    1 
ATOM   1676  H  HD3    . LYS A 1 127 ? -34.758  67.279  15.814  1.00 86.54  ? 1089 LYS A HD3    1 
ATOM   1677  H  HE2    . LYS A 1 127 ? -36.229  68.667  14.488  1.00 88.15  ? 1089 LYS A HE2    1 
ATOM   1678  H  HE3    . LYS A 1 127 ? -37.005  68.973  15.841  1.00 88.15  ? 1089 LYS A HE3    1 
ATOM   1679  H  HZ1    . LYS A 1 127 ? -35.487  70.603  15.409  1.00 91.47  ? 1089 LYS A HZ1    1 
ATOM   1680  H  HZ2    . LYS A 1 127 ? -35.101  69.931  16.634  1.00 91.47  ? 1089 LYS A HZ2    1 
ATOM   1681  H  HZ3    . LYS A 1 127 ? -34.394  69.652  15.400  1.00 91.47  ? 1089 LYS A HZ3    1 
ATOM   1682  N  N      . HIS A 1 128 ? -41.158  65.566  14.378  1.00 58.04  ? 1090 HIS A N      1 
ATOM   1683  C  CA     . HIS A 1 128 ? -42.573  65.846  14.597  1.00 56.47  ? 1090 HIS A CA     1 
ATOM   1684  C  C      . HIS A 1 128 ? -43.327  64.531  14.765  1.00 58.25  ? 1090 HIS A C      1 
ATOM   1685  O  O      . HIS A 1 128 ? -43.404  63.730  13.826  1.00 57.95  ? 1090 HIS A O      1 
ATOM   1686  C  CB     . HIS A 1 128 ? -43.130  66.657  13.428  1.00 55.36  ? 1090 HIS A CB     1 
ATOM   1687  C  CG     . HIS A 1 128 ? -44.457  67.293  13.700  1.00 54.45  ? 1090 HIS A CG     1 
ATOM   1688  N  ND1    . HIS A 1 128 ? -45.554  66.579  14.130  1.00 53.30  ? 1090 HIS A ND1    1 
ATOM   1689  C  CD2    . HIS A 1 128 ? -44.870  68.577  13.580  1.00 54.19  ? 1090 HIS A CD2    1 
ATOM   1690  C  CE1    . HIS A 1 128 ? -46.582  67.395  14.273  1.00 51.23  ? 1090 HIS A CE1    1 
ATOM   1691  N  NE2    . HIS A 1 128 ? -46.194  68.614  13.945  1.00 52.32  ? 1090 HIS A NE2    1 
ATOM   1692  H  H      . HIS A 1 128 ? -40.947  65.483  13.549  1.00 69.65  ? 1090 HIS A H      1 
ATOM   1693  H  HA     . HIS A 1 128 ? -42.678  66.366  15.409  1.00 67.77  ? 1090 HIS A HA     1 
ATOM   1694  H  HB2    . HIS A 1 128 ? -42.502  67.364  13.212  1.00 66.44  ? 1090 HIS A HB2    1 
ATOM   1695  H  HB3    . HIS A 1 128 ? -43.236  66.069  12.664  1.00 66.44  ? 1090 HIS A HB3    1 
ATOM   1696  H  HD2    . HIS A 1 128 ? -44.353  69.300  13.305  1.00 65.03  ? 1090 HIS A HD2    1 
ATOM   1697  H  HE1    . HIS A 1 128 ? -47.434  67.153  14.557  1.00 61.48  ? 1090 HIS A HE1    1 
ATOM   1698  H  HE2    . HIS A 1 128 ? -46.689  69.317  13.960  1.00 62.79  ? 1090 HIS A HE2    1 
ATOM   1699  N  N      . SER A 1 129 ? -43.894  64.319  15.957  1.00 60.20  ? 1091 SER A N      1 
ATOM   1700  C  CA     . SER A 1 129 ? -44.505  63.037  16.294  1.00 59.07  ? 1091 SER A CA     1 
ATOM   1701  C  C      . SER A 1 129 ? -45.779  62.759  15.506  1.00 59.52  ? 1091 SER A C      1 
ATOM   1702  O  O      . SER A 1 129 ? -46.230  61.610  15.471  1.00 59.99  ? 1091 SER A O      1 
ATOM   1703  C  CB     . SER A 1 129 ? -44.818  62.984  17.789  1.00 61.61  ? 1091 SER A CB     1 
ATOM   1704  O  OG     . SER A 1 129 ? -45.752  63.988  18.145  1.00 61.43  ? 1091 SER A OG     1 
ATOM   1705  H  H      . SER A 1 129 ? -43.936  64.904  16.586  1.00 72.24  ? 1091 SER A H      1 
ATOM   1706  H  HA     . SER A 1 129 ? -43.873  62.327  16.097  1.00 70.88  ? 1091 SER A HA     1 
ATOM   1707  H  HB2    . SER A 1 129 ? -45.193  62.115  18.003  1.00 73.94  ? 1091 SER A HB2    1 
ATOM   1708  H  HB3    . SER A 1 129 ? -43.999  63.124  18.289  1.00 73.94  ? 1091 SER A HB3    1 
ATOM   1709  H  HG     . SER A 1 129 ? -45.917  63.950  18.967  1.00 73.72  ? 1091 SER A HG     1 
ATOM   1710  N  N      . GLY A 1 130 ? -46.368  63.771  14.878  1.00 55.57  ? 1092 GLY A N      1 
ATOM   1711  C  CA     . GLY A 1 130 ? -47.577  63.596  14.104  1.00 52.37  ? 1092 GLY A CA     1 
ATOM   1712  C  C      . GLY A 1 130 ? -47.360  63.341  12.630  1.00 53.14  ? 1092 GLY A C      1 
ATOM   1713  O  O      . GLY A 1 130 ? -48.338  63.279  11.876  1.00 50.68  ? 1092 GLY A O      1 
ATOM   1714  H  H      . GLY A 1 130 ? -46.077  64.580  14.889  1.00 66.68  ? 1092 GLY A H      1 
ATOM   1715  H  HA2    . GLY A 1 130 ? -48.077  62.848  14.466  1.00 62.84  ? 1092 GLY A HA2    1 
ATOM   1716  H  HA3    . GLY A 1 130 ? -48.124  64.393  14.192  1.00 62.84  ? 1092 GLY A HA3    1 
ATOM   1717  N  N      . LEU A 1 131 ? -46.113  63.173  12.197  1.00 50.66  ? 1093 LEU A N      1 
ATOM   1718  C  CA     . LEU A 1 131 ? -45.780  62.961  10.799  1.00 50.79  ? 1093 LEU A CA     1 
ATOM   1719  C  C      . LEU A 1 131 ? -45.107  61.606  10.635  1.00 52.27  ? 1093 LEU A C      1 
ATOM   1720  O  O      . LEU A 1 131 ? -44.600  61.021  11.595  1.00 52.98  ? 1093 LEU A O      1 
ATOM   1721  C  CB     . LEU A 1 131 ? -44.859  64.069  10.273  1.00 51.04  ? 1093 LEU A CB     1 
ATOM   1722  C  CG     . LEU A 1 131 ? -45.290  65.501  10.597  1.00 50.12  ? 1093 LEU A CG     1 
ATOM   1723  C  CD1    . LEU A 1 131 ? -44.300  66.490  10.003  1.00 51.76  ? 1093 LEU A CD1    1 
ATOM   1724  C  CD2    . LEU A 1 131 ? -46.705  65.783  10.103  1.00 49.24  ? 1093 LEU A CD2    1 
ATOM   1725  H  H      . LEU A 1 131 ? -45.425  63.179  12.713  1.00 60.79  ? 1093 LEU A H      1 
ATOM   1726  H  HA     . LEU A 1 131 ? -46.594  62.964  10.271  1.00 60.95  ? 1093 LEU A HA     1 
ATOM   1727  H  HB2    . LEU A 1 131 ? -43.976  63.939  10.653  1.00 61.24  ? 1093 LEU A HB2    1 
ATOM   1728  H  HB3    . LEU A 1 131 ? -44.809  63.993  9.307   1.00 61.24  ? 1093 LEU A HB3    1 
ATOM   1729  H  HG     . LEU A 1 131 ? -45.284  65.618  11.560  1.00 60.14  ? 1093 LEU A HG     1 
ATOM   1730  H  HD11   . LEU A 1 131 ? -44.587  67.391  10.217  1.00 62.11  ? 1093 LEU A HD11   1 
ATOM   1731  H  HD12   . LEU A 1 131 ? -43.423  66.323  10.382  1.00 62.11  ? 1093 LEU A HD12   1 
ATOM   1732  H  HD13   . LEU A 1 131 ? -44.273  66.370  9.041   1.00 62.11  ? 1093 LEU A HD13   1 
ATOM   1733  H  HD21   . LEU A 1 131 ? -46.940  66.697  10.327  1.00 59.09  ? 1093 LEU A HD21   1 
ATOM   1734  H  HD22   . LEU A 1 131 ? -46.734  65.659  9.142   1.00 59.09  ? 1093 LEU A HD22   1 
ATOM   1735  H  HD23   . LEU A 1 131 ? -47.318  65.167  10.535  1.00 59.09  ? 1093 LEU A HD23   1 
ATOM   1736  N  N      . ARG A 1 132 ? -45.113  61.110  9.399   1.00 53.66  ? 1094 ARG A N      1 
ATOM   1737  C  CA     . ARG A 1 132 ? -44.501  59.829  9.082   1.00 56.20  ? 1094 ARG A CA     1 
ATOM   1738  C  C      . ARG A 1 132 ? -43.898  59.897  7.688   1.00 56.78  ? 1094 ARG A C      1 
ATOM   1739  O  O      . ARG A 1 132 ? -44.362  60.653  6.831   1.00 57.02  ? 1094 ARG A O      1 
ATOM   1740  C  CB     . ARG A 1 132 ? -45.520  58.683  9.141   1.00 60.83  ? 1094 ARG A CB     1 
ATOM   1741  C  CG     . ARG A 1 132 ? -46.117  58.419  10.516  1.00 64.43  ? 1094 ARG A CG     1 
ATOM   1742  C  CD     . ARG A 1 132 ? -45.077  57.912  11.505  1.00 65.15  ? 1094 ARG A CD     1 
ATOM   1743  N  NE     . ARG A 1 132 ? -45.682  57.491  12.765  1.00 68.29  ? 1094 ARG A NE     1 
ATOM   1744  C  CZ     . ARG A 1 132 ? -46.059  58.321  13.734  1.00 68.51  ? 1094 ARG A CZ     1 
ATOM   1745  N  NH1    . ARG A 1 132 ? -45.901  59.631  13.593  1.00 67.62  1 1094 ARG A NH1    1 
ATOM   1746  N  NH2    . ARG A 1 132 ? -46.602  57.842  14.847  1.00 66.49  ? 1094 ARG A NH2    1 
ATOM   1747  H  H      . ARG A 1 132 ? -45.469  61.503  8.722   1.00 64.39  ? 1094 ARG A H      1 
ATOM   1748  H  HA     . ARG A 1 132 ? -43.791  59.644  9.716   1.00 67.44  ? 1094 ARG A HA     1 
ATOM   1749  H  HB2    . ARG A 1 132 ? -46.252  58.890  8.540   1.00 72.99  ? 1094 ARG A HB2    1 
ATOM   1750  H  HB3    . ARG A 1 132 ? -45.082  57.867  8.851   1.00 72.99  ? 1094 ARG A HB3    1 
ATOM   1751  H  HG2    . ARG A 1 132 ? -46.488  59.244  10.865  1.00 77.31  ? 1094 ARG A HG2    1 
ATOM   1752  H  HG3    . ARG A 1 132 ? -46.811  57.746  10.438  1.00 77.31  ? 1094 ARG A HG3    1 
ATOM   1753  H  HD2    . ARG A 1 132 ? -44.616  57.150  11.120  1.00 78.18  ? 1094 ARG A HD2    1 
ATOM   1754  H  HD3    . ARG A 1 132 ? -44.446  58.624  11.696  1.00 78.18  ? 1094 ARG A HD3    1 
ATOM   1755  H  HE     . ARG A 1 132 ? -45.804  56.648  12.889  1.00 81.95  ? 1094 ARG A HE     1 
ATOM   1756  H  HH11   . ARG A 1 132 ? -45.551  59.947  12.874  1.00 81.15  ? 1094 ARG A HH11   1 
ATOM   1757  H  HH12   . ARG A 1 132 ? -46.147  60.164  14.222  1.00 81.15  ? 1094 ARG A HH12   1 
ATOM   1758  H  HH21   . ARG A 1 132 ? -46.707  56.994  14.943  1.00 79.78  ? 1094 ARG A HH21   1 
ATOM   1759  H  HH22   . ARG A 1 132 ? -46.846  58.379  15.472  1.00 79.78  ? 1094 ARG A HH22   1 
ATOM   1760  N  N      . ASN A 1 133 ? -42.855  59.099  7.473   1.00 58.39  ? 1095 ASN A N      1 
ATOM   1761  C  CA     . ASN A 1 133 ? -42.289  58.894  6.143   1.00 58.96  ? 1095 ASN A CA     1 
ATOM   1762  C  C      . ASN A 1 133 ? -41.817  60.212  5.525   1.00 56.50  ? 1095 ASN A C      1 
ATOM   1763  O  O      . ASN A 1 133 ? -42.245  60.610  4.441   1.00 52.37  ? 1095 ASN A O      1 
ATOM   1764  C  CB     . ASN A 1 133 ? -43.303  58.191  5.234   1.00 59.67  ? 1095 ASN A CB     1 
ATOM   1765  C  CG     . ASN A 1 133 ? -43.833  56.901  5.839   1.00 63.52  ? 1095 ASN A CG     1 
ATOM   1766  O  OD1    . ASN A 1 133 ? -43.084  56.129  6.435   1.00 66.11  ? 1095 ASN A OD1    1 
ATOM   1767  N  ND2    . ASN A 1 133 ? -45.131  56.665  5.691   1.00 64.62  ? 1095 ASN A ND2    1 
ATOM   1768  H  H      . ASN A 1 133 ? -42.452  58.658  8.092   1.00 70.06  ? 1095 ASN A H      1 
ATOM   1769  H  HA     . ASN A 1 133 ? -41.515  58.314  6.223   1.00 70.75  ? 1095 ASN A HA     1 
ATOM   1770  H  HB2    . ASN A 1 133 ? -44.056  58.783  5.082   1.00 71.61  ? 1095 ASN A HB2    1 
ATOM   1771  H  HB3    . ASN A 1 133 ? -42.876  57.974  4.391   1.00 71.61  ? 1095 ASN A HB3    1 
ATOM   1772  H  HD21   . ASN A 1 133 ? -45.477  55.948  6.016   1.00 77.54  ? 1095 ASN A HD21   1 
ATOM   1773  H  HD22   . ASN A 1 133 ? -45.626  57.228  5.270   1.00 77.54  ? 1095 ASN A HD22   1 
ATOM   1774  N  N      . ILE A 1 134 ? -40.918  60.891  6.239   1.00 55.75  ? 1096 ILE A N      1 
ATOM   1775  C  CA     . ILE A 1 134 ? -40.303  62.098  5.698   1.00 54.07  ? 1096 ILE A CA     1 
ATOM   1776  C  C      . ILE A 1 134 ? -39.415  61.710  4.525   1.00 53.70  ? 1096 ILE A C      1 
ATOM   1777  O  O      . ILE A 1 134 ? -38.529  60.855  4.653   1.00 54.90  ? 1096 ILE A O      1 
ATOM   1778  C  CB     . ILE A 1 134 ? -39.492  62.835  6.774   1.00 56.82  ? 1096 ILE A CB     1 
ATOM   1779  C  CG1    . ILE A 1 134 ? -40.287  62.993  8.078   1.00 57.81  ? 1096 ILE A CG1    1 
ATOM   1780  C  CG2    . ILE A 1 134 ? -39.056  64.197  6.251   1.00 55.15  ? 1096 ILE A CG2    1 
ATOM   1781  C  CD1    . ILE A 1 134 ? -41.648  63.621  7.916   1.00 55.30  ? 1096 ILE A CD1    1 
ATOM   1782  H  H      . ILE A 1 134 ? -40.652  60.676  7.028   1.00 66.90  ? 1096 ILE A H      1 
ATOM   1783  H  HA     . ILE A 1 134 ? -40.996  62.695  5.374   1.00 64.89  ? 1096 ILE A HA     1 
ATOM   1784  H  HB     . ILE A 1 134 ? -38.697  62.314  6.965   1.00 68.19  ? 1096 ILE A HB     1 
ATOM   1785  H  HG12   . ILE A 1 134 ? -40.414  62.115  8.471   1.00 69.37  ? 1096 ILE A HG12   1 
ATOM   1786  H  HG13   . ILE A 1 134 ? -39.777  63.551  8.686   1.00 69.37  ? 1096 ILE A HG13   1 
ATOM   1787  H  HG21   . ILE A 1 134 ? -38.545  64.650  6.940   1.00 66.18  ? 1096 ILE A HG21   1 
ATOM   1788  H  HG22   . ILE A 1 134 ? -38.507  64.070  5.461   1.00 66.18  ? 1096 ILE A HG22   1 
ATOM   1789  H  HG23   . ILE A 1 134 ? -39.844  64.716  6.027   1.00 66.18  ? 1096 ILE A HG23   1 
ATOM   1790  H  HD11   . ILE A 1 134 ? -42.073  63.680  8.786   1.00 66.36  ? 1096 ILE A HD11   1 
ATOM   1791  H  HD12   . ILE A 1 134 ? -41.542  64.508  7.538   1.00 66.36  ? 1096 ILE A HD12   1 
ATOM   1792  H  HD13   . ILE A 1 134 ? -42.181  63.069  7.323   1.00 66.36  ? 1096 ILE A HD13   1 
ATOM   1793  N  N      . LEU A 1 135 ? -39.638  62.343  3.378   1.00 54.62  ? 1097 LEU A N      1 
ATOM   1794  C  CA     . LEU A 1 135 ? -38.891  61.986  2.180   1.00 58.07  ? 1097 LEU A CA     1 
ATOM   1795  C  C      . LEU A 1 135 ? -38.506  63.232  1.390   1.00 55.88  ? 1097 LEU A C      1 
ATOM   1796  O  O      . LEU A 1 135 ? -39.370  63.849  0.753   1.00 54.74  ? 1097 LEU A O      1 
ATOM   1797  C  CB     . LEU A 1 135 ? -39.715  61.042  1.303   1.00 59.04  ? 1097 LEU A CB     1 
ATOM   1798  C  CG     . LEU A 1 135 ? -39.026  60.523  0.041   1.00 63.10  ? 1097 LEU A CG     1 
ATOM   1799  C  CD1    . LEU A 1 135 ? -37.772  59.726  0.391   1.00 66.91  ? 1097 LEU A CD1    1 
ATOM   1800  C  CD2    . LEU A 1 135 ? -39.989  59.683  -0.780  1.00 63.85  ? 1097 LEU A CD2    1 
ATOM   1801  H  H      . LEU A 1 135 ? -40.210  62.976  3.269   1.00 65.55  ? 1097 LEU A H      1 
ATOM   1802  H  HA     . LEU A 1 135 ? -38.076  61.527  2.438   1.00 69.68  ? 1097 LEU A HA     1 
ATOM   1803  H  HB2    . LEU A 1 135 ? -39.962  60.269  1.835   1.00 70.85  ? 1097 LEU A HB2    1 
ATOM   1804  H  HB3    . LEU A 1 135 ? -40.518  61.509  1.023   1.00 70.85  ? 1097 LEU A HB3    1 
ATOM   1805  H  HG     . LEU A 1 135 ? -38.755  61.280  -0.502  1.00 75.71  ? 1097 LEU A HG     1 
ATOM   1806  H  HD11   . LEU A 1 135 ? -37.359  59.412  -0.428  1.00 80.29  ? 1097 LEU A HD11   1 
ATOM   1807  H  HD12   . LEU A 1 135 ? -37.157  60.301  0.873   1.00 80.29  ? 1097 LEU A HD12   1 
ATOM   1808  H  HD13   . LEU A 1 135 ? -38.023  58.971  0.946   1.00 80.29  ? 1097 LEU A HD13   1 
ATOM   1809  H  HD21   . LEU A 1 135 ? -39.532  59.365  -1.574  1.00 76.62  ? 1097 LEU A HD21   1 
ATOM   1810  H  HD22   . LEU A 1 135 ? -40.286  58.931  -0.244  1.00 76.62  ? 1097 LEU A HD22   1 
ATOM   1811  H  HD23   . LEU A 1 135 ? -40.749  60.231  -1.031  1.00 76.62  ? 1097 LEU A HD23   1 
ATOM   1812  N  N      . PRO A 1 136 ? -37.235  63.636  1.397   1.00 51.45  ? 1098 PRO A N      1 
ATOM   1813  C  CA     . PRO A 1 136 ? -36.819  64.746  0.534   1.00 50.58  ? 1098 PRO A CA     1 
ATOM   1814  C  C      . PRO A 1 136 ? -36.543  64.267  -0.882  1.00 49.72  ? 1098 PRO A C      1 
ATOM   1815  O  O      . PRO A 1 136 ? -35.898  63.238  -1.098  1.00 52.86  ? 1098 PRO A O      1 
ATOM   1816  C  CB     . PRO A 1 136 ? -35.541  65.261  1.210   1.00 49.66  ? 1098 PRO A CB     1 
ATOM   1817  C  CG     . PRO A 1 136 ? -35.031  64.112  2.041   1.00 49.73  ? 1098 PRO A CG     1 
ATOM   1818  C  CD     . PRO A 1 136 ? -36.090  63.040  2.103   1.00 49.68  ? 1098 PRO A CD     1 
ATOM   1819  H  HA     . PRO A 1 136 ? -37.491  65.446  0.523   1.00 60.69  ? 1098 PRO A HA     1 
ATOM   1820  H  HB2    . PRO A 1 136 ? -34.892  65.509  0.534   1.00 59.60  ? 1098 PRO A HB2    1 
ATOM   1821  H  HB3    . PRO A 1 136 ? -35.755  66.022  1.774   1.00 59.60  ? 1098 PRO A HB3    1 
ATOM   1822  H  HG2    . PRO A 1 136 ? -34.227  63.759  1.629   1.00 59.68  ? 1098 PRO A HG2    1 
ATOM   1823  H  HG3    . PRO A 1 136 ? -34.832  64.433  2.934   1.00 59.68  ? 1098 PRO A HG3    1 
ATOM   1824  H  HD2    . PRO A 1 136 ? -35.788  62.241  1.642   1.00 59.62  ? 1098 PRO A HD2    1 
ATOM   1825  H  HD3    . PRO A 1 136 ? -36.324  62.850  3.025   1.00 59.62  ? 1098 PRO A HD3    1 
ATOM   1826  N  N      . ILE A 1 137 ? -37.048  65.022  -1.849  1.00 53.42  ? 1099 ILE A N      1 
ATOM   1827  C  CA     . ILE A 1 137 ? -36.867  64.721  -3.269  1.00 57.14  ? 1099 ILE A CA     1 
ATOM   1828  C  C      . ILE A 1 137 ? -36.166  65.935  -3.866  1.00 60.20  ? 1099 ILE A C      1 
ATOM   1829  O  O      . ILE A 1 137 ? -36.804  66.880  -4.339  1.00 57.62  ? 1099 ILE A O      1 
ATOM   1830  C  CB     . ILE A 1 137 ? -38.190  64.418  -3.978  1.00 60.63  ? 1099 ILE A CB     1 
ATOM   1831  C  CG1    . ILE A 1 137 ? -38.918  63.276  -3.254  1.00 60.11  ? 1099 ILE A CG1    1 
ATOM   1832  C  CG2    . ILE A 1 137 ? -37.946  64.070  -5.454  1.00 61.40  ? 1099 ILE A CG2    1 
ATOM   1833  C  CD1    . ILE A 1 137 ? -40.255  62.886  -3.859  1.00 60.57  ? 1099 ILE A CD1    1 
ATOM   1834  H  H      . ILE A 1 137 ? -37.511  65.732  -1.707  1.00 64.10  ? 1099 ILE A H      1 
ATOM   1835  H  HA     . ILE A 1 137 ? -36.284  63.951  -3.365  1.00 68.57  ? 1099 ILE A HA     1 
ATOM   1836  H  HB     . ILE A 1 137 ? -38.748  65.211  -3.938  1.00 72.76  ? 1099 ILE A HB     1 
ATOM   1837  H  HG12   . ILE A 1 137 ? -38.349  62.490  -3.268  1.00 72.13  ? 1099 ILE A HG12   1 
ATOM   1838  H  HG13   . ILE A 1 137 ? -39.079  63.545  -2.336  1.00 72.13  ? 1099 ILE A HG13   1 
ATOM   1839  H  HG21   . ILE A 1 137 ? -38.798  63.884  -5.879  1.00 73.68  ? 1099 ILE A HG21   1 
ATOM   1840  H  HG22   . ILE A 1 137 ? -37.517  64.824  -5.889  1.00 73.68  ? 1099 ILE A HG22   1 
ATOM   1841  H  HG23   . ILE A 1 137 ? -37.373  63.289  -5.503  1.00 73.68  ? 1099 ILE A HG23   1 
ATOM   1842  H  HD11   . ILE A 1 137 ? -40.637  62.162  -3.339  1.00 72.68  ? 1099 ILE A HD11   1 
ATOM   1843  H  HD12   . ILE A 1 137 ? -40.846  63.655  -3.841  1.00 72.68  ? 1099 ILE A HD12   1 
ATOM   1844  H  HD13   . ILE A 1 137 ? -40.114  62.597  -4.775  1.00 72.68  ? 1099 ILE A HD13   1 
ATOM   1845  N  N      . THR A 1 138 ? -34.835  65.915  -3.840  1.00 70.53  ? 1100 THR A N      1 
ATOM   1846  C  CA     . THR A 1 138 ? -34.022  67.052  -4.248  1.00 74.94  ? 1100 THR A CA     1 
ATOM   1847  C  C      . THR A 1 138 ? -33.682  67.057  -5.733  1.00 78.29  ? 1100 THR A C      1 
ATOM   1848  O  O      . THR A 1 138 ? -33.224  68.086  -6.240  1.00 77.96  ? 1100 THR A O      1 
ATOM   1849  C  CB     . THR A 1 138 ? -32.721  67.079  -3.437  1.00 76.06  ? 1100 THR A CB     1 
ATOM   1850  O  OG1    . THR A 1 138 ? -32.042  65.825  -3.578  1.00 78.51  ? 1100 THR A OG1    1 
ATOM   1851  C  CG2    . THR A 1 138 ? -33.008  67.341  -1.965  1.00 76.68  ? 1100 THR A CG2    1 
ATOM   1852  H  H      . THR A 1 138 ? -34.372  65.237  -3.584  1.00 84.64  ? 1100 THR A H      1 
ATOM   1853  H  HA     . THR A 1 138 ? -34.510  67.868  -4.053  1.00 89.92  ? 1100 THR A HA     1 
ATOM   1854  H  HB     . THR A 1 138 ? -32.151  67.792  -3.768  1.00 91.27  ? 1100 THR A HB     1 
ATOM   1855  H  HG1    . THR A 1 138 ? -31.327  65.833  -3.136  1.00 94.22  ? 1100 THR A HG1    1 
ATOM   1856  H  HG21   . THR A 1 138 ? -32.178  67.356  -1.463  1.00 92.01  ? 1100 THR A HG21   1 
ATOM   1857  H  HG22   . THR A 1 138 ? -33.454  68.196  -1.862  1.00 92.01  ? 1100 THR A HG22   1 
ATOM   1858  H  HG23   . THR A 1 138 ? -33.579  66.643  -1.610  1.00 92.01  ? 1100 THR A HG23   1 
ATOM   1859  N  N      . THR A 1 139 ? -33.891  65.947  -6.440  1.00 77.65  ? 1101 THR A N      1 
ATOM   1860  C  CA     . THR A 1 139 ? -33.524  65.856  -7.847  1.00 81.57  ? 1101 THR A CA     1 
ATOM   1861  C  C      . THR A 1 139 ? -34.640  66.288  -8.792  1.00 78.00  ? 1101 THR A C      1 
ATOM   1862  O  O      . THR A 1 139 ? -34.396  66.400  -9.997  1.00 85.73  ? 1101 THR A O      1 
ATOM   1863  C  CB     . THR A 1 139 ? -33.108  64.423  -8.194  1.00 85.45  ? 1101 THR A CB     1 
ATOM   1864  O  OG1    . THR A 1 139 ? -34.212  63.534  -7.979  1.00 84.57  ? 1101 THR A OG1    1 
ATOM   1865  C  CG2    . THR A 1 139 ? -31.925  63.988  -7.340  1.00 87.67  ? 1101 THR A CG2    1 
ATOM   1866  H  H      . THR A 1 139 ? -34.246  65.231  -6.124  1.00 93.18  ? 1101 THR A H      1 
ATOM   1867  H  HA     . THR A 1 139 ? -32.761  66.433  -8.008  1.00 97.88  ? 1101 THR A HA     1 
ATOM   1868  H  HB     . THR A 1 139 ? -32.841  64.383  -9.126  1.00 102.54 ? 1101 THR A HB     1 
ATOM   1869  H  HG1    . THR A 1 139 ? -33.988  62.746  -8.168  1.00 101.48 ? 1101 THR A HG1    1 
ATOM   1870  H  HG21   . THR A 1 139 ? -31.669  63.080  -7.566  1.00 105.21 ? 1101 THR A HG21   1 
ATOM   1871  H  HG22   . THR A 1 139 ? -31.170  64.577  -7.495  1.00 105.21 ? 1101 THR A HG22   1 
ATOM   1872  H  HG23   . THR A 1 139 ? -32.164  64.023  -6.400  1.00 105.21 ? 1101 THR A HG23   1 
ATOM   1873  N  N      . ALA A 1 140 ? -35.843  66.535  -8.284  1.00 68.07  ? 1102 ALA A N      1 
ATOM   1874  C  CA     . ALA A 1 140 ? -36.946  66.957  -9.132  1.00 62.39  ? 1102 ALA A CA     1 
ATOM   1875  C  C      . ALA A 1 140 ? -36.760  68.405  -9.580  1.00 59.54  ? 1102 ALA A C      1 
ATOM   1876  O  O      . ALA A 1 140 ? -36.039  69.188  -8.957  1.00 58.73  ? 1102 ALA A O      1 
ATOM   1877  C  CB     . ALA A 1 140 ? -38.275  66.808  -8.391  1.00 58.21  ? 1102 ALA A CB     1 
ATOM   1878  H  H      . ALA A 1 140 ? -36.045  66.465  -7.451  1.00 81.68  ? 1102 ALA A H      1 
ATOM   1879  H  HA     . ALA A 1 140 ? -36.975  66.396  -9.922  1.00 74.86  ? 1102 ALA A HA     1 
ATOM   1880  H  HB1    . ALA A 1 140 ? -38.996  67.095  -8.974  1.00 69.86  ? 1102 ALA A HB1    1 
ATOM   1881  H  HB2    . ALA A 1 140 ? -38.397  65.877  -8.146  1.00 69.86  ? 1102 ALA A HB2    1 
ATOM   1882  H  HB3    . ALA A 1 140 ? -38.255  67.360  -7.593  1.00 69.86  ? 1102 ALA A HB3    1 
ATOM   1883  N  N      . LYS A 1 141 ? -37.421  68.754  -10.689 1.00 59.76  ? 1103 LYS A N      1 
ATOM   1884  C  CA     . LYS A 1 141 ? -37.408  70.138  -11.155 1.00 59.70  ? 1103 LYS A CA     1 
ATOM   1885  C  C      . LYS A 1 141 ? -37.758  71.089  -10.019 1.00 56.43  ? 1103 LYS A C      1 
ATOM   1886  O  O      . LYS A 1 141 ? -37.094  72.111  -9.813  1.00 52.64  ? 1103 LYS A O      1 
ATOM   1887  C  CB     . LYS A 1 141 ? -38.394  70.311  -12.313 1.00 62.74  ? 1103 LYS A CB     1 
ATOM   1888  C  CG     . LYS A 1 141 ? -37.921  69.769  -13.650 1.00 71.35  ? 1103 LYS A CG     1 
ATOM   1889  C  CD     . LYS A 1 141 ? -39.064  69.751  -14.663 1.00 76.28  ? 1103 LYS A CD     1 
ATOM   1890  C  CE     . LYS A 1 141 ? -38.639  69.141  -15.993 1.00 80.58  ? 1103 LYS A CE     1 
ATOM   1891  N  NZ     . LYS A 1 141 ? -37.710  70.032  -16.747 1.00 83.67  1 1103 LYS A NZ     1 
ATOM   1892  H  H      . LYS A 1 141 ? -37.877  68.215  -11.180 1.00 71.71  ? 1103 LYS A H      1 
ATOM   1893  H  HA     . LYS A 1 141 ? -36.519  70.360  -11.476 1.00 71.64  ? 1103 LYS A HA     1 
ATOM   1894  H  HB2    . LYS A 1 141 ? -39.218  69.852  -12.086 1.00 75.29  ? 1103 LYS A HB2    1 
ATOM   1895  H  HB3    . LYS A 1 141 ? -38.571  71.258  -12.428 1.00 75.29  ? 1103 LYS A HB3    1 
ATOM   1896  H  HG2    . LYS A 1 141 ? -37.214  70.336  -13.996 1.00 85.62  ? 1103 LYS A HG2    1 
ATOM   1897  H  HG3    . LYS A 1 141 ? -37.600  68.861  -13.534 1.00 85.62  ? 1103 LYS A HG3    1 
ATOM   1898  H  HD2    . LYS A 1 141 ? -39.795  69.222  -14.308 1.00 91.53  ? 1103 LYS A HD2    1 
ATOM   1899  H  HD3    . LYS A 1 141 ? -39.358  70.660  -14.827 1.00 91.53  ? 1103 LYS A HD3    1 
ATOM   1900  H  HE2    . LYS A 1 141 ? -38.184  68.301  -15.827 1.00 96.69  ? 1103 LYS A HE2    1 
ATOM   1901  H  HE3    . LYS A 1 141 ? -39.426  68.992  -16.540 1.00 96.69  ? 1103 LYS A HE3    1 
ATOM   1902  H  HZ1    . LYS A 1 141 ? -37.480  69.649  -17.517 1.00 100.41 ? 1103 LYS A HZ1    1 
ATOM   1903  H  HZ2    . LYS A 1 141 ? -38.106  70.810  -16.917 1.00 100.41 ? 1103 LYS A HZ2    1 
ATOM   1904  H  HZ3    . LYS A 1 141 ? -36.975  70.180  -16.267 1.00 100.41 ? 1103 LYS A HZ3    1 
ATOM   1905  N  N      . VAL A 1 142 ? -38.802  70.757  -9.266  1.00 54.67  ? 1104 VAL A N      1 
ATOM   1906  C  CA     . VAL A 1 142 ? -39.170  71.486  -8.056  1.00 52.17  ? 1104 VAL A CA     1 
ATOM   1907  C  C      . VAL A 1 142 ? -38.815  70.615  -6.858  1.00 52.47  ? 1104 VAL A C      1 
ATOM   1908  O  O      . VAL A 1 142 ? -39.596  69.722  -6.501  1.00 50.95  ? 1104 VAL A O      1 
ATOM   1909  C  CB     . VAL A 1 142 ? -40.662  71.848  -8.051  1.00 50.94  ? 1104 VAL A CB     1 
ATOM   1910  C  CG1    . VAL A 1 142 ? -41.033  72.585  -6.762  1.00 47.76  ? 1104 VAL A CG1    1 
ATOM   1911  C  CG2    . VAL A 1 142 ? -41.003  72.687  -9.270  1.00 51.35  ? 1104 VAL A CG2    1 
ATOM   1912  H  H      . VAL A 1 142 ? -39.325  70.097  -9.440  1.00 65.60  ? 1104 VAL A H      1 
ATOM   1913  H  HA     . VAL A 1 142 ? -38.655  72.306  -8.003  1.00 62.60  ? 1104 VAL A HA     1 
ATOM   1914  H  HB     . VAL A 1 142 ? -41.186  71.033  -8.092  1.00 61.13  ? 1104 VAL A HB     1 
ATOM   1915  H  HG11   . VAL A 1 142 ? -41.978  72.802  -6.784  1.00 57.32  ? 1104 VAL A HG11   1 
ATOM   1916  H  HG12   . VAL A 1 142 ? -40.843  72.010  -6.005  1.00 57.32  ? 1104 VAL A HG12   1 
ATOM   1917  H  HG13   . VAL A 1 142 ? -40.507  73.398  -6.701  1.00 57.32  ? 1104 VAL A HG13   1 
ATOM   1918  H  HG21   . VAL A 1 142 ? -41.947  72.905  -9.249  1.00 61.62  ? 1104 VAL A HG21   1 
ATOM   1919  H  HG22   . VAL A 1 142 ? -40.474  73.500  -9.251  1.00 61.62  ? 1104 VAL A HG22   1 
ATOM   1920  H  HG23   . VAL A 1 142 ? -40.798  72.178  -10.070 1.00 61.62  ? 1104 VAL A HG23   1 
ATOM   1921  N  N      . PRO A 1 143 ? -37.661  70.810  -6.220  1.00 55.83  ? 1105 PRO A N      1 
ATOM   1922  C  CA     . PRO A 1 143 ? -37.329  69.977  -5.059  1.00 57.14  ? 1105 PRO A CA     1 
ATOM   1923  C  C      . PRO A 1 143 ? -38.342  70.170  -3.942  1.00 52.46  ? 1105 PRO A C      1 
ATOM   1924  O  O      . PRO A 1 143 ? -38.768  71.288  -3.647  1.00 51.83  ? 1105 PRO A O      1 
ATOM   1925  C  CB     . PRO A 1 143 ? -35.933  70.464  -4.653  1.00 60.98  ? 1105 PRO A CB     1 
ATOM   1926  C  CG     . PRO A 1 143 ? -35.789  71.806  -5.273  1.00 59.61  ? 1105 PRO A CG     1 
ATOM   1927  C  CD     . PRO A 1 143 ? -36.594  71.776  -6.528  1.00 57.12  ? 1105 PRO A CD     1 
ATOM   1928  H  HA     . PRO A 1 143 ? -37.290  69.041  -5.308  1.00 68.57  ? 1105 PRO A HA     1 
ATOM   1929  H  HB2    . PRO A 1 143 ? -35.877  70.526  -3.686  1.00 73.18  ? 1105 PRO A HB2    1 
ATOM   1930  H  HB3    . PRO A 1 143 ? -35.262  69.854  -4.997  1.00 73.18  ? 1105 PRO A HB3    1 
ATOM   1931  H  HG2    . PRO A 1 143 ? -36.131  72.481  -4.666  1.00 71.53  ? 1105 PRO A HG2    1 
ATOM   1932  H  HG3    . PRO A 1 143 ? -34.854  71.971  -5.473  1.00 71.53  ? 1105 PRO A HG3    1 
ATOM   1933  H  HD2    . PRO A 1 143 ? -36.971  72.651  -6.709  1.00 68.55  ? 1105 PRO A HD2    1 
ATOM   1934  H  HD3    . PRO A 1 143 ? -36.054  71.460  -7.269  1.00 68.55  ? 1105 PRO A HD3    1 
ATOM   1935  N  N      . ILE A 1 144 ? -38.729  69.058  -3.317  1.00 50.33  ? 1106 ILE A N      1 
ATOM   1936  C  CA     . ILE A 1 144 ? -39.708  69.072  -2.240  1.00 48.73  ? 1106 ILE A CA     1 
ATOM   1937  C  C      . ILE A 1 144 ? -39.245  68.156  -1.117  1.00 48.91  ? 1106 ILE A C      1 
ATOM   1938  O  O      . ILE A 1 144 ? -38.361  67.314  -1.286  1.00 47.76  ? 1106 ILE A O      1 
ATOM   1939  C  CB     . ILE A 1 144 ? -41.111  68.626  -2.712  1.00 46.15  ? 1106 ILE A CB     1 
ATOM   1940  C  CG1    . ILE A 1 144 ? -41.015  67.285  -3.448  1.00 48.71  ? 1106 ILE A CG1    1 
ATOM   1941  C  CG2    . ILE A 1 144 ? -41.744  69.694  -3.582  1.00 44.93  ? 1106 ILE A CG2    1 
ATOM   1942  C  CD1    . ILE A 1 144 ? -42.352  66.642  -3.733  1.00 46.47  ? 1106 ILE A CD1    1 
ATOM   1943  H  H      . ILE A 1 144 ? -38.432  68.273  -3.504  1.00 60.40  ? 1106 ILE A H      1 
ATOM   1944  H  HA     . ILE A 1 144 ? -39.780  69.972  -1.886  1.00 58.48  ? 1106 ILE A HA     1 
ATOM   1945  H  HB     . ILE A 1 144 ? -41.670  68.503  -1.928  1.00 55.38  ? 1106 ILE A HB     1 
ATOM   1946  H  HG12   . ILE A 1 144 ? -40.568  67.427  -4.297  1.00 58.46  ? 1106 ILE A HG12   1 
ATOM   1947  H  HG13   . ILE A 1 144 ? -40.500  66.668  -2.905  1.00 58.46  ? 1106 ILE A HG13   1 
ATOM   1948  H  HG21   . ILE A 1 144 ? -42.621  69.392  -3.865  1.00 53.91  ? 1106 ILE A HG21   1 
ATOM   1949  H  HG22   . ILE A 1 144 ? -41.826  70.513  -3.068  1.00 53.91  ? 1106 ILE A HG22   1 
ATOM   1950  H  HG23   . ILE A 1 144 ? -41.180  69.845  -4.357  1.00 53.91  ? 1106 ILE A HG23   1 
ATOM   1951  H  HD11   . ILE A 1 144 ? -42.206  65.803  -4.197  1.00 55.76  ? 1106 ILE A HD11   1 
ATOM   1952  H  HD12   . ILE A 1 144 ? -42.810  66.480  -2.893  1.00 55.76  ? 1106 ILE A HD12   1 
ATOM   1953  H  HD13   . ILE A 1 144 ? -42.878  67.240  -4.287  1.00 55.76  ? 1106 ILE A HD13   1 
ATOM   1954  N  N      . VAL A 1 145 ? -39.859  68.338  0.045   1.00 46.97  ? 1107 VAL A N      1 
ATOM   1955  C  CA     . VAL A 1 145 ? -39.868  67.328  1.091   1.00 49.99  ? 1107 VAL A CA     1 
ATOM   1956  C  C      . VAL A 1 145 ? -41.328  66.983  1.336   1.00 48.00  ? 1107 VAL A C      1 
ATOM   1957  O  O      . VAL A 1 145 ? -42.132  67.862  1.669   1.00 47.95  ? 1107 VAL A O      1 
ATOM   1958  C  CB     . VAL A 1 145 ? -39.162  67.806  2.375   1.00 50.63  ? 1107 VAL A CB     1 
ATOM   1959  C  CG1    . VAL A 1 145 ? -39.631  69.195  2.779   1.00 50.65  ? 1107 VAL A CG1    1 
ATOM   1960  C  CG2    . VAL A 1 145 ? -39.362  66.805  3.514   1.00 49.27  ? 1107 VAL A CG2    1 
ATOM   1961  H  H      . VAL A 1 145 ? -40.287  69.054  0.254   1.00 56.36  ? 1107 VAL A H      1 
ATOM   1962  H  HA     . VAL A 1 145 ? -39.415  66.532  0.773   1.00 59.98  ? 1107 VAL A HA     1 
ATOM   1963  H  HB     . VAL A 1 145 ? -38.210  67.860  2.199   1.00 60.76  ? 1107 VAL A HB     1 
ATOM   1964  H  HG11   . VAL A 1 145 ? -39.167  69.461  3.588   1.00 60.78  ? 1107 VAL A HG11   1 
ATOM   1965  H  HG12   . VAL A 1 145 ? -39.430  69.817  2.062   1.00 60.78  ? 1107 VAL A HG12   1 
ATOM   1966  H  HG13   . VAL A 1 145 ? -40.588  69.171  2.938   1.00 60.78  ? 1107 VAL A HG13   1 
ATOM   1967  H  HG21   . VAL A 1 145 ? -38.907  67.134  4.305   1.00 59.13  ? 1107 VAL A HG21   1 
ATOM   1968  H  HG22   . VAL A 1 145 ? -40.311  66.714  3.691   1.00 59.13  ? 1107 VAL A HG22   1 
ATOM   1969  H  HG23   . VAL A 1 145 ? -38.990  65.949  3.250   1.00 59.13  ? 1107 VAL A HG23   1 
ATOM   1970  N  N      . LYS A 1 146 ? -41.684  65.723  1.115   1.00 53.83  ? 1108 LYS A N      1 
ATOM   1971  C  CA     . LYS A 1 146 ? -43.050  65.266  1.311   1.00 56.49  ? 1108 LYS A CA     1 
ATOM   1972  C  C      . LYS A 1 146 ? -43.122  64.332  2.510   1.00 55.09  ? 1108 LYS A C      1 
ATOM   1973  O  O      . LYS A 1 146 ? -42.123  63.742  2.929   1.00 58.23  ? 1108 LYS A O      1 
ATOM   1974  C  CB     . LYS A 1 146 ? -43.593  64.551  0.068   1.00 59.17  ? 1108 LYS A CB     1 
ATOM   1975  C  CG     . LYS A 1 146 ? -42.741  63.393  -0.423  1.00 64.55  ? 1108 LYS A CG     1 
ATOM   1976  C  CD     . LYS A 1 146 ? -43.544  62.437  -1.310  1.00 65.90  ? 1108 LYS A CD     1 
ATOM   1977  C  CE     . LYS A 1 146 ? -44.154  63.124  -2.523  1.00 66.97  ? 1108 LYS A CE     1 
ATOM   1978  N  NZ     . LYS A 1 146 ? -45.072  62.213  -3.262  1.00 69.50  1 1108 LYS A NZ     1 
ATOM   1979  H  H      . LYS A 1 146 ? -41.145  65.108  0.849   1.00 64.60  ? 1108 LYS A H      1 
ATOM   1980  H  HA     . LYS A 1 146 ? -43.618  66.032  1.490   1.00 67.79  ? 1108 LYS A HA     1 
ATOM   1981  H  HB2    . LYS A 1 146 ? -44.474  64.201  0.273   1.00 71.00  ? 1108 LYS A HB2    1 
ATOM   1982  H  HB3    . LYS A 1 146 ? -43.658  65.194  -0.655  1.00 71.00  ? 1108 LYS A HB3    1 
ATOM   1983  H  HG2    . LYS A 1 146 ? -42.000  63.740  -0.943  1.00 77.46  ? 1108 LYS A HG2    1 
ATOM   1984  H  HG3    . LYS A 1 146 ? -42.411  62.894  0.340   1.00 77.46  ? 1108 LYS A HG3    1 
ATOM   1985  H  HD2    . LYS A 1 146 ? -42.956  61.734  -1.628  1.00 79.08  ? 1108 LYS A HD2    1 
ATOM   1986  H  HD3    . LYS A 1 146 ? -44.266  62.054  -0.788  1.00 79.08  ? 1108 LYS A HD3    1 
ATOM   1987  H  HE2    . LYS A 1 146 ? -44.663  63.897  -2.232  1.00 80.36  ? 1108 LYS A HE2    1 
ATOM   1988  H  HE3    . LYS A 1 146 ? -43.446  63.396  -3.127  1.00 80.36  ? 1108 LYS A HE3    1 
ATOM   1989  H  HZ1    . LYS A 1 146 ? -45.417  62.635  -3.966  1.00 83.39  ? 1108 LYS A HZ1    1 
ATOM   1990  H  HZ2    . LYS A 1 146 ? -44.627  61.496  -3.544  1.00 83.39  ? 1108 LYS A HZ2    1 
ATOM   1991  H  HZ3    . LYS A 1 146 ? -45.735  61.952  -2.729  1.00 83.39  ? 1108 LYS A HZ3    1 
ATOM   1992  N  N      . PHE A 1 147 ? -44.323  64.210  3.066   1.00 45.58  ? 1109 PHE A N      1 
ATOM   1993  C  CA     . PHE A 1 147 ? -44.523  63.374  4.240   1.00 46.22  ? 1109 PHE A CA     1 
ATOM   1994  C  C      . PHE A 1 147 ? -46.013  63.125  4.430   1.00 46.88  ? 1109 PHE A C      1 
ATOM   1995  O  O      . PHE A 1 147 ? -46.858  63.724  3.762   1.00 42.86  ? 1109 PHE A O      1 
ATOM   1996  C  CB     . PHE A 1 147 ? -43.904  64.011  5.488   1.00 46.55  ? 1109 PHE A CB     1 
ATOM   1997  C  CG     . PHE A 1 147 ? -44.346  65.426  5.741   1.00 47.00  ? 1109 PHE A CG     1 
ATOM   1998  C  CD1    . PHE A 1 147 ? -45.476  65.693  6.495   1.00 46.40  ? 1109 PHE A CD1    1 
ATOM   1999  C  CD2    . PHE A 1 147 ? -43.614  66.493  5.243   1.00 48.83  ? 1109 PHE A CD2    1 
ATOM   2000  C  CE1    . PHE A 1 147 ? -45.873  66.997  6.738   1.00 47.22  ? 1109 PHE A CE1    1 
ATOM   2001  C  CE2    . PHE A 1 147 ? -44.008  67.798  5.483   1.00 47.07  ? 1109 PHE A CE2    1 
ATOM   2002  C  CZ     . PHE A 1 147 ? -45.139  68.049  6.231   1.00 45.26  ? 1109 PHE A CZ     1 
ATOM   2003  H  H      . PHE A 1 147 ? -45.035  64.600  2.783   1.00 54.70  ? 1109 PHE A H      1 
ATOM   2004  H  HA     . PHE A 1 147 ? -44.091  62.517  4.095   1.00 55.46  ? 1109 PHE A HA     1 
ATOM   2005  H  HB2    . PHE A 1 147 ? -44.150  63.482  6.263   1.00 55.86  ? 1109 PHE A HB2    1 
ATOM   2006  H  HB3    . PHE A 1 147 ? -42.939  64.016  5.389   1.00 55.86  ? 1109 PHE A HB3    1 
ATOM   2007  H  HD1    . PHE A 1 147 ? -45.975  64.988  6.840   1.00 55.68  ? 1109 PHE A HD1    1 
ATOM   2008  H  HD2    . PHE A 1 147 ? -42.850  66.330  4.738   1.00 58.59  ? 1109 PHE A HD2    1 
ATOM   2009  H  HE1    . PHE A 1 147 ? -46.636  67.164  7.242   1.00 56.66  ? 1109 PHE A HE1    1 
ATOM   2010  H  HE2    . PHE A 1 147 ? -43.511  68.504  5.140   1.00 56.49  ? 1109 PHE A HE2    1 
ATOM   2011  H  HZ     . PHE A 1 147 ? -45.406  68.925  6.392   1.00 54.31  ? 1109 PHE A HZ     1 
ATOM   2012  N  N      . PHE A 1 148 ? -46.315  62.232  5.366   1.00 53.32  ? 1110 PHE A N      1 
ATOM   2013  C  CA     . PHE A 1 148 ? -47.672  61.792  5.651   1.00 57.76  ? 1110 PHE A CA     1 
ATOM   2014  C  C      . PHE A 1 148 ? -48.106  62.359  6.997   1.00 55.35  ? 1110 PHE A C      1 
ATOM   2015  O  O      . PHE A 1 148 ? -47.403  62.194  7.999   1.00 59.83  ? 1110 PHE A O      1 
ATOM   2016  C  CB     . PHE A 1 148 ? -47.729  60.263  5.652   1.00 61.49  ? 1110 PHE A CB     1 
ATOM   2017  C  CG     . PHE A 1 148 ? -49.096  59.697  5.885   1.00 65.22  ? 1110 PHE A CG     1 
ATOM   2018  C  CD1    . PHE A 1 148 ? -50.090  59.829  4.929   1.00 64.80  ? 1110 PHE A CD1    1 
ATOM   2019  C  CD2    . PHE A 1 148 ? -49.381  59.007  7.053   1.00 65.45  ? 1110 PHE A CD2    1 
ATOM   2020  C  CE1    . PHE A 1 148 ? -51.349  59.294  5.141   1.00 66.32  ? 1110 PHE A CE1    1 
ATOM   2021  C  CE2    . PHE A 1 148 ? -50.635  58.471  7.271   1.00 65.65  ? 1110 PHE A CE2    1 
ATOM   2022  C  CZ     . PHE A 1 148 ? -51.620  58.614  6.315   1.00 67.37  ? 1110 PHE A CZ     1 
ATOM   2023  H  H      . PHE A 1 148 ? -45.727  61.855  5.867   1.00 63.98  ? 1110 PHE A H      1 
ATOM   2024  H  HA     . PHE A 1 148 ? -48.273  62.124  4.966   1.00 69.31  ? 1110 PHE A HA     1 
ATOM   2025  H  HB2    . PHE A 1 148 ? -47.419  59.939  4.792   1.00 73.79  ? 1110 PHE A HB2    1 
ATOM   2026  H  HB3    . PHE A 1 148 ? -47.149  59.931  6.355   1.00 73.79  ? 1110 PHE A HB3    1 
ATOM   2027  H  HD1    . PHE A 1 148 ? -49.911  60.286  4.139   1.00 77.76  ? 1110 PHE A HD1    1 
ATOM   2028  H  HD2    . PHE A 1 148 ? -48.720  58.908  7.700   1.00 78.54  ? 1110 PHE A HD2    1 
ATOM   2029  H  HE1    . PHE A 1 148 ? -52.012  59.393  4.496   1.00 79.59  ? 1110 PHE A HE1    1 
ATOM   2030  H  HE2    . PHE A 1 148 ? -50.815  58.015  8.061   1.00 78.78  ? 1110 PHE A HE2    1 
ATOM   2031  H  HZ     . PHE A 1 148 ? -52.466  58.256  6.461   1.00 80.85  ? 1110 PHE A HZ     1 
ATOM   2032  N  N      . HIS A 1 149 ? -49.254  63.031  7.014   1.00 50.75  ? 1111 HIS A N      1 
ATOM   2033  C  CA     . HIS A 1 149 ? -49.806  63.616  8.230   1.00 51.57  ? 1111 HIS A CA     1 
ATOM   2034  C  C      . HIS A 1 149 ? -50.785  62.622  8.849   1.00 52.01  ? 1111 HIS A C      1 
ATOM   2035  O  O      . HIS A 1 149 ? -51.820  62.309  8.249   1.00 50.49  ? 1111 HIS A O      1 
ATOM   2036  C  CB     . HIS A 1 149 ? -50.491  64.944  7.904   1.00 48.59  ? 1111 HIS A CB     1 
ATOM   2037  C  CG     . HIS A 1 149 ? -50.937  65.719  9.105   1.00 48.48  ? 1111 HIS A CG     1 
ATOM   2038  N  ND1    . HIS A 1 149 ? -52.240  65.712  9.556   1.00 49.36  ? 1111 HIS A ND1    1 
ATOM   2039  C  CD2    . HIS A 1 149 ? -50.259  66.550  9.931   1.00 47.31  ? 1111 HIS A CD2    1 
ATOM   2040  C  CE1    . HIS A 1 149 ? -52.341  66.493  10.616  1.00 49.75  ? 1111 HIS A CE1    1 
ATOM   2041  N  NE2    . HIS A 1 149 ? -51.153  67.014  10.864  1.00 49.67  ? 1111 HIS A NE2    1 
ATOM   2042  H  H      . HIS A 1 149 ? -49.741  63.163  6.318   1.00 60.90  ? 1111 HIS A H      1 
ATOM   2043  H  HA     . HIS A 1 149 ? -49.092  63.783  8.865   1.00 61.89  ? 1111 HIS A HA     1 
ATOM   2044  H  HB2    . HIS A 1 149 ? -49.870  65.500  7.409   1.00 58.31  ? 1111 HIS A HB2    1 
ATOM   2045  H  HB3    . HIS A 1 149 ? -51.274  64.764  7.361   1.00 58.31  ? 1111 HIS A HB3    1 
ATOM   2046  H  HD2    . HIS A 1 149 ? -49.355  66.761  9.880   1.00 56.78  ? 1111 HIS A HD2    1 
ATOM   2047  H  HE1    . HIS A 1 149 ? -53.117  66.650  11.104  1.00 59.71  ? 1111 HIS A HE1    1 
ATOM   2048  H  HE2    . HIS A 1 149 ? -50.969  67.555  11.507  1.00 59.61  ? 1111 HIS A HE2    1 
ATOM   2049  N  N      . LEU A 1 150 ? -50.461  62.130  10.048  1.00 51.06  ? 1112 LEU A N      1 
ATOM   2050  C  CA     . LEU A 1 150 ? -51.192  60.998  10.616  1.00 54.16  ? 1112 LEU A CA     1 
ATOM   2051  C  C      . LEU A 1 150 ? -52.660  61.324  10.852  1.00 56.10  ? 1112 LEU A C      1 
ATOM   2052  O  O      . LEU A 1 150 ? -53.550  60.597  10.398  1.00 57.90  ? 1112 LEU A O      1 
ATOM   2053  C  CB     . LEU A 1 150 ? -50.552  60.555  11.932  1.00 56.99  ? 1112 LEU A CB     1 
ATOM   2054  C  CG     . LEU A 1 150 ? -49.769  59.243  11.955  1.00 60.21  ? 1112 LEU A CG     1 
ATOM   2055  C  CD1    . LEU A 1 150 ? -49.263  58.990  13.366  1.00 60.21  ? 1112 LEU A CD1    1 
ATOM   2056  C  CD2    . LEU A 1 150 ? -50.618  58.065  11.474  1.00 59.79  ? 1112 LEU A CD2    1 
ATOM   2057  H  H      . LEU A 1 150 ? -49.828  62.432  10.547  1.00 61.27  ? 1112 LEU A H      1 
ATOM   2058  H  HA     . LEU A 1 150 ? -51.148  60.253  9.996   1.00 65.00  ? 1112 LEU A HA     1 
ATOM   2059  H  HB2    . LEU A 1 150 ? -49.938  61.252  12.213  1.00 68.38  ? 1112 LEU A HB2    1 
ATOM   2060  H  HB3    . LEU A 1 150 ? -51.258  60.472  12.592  1.00 68.38  ? 1112 LEU A HB3    1 
ATOM   2061  H  HG     . LEU A 1 150 ? -49.001  59.320  11.368  1.00 72.25  ? 1112 LEU A HG     1 
ATOM   2062  H  HD11   . LEU A 1 150 ? -48.767  58.156  13.379  1.00 72.25  ? 1112 LEU A HD11   1 
ATOM   2063  H  HD12   . LEU A 1 150 ? -48.686  59.723  13.630  1.00 72.25  ? 1112 LEU A HD12   1 
ATOM   2064  H  HD13   . LEU A 1 150 ? -50.022  58.932  13.968  1.00 72.25  ? 1112 LEU A HD13   1 
ATOM   2065  H  HD21   . LEU A 1 150 ? -50.083  57.257  11.505  1.00 71.75  ? 1112 LEU A HD21   1 
ATOM   2066  H  HD22   . LEU A 1 150 ? -51.390  57.975  12.056  1.00 71.75  ? 1112 LEU A HD22   1 
ATOM   2067  H  HD23   . LEU A 1 150 ? -50.908  58.236  10.564  1.00 71.75  ? 1112 LEU A HD23   1 
ATOM   2068  N  N      . ARG A 1 151 ? -52.934  62.395  11.596  1.00 59.84  ? 1113 ARG A N      1 
ATOM   2069  C  CA     . ARG A 1 151 ? -54.296  62.624  12.065  1.00 62.96  ? 1113 ARG A CA     1 
ATOM   2070  C  C      . ARG A 1 151 ? -55.245  62.955  10.919  1.00 57.52  ? 1113 ARG A C      1 
ATOM   2071  O  O      . ARG A 1 151 ? -56.421  62.576  10.968  1.00 61.73  ? 1113 ARG A O      1 
ATOM   2072  C  CB     . ARG A 1 151 ? -54.296  63.721  13.130  1.00 66.61  ? 1113 ARG A CB     1 
ATOM   2073  C  CG     . ARG A 1 151 ? -53.631  63.261  14.429  1.00 72.89  ? 1113 ARG A CG     1 
ATOM   2074  C  CD     . ARG A 1 151 ? -53.769  64.265  15.558  1.00 76.99  ? 1113 ARG A CD     1 
ATOM   2075  N  NE     . ARG A 1 151 ? -53.140  63.782  16.787  1.00 80.37  ? 1113 ARG A NE     1 
ATOM   2076  C  CZ     . ARG A 1 151 ? -53.753  63.070  17.732  1.00 84.24  ? 1113 ARG A CZ     1 
ATOM   2077  N  NH1    . ARG A 1 151 ? -55.033  62.743  17.614  1.00 83.91  1 1113 ARG A NH1    1 
ATOM   2078  N  NH2    . ARG A 1 151 ? -53.079  62.682  18.807  1.00 84.75  ? 1113 ARG A NH2    1 
ATOM   2079  H  H      . ARG A 1 151 ? -52.363  62.991  11.837  1.00 71.81  ? 1113 ARG A H      1 
ATOM   2080  H  HA     . ARG A 1 151 ? -54.617  61.811  12.484  1.00 75.55  ? 1113 ARG A HA     1 
ATOM   2081  H  HB2    . ARG A 1 151 ? -53.808  64.489  12.796  1.00 79.93  ? 1113 ARG A HB2    1 
ATOM   2082  H  HB3    . ARG A 1 151 ? -55.212  63.969  13.330  1.00 79.93  ? 1113 ARG A HB3    1 
ATOM   2083  H  HG2    . ARG A 1 151 ? -54.043  62.431  14.716  1.00 87.47  ? 1113 ARG A HG2    1 
ATOM   2084  H  HG3    . ARG A 1 151 ? -52.685  63.123  14.266  1.00 87.47  ? 1113 ARG A HG3    1 
ATOM   2085  H  HD2    . ARG A 1 151 ? -53.338  65.096  15.302  1.00 92.39  ? 1113 ARG A HD2    1 
ATOM   2086  H  HD3    . ARG A 1 151 ? -54.710  64.417  15.738  1.00 92.39  ? 1113 ARG A HD3    1 
ATOM   2087  H  HE     . ARG A 1 151 ? -52.310  63.973  16.910  1.00 96.44  ? 1113 ARG A HE     1 
ATOM   2088  H  HH11   . ARG A 1 151 ? -55.478  62.989  16.920  1.00 100.69 ? 1113 ARG A HH11   1 
ATOM   2089  H  HH12   . ARG A 1 151 ? -55.418  62.284  18.231  1.00 100.69 ? 1113 ARG A HH12   1 
ATOM   2090  H  HH21   . ARG A 1 151 ? -52.249  62.890  18.893  1.00 101.69 ? 1113 ARG A HH21   1 
ATOM   2091  H  HH22   . ARG A 1 151 ? -53.472  62.224  19.419  1.00 101.69 ? 1113 ARG A HH22   1 
ATOM   2092  N  N      . SER A 1 152 ? -54.766  63.632  9.877   1.00 50.51  ? 1114 SER A N      1 
ATOM   2093  C  CA     . SER A 1 152 ? -55.623  63.947  8.741   1.00 47.10  ? 1114 SER A CA     1 
ATOM   2094  C  C      . SER A 1 152 ? -55.521  62.919  7.626   1.00 43.87  ? 1114 SER A C      1 
ATOM   2095  O  O      . SER A 1 152 ? -56.417  62.859  6.779   1.00 46.65  ? 1114 SER A O      1 
ATOM   2096  C  CB     . SER A 1 152 ? -55.288  65.331  8.172   1.00 40.55  ? 1114 SER A CB     1 
ATOM   2097  O  OG     . SER A 1 152 ? -54.119  65.296  7.377   1.00 39.55  ? 1114 SER A OG     1 
ATOM   2098  H  H      . SER A 1 152 ? -53.958  63.917  9.806   1.00 60.61  ? 1114 SER A H      1 
ATOM   2099  H  HA     . SER A 1 152 ? -56.545  63.965  9.043   1.00 56.51  ? 1114 SER A HA     1 
ATOM   2100  H  HB2    . SER A 1 152 ? -56.030  65.633  7.625   1.00 48.66  ? 1114 SER A HB2    1 
ATOM   2101  H  HB3    . SER A 1 152 ? -55.149  65.947  8.908   1.00 48.66  ? 1114 SER A HB3    1 
ATOM   2102  H  HG     . SER A 1 152 ? -53.466  65.037  7.838   1.00 47.46  ? 1114 SER A HG     1 
ATOM   2103  N  N      . GLY A 1 153 ? -54.469  62.103  7.618   1.00 44.81  ? 1115 GLY A N      1 
ATOM   2104  C  CA     . GLY A 1 153 ? -54.256  61.155  6.543   1.00 51.95  ? 1115 GLY A CA     1 
ATOM   2105  C  C      . GLY A 1 153 ? -53.876  61.772  5.216   1.00 51.43  ? 1115 GLY A C      1 
ATOM   2106  O  O      . GLY A 1 153 ? -53.954  61.097  4.188   1.00 56.06  ? 1115 GLY A O      1 
ATOM   2107  H  H      . GLY A 1 153 ? -53.864  62.083  8.229   1.00 53.77  ? 1115 GLY A H      1 
ATOM   2108  H  HA2    . GLY A 1 153 ? -53.551  60.540  6.800   1.00 62.34  ? 1115 GLY A HA2    1 
ATOM   2109  H  HA3    . GLY A 1 153 ? -55.069  60.641  6.411   1.00 62.34  ? 1115 GLY A HA3    1 
ATOM   2110  N  N      . LEU A 1 154 ? -53.450  63.031  5.209   1.00 48.32  ? 1116 LEU A N      1 
ATOM   2111  C  CA     . LEU A 1 154 ? -53.121  63.741  3.984   1.00 51.36  ? 1116 LEU A CA     1 
ATOM   2112  C  C      . LEU A 1 154 ? -51.622  63.712  3.722   1.00 51.83  ? 1116 LEU A C      1 
ATOM   2113  O  O      . LEU A 1 154 ? -50.807  63.687  4.648   1.00 50.12  ? 1116 LEU A O      1 
ATOM   2114  C  CB     . LEU A 1 154 ? -53.591  65.195  4.057   1.00 49.72  ? 1116 LEU A CB     1 
ATOM   2115  C  CG     . LEU A 1 154 ? -55.096  65.441  4.148   1.00 50.61  ? 1116 LEU A CG     1 
ATOM   2116  C  CD1    . LEU A 1 154 ? -55.361  66.933  4.283   1.00 48.85  ? 1116 LEU A CD1    1 
ATOM   2117  C  CD2    . LEU A 1 154 ? -55.823  64.870  2.934   1.00 52.67  ? 1116 LEU A CD2    1 
ATOM   2118  H  H      . LEU A 1 154 ? -53.342  63.503  5.920   1.00 57.98  ? 1116 LEU A H      1 
ATOM   2119  H  HA     . LEU A 1 154 ? -53.569  63.314  3.237   1.00 61.63  ? 1116 LEU A HA     1 
ATOM   2120  H  HB2    . LEU A 1 154 ? -53.188  65.602  4.840   1.00 59.66  ? 1116 LEU A HB2    1 
ATOM   2121  H  HB3    . LEU A 1 154 ? -53.275  65.653  3.262   1.00 59.66  ? 1116 LEU A HB3    1 
ATOM   2122  H  HG     . LEU A 1 154 ? -55.442  65.001  4.941   1.00 60.73  ? 1116 LEU A HG     1 
ATOM   2123  H  HD11   . LEU A 1 154 ? -56.318  67.080  4.340   1.00 58.62  ? 1116 LEU A HD11   1 
ATOM   2124  H  HD12   . LEU A 1 154 ? -54.927  67.259  5.087   1.00 58.62  ? 1116 LEU A HD12   1 
ATOM   2125  H  HD13   . LEU A 1 154 ? -55.002  67.389  3.505   1.00 58.62  ? 1116 LEU A HD13   1 
ATOM   2126  H  HD21   . LEU A 1 154 ? -56.773  65.044  3.025   1.00 63.20  ? 1116 LEU A HD21   1 
ATOM   2127  H  HD22   . LEU A 1 154 ? -55.483  65.299  2.133   1.00 63.20  ? 1116 LEU A HD22   1 
ATOM   2128  H  HD23   . LEU A 1 154 ? -55.663  63.914  2.892   1.00 63.20  ? 1116 LEU A HD23   1 
ATOM   2129  N  N      . GLU A 1 155 ? -51.268  63.710  2.441   1.00 51.57  ? 1117 GLU A N      1 
ATOM   2130  C  CA     . GLU A 1 155 ? -49.886  63.885  2.022   1.00 52.10  ? 1117 GLU A CA     1 
ATOM   2131  C  C      . GLU A 1 155 ? -49.579  65.373  1.920   1.00 45.80  ? 1117 GLU A C      1 
ATOM   2132  O  O      . GLU A 1 155 ? -50.390  66.154  1.416   1.00 48.11  ? 1117 GLU A O      1 
ATOM   2133  C  CB     . GLU A 1 155 ? -49.632  63.196  0.679   1.00 56.49  ? 1117 GLU A CB     1 
ATOM   2134  C  CG     . GLU A 1 155 ? -48.165  63.155  0.254   1.00 61.82  ? 1117 GLU A CG     1 
ATOM   2135  C  CD     . GLU A 1 155 ? -47.327  62.193  1.094   1.00 67.32  ? 1117 GLU A CD     1 
ATOM   2136  O  OE1    . GLU A 1 155 ? -47.910  61.358  1.818   1.00 66.80  ? 1117 GLU A OE1    1 
ATOM   2137  O  OE2    . GLU A 1 155 ? -46.081  62.271  1.027   1.00 69.05  1 1117 GLU A OE2    1 
ATOM   2138  H  H      . GLU A 1 155 ? -51.819  63.607  1.788   1.00 61.88  ? 1117 GLU A H      1 
ATOM   2139  H  HA     . GLU A 1 155 ? -49.295  63.493  2.685   1.00 62.51  ? 1117 GLU A HA     1 
ATOM   2140  H  HB2    . GLU A 1 155 ? -49.947  62.281  0.735   1.00 67.79  ? 1117 GLU A HB2    1 
ATOM   2141  H  HB3    . GLU A 1 155 ? -50.124  63.670  -0.010  1.00 67.79  ? 1117 GLU A HB3    1 
ATOM   2142  H  HG2    . GLU A 1 155 ? -48.113  62.869  -0.671  1.00 74.18  ? 1117 GLU A HG2    1 
ATOM   2143  H  HG3    . GLU A 1 155 ? -47.785  64.043  0.348   1.00 74.18  ? 1117 GLU A HG3    1 
ATOM   2144  N  N      . VAL A 1 156 ? -48.412  65.761  2.421   1.00 43.99  ? 1118 VAL A N      1 
ATOM   2145  C  CA     . VAL A 1 156 ? -47.979  67.151  2.440   1.00 43.94  ? 1118 VAL A CA     1 
ATOM   2146  C  C      . VAL A 1 156 ? -46.709  67.263  1.610   1.00 40.71  ? 1118 VAL A C      1 
ATOM   2147  O  O      . VAL A 1 156 ? -45.833  66.397  1.688   1.00 41.32  ? 1118 VAL A O      1 
ATOM   2148  C  CB     . VAL A 1 156 ? -47.740  67.647  3.884   1.00 45.06  ? 1118 VAL A CB     1 
ATOM   2149  C  CG1    . VAL A 1 156 ? -47.479  69.150  3.909   1.00 43.99  ? 1118 VAL A CG1    1 
ATOM   2150  C  CG2    . VAL A 1 156 ? -48.925  67.295  4.779   1.00 42.66  ? 1118 VAL A CG2    1 
ATOM   2151  H  H      . VAL A 1 156 ? -47.838  65.221  2.765   1.00 52.79  ? 1118 VAL A H      1 
ATOM   2152  H  HA     . VAL A 1 156 ? -48.662  67.708  2.034   1.00 52.73  ? 1118 VAL A HA     1 
ATOM   2153  H  HB     . VAL A 1 156 ? -46.956  67.203  4.242   1.00 54.07  ? 1118 VAL A HB     1 
ATOM   2154  H  HG11   . VAL A 1 156 ? -47.333  69.430  4.826   1.00 52.79  ? 1118 VAL A HG11   1 
ATOM   2155  H  HG12   . VAL A 1 156 ? -46.692  69.342  3.375   1.00 52.79  ? 1118 VAL A HG12   1 
ATOM   2156  H  HG13   . VAL A 1 156 ? -48.249  69.611  3.540   1.00 52.79  ? 1118 VAL A HG13   1 
ATOM   2157  H  HG21   . VAL A 1 156 ? -48.749  67.617  5.677   1.00 51.20  ? 1118 VAL A HG21   1 
ATOM   2158  H  HG22   . VAL A 1 156 ? -49.724  67.718  4.427   1.00 51.20  ? 1118 VAL A HG22   1 
ATOM   2159  H  HG23   . VAL A 1 156 ? -49.038  66.331  4.789   1.00 51.20  ? 1118 VAL A HG23   1 
ATOM   2160  N  N      . ASP A 1 157 ? -46.621  68.320  0.802   1.00 43.16  ? 1119 ASP A N      1 
ATOM   2161  C  CA     . ASP A 1 157 ? -45.465  68.580  -0.051  1.00 45.97  ? 1119 ASP A CA     1 
ATOM   2162  C  C      . ASP A 1 157 ? -45.011  70.014  0.174   1.00 46.29  ? 1119 ASP A C      1 
ATOM   2163  O  O      . ASP A 1 157 ? -45.746  70.952  -0.152  1.00 47.83  ? 1119 ASP A O      1 
ATOM   2164  C  CB     . ASP A 1 157 ? -45.801  68.369  -1.532  1.00 49.81  ? 1119 ASP A CB     1 
ATOM   2165  C  CG     . ASP A 1 157 ? -46.195  66.939  -1.856  1.00 50.39  ? 1119 ASP A CG     1 
ATOM   2166  O  OD1    . ASP A 1 157 ? -47.050  66.371  -1.149  1.00 52.15  ? 1119 ASP A OD1    1 
ATOM   2167  O  OD2    . ASP A 1 157 ? -45.657  66.386  -2.837  1.00 53.38  1 1119 ASP A OD2    1 
ATOM   2168  H  H      . ASP A 1 157 ? -47.237  68.916  0.730   1.00 51.79  ? 1119 ASP A H      1 
ATOM   2169  H  HA     . ASP A 1 157 ? -44.740  67.983  0.191   1.00 55.17  ? 1119 ASP A HA     1 
ATOM   2170  H  HB2    . ASP A 1 157 ? -46.544  68.945  -1.772  1.00 59.77  ? 1119 ASP A HB2    1 
ATOM   2171  H  HB3    . ASP A 1 157 ? -45.023  68.593  -2.067  1.00 59.77  ? 1119 ASP A HB3    1 
ATOM   2172  N  N      . ILE A 1 158 ? -43.806  70.189  0.713   1.00 46.47  ? 1120 ILE A N      1 
ATOM   2173  C  CA     . ILE A 1 158 ? -43.251  71.514  0.985   1.00 48.37  ? 1120 ILE A CA     1 
ATOM   2174  C  C      . ILE A 1 158 ? -42.188  71.824  -0.060  1.00 48.77  ? 1120 ILE A C      1 
ATOM   2175  O  O      . ILE A 1 158 ? -41.264  71.027  -0.270  1.00 47.91  ? 1120 ILE A O      1 
ATOM   2176  C  CB     . ILE A 1 158 ? -42.661  71.608  2.404   1.00 46.35  ? 1120 ILE A CB     1 
ATOM   2177  C  CG1    . ILE A 1 158 ? -43.733  71.280  3.450   1.00 48.00  ? 1120 ILE A CG1    1 
ATOM   2178  C  CG2    . ILE A 1 158 ? -42.098  73.006  2.637   1.00 47.61  ? 1120 ILE A CG2    1 
ATOM   2179  C  CD1    . ILE A 1 158 ? -43.272  71.394  4.908   1.00 49.18  ? 1120 ILE A CD1    1 
ATOM   2180  H  H      . ILE A 1 158 ? -43.281  69.545  0.933   1.00 55.76  ? 1120 ILE A H      1 
ATOM   2181  H  HA     . ILE A 1 158 ? -43.955  72.176  0.906   1.00 58.05  ? 1120 ILE A HA     1 
ATOM   2182  H  HB     . ILE A 1 158 ? -41.940  70.964  2.484   1.00 55.63  ? 1120 ILE A HB     1 
ATOM   2183  H  HG12   . ILE A 1 158 ? -44.478  71.889  3.330   1.00 57.60  ? 1120 ILE A HG12   1 
ATOM   2184  H  HG13   . ILE A 1 158 ? -44.033  70.368  3.309   1.00 57.60  ? 1120 ILE A HG13   1 
ATOM   2185  H  HG21   . ILE A 1 158 ? -41.730  73.052  3.534   1.00 57.14  ? 1120 ILE A HG21   1 
ATOM   2186  H  HG22   . ILE A 1 158 ? -41.402  73.180  1.984   1.00 57.14  ? 1120 ILE A HG22   1 
ATOM   2187  H  HG23   . ILE A 1 158 ? -42.813  73.654  2.540   1.00 57.14  ? 1120 ILE A HG23   1 
ATOM   2188  H  HD11   . ILE A 1 158 ? -44.014  71.169  5.491   1.00 59.02  ? 1120 ILE A HD11   1 
ATOM   2189  H  HD12   . ILE A 1 158 ? -42.537  70.780  5.055   1.00 59.02  ? 1120 ILE A HD12   1 
ATOM   2190  H  HD13   . ILE A 1 158 ? -42.983  72.305  5.076   1.00 59.02  ? 1120 ILE A HD13   1 
ATOM   2191  N  N      . SER A 1 159 ? -42.307  72.991  -0.694  1.00 47.00  ? 1121 SER A N      1 
ATOM   2192  C  CA     . SER A 1 159 ? -41.321  73.488  -1.641  1.00 47.81  ? 1121 SER A CA     1 
ATOM   2193  C  C      . SER A 1 159 ? -40.833  74.858  -1.184  1.00 46.37  ? 1121 SER A C      1 
ATOM   2194  O  O      . SER A 1 159 ? -41.475  75.525  -0.370  1.00 47.33  ? 1121 SER A O      1 
ATOM   2195  C  CB     . SER A 1 159 ? -41.902  73.573  -3.062  1.00 47.94  ? 1121 SER A CB     1 
ATOM   2196  O  OG     . SER A 1 159 ? -43.127  74.288  -3.082  1.00 47.30  ? 1121 SER A OG     1 
ATOM   2197  H  H      . SER A 1 159 ? -42.973  73.524  -0.586  1.00 56.41  ? 1121 SER A H      1 
ATOM   2198  H  HA     . SER A 1 159 ? -40.561  72.885  -1.658  1.00 57.37  ? 1121 SER A HA     1 
ATOM   2199  H  HB2    . SER A 1 159 ? -41.264  74.027  -3.635  1.00 57.52  ? 1121 SER A HB2    1 
ATOM   2200  H  HB3    . SER A 1 159 ? -42.058  72.674  -3.391  1.00 57.52  ? 1121 SER A HB3    1 
ATOM   2201  H  HG     . SER A 1 159 ? -43.691  73.905  -2.590  1.00 56.76  ? 1121 SER A HG     1 
ATOM   2202  N  N      . LEU A 1 160 ? -39.699  75.288  -1.735  1.00 52.88  ? 1122 LEU A N      1 
ATOM   2203  C  CA     . LEU A 1 160 ? -39.028  76.511  -1.308  1.00 58.10  ? 1122 LEU A CA     1 
ATOM   2204  C  C      . LEU A 1 160 ? -39.211  77.608  -2.346  1.00 55.47  ? 1122 LEU A C      1 
ATOM   2205  O  O      . LEU A 1 160 ? -38.890  77.412  -3.521  1.00 59.43  ? 1122 LEU A O      1 
ATOM   2206  C  CB     . LEU A 1 160 ? -37.536  76.261  -1.088  1.00 58.87  ? 1122 LEU A CB     1 
ATOM   2207  C  CG     . LEU A 1 160 ? -37.142  75.435  0.135   1.00 61.34  ? 1122 LEU A CG     1 
ATOM   2208  C  CD1    . LEU A 1 160 ? -35.644  75.159  0.107   1.00 63.35  ? 1122 LEU A CD1    1 
ATOM   2209  C  CD2    . LEU A 1 160 ? -37.542  76.129  1.434   1.00 64.52  ? 1122 LEU A CD2    1 
ATOM   2210  H  H      . LEU A 1 160 ? -39.292  74.878  -2.372  1.00 63.46  ? 1122 LEU A H      1 
ATOM   2211  H  HA     . LEU A 1 160 ? -39.414  76.814  -0.471  1.00 69.72  ? 1122 LEU A HA     1 
ATOM   2212  H  HB2    . LEU A 1 160 ? -37.189  75.800  -1.867  1.00 70.64  ? 1122 LEU A HB2    1 
ATOM   2213  H  HB3    . LEU A 1 160 ? -37.096  77.122  -1.005  1.00 70.64  ? 1122 LEU A HB3    1 
ATOM   2214  H  HG     . LEU A 1 160 ? -37.603  74.583  0.100   1.00 73.61  ? 1122 LEU A HG     1 
ATOM   2215  H  HD11   . LEU A 1 160 ? -35.406  74.634  0.887   1.00 76.02  ? 1122 LEU A HD11   1 
ATOM   2216  H  HD12   . LEU A 1 160 ? -35.430  74.667  -0.701  1.00 76.02  ? 1122 LEU A HD12   1 
ATOM   2217  H  HD13   . LEU A 1 160 ? -35.167  76.003  0.117   1.00 76.02  ? 1122 LEU A HD13   1 
ATOM   2218  H  HD21   . LEU A 1 160 ? -37.275  75.574  2.183   1.00 77.42  ? 1122 LEU A HD21   1 
ATOM   2219  H  HD22   . LEU A 1 160 ? -37.094  76.988  1.483   1.00 77.42  ? 1122 LEU A HD22   1 
ATOM   2220  H  HD23   . LEU A 1 160 ? -38.503  76.255  1.441   1.00 77.42  ? 1122 LEU A HD23   1 
ATOM   2221  N  N      . TYR A 1 161 ? -39.692  78.768  -1.900  1.00 56.92  ? 1123 TYR A N      1 
ATOM   2222  C  CA     . TYR A 1 161 ? -39.818  79.951  -2.750  1.00 55.63  ? 1123 TYR A CA     1 
ATOM   2223  C  C      . TYR A 1 161 ? -40.445  79.594  -4.093  1.00 58.52  ? 1123 TYR A C      1 
ATOM   2224  O  O      . TYR A 1 161 ? -39.955  79.961  -5.165  1.00 58.10  ? 1123 TYR A O      1 
ATOM   2225  C  CB     . TYR A 1 161 ? -38.468  80.649  -2.923  1.00 58.23  ? 1123 TYR A CB     1 
ATOM   2226  C  CG     . TYR A 1 161 ? -38.077  81.454  -1.704  1.00 56.05  ? 1123 TYR A CG     1 
ATOM   2227  C  CD1    . TYR A 1 161 ? -37.455  80.856  -0.617  1.00 55.55  ? 1123 TYR A CD1    1 
ATOM   2228  C  CD2    . TYR A 1 161 ? -38.348  82.815  -1.636  1.00 56.19  ? 1123 TYR A CD2    1 
ATOM   2229  C  CE1    . TYR A 1 161 ? -37.109  81.593  0.500   1.00 57.14  ? 1123 TYR A CE1    1 
ATOM   2230  C  CE2    . TYR A 1 161 ? -38.006  83.557  -0.525  1.00 58.80  ? 1123 TYR A CE2    1 
ATOM   2231  C  CZ     . TYR A 1 161 ? -37.388  82.940  0.539   1.00 58.45  ? 1123 TYR A CZ     1 
ATOM   2232  O  OH     . TYR A 1 161 ? -37.049  83.677  1.645   1.00 63.58  ? 1123 TYR A OH     1 
ATOM   2233  H  H      . TYR A 1 161 ? -39.957  78.896  -1.092  1.00 68.30  ? 1123 TYR A H      1 
ATOM   2234  H  HA     . TYR A 1 161 ? -40.414  80.579  -2.312  1.00 66.76  ? 1123 TYR A HA     1 
ATOM   2235  H  HB2    . TYR A 1 161 ? -37.782  79.980  -3.075  1.00 69.87  ? 1123 TYR A HB2    1 
ATOM   2236  H  HB3    . TYR A 1 161 ? -38.518  81.254  -3.680  1.00 69.87  ? 1123 TYR A HB3    1 
ATOM   2237  H  HD1    . TYR A 1 161 ? -37.268  79.946  -0.641  1.00 66.66  ? 1123 TYR A HD1    1 
ATOM   2238  H  HD2    . TYR A 1 161 ? -38.767  83.233  -2.353  1.00 67.43  ? 1123 TYR A HD2    1 
ATOM   2239  H  HE1    . TYR A 1 161 ? -36.692  81.181  1.221   1.00 68.57  ? 1123 TYR A HE1    1 
ATOM   2240  H  HE2    . TYR A 1 161 ? -38.192  84.467  -0.495  1.00 70.56  ? 1123 TYR A HE2    1 
ATOM   2241  H  HH     . TYR A 1 161 ? -37.275  84.479  1.537   1.00 76.30  ? 1123 TYR A HH     1 
ATOM   2242  N  N      . ASN A 1 162 ? -41.551  78.857  -4.018  1.00 59.52  ? 1124 ASN A N      1 
ATOM   2243  C  CA     . ASN A 1 162 ? -42.331  78.499  -5.198  1.00 56.50  ? 1124 ASN A CA     1 
ATOM   2244  C  C      . ASN A 1 162 ? -43.291  79.645  -5.525  1.00 55.70  ? 1124 ASN A C      1 
ATOM   2245  O  O      . ASN A 1 162 ? -44.514  79.522  -5.466  1.00 58.81  ? 1124 ASN A O      1 
ATOM   2246  C  CB     . ASN A 1 162 ? -43.069  77.192  -4.947  1.00 55.92  ? 1124 ASN A CB     1 
ATOM   2247  C  CG     . ASN A 1 162 ? -43.461  76.490  -6.221  1.00 54.62  ? 1124 ASN A CG     1 
ATOM   2248  O  OD1    . ASN A 1 162 ? -43.459  77.082  -7.302  1.00 56.28  ? 1124 ASN A OD1    1 
ATOM   2249  N  ND2    . ASN A 1 162 ? -43.805  75.216  -6.103  1.00 54.61  ? 1124 ASN A ND2    1 
ATOM   2250  H  H      . ASN A 1 162 ? -41.874  78.547  -3.284  1.00 71.42  ? 1124 ASN A H      1 
ATOM   2251  H  HA     . ASN A 1 162 ? -41.735  78.374  -5.953  1.00 67.80  ? 1124 ASN A HA     1 
ATOM   2252  H  HB2    . ASN A 1 162 ? -42.495  76.597  -4.441  1.00 67.11  ? 1124 ASN A HB2    1 
ATOM   2253  H  HB3    . ASN A 1 162 ? -43.879  77.378  -4.446  1.00 67.11  ? 1124 ASN A HB3    1 
ATOM   2254  H  HD21   . ASN A 1 162 ? -44.038  74.766  -6.798  1.00 65.53  ? 1124 ASN A HD21   1 
ATOM   2255  H  HD22   . ASN A 1 162 ? -43.795  74.838  -5.330  1.00 65.53  ? 1124 ASN A HD22   1 
ATOM   2256  N  N      . THR A 1 163 ? -42.697  80.787  -5.874  1.00 53.91  ? 1125 THR A N      1 
ATOM   2257  C  CA     . THR A 1 163 ? -43.463  82.026  -5.967  1.00 54.17  ? 1125 THR A CA     1 
ATOM   2258  C  C      . THR A 1 163 ? -44.478  81.971  -7.102  1.00 53.81  ? 1125 THR A C      1 
ATOM   2259  O  O      . THR A 1 163 ? -45.629  82.390  -6.934  1.00 53.66  ? 1125 THR A O      1 
ATOM   2260  C  CB     . THR A 1 163 ? -42.517  83.213  -6.145  1.00 59.20  ? 1125 THR A CB     1 
ATOM   2261  O  OG1    . THR A 1 163 ? -41.374  83.046  -5.296  1.00 62.23  ? 1125 THR A OG1    1 
ATOM   2262  C  CG2    . THR A 1 163 ? -43.223  84.514  -5.782  1.00 59.90  ? 1125 THR A CG2    1 
ATOM   2263  H  H      . THR A 1 163 ? -41.861  80.869  -6.060  1.00 64.69  ? 1125 THR A H      1 
ATOM   2264  H  HA     . THR A 1 163 ? -43.950  82.156  -5.139  1.00 65.01  ? 1125 THR A HA     1 
ATOM   2265  H  HB     . THR A 1 163 ? -42.230  83.265  -7.070  1.00 71.04  ? 1125 THR A HB     1 
ATOM   2266  H  HG1    . THR A 1 163 ? -40.850  83.696  -5.389  1.00 74.68  ? 1125 THR A HG1    1 
ATOM   2267  H  HG21   . THR A 1 163 ? -42.617  85.263  -5.897  1.00 71.88  ? 1125 THR A HG21   1 
ATOM   2268  H  HG22   . THR A 1 163 ? -43.996  84.643  -6.354  1.00 71.88  ? 1125 THR A HG22   1 
ATOM   2269  H  HG23   . THR A 1 163 ? -43.516  84.485  -4.858  1.00 71.88  ? 1125 THR A HG23   1 
ATOM   2270  N  N      . LEU A 1 164 ? -44.074  81.462  -8.269  1.00 55.10  ? 1126 LEU A N      1 
ATOM   2271  C  CA     . LEU A 1 164 ? -44.992  81.421  -9.401  1.00 55.65  ? 1126 LEU A CA     1 
ATOM   2272  C  C      . LEU A 1 164 ? -46.172  80.498  -9.132  1.00 53.61  ? 1126 LEU A C      1 
ATOM   2273  O  O      . LEU A 1 164 ? -47.281  80.755  -9.616  1.00 52.06  ? 1126 LEU A O      1 
ATOM   2274  C  CB     . LEU A 1 164 ? -44.249  80.980  -10.663 1.00 54.49  ? 1126 LEU A CB     1 
ATOM   2275  C  CG     . LEU A 1 164 ? -43.218  81.960  -11.230 1.00 56.86  ? 1126 LEU A CG     1 
ATOM   2276  C  CD1    . LEU A 1 164 ? -42.566  81.376  -12.472 1.00 58.37  ? 1126 LEU A CD1    1 
ATOM   2277  C  CD2    . LEU A 1 164 ? -43.843  83.312  -11.549 1.00 57.30  ? 1126 LEU A CD2    1 
ATOM   2278  H  H      . LEU A 1 164 ? -43.292  81.142  -8.425  1.00 66.12  ? 1126 LEU A H      1 
ATOM   2279  H  HA     . LEU A 1 164 ? -45.340  82.313  -9.556  1.00 66.78  ? 1126 LEU A HA     1 
ATOM   2280  H  HB2    . LEU A 1 164 ? -43.782  80.153  -10.466 1.00 65.38  ? 1126 LEU A HB2    1 
ATOM   2281  H  HB3    . LEU A 1 164 ? -44.905  80.819  -11.360 1.00 65.38  ? 1126 LEU A HB3    1 
ATOM   2282  H  HG     . LEU A 1 164 ? -42.523  82.102  -10.568 1.00 68.23  ? 1126 LEU A HG     1 
ATOM   2283  H  HD11   . LEU A 1 164 ? -41.918  82.010  -12.815 1.00 70.05  ? 1126 LEU A HD11   1 
ATOM   2284  H  HD12   . LEU A 1 164 ? -42.125  80.546  -12.236 1.00 70.05  ? 1126 LEU A HD12   1 
ATOM   2285  H  HD13   . LEU A 1 164 ? -43.251  81.209  -13.138 1.00 70.05  ? 1126 LEU A HD13   1 
ATOM   2286  H  HD21   . LEU A 1 164 ? -43.159  83.900  -11.904 1.00 68.76  ? 1126 LEU A HD21   1 
ATOM   2287  H  HD22   . LEU A 1 164 ? -44.546  83.187  -12.206 1.00 68.76  ? 1126 LEU A HD22   1 
ATOM   2288  H  HD23   . LEU A 1 164 ? -44.214  83.688  -10.736 1.00 68.76  ? 1126 LEU A HD23   1 
ATOM   2289  N  N      . ALA A 1 165 ? -45.962  79.421  -8.371  1.00 54.65  ? 1127 ALA A N      1 
ATOM   2290  C  CA     . ALA A 1 165 ? -47.074  78.532  -8.050  1.00 53.33  ? 1127 ALA A CA     1 
ATOM   2291  C  C      . ALA A 1 165 ? -48.136  79.262  -7.240  1.00 52.47  ? 1127 ALA A C      1 
ATOM   2292  O  O      . ALA A 1 165 ? -49.337  79.050  -7.441  1.00 49.44  ? 1127 ALA A O      1 
ATOM   2293  C  CB     . ALA A 1 165 ? -46.568  77.305  -7.293  1.00 51.70  ? 1127 ALA A CB     1 
ATOM   2294  H  H      . ALA A 1 165 ? -45.204  79.189  -8.037  1.00 65.59  ? 1127 ALA A H      1 
ATOM   2295  H  HA     . ALA A 1 165 ? -47.483  78.228  -8.876  1.00 64.00  ? 1127 ALA A HA     1 
ATOM   2296  H  HB1    . ALA A 1 165 ? -47.321  76.728  -7.089  1.00 62.03  ? 1127 ALA A HB1    1 
ATOM   2297  H  HB2    . ALA A 1 165 ? -45.929  76.832  -7.849  1.00 62.03  ? 1127 ALA A HB2    1 
ATOM   2298  H  HB3    . ALA A 1 165 ? -46.142  77.595  -6.471  1.00 62.03  ? 1127 ALA A HB3    1 
ATOM   2299  N  N      . LEU A 1 166 ? -47.714  80.151  -6.338  1.00 59.06  ? 1128 LEU A N      1 
ATOM   2300  C  CA     . LEU A 1 166 ? -48.674  80.937  -5.573  1.00 61.71  ? 1128 LEU A CA     1 
ATOM   2301  C  C      . LEU A 1 166 ? -49.522  81.815  -6.480  1.00 59.78  ? 1128 LEU A C      1 
ATOM   2302  O  O      . LEU A 1 166 ? -50.709  82.026  -6.207  1.00 58.88  ? 1128 LEU A O      1 
ATOM   2303  C  CB     . LEU A 1 166 ? -47.947  81.792  -4.537  1.00 63.09  ? 1128 LEU A CB     1 
ATOM   2304  C  CG     . LEU A 1 166 ? -47.441  81.041  -3.305  1.00 67.54  ? 1128 LEU A CG     1 
ATOM   2305  C  CD1    . LEU A 1 166 ? -46.403  81.865  -2.554  1.00 70.56  ? 1128 LEU A CD1    1 
ATOM   2306  C  CD2    . LEU A 1 166 ? -48.605  80.703  -2.387  1.00 67.62  ? 1128 LEU A CD2    1 
ATOM   2307  H  H      . LEU A 1 166 ? -46.889  80.313  -6.154  1.00 70.87  ? 1128 LEU A H      1 
ATOM   2308  H  HA     . LEU A 1 166 ? -49.269  80.334  -5.100  1.00 74.05  ? 1128 LEU A HA     1 
ATOM   2309  H  HB2    . LEU A 1 166 ? -47.179  82.204  -4.963  1.00 75.71  ? 1128 LEU A HB2    1 
ATOM   2310  H  HB3    . LEU A 1 166 ? -48.555  82.482  -4.227  1.00 75.71  ? 1128 LEU A HB3    1 
ATOM   2311  H  HG     . LEU A 1 166 ? -47.025  80.211  -3.585  1.00 81.05  ? 1128 LEU A HG     1 
ATOM   2312  H  HD11   . LEU A 1 166 ? -46.102  81.364  -1.780  1.00 84.67  ? 1128 LEU A HD11   1 
ATOM   2313  H  HD12   . LEU A 1 166 ? -45.655  82.044  -3.145  1.00 84.67  ? 1128 LEU A HD12   1 
ATOM   2314  H  HD13   . LEU A 1 166 ? -46.808  82.700  -2.271  1.00 84.67  ? 1128 LEU A HD13   1 
ATOM   2315  H  HD21   . LEU A 1 166 ? -48.268  80.228  -1.612  1.00 81.14  ? 1128 LEU A HD21   1 
ATOM   2316  H  HD22   . LEU A 1 166 ? -49.037  81.526  -2.109  1.00 81.14  ? 1128 LEU A HD22   1 
ATOM   2317  H  HD23   . LEU A 1 166 ? -49.235  80.145  -2.870  1.00 81.14  ? 1128 LEU A HD23   1 
ATOM   2318  N  N      . HIS A 1 167 ? -48.941  82.327  -7.566  1.00 59.10  ? 1129 HIS A N      1 
ATOM   2319  C  CA     . HIS A 1 167 ? -49.681  83.240  -8.427  1.00 57.32  ? 1129 HIS A CA     1 
ATOM   2320  C  C      . HIS A 1 167 ? -50.631  82.499  -9.361  1.00 52.47  ? 1129 HIS A C      1 
ATOM   2321  O  O      . HIS A 1 167 ? -51.755  82.961  -9.585  1.00 53.68  ? 1129 HIS A O      1 
ATOM   2322  C  CB     . HIS A 1 167 ? -48.717  84.119  -9.223  1.00 58.94  ? 1129 HIS A CB     1 
ATOM   2323  C  CG     . HIS A 1 167 ? -48.094  85.210  -8.411  1.00 61.37  ? 1129 HIS A CG     1 
ATOM   2324  N  ND1    . HIS A 1 167 ? -46.841  85.103  -7.848  1.00 65.22  ? 1129 HIS A ND1    1 
ATOM   2325  C  CD2    . HIS A 1 167 ? -48.565  86.427  -8.050  1.00 62.82  ? 1129 HIS A CD2    1 
ATOM   2326  C  CE1    . HIS A 1 167 ? -46.560  86.212  -7.188  1.00 65.90  ? 1129 HIS A CE1    1 
ATOM   2327  N  NE2    . HIS A 1 167 ? -47.590  87.032  -7.294  1.00 64.84  ? 1129 HIS A NE2    1 
ATOM   2328  H  H      . HIS A 1 167 ? -48.135  82.165  -7.819  1.00 70.92  ? 1129 HIS A H      1 
ATOM   2329  H  HA     . HIS A 1 167 ? -50.217  83.825  -7.868  1.00 68.78  ? 1129 HIS A HA     1 
ATOM   2330  H  HB2    . HIS A 1 167 ? -48.002  83.563  -9.572  1.00 70.72  ? 1129 HIS A HB2    1 
ATOM   2331  H  HB3    . HIS A 1 167 ? -49.200  84.532  -9.955  1.00 70.72  ? 1129 HIS A HB3    1 
ATOM   2332  H  HD1    . HIS A 1 167 ? -46.319  84.423  -7.923  1.00 78.27  ? 1129 HIS A HD1    1 
ATOM   2333  H  HD2    . HIS A 1 167 ? -49.390  86.790  -8.278  1.00 75.39  ? 1129 HIS A HD2    1 
ATOM   2334  H  HE1    . HIS A 1 167 ? -45.773  86.385  -6.724  1.00 79.08  ? 1129 HIS A HE1    1 
ATOM   2335  N  N      . ASN A 1 168 ? -50.219  81.357  -9.919  1.00 45.58  ? 1130 ASN A N      1 
ATOM   2336  C  CA     . ASN A 1 168 ? -51.165  80.610  -10.740 1.00 48.85  ? 1130 ASN A CA     1 
ATOM   2337  C  C      . ASN A 1 168 ? -52.251  79.966  -9.886  1.00 44.86  ? 1130 ASN A C      1 
ATOM   2338  O  O      . ASN A 1 168 ? -53.335  79.674  -10.402 1.00 44.45  ? 1130 ASN A O      1 
ATOM   2339  C  CB     . ASN A 1 168 ? -50.437  79.577  -11.622 1.00 46.06  ? 1130 ASN A CB     1 
ATOM   2340  C  CG     . ASN A 1 168 ? -49.918  78.374  -10.855 1.00 43.95  ? 1130 ASN A CG     1 
ATOM   2341  O  OD1    . ASN A 1 168 ? -50.618  77.788  -10.033 1.00 47.87  ? 1130 ASN A OD1    1 
ATOM   2342  N  ND2    . ASN A 1 168 ? -48.682  77.985  -11.145 1.00 44.04  ? 1130 ASN A ND2    1 
ATOM   2343  H  H      . ASN A 1 168 ? -49.436  81.010  -9.842  1.00 54.70  ? 1130 ASN A H      1 
ATOM   2344  H  HA     . ASN A 1 168 ? -51.605  81.235  -11.337 1.00 58.62  ? 1130 ASN A HA     1 
ATOM   2345  H  HB2    . ASN A 1 168 ? -51.053  79.255  -12.299 1.00 55.27  ? 1130 ASN A HB2    1 
ATOM   2346  H  HB3    . ASN A 1 168 ? -49.679  80.008  -12.047 1.00 55.27  ? 1130 ASN A HB3    1 
ATOM   2347  H  HD21   . ASN A 1 168 ? -48.338  77.309  -10.740 1.00 52.85  ? 1130 ASN A HD21   1 
ATOM   2348  H  HD22   . ASN A 1 168 ? -48.226  78.409  -11.738 1.00 52.85  ? 1130 ASN A HD22   1 
ATOM   2349  N  N      . THR A 1 169 ? -51.998  79.766  -8.589  1.00 42.15  ? 1131 THR A N      1 
ATOM   2350  C  CA     . THR A 1 169 ? -53.074  79.392  -7.676  1.00 43.58  ? 1131 THR A CA     1 
ATOM   2351  C  C      . THR A 1 169 ? -54.117  80.498  -7.600  1.00 44.91  ? 1131 THR A C      1 
ATOM   2352  O  O      . THR A 1 169 ? -55.321  80.242  -7.715  1.00 46.04  ? 1131 THR A O      1 
ATOM   2353  C  CB     . THR A 1 169 ? -52.514  79.091  -6.280  1.00 46.83  ? 1131 THR A CB     1 
ATOM   2354  O  OG1    . THR A 1 169 ? -51.626  77.969  -6.340  1.00 45.75  ? 1131 THR A OG1    1 
ATOM   2355  C  CG2    . THR A 1 169 ? -53.641  78.784  -5.288  1.00 42.00  ? 1131 THR A CG2    1 
ATOM   2356  H  H      . THR A 1 169 ? -51.224  79.838  -8.221  1.00 50.57  ? 1131 THR A H      1 
ATOM   2357  H  HA     . THR A 1 169 ? -53.508  78.590  -8.007  1.00 52.30  ? 1131 THR A HA     1 
ATOM   2358  H  HB     . THR A 1 169 ? -52.028  79.866  -5.957  1.00 56.19  ? 1131 THR A HB     1 
ATOM   2359  H  HG1    . THR A 1 169 ? -50.988  78.134  -6.860  1.00 54.91  ? 1131 THR A HG1    1 
ATOM   2360  H  HG21   . THR A 1 169 ? -53.269  78.596  -4.412  1.00 50.40  ? 1131 THR A HG21   1 
ATOM   2361  H  HG22   . THR A 1 169 ? -54.239  79.544  -5.221  1.00 50.40  ? 1131 THR A HG22   1 
ATOM   2362  H  HG23   . THR A 1 169 ? -54.145  78.012  -5.589  1.00 50.40  ? 1131 THR A HG23   1 
ATOM   2363  N  N      . ARG A 1 170 ? -53.670  81.742  -7.401  1.00 44.55  ? 1132 ARG A N      1 
ATOM   2364  C  CA     . ARG A 1 170 ? -54.595  82.870  -7.411  1.00 48.38  ? 1132 ARG A CA     1 
ATOM   2365  C  C      . ARG A 1 170 ? -55.303  82.992  -8.756  1.00 48.76  ? 1132 ARG A C      1 
ATOM   2366  O  O      . ARG A 1 170 ? -56.507  83.270  -8.808  1.00 48.90  ? 1132 ARG A O      1 
ATOM   2367  C  CB     . ARG A 1 170 ? -53.852  84.166  -7.087  1.00 56.21  ? 1132 ARG A CB     1 
ATOM   2368  C  CG     . ARG A 1 170 ? -53.383  84.280  -5.642  1.00 62.58  ? 1132 ARG A CG     1 
ATOM   2369  C  CD     . ARG A 1 170 ? -52.590  85.564  -5.411  1.00 72.09  ? 1132 ARG A CD     1 
ATOM   2370  N  NE     . ARG A 1 170 ? -53.266  86.735  -5.976  1.00 76.98  ? 1132 ARG A NE     1 
ATOM   2371  C  CZ     . ARG A 1 170 ? -52.871  87.405  -7.059  1.00 78.69  ? 1132 ARG A CZ     1 
ATOM   2372  N  NH1    . ARG A 1 170 ? -51.779  87.048  -7.724  1.00 77.27  1 1132 ARG A NH1    1 
ATOM   2373  N  NH2    . ARG A 1 170 ? -53.574  88.451  -7.476  1.00 79.47  ? 1132 ARG A NH2    1 
ATOM   2374  H  H      . ARG A 1 170 ? -52.848  81.953  -7.259  1.00 53.46  ? 1132 ARG A H      1 
ATOM   2375  H  HA     . ARG A 1 170 ? -55.270  82.732  -6.728  1.00 58.06  ? 1132 ARG A HA     1 
ATOM   2376  H  HB2    . ARG A 1 170 ? -53.069  84.226  -7.656  1.00 67.45  ? 1132 ARG A HB2    1 
ATOM   2377  H  HB3    . ARG A 1 170 ? -54.443  84.915  -7.264  1.00 67.45  ? 1132 ARG A HB3    1 
ATOM   2378  H  HG2    . ARG A 1 170 ? -54.155  84.289  -5.055  1.00 75.10  ? 1132 ARG A HG2    1 
ATOM   2379  H  HG3    . ARG A 1 170 ? -52.810  83.526  -5.432  1.00 75.10  ? 1132 ARG A HG3    1 
ATOM   2380  H  HD2    . ARG A 1 170 ? -52.485  85.706  -4.457  1.00 86.50  ? 1132 ARG A HD2    1 
ATOM   2381  H  HD3    . ARG A 1 170 ? -51.722  85.482  -5.835  1.00 86.50  ? 1132 ARG A HD3    1 
ATOM   2382  H  HE     . ARG A 1 170 ? -53.975  87.012  -5.576  1.00 92.38  ? 1132 ARG A HE     1 
ATOM   2383  H  HH11   . ARG A 1 170 ? -51.318  86.371  -7.462  1.00 92.72  ? 1132 ARG A HH11   1 
ATOM   2384  H  HH12   . ARG A 1 170 ? -51.535  87.491  -8.420  1.00 92.72  ? 1132 ARG A HH12   1 
ATOM   2385  H  HH21   . ARG A 1 170 ? -54.281  88.692  -7.050  1.00 95.37  ? 1132 ARG A HH21   1 
ATOM   2386  H  HH22   . ARG A 1 170 ? -53.321  88.890  -8.172  1.00 95.37  ? 1132 ARG A HH22   1 
ATOM   2387  N  N      . LEU A 1 171 ? -54.576  82.783  -9.856  1.00 50.30  ? 1133 LEU A N      1 
ATOM   2388  C  CA     . LEU A 1 171 ? -55.188  82.874  -11.179 1.00 50.91  ? 1133 LEU A CA     1 
ATOM   2389  C  C      . LEU A 1 171 ? -56.325  81.872  -11.321 1.00 49.34  ? 1133 LEU A C      1 
ATOM   2390  O  O      . LEU A 1 171 ? -57.443  82.232  -11.707 1.00 46.67  ? 1133 LEU A O      1 
ATOM   2391  C  CB     . LEU A 1 171 ? -54.133  82.648  -12.263 1.00 51.24  ? 1133 LEU A CB     1 
ATOM   2392  C  CG     . LEU A 1 171 ? -54.632  82.658  -13.715 1.00 51.51  ? 1133 LEU A CG     1 
ATOM   2393  C  CD1    . LEU A 1 171 ? -55.085  84.053  -14.121 1.00 54.38  ? 1133 LEU A CD1    1 
ATOM   2394  C  CD2    . LEU A 1 171 ? -53.558  82.146  -14.662 1.00 49.99  ? 1133 LEU A CD2    1 
ATOM   2395  H  H      . LEU A 1 171 ? -53.738  82.589  -9.863  1.00 60.35  ? 1133 LEU A H      1 
ATOM   2396  H  HA     . LEU A 1 171 ? -55.555  83.764  -11.297 1.00 61.09  ? 1133 LEU A HA     1 
ATOM   2397  H  HB2    . LEU A 1 171 ? -53.463  83.345  -12.185 1.00 61.49  ? 1133 LEU A HB2    1 
ATOM   2398  H  HB3    . LEU A 1 171 ? -53.718  81.785  -12.108 1.00 61.49  ? 1133 LEU A HB3    1 
ATOM   2399  H  HG     . LEU A 1 171 ? -55.397  82.065  -13.786 1.00 61.81  ? 1133 LEU A HG     1 
ATOM   2400  H  HD11   . LEU A 1 171 ? -55.394  84.029  -15.040 1.00 65.25  ? 1133 LEU A HD11   1 
ATOM   2401  H  HD12   . LEU A 1 171 ? -55.807  84.333  -13.536 1.00 65.25  ? 1133 LEU A HD12   1 
ATOM   2402  H  HD13   . LEU A 1 171 ? -54.336  84.664  -14.039 1.00 65.25  ? 1133 LEU A HD13   1 
ATOM   2403  H  HD21   . LEU A 1 171 ? -53.902  82.164  -15.569 1.00 59.99  ? 1133 LEU A HD21   1 
ATOM   2404  H  HD22   . LEU A 1 171 ? -52.777  82.718  -14.593 1.00 59.99  ? 1133 LEU A HD22   1 
ATOM   2405  H  HD23   . LEU A 1 171 ? -53.325  81.237  -14.414 1.00 59.99  ? 1133 LEU A HD23   1 
ATOM   2406  N  N      . LEU A 1 172 ? -56.056  80.602  -11.010 1.00 49.92  ? 1134 LEU A N      1 
ATOM   2407  C  CA     . LEU A 1 172 ? -57.085  79.575  -11.131 1.00 49.00  ? 1134 LEU A CA     1 
ATOM   2408  C  C      . LEU A 1 172 ? -58.250  79.847  -10.188 1.00 46.89  ? 1134 LEU A C      1 
ATOM   2409  O  O      . LEU A 1 172 ? -59.410  79.594  -10.535 1.00 45.15  ? 1134 LEU A O      1 
ATOM   2410  C  CB     . LEU A 1 172 ? -56.479  78.197  -10.859 1.00 46.63  ? 1134 LEU A CB     1 
ATOM   2411  C  CG     . LEU A 1 172 ? -55.971  77.456  -12.102 1.00 49.16  ? 1134 LEU A CG     1 
ATOM   2412  C  CD1    . LEU A 1 172 ? -54.965  78.298  -12.880 1.00 46.16  ? 1134 LEU A CD1    1 
ATOM   2413  C  CD2    . LEU A 1 172 ? -55.361  76.118  -11.713 1.00 45.92  ? 1134 LEU A CD2    1 
ATOM   2414  H  H      . LEU A 1 172 ? -55.295  80.315  -10.731 1.00 59.90  ? 1134 LEU A H      1 
ATOM   2415  H  HA     . LEU A 1 172 ? -57.428  79.577  -12.038 1.00 58.81  ? 1134 LEU A HA     1 
ATOM   2416  H  HB2    . LEU A 1 172 ? -55.727  78.304  -10.255 1.00 55.96  ? 1134 LEU A HB2    1 
ATOM   2417  H  HB3    . LEU A 1 172 ? -57.154  77.639  -10.442 1.00 55.96  ? 1134 LEU A HB3    1 
ATOM   2418  H  HG     . LEU A 1 172 ? -56.723  77.278  -12.688 1.00 58.99  ? 1134 LEU A HG     1 
ATOM   2419  H  HD11   . LEU A 1 172 ? -54.668  77.797  -13.655 1.00 55.39  ? 1134 LEU A HD11   1 
ATOM   2420  H  HD12   . LEU A 1 172 ? -55.393  79.121  -13.161 1.00 55.39  ? 1134 LEU A HD12   1 
ATOM   2421  H  HD13   . LEU A 1 172 ? -54.209  78.497  -12.305 1.00 55.39  ? 1134 LEU A HD13   1 
ATOM   2422  H  HD21   . LEU A 1 172 ? -55.047  75.670  -12.514 1.00 55.10  ? 1134 LEU A HD21   1 
ATOM   2423  H  HD22   . LEU A 1 172 ? -54.618  76.274  -11.109 1.00 55.10  ? 1134 LEU A HD22   1 
ATOM   2424  H  HD23   . LEU A 1 172 ? -56.037  75.579  -11.274 1.00 55.10  ? 1134 LEU A HD23   1 
ATOM   2425  N  N      . SER A 1 173 ? -57.963  80.364  -8.990  1.00 47.99  ? 1135 SER A N      1 
ATOM   2426  C  CA     . SER A 1 173 ? -59.031  80.698  -8.053  1.00 46.81  ? 1135 SER A CA     1 
ATOM   2427  C  C      . SER A 1 173 ? -59.945  81.776  -8.623  1.00 47.04  ? 1135 SER A C      1 
ATOM   2428  O  O      . SER A 1 173 ? -61.170  81.708  -8.468  1.00 47.83  ? 1135 SER A O      1 
ATOM   2429  C  CB     . SER A 1 173 ? -58.436  81.149  -6.718  1.00 48.01  ? 1135 SER A CB     1 
ATOM   2430  O  OG     . SER A 1 173 ? -59.453  81.384  -5.758  1.00 46.49  ? 1135 SER A OG     1 
ATOM   2431  H  H      . SER A 1 173 ? -57.169  80.527  -8.702  1.00 57.59  ? 1135 SER A H      1 
ATOM   2432  H  HA     . SER A 1 173 ? -59.567  79.907  -7.890  1.00 56.17  ? 1135 SER A HA     1 
ATOM   2433  H  HB2    . SER A 1 173 ? -57.845  80.455  -6.386  1.00 57.61  ? 1135 SER A HB2    1 
ATOM   2434  H  HB3    . SER A 1 173 ? -57.938  81.970  -6.856  1.00 57.61  ? 1135 SER A HB3    1 
ATOM   2435  H  HG     . SER A 1 173 ? -59.111  81.630  -5.032  1.00 55.79  ? 1135 SER A HG     1 
ATOM   2436  N  N      . ALA A 1 174 ? -59.367  82.788  -9.274  1.00 47.24  ? 1136 ALA A N      1 
ATOM   2437  C  CA     . ALA A 1 174 ? -60.182  83.821  -9.905  1.00 50.40  ? 1136 ALA A CA     1 
ATOM   2438  C  C      . ALA A 1 174 ? -61.099  83.226  -10.967 1.00 52.40  ? 1136 ALA A C      1 
ATOM   2439  O  O      . ALA A 1 174 ? -62.288  83.560  -11.030 1.00 55.24  ? 1136 ALA A O      1 
ATOM   2440  C  CB     . ALA A 1 174 ? -59.284  84.899  -10.510 1.00 50.26  ? 1136 ALA A CB     1 
ATOM   2441  H  H      . ALA A 1 174 ? -58.518  82.896  -9.363  1.00 56.68  ? 1136 ALA A H      1 
ATOM   2442  H  HA     . ALA A 1 174 ? -60.739  84.239  -9.229  1.00 60.48  ? 1136 ALA A HA     1 
ATOM   2443  H  HB1    . ALA A 1 174 ? -59.841  85.577  -10.924 1.00 60.31  ? 1136 ALA A HB1    1 
ATOM   2444  H  HB2    . ALA A 1 174 ? -58.749  85.296  -9.806  1.00 60.31  ? 1136 ALA A HB2    1 
ATOM   2445  H  HB3    . ALA A 1 174 ? -58.708  84.492  -11.176 1.00 60.31  ? 1136 ALA A HB3    1 
ATOM   2446  N  N      . TYR A 1 175 ? -60.566  82.339  -11.811 1.00 50.24  ? 1137 TYR A N      1 
ATOM   2447  C  CA     . TYR A 1 175 ? -61.394  81.700  -12.830 1.00 51.36  ? 1137 TYR A CA     1 
ATOM   2448  C  C      . TYR A 1 175 ? -62.525  80.900  -12.196 1.00 52.11  ? 1137 TYR A C      1 
ATOM   2449  O  O      . TYR A 1 175 ? -63.662  80.925  -12.683 1.00 51.67  ? 1137 TYR A O      1 
ATOM   2450  C  CB     . TYR A 1 175 ? -60.538  80.798  -13.721 1.00 49.12  ? 1137 TYR A CB     1 
ATOM   2451  C  CG     . TYR A 1 175 ? -59.770  81.534  -14.800 1.00 51.35  ? 1137 TYR A CG     1 
ATOM   2452  C  CD1    . TYR A 1 175 ? -60.437  82.198  -15.823 1.00 51.12  ? 1137 TYR A CD1    1 
ATOM   2453  C  CD2    . TYR A 1 175 ? -58.379  81.550  -14.808 1.00 50.95  ? 1137 TYR A CD2    1 
ATOM   2454  C  CE1    . TYR A 1 175 ? -59.746  82.868  -16.814 1.00 51.28  ? 1137 TYR A CE1    1 
ATOM   2455  C  CE2    . TYR A 1 175 ? -57.678  82.218  -15.799 1.00 51.01  ? 1137 TYR A CE2    1 
ATOM   2456  C  CZ     . TYR A 1 175 ? -58.368  82.874  -16.800 1.00 51.12  ? 1137 TYR A CZ     1 
ATOM   2457  O  OH     . TYR A 1 175 ? -57.686  83.544  -17.791 1.00 51.32  ? 1137 TYR A OH     1 
ATOM   2458  H  H      . TYR A 1 175 ? -59.741  82.094  -11.814 1.00 60.29  ? 1137 TYR A H      1 
ATOM   2459  H  HA     . TYR A 1 175 ? -61.790  82.386  -13.390 1.00 61.64  ? 1137 TYR A HA     1 
ATOM   2460  H  HB2    . TYR A 1 175 ? -59.893  80.334  -13.165 1.00 58.95  ? 1137 TYR A HB2    1 
ATOM   2461  H  HB3    . TYR A 1 175 ? -61.116  80.154  -14.158 1.00 58.95  ? 1137 TYR A HB3    1 
ATOM   2462  H  HD1    . TYR A 1 175 ? -61.367  82.197  -15.837 1.00 61.34  ? 1137 TYR A HD1    1 
ATOM   2463  H  HD2    . TYR A 1 175 ? -57.913  81.110  -14.135 1.00 61.14  ? 1137 TYR A HD2    1 
ATOM   2464  H  HE1    . TYR A 1 175 ? -60.208  83.310  -17.489 1.00 61.53  ? 1137 TYR A HE1    1 
ATOM   2465  H  HE2    . TYR A 1 175 ? -56.748  82.225  -15.790 1.00 61.21  ? 1137 TYR A HE2    1 
ATOM   2466  H  HH     . TYR A 1 175 ? -56.858  83.472  -17.669 1.00 61.58  ? 1137 TYR A HH     1 
ATOM   2467  N  N      . SER A 1 176 ? -62.234  80.185  -11.105 1.00 52.66  ? 1138 SER A N      1 
ATOM   2468  C  CA     . SER A 1 176 ? -63.251  79.365  -10.458 1.00 52.87  ? 1138 SER A CA     1 
ATOM   2469  C  C      . SER A 1 176 ? -64.404  80.200  -9.923  1.00 53.38  ? 1138 SER A C      1 
ATOM   2470  O  O      . SER A 1 176 ? -65.503  79.668  -9.732  1.00 54.57  ? 1138 SER A O      1 
ATOM   2471  C  CB     . SER A 1 176 ? -62.628  78.556  -9.320  1.00 55.61  ? 1138 SER A CB     1 
ATOM   2472  O  OG     . SER A 1 176 ? -62.490  79.342  -8.151  1.00 61.48  ? 1138 SER A OG     1 
ATOM   2473  H  H      . SER A 1 176 ? -61.462  80.160  -10.727 1.00 63.20  ? 1138 SER A H      1 
ATOM   2474  H  HA     . SER A 1 176 ? -63.610  78.741  -11.107 1.00 63.44  ? 1138 SER A HA     1 
ATOM   2475  H  HB2    . SER A 1 176 ? -63.200  77.797  -9.124  1.00 66.73  ? 1138 SER A HB2    1 
ATOM   2476  H  HB3    . SER A 1 176 ? -61.752  78.246  -9.597  1.00 66.73  ? 1138 SER A HB3    1 
ATOM   2477  H  HG     . SER A 1 176 ? -61.996  80.003  -8.306  1.00 73.78  ? 1138 SER A HG     1 
ATOM   2478  N  N      . ALA A 1 177 ? -64.182  81.489  -9.679  1.00 52.44  ? 1139 ALA A N      1 
ATOM   2479  C  CA     . ALA A 1 177 ? -65.203  82.365  -9.126  1.00 50.66  ? 1139 ALA A CA     1 
ATOM   2480  C  C      . ALA A 1 177 ? -66.043  83.056  -10.192 1.00 53.47  ? 1139 ALA A C      1 
ATOM   2481  O  O      . ALA A 1 177 ? -67.088  83.627  -9.861  1.00 53.39  ? 1139 ALA A O      1 
ATOM   2482  C  CB     . ALA A 1 177 ? -64.552  83.424  -8.235  1.00 52.24  ? 1139 ALA A CB     1 
ATOM   2483  H  H      . ALA A 1 177 ? -63.433  81.884  -9.829  1.00 62.93  ? 1139 ALA A H      1 
ATOM   2484  H  HA     . ALA A 1 177 ? -65.801  81.837  -8.573  1.00 60.79  ? 1139 ALA A HA     1 
ATOM   2485  H  HB1    . ALA A 1 177 ? -65.243  84.000  -7.872  1.00 62.69  ? 1139 ALA A HB1    1 
ATOM   2486  H  HB2    . ALA A 1 177 ? -64.078  82.981  -7.513  1.00 62.69  ? 1139 ALA A HB2    1 
ATOM   2487  H  HB3    . ALA A 1 177 ? -63.931  83.945  -8.767  1.00 62.69  ? 1139 ALA A HB3    1 
ATOM   2488  N  N      . ILE A 1 178 ? -65.618  83.020  -11.455 1.00 55.85  ? 1140 ILE A N      1 
ATOM   2489  C  CA     . ILE A 1 178 ? -66.351  83.714  -12.507 1.00 56.44  ? 1140 ILE A CA     1 
ATOM   2490  C  C      . ILE A 1 178 ? -67.710  83.065  -12.735 1.00 56.15  ? 1140 ILE A C      1 
ATOM   2491  O  O      . ILE A 1 178 ? -68.720  83.756  -12.916 1.00 57.97  ? 1140 ILE A O      1 
ATOM   2492  C  CB     . ILE A 1 178 ? -65.512  83.741  -13.799 1.00 55.76  ? 1140 ILE A CB     1 
ATOM   2493  C  CG1    . ILE A 1 178 ? -64.257  84.593  -13.587 1.00 57.01  ? 1140 ILE A CG1    1 
ATOM   2494  C  CG2    . ILE A 1 178 ? -66.339  84.257  -14.978 1.00 56.62  ? 1140 ILE A CG2    1 
ATOM   2495  C  CD1    . ILE A 1 178 ? -63.282  84.562  -14.745 1.00 57.18  ? 1140 ILE A CD1    1 
ATOM   2496  H  H      . ILE A 1 178 ? -64.914  82.604  -11.724 1.00 67.02  ? 1140 ILE A H      1 
ATOM   2497  H  HA     . ILE A 1 178 ? -66.502  84.632  -12.232 1.00 67.73  ? 1140 ILE A HA     1 
ATOM   2498  H  HB     . ILE A 1 178 ? -65.232  82.834  -13.998 1.00 66.91  ? 1140 ILE A HB     1 
ATOM   2499  H  HG12   . ILE A 1 178 ? -64.527  85.515  -13.453 1.00 68.41  ? 1140 ILE A HG12   1 
ATOM   2500  H  HG13   . ILE A 1 178 ? -63.791  84.270  -12.800 1.00 68.41  ? 1140 ILE A HG13   1 
ATOM   2501  H  HG21   . ILE A 1 178 ? -65.785  84.262  -15.774 1.00 67.95  ? 1140 ILE A HG21   1 
ATOM   2502  H  HG22   . ILE A 1 178 ? -67.101  83.671  -15.109 1.00 67.95  ? 1140 ILE A HG22   1 
ATOM   2503  H  HG23   . ILE A 1 178 ? -66.643  85.157  -14.780 1.00 67.95  ? 1140 ILE A HG23   1 
ATOM   2504  H  HD11   . ILE A 1 178 ? -62.521  85.124  -14.531 1.00 68.62  ? 1140 ILE A HD11   1 
ATOM   2505  H  HD12   . ILE A 1 178 ? -62.990  83.648  -14.886 1.00 68.62  ? 1140 ILE A HD12   1 
ATOM   2506  H  HD13   . ILE A 1 178 ? -63.727  84.894  -15.540 1.00 68.62  ? 1140 ILE A HD13   1 
ATOM   2507  N  N      . ASP A 1 179 ? -67.762  81.736  -12.727 1.00 54.93  ? 1141 ASP A N      1 
ATOM   2508  C  CA     . ASP A 1 179 ? -68.969  81.015  -13.108 1.00 55.99  ? 1141 ASP A CA     1 
ATOM   2509  C  C      . ASP A 1 179 ? -68.961  79.638  -12.454 1.00 52.00  ? 1141 ASP A C      1 
ATOM   2510  O  O      . ASP A 1 179 ? -67.927  78.960  -12.471 1.00 51.67  ? 1141 ASP A O      1 
ATOM   2511  C  CB     . ASP A 1 179 ? -69.050  80.900  -14.635 1.00 57.72  ? 1141 ASP A CB     1 
ATOM   2512  C  CG     . ASP A 1 179 ? -70.404  80.410  -15.123 1.00 58.64  ? 1141 ASP A CG     1 
ATOM   2513  O  OD1    . ASP A 1 179 ? -70.871  79.350  -14.656 1.00 55.60  ? 1141 ASP A OD1    1 
ATOM   2514  O  OD2    . ASP A 1 179 ? -71.003  81.094  -15.981 1.00 62.47  1 1141 ASP A OD2    1 
ATOM   2515  H  H      . ASP A 1 179 ? -67.106  81.227  -12.503 1.00 65.91  ? 1141 ASP A H      1 
ATOM   2516  H  HA     . ASP A 1 179 ? -69.749  81.501  -12.794 1.00 67.19  ? 1141 ASP A HA     1 
ATOM   2517  H  HB2    . ASP A 1 179 ? -68.888  81.773  -15.026 1.00 69.26  ? 1141 ASP A HB2    1 
ATOM   2518  H  HB3    . ASP A 1 179 ? -68.376  80.271  -14.939 1.00 69.26  ? 1141 ASP A HB3    1 
ATOM   2519  N  N      . PRO A 1 180 ? -70.072  79.190  -11.860 1.00 52.07  ? 1142 PRO A N      1 
ATOM   2520  C  CA     . PRO A 1 180 ? -70.067  77.854  -11.236 1.00 53.31  ? 1142 PRO A CA     1 
ATOM   2521  C  C      . PRO A 1 180 ? -69.685  76.740  -12.192 1.00 48.39  ? 1142 PRO A C      1 
ATOM   2522  O  O      . PRO A 1 180 ? -69.158  75.711  -11.752 1.00 47.79  ? 1142 PRO A O      1 
ATOM   2523  C  CB     . PRO A 1 180 ? -71.510  77.696  -10.736 1.00 54.81  ? 1142 PRO A CB     1 
ATOM   2524  C  CG     . PRO A 1 180 ? -72.021  79.088  -10.595 1.00 56.35  ? 1142 PRO A CG     1 
ATOM   2525  C  CD     . PRO A 1 180 ? -71.360  79.879  -11.674 1.00 54.41  ? 1142 PRO A CD     1 
ATOM   2526  H  HA     . PRO A 1 180 ? -69.464  77.843  -10.476 1.00 63.97  ? 1142 PRO A HA     1 
ATOM   2527  H  HB2    . PRO A 1 180 ? -72.031  77.203  -11.390 1.00 65.77  ? 1142 PRO A HB2    1 
ATOM   2528  H  HB3    . PRO A 1 180 ? -71.512  77.240  -9.880  1.00 65.77  ? 1142 PRO A HB3    1 
ATOM   2529  H  HG2    . PRO A 1 180 ? -72.984  79.093  -10.710 1.00 67.62  ? 1142 PRO A HG2    1 
ATOM   2530  H  HG3    . PRO A 1 180 ? -71.781  79.434  -9.722  1.00 67.62  ? 1142 PRO A HG3    1 
ATOM   2531  H  HD2    . PRO A 1 180 ? -71.884  79.844  -12.489 1.00 65.29  ? 1142 PRO A HD2    1 
ATOM   2532  H  HD3    . PRO A 1 180 ? -71.215  80.793  -11.383 1.00 65.29  ? 1142 PRO A HD3    1 
ATOM   2533  N  N      . ARG A 1 181 ? -69.933  76.913  -13.492 1.00 46.79  ? 1143 ARG A N      1 
ATOM   2534  C  CA     . ARG A 1 181 ? -69.617  75.862  -14.453 1.00 46.63  ? 1143 ARG A CA     1 
ATOM   2535  C  C      . ARG A 1 181 ? -68.119  75.598  -14.527 1.00 41.27  ? 1143 ARG A C      1 
ATOM   2536  O  O      . ARG A 1 181 ? -67.704  74.480  -14.855 1.00 38.03  ? 1143 ARG A O      1 
ATOM   2537  C  CB     . ARG A 1 181 ? -70.162  76.238  -15.831 1.00 42.50  ? 1143 ARG A CB     1 
ATOM   2538  C  CG     . ARG A 1 181 ? -71.672  76.370  -15.870 1.00 42.93  ? 1143 ARG A CG     1 
ATOM   2539  C  CD     . ARG A 1 181 ? -72.162  76.836  -17.225 1.00 45.40  ? 1143 ARG A CD     1 
ATOM   2540  N  NE     . ARG A 1 181 ? -71.805  78.227  -17.482 1.00 47.93  ? 1143 ARG A NE     1 
ATOM   2541  C  CZ     . ARG A 1 181 ? -71.987  78.846  -18.643 1.00 50.21  ? 1143 ARG A CZ     1 
ATOM   2542  N  NH1    . ARG A 1 181 ? -72.522  78.200  -19.673 1.00 51.24  1 1143 ARG A NH1    1 
ATOM   2543  N  NH2    . ARG A 1 181 ? -71.630  80.116  -18.775 1.00 51.96  ? 1143 ARG A NH2    1 
ATOM   2544  H  H      . ARG A 1 181 ? -70.280  77.621  -13.836 1.00 56.15  ? 1143 ARG A H      1 
ATOM   2545  H  HA     . ARG A 1 181 ? -70.051  75.041  -14.174 1.00 55.96  ? 1143 ARG A HA     1 
ATOM   2546  H  HB2    . ARG A 1 181 ? -69.782  77.090  -16.097 1.00 51.00  ? 1143 ARG A HB2    1 
ATOM   2547  H  HB3    . ARG A 1 181 ? -69.908  75.551  -16.467 1.00 51.00  ? 1143 ARG A HB3    1 
ATOM   2548  H  HG2    . ARG A 1 181 ? -72.072  75.506  -15.683 1.00 51.52  ? 1143 ARG A HG2    1 
ATOM   2549  H  HG3    . ARG A 1 181 ? -71.952  77.019  -15.206 1.00 51.52  ? 1143 ARG A HG3    1 
ATOM   2550  H  HD2    . ARG A 1 181 ? -71.759  76.287  -17.916 1.00 54.48  ? 1143 ARG A HD2    1 
ATOM   2551  H  HD3    . ARG A 1 181 ? -73.128  76.760  -17.258 1.00 54.48  ? 1143 ARG A HD3    1 
ATOM   2552  H  HE     . ARG A 1 181 ? -71.453  78.676  -16.839 1.00 57.52  ? 1143 ARG A HE     1 
ATOM   2553  H  HH11   . ARG A 1 181 ? -72.755  77.377  -19.590 1.00 61.49  ? 1143 ARG A HH11   1 
ATOM   2554  H  HH12   . ARG A 1 181 ? -72.637  78.606  -20.422 1.00 61.49  ? 1143 ARG A HH12   1 
ATOM   2555  H  HH21   . ARG A 1 181 ? -71.282  80.536  -18.110 1.00 62.35  ? 1143 ARG A HH21   1 
ATOM   2556  H  HH22   . ARG A 1 181 ? -71.745  80.519  -19.526 1.00 62.35  ? 1143 ARG A HH22   1 
ATOM   2557  N  N      . VAL A 1 182 ? -67.293  76.599  -14.217 1.00 40.93  ? 1144 VAL A N      1 
ATOM   2558  C  CA     . VAL A 1 182 ? -65.847  76.389  -14.203 1.00 45.11  ? 1144 VAL A CA     1 
ATOM   2559  C  C      . VAL A 1 182 ? -65.487  75.308  -13.189 1.00 46.25  ? 1144 VAL A C      1 
ATOM   2560  O  O      . VAL A 1 182 ? -64.733  74.374  -13.488 1.00 43.51  ? 1144 VAL A O      1 
ATOM   2561  C  CB     . VAL A 1 182 ? -65.110  77.709  -13.901 1.00 47.11  ? 1144 VAL A CB     1 
ATOM   2562  C  CG1    . VAL A 1 182 ? -63.597  77.499  -13.913 1.00 47.94  ? 1144 VAL A CG1    1 
ATOM   2563  C  CG2    . VAL A 1 182 ? -65.500  78.788  -14.893 1.00 48.41  ? 1144 VAL A CG2    1 
ATOM   2564  H  H      . VAL A 1 182 ? -67.541  77.398  -14.015 1.00 49.12  ? 1144 VAL A H      1 
ATOM   2565  H  HA     . VAL A 1 182 ? -65.564  76.083  -15.079 1.00 54.14  ? 1144 VAL A HA     1 
ATOM   2566  H  HB     . VAL A 1 182 ? -65.362  78.013  -13.015 1.00 56.53  ? 1144 VAL A HB     1 
ATOM   2567  H  HG11   . VAL A 1 182 ? -63.160  78.343  -13.721 1.00 57.53  ? 1144 VAL A HG11   1 
ATOM   2568  H  HG12   . VAL A 1 182 ? -63.364  76.844  -13.237 1.00 57.53  ? 1144 VAL A HG12   1 
ATOM   2569  H  HG13   . VAL A 1 182 ? -63.330  77.179  -14.789 1.00 57.53  ? 1144 VAL A HG13   1 
ATOM   2570  H  HG21   . VAL A 1 182 ? -65.021  79.603  -14.677 1.00 58.09  ? 1144 VAL A HG21   1 
ATOM   2571  H  HG22   . VAL A 1 182 ? -65.266  78.493  -15.787 1.00 58.09  ? 1144 VAL A HG22   1 
ATOM   2572  H  HG23   . VAL A 1 182 ? -66.456  78.939  -14.834 1.00 58.09  ? 1144 VAL A HG23   1 
ATOM   2573  N  N      . LYS A 1 183 ? -66.038  75.412  -11.977 1.00 43.61  ? 1145 LYS A N      1 
ATOM   2574  C  CA     . LYS A 1 183 ? -65.767  74.421  -10.941 1.00 44.60  ? 1145 LYS A CA     1 
ATOM   2575  C  C      . LYS A 1 183 ? -66.281  73.045  -11.343 1.00 42.51  ? 1145 LYS A C      1 
ATOM   2576  O  O      . LYS A 1 183 ? -65.555  72.048  -11.251 1.00 41.01  ? 1145 LYS A O      1 
ATOM   2577  C  CB     . LYS A 1 183 ? -66.404  74.860  -9.623  1.00 49.22  ? 1145 LYS A CB     1 
ATOM   2578  C  CG     . LYS A 1 183 ? -65.583  75.873  -8.861  1.00 53.39  ? 1145 LYS A CG     1 
ATOM   2579  C  CD     . LYS A 1 183 ? -66.146  76.116  -7.475  1.00 56.15  ? 1145 LYS A CD     1 
ATOM   2580  C  CE     . LYS A 1 183 ? -65.204  76.975  -6.649  1.00 57.87  ? 1145 LYS A CE     1 
ATOM   2581  N  NZ     . LYS A 1 183 ? -65.687  77.148  -5.256  1.00 63.83  1 1145 LYS A NZ     1 
ATOM   2582  H  H      . LYS A 1 183 ? -66.568  76.044  -11.733 1.00 52.34  ? 1145 LYS A H      1 
ATOM   2583  H  HA     . LYS A 1 183 ? -64.809  74.357  -10.806 1.00 53.52  ? 1145 LYS A HA     1 
ATOM   2584  H  HB2    . LYS A 1 183 ? -67.268  75.259  -9.810  1.00 59.06  ? 1145 LYS A HB2    1 
ATOM   2585  H  HB3    . LYS A 1 183 ? -66.517  74.082  -9.055  1.00 59.06  ? 1145 LYS A HB3    1 
ATOM   2586  H  HG2    . LYS A 1 183 ? -64.675  75.544  -8.766  1.00 64.07  ? 1145 LYS A HG2    1 
ATOM   2587  H  HG3    . LYS A 1 183 ? -65.586  76.715  -9.342  1.00 64.07  ? 1145 LYS A HG3    1 
ATOM   2588  H  HD2    . LYS A 1 183 ? -66.995  76.578  -7.549  1.00 67.37  ? 1145 LYS A HD2    1 
ATOM   2589  H  HD3    . LYS A 1 183 ? -66.261  75.267  -7.021  1.00 67.37  ? 1145 LYS A HD3    1 
ATOM   2590  H  HE2    . LYS A 1 183 ? -64.332  76.551  -6.617  1.00 69.44  ? 1145 LYS A HE2    1 
ATOM   2591  H  HE3    . LYS A 1 183 ? -65.135  77.853  -7.056  1.00 69.44  ? 1145 LYS A HE3    1 
ATOM   2592  H  HZ1    . LYS A 1 183 ? -65.117  77.654  -4.797  1.00 76.60  ? 1145 LYS A HZ1    1 
ATOM   2593  H  HZ2    . LYS A 1 183 ? -66.486  77.540  -5.257  1.00 76.60  ? 1145 LYS A HZ2    1 
ATOM   2594  H  HZ3    . LYS A 1 183 ? -65.755  76.355  -4.857  1.00 76.60  ? 1145 LYS A HZ3    1 
ATOM   2595  N  N      . TYR A 1 184 ? -67.541  72.968  -11.777 1.00 41.12  ? 1146 TYR A N      1 
ATOM   2596  C  CA     . TYR A 1 184 ? -68.130  71.678  -12.122 1.00 39.80  ? 1146 TYR A CA     1 
ATOM   2597  C  C      . TYR A 1 184 ? -67.289  70.940  -13.157 1.00 44.61  ? 1146 TYR A C      1 
ATOM   2598  O  O      . TYR A 1 184 ? -67.054  69.732  -13.031 1.00 41.74  ? 1146 TYR A O      1 
ATOM   2599  C  CB     . TYR A 1 184 ? -69.556  71.879  -12.637 1.00 42.39  ? 1146 TYR A CB     1 
ATOM   2600  C  CG     . TYR A 1 184 ? -70.493  72.521  -11.637 1.00 44.00  ? 1146 TYR A CG     1 
ATOM   2601  C  CD1    . TYR A 1 184 ? -70.366  72.272  -10.278 1.00 45.47  ? 1146 TYR A CD1    1 
ATOM   2602  C  CD2    . TYR A 1 184 ? -71.501  73.380  -12.051 1.00 44.94  ? 1146 TYR A CD2    1 
ATOM   2603  C  CE1    . TYR A 1 184 ? -71.217  72.852  -9.361  1.00 45.41  ? 1146 TYR A CE1    1 
ATOM   2604  C  CE2    . TYR A 1 184 ? -72.361  73.966  -11.139 1.00 46.79  ? 1146 TYR A CE2    1 
ATOM   2605  C  CZ     . TYR A 1 184 ? -72.212  73.699  -9.795  1.00 49.60  ? 1146 TYR A CZ     1 
ATOM   2606  O  OH     . TYR A 1 184 ? -73.058  74.280  -8.873  1.00 54.82  ? 1146 TYR A OH     1 
ATOM   2607  H  H      . TYR A 1 184 ? -68.068  73.640  -11.879 1.00 49.35  ? 1146 TYR A H      1 
ATOM   2608  H  HA     . TYR A 1 184 ? -68.174  71.128  -11.324 1.00 47.76  ? 1146 TYR A HA     1 
ATOM   2609  H  HB2    . TYR A 1 184 ? -69.526  72.448  -13.422 1.00 50.87  ? 1146 TYR A HB2    1 
ATOM   2610  H  HB3    . TYR A 1 184 ? -69.926  71.014  -12.874 1.00 50.87  ? 1146 TYR A HB3    1 
ATOM   2611  H  HD1    . TYR A 1 184 ? -69.697  71.699  -9.980  1.00 54.56  ? 1146 TYR A HD1    1 
ATOM   2612  H  HD2    . TYR A 1 184 ? -71.604  73.560  -12.958 1.00 53.93  ? 1146 TYR A HD2    1 
ATOM   2613  H  HE1    . TYR A 1 184 ? -71.117  72.673  -8.454  1.00 54.49  ? 1146 TYR A HE1    1 
ATOM   2614  H  HE2    . TYR A 1 184 ? -73.032  74.540  -11.430 1.00 56.15  ? 1146 TYR A HE2    1 
ATOM   2615  H  HH     . TYR A 1 184 ? -73.616  74.771  -9.265  1.00 65.79  ? 1146 TYR A HH     1 
ATOM   2616  N  N      . LEU A 1 185 ? -66.811  71.652  -14.180 1.00 45.75  ? 1147 LEU A N      1 
ATOM   2617  C  CA     . LEU A 1 185 ? -66.062  70.995  -15.247 1.00 45.54  ? 1147 LEU A CA     1 
ATOM   2618  C  C      . LEU A 1 185 ? -64.675  70.585  -14.781 1.00 44.63  ? 1147 LEU A C      1 
ATOM   2619  O  O      . LEU A 1 185 ? -64.198  69.498  -15.124 1.00 46.92  ? 1147 LEU A O      1 
ATOM   2620  C  CB     . LEU A 1 185 ? -65.965  71.912  -16.463 1.00 50.46  ? 1147 LEU A CB     1 
ATOM   2621  C  CG     . LEU A 1 185 ? -67.226  72.002  -17.317 1.00 51.68  ? 1147 LEU A CG     1 
ATOM   2622  C  CD1    . LEU A 1 185 ? -67.106  73.153  -18.289 1.00 56.73  ? 1147 LEU A CD1    1 
ATOM   2623  C  CD2    . LEU A 1 185 ? -67.458  70.694  -18.067 1.00 52.51  ? 1147 LEU A CD2    1 
ATOM   2624  H  H      . LEU A 1 185 ? -66.906  72.502  -14.278 1.00 54.90  ? 1147 LEU A H      1 
ATOM   2625  H  HA     . LEU A 1 185 ? -66.536  70.193  -15.515 1.00 54.65  ? 1147 LEU A HA     1 
ATOM   2626  H  HB2    . LEU A 1 185 ? -65.756  72.808  -16.156 1.00 60.55  ? 1147 LEU A HB2    1 
ATOM   2627  H  HB3    . LEU A 1 185 ? -65.249  71.591  -17.034 1.00 60.55  ? 1147 LEU A HB3    1 
ATOM   2628  H  HG     . LEU A 1 185 ? -67.991  72.165  -16.743 1.00 62.02  ? 1147 LEU A HG     1 
ATOM   2629  H  HD11   . LEU A 1 185 ? -67.913  73.198  -18.824 1.00 68.08  ? 1147 LEU A HD11   1 
ATOM   2630  H  HD12   . LEU A 1 185 ? -66.992  73.977  -17.790 1.00 68.08  ? 1147 LEU A HD12   1 
ATOM   2631  H  HD13   . LEU A 1 185 ? -66.337  73.004  -18.861 1.00 68.08  ? 1147 LEU A HD13   1 
ATOM   2632  H  HD21   . LEU A 1 185 ? -68.263  70.776  -18.601 1.00 63.01  ? 1147 LEU A HD21   1 
ATOM   2633  H  HD22   . LEU A 1 185 ? -66.696  70.520  -18.641 1.00 63.01  ? 1147 LEU A HD22   1 
ATOM   2634  H  HD23   . LEU A 1 185 ? -67.559  69.975  -17.423 1.00 63.01  ? 1147 LEU A HD23   1 
ATOM   2635  N  N      . CYS A 1 186 ? -64.005  71.443  -14.009 1.00 46.94  ? 1148 CYS A N      1 
ATOM   2636  C  CA     . CYS A 1 186 ? -62.685  71.091  -13.500 1.00 44.93  ? 1148 CYS A CA     1 
ATOM   2637  C  C      . CYS A 1 186 ? -62.759  69.890  -12.567 1.00 43.10  ? 1148 CYS A C      1 
ATOM   2638  O  O      . CYS A 1 186 ? -61.869  69.031  -12.577 1.00 42.67  ? 1148 CYS A O      1 
ATOM   2639  C  CB     . CYS A 1 186 ? -62.061  72.290  -12.790 1.00 48.39  ? 1148 CYS A CB     1 
ATOM   2640  S  SG     . CYS A 1 186 ? -61.529  73.598  -13.918 1.00 47.77  ? 1148 CYS A SG     1 
ATOM   2641  H  H      . CYS A 1 186 ? -64.288  72.219  -13.772 1.00 56.33  ? 1148 CYS A H      1 
ATOM   2642  H  HA     . CYS A 1 186 ? -62.112  70.854  -14.246 1.00 53.92  ? 1148 CYS A HA     1 
ATOM   2643  H  HB2    . CYS A 1 186 ? -62.714  72.670  -12.182 1.00 58.07  ? 1148 CYS A HB2    1 
ATOM   2644  H  HB3    . CYS A 1 186 ? -61.283  71.991  -12.294 1.00 58.07  ? 1148 CYS A HB3    1 
ATOM   2645  H  HG     . CYS A 1 186 ? -61.053  74.496  -13.278 1.00 57.32  ? 1148 CYS A HG     1 
ATOM   2646  N  N      . TYR A 1 187 ? -63.814  69.807  -11.751 1.00 40.35  ? 1149 TYR A N      1 
ATOM   2647  C  CA     . TYR A 1 187 ? -63.993  68.627  -10.913 1.00 39.42  ? 1149 TYR A CA     1 
ATOM   2648  C  C      . TYR A 1 187 ? -64.278  67.395  -11.761 1.00 39.98  ? 1149 TYR A C      1 
ATOM   2649  O  O      . TYR A 1 187 ? -63.712  66.323  -11.519 1.00 39.67  ? 1149 TYR A O      1 
ATOM   2650  C  CB     . TYR A 1 187 ? -65.114  68.861  -9.898  1.00 39.73  ? 1149 TYR A CB     1 
ATOM   2651  C  CG     . TYR A 1 187 ? -64.643  69.525  -8.621  1.00 41.62  ? 1149 TYR A CG     1 
ATOM   2652  C  CD1    . TYR A 1 187 ? -64.444  70.896  -8.559  1.00 41.58  ? 1149 TYR A CD1    1 
ATOM   2653  C  CD2    . TYR A 1 187 ? -64.391  68.776  -7.478  1.00 41.65  ? 1149 TYR A CD2    1 
ATOM   2654  C  CE1    . TYR A 1 187 ? -64.013  71.505  -7.394  1.00 42.21  ? 1149 TYR A CE1    1 
ATOM   2655  C  CE2    . TYR A 1 187 ? -63.957  69.376  -6.308  1.00 42.13  ? 1149 TYR A CE2    1 
ATOM   2656  C  CZ     . TYR A 1 187 ? -63.769  70.741  -6.273  1.00 42.46  ? 1149 TYR A CZ     1 
ATOM   2657  O  OH     . TYR A 1 187 ? -63.338  71.348  -5.114  1.00 46.19  ? 1149 TYR A OH     1 
ATOM   2658  H  H      . TYR A 1 187 ? -64.424  70.407  -11.668 1.00 48.42  ? 1149 TYR A H      1 
ATOM   2659  H  HA     . TYR A 1 187 ? -63.174  68.466  -10.419 1.00 47.31  ? 1149 TYR A HA     1 
ATOM   2660  H  HB2    . TYR A 1 187 ? -65.787  69.432  -10.300 1.00 47.67  ? 1149 TYR A HB2    1 
ATOM   2661  H  HB3    . TYR A 1 187 ? -65.506  68.006  -9.662  1.00 47.67  ? 1149 TYR A HB3    1 
ATOM   2662  H  HD1    . TYR A 1 187 ? -64.607  71.416  -9.312  1.00 49.89  ? 1149 TYR A HD1    1 
ATOM   2663  H  HD2    . TYR A 1 187 ? -64.517  67.854  -7.499  1.00 49.98  ? 1149 TYR A HD2    1 
ATOM   2664  H  HE1    . TYR A 1 187 ? -63.884  72.425  -7.368  1.00 50.65  ? 1149 TYR A HE1    1 
ATOM   2665  H  HE2    . TYR A 1 187 ? -63.793  68.861  -5.551  1.00 50.56  ? 1149 TYR A HE2    1 
ATOM   2666  H  HH     . TYR A 1 187 ? -63.228  70.772  -4.512  1.00 55.43  ? 1149 TYR A HH     1 
ATOM   2667  N  N      . THR A 1 188 ? -65.137  67.531  -12.773 1.00 39.35  ? 1150 THR A N      1 
ATOM   2668  C  CA     . THR A 1 188 ? -65.418  66.406  -13.656 1.00 38.67  ? 1150 THR A CA     1 
ATOM   2669  C  C      . THR A 1 188 ? -64.158  65.956  -14.386 1.00 41.58  ? 1150 THR A C      1 
ATOM   2670  O  O      . THR A 1 188 ? -63.894  64.753  -14.501 1.00 41.61  ? 1150 THR A O      1 
ATOM   2671  C  CB     . THR A 1 188 ? -66.516  66.789  -14.648 1.00 39.04  ? 1150 THR A CB     1 
ATOM   2672  O  OG1    . THR A 1 188 ? -67.685  67.198  -13.929 1.00 38.80  ? 1150 THR A OG1    1 
ATOM   2673  C  CG2    . THR A 1 188 ? -66.871  65.619  -15.549 1.00 37.85  ? 1150 THR A CG2    1 
ATOM   2674  H  H      . THR A 1 188 ? -65.562  68.254  -12.966 1.00 47.22  ? 1150 THR A H      1 
ATOM   2675  H  HA     . THR A 1 188 ? -65.740  65.660  -13.126 1.00 46.40  ? 1150 THR A HA     1 
ATOM   2676  H  HB     . THR A 1 188 ? -66.207  67.522  -15.204 1.00 46.85  ? 1150 THR A HB     1 
ATOM   2677  H  HG1    . THR A 1 188 ? -67.508  67.860  -13.443 1.00 46.56  ? 1150 THR A HG1    1 
ATOM   2678  H  HG21   . THR A 1 188 ? -67.568  65.879  -16.172 1.00 45.42  ? 1150 THR A HG21   1 
ATOM   2679  H  HG22   . THR A 1 188 ? -66.090  65.337  -16.051 1.00 45.42  ? 1150 THR A HG22   1 
ATOM   2680  H  HG23   . THR A 1 188 ? -67.188  64.874  -15.015 1.00 45.42  ? 1150 THR A HG23   1 
ATOM   2681  N  N      . MET A 1 189 ? -63.368  66.908  -14.890 1.00 41.01  ? 1151 MET A N      1 
ATOM   2682  C  CA     . MET A 1 189 ? -62.108  66.554  -15.537 1.00 38.39  ? 1151 MET A CA     1 
ATOM   2683  C  C      . MET A 1 189 ? -61.178  65.832  -14.569 1.00 39.32  ? 1151 MET A C      1 
ATOM   2684  O  O      . MET A 1 189 ? -60.522  64.851  -14.938 1.00 36.80  ? 1151 MET A O      1 
ATOM   2685  C  CB     . MET A 1 189 ? -61.437  67.810  -16.089 1.00 36.38  ? 1151 MET A CB     1 
ATOM   2686  C  CG     . MET A 1 189 ? -60.073  67.573  -16.722 1.00 41.37  ? 1151 MET A CG     1 
ATOM   2687  S  SD     . MET A 1 189 ? -60.153  66.568  -18.216 1.00 49.94  ? 1151 MET A SD     1 
ATOM   2688  C  CE     . MET A 1 189 ? -59.847  67.806  -19.465 1.00 45.25  ? 1151 MET A CE     1 
ATOM   2689  H  H      . MET A 1 189 ? -63.536  67.751  -14.869 1.00 49.21  ? 1151 MET A H      1 
ATOM   2690  H  HA     . MET A 1 189 ? -62.297  65.966  -16.285 1.00 46.06  ? 1151 MET A HA     1 
ATOM   2691  H  HB2    . MET A 1 189 ? -62.012  68.196  -16.768 1.00 43.66  ? 1151 MET A HB2    1 
ATOM   2692  H  HB3    . MET A 1 189 ? -61.318  68.443  -15.364 1.00 43.66  ? 1151 MET A HB3    1 
ATOM   2693  H  HG2    . MET A 1 189 ? -59.682  68.429  -16.958 1.00 49.64  ? 1151 MET A HG2    1 
ATOM   2694  H  HG3    . MET A 1 189 ? -59.505  67.115  -16.083 1.00 49.64  ? 1151 MET A HG3    1 
ATOM   2695  H  HE1    . MET A 1 189 ? -59.863  67.385  -20.338 1.00 54.30  ? 1151 MET A HE1    1 
ATOM   2696  H  HE2    . MET A 1 189 ? -60.537  68.486  -19.411 1.00 54.30  ? 1151 MET A HE2    1 
ATOM   2697  H  HE3    . MET A 1 189 ? -58.977  68.205  -19.306 1.00 54.30  ? 1151 MET A HE3    1 
ATOM   2698  N  N      . LYS A 1 190 ? -61.112  66.300  -13.320 1.00 44.57  ? 1152 LYS A N      1 
ATOM   2699  C  CA     . LYS A 1 190 ? -60.227  65.678  -12.341 1.00 45.68  ? 1152 LYS A CA     1 
ATOM   2700  C  C      . LYS A 1 190 ? -60.677  64.258  -12.015 1.00 42.26  ? 1152 LYS A C      1 
ATOM   2701  O  O      . LYS A 1 190 ? -59.845  63.356  -11.867 1.00 40.39  ? 1152 LYS A O      1 
ATOM   2702  C  CB     . LYS A 1 190 ? -60.171  66.533  -11.076 1.00 45.65  ? 1152 LYS A CB     1 
ATOM   2703  C  CG     . LYS A 1 190 ? -58.990  66.230  -10.169 1.00 48.70  ? 1152 LYS A CG     1 
ATOM   2704  C  CD     . LYS A 1 190 ? -58.848  67.287  -9.078  1.00 52.70  ? 1152 LYS A CD     1 
ATOM   2705  C  CE     . LYS A 1 190 ? -57.758  68.296  -9.410  1.00 52.64  ? 1152 LYS A CE     1 
ATOM   2706  N  NZ     . LYS A 1 190 ? -57.681  69.389  -8.395  1.00 53.86  1 1152 LYS A NZ     1 
ATOM   2707  H  H      . LYS A 1 190 ? -61.564  66.967  -13.021 1.00 53.48  ? 1152 LYS A H      1 
ATOM   2708  H  HA     . LYS A 1 190 ? -59.331  65.631  -12.710 1.00 54.81  ? 1152 LYS A HA     1 
ATOM   2709  H  HB2    . LYS A 1 190 ? -60.113  67.467  -11.333 1.00 54.78  ? 1152 LYS A HB2    1 
ATOM   2710  H  HB3    . LYS A 1 190 ? -60.982  66.384  -10.564 1.00 54.78  ? 1152 LYS A HB3    1 
ATOM   2711  H  HG2    . LYS A 1 190 ? -59.125  65.369  -9.743  1.00 58.44  ? 1152 LYS A HG2    1 
ATOM   2712  H  HG3    . LYS A 1 190 ? -58.175  66.222  -10.695 1.00 58.44  ? 1152 LYS A HG3    1 
ATOM   2713  H  HD2    . LYS A 1 190 ? -59.686  67.766  -8.986  1.00 63.24  ? 1152 LYS A HD2    1 
ATOM   2714  H  HD3    . LYS A 1 190 ? -58.616  66.854  -8.242  1.00 63.24  ? 1152 LYS A HD3    1 
ATOM   2715  H  HE2    . LYS A 1 190 ? -56.901  67.843  -9.433  1.00 63.17  ? 1152 LYS A HE2    1 
ATOM   2716  H  HE3    . LYS A 1 190 ? -57.947  68.698  -10.272 1.00 63.17  ? 1152 LYS A HE3    1 
ATOM   2717  H  HZ1    . LYS A 1 190 ? -57.036  69.962  -8.614  1.00 64.64  ? 1152 LYS A HZ1    1 
ATOM   2718  H  HZ2    . LYS A 1 190 ? -58.456  69.824  -8.357  1.00 64.64  ? 1152 LYS A HZ2    1 
ATOM   2719  H  HZ3    . LYS A 1 190 ? -57.502  69.046  -7.593  1.00 64.64  ? 1152 LYS A HZ3    1 
ATOM   2720  N  N      . VAL A 1 191 ? -61.988  64.037  -11.905 1.00 37.14  ? 1153 VAL A N      1 
ATOM   2721  C  CA     . VAL A 1 191 ? -62.494  62.680  -11.716 1.00 37.57  ? 1153 VAL A CA     1 
ATOM   2722  C  C      . VAL A 1 191 ? -62.139  61.817  -12.921 1.00 41.98  ? 1153 VAL A C      1 
ATOM   2723  O  O      . VAL A 1 191 ? -61.639  60.694  -12.781 1.00 38.15  ? 1153 VAL A O      1 
ATOM   2724  C  CB     . VAL A 1 191 ? -64.014  62.701  -11.468 1.00 38.03  ? 1153 VAL A CB     1 
ATOM   2725  C  CG1    . VAL A 1 191 ? -64.583  61.282  -11.460 1.00 41.37  ? 1153 VAL A CG1    1 
ATOM   2726  C  CG2    . VAL A 1 191 ? -64.339  63.410  -10.149 1.00 40.25  ? 1153 VAL A CG2    1 
ATOM   2727  H  H      . VAL A 1 191 ? -62.595  64.645  -11.937 1.00 44.57  ? 1153 VAL A H      1 
ATOM   2728  H  HA     . VAL A 1 191 ? -62.069  62.291  -10.935 1.00 45.09  ? 1153 VAL A HA     1 
ATOM   2729  H  HB     . VAL A 1 191 ? -64.444  63.193  -12.186 1.00 45.63  ? 1153 VAL A HB     1 
ATOM   2730  H  HG11   . VAL A 1 191 ? -65.539  61.327  -11.302 1.00 49.64  ? 1153 VAL A HG11   1 
ATOM   2731  H  HG12   . VAL A 1 191 ? -64.409  60.868  -12.319 1.00 49.64  ? 1153 VAL A HG12   1 
ATOM   2732  H  HG13   . VAL A 1 191 ? -64.154  60.774  -10.754 1.00 49.64  ? 1153 VAL A HG13   1 
ATOM   2733  H  HG21   . VAL A 1 191 ? -65.300  63.409  -10.018 1.00 48.30  ? 1153 VAL A HG21   1 
ATOM   2734  H  HG22   . VAL A 1 191 ? -63.905  62.936  -9.422  1.00 48.30  ? 1153 VAL A HG22   1 
ATOM   2735  H  HG23   . VAL A 1 191 ? -64.011  64.322  -10.192 1.00 48.30  ? 1153 VAL A HG23   1 
ATOM   2736  N  N      . PHE A 1 192 ? -62.389  62.338  -14.125 1.00 37.97  ? 1154 PHE A N      1 
ATOM   2737  C  CA     . PHE A 1 192 ? -62.169  61.562  -15.339 1.00 35.80  ? 1154 PHE A CA     1 
ATOM   2738  C  C      . PHE A 1 192 ? -60.725  61.089  -15.439 1.00 35.31  ? 1154 PHE A C      1 
ATOM   2739  O  O      . PHE A 1 192 ? -60.461  59.892  -15.595 1.00 32.92  ? 1154 PHE A O      1 
ATOM   2740  C  CB     . PHE A 1 192 ? -62.548  62.403  -16.559 1.00 37.02  ? 1154 PHE A CB     1 
ATOM   2741  C  CG     . PHE A 1 192 ? -62.394  61.681  -17.867 1.00 34.26  ? 1154 PHE A CG     1 
ATOM   2742  C  CD1    . PHE A 1 192 ? -63.384  60.825  -18.322 1.00 37.44  ? 1154 PHE A CD1    1 
ATOM   2743  C  CD2    . PHE A 1 192 ? -61.267  61.864  -18.646 1.00 31.52  ? 1154 PHE A CD2    1 
ATOM   2744  C  CE1    . PHE A 1 192 ? -63.247  60.161  -19.528 1.00 36.00  ? 1154 PHE A CE1    1 
ATOM   2745  C  CE2    . PHE A 1 192 ? -61.127  61.202  -19.856 1.00 37.88  ? 1154 PHE A CE2    1 
ATOM   2746  C  CZ     . PHE A 1 192 ? -62.118  60.350  -20.294 1.00 34.37  ? 1154 PHE A CZ     1 
ATOM   2747  H  H      . PHE A 1 192 ? -62.685  63.134  -14.262 1.00 45.56  ? 1154 PHE A H      1 
ATOM   2748  H  HA     . PHE A 1 192 ? -62.742  60.780  -15.323 1.00 42.96  ? 1154 PHE A HA     1 
ATOM   2749  H  HB2    . PHE A 1 192 ? -63.476  62.672  -16.477 1.00 44.43  ? 1154 PHE A HB2    1 
ATOM   2750  H  HB3    . PHE A 1 192 ? -61.979  63.188  -16.586 1.00 44.43  ? 1154 PHE A HB3    1 
ATOM   2751  H  HD1    . PHE A 1 192 ? -64.148  60.692  -17.809 1.00 44.93  ? 1154 PHE A HD1    1 
ATOM   2752  H  HD2    . PHE A 1 192 ? -60.595  62.438  -18.355 1.00 37.83  ? 1154 PHE A HD2    1 
ATOM   2753  H  HE1    . PHE A 1 192 ? -63.917  59.587  -19.822 1.00 43.20  ? 1154 PHE A HE1    1 
ATOM   2754  H  HE2    . PHE A 1 192 ? -60.364  61.330  -20.371 1.00 45.45  ? 1154 PHE A HE2    1 
ATOM   2755  H  HZ     . PHE A 1 192 ? -62.024  59.905  -21.105 1.00 41.24  ? 1154 PHE A HZ     1 
ATOM   2756  N  N      . THR A 1 193 ? -59.771  62.017  -15.343 1.00 32.72  ? 1155 THR A N      1 
ATOM   2757  C  CA     . THR A 1 193 ? -58.374  61.638  -15.515 1.00 38.50  ? 1155 THR A CA     1 
ATOM   2758  C  C      . THR A 1 193 ? -57.884  60.768  -14.367 1.00 45.99  ? 1155 THR A C      1 
ATOM   2759  O  O      . THR A 1 193 ? -57.057  59.872  -14.579 1.00 43.01  ? 1155 THR A O      1 
ATOM   2760  C  CB     . THR A 1 193 ? -57.500  62.888  -15.649 1.00 41.17  ? 1155 THR A CB     1 
ATOM   2761  O  OG1    . THR A 1 193 ? -57.688  63.741  -14.513 1.00 40.90  ? 1155 THR A OG1    1 
ATOM   2762  C  CG2    . THR A 1 193 ? -57.864  63.649  -16.917 1.00 44.76  ? 1155 THR A CG2    1 
ATOM   2763  H  H      . THR A 1 193 ? -59.904  62.851  -15.182 1.00 39.26  ? 1155 THR A H      1 
ATOM   2764  H  HA     . THR A 1 193 ? -58.287  61.126  -16.334 1.00 46.20  ? 1155 THR A HA     1 
ATOM   2765  H  HB     . THR A 1 193 ? -56.568  62.625  -15.705 1.00 49.41  ? 1155 THR A HB     1 
ATOM   2766  H  HG1    . THR A 1 193 ? -58.492  63.975  -14.459 1.00 49.08  ? 1155 THR A HG1    1 
ATOM   2767  H  HG21   . THR A 1 193 ? -57.309  64.440  -16.999 1.00 53.72  ? 1155 THR A HG21   1 
ATOM   2768  H  HG22   . THR A 1 193 ? -57.725  63.084  -17.693 1.00 53.72  ? 1155 THR A HG22   1 
ATOM   2769  H  HG23   . THR A 1 193 ? -58.795  63.918  -16.886 1.00 53.72  ? 1155 THR A HG23   1 
ATOM   2770  N  N      . LYS A 1 194 ? -58.392  61.000  -13.154 1.00 44.32  ? 1156 LYS A N      1 
ATOM   2771  C  CA     . LYS A 1 194 ? -58.027  60.149  -12.029 1.00 45.58  ? 1156 LYS A CA     1 
ATOM   2772  C  C      . LYS A 1 194 ? -58.536  58.727  -12.239 1.00 43.48  ? 1156 LYS A C      1 
ATOM   2773  O  O      . LYS A 1 194 ? -57.827  57.758  -11.944 1.00 44.01  ? 1156 LYS A O      1 
ATOM   2774  C  CB     . LYS A 1 194 ? -58.563  60.746  -10.729 1.00 50.64  ? 1156 LYS A CB     1 
ATOM   2775  C  CG     . LYS A 1 194 ? -58.002  60.096  -9.473  1.00 59.10  ? 1156 LYS A CG     1 
ATOM   2776  C  CD     . LYS A 1 194 ? -58.435  60.823  -8.198  1.00 63.17  ? 1156 LYS A CD     1 
ATOM   2777  C  CE     . LYS A 1 194 ? -57.927  62.261  -8.128  1.00 63.33  ? 1156 LYS A CE     1 
ATOM   2778  N  NZ     . LYS A 1 194 ? -56.441  62.334  -8.082  1.00 65.21  1 1156 LYS A NZ     1 
ATOM   2779  H  H      . LYS A 1 194 ? -58.940  61.634  -12.962 1.00 53.19  ? 1156 LYS A H      1 
ATOM   2780  H  HA     . LYS A 1 194 ? -57.060  60.112  -11.963 1.00 54.70  ? 1156 LYS A HA     1 
ATOM   2781  H  HB2    . LYS A 1 194 ? -58.336  61.688  -10.701 1.00 60.77  ? 1156 LYS A HB2    1 
ATOM   2782  H  HB3    . LYS A 1 194 ? -59.527  60.640  -10.711 1.00 60.77  ? 1156 LYS A HB3    1 
ATOM   2783  H  HG2    . LYS A 1 194 ? -58.320  59.181  -9.420  1.00 70.92  ? 1156 LYS A HG2    1 
ATOM   2784  H  HG3    . LYS A 1 194 ? -57.033  60.110  -9.513  1.00 70.92  ? 1156 LYS A HG3    1 
ATOM   2785  H  HD2    . LYS A 1 194 ? -59.404  60.846  -8.162  1.00 75.81  ? 1156 LYS A HD2    1 
ATOM   2786  H  HD3    . LYS A 1 194 ? -58.087  60.345  -7.429  1.00 75.81  ? 1156 LYS A HD3    1 
ATOM   2787  H  HE2    . LYS A 1 194 ? -58.229  62.742  -8.914  1.00 76.00  ? 1156 LYS A HE2    1 
ATOM   2788  H  HE3    . LYS A 1 194 ? -58.274  62.681  -7.326  1.00 76.00  ? 1156 LYS A HE3    1 
ATOM   2789  H  HZ1    . LYS A 1 194 ? -56.180  63.183  -8.042  1.00 78.25  ? 1156 LYS A HZ1    1 
ATOM   2790  H  HZ2    . LYS A 1 194 ? -56.137  61.903  -7.365  1.00 78.25  ? 1156 LYS A HZ2    1 
ATOM   2791  H  HZ3    . LYS A 1 194 ? -56.096  61.959  -8.812  1.00 78.25  ? 1156 LYS A HZ3    1 
ATOM   2792  N  N      . MET A 1 195 ? -59.770  58.580  -12.729 1.00 40.48  ? 1157 MET A N      1 
ATOM   2793  C  CA     . MET A 1 195 ? -60.311  57.247  -12.974 1.00 42.59  ? 1157 MET A CA     1 
ATOM   2794  C  C      . MET A 1 195 ? -59.579  56.547  -14.114 1.00 44.79  ? 1157 MET A C      1 
ATOM   2795  O  O      . MET A 1 195 ? -59.493  55.313  -14.127 1.00 43.21  ? 1157 MET A O      1 
ATOM   2796  C  CB     . MET A 1 195 ? -61.805  57.334  -13.283 1.00 43.17  ? 1157 MET A CB     1 
ATOM   2797  C  CG     . MET A 1 195 ? -62.652  57.816  -12.117 1.00 44.53  ? 1157 MET A CG     1 
ATOM   2798  S  SD     . MET A 1 195 ? -62.524  56.781  -10.647 1.00 45.49  ? 1157 MET A SD     1 
ATOM   2799  C  CE     . MET A 1 195 ? -63.102  55.207  -11.267 1.00 43.66  ? 1157 MET A CE     1 
ATOM   2800  H  H      . MET A 1 195 ? -60.304  59.226  -12.924 1.00 48.58  ? 1157 MET A H      1 
ATOM   2801  H  HA     . MET A 1 195 ? -60.207  56.718  -12.168 1.00 51.11  ? 1157 MET A HA     1 
ATOM   2802  H  HB2    . MET A 1 195 ? -61.936  57.952  -14.019 1.00 51.80  ? 1157 MET A HB2    1 
ATOM   2803  H  HB3    . MET A 1 195 ? -62.122  56.452  -13.534 1.00 51.80  ? 1157 MET A HB3    1 
ATOM   2804  H  HG2    . MET A 1 195 ? -62.369  58.711  -11.874 1.00 53.44  ? 1157 MET A HG2    1 
ATOM   2805  H  HG3    . MET A 1 195 ? -63.583  57.828  -12.390 1.00 53.44  ? 1157 MET A HG3    1 
ATOM   2806  H  HE1    . MET A 1 195 ? -63.077  54.557  -10.547 1.00 52.39  ? 1157 MET A HE1    1 
ATOM   2807  H  HE2    . MET A 1 195 ? -64.011  55.310  -11.589 1.00 52.39  ? 1157 MET A HE2    1 
ATOM   2808  H  HE3    . MET A 1 195 ? -62.524  54.922  -11.992 1.00 52.39  ? 1157 MET A HE3    1 
ATOM   2809  N  N      . CYS A 1 196 ? -59.047  57.306  -15.074 1.00 44.38  ? 1158 CYS A N      1 
ATOM   2810  C  CA     . CYS A 1 196 ? -58.243  56.717  -16.137 1.00 48.66  ? 1158 CYS A CA     1 
ATOM   2811  C  C      . CYS A 1 196 ? -56.789  56.535  -15.729 1.00 48.39  ? 1158 CYS A C      1 
ATOM   2812  O  O      . CYS A 1 196 ? -56.023  55.924  -16.482 1.00 47.92  ? 1158 CYS A O      1 
ATOM   2813  C  CB     . CYS A 1 196 ? -58.310  57.576  -17.401 1.00 42.45  ? 1158 CYS A CB     1 
ATOM   2814  S  SG     . CYS A 1 196 ? -59.945  57.659  -18.146 1.00 43.06  ? 1158 CYS A SG     1 
ATOM   2815  H  H      . CYS A 1 196 ? -59.139  58.159  -15.130 1.00 53.25  ? 1158 CYS A H      1 
ATOM   2816  H  HA     . CYS A 1 196 ? -58.602  55.842  -16.352 1.00 58.39  ? 1158 CYS A HA     1 
ATOM   2817  H  HB2    . CYS A 1 196 ? -58.041  58.481  -17.177 1.00 50.94  ? 1158 CYS A HB2    1 
ATOM   2818  H  HB3    . CYS A 1 196 ? -57.703  57.208  -18.061 1.00 50.94  ? 1158 CYS A HB3    1 
ATOM   2819  H  HG     . CYS A 1 196 ? -60.713  58.128  -17.352 1.00 51.67  ? 1158 CYS A HG     1 
ATOM   2820  N  N      . ASP A 1 197 ? -56.396  57.051  -14.565 1.00 44.42  ? 1159 ASP A N      1 
ATOM   2821  C  CA     . ASP A 1 197 ? -55.038  56.882  -14.051 1.00 48.22  ? 1159 ASP A CA     1 
ATOM   2822  C  C      . ASP A 1 197 ? -54.014  57.562  -14.960 1.00 44.47  ? 1159 ASP A C      1 
ATOM   2823  O  O      . ASP A 1 197 ? -52.952  57.010  -15.251 1.00 45.07  ? 1159 ASP A O      1 
ATOM   2824  C  CB     . ASP A 1 197 ? -54.716  55.396  -13.877 1.00 48.77  ? 1159 ASP A CB     1 
ATOM   2825  C  CG     . ASP A 1 197 ? -53.640  55.147  -12.847 1.00 49.42  ? 1159 ASP A CG     1 
ATOM   2826  O  OD1    . ASP A 1 197 ? -53.528  55.952  -11.897 1.00 51.42  ? 1159 ASP A OD1    1 
ATOM   2827  O  OD2    . ASP A 1 197 ? -52.919  54.133  -12.975 1.00 51.41  1 1159 ASP A OD2    1 
ATOM   2828  H  H      . ASP A 1 197 ? -56.906  57.510  -14.047 1.00 53.30  ? 1159 ASP A H      1 
ATOM   2829  H  HA     . ASP A 1 197 ? -54.982  57.301  -13.178 1.00 57.87  ? 1159 ASP A HA     1 
ATOM   2830  H  HB2    . ASP A 1 197 ? -55.518  54.930  -13.591 1.00 58.53  ? 1159 ASP A HB2    1 
ATOM   2831  H  HB3    . ASP A 1 197 ? -54.409  55.038  -14.724 1.00 58.53  ? 1159 ASP A HB3    1 
ATOM   2832  N  N      . ILE A 1 198 ? -54.324  58.788  -15.382 1.00 41.15  ? 1160 ILE A N      1 
ATOM   2833  C  CA     . ILE A 1 198 ? -53.461  59.545  -16.283 1.00 46.04  ? 1160 ILE A CA     1 
ATOM   2834  C  C      . ILE A 1 198 ? -53.181  60.925  -15.701 1.00 45.88  ? 1160 ILE A C      1 
ATOM   2835  O  O      . ILE A 1 198 ? -52.797  61.849  -16.427 1.00 43.65  ? 1160 ILE A O      1 
ATOM   2836  C  CB     . ILE A 1 198 ? -54.094  59.660  -17.684 1.00 45.19  ? 1160 ILE A CB     1 
ATOM   2837  C  CG1    . ILE A 1 198 ? -55.474  60.319  -17.595 1.00 42.85  ? 1160 ILE A CG1    1 
ATOM   2838  C  CG2    . ILE A 1 198 ? -54.206  58.283  -18.326 1.00 47.71  ? 1160 ILE A CG2    1 
ATOM   2839  C  CD1    . ILE A 1 198 ? -56.100  60.636  -18.935 1.00 46.19  ? 1160 ILE A CD1    1 
ATOM   2840  H  H      . ILE A 1 198 ? -55.040  59.207  -15.155 1.00 49.38  ? 1160 ILE A H      1 
ATOM   2841  H  HA     . ILE A 1 198 ? -52.615  59.080  -16.374 1.00 55.25  ? 1160 ILE A HA     1 
ATOM   2842  H  HB     . ILE A 1 198 ? -53.521  60.214  -18.237 1.00 54.23  ? 1160 ILE A HB     1 
ATOM   2843  H  HG12   . ILE A 1 198 ? -56.075  59.721  -17.123 1.00 51.42  ? 1160 ILE A HG12   1 
ATOM   2844  H  HG13   . ILE A 1 198 ? -55.390  61.152  -17.105 1.00 51.42  ? 1160 ILE A HG13   1 
ATOM   2845  H  HG21   . ILE A 1 198 ? -54.606  58.377  -19.205 1.00 57.25  ? 1160 ILE A HG21   1 
ATOM   2846  H  HG22   . ILE A 1 198 ? -53.319  57.898  -18.405 1.00 57.25  ? 1160 ILE A HG22   1 
ATOM   2847  H  HG23   . ILE A 1 198 ? -54.763  57.719  -17.767 1.00 57.25  ? 1160 ILE A HG23   1 
ATOM   2848  H  HD11   . ILE A 1 198 ? -56.966  61.048  -18.789 1.00 55.43  ? 1160 ILE A HD11   1 
ATOM   2849  H  HD12   . ILE A 1 198 ? -55.520  61.246  -19.417 1.00 55.43  ? 1160 ILE A HD12   1 
ATOM   2850  H  HD13   . ILE A 1 198 ? -56.206  59.812  -19.436 1.00 55.43  ? 1160 ILE A HD13   1 
ATOM   2851  N  N      . GLY A 1 199 ? -53.354  61.071  -14.389 1.00 47.01  ? 1161 GLY A N      1 
ATOM   2852  C  CA     . GLY A 1 199 ? -53.187  62.359  -13.745 1.00 44.87  ? 1161 GLY A CA     1 
ATOM   2853  C  C      . GLY A 1 199 ? -52.099  62.376  -12.690 1.00 45.20  ? 1161 GLY A C      1 
ATOM   2854  O  O      . GLY A 1 199 ? -52.262  63.009  -11.644 1.00 46.01  ? 1161 GLY A O      1 
ATOM   2855  H  H      . GLY A 1 199 ? -53.569  60.434  -13.852 1.00 56.41  ? 1161 GLY A H      1 
ATOM   2856  H  HA2    . GLY A 1 199 ? -52.969  63.025  -14.416 1.00 53.85  ? 1161 GLY A HA2    1 
ATOM   2857  H  HA3    . GLY A 1 199 ? -54.022  62.615  -13.323 1.00 53.85  ? 1161 GLY A HA3    1 
ATOM   2858  N  N      . ASP A 1 200 ? -50.981  61.697  -12.954 1.00 44.16  ? 1162 ASP A N      1 
ATOM   2859  C  CA     . ASP A 1 200 ? -49.865  61.630  -12.010 1.00 40.34  ? 1162 ASP A CA     1 
ATOM   2860  C  C      . ASP A 1 200 ? -48.565  61.847  -12.780 1.00 40.14  ? 1162 ASP A C      1 
ATOM   2861  O  O      . ASP A 1 200 ? -48.018  60.905  -13.363 1.00 40.16  ? 1162 ASP A O      1 
ATOM   2862  C  CB     . ASP A 1 200 ? -49.853  60.293  -11.283 1.00 40.61  ? 1162 ASP A CB     1 
ATOM   2863  C  CG     . ASP A 1 200 ? -48.906  60.279  -10.104 1.00 43.10  ? 1162 ASP A CG     1 
ATOM   2864  O  OD1    . ASP A 1 200 ? -48.038  61.176  -10.014 1.00 40.44  ? 1162 ASP A OD1    1 
ATOM   2865  O  OD2    . ASP A 1 200 ? -49.028  59.358  -9.271  1.00 47.95  1 1162 ASP A OD2    1 
ATOM   2866  H  H      . ASP A 1 200 ? -50.844  61.262  -13.683 1.00 52.99  ? 1162 ASP A H      1 
ATOM   2867  H  HA     . ASP A 1 200 ? -49.954  62.338  -11.352 1.00 48.40  ? 1162 ASP A HA     1 
ATOM   2868  H  HB2    . ASP A 1 200 ? -50.746  60.104  -10.954 1.00 48.73  ? 1162 ASP A HB2    1 
ATOM   2869  H  HB3    . ASP A 1 200 ? -49.573  59.600  -11.901 1.00 48.73  ? 1162 ASP A HB3    1 
ATOM   2870  N  N      . ALA A 1 201 ? -48.046  63.074  -12.734 1.00 41.46  ? 1163 ALA A N      1 
ATOM   2871  C  CA     . ALA A 1 201 ? -46.806  63.378  -13.442 1.00 41.04  ? 1163 ALA A CA     1 
ATOM   2872  C  C      . ALA A 1 201 ? -45.630  62.581  -12.891 1.00 43.66  ? 1163 ALA A C      1 
ATOM   2873  O  O      . ALA A 1 201 ? -44.669  62.309  -13.621 1.00 43.74  ? 1163 ALA A O      1 
ATOM   2874  C  CB     . ALA A 1 201 ? -46.515  64.877  -13.370 1.00 39.60  ? 1163 ALA A CB     1 
ATOM   2875  H  H      . ALA A 1 201 ? -48.386  63.738  -12.306 1.00 49.75  ? 1163 ALA A H      1 
ATOM   2876  H  HA     . ALA A 1 201 ? -46.913  63.141  -14.376 1.00 49.24  ? 1163 ALA A HA     1 
ATOM   2877  H  HB1    . ALA A 1 201 ? -45.690  65.062  -13.844 1.00 47.52  ? 1163 ALA A HB1    1 
ATOM   2878  H  HB2    . ALA A 1 201 ? -47.249  65.361  -13.781 1.00 47.52  ? 1163 ALA A HB2    1 
ATOM   2879  H  HB3    . ALA A 1 201 ? -46.428  65.137  -12.439 1.00 47.52  ? 1163 ALA A HB3    1 
ATOM   2880  N  N      . SER A 1 202 ? -45.682  62.199  -11.612 1.00 44.50  ? 1164 SER A N      1 
ATOM   2881  C  CA     . SER A 1 202 ? -44.612  61.401  -11.026 1.00 45.44  ? 1164 SER A CA     1 
ATOM   2882  C  C      . SER A 1 202 ? -44.588  59.974  -11.557 1.00 45.18  ? 1164 SER A C      1 
ATOM   2883  O  O      . SER A 1 202 ? -43.609  59.259  -11.319 1.00 43.21  ? 1164 SER A O      1 
ATOM   2884  C  CB     . SER A 1 202 ? -44.743  61.385  -9.498  1.00 45.02  ? 1164 SER A CB     1 
ATOM   2885  O  OG     . SER A 1 202 ? -45.849  60.600  -9.086  1.00 46.41  ? 1164 SER A OG     1 
ATOM   2886  H  H      . SER A 1 202 ? -46.322  62.389  -11.070 1.00 53.40  ? 1164 SER A H      1 
ATOM   2887  H  HA     . SER A 1 202 ? -43.761  61.812  -11.245 1.00 54.52  ? 1164 SER A HA     1 
ATOM   2888  H  HB2    . SER A 1 202 ? -43.933  61.011  -9.117  1.00 54.02  ? 1164 SER A HB2    1 
ATOM   2889  H  HB3    . SER A 1 202 ? -44.868  62.294  -9.183  1.00 54.02  ? 1164 SER A HB3    1 
ATOM   2890  H  HG     . SER A 1 202 ? -46.559  60.913  -9.408  1.00 55.70  ? 1164 SER A HG     1 
ATOM   2891  N  N      . ARG A 1 203 ? -45.633  59.544  -12.262 1.00 51.40  ? 1165 ARG A N      1 
ATOM   2892  C  CA     . ARG A 1 203 ? -45.665  58.230  -12.889 1.00 56.05  ? 1165 ARG A CA     1 
ATOM   2893  C  C      . ARG A 1 203 ? -45.660  58.312  -14.412 1.00 51.51  ? 1165 ARG A C      1 
ATOM   2894  O  O      . ARG A 1 203 ? -45.908  57.301  -15.077 1.00 52.98  ? 1165 ARG A O      1 
ATOM   2895  C  CB     . ARG A 1 203 ? -46.887  57.444  -12.403 1.00 57.31  ? 1165 ARG A CB     1 
ATOM   2896  C  CG     . ARG A 1 203 ? -46.879  57.179  -10.904 1.00 60.77  ? 1165 ARG A CG     1 
ATOM   2897  C  CD     . ARG A 1 203 ? -48.013  56.263  -10.475 1.00 62.06  ? 1165 ARG A CD     1 
ATOM   2898  N  NE     . ARG A 1 203 ? -48.247  56.340  -9.034  1.00 67.31  ? 1165 ARG A NE     1 
ATOM   2899  C  CZ     . ARG A 1 203 ? -47.682  55.548  -8.124  1.00 70.67  ? 1165 ARG A CZ     1 
ATOM   2900  N  NH1    . ARG A 1 203 ? -46.838  54.589  -8.484  1.00 72.10  1 1165 ARG A NH1    1 
ATOM   2901  N  NH2    . ARG A 1 203 ? -47.968  55.715  -6.838  1.00 68.31  ? 1165 ARG A NH2    1 
ATOM   2902  H  H      . ARG A 1 203 ? -46.347  60.006  -12.393 1.00 61.68  ? 1165 ARG A H      1 
ATOM   2903  H  HA     . ARG A 1 203 ? -44.873  57.739  -12.619 1.00 67.26  ? 1165 ARG A HA     1 
ATOM   2904  H  HB2    . ARG A 1 203 ? -47.688  57.949  -12.612 1.00 68.77  ? 1165 ARG A HB2    1 
ATOM   2905  H  HB3    . ARG A 1 203 ? -46.909  56.587  -12.856 1.00 68.77  ? 1165 ARG A HB3    1 
ATOM   2906  H  HG2    . ARG A 1 203 ? -46.041  56.756  -10.661 1.00 72.93  ? 1165 ARG A HG2    1 
ATOM   2907  H  HG3    . ARG A 1 203 ? -46.977  58.021  -10.433 1.00 72.93  ? 1165 ARG A HG3    1 
ATOM   2908  H  HD2    . ARG A 1 203 ? -48.828  56.527  -10.929 1.00 74.47  ? 1165 ARG A HD2    1 
ATOM   2909  H  HD3    . ARG A 1 203 ? -47.787  55.346  -10.697 1.00 74.47  ? 1165 ARG A HD3    1 
ATOM   2910  H  HE     . ARG A 1 203 ? -48.791  56.943  -8.753  1.00 80.77  ? 1165 ARG A HE     1 
ATOM   2911  H  HH11   . ARG A 1 203 ? -46.646  54.474  -9.314  1.00 86.52  ? 1165 ARG A HH11   1 
ATOM   2912  H  HH12   . ARG A 1 203 ? -46.481  54.084  -7.886  1.00 86.52  ? 1165 ARG A HH12   1 
ATOM   2913  H  HH21   . ARG A 1 203 ? -48.515  56.333  -6.596  1.00 81.98  ? 1165 ARG A HH21   1 
ATOM   2914  H  HH22   . ARG A 1 203 ? -47.608  55.205  -6.247  1.00 81.98  ? 1165 ARG A HH22   1 
ATOM   2915  N  N      . GLY A 1 204 ? -45.389  59.490  -14.979 1.00 48.14  ? 1166 GLY A N      1 
ATOM   2916  C  CA     . GLY A 1 204 ? -45.219  59.653  -16.409 1.00 44.15  ? 1166 GLY A CA     1 
ATOM   2917  C  C      . GLY A 1 204 ? -46.398  60.265  -17.141 1.00 44.00  ? 1166 GLY A C      1 
ATOM   2918  O  O      . GLY A 1 204 ? -46.275  60.555  -18.337 1.00 41.90  ? 1166 GLY A O      1 
ATOM   2919  H  H      . GLY A 1 204 ? -45.300  60.223  -14.539 1.00 57.76  ? 1166 GLY A H      1 
ATOM   2920  H  HA2    . GLY A 1 204 ? -44.445  60.215  -16.570 1.00 52.98  ? 1166 GLY A HA2    1 
ATOM   2921  H  HA3    . GLY A 1 204 ? -45.043  58.784  -16.804 1.00 52.98  ? 1166 GLY A HA3    1 
ATOM   2922  N  N      . SER A 1 205 ? -47.533  60.456  -16.476 1.00 47.12  ? 1167 SER A N      1 
ATOM   2923  C  CA     . SER A 1 205 ? -48.690  61.073  -17.109 1.00 46.55  ? 1167 SER A CA     1 
ATOM   2924  C  C      . SER A 1 205 ? -48.664  62.579  -16.823 1.00 44.09  ? 1167 SER A C      1 
ATOM   2925  O  O      . SER A 1 205 ? -47.604  63.150  -16.557 1.00 46.97  ? 1167 SER A O      1 
ATOM   2926  C  CB     . SER A 1 205 ? -49.967  60.363  -16.645 1.00 44.68  ? 1167 SER A CB     1 
ATOM   2927  O  OG     . SER A 1 205 ? -50.062  60.327  -15.236 1.00 46.12  ? 1167 SER A OG     1 
ATOM   2928  H  H      . SER A 1 205 ? -47.658  60.235  -15.654 1.00 56.54  ? 1167 SER A H      1 
ATOM   2929  H  HA     . SER A 1 205 ? -48.620  60.955  -18.069 1.00 55.86  ? 1167 SER A HA     1 
ATOM   2930  H  HB2    . SER A 1 205 ? -50.735  60.839  -16.999 1.00 53.62  ? 1167 SER A HB2    1 
ATOM   2931  H  HB3    . SER A 1 205 ? -49.959  59.454  -16.982 1.00 53.62  ? 1167 SER A HB3    1 
ATOM   2932  H  HG     . SER A 1 205 ? -49.404  59.916  -14.914 1.00 55.34  ? 1167 SER A HG     1 
ATOM   2933  N  N      . LEU A 1 206 ? -49.815  63.243  -16.879 1.00 37.85  ? 1168 LEU A N      1 
ATOM   2934  C  CA     . LEU A 1 206 ? -49.883  64.689  -16.721 1.00 38.91  ? 1168 LEU A CA     1 
ATOM   2935  C  C      . LEU A 1 206 ? -50.303  65.088  -15.312 1.00 40.65  ? 1168 LEU A C      1 
ATOM   2936  O  O      . LEU A 1 206 ? -51.055  64.381  -14.637 1.00 40.97  ? 1168 LEU A O      1 
ATOM   2937  C  CB     . LEU A 1 206 ? -50.867  65.298  -17.721 1.00 38.65  ? 1168 LEU A CB     1 
ATOM   2938  C  CG     . LEU A 1 206 ? -50.443  65.313  -19.186 1.00 39.23  ? 1168 LEU A CG     1 
ATOM   2939  C  CD1    . LEU A 1 206 ? -51.588  65.805  -20.052 1.00 38.36  ? 1168 LEU A CD1    1 
ATOM   2940  C  CD2    . LEU A 1 206 ? -49.206  66.181  -19.374 1.00 40.99  ? 1168 LEU A CD2    1 
ATOM   2941  H  H      . LEU A 1 206 ? -50.580  62.872  -17.010 1.00 45.42  ? 1168 LEU A H      1 
ATOM   2942  H  HA     . LEU A 1 206 ? -49.007  65.068  -16.892 1.00 46.69  ? 1168 LEU A HA     1 
ATOM   2943  H  HB2    . LEU A 1 206 ? -51.697  64.800  -17.669 1.00 46.39  ? 1168 LEU A HB2    1 
ATOM   2944  H  HB3    . LEU A 1 206 ? -51.030  66.219  -17.462 1.00 46.39  ? 1168 LEU A HB3    1 
ATOM   2945  H  HG     . LEU A 1 206 ? -50.222  64.410  -19.463 1.00 47.08  ? 1168 LEU A HG     1 
ATOM   2946  H  HD11   . LEU A 1 206 ? -51.304  65.809  -20.979 1.00 46.04  ? 1168 LEU A HD11   1 
ATOM   2947  H  HD12   . LEU A 1 206 ? -52.346  65.209  -19.940 1.00 46.04  ? 1168 LEU A HD12   1 
ATOM   2948  H  HD13   . LEU A 1 206 ? -51.830  66.703  -19.775 1.00 46.04  ? 1168 LEU A HD13   1 
ATOM   2949  H  HD21   . LEU A 1 206 ? -48.956  66.176  -20.311 1.00 49.18  ? 1168 LEU A HD21   1 
ATOM   2950  H  HD22   . LEU A 1 206 ? -49.411  67.087  -19.091 1.00 49.18  ? 1168 LEU A HD22   1 
ATOM   2951  H  HD23   . LEU A 1 206 ? -48.484  65.821  -18.836 1.00 49.18  ? 1168 LEU A HD23   1 
ATOM   2952  N  N      . SER A 1 207 ? -49.817  66.246  -14.883 1.00 43.32  ? 1169 SER A N      1 
ATOM   2953  C  CA     . SER A 1 207 ? -50.257  66.823  -13.625 1.00 45.42  ? 1169 SER A CA     1 
ATOM   2954  C  C      . SER A 1 207 ? -51.724  67.225  -13.723 1.00 43.30  ? 1169 SER A C      1 
ATOM   2955  O  O      . SER A 1 207 ? -52.209  67.642  -14.777 1.00 45.87  ? 1169 SER A O      1 
ATOM   2956  C  CB     . SER A 1 207 ? -49.394  68.035  -13.271 1.00 45.45  ? 1169 SER A CB     1 
ATOM   2957  O  OG     . SER A 1 207 ? -49.921  68.741  -12.161 1.00 47.64  ? 1169 SER A OG     1 
ATOM   2958  H  H      . SER A 1 207 ? -49.232  66.716  -15.303 1.00 51.98  ? 1169 SER A H      1 
ATOM   2959  H  HA     . SER A 1 207 ? -50.166  66.164  -12.918 1.00 54.50  ? 1169 SER A HA     1 
ATOM   2960  H  HB2    . SER A 1 207 ? -48.499  67.731  -13.053 1.00 54.54  ? 1169 SER A HB2    1 
ATOM   2961  H  HB3    . SER A 1 207 ? -49.362  68.631  -14.035 1.00 54.54  ? 1169 SER A HB3    1 
ATOM   2962  H  HG     . SER A 1 207 ? -49.953  68.238  -11.489 1.00 57.17  ? 1169 SER A HG     1 
ATOM   2963  N  N      . SER A 1 208 ? -52.444  67.083  -12.609 1.00 44.94  ? 1170 SER A N      1 
ATOM   2964  C  CA     . SER A 1 208 ? -53.835  67.520  -12.587 1.00 48.38  ? 1170 SER A CA     1 
ATOM   2965  C  C      . SER A 1 208 ? -53.945  69.016  -12.860 1.00 45.40  ? 1170 SER A C      1 
ATOM   2966  O  O      . SER A 1 208 ? -54.963  69.481  -13.386 1.00 42.55  ? 1170 SER A O      1 
ATOM   2967  C  CB     . SER A 1 208 ? -54.470  67.173  -11.239 1.00 47.18  ? 1170 SER A CB     1 
ATOM   2968  O  OG     . SER A 1 208 ? -53.844  67.882  -10.195 1.00 45.05  ? 1170 SER A OG     1 
ATOM   2969  H  H      . SER A 1 208 ? -52.157  66.745  -11.872 1.00 53.93  ? 1170 SER A H      1 
ATOM   2970  H  HA     . SER A 1 208 ? -54.326  67.051  -13.280 1.00 58.06  ? 1170 SER A HA     1 
ATOM   2971  H  HB2    . SER A 1 208 ? -55.411  67.410  -11.263 1.00 56.62  ? 1170 SER A HB2    1 
ATOM   2972  H  HB3    . SER A 1 208 ? -54.372  66.221  -11.079 1.00 56.62  ? 1170 SER A HB3    1 
ATOM   2973  H  HG     . SER A 1 208 ? -54.200  67.685  -9.460  1.00 54.05  ? 1170 SER A HG     1 
ATOM   2974  N  N      . TYR A 1 209 ? -52.905  69.779  -12.510 1.00 43.27  ? 1171 TYR A N      1 
ATOM   2975  C  CA     . TYR A 1 209 ? -52.846  71.193  -12.863 1.00 44.69  ? 1171 TYR A CA     1 
ATOM   2976  C  C      . TYR A 1 209 ? -52.817  71.384  -14.373 1.00 45.86  ? 1171 TYR A C      1 
ATOM   2977  O  O      . TYR A 1 209 ? -53.352  72.373  -14.886 1.00 44.70  ? 1171 TYR A O      1 
ATOM   2978  C  CB     . TYR A 1 209 ? -51.616  71.828  -12.210 1.00 47.65  ? 1171 TYR A CB     1 
ATOM   2979  C  CG     . TYR A 1 209 ? -51.276  73.231  -12.667 1.00 45.58  ? 1171 TYR A CG     1 
ATOM   2980  C  CD1    . TYR A 1 209 ? -52.099  74.307  -12.361 1.00 43.00  ? 1171 TYR A CD1    1 
ATOM   2981  C  CD2    . TYR A 1 209 ? -50.109  73.480  -13.378 1.00 44.47  ? 1171 TYR A CD2    1 
ATOM   2982  C  CE1    . TYR A 1 209 ? -51.778  75.590  -12.769 1.00 46.16  ? 1171 TYR A CE1    1 
ATOM   2983  C  CE2    . TYR A 1 209 ? -49.777  74.754  -13.786 1.00 45.84  ? 1171 TYR A CE2    1 
ATOM   2984  C  CZ     . TYR A 1 209 ? -50.613  75.808  -13.481 1.00 48.81  ? 1171 TYR A CZ     1 
ATOM   2985  O  OH     . TYR A 1 209 ? -50.276  77.080  -13.893 1.00 47.87  ? 1171 TYR A OH     1 
ATOM   2986  H  H      . TYR A 1 209 ? -52.223  69.498  -12.067 1.00 51.93  ? 1171 TYR A H      1 
ATOM   2987  H  HA     . TYR A 1 209 ? -53.635  71.640  -12.519 1.00 53.63  ? 1171 TYR A HA     1 
ATOM   2988  H  HB2    . TYR A 1 209 ? -51.763  71.864  -11.252 1.00 57.18  ? 1171 TYR A HB2    1 
ATOM   2989  H  HB3    . TYR A 1 209 ? -50.847  71.268  -12.398 1.00 57.18  ? 1171 TYR A HB3    1 
ATOM   2990  H  HD1    . TYR A 1 209 ? -52.883  74.162  -11.882 1.00 51.60  ? 1171 TYR A HD1    1 
ATOM   2991  H  HD2    . TYR A 1 209 ? -49.542  72.773  -13.585 1.00 53.37  ? 1171 TYR A HD2    1 
ATOM   2992  H  HE1    . TYR A 1 209 ? -52.340  76.302  -12.563 1.00 55.39  ? 1171 TYR A HE1    1 
ATOM   2993  H  HE2    . TYR A 1 209 ? -48.994  74.902  -14.266 1.00 55.01  ? 1171 TYR A HE2    1 
ATOM   2994  H  HH     . TYR A 1 209 ? -49.548  77.063  -14.312 1.00 57.44  ? 1171 TYR A HH     1 
ATOM   2995  N  N      . ALA A 1 210 ? -52.192  70.456  -15.099 1.00 46.48  ? 1172 ALA A N      1 
ATOM   2996  C  CA     . ALA A 1 210 ? -52.201  70.526  -16.555 1.00 44.88  ? 1172 ALA A CA     1 
ATOM   2997  C  C      . ALA A 1 210 ? -53.605  70.308  -17.103 1.00 46.82  ? 1172 ALA A C      1 
ATOM   2998  O  O      . ALA A 1 210 ? -54.018  70.982  -18.055 1.00 45.59  ? 1172 ALA A O      1 
ATOM   2999  C  CB     . ALA A 1 210 ? -51.231  69.498  -17.133 1.00 46.48  ? 1172 ALA A CB     1 
ATOM   3000  H  H      . ALA A 1 210 ? -51.761  69.785  -14.775 1.00 55.77  ? 1172 ALA A H      1 
ATOM   3001  H  HA     . ALA A 1 210 ? -51.904  71.407  -16.830 1.00 53.86  ? 1172 ALA A HA     1 
ATOM   3002  H  HB1    . ALA A 1 210 ? -51.248  69.558  -18.101 1.00 55.77  ? 1172 ALA A HB1    1 
ATOM   3003  H  HB2    . ALA A 1 210 ? -50.337  69.689  -16.806 1.00 55.77  ? 1172 ALA A HB2    1 
ATOM   3004  H  HB3    . ALA A 1 210 ? -51.505  68.612  -16.850 1.00 55.77  ? 1172 ALA A HB3    1 
ATOM   3005  N  N      . TYR A 1 211 ? -54.354  69.366  -16.523 1.00 42.70  ? 1173 TYR A N      1 
ATOM   3006  C  CA     . TYR A 1 211 ? -55.722  69.139  -16.977 1.00 43.05  ? 1173 TYR A CA     1 
ATOM   3007  C  C      . TYR A 1 211 ? -56.627  70.316  -16.637 1.00 41.69  ? 1173 TYR A C      1 
ATOM   3008  O  O      . TYR A 1 211 ? -57.550  70.624  -17.399 1.00 41.36  ? 1173 TYR A O      1 
ATOM   3009  C  CB     . TYR A 1 211 ? -56.277  67.849  -16.377 1.00 40.78  ? 1173 TYR A CB     1 
ATOM   3010  C  CG     . TYR A 1 211 ? -55.638  66.609  -16.950 1.00 40.61  ? 1173 TYR A CG     1 
ATOM   3011  C  CD1    . TYR A 1 211 ? -55.757  66.305  -18.301 1.00 40.05  ? 1173 TYR A CD1    1 
ATOM   3012  C  CD2    . TYR A 1 211 ? -54.920  65.741  -16.144 1.00 39.99  ? 1173 TYR A CD2    1 
ATOM   3013  C  CE1    . TYR A 1 211 ? -55.172  65.173  -18.829 1.00 41.87  ? 1173 TYR A CE1    1 
ATOM   3014  C  CE2    . TYR A 1 211 ? -54.334  64.606  -16.664 1.00 41.82  ? 1173 TYR A CE2    1 
ATOM   3015  C  CZ     . TYR A 1 211 ? -54.462  64.327  -18.005 1.00 41.26  ? 1173 TYR A CZ     1 
ATOM   3016  O  OH     . TYR A 1 211 ? -53.879  63.197  -18.522 1.00 42.29  ? 1173 TYR A OH     1 
ATOM   3017  H  H      . TYR A 1 211 ? -54.099  68.857  -15.878 1.00 51.24  ? 1173 TYR A H      1 
ATOM   3018  H  HA     . TYR A 1 211 ? -55.718  69.039  -17.942 1.00 51.66  ? 1173 TYR A HA     1 
ATOM   3019  H  HB2    . TYR A 1 211 ? -56.117  67.852  -15.420 1.00 48.94  ? 1173 TYR A HB2    1 
ATOM   3020  H  HB3    . TYR A 1 211 ? -57.230  67.803  -16.553 1.00 48.94  ? 1173 TYR A HB3    1 
ATOM   3021  H  HD1    . TYR A 1 211 ? -56.234  66.876  -18.858 1.00 48.06  ? 1173 TYR A HD1    1 
ATOM   3022  H  HD2    . TYR A 1 211 ? -54.831  65.927  -15.237 1.00 47.99  ? 1173 TYR A HD2    1 
ATOM   3023  H  HE1    . TYR A 1 211 ? -55.258  64.981  -19.735 1.00 50.24  ? 1173 TYR A HE1    1 
ATOM   3024  H  HE2    . TYR A 1 211 ? -53.854  64.032  -16.111 1.00 50.19  ? 1173 TYR A HE2    1 
ATOM   3025  H  HH     . TYR A 1 211 ? -53.481  62.775  -17.914 1.00 50.75  ? 1173 TYR A HH     1 
ATOM   3026  N  N      . THR A 1 212 ? -56.392  70.980  -15.503 1.00 39.24  ? 1174 THR A N      1 
ATOM   3027  C  CA     . THR A 1 212 ? -57.152  72.188  -15.201 1.00 43.71  ? 1174 THR A CA     1 
ATOM   3028  C  C      . THR A 1 212 ? -56.943  73.243  -16.283 1.00 44.54  ? 1174 THR A C      1 
ATOM   3029  O  O      . THR A 1 212 ? -57.898  73.901  -16.710 1.00 44.80  ? 1174 THR A O      1 
ATOM   3030  C  CB     . THR A 1 212 ? -56.758  72.736  -13.827 1.00 45.12  ? 1174 THR A CB     1 
ATOM   3031  O  OG1    . THR A 1 212 ? -56.983  71.738  -12.822 1.00 42.93  ? 1174 THR A OG1    1 
ATOM   3032  C  CG2    . THR A 1 212 ? -57.579  73.971  -13.481 1.00 44.56  ? 1174 THR A CG2    1 
ATOM   3033  H  H      . THR A 1 212 ? -55.813  70.756  -14.907 1.00 47.09  ? 1174 THR A H      1 
ATOM   3034  H  HA     . THR A 1 212 ? -58.096  71.968  -15.176 1.00 52.45  ? 1174 THR A HA     1 
ATOM   3035  H  HB     . THR A 1 212 ? -55.820  72.982  -13.833 1.00 54.15  ? 1174 THR A HB     1 
ATOM   3036  H  HG1    . THR A 1 212 ? -56.522  71.055  -12.987 1.00 51.52  ? 1174 THR A HG1    1 
ATOM   3037  H  HG21   . THR A 1 212 ? -57.320  74.308  -12.610 1.00 53.47  ? 1174 THR A HG21   1 
ATOM   3038  H  HG22   . THR A 1 212 ? -57.430  74.664  -14.144 1.00 53.47  ? 1174 THR A HG22   1 
ATOM   3039  H  HG23   . THR A 1 212 ? -58.523  73.748  -13.465 1.00 53.47  ? 1174 THR A HG23   1 
ATOM   3040  N  N      . LEU A 1 213 ? -55.701  73.407  -16.750 1.00 43.98  ? 1175 LEU A N      1 
ATOM   3041  C  CA     . LEU A 1 213 ? -55.429  74.369  -17.814 1.00 46.49  ? 1175 LEU A CA     1 
ATOM   3042  C  C      . LEU A 1 213 ? -56.177  74.001  -19.089 1.00 47.67  ? 1175 LEU A C      1 
ATOM   3043  O  O      . LEU A 1 213 ? -56.653  74.882  -19.815 1.00 46.26  ? 1175 LEU A O      1 
ATOM   3044  C  CB     . LEU A 1 213 ? -53.923  74.450  -18.079 1.00 46.50  ? 1175 LEU A CB     1 
ATOM   3045  C  CG     . LEU A 1 213 ? -53.037  74.958  -16.932 1.00 47.93  ? 1175 LEU A CG     1 
ATOM   3046  C  CD1    . LEU A 1 213 ? -51.561  74.870  -17.303 1.00 48.92  ? 1175 LEU A CD1    1 
ATOM   3047  C  CD2    . LEU A 1 213 ? -53.393  76.386  -16.547 1.00 46.16  ? 1175 LEU A CD2    1 
ATOM   3048  H  H      . LEU A 1 213 ? -55.010  72.978  -16.470 1.00 52.78  ? 1175 LEU A H      1 
ATOM   3049  H  HA     . LEU A 1 213 ? -55.731  75.246  -17.532 1.00 55.79  ? 1175 LEU A HA     1 
ATOM   3050  H  HB2    . LEU A 1 213 ? -53.609  73.561  -18.309 1.00 55.80  ? 1175 LEU A HB2    1 
ATOM   3051  H  HB3    . LEU A 1 213 ? -53.781  75.043  -18.833 1.00 55.80  ? 1175 LEU A HB3    1 
ATOM   3052  H  HG     . LEU A 1 213 ? -53.181  74.397  -16.154 1.00 57.52  ? 1175 LEU A HG     1 
ATOM   3053  H  HD11   . LEU A 1 213 ? -51.029  75.197  -16.560 1.00 58.70  ? 1175 LEU A HD11   1 
ATOM   3054  H  HD12   . LEU A 1 213 ? -51.337  73.944  -17.488 1.00 58.70  ? 1175 LEU A HD12   1 
ATOM   3055  H  HD13   . LEU A 1 213 ? -51.400  75.413  -18.090 1.00 58.70  ? 1175 LEU A HD13   1 
ATOM   3056  H  HD21   . LEU A 1 213 ? -52.815  76.671  -15.822 1.00 55.39  ? 1175 LEU A HD21   1 
ATOM   3057  H  HD22   . LEU A 1 213 ? -53.266  76.962  -17.317 1.00 55.39  ? 1175 LEU A HD22   1 
ATOM   3058  H  HD23   . LEU A 1 213 ? -54.320  76.414  -16.261 1.00 55.39  ? 1175 LEU A HD23   1 
ATOM   3059  N  N      . MET A 1 214 ? -56.296  72.703  -19.375 1.00 47.38  ? 1176 MET A N      1 
ATOM   3060  C  CA     . MET A 1 214 ? -57.027  72.271  -20.560 1.00 46.23  ? 1176 MET A CA     1 
ATOM   3061  C  C      . MET A 1 214 ? -58.502  72.643  -20.470 1.00 44.81  ? 1176 MET A C      1 
ATOM   3062  O  O      . MET A 1 214 ? -59.115  73.023  -21.475 1.00 50.13  ? 1176 MET A O      1 
ATOM   3063  C  CB     . MET A 1 214 ? -56.862  70.765  -20.755 1.00 45.91  ? 1176 MET A CB     1 
ATOM   3064  C  CG     . MET A 1 214 ? -55.434  70.344  -21.073 1.00 48.70  ? 1176 MET A CG     1 
ATOM   3065  S  SD     . MET A 1 214 ? -55.264  68.585  -21.437 1.00 48.18  ? 1176 MET A SD     1 
ATOM   3066  C  CE     . MET A 1 214 ? -56.214  68.448  -22.953 1.00 49.11  ? 1176 MET A CE     1 
ATOM   3067  H  H      . MET A 1 214 ? -55.967  72.063  -18.904 1.00 56.86  ? 1176 MET A H      1 
ATOM   3068  H  HA     . MET A 1 214 ? -56.644  72.710  -21.336 1.00 55.47  ? 1176 MET A HA     1 
ATOM   3069  H  HB2    . MET A 1 214 ? -57.130  70.312  -19.940 1.00 55.09  ? 1176 MET A HB2    1 
ATOM   3070  H  HB3    . MET A 1 214 ? -57.426  70.480  -21.491 1.00 55.09  ? 1176 MET A HB3    1 
ATOM   3071  H  HG2    . MET A 1 214 ? -55.127  70.839  -21.848 1.00 58.43  ? 1176 MET A HG2    1 
ATOM   3072  H  HG3    . MET A 1 214 ? -54.871  70.545  -20.309 1.00 58.43  ? 1176 MET A HG3    1 
ATOM   3073  H  HE1    . MET A 1 214 ? -56.196  67.526  -23.254 1.00 58.93  ? 1176 MET A HE1    1 
ATOM   3074  H  HE2    . MET A 1 214 ? -57.128  68.722  -22.778 1.00 58.93  ? 1176 MET A HE2    1 
ATOM   3075  H  HE3    . MET A 1 214 ? -55.819  69.024  -23.626 1.00 58.93  ? 1176 MET A HE3    1 
ATOM   3076  N  N      . VAL A 1 215 ? -59.092  72.537  -19.278 1.00 43.20  ? 1177 VAL A N      1 
ATOM   3077  C  CA     . VAL A 1 215 ? -60.485  72.944  -19.099 1.00 42.35  ? 1177 VAL A CA     1 
ATOM   3078  C  C      . VAL A 1 215 ? -60.628  74.440  -19.342 1.00 44.13  ? 1177 VAL A C      1 
ATOM   3079  O  O      . VAL A 1 215 ? -61.500  74.887  -20.096 1.00 44.65  ? 1177 VAL A O      1 
ATOM   3080  C  CB     . VAL A 1 215 ? -60.987  72.551  -17.696 1.00 43.04  ? 1177 VAL A CB     1 
ATOM   3081  C  CG1    . VAL A 1 215 ? -62.418  73.043  -17.474 1.00 41.96  ? 1177 VAL A CG1    1 
ATOM   3082  C  CG2    . VAL A 1 215 ? -60.907  71.043  -17.497 1.00 43.31  ? 1177 VAL A CG2    1 
ATOM   3083  H  H      . VAL A 1 215 ? -58.713  72.237  -18.567 1.00 51.84  ? 1177 VAL A H      1 
ATOM   3084  H  HA     . VAL A 1 215 ? -61.033  72.482  -19.752 1.00 50.82  ? 1177 VAL A HA     1 
ATOM   3085  H  HB     . VAL A 1 215 ? -60.420  72.971  -17.031 1.00 51.65  ? 1177 VAL A HB     1 
ATOM   3086  H  HG11   . VAL A 1 215 ? -62.707  72.782  -16.585 1.00 50.35  ? 1177 VAL A HG11   1 
ATOM   3087  H  HG12   . VAL A 1 215 ? -62.437  74.009  -17.558 1.00 50.35  ? 1177 VAL A HG12   1 
ATOM   3088  H  HG13   . VAL A 1 215 ? -62.997  72.642  -18.141 1.00 50.35  ? 1177 VAL A HG13   1 
ATOM   3089  H  HG21   . VAL A 1 215 ? -61.228  70.824  -16.608 1.00 51.97  ? 1177 VAL A HG21   1 
ATOM   3090  H  HG22   . VAL A 1 215 ? -61.459  70.606  -18.165 1.00 51.97  ? 1177 VAL A HG22   1 
ATOM   3091  H  HG23   . VAL A 1 215 ? -59.984  70.760  -17.594 1.00 51.97  ? 1177 VAL A HG23   1 
ATOM   3092  N  N      . LEU A 1 216 ? -59.772  75.238  -18.699 1.00 46.82  ? 1178 LEU A N      1 
ATOM   3093  C  CA     . LEU A 1 216 ? -59.858  76.689  -18.843 1.00 48.50  ? 1178 LEU A CA     1 
ATOM   3094  C  C      . LEU A 1 216 ? -59.648  77.113  -20.291 1.00 47.74  ? 1178 LEU A C      1 
ATOM   3095  O  O      . LEU A 1 216 ? -60.352  77.997  -20.795 1.00 49.96  ? 1178 LEU A O      1 
ATOM   3096  C  CB     . LEU A 1 216 ? -58.833  77.360  -17.929 1.00 47.52  ? 1178 LEU A CB     1 
ATOM   3097  C  CG     . LEU A 1 216 ? -58.980  77.076  -16.430 1.00 44.63  ? 1178 LEU A CG     1 
ATOM   3098  C  CD1    . LEU A 1 216 ? -57.826  77.691  -15.655 1.00 46.10  ? 1178 LEU A CD1    1 
ATOM   3099  C  CD2    . LEU A 1 216 ? -60.311  77.590  -15.898 1.00 46.49  ? 1178 LEU A CD2    1 
ATOM   3100  H  H      . LEU A 1 216 ? -59.142  74.967  -18.181 1.00 56.19  ? 1178 LEU A H      1 
ATOM   3101  H  HA     . LEU A 1 216 ? -60.741  76.981  -18.569 1.00 58.20  ? 1178 LEU A HA     1 
ATOM   3102  H  HB2    . LEU A 1 216 ? -57.948  77.064  -18.193 1.00 57.03  ? 1178 LEU A HB2    1 
ATOM   3103  H  HB3    . LEU A 1 216 ? -58.900  78.320  -18.048 1.00 57.03  ? 1178 LEU A HB3    1 
ATOM   3104  H  HG     . LEU A 1 216 ? -58.954  76.117  -16.289 1.00 53.55  ? 1178 LEU A HG     1 
ATOM   3105  H  HD11   . LEU A 1 216 ? -57.942  77.498  -14.712 1.00 55.31  ? 1178 LEU A HD11   1 
ATOM   3106  H  HD12   . LEU A 1 216 ? -56.993  77.308  -15.972 1.00 55.31  ? 1178 LEU A HD12   1 
ATOM   3107  H  HD13   . LEU A 1 216 ? -57.826  78.651  -15.799 1.00 55.31  ? 1178 LEU A HD13   1 
ATOM   3108  H  HD21   . LEU A 1 216 ? -60.369  77.394  -14.950 1.00 55.78  ? 1178 LEU A HD21   1 
ATOM   3109  H  HD22   . LEU A 1 216 ? -60.359  78.548  -16.041 1.00 55.78  ? 1178 LEU A HD22   1 
ATOM   3110  H  HD23   . LEU A 1 216 ? -61.032  77.148  -16.373 1.00 55.78  ? 1178 LEU A HD23   1 
ATOM   3111  N  N      . TYR A 1 217 ? -58.682  76.497  -20.978 1.00 45.77  ? 1179 TYR A N      1 
ATOM   3112  C  CA     . TYR A 1 217 ? -58.439  76.835  -22.377 1.00 48.27  ? 1179 TYR A CA     1 
ATOM   3113  C  C      . TYR A 1 217 ? -59.659  76.522  -23.239 1.00 51.62  ? 1179 TYR A C      1 
ATOM   3114  O  O      . TYR A 1 217 ? -60.019  77.304  -24.127 1.00 51.30  ? 1179 TYR A O      1 
ATOM   3115  C  CB     . TYR A 1 217 ? -57.203  76.090  -22.887 1.00 46.84  ? 1179 TYR A CB     1 
ATOM   3116  C  CG     . TYR A 1 217 ? -56.867  76.368  -24.340 1.00 48.36  ? 1179 TYR A CG     1 
ATOM   3117  C  CD1    . TYR A 1 217 ? -56.305  77.579  -24.725 1.00 49.09  ? 1179 TYR A CD1    1 
ATOM   3118  C  CD2    . TYR A 1 217 ? -57.090  75.411  -25.321 1.00 47.14  ? 1179 TYR A CD2    1 
ATOM   3119  C  CE1    . TYR A 1 217 ? -55.995  77.836  -26.046 1.00 51.50  ? 1179 TYR A CE1    1 
ATOM   3120  C  CE2    . TYR A 1 217 ? -56.781  75.658  -26.646 1.00 50.47  ? 1179 TYR A CE2    1 
ATOM   3121  C  CZ     . TYR A 1 217 ? -56.233  76.871  -27.002 1.00 52.19  ? 1179 TYR A CZ     1 
ATOM   3122  O  OH     . TYR A 1 217 ? -55.920  77.121  -28.318 1.00 53.72  ? 1179 TYR A OH     1 
ATOM   3123  H  H      . TYR A 1 217 ? -58.164  75.889  -20.660 1.00 54.93  ? 1179 TYR A H      1 
ATOM   3124  H  HA     . TYR A 1 217 ? -58.263  77.786  -22.445 1.00 57.92  ? 1179 TYR A HA     1 
ATOM   3125  H  HB2    . TYR A 1 217 ? -56.439  76.353  -22.351 1.00 56.21  ? 1179 TYR A HB2    1 
ATOM   3126  H  HB3    . TYR A 1 217 ? -57.355  75.136  -22.796 1.00 56.21  ? 1179 TYR A HB3    1 
ATOM   3127  H  HD1    . TYR A 1 217 ? -56.146  78.233  -24.083 1.00 58.90  ? 1179 TYR A HD1    1 
ATOM   3128  H  HD2    . TYR A 1 217 ? -57.462  74.592  -25.084 1.00 56.57  ? 1179 TYR A HD2    1 
ATOM   3129  H  HE1    . TYR A 1 217 ? -55.623  78.653  -26.289 1.00 61.80  ? 1179 TYR A HE1    1 
ATOM   3130  H  HE2    . TYR A 1 217 ? -56.940  75.009  -27.292 1.00 60.57  ? 1179 TYR A HE2    1 
ATOM   3131  H  HH     . TYR A 1 217 ? -56.114  76.455  -28.791 1.00 64.46  ? 1179 TYR A HH     1 
ATOM   3132  N  N      . PHE A 1 218 ? -60.299  75.373  -23.003 1.00 49.99  ? 1180 PHE A N      1 
ATOM   3133  C  CA     . PHE A 1 218 ? -61.525  75.051  -23.728 1.00 50.25  ? 1180 PHE A CA     1 
ATOM   3134  C  C      . PHE A 1 218 ? -62.600  76.103  -23.486 1.00 49.99  ? 1180 PHE A C      1 
ATOM   3135  O  O      . PHE A 1 218 ? -63.276  76.538  -24.425 1.00 51.80  ? 1180 PHE A O      1 
ATOM   3136  C  CB     . PHE A 1 218 ? -62.035  73.669  -23.317 1.00 48.01  ? 1180 PHE A CB     1 
ATOM   3137  C  CG     . PHE A 1 218 ? -63.470  73.422  -23.687 1.00 50.01  ? 1180 PHE A CG     1 
ATOM   3138  C  CD1    . PHE A 1 218 ? -63.828  73.163  -25.001 1.00 51.47  ? 1180 PHE A CD1    1 
ATOM   3139  C  CD2    . PHE A 1 218 ? -64.462  73.447  -22.720 1.00 47.59  ? 1180 PHE A CD2    1 
ATOM   3140  C  CE1    . PHE A 1 218 ? -65.148  72.937  -25.342 1.00 52.08  ? 1180 PHE A CE1    1 
ATOM   3141  C  CE2    . PHE A 1 218 ? -65.781  73.222  -23.053 1.00 47.39  ? 1180 PHE A CE2    1 
ATOM   3142  C  CZ     . PHE A 1 218 ? -66.126  72.967  -24.367 1.00 55.67  ? 1180 PHE A CZ     1 
ATOM   3143  H  H      . PHE A 1 218 ? -60.047  74.774  -22.439 1.00 59.99  ? 1180 PHE A H      1 
ATOM   3144  H  HA     . PHE A 1 218 ? -61.334  75.030  -24.679 1.00 60.30  ? 1180 PHE A HA     1 
ATOM   3145  H  HB2    . PHE A 1 218 ? -61.494  72.993  -23.755 1.00 57.61  ? 1180 PHE A HB2    1 
ATOM   3146  H  HB3    . PHE A 1 218 ? -61.957  73.580  -22.354 1.00 57.61  ? 1180 PHE A HB3    1 
ATOM   3147  H  HD1    . PHE A 1 218 ? -63.173  73.143  -25.661 1.00 61.77  ? 1180 PHE A HD1    1 
ATOM   3148  H  HD2    . PHE A 1 218 ? -64.236  73.620  -21.835 1.00 57.11  ? 1180 PHE A HD2    1 
ATOM   3149  H  HE1    . PHE A 1 218 ? -65.377  72.765  -26.227 1.00 62.50  ? 1180 PHE A HE1    1 
ATOM   3150  H  HE2    . PHE A 1 218 ? -66.438  73.242  -22.395 1.00 56.86  ? 1180 PHE A HE2    1 
ATOM   3151  H  HZ     . PHE A 1 218 ? -67.015  72.814  -24.594 1.00 66.80  ? 1180 PHE A HZ     1 
ATOM   3152  N  N      . LEU A 1 219 ? -62.774  76.522  -22.230 1.00 46.27  ? 1181 LEU A N      1 
ATOM   3153  C  CA     . LEU A 1 219 ? -63.811  77.495  -21.905 1.00 46.03  ? 1181 LEU A CA     1 
ATOM   3154  C  C      . LEU A 1 219 ? -63.485  78.878  -22.455 1.00 47.46  ? 1181 LEU A C      1 
ATOM   3155  O  O      . LEU A 1 219 ? -64.399  79.676  -22.695 1.00 48.90  ? 1181 LEU A O      1 
ATOM   3156  C  CB     . LEU A 1 219 ? -64.014  77.555  -20.392 1.00 43.24  ? 1181 LEU A CB     1 
ATOM   3157  C  CG     . LEU A 1 219 ? -64.499  76.251  -19.751 1.00 44.53  ? 1181 LEU A CG     1 
ATOM   3158  C  CD1    . LEU A 1 219 ? -64.507  76.367  -18.229 1.00 43.89  ? 1181 LEU A CD1    1 
ATOM   3159  C  CD2    . LEU A 1 219 ? -65.880  75.870  -20.277 1.00 46.53  ? 1181 LEU A CD2    1 
ATOM   3160  H  H      . LEU A 1 219 ? -62.308  76.259  -21.556 1.00 55.53  ? 1181 LEU A H      1 
ATOM   3161  H  HA     . LEU A 1 219 ? -64.646  77.207  -22.305 1.00 55.23  ? 1181 LEU A HA     1 
ATOM   3162  H  HB2    . LEU A 1 219 ? -63.169  77.788  -19.976 1.00 51.88  ? 1181 LEU A HB2    1 
ATOM   3163  H  HB3    . LEU A 1 219 ? -64.673  78.240  -20.196 1.00 51.88  ? 1181 LEU A HB3    1 
ATOM   3164  H  HG     . LEU A 1 219 ? -63.885  75.540  -19.990 1.00 53.43  ? 1181 LEU A HG     1 
ATOM   3165  H  HD11   . LEU A 1 219 ? -64.818  75.529  -17.851 1.00 52.67  ? 1181 LEU A HD11   1 
ATOM   3166  H  HD12   . LEU A 1 219 ? -63.607  76.555  -17.922 1.00 52.67  ? 1181 LEU A HD12   1 
ATOM   3167  H  HD13   . LEU A 1 219 ? -65.103  77.088  -17.970 1.00 52.67  ? 1181 LEU A HD13   1 
ATOM   3168  H  HD21   . LEU A 1 219 ? -66.161  75.042  -19.855 1.00 55.83  ? 1181 LEU A HD21   1 
ATOM   3169  H  HD22   . LEU A 1 219 ? -66.506  76.579  -20.064 1.00 55.83  ? 1181 LEU A HD22   1 
ATOM   3170  H  HD23   . LEU A 1 219 ? -65.830  75.750  -21.239 1.00 55.83  ? 1181 LEU A HD23   1 
ATOM   3171  N  N      . GLN A 1 220 ? -62.203  79.191  -22.639 1.00 52.68  ? 1182 GLN A N      1 
ATOM   3172  C  CA     . GLN A 1 220 ? -61.834  80.467  -23.244 1.00 56.69  ? 1182 GLN A CA     1 
ATOM   3173  C  C      . GLN A 1 220 ? -62.087  80.462  -24.746 1.00 55.25  ? 1182 GLN A C      1 
ATOM   3174  O  O      . GLN A 1 220 ? -62.535  81.469  -25.306 1.00 60.27  ? 1182 GLN A O      1 
ATOM   3175  C  CB     . GLN A 1 220 ? -60.365  80.783  -22.957 1.00 56.99  ? 1182 GLN A CB     1 
ATOM   3176  C  CG     . GLN A 1 220 ? -60.080  81.185  -21.520 1.00 57.47  ? 1182 GLN A CG     1 
ATOM   3177  C  CD     . GLN A 1 220 ? -58.594  81.278  -21.225 1.00 57.53  ? 1182 GLN A CD     1 
ATOM   3178  O  OE1    . GLN A 1 220 ? -57.779  80.623  -21.872 1.00 55.73  ? 1182 GLN A OE1    1 
ATOM   3179  N  NE2    . GLN A 1 220 ? -58.234  82.107  -20.253 1.00 59.90  ? 1182 GLN A NE2    1 
ATOM   3180  H  H      . GLN A 1 220 ? -61.537  78.689  -22.426 1.00 63.21  ? 1182 GLN A H      1 
ATOM   3181  H  HA     . GLN A 1 220 ? -62.374  81.170  -22.851 1.00 68.03  ? 1182 GLN A HA     1 
ATOM   3182  H  HB2    . GLN A 1 220 ? -59.833  79.996  -23.154 1.00 68.39  ? 1182 GLN A HB2    1 
ATOM   3183  H  HB3    . GLN A 1 220 ? -60.088  81.516  -23.529 1.00 68.39  ? 1182 GLN A HB3    1 
ATOM   3184  H  HG2    . GLN A 1 220 ? -60.475  82.054  -21.350 1.00 68.97  ? 1182 GLN A HG2    1 
ATOM   3185  H  HG3    . GLN A 1 220 ? -60.463  80.523  -20.924 1.00 68.97  ? 1182 GLN A HG3    1 
ATOM   3186  H  HE21   . GLN A 1 220 ? -58.832  82.557  -19.827 1.00 71.88  ? 1182 GLN A HE21   1 
ATOM   3187  H  HE22   . GLN A 1 220 ? -57.403  82.195  -20.048 1.00 71.88  ? 1182 GLN A HE22   1 
ATOM   3188  N  N      . GLN A 1 221 ? -61.818  79.337  -25.409 1.00 52.16  ? 1183 GLN A N      1 
ATOM   3189  C  CA     . GLN A 1 221 ? -61.981  79.236  -26.854 1.00 53.18  ? 1183 GLN A CA     1 
ATOM   3190  C  C      . GLN A 1 221 ? -63.406  78.907  -27.272 1.00 53.33  ? 1183 GLN A C      1 
ATOM   3191  O  O      . GLN A 1 221 ? -63.718  78.989  -28.465 1.00 53.19  ? 1183 GLN A O      1 
ATOM   3192  C  CB     . GLN A 1 221 ? -61.027  78.175  -27.409 1.00 49.47  ? 1183 GLN A CB     1 
ATOM   3193  C  CG     . GLN A 1 221 ? -59.558  78.517  -27.229 1.00 51.03  ? 1183 GLN A CG     1 
ATOM   3194  C  CD     . GLN A 1 221 ? -59.141  79.716  -28.060 1.00 54.98  ? 1183 GLN A CD     1 
ATOM   3195  O  OE1    . GLN A 1 221 ? -59.484  79.816  -29.238 1.00 58.79  ? 1183 GLN A OE1    1 
ATOM   3196  N  NE2    . GLN A 1 221 ? -58.402  80.634  -27.449 1.00 56.34  ? 1183 GLN A NE2    1 
ATOM   3197  H  H      . GLN A 1 221 ? -61.537  78.613  -25.038 1.00 62.59  ? 1183 GLN A H      1 
ATOM   3198  H  HA     . GLN A 1 221 ? -61.743  80.087  -27.254 1.00 63.82  ? 1183 GLN A HA     1 
ATOM   3199  H  HB2    . GLN A 1 221 ? -61.194  77.335  -26.953 1.00 59.36  ? 1183 GLN A HB2    1 
ATOM   3200  H  HB3    . GLN A 1 221 ? -61.193  78.072  -28.359 1.00 59.36  ? 1183 GLN A HB3    1 
ATOM   3201  H  HG2    . GLN A 1 221 ? -59.392  78.724  -26.296 1.00 61.23  ? 1183 GLN A HG2    1 
ATOM   3202  H  HG3    . GLN A 1 221 ? -59.020  77.758  -27.503 1.00 61.23  ? 1183 GLN A HG3    1 
ATOM   3203  H  HE21   . GLN A 1 221 ? -58.184  80.532  -26.623 1.00 67.61  ? 1183 GLN A HE21   1 
ATOM   3204  H  HE22   . GLN A 1 221 ? -58.141  81.332  -27.879 1.00 67.61  ? 1183 GLN A HE22   1 
ATOM   3205  N  N      . ARG A 1 222 ? -64.274  78.542  -26.333 1.00 53.01  ? 1184 ARG A N      1 
ATOM   3206  C  CA     . ARG A 1 222 ? -65.651  78.225  -26.678 1.00 54.92  ? 1184 ARG A CA     1 
ATOM   3207  C  C      . ARG A 1 222 ? -66.323  79.425  -27.343 1.00 57.77  ? 1184 ARG A C      1 
ATOM   3208  O  O      . ARG A 1 222 ? -66.004  80.583  -27.058 1.00 58.35  ? 1184 ARG A O      1 
ATOM   3209  C  CB     . ARG A 1 222 ? -66.418  77.810  -25.419 1.00 51.53  ? 1184 ARG A CB     1 
ATOM   3210  C  CG     . ARG A 1 222 ? -67.752  77.125  -25.674 1.00 52.67  ? 1184 ARG A CG     1 
ATOM   3211  C  CD     . ARG A 1 222 ? -67.565  75.805  -26.399 1.00 51.39  ? 1184 ARG A CD     1 
ATOM   3212  N  NE     . ARG A 1 222 ? -68.748  74.958  -26.318 1.00 49.75  ? 1184 ARG A NE     1 
ATOM   3213  C  CZ     . ARG A 1 222 ? -68.870  73.787  -26.934 1.00 51.65  ? 1184 ARG A CZ     1 
ATOM   3214  N  NH1    . ARG A 1 222 ? -67.885  73.322  -27.691 1.00 51.32  1 1184 ARG A NH1    1 
ATOM   3215  N  NH2    . ARG A 1 222 ? -69.983  73.081  -26.797 1.00 52.41  ? 1184 ARG A NH2    1 
ATOM   3216  H  H      . ARG A 1 222 ? -64.090  78.471  -25.496 1.00 63.61  ? 1184 ARG A H      1 
ATOM   3217  H  HA     . ARG A 1 222 ? -65.664  77.483  -27.303 1.00 65.90  ? 1184 ARG A HA     1 
ATOM   3218  H  HB2    . ARG A 1 222 ? -65.866  77.195  -24.911 1.00 61.83  ? 1184 ARG A HB2    1 
ATOM   3219  H  HB3    . ARG A 1 222 ? -66.593  78.603  -24.889 1.00 61.83  ? 1184 ARG A HB3    1 
ATOM   3220  H  HG2    . ARG A 1 222 ? -68.189  76.948  -24.826 1.00 63.20  ? 1184 ARG A HG2    1 
ATOM   3221  H  HG3    . ARG A 1 222 ? -68.307  77.699  -26.225 1.00 63.20  ? 1184 ARG A HG3    1 
ATOM   3222  H  HD2    . ARG A 1 222 ? -67.383  75.980  -27.335 1.00 61.67  ? 1184 ARG A HD2    1 
ATOM   3223  H  HD3    . ARG A 1 222 ? -66.823  75.325  -25.998 1.00 61.67  ? 1184 ARG A HD3    1 
ATOM   3224  H  HE     . ARG A 1 222 ? -69.424  75.252  -25.875 1.00 59.70  ? 1184 ARG A HE     1 
ATOM   3225  H  HH11   . ARG A 1 222 ? -67.160  73.776  -27.781 1.00 61.58  ? 1184 ARG A HH11   1 
ATOM   3226  H  HH12   . ARG A 1 222 ? -67.969  72.564  -28.089 1.00 61.58  ? 1184 ARG A HH12   1 
ATOM   3227  H  HH21   . ARG A 1 222 ? -70.625  73.381  -26.309 1.00 62.89  ? 1184 ARG A HH21   1 
ATOM   3228  H  HH22   . ARG A 1 222 ? -70.065  72.325  -27.198 1.00 62.89  ? 1184 ARG A HH22   1 
ATOM   3229  N  N      . ASN A 1 223 ? -67.252  79.141  -28.250 1.00 56.88  ? 1185 ASN A N      1 
ATOM   3230  C  CA     . ASN A 1 223 ? -68.008  80.201  -28.912 1.00 62.43  ? 1185 ASN A CA     1 
ATOM   3231  C  C      . ASN A 1 223 ? -69.489  80.113  -28.542 1.00 61.24  ? 1185 ASN A C      1 
ATOM   3232  O  O      . ASN A 1 223 ? -70.171  79.185  -28.966 1.00 62.03  ? 1185 ASN A O      1 
ATOM   3233  C  CB     . ASN A 1 223 ? -67.849  80.131  -30.430 1.00 64.83  ? 1185 ASN A CB     1 
ATOM   3234  C  CG     . ASN A 1 223 ? -68.534  81.290  -31.132 1.00 71.37  ? 1185 ASN A CG     1 
ATOM   3235  O  OD1    . ASN A 1 223 ? -68.623  82.390  -30.586 1.00 74.17  ? 1185 ASN A OD1    1 
ATOM   3236  N  ND2    . ASN A 1 223 ? -69.022  81.051  -32.343 1.00 71.53  ? 1185 ASN A ND2    1 
ATOM   3237  H  H      . ASN A 1 223 ? -67.463  78.346  -28.501 1.00 68.25  ? 1185 ASN A H      1 
ATOM   3238  H  HA     . ASN A 1 223 ? -67.674  81.061  -28.614 1.00 74.91  ? 1185 ASN A HA     1 
ATOM   3239  H  HB2    . ASN A 1 223 ? -66.905  80.159  -30.653 1.00 77.80  ? 1185 ASN A HB2    1 
ATOM   3240  H  HB3    . ASN A 1 223 ? -68.243  79.306  -30.754 1.00 77.80  ? 1185 ASN A HB3    1 
ATOM   3241  H  HD21   . ASN A 1 223 ? -69.419  81.678  -32.778 1.00 85.83  ? 1185 ASN A HD21   1 
ATOM   3242  H  HD22   . ASN A 1 223 ? -68.943  80.269  -32.693 1.00 85.83  ? 1185 ASN A HD22   1 
ATOM   3243  N  N      . PRO A 1 224 ? -69.994  81.061  -27.733 1.00 60.96  ? 1186 PRO A N      1 
ATOM   3244  C  CA     . PRO A 1 224 ? -69.275  82.161  -27.082 1.00 59.71  ? 1186 PRO A CA     1 
ATOM   3245  C  C      . PRO A 1 224 ? -68.457  81.684  -25.883 1.00 57.31  ? 1186 PRO A C      1 
ATOM   3246  O  O      . PRO A 1 224 ? -68.732  80.606  -25.355 1.00 53.20  ? 1186 PRO A O      1 
ATOM   3247  C  CB     . PRO A 1 224 ? -70.399  83.100  -26.645 1.00 60.63  ? 1186 PRO A CB     1 
ATOM   3248  C  CG     . PRO A 1 224 ? -71.565  82.214  -26.435 1.00 61.81  ? 1186 PRO A CG     1 
ATOM   3249  C  CD     . PRO A 1 224 ? -71.436  81.092  -27.428 1.00 60.79  ? 1186 PRO A CD     1 
ATOM   3250  H  HA     . PRO A 1 224 ? -68.697  82.616  -27.715 1.00 71.65  ? 1186 PRO A HA     1 
ATOM   3251  H  HB2    . PRO A 1 224 ? -70.153  83.546  -25.820 1.00 72.75  ? 1186 PRO A HB2    1 
ATOM   3252  H  HB3    . PRO A 1 224 ? -70.579  83.745  -27.347 1.00 72.75  ? 1186 PRO A HB3    1 
ATOM   3253  H  HG2    . PRO A 1 224 ? -71.548  81.867  -25.529 1.00 74.17  ? 1186 PRO A HG2    1 
ATOM   3254  H  HG3    . PRO A 1 224 ? -72.382  82.712  -26.592 1.00 74.17  ? 1186 PRO A HG3    1 
ATOM   3255  H  HD2    . PRO A 1 224 ? -71.715  80.254  -27.028 1.00 72.94  ? 1186 PRO A HD2    1 
ATOM   3256  H  HD3    . PRO A 1 224 ? -71.946  81.290  -28.229 1.00 72.94  ? 1186 PRO A HD3    1 
ATOM   3257  N  N      . PRO A 1 225 ? -67.461  82.466  -25.469 1.00 56.79  ? 1187 PRO A N      1 
ATOM   3258  C  CA     . PRO A 1 225 ? -66.598  82.029  -24.366 1.00 54.31  ? 1187 PRO A CA     1 
ATOM   3259  C  C      . PRO A 1 225 ? -67.343  82.011  -23.039 1.00 54.34  ? 1187 PRO A C      1 
ATOM   3260  O  O      . PRO A 1 225 ? -68.188  82.867  -22.765 1.00 55.38  ? 1187 PRO A O      1 
ATOM   3261  C  CB     . PRO A 1 225 ? -65.472  83.069  -24.364 1.00 55.16  ? 1187 PRO A CB     1 
ATOM   3262  C  CG     . PRO A 1 225 ? -66.077  84.281  -24.985 1.00 58.77  ? 1187 PRO A CG     1 
ATOM   3263  C  CD     . PRO A 1 225 ? -67.061  83.781  -26.001 1.00 57.71  ? 1187 PRO A CD     1 
ATOM   3264  H  HA     . PRO A 1 225 ? -66.231  81.150  -24.547 1.00 65.17  ? 1187 PRO A HA     1 
ATOM   3265  H  HB2    . PRO A 1 225 ? -65.194  83.251  -23.453 1.00 66.20  ? 1187 PRO A HB2    1 
ATOM   3266  H  HB3    . PRO A 1 225 ? -64.726  82.747  -24.895 1.00 66.20  ? 1187 PRO A HB3    1 
ATOM   3267  H  HG2    . PRO A 1 225 ? -66.528  84.803  -24.303 1.00 70.53  ? 1187 PRO A HG2    1 
ATOM   3268  H  HG3    . PRO A 1 225 ? -65.383  84.807  -25.413 1.00 70.53  ? 1187 PRO A HG3    1 
ATOM   3269  H  HD2    . PRO A 1 225 ? -67.827  84.373  -26.050 1.00 69.25  ? 1187 PRO A HD2    1 
ATOM   3270  H  HD3    . PRO A 1 225 ? -66.633  83.680  -26.865 1.00 69.25  ? 1187 PRO A HD3    1 
ATOM   3271  N  N      . VAL A 1 226 ? -67.013  81.020  -22.211 1.00 51.80  ? 1188 VAL A N      1 
ATOM   3272  C  CA     . VAL A 1 226 ? -67.558  80.949  -20.861 1.00 53.55  ? 1188 VAL A CA     1 
ATOM   3273  C  C      . VAL A 1 226 ? -66.737  81.790  -19.887 1.00 55.38  ? 1188 VAL A C      1 
ATOM   3274  O  O      . VAL A 1 226 ? -67.276  82.296  -18.897 1.00 50.57  ? 1188 VAL A O      1 
ATOM   3275  C  CB     . VAL A 1 226 ? -67.625  79.483  -20.399 1.00 52.17  ? 1188 VAL A CB     1 
ATOM   3276  C  CG1    . VAL A 1 226 ? -68.129  79.386  -18.965 1.00 52.17  ? 1188 VAL A CG1    1 
ATOM   3277  C  CG2    . VAL A 1 226 ? -68.509  78.674  -21.336 1.00 53.98  ? 1188 VAL A CG2    1 
ATOM   3278  H  H      . VAL A 1 226 ? -66.476  80.379  -22.410 1.00 62.17  ? 1188 VAL A H      1 
ATOM   3279  H  HA     . VAL A 1 226 ? -68.462  81.301  -20.868 1.00 64.26  ? 1188 VAL A HA     1 
ATOM   3280  H  HB     . VAL A 1 226 ? -66.733  79.103  -20.429 1.00 62.61  ? 1188 VAL A HB     1 
ATOM   3281  H  HG11   . VAL A 1 226 ? -68.160  78.452  -18.705 1.00 62.61  ? 1188 VAL A HG11   1 
ATOM   3282  H  HG12   . VAL A 1 226 ? -67.523  79.872  -18.384 1.00 62.61  ? 1188 VAL A HG12   1 
ATOM   3283  H  HG13   . VAL A 1 226 ? -69.017  79.773  -18.916 1.00 62.61  ? 1188 VAL A HG13   1 
ATOM   3284  H  HG21   . VAL A 1 226 ? -68.537  77.755  -21.027 1.00 64.78  ? 1188 VAL A HG21   1 
ATOM   3285  H  HG22   . VAL A 1 226 ? -69.403  79.052  -21.331 1.00 64.78  ? 1188 VAL A HG22   1 
ATOM   3286  H  HG23   . VAL A 1 226 ? -68.138  78.711  -22.231 1.00 64.78  ? 1188 VAL A HG23   1 
ATOM   3287  N  N      . ILE A 1 227 ? -65.443  81.941  -20.146 1.00 57.86  ? 1189 ILE A N      1 
ATOM   3288  C  CA     . ILE A 1 227 ? -64.570  82.770  -19.320 1.00 56.03  ? 1189 ILE A CA     1 
ATOM   3289  C  C      . ILE A 1 227 ? -63.687  83.606  -20.230 1.00 58.29  ? 1189 ILE A C      1 
ATOM   3290  O  O      . ILE A 1 227 ? -63.429  83.238  -21.384 1.00 56.52  ? 1189 ILE A O      1 
ATOM   3291  C  CB     . ILE A 1 227 ? -63.698  81.924  -18.372 1.00 54.16  ? 1189 ILE A CB     1 
ATOM   3292  C  CG1    . ILE A 1 227 ? -62.980  80.821  -19.156 1.00 53.45  ? 1189 ILE A CG1    1 
ATOM   3293  C  CG2    . ILE A 1 227 ? -64.553  81.332  -17.265 1.00 53.48  ? 1189 ILE A CG2    1 
ATOM   3294  C  CD1    . ILE A 1 227 ? -61.945  80.063  -18.351 1.00 52.73  ? 1189 ILE A CD1    1 
ATOM   3295  H  H      . ILE A 1 227 ? -65.039  81.567  -20.807 1.00 69.44  ? 1189 ILE A H      1 
ATOM   3296  H  HA     . ILE A 1 227 ? -65.110  83.371  -18.783 1.00 67.23  ? 1189 ILE A HA     1 
ATOM   3297  H  HB     . ILE A 1 227 ? -63.030  82.501  -17.970 1.00 64.99  ? 1189 ILE A HB     1 
ATOM   3298  H  HG12   . ILE A 1 227 ? -63.639  80.181  -19.467 1.00 64.15  ? 1189 ILE A HG12   1 
ATOM   3299  H  HG13   . ILE A 1 227 ? -62.528  81.222  -19.915 1.00 64.15  ? 1189 ILE A HG13   1 
ATOM   3300  H  HG21   . ILE A 1 227 ? -63.988  80.804  -16.679 1.00 64.18  ? 1189 ILE A HG21   1 
ATOM   3301  H  HG22   . ILE A 1 227 ? -64.965  82.054  -16.765 1.00 64.18  ? 1189 ILE A HG22   1 
ATOM   3302  H  HG23   . ILE A 1 227 ? -65.237  80.771  -17.661 1.00 64.18  ? 1189 ILE A HG23   1 
ATOM   3303  H  HD11   . ILE A 1 227 ? -61.539  79.387  -18.917 1.00 63.28  ? 1189 ILE A HD11   1 
ATOM   3304  H  HD12   . ILE A 1 227 ? -61.268  80.686  -18.041 1.00 63.28  ? 1189 ILE A HD12   1 
ATOM   3305  H  HD13   . ILE A 1 227 ? -62.380  79.643  -17.593 1.00 63.28  ? 1189 ILE A HD13   1 
ATOM   3306  N  N      . PRO A 1 228 ? -63.203  84.740  -19.733 1.00 64.21  ? 1190 PRO A N      1 
ATOM   3307  C  CA     . PRO A 1 228 ? -62.278  85.550  -20.530 1.00 65.88  ? 1190 PRO A CA     1 
ATOM   3308  C  C      . PRO A 1 228 ? -60.838  85.112  -20.341 1.00 64.13  ? 1190 PRO A C      1 
ATOM   3309  O  O      . PRO A 1 228 ? -60.568  84.090  -19.701 1.00 64.06  ? 1190 PRO A O      1 
ATOM   3310  C  CB     . PRO A 1 228 ? -62.509  86.961  -19.985 1.00 69.50  ? 1190 PRO A CB     1 
ATOM   3311  C  CG     . PRO A 1 228 ? -62.802  86.724  -18.533 1.00 67.22  ? 1190 PRO A CG     1 
ATOM   3312  C  CD     . PRO A 1 228 ? -63.516  85.386  -18.445 1.00 64.66  ? 1190 PRO A CD     1 
ATOM   3313  H  HA     . PRO A 1 228 ? -62.513  85.518  -21.471 1.00 79.06  ? 1190 PRO A HA     1 
ATOM   3314  H  HB2    . PRO A 1 228 ? -61.707  87.495  -20.096 1.00 83.40  ? 1190 PRO A HB2    1 
ATOM   3315  H  HB3    . PRO A 1 228 ? -63.266  87.370  -20.431 1.00 83.40  ? 1190 PRO A HB3    1 
ATOM   3316  H  HG2    . PRO A 1 228 ? -61.969  86.696  -18.037 1.00 80.67  ? 1190 PRO A HG2    1 
ATOM   3317  H  HG3    . PRO A 1 228 ? -63.371  87.434  -18.199 1.00 80.67  ? 1190 PRO A HG3    1 
ATOM   3318  H  HD2    . PRO A 1 228 ? -63.162  84.862  -17.710 1.00 77.59  ? 1190 PRO A HD2    1 
ATOM   3319  H  HD3    . PRO A 1 228 ? -64.473  85.520  -18.359 1.00 77.59  ? 1190 PRO A HD3    1 
ATOM   3320  N  N      . VAL A 1 229 ? -59.908  85.879  -20.897 1.00 62.17  ? 1191 VAL A N      1 
ATOM   3321  C  CA     . VAL A 1 229 ? -58.486  85.714  -20.632 1.00 59.28  ? 1191 VAL A CA     1 
ATOM   3322  C  C      . VAL A 1 229 ? -58.109  86.820  -19.652 1.00 59.88  ? 1191 VAL A C      1 
ATOM   3323  O  O      . VAL A 1 229 ? -57.875  87.966  -20.048 1.00 62.91  ? 1191 VAL A O      1 
ATOM   3324  C  CB     . VAL A 1 229 ? -57.658  85.775  -21.918 1.00 58.45  ? 1191 VAL A CB     1 
ATOM   3325  C  CG1    . VAL A 1 229 ? -56.179  85.599  -21.608 1.00 57.69  ? 1191 VAL A CG1    1 
ATOM   3326  C  CG2    . VAL A 1 229 ? -58.138  84.713  -22.903 1.00 57.60  ? 1191 VAL A CG2    1 
ATOM   3327  H  H      . VAL A 1 229 ? -60.082  86.519  -21.444 1.00 74.60  ? 1191 VAL A H      1 
ATOM   3328  H  HA     . VAL A 1 229 ? -58.331  84.857  -20.205 1.00 71.14  ? 1191 VAL A HA     1 
ATOM   3329  H  HB     . VAL A 1 229 ? -57.778  86.644  -22.331 1.00 70.14  ? 1191 VAL A HB     1 
ATOM   3330  H  HG11   . VAL A 1 229 ? -55.676  85.641  -22.436 1.00 69.22  ? 1191 VAL A HG11   1 
ATOM   3331  H  HG12   . VAL A 1 229 ? -55.895  86.310  -21.012 1.00 69.22  ? 1191 VAL A HG12   1 
ATOM   3332  H  HG13   . VAL A 1 229 ? -56.046  84.738  -21.183 1.00 69.22  ? 1191 VAL A HG13   1 
ATOM   3333  H  HG21   . VAL A 1 229 ? -57.602  84.767  -23.710 1.00 69.12  ? 1191 VAL A HG21   1 
ATOM   3334  H  HG22   . VAL A 1 229 ? -58.038  83.838  -22.498 1.00 69.12  ? 1191 VAL A HG22   1 
ATOM   3335  H  HG23   . VAL A 1 229 ? -59.071  84.876  -23.113 1.00 69.12  ? 1191 VAL A HG23   1 
ATOM   3336  N  N      . LEU A 1 230 ? -58.056  86.478  -18.362 1.00 56.11  ? 1192 LEU A N      1 
ATOM   3337  C  CA     . LEU A 1 230 ? -57.845  87.493  -17.334 1.00 56.26  ? 1192 LEU A CA     1 
ATOM   3338  C  C      . LEU A 1 230 ? -56.504  88.193  -17.498 1.00 58.36  ? 1192 LEU A C      1 
ATOM   3339  O  O      . LEU A 1 230 ? -56.368  89.365  -17.129 1.00 60.32  ? 1192 LEU A O      1 
ATOM   3340  C  CB     . LEU A 1 230 ? -57.948  86.863  -15.944 1.00 53.24  ? 1192 LEU A CB     1 
ATOM   3341  C  CG     . LEU A 1 230 ? -59.320  86.305  -15.559 1.00 51.55  ? 1192 LEU A CG     1 
ATOM   3342  C  CD1    . LEU A 1 230 ? -59.231  85.546  -14.244 1.00 49.14  ? 1192 LEU A CD1    1 
ATOM   3343  C  CD2    . LEU A 1 230 ? -60.360  87.415  -15.472 1.00 53.36  ? 1192 LEU A CD2    1 
ATOM   3344  H  H      . LEU A 1 230 ? -58.138  85.676  -18.062 1.00 67.33  ? 1192 LEU A H      1 
ATOM   3345  H  HA     . LEU A 1 230 ? -58.542  88.164  -17.409 1.00 67.51  ? 1192 LEU A HA     1 
ATOM   3346  H  HB2    . LEU A 1 230 ? -57.314  86.131  -15.894 1.00 63.89  ? 1192 LEU A HB2    1 
ATOM   3347  H  HB3    . LEU A 1 230 ? -57.715  87.537  -15.286 1.00 63.89  ? 1192 LEU A HB3    1 
ATOM   3348  H  HG     . LEU A 1 230 ? -59.608  85.681  -16.244 1.00 61.86  ? 1192 LEU A HG     1 
ATOM   3349  H  HD11   . LEU A 1 230 ? -60.109  85.201  -14.018 1.00 58.97  ? 1192 LEU A HD11   1 
ATOM   3350  H  HD12   . LEU A 1 230 ? -58.604  84.813  -14.345 1.00 58.97  ? 1192 LEU A HD12   1 
ATOM   3351  H  HD13   . LEU A 1 230 ? -58.925  86.151  -13.550 1.00 58.97  ? 1192 LEU A HD13   1 
ATOM   3352  H  HD21   . LEU A 1 230 ? -61.215  87.027  -15.226 1.00 64.04  ? 1192 LEU A HD21   1 
ATOM   3353  H  HD22   . LEU A 1 230 ? -60.082  88.055  -14.799 1.00 64.04  ? 1192 LEU A HD22   1 
ATOM   3354  H  HD23   . LEU A 1 230 ? -60.430  87.850  -16.335 1.00 64.04  ? 1192 LEU A HD23   1 
ATOM   3355  N  N      . GLN A 1 231 ? -55.503  87.499  -18.043 1.00 57.81  ? 1193 GLN A N      1 
ATOM   3356  C  CA     . GLN A 1 231 ? -54.201  88.119  -18.257 1.00 62.89  ? 1193 GLN A CA     1 
ATOM   3357  C  C      . GLN A 1 231 ? -54.220  89.142  -19.384 1.00 66.47  ? 1193 GLN A C      1 
ATOM   3358  O  O      . GLN A 1 231 ? -53.214  89.828  -19.590 1.00 67.66  ? 1193 GLN A O      1 
ATOM   3359  C  CB     . GLN A 1 231 ? -53.156  87.044  -18.557 1.00 61.50  ? 1193 GLN A CB     1 
ATOM   3360  C  CG     . GLN A 1 231 ? -52.773  86.206  -17.351 1.00 59.75  ? 1193 GLN A CG     1 
ATOM   3361  C  CD     . GLN A 1 231 ? -52.042  84.938  -17.737 1.00 58.34  ? 1193 GLN A CD     1 
ATOM   3362  O  OE1    . GLN A 1 231 ? -52.659  83.894  -17.948 1.00 56.95  ? 1193 GLN A OE1    1 
ATOM   3363  N  NE2    . GLN A 1 231 ? -50.720  85.023  -17.836 1.00 58.41  ? 1193 GLN A NE2    1 
ATOM   3364  H  H      . GLN A 1 231 ? -55.553  86.678  -18.294 1.00 69.37  ? 1193 GLN A H      1 
ATOM   3365  H  HA     . GLN A 1 231 ? -53.934  88.576  -17.445 1.00 75.46  ? 1193 GLN A HA     1 
ATOM   3366  H  HB2    . GLN A 1 231 ? -53.508  86.446  -19.234 1.00 73.80  ? 1193 GLN A HB2    1 
ATOM   3367  H  HB3    . GLN A 1 231 ? -52.351  87.475  -18.886 1.00 73.80  ? 1193 GLN A HB3    1 
ATOM   3368  H  HG2    . GLN A 1 231 ? -52.190  86.726  -16.775 1.00 71.70  ? 1193 GLN A HG2    1 
ATOM   3369  H  HG3    . GLN A 1 231 ? -53.577  85.955  -16.871 1.00 71.70  ? 1193 GLN A HG3    1 
ATOM   3370  H  HE21   . GLN A 1 231 ? -50.324  85.771  -17.684 1.00 70.10  ? 1193 GLN A HE21   1 
ATOM   3371  H  HE22   . GLN A 1 231 ? -50.260  84.330  -18.053 1.00 70.10  ? 1193 GLN A HE22   1 
ATOM   3372  N  N      . GLU A 1 232 ? -55.334  89.262  -20.105 1.00 66.86  ? 1194 GLU A N      1 
ATOM   3373  C  CA     . GLU A 1 232 ? -55.478  90.236  -21.180 1.00 73.29  ? 1194 GLU A CA     1 
ATOM   3374  C  C      . GLU A 1 232 ? -56.548  91.276  -20.872 1.00 74.66  ? 1194 GLU A C      1 
ATOM   3375  O  O      . GLU A 1 232 ? -56.913  92.056  -21.759 1.00 75.33  ? 1194 GLU A O      1 
ATOM   3376  C  CB     . GLU A 1 232 ? -55.798  89.521  -22.497 1.00 72.15  ? 1194 GLU A CB     1 
ATOM   3377  C  CG     . GLU A 1 232 ? -54.623  88.744  -23.070 1.00 73.46  ? 1194 GLU A CG     1 
ATOM   3378  C  CD     . GLU A 1 232 ? -54.939  88.095  -24.405 1.00 76.06  ? 1194 GLU A CD     1 
ATOM   3379  O  OE1    . GLU A 1 232 ? -56.131  87.844  -24.685 1.00 75.23  ? 1194 GLU A OE1    1 
ATOM   3380  O  OE2    . GLU A 1 232 ? -53.991  87.836  -25.178 1.00 77.45  1 1194 GLU A OE2    1 
ATOM   3381  H  H      . GLU A 1 232 ? -56.035  88.779  -19.985 1.00 80.23  ? 1194 GLU A H      1 
ATOM   3382  H  HA     . GLU A 1 232 ? -54.636  90.702  -21.293 1.00 87.95  ? 1194 GLU A HA     1 
ATOM   3383  H  HB2    . GLU A 1 232 ? -56.523  88.895  -22.345 1.00 86.58  ? 1194 GLU A HB2    1 
ATOM   3384  H  HB3    . GLU A 1 232 ? -56.067  90.182  -23.154 1.00 86.58  ? 1194 GLU A HB3    1 
ATOM   3385  H  HG2    . GLU A 1 232 ? -53.878  89.351  -23.201 1.00 88.15  ? 1194 GLU A HG2    1 
ATOM   3386  H  HG3    . GLU A 1 232 ? -54.375  88.043  -22.447 1.00 88.15  ? 1194 GLU A HG3    1 
ATOM   3387  N  N      . ILE A 1 233 ? -57.061  91.303  -19.645 1.00 73.91  ? 1195 ILE A N      1 
ATOM   3388  C  CA     . ILE A 1 233 ? -58.029  92.301  -19.208 1.00 76.14  ? 1195 ILE A CA     1 
ATOM   3389  C  C      . ILE A 1 233 ? -57.308  93.264  -18.277 1.00 80.16  ? 1195 ILE A C      1 
ATOM   3390  O  O      . ILE A 1 233 ? -56.623  92.840  -17.338 1.00 78.63  ? 1195 ILE A O      1 
ATOM   3391  C  CB     . ILE A 1 233 ? -59.239  91.653  -18.512 1.00 73.55  ? 1195 ILE A CB     1 
ATOM   3392  C  CG1    . ILE A 1 233 ? -60.077  90.888  -19.540 1.00 71.98  ? 1195 ILE A CG1    1 
ATOM   3393  C  CG2    . ILE A 1 233 ? -60.085  92.713  -17.792 1.00 76.11  ? 1195 ILE A CG2    1 
ATOM   3394  C  CD1    . ILE A 1 233 ? -61.278  90.163  -18.962 1.00 70.38  ? 1195 ILE A CD1    1 
ATOM   3395  H  H      . ILE A 1 233 ? -56.857  90.736  -19.031 1.00 88.69  ? 1195 ILE A H      1 
ATOM   3396  H  HA     . ILE A 1 233 ? -58.348  92.800  -19.976 1.00 91.37  ? 1195 ILE A HA     1 
ATOM   3397  H  HB     . ILE A 1 233 ? -58.911  91.021  -17.853 1.00 88.26  ? 1195 ILE A HB     1 
ATOM   3398  H  HG12   . ILE A 1 233 ? -60.404  91.517  -20.202 1.00 86.37  ? 1195 ILE A HG12   1 
ATOM   3399  H  HG13   . ILE A 1 233 ? -59.513  90.226  -19.970 1.00 86.37  ? 1195 ILE A HG13   1 
ATOM   3400  H  HG21   . ILE A 1 233 ? -60.839  92.277  -17.363 1.00 91.33  ? 1195 ILE A HG21   1 
ATOM   3401  H  HG22   . ILE A 1 233 ? -59.536  93.155  -17.125 1.00 91.33  ? 1195 ILE A HG22   1 
ATOM   3402  H  HG23   . ILE A 1 233 ? -60.402  93.359  -18.442 1.00 91.33  ? 1195 ILE A HG23   1 
ATOM   3403  H  HD11   . ILE A 1 233 ? -61.748  89.709  -19.679 1.00 84.46  ? 1195 ILE A HD11   1 
ATOM   3404  H  HD12   . ILE A 1 233 ? -60.971  89.517  -18.307 1.00 84.46  ? 1195 ILE A HD12   1 
ATOM   3405  H  HD13   . ILE A 1 233 ? -61.864  90.810  -18.540 1.00 84.46  ? 1195 ILE A HD13   1 
ATOM   3406  N  N      . TYR A 1 234 ? -57.460  94.556  -18.540 1.00 86.61  ? 1196 TYR A N      1 
ATOM   3407  C  CA     . TYR A 1 234 ? -56.795  95.591  -17.765 1.00 95.31  ? 1196 TYR A CA     1 
ATOM   3408  C  C      . TYR A 1 234 ? -57.365  96.936  -18.180 1.00 103.90 ? 1196 TYR A C      1 
ATOM   3409  O  O      . TYR A 1 234 ? -57.925  97.081  -19.270 1.00 103.16 ? 1196 TYR A O      1 
ATOM   3410  C  CB     . TYR A 1 234 ? -55.277  95.560  -17.972 1.00 96.43  ? 1196 TYR A CB     1 
ATOM   3411  C  CG     . TYR A 1 234 ? -54.866  95.498  -19.423 1.00 99.13  ? 1196 TYR A CG     1 
ATOM   3412  C  CD1    . TYR A 1 234 ? -54.854  96.638  -20.214 1.00 104.37 ? 1196 TYR A CD1    1 
ATOM   3413  C  CD2    . TYR A 1 234 ? -54.483  94.295  -20.000 1.00 97.14  ? 1196 TYR A CD2    1 
ATOM   3414  C  CE1    . TYR A 1 234 ? -54.479  96.580  -21.541 1.00 106.32 ? 1196 TYR A CE1    1 
ATOM   3415  C  CE2    . TYR A 1 234 ? -54.104  94.226  -21.324 1.00 98.55  ? 1196 TYR A CE2    1 
ATOM   3416  C  CZ     . TYR A 1 234 ? -54.103  95.372  -22.091 1.00 104.00 ? 1196 TYR A CZ     1 
ATOM   3417  O  OH     . TYR A 1 234 ? -53.727  95.310  -23.413 1.00 106.05 ? 1196 TYR A OH     1 
ATOM   3418  H  H      . TYR A 1 234 ? -57.954  94.862  -19.175 1.00 103.94 ? 1196 TYR A H      1 
ATOM   3419  H  HA     . TYR A 1 234 ? -56.979  95.457  -16.822 1.00 114.37 ? 1196 TYR A HA     1 
ATOM   3420  H  HB2    . TYR A 1 234 ? -54.892  96.363  -17.588 1.00 115.72 ? 1196 TYR A HB2    1 
ATOM   3421  H  HB3    . TYR A 1 234 ? -54.917  94.776  -17.527 1.00 115.72 ? 1196 TYR A HB3    1 
ATOM   3422  H  HD1    . TYR A 1 234 ? -55.108  97.453  -19.846 1.00 125.24 ? 1196 TYR A HD1    1 
ATOM   3423  H  HD2    . TYR A 1 234 ? -54.483  93.521  -19.484 1.00 116.57 ? 1196 TYR A HD2    1 
ATOM   3424  H  HE1    . TYR A 1 234 ? -54.477  97.351  -22.060 1.00 127.59 ? 1196 TYR A HE1    1 
ATOM   3425  H  HE2    . TYR A 1 234 ? -53.851  93.413  -21.697 1.00 118.26 ? 1196 TYR A HE2    1 
ATOM   3426  H  HH     . TYR A 1 234 ? -53.524  94.521  -23.617 1.00 127.26 ? 1196 TYR A HH     1 
ATOM   3427  N  N      . LYS A 1 235 ? -57.214  97.920  -17.300 1.00 110.97 ? 1197 LYS A N      1 
ATOM   3428  C  CA     . LYS A 1 235 ? -57.505  99.294  -17.680 1.00 120.15 ? 1197 LYS A CA     1 
ATOM   3429  C  C      . LYS A 1 235 ? -56.420  99.762  -18.643 1.00 122.55 ? 1197 LYS A C      1 
ATOM   3430  O  O      . LYS A 1 235 ? -55.233  99.757  -18.301 1.00 126.06 ? 1197 LYS A O      1 
ATOM   3431  C  CB     . LYS A 1 235 ? -57.570  100.187 -16.445 1.00 123.92 ? 1197 LYS A CB     1 
ATOM   3432  C  CG     . LYS A 1 235 ? -58.714  99.846  -15.494 1.00 122.59 ? 1197 LYS A CG     1 
ATOM   3433  C  CD     . LYS A 1 235 ? -58.289  98.842  -14.427 1.00 118.90 ? 1197 LYS A CD     1 
ATOM   3434  C  CE     . LYS A 1 235 ? -59.389  98.616  -13.401 1.00 117.16 ? 1197 LYS A CE     1 
ATOM   3435  N  NZ     . LYS A 1 235 ? -58.916  97.853  -12.214 1.00 113.99 1 1197 LYS A NZ     1 
ATOM   3436  H  H      . LYS A 1 235 ? -56.949  97.820  -16.488 1.00 133.16 ? 1197 LYS A H      1 
ATOM   3437  H  HA     . LYS A 1 235 ? -58.360  99.332  -18.135 1.00 144.18 ? 1197 LYS A HA     1 
ATOM   3438  H  HB2    . LYS A 1 235 ? -56.739  100.099 -15.952 1.00 148.71 ? 1197 LYS A HB2    1 
ATOM   3439  H  HB3    . LYS A 1 235 ? -57.686  101.107 -16.730 1.00 148.71 ? 1197 LYS A HB3    1 
ATOM   3440  H  HG2    . LYS A 1 235 ? -59.009  100.655 -15.047 1.00 147.11 ? 1197 LYS A HG2    1 
ATOM   3441  H  HG3    . LYS A 1 235 ? -59.444  99.458  -16.000 1.00 147.11 ? 1197 LYS A HG3    1 
ATOM   3442  H  HD2    . LYS A 1 235 ? -58.089  97.992  -14.849 1.00 142.68 ? 1197 LYS A HD2    1 
ATOM   3443  H  HD3    . LYS A 1 235 ? -57.507  99.179  -13.964 1.00 142.68 ? 1197 LYS A HD3    1 
ATOM   3444  H  HE2    . LYS A 1 235 ? -59.717  99.476  -13.095 1.00 140.59 ? 1197 LYS A HE2    1 
ATOM   3445  H  HE3    . LYS A 1 235 ? -60.109  98.114  -13.814 1.00 140.59 ? 1197 LYS A HE3    1 
ATOM   3446  H  HZ1    . LYS A 1 235 ? -59.586  97.741  -11.638 1.00 136.78 ? 1197 LYS A HZ1    1 
ATOM   3447  H  HZ2    . LYS A 1 235 ? -58.615  97.054  -12.466 1.00 136.78 ? 1197 LYS A HZ2    1 
ATOM   3448  H  HZ3    . LYS A 1 235 ? -58.258  98.296  -11.810 1.00 136.78 ? 1197 LYS A HZ3    1 
ATOM   3449  N  N      . GLY A 1 236 ? -56.828  100.161 -19.843 1.00 118.60 ? 1198 GLY A N      1 
ATOM   3450  C  CA     . GLY A 1 236 ? -55.897  100.432 -20.924 1.00 117.97 ? 1198 GLY A CA     1 
ATOM   3451  C  C      . GLY A 1 236 ? -54.772  101.394 -20.601 1.00 124.43 ? 1198 GLY A C      1 
ATOM   3452  O  O      . GLY A 1 236 ? -54.753  101.983 -19.522 1.00 122.52 ? 1198 GLY A O      1 
ATOM   3453  H  H      . GLY A 1 236 ? -57.652  100.282 -20.057 1.00 142.32 ? 1198 GLY A H      1 
ATOM   3454  H  HA2    . GLY A 1 236 ? -55.497  99.595  -21.208 1.00 141.57 ? 1198 GLY A HA2    1 
ATOM   3455  H  HA3    . GLY A 1 236 ? -56.390  100.796 -21.676 1.00 141.57 ? 1198 GLY A HA3    1 
ATOM   3456  N  N      . GLU A 1 237 ? -53.822  101.563 -21.523 1.00 135.78 ? 1199 GLU A N      1 
ATOM   3457  C  CA     . GLU A 1 237 ? -53.831  100.897 -22.830 1.00 136.48 ? 1199 GLU A CA     1 
ATOM   3458  C  C      . GLU A 1 237 ? -53.003  99.615  -22.805 1.00 132.85 ? 1199 GLU A C      1 
ATOM   3459  O  O      . GLU A 1 237 ? -53.379  98.619  -23.422 1.00 133.01 ? 1199 GLU A O      1 
ATOM   3460  C  CB     . GLU A 1 237 ? -53.309  101.827 -23.925 1.00 141.56 ? 1199 GLU A CB     1 
ATOM   3461  C  CG     . GLU A 1 237 ? -51.896  102.340 -23.716 1.00 143.71 ? 1199 GLU A CG     1 
ATOM   3462  C  CD     . GLU A 1 237 ? -51.452  103.272 -24.827 1.00 147.68 ? 1199 GLU A CD     1 
ATOM   3463  O  OE1    . GLU A 1 237 ? -52.100  103.273 -25.895 1.00 148.18 ? 1199 GLU A OE1    1 
ATOM   3464  O  OE2    . GLU A 1 237 ? -50.457  104.002 -24.634 1.00 150.55 1 1199 GLU A OE2    1 
ATOM   3465  H  H      . GLU A 1 237 ? -53.141  102.075 -21.411 1.00 162.93 ? 1199 GLU A H      1 
ATOM   3466  H  HA     . GLU A 1 237 ? -54.744  100.657 -23.053 1.00 163.77 ? 1199 GLU A HA     1 
ATOM   3467  H  HB2    . GLU A 1 237 ? -53.324  101.348 -24.769 1.00 169.87 ? 1199 GLU A HB2    1 
ATOM   3468  H  HB3    . GLU A 1 237 ? -53.894  102.598 -23.980 1.00 169.87 ? 1199 GLU A HB3    1 
ATOM   3469  H  HG2    . GLU A 1 237 ? -51.856  102.828 -22.879 1.00 172.46 ? 1199 GLU A HG2    1 
ATOM   3470  H  HG3    . GLU A 1 237 ? -51.285  101.587 -23.692 1.00 172.46 ? 1199 GLU A HG3    1 
ATOM   3471  N  N      . LYS A 1 238 ? -51.874  99.642  -22.104 1.00 128.60 ? 1200 LYS A N      1 
ATOM   3472  C  CA     . LYS A 1 238 ? -50.949  98.519  -22.089 1.00 123.69 ? 1200 LYS A CA     1 
ATOM   3473  C  C      . LYS A 1 238 ? -51.150  97.640  -20.860 1.00 116.91 ? 1200 LYS A C      1 
ATOM   3474  O  O      . LYS A 1 238 ? -51.660  98.071  -19.823 1.00 117.74 ? 1200 LYS A O      1 
ATOM   3475  C  CB     . LYS A 1 238 ? -49.497  99.003  -22.130 1.00 126.88 ? 1200 LYS A CB     1 
ATOM   3476  C  CG     . LYS A 1 238 ? -49.072  99.826  -20.918 1.00 129.38 ? 1200 LYS A CG     1 
ATOM   3477  C  CD     . LYS A 1 238 ? -47.590  100.157 -20.959 1.00 131.48 ? 1200 LYS A CD     1 
ATOM   3478  C  CE     . LYS A 1 238 ? -46.752  98.898  -20.756 1.00 127.91 ? 1200 LYS A CE     1 
ATOM   3479  N  NZ     . LYS A 1 238 ? -45.294  99.171  -20.695 1.00 129.31 ? 1200 LYS A NZ     1 
ATOM   3480  H  H      . LYS A 1 238 ? -51.620  100.308 -21.623 1.00 154.32 ? 1200 LYS A H      1 
ATOM   3481  H  HA     . LYS A 1 238 ? -51.104  97.973  -22.875 1.00 148.42 ? 1200 LYS A HA     1 
ATOM   3482  H  HB2    . LYS A 1 238 ? -48.913  98.230  -22.180 1.00 152.26 ? 1200 LYS A HB2    1 
ATOM   3483  H  HB3    . LYS A 1 238 ? -49.376  99.555  -22.918 1.00 152.26 ? 1200 LYS A HB3    1 
ATOM   3484  H  HG2    . LYS A 1 238 ? -49.569  100.659 -20.907 1.00 155.25 ? 1200 LYS A HG2    1 
ATOM   3485  H  HG3    . LYS A 1 238 ? -49.248  99.320  -20.110 1.00 155.25 ? 1200 LYS A HG3    1 
ATOM   3486  H  HD2    . LYS A 1 238 ? -47.368  100.537 -21.823 1.00 157.78 ? 1200 LYS A HD2    1 
ATOM   3487  H  HD3    . LYS A 1 238 ? -47.379  100.783 -20.249 1.00 157.78 ? 1200 LYS A HD3    1 
ATOM   3488  H  HE2    . LYS A 1 238 ? -47.012  98.477  -19.922 1.00 153.49 ? 1200 LYS A HE2    1 
ATOM   3489  H  HE3    . LYS A 1 238 ? -46.911  98.291  -21.496 1.00 153.49 ? 1200 LYS A HE3    1 
ATOM   3490  H  HZ1    . LYS A 1 238 ? -44.847  98.411  -20.577 1.00 155.17 ? 1200 LYS A HZ1    1 
ATOM   3491  H  HZ2    . LYS A 1 238 ? -45.024  99.550  -21.454 1.00 155.17 ? 1200 LYS A HZ2    1 
ATOM   3492  H  HZ3    . LYS A 1 238 ? -45.116  99.720  -20.018 1.00 155.17 ? 1200 LYS A HZ3    1 
ATOM   3493  N  N      . LYS A 1 239 ? -50.723  96.393  -21.000 1.00 110.42 ? 1201 LYS A N      1 
ATOM   3494  C  CA     . LYS A 1 239 ? -50.774  95.439  -19.901 1.00 103.80 ? 1201 LYS A CA     1 
ATOM   3495  C  C      . LYS A 1 239 ? -49.791  95.840  -18.803 1.00 101.29 ? 1201 LYS A C      1 
ATOM   3496  O  O      . LYS A 1 239 ? -48.622  96.113  -19.099 1.00 105.84 ? 1201 LYS A O      1 
ATOM   3497  C  CB     . LYS A 1 239 ? -50.445  94.044  -20.436 1.00 99.83  ? 1201 LYS A CB     1 
ATOM   3498  C  CG     . LYS A 1 239 ? -50.475  92.924  -19.410 1.00 94.83  ? 1201 LYS A CG     1 
ATOM   3499  C  CD     . LYS A 1 239 ? -50.103  91.599  -20.066 1.00 90.95  ? 1201 LYS A CD     1 
ATOM   3500  C  CE     . LYS A 1 239 ? -50.178  90.433  -19.092 1.00 87.11  ? 1201 LYS A CE     1 
ATOM   3501  N  NZ     . LYS A 1 239 ? -49.911  89.127  -19.764 1.00 84.08  1 1201 LYS A NZ     1 
ATOM   3502  H  H      . LYS A 1 239 ? -50.397  96.071  -21.728 1.00 132.50 ? 1201 LYS A H      1 
ATOM   3503  H  HA     . LYS A 1 239 ? -51.668  95.423  -19.525 1.00 124.55 ? 1201 LYS A HA     1 
ATOM   3504  H  HB2    . LYS A 1 239 ? -51.087  93.822  -21.128 1.00 119.80 ? 1201 LYS A HB2    1 
ATOM   3505  H  HB3    . LYS A 1 239 ? -49.553  94.065  -20.817 1.00 119.80 ? 1201 LYS A HB3    1 
ATOM   3506  H  HG2    . LYS A 1 239 ? -49.834  93.110  -18.707 1.00 113.79 ? 1201 LYS A HG2    1 
ATOM   3507  H  HG3    . LYS A 1 239 ? -51.369  92.845  -19.043 1.00 113.79 ? 1201 LYS A HG3    1 
ATOM   3508  H  HD2    . LYS A 1 239 ? -50.716  91.422  -20.796 1.00 109.14 ? 1201 LYS A HD2    1 
ATOM   3509  H  HD3    . LYS A 1 239 ? -49.194  91.654  -20.401 1.00 109.14 ? 1201 LYS A HD3    1 
ATOM   3510  H  HE2    . LYS A 1 239 ? -49.514  90.556  -18.396 1.00 104.53 ? 1201 LYS A HE2    1 
ATOM   3511  H  HE3    . LYS A 1 239 ? -51.066  90.398  -18.705 1.00 104.53 ? 1201 LYS A HE3    1 
ATOM   3512  H  HZ1    . LYS A 1 239 ? -49.962  88.465  -19.171 1.00 100.90 ? 1201 LYS A HZ1    1 
ATOM   3513  H  HZ2    . LYS A 1 239 ? -50.512  88.987  -20.406 1.00 100.90 ? 1201 LYS A HZ2    1 
ATOM   3514  H  HZ3    . LYS A 1 239 ? -49.098  89.131  -20.124 1.00 100.90 ? 1201 LYS A HZ3    1 
ATOM   3515  N  N      . PRO A 1 240 ? -50.217  95.901  -17.539 1.00 92.67  ? 1202 PRO A N      1 
ATOM   3516  C  CA     . PRO A 1 240 ? -49.261  96.174  -16.460 1.00 89.73  ? 1202 PRO A CA     1 
ATOM   3517  C  C      . PRO A 1 240 ? -48.171  95.113  -16.413 1.00 88.84  ? 1202 PRO A C      1 
ATOM   3518  O  O      . PRO A 1 240 ? -48.395  93.945  -16.740 1.00 83.86  ? 1202 PRO A O      1 
ATOM   3519  C  CB     . PRO A 1 240 ? -50.127  96.145  -15.196 1.00 87.17  ? 1202 PRO A CB     1 
ATOM   3520  C  CG     . PRO A 1 240 ? -51.503  96.430  -15.669 1.00 86.85  ? 1202 PRO A CG     1 
ATOM   3521  C  CD     . PRO A 1 240 ? -51.600  95.824  -17.037 1.00 88.05  ? 1202 PRO A CD     1 
ATOM   3522  H  HA     . PRO A 1 240 ? -48.862  97.052  -16.566 1.00 107.68 ? 1202 PRO A HA     1 
ATOM   3523  H  HB2    . PRO A 1 240 ? -50.080  95.267  -14.786 1.00 104.60 ? 1202 PRO A HB2    1 
ATOM   3524  H  HB3    . PRO A 1 240 ? -49.828  96.829  -14.578 1.00 104.60 ? 1202 PRO A HB3    1 
ATOM   3525  H  HG2    . PRO A 1 240 ? -52.145  96.020  -15.069 1.00 104.22 ? 1202 PRO A HG2    1 
ATOM   3526  H  HG3    . PRO A 1 240 ? -51.640  97.389  -15.711 1.00 104.22 ? 1202 PRO A HG3    1 
ATOM   3527  H  HD2    . PRO A 1 240 ? -51.888  94.899  -16.978 1.00 105.66 ? 1202 PRO A HD2    1 
ATOM   3528  H  HD3    . PRO A 1 240 ? -52.194  96.347  -17.598 1.00 105.66 ? 1202 PRO A HD3    1 
ATOM   3529  N  N      . GLU A 1 241 ? -46.981  95.529  -15.989 1.00 95.09  ? 1203 GLU A N      1 
ATOM   3530  C  CA     . GLU A 1 241 ? -45.815  94.650  -15.927 1.00 96.54  ? 1203 GLU A CA     1 
ATOM   3531  C  C      . GLU A 1 241 ? -45.422  94.465  -14.464 1.00 95.97  ? 1203 GLU A C      1 
ATOM   3532  O  O      . GLU A 1 241 ? -44.784  95.336  -13.866 1.00 100.71 ? 1203 GLU A O      1 
ATOM   3533  C  CB     . GLU A 1 241 ? -44.664  95.226  -16.746 1.00 100.19 ? 1203 GLU A CB     1 
ATOM   3534  C  CG     . GLU A 1 241 ? -44.942  95.281  -18.239 1.00 101.61 ? 1203 GLU A CG     1 
ATOM   3535  C  CD     . GLU A 1 241 ? -43.817  95.930  -19.020 1.00 105.97 ? 1203 GLU A CD     1 
ATOM   3536  O  OE1    . GLU A 1 241 ? -43.154  96.835  -18.473 1.00 109.41 ? 1203 GLU A OE1    1 
ATOM   3537  O  OE2    . GLU A 1 241 ? -43.594  95.532  -20.182 1.00 106.30 1 1203 GLU A OE2    1 
ATOM   3538  H  H      . GLU A 1 241 ? -46.819  96.332  -15.727 1.00 114.11 ? 1203 GLU A H      1 
ATOM   3539  H  HA     . GLU A 1 241 ? -46.046  93.782  -16.293 1.00 115.85 ? 1203 GLU A HA     1 
ATOM   3540  H  HB2    . GLU A 1 241 ? -44.487  96.130  -16.443 1.00 120.22 ? 1203 GLU A HB2    1 
ATOM   3541  H  HB3    . GLU A 1 241 ? -43.877  94.674  -16.611 1.00 120.22 ? 1203 GLU A HB3    1 
ATOM   3542  H  HG2    . GLU A 1 241 ? -45.058  94.378  -18.572 1.00 121.93 ? 1203 GLU A HG2    1 
ATOM   3543  H  HG3    . GLU A 1 241 ? -45.749  95.797  -18.391 1.00 121.93 ? 1203 GLU A HG3    1 
ATOM   3544  N  N      . ILE A 1 242 ? -45.805  93.323  -13.899 1.00 90.43  ? 1204 ILE A N      1 
ATOM   3545  C  CA     . ILE A 1 242 ? -45.434  92.931  -12.544 1.00 87.54  ? 1204 ILE A CA     1 
ATOM   3546  C  C      . ILE A 1 242 ? -44.623  91.649  -12.671 1.00 83.94  ? 1204 ILE A C      1 
ATOM   3547  O  O      . ILE A 1 242 ? -45.175  90.587  -12.986 1.00 80.78  ? 1204 ILE A O      1 
ATOM   3548  C  CB     . ILE A 1 242 ? -46.660  92.723  -11.643 1.00 84.79  ? 1204 ILE A CB     1 
ATOM   3549  C  CG1    . ILE A 1 242 ? -47.693  93.837  -11.863 1.00 85.22  ? 1204 ILE A CG1    1 
ATOM   3550  C  CG2    . ILE A 1 242 ? -46.238  92.652  -10.181 1.00 83.52  ? 1204 ILE A CG2    1 
ATOM   3551  C  CD1    . ILE A 1 242 ? -47.190  95.235  -11.542 1.00 89.27  ? 1204 ILE A CD1    1 
ATOM   3552  H  H      . ILE A 1 242 ? -46.297  92.741  -14.296 1.00 108.52 ? 1204 ILE A H      1 
ATOM   3553  H  HA     . ILE A 1 242 ? -44.872  93.615  -12.149 1.00 105.05 ? 1204 ILE A HA     1 
ATOM   3554  H  HB     . ILE A 1 242 ? -47.071  91.878  -11.881 1.00 101.75 ? 1204 ILE A HB     1 
ATOM   3555  H  HG12   . ILE A 1 242 ? -47.964  93.829  -12.794 1.00 102.26 ? 1204 ILE A HG12   1 
ATOM   3556  H  HG13   . ILE A 1 242 ? -48.461  93.663  -11.297 1.00 102.26 ? 1204 ILE A HG13   1 
ATOM   3557  H  HG21   . ILE A 1 242 ? -47.027  92.521  -9.631  1.00 100.22 ? 1204 ILE A HG21   1 
ATOM   3558  H  HG22   . ILE A 1 242 ? -45.627  91.908  -10.065 1.00 100.22 ? 1204 ILE A HG22   1 
ATOM   3559  H  HG23   . ILE A 1 242 ? -45.799  93.482  -9.938  1.00 100.22 ? 1204 ILE A HG23   1 
ATOM   3560  H  HD11   . ILE A 1 242 ? -47.903  95.872  -11.708 1.00 107.12 ? 1204 ILE A HD11   1 
ATOM   3561  H  HD12   . ILE A 1 242 ? -46.926  95.269  -10.609 1.00 107.12 ? 1204 ILE A HD12   1 
ATOM   3562  H  HD13   . ILE A 1 242 ? -46.429  95.434  -12.109 1.00 107.12 ? 1204 ILE A HD13   1 
ATOM   3563  N  N      . PHE A 1 243 ? -43.319  91.740  -12.428 1.00 83.68  ? 1205 PHE A N      1 
ATOM   3564  C  CA     . PHE A 1 243 ? -42.400  90.646  -12.707 1.00 81.08  ? 1205 PHE A CA     1 
ATOM   3565  C  C      . PHE A 1 243 ? -42.084  89.852  -11.447 1.00 78.60  ? 1205 PHE A C      1 
ATOM   3566  O  O      . PHE A 1 243 ? -41.866  90.422  -10.373 1.00 80.46  ? 1205 PHE A O      1 
ATOM   3567  C  CB     . PHE A 1 243 ? -41.105  91.174  -13.329 1.00 82.07  ? 1205 PHE A CB     1 
ATOM   3568  C  CG     . PHE A 1 243 ? -41.249  91.570  -14.768 1.00 84.22  ? 1205 PHE A CG     1 
ATOM   3569  C  CD1    . PHE A 1 243 ? -41.312  90.604  -15.759 1.00 82.99  ? 1205 PHE A CD1    1 
ATOM   3570  C  CD2    . PHE A 1 243 ? -41.330  92.903  -15.131 1.00 88.09  ? 1205 PHE A CD2    1 
ATOM   3571  C  CE1    . PHE A 1 243 ? -41.449  90.960  -17.086 1.00 82.47  ? 1205 PHE A CE1    1 
ATOM   3572  C  CE2    . PHE A 1 243 ? -41.467  93.266  -16.458 1.00 89.09  ? 1205 PHE A CE2    1 
ATOM   3573  C  CZ     . PHE A 1 243 ? -41.527  92.292  -17.436 1.00 86.30  ? 1205 PHE A CZ     1 
ATOM   3574  H  H      . PHE A 1 243 ? -42.938  92.437  -12.097 1.00 100.42 ? 1205 PHE A H      1 
ATOM   3575  H  HA     . PHE A 1 243 ? -42.813  90.043  -13.345 1.00 97.29  ? 1205 PHE A HA     1 
ATOM   3576  H  HB2    . PHE A 1 243 ? -40.816  91.956  -12.833 1.00 98.49  ? 1205 PHE A HB2    1 
ATOM   3577  H  HB3    . PHE A 1 243 ? -40.427  90.482  -13.277 1.00 98.49  ? 1205 PHE A HB3    1 
ATOM   3578  H  HD1    . PHE A 1 243 ? -41.261  89.705  -15.528 1.00 99.59  ? 1205 PHE A HD1    1 
ATOM   3579  H  HD2    . PHE A 1 243 ? -41.290  93.562  -14.476 1.00 105.71 ? 1205 PHE A HD2    1 
ATOM   3580  H  HE1    . PHE A 1 243 ? -41.489  90.302  -17.743 1.00 98.96  ? 1205 PHE A HE1    1 
ATOM   3581  H  HE2    . PHE A 1 243 ? -41.519  94.164  -16.692 1.00 106.90 ? 1205 PHE A HE2    1 
ATOM   3582  H  HZ     . PHE A 1 243 ? -41.619  92.534  -18.330 1.00 103.56 ? 1205 PHE A HZ     1 
ATOM   3583  N  N      . VAL A 1 244 ? -42.065  88.528  -11.592 1.00 75.61  ? 1206 VAL A N      1 
ATOM   3584  C  CA     . VAL A 1 244 ? -41.661  87.608  -10.535 1.00 75.75  ? 1206 VAL A CA     1 
ATOM   3585  C  C      . VAL A 1 244 ? -40.789  86.537  -11.173 1.00 78.73  ? 1206 VAL A C      1 
ATOM   3586  O  O      . VAL A 1 244 ? -41.244  85.816  -12.068 1.00 73.77  ? 1206 VAL A O      1 
ATOM   3587  C  CB     . VAL A 1 244 ? -42.869  86.965  -9.829  1.00 73.93  ? 1206 VAL A CB     1 
ATOM   3588  C  CG1    . VAL A 1 244 ? -42.414  85.935  -8.798  1.00 72.78  ? 1206 VAL A CG1    1 
ATOM   3589  C  CG2    . VAL A 1 244 ? -43.723  88.036  -9.170  1.00 76.08  ? 1206 VAL A CG2    1 
ATOM   3590  H  H      . VAL A 1 244 ? -42.290  88.128  -12.320 1.00 90.73  ? 1206 VAL A H      1 
ATOM   3591  H  HA     . VAL A 1 244 ? -41.134  88.083  -9.874  1.00 90.91  ? 1206 VAL A HA     1 
ATOM   3592  H  HB     . VAL A 1 244 ? -43.415  86.509  -10.489 1.00 88.71  ? 1206 VAL A HB     1 
ATOM   3593  H  HG11   . VAL A 1 244 ? -43.195  85.549  -8.372  1.00 87.34  ? 1206 VAL A HG11   1 
ATOM   3594  H  HG12   . VAL A 1 244 ? -41.906  85.242  -9.247  1.00 87.34  ? 1206 VAL A HG12   1 
ATOM   3595  H  HG13   . VAL A 1 244 ? -41.859  86.376  -8.135  1.00 87.34  ? 1206 VAL A HG13   1 
ATOM   3596  H  HG21   . VAL A 1 244 ? -44.478  87.612  -8.732  1.00 91.29  ? 1206 VAL A HG21   1 
ATOM   3597  H  HG22   . VAL A 1 244 ? -43.185  88.511  -8.518  1.00 91.29  ? 1206 VAL A HG22   1 
ATOM   3598  H  HG23   . VAL A 1 244 ? -44.039  88.651  -9.851  1.00 91.29  ? 1206 VAL A HG23   1 
ATOM   3599  N  N      . ASP A 1 245 ? -39.545  86.422  -10.710 1.00 88.81  ? 1207 ASP A N      1 
ATOM   3600  C  CA     . ASP A 1 245 ? -38.604  85.447  -11.258 1.00 91.40  ? 1207 ASP A CA     1 
ATOM   3601  C  C      . ASP A 1 245 ? -38.505  85.570  -12.777 1.00 92.11  ? 1207 ASP A C      1 
ATOM   3602  O  O      . ASP A 1 245 ? -38.327  84.576  -13.485 1.00 94.20  ? 1207 ASP A O      1 
ATOM   3603  C  CB     . ASP A 1 245 ? -38.992  84.022  -10.856 1.00 90.29  ? 1207 ASP A CB     1 
ATOM   3604  C  CG     . ASP A 1 245 ? -38.856  83.779  -9.364  1.00 91.05  ? 1207 ASP A CG     1 
ATOM   3605  O  OD1    . ASP A 1 245 ? -38.104  84.529  -8.704  1.00 94.30  ? 1207 ASP A OD1    1 
ATOM   3606  O  OD2    . ASP A 1 245 ? -39.500  82.839  -8.851  1.00 87.01  1 1207 ASP A OD2    1 
ATOM   3607  H  H      . ASP A 1 245 ? -39.220  86.901  -10.074 1.00 106.57 ? 1207 ASP A H      1 
ATOM   3608  H  HA     . ASP A 1 245 ? -37.724  85.626  -10.891 1.00 109.68 ? 1207 ASP A HA     1 
ATOM   3609  H  HB2    . ASP A 1 245 ? -39.917  83.864  -11.103 1.00 108.35 ? 1207 ASP A HB2    1 
ATOM   3610  H  HB3    . ASP A 1 245 ? -38.414  83.394  -11.317 1.00 108.35 ? 1207 ASP A HB3    1 
ATOM   3611  N  N      . GLY A 1 246 ? -38.626  86.793  -13.287 1.00 85.56  ? 1208 GLY A N      1 
ATOM   3612  C  CA     . GLY A 1 246 ? -38.441  87.051  -14.700 1.00 81.56  ? 1208 GLY A CA     1 
ATOM   3613  C  C      . GLY A 1 246 ? -39.685  86.968  -15.559 1.00 77.80  ? 1208 GLY A C      1 
ATOM   3614  O  O      . GLY A 1 246 ? -39.573  87.086  -16.785 1.00 77.22  ? 1208 GLY A O      1 
ATOM   3615  H  H      . GLY A 1 246 ? -38.816  87.494  -12.826 1.00 102.67 ? 1208 GLY A H      1 
ATOM   3616  H  HA2    . GLY A 1 246 ? -38.068  87.940  -14.807 1.00 97.88  ? 1208 GLY A HA2    1 
ATOM   3617  H  HA3    . GLY A 1 246 ? -37.798  86.415  -15.051 1.00 97.88  ? 1208 GLY A HA3    1 
ATOM   3618  N  N      . TRP A 1 247 ? -40.864  86.785  -14.964 1.00 74.45  ? 1209 TRP A N      1 
ATOM   3619  C  CA     . TRP A 1 247 ? -42.098  86.593  -15.716 1.00 72.70  ? 1209 TRP A CA     1 
ATOM   3620  C  C      . TRP A 1 247 ? -43.164  87.558  -15.224 1.00 72.77  ? 1209 TRP A C      1 
ATOM   3621  O  O      . TRP A 1 247 ? -43.255  87.841  -14.026 1.00 76.03  ? 1209 TRP A O      1 
ATOM   3622  C  CB     . TRP A 1 247 ? -42.617  85.156  -15.587 1.00 69.43  ? 1209 TRP A CB     1 
ATOM   3623  C  CG     . TRP A 1 247 ? -41.644  84.114  -16.042 1.00 69.84  ? 1209 TRP A CG     1 
ATOM   3624  C  CD1    . TRP A 1 247 ? -40.917  83.269  -15.255 1.00 70.10  ? 1209 TRP A CD1    1 
ATOM   3625  C  CD2    . TRP A 1 247 ? -41.290  83.807  -17.394 1.00 71.07  ? 1209 TRP A CD2    1 
ATOM   3626  N  NE1    . TRP A 1 247 ? -40.134  82.451  -16.035 1.00 68.73  ? 1209 TRP A NE1    1 
ATOM   3627  C  CE2    . TRP A 1 247 ? -40.345  82.762  -17.352 1.00 70.78  ? 1209 TRP A CE2    1 
ATOM   3628  C  CE3    . TRP A 1 247 ? -41.682  84.313  -18.638 1.00 70.74  ? 1209 TRP A CE3    1 
ATOM   3629  C  CZ2    . TRP A 1 247 ? -39.784  82.217  -18.506 1.00 72.43  ? 1209 TRP A CZ2    1 
ATOM   3630  C  CZ3    . TRP A 1 247 ? -41.124  83.771  -19.781 1.00 70.67  ? 1209 TRP A CZ3    1 
ATOM   3631  C  CH2    . TRP A 1 247 ? -40.186  82.733  -19.707 1.00 71.10  ? 1209 TRP A CH2    1 
ATOM   3632  H  H      . TRP A 1 247 ? -40.974  86.768  -14.112 1.00 89.33  ? 1209 TRP A H      1 
ATOM   3633  H  HA     . TRP A 1 247 ? -41.933  86.774  -16.655 1.00 87.24  ? 1209 TRP A HA     1 
ATOM   3634  H  HB2    . TRP A 1 247 ? -42.824  84.982  -14.655 1.00 83.32  ? 1209 TRP A HB2    1 
ATOM   3635  H  HB3    . TRP A 1 247 ? -43.420  85.065  -16.123 1.00 83.32  ? 1209 TRP A HB3    1 
ATOM   3636  H  HD1    . TRP A 1 247 ? -40.950  83.246  -14.326 1.00 84.12  ? 1209 TRP A HD1    1 
ATOM   3637  H  HE1    . TRP A 1 247 ? -39.598  81.845  -15.743 1.00 82.47  ? 1209 TRP A HE1    1 
ATOM   3638  H  HE3    . TRP A 1 247 ? -42.305  85.002  -18.694 1.00 84.89  ? 1209 TRP A HE3    1 
ATOM   3639  H  HZ2    . TRP A 1 247 ? -39.160  81.529  -18.461 1.00 86.91  ? 1209 TRP A HZ2    1 
ATOM   3640  H  HZ3    . TRP A 1 247 ? -41.378  84.099  -20.613 1.00 84.80  ? 1209 TRP A HZ3    1 
ATOM   3641  H  HH2    . TRP A 1 247 ? -39.828  82.387  -20.493 1.00 85.32  ? 1209 TRP A HH2    1 
ATOM   3642  N  N      . ASN A 1 248 ? -43.967  88.064  -16.158 1.00 69.48  ? 1210 ASN A N      1 
ATOM   3643  C  CA     . ASN A 1 248 ? -45.077  88.948  -15.826 1.00 68.80  ? 1210 ASN A CA     1 
ATOM   3644  C  C      . ASN A 1 248 ? -46.236  88.123  -15.275 1.00 66.61  ? 1210 ASN A C      1 
ATOM   3645  O  O      . ASN A 1 248 ? -46.796  87.279  -15.983 1.00 62.56  ? 1210 ASN A O      1 
ATOM   3646  C  CB     . ASN A 1 248 ? -45.512  89.742  -17.056 1.00 69.28  ? 1210 ASN A CB     1 
ATOM   3647  C  CG     . ASN A 1 248 ? -46.563  90.786  -16.734 1.00 70.79  ? 1210 ASN A CG     1 
ATOM   3648  O  OD1    . ASN A 1 248 ? -46.944  90.964  -15.578 1.00 72.52  ? 1210 ASN A OD1    1 
ATOM   3649  N  ND2    . ASN A 1 248 ? -47.027  91.492  -17.756 1.00 71.62  ? 1210 ASN A ND2    1 
ATOM   3650  H  H      . ASN A 1 248 ? -43.886  87.908  -17.000 1.00 83.38  ? 1210 ASN A H      1 
ATOM   3651  H  HA     . ASN A 1 248 ? -44.796  89.575  -15.141 1.00 82.56  ? 1210 ASN A HA     1 
ATOM   3652  H  HB2    . ASN A 1 248 ? -44.741  90.197  -17.428 1.00 83.14  ? 1210 ASN A HB2    1 
ATOM   3653  H  HB3    . ASN A 1 248 ? -45.886  89.132  -17.710 1.00 83.14  ? 1210 ASN A HB3    1 
ATOM   3654  H  HD21   . ASN A 1 248 ? -47.624  92.097  -17.624 1.00 85.95  ? 1210 ASN A HD21   1 
ATOM   3655  H  HD22   . ASN A 1 248 ? -46.730  91.346  -18.549 1.00 85.95  ? 1210 ASN A HD22   1 
ATOM   3656  N  N      . ILE A 1 249 ? -46.598  88.370  -14.016 1.00 69.54  ? 1211 ILE A N      1 
ATOM   3657  C  CA     . ILE A 1 249 ? -47.643  87.607  -13.346 1.00 70.96  ? 1211 ILE A CA     1 
ATOM   3658  C  C      . ILE A 1 249 ? -48.945  88.392  -13.232 1.00 70.93  ? 1211 ILE A C      1 
ATOM   3659  O  O      . ILE A 1 249 ? -49.836  87.993  -12.477 1.00 74.07  ? 1211 ILE A O      1 
ATOM   3660  C  CB     . ILE A 1 249 ? -47.187  87.118  -11.958 1.00 70.31  ? 1211 ILE A CB     1 
ATOM   3661  C  CG1    . ILE A 1 249 ? -46.713  88.278  -11.069 1.00 72.09  ? 1211 ILE A CG1    1 
ATOM   3662  C  CG2    . ILE A 1 249 ? -46.096  86.065  -12.095 1.00 69.33  ? 1211 ILE A CG2    1 
ATOM   3663  C  CD1    . ILE A 1 249 ? -47.817  89.046  -10.363 1.00 71.38  ? 1211 ILE A CD1    1 
ATOM   3664  H  H      . ILE A 1 249 ? -46.246  88.982  -13.525 1.00 83.44  ? 1211 ILE A H      1 
ATOM   3665  H  HA     . ILE A 1 249 ? -47.830  86.819  -13.880 1.00 85.15  ? 1211 ILE A HA     1 
ATOM   3666  H  HB     . ILE A 1 249 ? -47.948  86.703  -11.524 1.00 84.38  ? 1211 ILE A HB     1 
ATOM   3667  H  HG12   . ILE A 1 249 ? -46.124  87.922  -10.387 1.00 86.51  ? 1211 ILE A HG12   1 
ATOM   3668  H  HG13   . ILE A 1 249 ? -46.226  88.910  -11.621 1.00 86.51  ? 1211 ILE A HG13   1 
ATOM   3669  H  HG21   . ILE A 1 249 ? -45.825  85.774  -11.210 1.00 83.20  ? 1211 ILE A HG21   1 
ATOM   3670  H  HG22   . ILE A 1 249 ? -46.445  85.313  -12.599 1.00 83.20  ? 1211 ILE A HG22   1 
ATOM   3671  H  HG23   . ILE A 1 249 ? -45.339  86.453  -12.562 1.00 83.20  ? 1211 ILE A HG23   1 
ATOM   3672  H  HD11   . ILE A 1 249 ? -47.419  89.752  -9.831  1.00 85.66  ? 1211 ILE A HD11   1 
ATOM   3673  H  HD12   . ILE A 1 249 ? -48.411  89.427  -11.028 1.00 85.66  ? 1211 ILE A HD12   1 
ATOM   3674  H  HD13   . ILE A 1 249 ? -48.308  88.436  -9.790  1.00 85.66  ? 1211 ILE A HD13   1 
ATOM   3675  N  N      . TYR A 1 250 ? -49.082  89.497  -13.958 1.00 68.48  ? 1212 TYR A N      1 
ATOM   3676  C  CA     . TYR A 1 250 ? -50.305  90.278  -13.856 1.00 68.18  ? 1212 TYR A CA     1 
ATOM   3677  C  C      . TYR A 1 250 ? -51.492  89.496  -14.404 1.00 65.59  ? 1212 TYR A C      1 
ATOM   3678  O  O      . TYR A 1 250 ? -51.369  88.740  -15.372 1.00 63.91  ? 1212 TYR A O      1 
ATOM   3679  C  CB     . TYR A 1 250 ? -50.189  91.598  -14.616 1.00 71.96  ? 1212 TYR A CB     1 
ATOM   3680  C  CG     . TYR A 1 250 ? -51.546  92.231  -14.824 1.00 73.30  ? 1212 TYR A CG     1 
ATOM   3681  C  CD1    . TYR A 1 250 ? -52.150  92.961  -13.810 1.00 74.50  ? 1212 TYR A CD1    1 
ATOM   3682  C  CD2    . TYR A 1 250 ? -52.251  92.046  -16.008 1.00 71.71  ? 1212 TYR A CD2    1 
ATOM   3683  C  CE1    . TYR A 1 250 ? -53.399  93.522  -13.980 1.00 75.56  ? 1212 TYR A CE1    1 
ATOM   3684  C  CE2    . TYR A 1 250 ? -53.505  92.601  -16.186 1.00 73.22  ? 1212 TYR A CE2    1 
ATOM   3685  C  CZ     . TYR A 1 250 ? -54.074  93.337  -15.167 1.00 75.09  ? 1212 TYR A CZ     1 
ATOM   3686  O  OH     . TYR A 1 250 ? -55.322  93.894  -15.331 1.00 76.68  ? 1212 TYR A OH     1 
ATOM   3687  H  H      . TYR A 1 250 ? -48.496  89.809  -14.504 1.00 82.17  ? 1212 TYR A H      1 
ATOM   3688  H  HA     . TYR A 1 250 ? -50.479  90.479  -12.923 1.00 81.82  ? 1212 TYR A HA     1 
ATOM   3689  H  HB2    . TYR A 1 250 ? -49.639  92.214  -14.107 1.00 86.35  ? 1212 TYR A HB2    1 
ATOM   3690  H  HB3    . TYR A 1 250 ? -49.792  91.433  -15.486 1.00 86.35  ? 1212 TYR A HB3    1 
ATOM   3691  H  HD1    . TYR A 1 250 ? -51.698  93.088  -13.007 1.00 89.40  ? 1212 TYR A HD1    1 
ATOM   3692  H  HD2    . TYR A 1 250 ? -51.869  91.550  -16.695 1.00 86.05  ? 1212 TYR A HD2    1 
ATOM   3693  H  HE1    . TYR A 1 250 ? -53.786  94.017  -13.295 1.00 90.67  ? 1212 TYR A HE1    1 
ATOM   3694  H  HE2    . TYR A 1 250 ? -53.961  92.479  -16.987 1.00 87.86  ? 1212 TYR A HE2    1 
ATOM   3695  H  HH     . TYR A 1 250 ? -55.622  93.708  -16.093 1.00 92.01  ? 1212 TYR A HH     1 
ATOM   3696  N  N      . PHE A 1 251 ? -52.650  89.690  -13.779 1.00 65.05  ? 1213 PHE A N      1 
ATOM   3697  C  CA     . PHE A 1 251 ? -53.915  89.249  -14.345 1.00 63.08  ? 1213 PHE A CA     1 
ATOM   3698  C  C      . PHE A 1 251 ? -55.039  89.989  -13.636 1.00 64.26  ? 1213 PHE A C      1 
ATOM   3699  O  O      . PHE A 1 251 ? -54.886  90.430  -12.495 1.00 67.07  ? 1213 PHE A O      1 
ATOM   3700  C  CB     . PHE A 1 251 ? -54.097  87.732  -14.221 1.00 59.23  ? 1213 PHE A CB     1 
ATOM   3701  C  CG     . PHE A 1 251 ? -54.244  87.248  -12.808 1.00 57.60  ? 1213 PHE A CG     1 
ATOM   3702  C  CD1    . PHE A 1 251 ? -53.129  86.902  -12.062 1.00 58.60  ? 1213 PHE A CD1    1 
ATOM   3703  C  CD2    . PHE A 1 251 ? -55.496  87.127  -12.228 1.00 55.82  ? 1213 PHE A CD2    1 
ATOM   3704  C  CE1    . PHE A 1 251 ? -53.258  86.451  -10.759 1.00 56.73  ? 1213 PHE A CE1    1 
ATOM   3705  C  CE2    . PHE A 1 251 ? -55.632  86.678  -10.926 1.00 58.26  ? 1213 PHE A CE2    1 
ATOM   3706  C  CZ     . PHE A 1 251 ? -54.510  86.340  -10.191 1.00 55.31  ? 1213 PHE A CZ     1 
ATOM   3707  H  H      . PHE A 1 251 ? -52.727  90.081  -13.017 1.00 78.06  ? 1213 PHE A H      1 
ATOM   3708  H  HA     . PHE A 1 251 ? -53.943  89.483  -15.286 1.00 75.69  ? 1213 PHE A HA     1 
ATOM   3709  H  HB2    . PHE A 1 251 ? -54.896  87.473  -14.707 1.00 71.08  ? 1213 PHE A HB2    1 
ATOM   3710  H  HB3    . PHE A 1 251 ? -53.322  87.292  -14.606 1.00 71.08  ? 1213 PHE A HB3    1 
ATOM   3711  H  HD1    . PHE A 1 251 ? -52.283  86.977  -12.440 1.00 70.31  ? 1213 PHE A HD1    1 
ATOM   3712  H  HD2    . PHE A 1 251 ? -56.254  87.354  -12.718 1.00 66.98  ? 1213 PHE A HD2    1 
ATOM   3713  H  HE1    . PHE A 1 251 ? -52.502  86.225  -10.268 1.00 68.08  ? 1213 PHE A HE1    1 
ATOM   3714  H  HE2    . PHE A 1 251 ? -56.477  86.602  -10.546 1.00 69.91  ? 1213 PHE A HE2    1 
ATOM   3715  H  HZ     . PHE A 1 251 ? -54.599  86.036  -9.316  1.00 66.37  ? 1213 PHE A HZ     1 
ATOM   3716  N  N      . PHE A 1 252 ? -56.165  90.120  -14.327 1.00 66.21  ? 1214 PHE A N      1 
ATOM   3717  C  CA     . PHE A 1 252 ? -57.324  90.804  -13.768 1.00 70.12  ? 1214 PHE A CA     1 
ATOM   3718  C  C      . PHE A 1 252 ? -57.998  89.910  -12.735 1.00 74.96  ? 1214 PHE A C      1 
ATOM   3719  O  O      . PHE A 1 252 ? -58.433  88.799  -13.054 1.00 67.95  ? 1214 PHE A O      1 
ATOM   3720  C  CB     . PHE A 1 252 ? -58.298  91.171  -14.882 1.00 70.35  ? 1214 PHE A CB     1 
ATOM   3721  C  CG     . PHE A 1 252 ? -59.448  92.019  -14.429 1.00 73.43  ? 1214 PHE A CG     1 
ATOM   3722  C  CD1    . PHE A 1 252 ? -59.314  93.393  -14.326 1.00 76.77  ? 1214 PHE A CD1    1 
ATOM   3723  C  CD2    . PHE A 1 252 ? -60.666  91.443  -14.114 1.00 71.69  ? 1214 PHE A CD2    1 
ATOM   3724  C  CE1    . PHE A 1 252 ? -60.375  94.178  -13.915 1.00 79.39  ? 1214 PHE A CE1    1 
ATOM   3725  C  CE2    . PHE A 1 252 ? -61.730  92.222  -13.702 1.00 74.21  ? 1214 PHE A CE2    1 
ATOM   3726  C  CZ     . PHE A 1 252 ? -61.583  93.591  -13.600 1.00 77.61  ? 1214 PHE A CZ     1 
ATOM   3727  H  H      . PHE A 1 252 ? -56.284  89.820  -15.125 1.00 79.45  ? 1214 PHE A H      1 
ATOM   3728  H  HA     . PHE A 1 252 ? -57.037  91.620  -13.329 1.00 84.15  ? 1214 PHE A HA     1 
ATOM   3729  H  HB2    . PHE A 1 252 ? -57.818  91.664  -15.566 1.00 84.42  ? 1214 PHE A HB2    1 
ATOM   3730  H  HB3    . PHE A 1 252 ? -58.662  90.356  -15.260 1.00 84.42  ? 1214 PHE A HB3    1 
ATOM   3731  H  HD1    . PHE A 1 252 ? -58.501  93.793  -14.537 1.00 92.13  ? 1214 PHE A HD1    1 
ATOM   3732  H  HD2    . PHE A 1 252 ? -60.770  90.521  -14.180 1.00 86.03  ? 1214 PHE A HD2    1 
ATOM   3733  H  HE1    . PHE A 1 252 ? -60.273  95.100  -13.847 1.00 95.27  ? 1214 PHE A HE1    1 
ATOM   3734  H  HE2    . PHE A 1 252 ? -62.543  91.824  -13.490 1.00 89.05  ? 1214 PHE A HE2    1 
ATOM   3735  H  HZ     . PHE A 1 252 ? -62.298  94.116  -13.322 1.00 93.13  ? 1214 PHE A HZ     1 
ATOM   3736  N  N      . ASP A 1 253 ? -58.084  90.396  -11.495 1.00 88.43  ? 1215 ASP A N      1 
ATOM   3737  C  CA     . ASP A 1 253 ? -58.620  89.614  -10.386 1.00 91.47  ? 1215 ASP A CA     1 
ATOM   3738  C  C      . ASP A 1 253 ? -59.803  90.290  -9.704  1.00 94.40  ? 1215 ASP A C      1 
ATOM   3739  O  O      . ASP A 1 253 ? -60.274  89.794  -8.674  1.00 94.69  ? 1215 ASP A O      1 
ATOM   3740  C  CB     . ASP A 1 253 ? -57.519  89.336  -9.359  1.00 91.82  ? 1215 ASP A CB     1 
ATOM   3741  C  CG     . ASP A 1 253 ? -57.009  90.598  -8.696  1.00 95.52  ? 1215 ASP A CG     1 
ATOM   3742  O  OD1    . ASP A 1 253 ? -57.316  91.702  -9.193  1.00 98.06  ? 1215 ASP A OD1    1 
ATOM   3743  O  OD2    . ASP A 1 253 ? -56.294  90.485  -7.678  1.00 96.34  1 1215 ASP A OD2    1 
ATOM   3744  H  H      . ASP A 1 253 ? -57.835  91.187  -11.270 1.00 106.12 ? 1215 ASP A H      1 
ATOM   3745  H  HA     . ASP A 1 253 ? -58.926  88.759  -10.729 1.00 109.77 ? 1215 ASP A HA     1 
ATOM   3746  H  HB2    . ASP A 1 253 ? -57.871  88.754  -8.667  1.00 110.18 ? 1215 ASP A HB2    1 
ATOM   3747  H  HB3    . ASP A 1 253 ? -56.771  88.908  -9.804  1.00 110.18 ? 1215 ASP A HB3    1 
ATOM   3748  N  N      . GLN A 1 254 ? -60.298  91.402  -10.246 1.00 96.54  ? 1216 GLN A N      1 
ATOM   3749  C  CA     . GLN A 1 254 ? -61.493  92.060  -9.717  1.00 96.53  ? 1216 GLN A CA     1 
ATOM   3750  C  C      . GLN A 1 254 ? -62.731  91.486  -10.408 1.00 90.72  ? 1216 GLN A C      1 
ATOM   3751  O  O      . GLN A 1 254 ? -63.379  92.119  -11.245 1.00 94.78  ? 1216 GLN A O      1 
ATOM   3752  C  CB     . GLN A 1 254 ? -61.391  93.568  -9.905  1.00 102.43 ? 1216 GLN A CB     1 
ATOM   3753  C  CG     . GLN A 1 254 ? -60.283  94.220  -9.098  1.00 105.10 ? 1216 GLN A CG     1 
ATOM   3754  C  CD     . GLN A 1 254 ? -60.161  95.705  -9.377  1.00 110.71 ? 1216 GLN A CD     1 
ATOM   3755  O  OE1    . GLN A 1 254 ? -60.563  96.184  -10.439 1.00 111.45 ? 1216 GLN A OE1    1 
ATOM   3756  N  NE2    . GLN A 1 254 ? -59.602  96.444  -8.423  1.00 113.58 ? 1216 GLN A NE2    1 
ATOM   3757  H  H      . GLN A 1 254 ? -59.956  91.800  -10.928 1.00 115.85 ? 1216 GLN A H      1 
ATOM   3758  H  HA     . GLN A 1 254 ? -61.564  91.877  -8.767  1.00 115.83 ? 1216 GLN A HA     1 
ATOM   3759  N  N      . ILE A 1 255 ? -63.061  90.250  -10.025 1.00 79.50  ? 1217 ILE A N      1 
ATOM   3760  C  CA     . ILE A 1 255 ? -64.119  89.516  -10.713 1.00 74.46  ? 1217 ILE A CA     1 
ATOM   3761  C  C      . ILE A 1 255 ? -65.471  90.189  -10.516 1.00 77.19  ? 1217 ILE A C      1 
ATOM   3762  O  O      . ILE A 1 255 ? -66.329  90.140  -11.406 1.00 73.99  ? 1217 ILE A O      1 
ATOM   3763  C  CB     . ILE A 1 255 ? -64.147  88.052  -10.235 1.00 69.67  ? 1217 ILE A CB     1 
ATOM   3764  C  CG1    . ILE A 1 255 ? -62.777  87.390  -10.424 1.00 67.97  ? 1217 ILE A CG1    1 
ATOM   3765  C  CG2    . ILE A 1 255 ? -65.224  87.261  -10.976 1.00 68.82  ? 1217 ILE A CG2    1 
ATOM   3766  C  CD1    . ILE A 1 255 ? -62.258  87.397  -11.855 1.00 69.11  ? 1217 ILE A CD1    1 
ATOM   3767  H  H      . ILE A 1 255 ? -62.690  89.820  -9.378  1.00 95.40  ? 1217 ILE A H      1 
ATOM   3768  H  HA     . ILE A 1 255 ? -63.927  89.512  -11.664 1.00 89.36  ? 1217 ILE A HA     1 
ATOM   3769  H  HB     . ILE A 1 255 ? -64.361  88.044  -9.289  1.00 83.61  ? 1217 ILE A HB     1 
ATOM   3770  H  HG12   . ILE A 1 255 ? -62.129  87.859  -9.875  1.00 81.57  ? 1217 ILE A HG12   1 
ATOM   3771  H  HG13   . ILE A 1 255 ? -62.838  86.465  -10.138 1.00 81.57  ? 1217 ILE A HG13   1 
ATOM   3772  H  HG21   . ILE A 1 255 ? -65.220  86.346  -10.656 1.00 82.58  ? 1217 ILE A HG21   1 
ATOM   3773  H  HG22   . ILE A 1 255 ? -66.088  87.668  -10.805 1.00 82.58  ? 1217 ILE A HG22   1 
ATOM   3774  H  HG23   . ILE A 1 255 ? -65.031  87.281  -11.927 1.00 82.58  ? 1217 ILE A HG23   1 
ATOM   3775  H  HD11   . ILE A 1 255 ? -61.392  86.961  -11.879 1.00 82.93  ? 1217 ILE A HD11   1 
ATOM   3776  H  HD12   . ILE A 1 255 ? -62.886  86.919  -12.420 1.00 82.93  ? 1217 ILE A HD12   1 
ATOM   3777  H  HD13   . ILE A 1 255 ? -62.175  88.315  -12.156 1.00 82.93  ? 1217 ILE A HD13   1 
ATOM   3778  N  N      . ASP A 1 256 ? -65.691  90.831  -9.367  1.00 86.24  ? 1218 ASP A N      1 
ATOM   3779  C  CA     . ASP A 1 256 ? -66.971  91.490  -9.133  1.00 93.27  ? 1218 ASP A CA     1 
ATOM   3780  C  C      . ASP A 1 256 ? -67.226  92.592  -10.154 1.00 97.19  ? 1218 ASP A C      1 
ATOM   3781  O  O      . ASP A 1 256 ? -68.385  92.901  -10.456 1.00 99.66  ? 1218 ASP A O      1 
ATOM   3782  C  CB     . ASP A 1 256 ? -67.020  92.055  -7.714  1.00 98.32  ? 1218 ASP A CB     1 
ATOM   3783  C  CG     . ASP A 1 256 ? -65.875  93.005  -7.422  1.00 102.95 ? 1218 ASP A CG     1 
ATOM   3784  O  OD1    . ASP A 1 256 ? -64.780  92.811  -7.991  1.00 102.08 ? 1218 ASP A OD1    1 
ATOM   3785  O  OD2    . ASP A 1 256 ? -66.070  93.946  -6.623  1.00 107.12 1 1218 ASP A OD2    1 
ATOM   3786  H  H      . ASP A 1 256 ? -65.127  90.897  -8.721  1.00 103.48 ? 1218 ASP A H      1 
ATOM   3787  H  HA     . ASP A 1 256 ? -67.681  90.835  -9.218  1.00 111.93 ? 1218 ASP A HA     1 
ATOM   3788  H  HB2    . ASP A 1 256 ? -67.851  92.541  -7.595  1.00 117.99 ? 1218 ASP A HB2    1 
ATOM   3789  H  HB3    . ASP A 1 256 ? -66.971  91.322  -7.080  1.00 117.99 ? 1218 ASP A HB3    1 
ATOM   3790  N  N      . GLU A 1 257 ? -66.167  93.192  -10.695 1.00 98.16  ? 1219 GLU A N      1 
ATOM   3791  C  CA     . GLU A 1 257 ? -66.284  94.214  -11.725 1.00 99.71  ? 1219 GLU A CA     1 
ATOM   3792  C  C      . GLU A 1 257 ? -66.105  93.644  -13.125 1.00 93.94  ? 1219 GLU A C      1 
ATOM   3793  O  O      . GLU A 1 257 ? -65.959  94.411  -14.082 1.00 95.83  ? 1219 GLU A O      1 
ATOM   3794  C  CB     . GLU A 1 257 ? -65.264  95.331  -11.492 1.00 104.54 ? 1219 GLU A CB     1 
ATOM   3795  C  CG     . GLU A 1 257 ? -65.343  95.987  -10.122 1.00 108.24 ? 1219 GLU A CG     1 
ATOM   3796  C  CD     . GLU A 1 257 ? -64.303  97.079  -9.943  1.00 111.98 ? 1219 GLU A CD     1 
ATOM   3797  O  OE1    . GLU A 1 257 ? -63.684  97.482  -10.952 1.00 112.77 ? 1219 GLU A OE1    1 
ATOM   3798  O  OE2    . GLU A 1 257 ? -64.108  97.539  -8.799  1.00 114.37 1 1219 GLU A OE2    1 
ATOM   3799  H  H      . GLU A 1 257 ? -65.354  93.018  -10.474 1.00 117.79 ? 1219 GLU A H      1 
ATOM   3800  H  HA     . GLU A 1 257 ? -67.169  94.606  -11.676 1.00 119.65 ? 1219 GLU A HA     1 
ATOM   3801  H  HB2    . GLU A 1 257 ? -64.372  94.962  -11.590 1.00 125.44 ? 1219 GLU A HB2    1 
ATOM   3802  H  HB3    . GLU A 1 257 ? -65.406  96.023  -12.157 1.00 125.44 ? 1219 GLU A HB3    1 
ATOM   3803  H  HG2    . GLU A 1 257 ? -66.220  96.385  -10.011 1.00 129.89 ? 1219 GLU A HG2    1 
ATOM   3804  H  HG3    . GLU A 1 257 ? -65.194  95.314  -9.440  1.00 129.89 ? 1219 GLU A HG3    1 
ATOM   3805  N  N      . LEU A 1 258 ? -66.113  92.321  -13.266 1.00 84.95  ? 1220 LEU A N      1 
ATOM   3806  C  CA     . LEU A 1 258 ? -65.835  91.720  -14.566 1.00 80.19  ? 1220 LEU A CA     1 
ATOM   3807  C  C      . LEU A 1 258 ? -66.847  92.118  -15.631 1.00 81.16  ? 1220 LEU A C      1 
ATOM   3808  O  O      . LEU A 1 258 ? -66.431  92.340  -16.782 1.00 80.60  ? 1220 LEU A O      1 
ATOM   3809  C  CB     . LEU A 1 258 ? -65.774  90.194  -14.425 1.00 75.31  ? 1220 LEU A CB     1 
ATOM   3810  C  CG     . LEU A 1 258 ? -65.273  89.428  -15.653 1.00 71.90  ? 1220 LEU A CG     1 
ATOM   3811  C  CD1    . LEU A 1 258 ? -63.827  89.790  -15.978 1.00 71.27  ? 1220 LEU A CD1    1 
ATOM   3812  C  CD2    . LEU A 1 258 ? -65.418  87.932  -15.437 1.00 68.31  ? 1220 LEU A CD2    1 
ATOM   3813  H  H      . LEU A 1 258 ? -66.273  91.758  -12.636 1.00 101.94 ? 1220 LEU A H      1 
ATOM   3814  H  HA     . LEU A 1 258 ? -64.963  92.021  -14.865 1.00 96.23  ? 1220 LEU A HA     1 
ATOM   3815  H  HB2    . LEU A 1 258 ? -65.181  89.979  -13.688 1.00 90.37  ? 1220 LEU A HB2    1 
ATOM   3816  H  HB3    . LEU A 1 258 ? -66.666  89.870  -14.226 1.00 90.37  ? 1220 LEU A HB3    1 
ATOM   3817  H  HG     . LEU A 1 258 ? -65.818  89.672  -16.417 1.00 86.28  ? 1220 LEU A HG     1 
ATOM   3818  H  HD11   . LEU A 1 258 ? -63.544  89.288  -16.759 1.00 85.53  ? 1220 LEU A HD11   1 
ATOM   3819  H  HD12   . LEU A 1 258 ? -63.773  90.742  -16.159 1.00 85.53  ? 1220 LEU A HD12   1 
ATOM   3820  H  HD13   . LEU A 1 258 ? -63.267  89.565  -15.219 1.00 85.53  ? 1220 LEU A HD13   1 
ATOM   3821  H  HD21   . LEU A 1 258 ? -65.095  87.466  -16.224 1.00 81.97  ? 1220 LEU A HD21   1 
ATOM   3822  H  HD22   . LEU A 1 258 ? -64.895  87.673  -14.662 1.00 81.97  ? 1220 LEU A HD22   1 
ATOM   3823  H  HD23   . LEU A 1 258 ? -66.354  87.724  -15.289 1.00 81.97  ? 1220 LEU A HD23   1 
ATOM   3824  N  N      . PRO A 1 259 ? -68.150  92.218  -15.348 1.00 84.88  ? 1221 PRO A N      1 
ATOM   3825  C  CA     . PRO A 1 259 ? -69.084  92.647  -16.403 1.00 86.01  ? 1221 PRO A CA     1 
ATOM   3826  C  C      . PRO A 1 259 ? -68.705  93.974  -17.034 1.00 87.52  ? 1221 PRO A C      1 
ATOM   3827  O  O      . PRO A 1 259 ? -69.029  94.209  -18.205 1.00 91.12  ? 1221 PRO A O      1 
ATOM   3828  C  CB     . PRO A 1 259 ? -70.429  92.731  -15.668 1.00 86.51  ? 1221 PRO A CB     1 
ATOM   3829  C  CG     . PRO A 1 259 ? -70.286  91.819  -14.500 1.00 84.37  ? 1221 PRO A CG     1 
ATOM   3830  C  CD     . PRO A 1 259 ? -68.846  91.893  -14.090 1.00 83.18  ? 1221 PRO A CD     1 
ATOM   3831  H  HA     . PRO A 1 259 ? -69.141  91.969  -17.095 1.00 103.21 ? 1221 PRO A HA     1 
ATOM   3832  H  HB2    . PRO A 1 259 ? -70.585  93.643  -15.375 1.00 103.81 ? 1221 PRO A HB2    1 
ATOM   3833  H  HB3    . PRO A 1 259 ? -71.142  92.431  -16.254 1.00 103.81 ? 1221 PRO A HB3    1 
ATOM   3834  H  HG2    . PRO A 1 259 ? -70.861  92.122  -13.779 1.00 101.24 ? 1221 PRO A HG2    1 
ATOM   3835  H  HG3    . PRO A 1 259 ? -70.519  90.915  -14.764 1.00 101.24 ? 1221 PRO A HG3    1 
ATOM   3836  H  HD2    . PRO A 1 259 ? -68.715  92.600  -13.439 1.00 99.82  ? 1221 PRO A HD2    1 
ATOM   3837  H  HD3    . PRO A 1 259 ? -68.546  91.035  -13.750 1.00 99.82  ? 1221 PRO A HD3    1 
ATOM   3838  N  N      . THR A 1 260 ? -68.023  94.853  -16.294 1.00 86.79  ? 1222 THR A N      1 
ATOM   3839  C  CA     . THR A 1 260 ? -67.614  96.138  -16.853 1.00 88.87  ? 1222 THR A CA     1 
ATOM   3840  C  C      . THR A 1 260 ? -66.483  95.969  -17.861 1.00 89.71  ? 1222 THR A C      1 
ATOM   3841  O  O      . THR A 1 260 ? -66.462  96.646  -18.896 1.00 89.45  ? 1222 THR A O      1 
ATOM   3842  C  CB     . THR A 1 260 ? -67.190  97.091  -15.734 1.00 90.24  ? 1222 THR A CB     1 
ATOM   3843  O  OG1    . THR A 1 260 ? -68.248  97.211  -14.774 1.00 90.63  ? 1222 THR A OG1    1 
ATOM   3844  C  CG2    . THR A 1 260 ? -66.865  98.470  -16.295 1.00 93.96  ? 1222 THR A CG2    1 
ATOM   3845  H  H      . THR A 1 260 ? -67.789  94.728  -15.476 1.00 104.15 ? 1222 THR A H      1 
ATOM   3846  H  HA     . THR A 1 260 ? -68.369  96.535  -17.315 1.00 106.65 ? 1222 THR A HA     1 
ATOM   3847  H  HB     . THR A 1 260 ? -66.397  96.743  -15.298 1.00 108.29 ? 1222 THR A HB     1 
ATOM   3848  H  HG1    . THR A 1 260 ? -68.018  97.734  -14.158 1.00 108.75 ? 1222 THR A HG1    1 
ATOM   3849  H  HG21   . THR A 1 260 ? -66.598  99.065  -15.576 1.00 112.75 ? 1222 THR A HG21   1 
ATOM   3850  H  HG22   . THR A 1 260 ? -66.140  98.405  -16.936 1.00 112.75 ? 1222 THR A HG22   1 
ATOM   3851  H  HG23   . THR A 1 260 ? -67.645  98.841  -16.737 1.00 112.75 ? 1222 THR A HG23   1 
ATOM   3852  N  N      . TYR A 1 261 ? -65.536  95.077  -17.579 1.00 92.09  ? 1223 TYR A N      1 
ATOM   3853  C  CA     . TYR A 1 261 ? -64.338  94.929  -18.395 1.00 94.36  ? 1223 TYR A CA     1 
ATOM   3854  C  C      . TYR A 1 261 ? -64.390  93.724  -19.323 1.00 92.66  ? 1223 TYR A C      1 
ATOM   3855  O  O      . TYR A 1 261 ? -63.456  93.528  -20.106 1.00 93.48  ? 1223 TYR A O      1 
ATOM   3856  C  CB     . TYR A 1 261 ? -63.101  94.827  -17.497 1.00 93.87  ? 1223 TYR A CB     1 
ATOM   3857  C  CG     . TYR A 1 261 ? -62.902  96.021  -16.592 1.00 97.12  ? 1223 TYR A CG     1 
ATOM   3858  C  CD1    . TYR A 1 261 ? -62.326  97.190  -17.072 1.00 101.00 ? 1223 TYR A CD1    1 
ATOM   3859  C  CD2    . TYR A 1 261 ? -63.292  95.983  -15.260 1.00 97.95  ? 1223 TYR A CD2    1 
ATOM   3860  C  CE1    . TYR A 1 261 ? -62.141  98.286  -16.251 1.00 104.61 ? 1223 TYR A CE1    1 
ATOM   3861  C  CE2    . TYR A 1 261 ? -63.111  97.074  -14.431 1.00 100.93 ? 1223 TYR A CE2    1 
ATOM   3862  C  CZ     . TYR A 1 261 ? -62.537  98.223  -14.932 1.00 104.61 ? 1223 TYR A CZ     1 
ATOM   3863  O  OH     . TYR A 1 261 ? -62.355  99.311  -14.110 1.00 108.39 ? 1223 TYR A OH     1 
ATOM   3864  H  H      . TYR A 1 261 ? -65.566  94.538  -16.910 1.00 110.50 ? 1223 TYR A H      1 
ATOM   3865  H  HA     . TYR A 1 261 ? -64.239  95.721  -18.946 1.00 113.23 ? 1223 TYR A HA     1 
ATOM   3866  H  HB2    . TYR A 1 261 ? -63.186  94.041  -16.935 1.00 112.64 ? 1223 TYR A HB2    1 
ATOM   3867  H  HB3    . TYR A 1 261 ? -62.314  94.746  -18.057 1.00 112.64 ? 1223 TYR A HB3    1 
ATOM   3868  H  HD1    . TYR A 1 261 ? -62.059  97.236  -17.962 1.00 121.20 ? 1223 TYR A HD1    1 
ATOM   3869  H  HD2    . TYR A 1 261 ? -63.680  95.209  -14.920 1.00 117.54 ? 1223 TYR A HD2    1 
ATOM   3870  H  HE1    . TYR A 1 261 ? -61.754  99.062  -16.587 1.00 125.54 ? 1223 TYR A HE1    1 
ATOM   3871  H  HE2    . TYR A 1 261 ? -63.377  97.034  -13.540 1.00 121.12 ? 1223 TYR A HE2    1 
ATOM   3872  H  HH     . TYR A 1 261 ? -62.638  99.138  -13.338 1.00 130.07 ? 1223 TYR A HH     1 
ATOM   3873  N  N      . TRP A 1 262 ? -65.445  92.915  -19.256 1.00 89.41  ? 1224 TRP A N      1 
ATOM   3874  C  CA     . TRP A 1 262 ? -65.633  91.791  -20.168 1.00 86.67  ? 1224 TRP A CA     1 
ATOM   3875  C  C      . TRP A 1 262 ? -66.982  91.974  -20.851 1.00 88.93  ? 1224 TRP A C      1 
ATOM   3876  O  O      . TRP A 1 262 ? -68.031  91.797  -20.221 1.00 88.48  ? 1224 TRP A O      1 
ATOM   3877  C  CB     . TRP A 1 262 ? -65.563  90.451  -19.435 1.00 82.21  ? 1224 TRP A CB     1 
ATOM   3878  C  CG     . TRP A 1 262 ? -65.573  89.271  -20.363 1.00 79.04  ? 1224 TRP A CG     1 
ATOM   3879  C  CD1    . TRP A 1 262 ? -65.088  89.229  -21.640 1.00 79.65  ? 1224 TRP A CD1    1 
ATOM   3880  C  CD2    . TRP A 1 262 ? -66.101  87.967  -20.093 1.00 76.60  ? 1224 TRP A CD2    1 
ATOM   3881  N  NE1    . TRP A 1 262 ? -65.278  87.981  -22.179 1.00 77.53  ? 1224 TRP A NE1    1 
ATOM   3882  C  CE2    . TRP A 1 262 ? -65.898  87.187  -21.250 1.00 76.09  ? 1224 TRP A CE2    1 
ATOM   3883  C  CE3    . TRP A 1 262 ? -66.723  87.382  -18.986 1.00 75.75  ? 1224 TRP A CE3    1 
ATOM   3884  C  CZ2    . TRP A 1 262 ? -66.295  85.854  -21.332 1.00 72.97  ? 1224 TRP A CZ2    1 
ATOM   3885  C  CZ3    . TRP A 1 262 ? -67.116  86.057  -19.069 1.00 75.08  ? 1224 TRP A CZ3    1 
ATOM   3886  C  CH2    . TRP A 1 262 ? -66.901  85.309  -20.234 1.00 73.91  ? 1224 TRP A CH2    1 
ATOM   3887  H  H      . TRP A 1 262 ? -66.077  92.999  -18.679 1.00 107.29 ? 1224 TRP A H      1 
ATOM   3888  H  HA     . TRP A 1 262 ? -64.941  91.806  -20.847 1.00 104.01 ? 1224 TRP A HA     1 
ATOM   3889  H  HB2    . TRP A 1 262 ? -64.743  90.418  -18.918 1.00 98.65  ? 1224 TRP A HB2    1 
ATOM   3890  H  HB3    . TRP A 1 262 ? -66.329  90.374  -18.845 1.00 98.65  ? 1224 TRP A HB3    1 
ATOM   3891  H  HD1    . TRP A 1 262 ? -64.687  89.943  -22.080 1.00 95.58  ? 1224 TRP A HD1    1 
ATOM   3892  H  HE1    . TRP A 1 262 ? -65.046  87.737  -22.970 1.00 93.04  ? 1224 TRP A HE1    1 
ATOM   3893  H  HE3    . TRP A 1 262 ? -66.870  87.873  -18.210 1.00 90.90  ? 1224 TRP A HE3    1 
ATOM   3894  H  HZ2    . TRP A 1 262 ? -66.153  85.354  -22.103 1.00 87.57  ? 1224 TRP A HZ2    1 
ATOM   3895  H  HZ3    . TRP A 1 262 ? -67.532  85.658  -18.339 1.00 90.09  ? 1224 TRP A HZ3    1 
ATOM   3896  H  HH2    . TRP A 1 262 ? -67.176  84.420  -20.261 1.00 88.69  ? 1224 TRP A HH2    1 
ATOM   3897  N  N      . SER A 1 263 ? -66.953  92.325  -22.138 1.00 90.00  ? 1225 SER A N      1 
ATOM   3898  C  CA     . SER A 1 263 ? -68.191  92.610  -22.855 1.00 93.69  ? 1225 SER A CA     1 
ATOM   3899  C  C      . SER A 1 263 ? -69.035  91.354  -23.024 1.00 96.02  ? 1225 SER A C      1 
ATOM   3900  O  O      . SER A 1 263 ? -70.266  91.410  -22.931 1.00 94.37  ? 1225 SER A O      1 
ATOM   3901  C  CB     . SER A 1 263 ? -67.875  93.223  -24.218 1.00 95.08  ? 1225 SER A CB     1 
ATOM   3902  O  OG     . SER A 1 263 ? -67.065  92.353  -24.990 1.00 93.68  ? 1225 SER A OG     1 
ATOM   3903  H  H      . SER A 1 263 ? -66.239  92.403  -22.611 1.00 108.01 ? 1225 SER A H      1 
ATOM   3904  H  HA     . SER A 1 263 ? -68.709  93.254  -22.349 1.00 112.43 ? 1225 SER A HA     1 
ATOM   3905  H  HB2    . SER A 1 263 ? -68.705  93.384  -24.692 1.00 114.10 ? 1225 SER A HB2    1 
ATOM   3906  H  HB3    . SER A 1 263 ? -67.401  94.059  -24.086 1.00 114.10 ? 1225 SER A HB3    1 
ATOM   3907  H  HG     . SER A 1 263 ? -66.898  92.701  -25.736 1.00 112.41 ? 1225 SER A HG     1 
ATOM   3908  N  N      . GLU A 1 264 ? -68.396  90.212  -23.273 1.00 100.31 ? 1226 GLU A N      1 
ATOM   3909  C  CA     . GLU A 1 264 ? -69.116  88.971  -23.521 1.00 101.10 ? 1226 GLU A CA     1 
ATOM   3910  C  C      . GLU A 1 264 ? -69.520  88.248  -22.243 1.00 97.69  ? 1226 GLU A C      1 
ATOM   3911  O  O      . GLU A 1 264 ? -69.709  87.025  -22.273 1.00 95.42  ? 1226 GLU A O      1 
ATOM   3912  C  CB     . GLU A 1 264 ? -68.277  88.038  -24.396 1.00 101.78 ? 1226 GLU A CB     1 
ATOM   3913  C  CG     . GLU A 1 264 ? -67.962  88.596  -25.769 1.00 105.08 ? 1226 GLU A CG     1 
ATOM   3914  C  CD     . GLU A 1 264 ? -67.436  87.536  -26.712 1.00 105.18 ? 1226 GLU A CD     1 
ATOM   3915  O  OE1    . GLU A 1 264 ? -66.293  87.075  -26.508 1.00 103.96 ? 1226 GLU A OE1    1 
ATOM   3916  O  OE2    . GLU A 1 264 ? -68.167  87.161  -27.652 1.00 106.08 1 1226 GLU A OE2    1 
ATOM   3917  H  H      . GLU A 1 264 ? -67.540  90.132  -23.304 1.00 120.38 ? 1226 GLU A H      1 
ATOM   3918  H  HA     . GLU A 1 264 ? -69.929  89.178  -24.008 1.00 121.32 ? 1226 GLU A HA     1 
ATOM   3919  H  HB2    . GLU A 1 264 ? -67.435  87.863  -23.947 1.00 122.13 ? 1226 GLU A HB2    1 
ATOM   3920  H  HB3    . GLU A 1 264 ? -68.761  87.206  -24.519 1.00 122.13 ? 1226 GLU A HB3    1 
ATOM   3921  H  HG2    . GLU A 1 264 ? -68.771  88.968  -26.154 1.00 126.10 ? 1226 GLU A HG2    1 
ATOM   3922  H  HG3    . GLU A 1 264 ? -67.285  89.286  -25.683 1.00 126.10 ? 1226 GLU A HG3    1 
ATOM   3923  N  N      . CYS A 1 265 ? -69.662  88.961  -21.132 1.00 95.56  ? 1227 CYS A N      1 
ATOM   3924  C  CA     . CYS A 1 265 ? -69.952  88.311  -19.863 1.00 92.56  ? 1227 CYS A CA     1 
ATOM   3925  C  C      . CYS A 1 265 ? -71.358  87.724  -19.881 1.00 91.33  ? 1227 CYS A C      1 
ATOM   3926  O  O      . CYS A 1 265 ? -72.329  88.418  -20.197 1.00 93.82  ? 1227 CYS A O      1 
ATOM   3927  C  CB     . CYS A 1 265 ? -69.804  89.307  -18.716 1.00 93.26  ? 1227 CYS A CB     1 
ATOM   3928  S  SG     . CYS A 1 265 ? -69.909  88.565  -17.081 1.00 92.83  ? 1227 CYS A SG     1 
ATOM   3929  H  H      . CYS A 1 265 ? -69.595  89.817  -21.086 1.00 114.68 ? 1227 CYS A H      1 
ATOM   3930  H  HA     . CYS A 1 265 ? -69.322  87.587  -19.721 1.00 111.07 ? 1227 CYS A HA     1 
ATOM   3931  H  HB2    . CYS A 1 265 ? -68.939  89.740  -18.789 1.00 111.91 ? 1227 CYS A HB2    1 
ATOM   3932  H  HB3    . CYS A 1 265 ? -70.510  89.970  -18.786 1.00 111.91 ? 1227 CYS A HB3    1 
ATOM   3933  H  HG     . CYS A 1 265 ? -69.782  89.424  -16.253 1.00 111.40 ? 1227 CYS A HG     1 
ATOM   3934  N  N      . GLY A 1 266 ? -71.463  86.441  -19.545 1.00 87.77  ? 1228 GLY A N      1 
ATOM   3935  C  CA     . GLY A 1 266 ? -72.756  85.802  -19.411 1.00 87.13  ? 1228 GLY A CA     1 
ATOM   3936  C  C      . GLY A 1 266 ? -73.476  85.519  -20.709 1.00 87.65  ? 1228 GLY A C      1 
ATOM   3937  O  O      . GLY A 1 266 ? -74.687  85.281  -20.692 1.00 87.79  ? 1228 GLY A O      1 
ATOM   3938  H  H      . GLY A 1 266 ? -70.795  85.922  -19.391 1.00 105.33 ? 1228 GLY A H      1 
ATOM   3939  H  HA2    . GLY A 1 266 ? -72.642  84.959  -18.945 1.00 104.56 ? 1228 GLY A HA2    1 
ATOM   3940  H  HA3    . GLY A 1 266 ? -73.329  86.367  -18.870 1.00 104.56 ? 1228 GLY A HA3    1 
ATOM   3941  N  N      . LYS A 1 267 ? -72.772  85.535  -21.843 1.00 88.43  ? 1229 LYS A N      1 
ATOM   3942  C  CA     . LYS A 1 267 ? -73.424  85.257  -23.118 1.00 88.66  ? 1229 LYS A CA     1 
ATOM   3943  C  C      . LYS A 1 267 ? -73.548  83.765  -23.390 1.00 82.35  ? 1229 LYS A C      1 
ATOM   3944  O  O      . LYS A 1 267 ? -74.454  83.350  -24.121 1.00 84.22  ? 1229 LYS A O      1 
ATOM   3945  C  CB     . LYS A 1 267 ? -72.655  85.909  -24.265 1.00 91.51  ? 1229 LYS A CB     1 
ATOM   3946  C  CG     . LYS A 1 267 ? -72.964  87.375  -24.481 1.00 97.11  ? 1229 LYS A CG     1 
ATOM   3947  C  CD     . LYS A 1 267 ? -71.956  87.995  -25.432 1.00 99.43  ? 1229 LYS A CD     1 
ATOM   3948  C  CE     . LYS A 1 267 ? -72.025  87.381  -26.819 1.00 100.31 ? 1229 LYS A CE     1 
ATOM   3949  N  NZ     . LYS A 1 267 ? -71.066  88.037  -27.746 1.00 103.20 1 1229 LYS A NZ     1 
ATOM   3950  H  H      . LYS A 1 267 ? -71.930  85.700  -21.898 1.00 106.12 ? 1229 LYS A H      1 
ATOM   3951  H  HA     . LYS A 1 267 ? -74.318  85.635  -23.104 1.00 106.40 ? 1229 LYS A HA     1 
ATOM   3952  H  HB2    . LYS A 1 267 ? -71.705  85.833  -24.083 1.00 109.81 ? 1229 LYS A HB2    1 
ATOM   3953  H  HB3    . LYS A 1 267 ? -72.868  85.439  -25.087 1.00 109.81 ? 1229 LYS A HB3    1 
ATOM   3954  H  HG2    . LYS A 1 267 ? -73.849  87.466  -24.869 1.00 116.53 ? 1229 LYS A HG2    1 
ATOM   3955  H  HG3    . LYS A 1 267 ? -72.916  87.845  -23.633 1.00 116.53 ? 1229 LYS A HG3    1 
ATOM   3956  H  HD2    . LYS A 1 267 ? -72.136  88.945  -25.513 1.00 119.31 ? 1229 LYS A HD2    1 
ATOM   3957  H  HD3    . LYS A 1 267 ? -71.061  87.854  -25.084 1.00 119.31 ? 1229 LYS A HD3    1 
ATOM   3958  H  HE2    . LYS A 1 267 ? -71.802  86.439  -26.765 1.00 120.38 ? 1229 LYS A HE2    1 
ATOM   3959  H  HE3    . LYS A 1 267 ? -72.920  87.495  -27.176 1.00 120.38 ? 1229 LYS A HE3    1 
ATOM   3960  H  HZ1    . LYS A 1 267 ? -71.121  87.665  -28.553 1.00 123.84 ? 1229 LYS A HZ1    1 
ATOM   3961  H  HZ2    . LYS A 1 267 ? -71.254  88.904  -27.814 1.00 123.84 ? 1229 LYS A HZ2    1 
ATOM   3962  H  HZ3    . LYS A 1 267 ? -70.236  87.943  -27.440 1.00 123.84 ? 1229 LYS A HZ3    1 
ATOM   3963  N  N      . ASN A 1 268 ? -72.661  82.950  -22.825 1.00 70.85  ? 1230 ASN A N      1 
ATOM   3964  C  CA     . ASN A 1 268 ? -72.736  81.507  -23.007 1.00 63.87  ? 1230 ASN A CA     1 
ATOM   3965  C  C      . ASN A 1 268 ? -73.709  80.919  -21.993 1.00 60.58  ? 1230 ASN A C      1 
ATOM   3966  O  O      . ASN A 1 268 ? -73.522  81.077  -20.782 1.00 60.61  ? 1230 ASN A O      1 
ATOM   3967  C  CB     . ASN A 1 268 ? -71.357  80.874  -22.854 1.00 60.57  ? 1230 ASN A CB     1 
ATOM   3968  C  CG     . ASN A 1 268 ? -71.369  79.389  -23.147 1.00 58.14  ? 1230 ASN A CG     1 
ATOM   3969  O  OD1    . ASN A 1 268 ? -71.965  78.604  -22.410 1.00 55.15  ? 1230 ASN A OD1    1 
ATOM   3970  N  ND2    . ASN A 1 268 ? -70.709  78.994  -24.232 1.00 59.53  ? 1230 ASN A ND2    1 
ATOM   3971  H  H      . ASN A 1 268 ? -72.006  83.210  -22.331 1.00 85.02  ? 1230 ASN A H      1 
ATOM   3972  H  HA     . ASN A 1 268 ? -73.066  81.311  -23.898 1.00 76.65  ? 1230 ASN A HA     1 
ATOM   3973  H  HB2    . ASN A 1 268 ? -70.743  81.298  -23.472 1.00 72.68  ? 1230 ASN A HB2    1 
ATOM   3974  H  HB3    . ASN A 1 268 ? -71.051  80.998  -21.942 1.00 72.68  ? 1230 ASN A HB3    1 
ATOM   3975  H  HD21   . ASN A 1 268 ? -70.686  78.161  -24.441 1.00 71.44  ? 1230 ASN A HD21   1 
ATOM   3976  H  HD22   . ASN A 1 268 ? -70.306  79.573  -24.724 1.00 71.44  ? 1230 ASN A HD22   1 
ATOM   3977  N  N      . THR A 1 269 ? -74.734  80.222  -22.489 1.00 59.23  ? 1231 THR A N      1 
ATOM   3978  C  CA     . THR A 1 269 ? -75.782  79.661  -21.644 1.00 56.39  ? 1231 THR A CA     1 
ATOM   3979  C  C      . THR A 1 269 ? -75.843  78.139  -21.735 1.00 56.23  ? 1231 THR A C      1 
ATOM   3980  O  O      . THR A 1 269 ? -76.875  77.544  -21.409 1.00 55.33  ? 1231 THR A O      1 
ATOM   3981  C  CB     . THR A 1 269 ? -77.141  80.265  -22.002 1.00 58.43  ? 1231 THR A CB     1 
ATOM   3982  O  OG1    . THR A 1 269 ? -77.434  80.017  -23.383 1.00 61.44  ? 1231 THR A OG1    1 
ATOM   3983  C  CG2    . THR A 1 269 ? -77.141  81.763  -21.744 1.00 60.50  ? 1231 THR A CG2    1 
ATOM   3984  H  H      . THR A 1 269 ? -74.843  80.059  -23.326 1.00 71.07  ? 1231 THR A H      1 
ATOM   3985  H  HA     . THR A 1 269 ? -75.592  79.892  -20.721 1.00 67.66  ? 1231 THR A HA     1 
ATOM   3986  H  HB     . THR A 1 269 ? -77.828  79.860  -21.450 1.00 70.11  ? 1231 THR A HB     1 
ATOM   3987  H  HG1    . THR A 1 269 ? -78.180  80.348  -23.582 1.00 73.72  ? 1231 THR A HG1    1 
ATOM   3988  H  HG21   . THR A 1 269 ? -78.006  82.139  -21.973 1.00 72.60  ? 1231 THR A HG21   1 
ATOM   3989  H  HG22   . THR A 1 269 ? -76.960  81.938  -20.807 1.00 72.60  ? 1231 THR A HG22   1 
ATOM   3990  H  HG23   . THR A 1 269 ? -76.458  82.192  -22.282 1.00 72.60  ? 1231 THR A HG23   1 
ATOM   3991  N  N      . GLU A 1 270 ? -74.766  77.498  -22.183 1.00 55.95  ? 1232 GLU A N      1 
ATOM   3992  C  CA     . GLU A 1 270 ? -74.726  76.044  -22.226 1.00 55.39  ? 1232 GLU A CA     1 
ATOM   3993  C  C      . GLU A 1 270 ? -74.734  75.473  -20.814 1.00 55.10  ? 1232 GLU A C      1 
ATOM   3994  O  O      . GLU A 1 270 ? -74.140  76.040  -19.893 1.00 54.40  ? 1232 GLU A O      1 
ATOM   3995  C  CB     . GLU A 1 270 ? -73.479  75.564  -22.970 1.00 55.28  ? 1232 GLU A CB     1 
ATOM   3996  C  CG     . GLU A 1 270 ? -73.338  76.094  -24.389 1.00 60.19  ? 1232 GLU A CG     1 
ATOM   3997  C  CD     . GLU A 1 270 ? -72.089  75.572  -25.077 1.00 58.75  ? 1232 GLU A CD     1 
ATOM   3998  O  OE1    . GLU A 1 270 ? -71.958  74.338  -25.217 1.00 59.02  ? 1232 GLU A OE1    1 
ATOM   3999  O  OE2    . GLU A 1 270 ? -71.235  76.394  -25.475 1.00 57.77  1 1232 GLU A OE2    1 
ATOM   4000  H  H      . GLU A 1 270 ? -74.050  77.881  -22.467 1.00 67.14  ? 1232 GLU A H      1 
ATOM   4001  H  HA     . GLU A 1 270 ? -75.509  75.713  -22.695 1.00 66.47  ? 1232 GLU A HA     1 
ATOM   4002  H  HB2    . GLU A 1 270 ? -72.695  75.845  -22.472 1.00 66.34  ? 1232 GLU A HB2    1 
ATOM   4003  H  HB3    . GLU A 1 270 ? -73.502  74.595  -23.019 1.00 66.34  ? 1232 GLU A HB3    1 
ATOM   4004  H  HG2    . GLU A 1 270 ? -74.108  75.815  -24.910 1.00 72.23  ? 1232 GLU A HG2    1 
ATOM   4005  H  HG3    . GLU A 1 270 ? -73.286  77.062  -24.362 1.00 72.23  ? 1232 GLU A HG3    1 
ATOM   4006  N  N      . SER A 1 271 ? -75.411  74.341  -20.648 1.00 52.67  ? 1233 SER A N      1 
ATOM   4007  C  CA     . SER A 1 271 ? -75.386  73.633  -19.380 1.00 50.35  ? 1233 SER A CA     1 
ATOM   4008  C  C      . SER A 1 271 ? -74.025  72.965  -19.174 1.00 48.02  ? 1233 SER A C      1 
ATOM   4009  O  O      . SER A 1 271 ? -73.189  72.896  -20.080 1.00 45.38  ? 1233 SER A O      1 
ATOM   4010  C  CB     . SER A 1 271 ? -76.506  72.597  -19.328 1.00 47.34  ? 1233 SER A CB     1 
ATOM   4011  O  OG     . SER A 1 271 ? -76.278  71.568  -20.272 1.00 47.84  ? 1233 SER A OG     1 
ATOM   4012  H  H      . SER A 1 271 ? -75.890  73.965  -21.255 1.00 63.20  ? 1233 SER A H      1 
ATOM   4013  H  HA     . SER A 1 271 ? -75.525  74.266  -18.658 1.00 60.42  ? 1233 SER A HA     1 
ATOM   4014  H  HB2    . SER A 1 271 ? -76.537  72.209  -18.440 1.00 56.81  ? 1233 SER A HB2    1 
ATOM   4015  H  HB3    . SER A 1 271 ? -77.348  73.032  -19.532 1.00 56.81  ? 1233 SER A HB3    1 
ATOM   4016  H  HG     . SER A 1 271 ? -75.549  71.184  -20.108 1.00 57.41  ? 1233 SER A HG     1 
ATOM   4017  N  N      . VAL A 1 272 ? -73.810  72.459  -17.958 1.00 46.87  ? 1234 VAL A N      1 
ATOM   4018  C  CA     . VAL A 1 272 ? -72.526  71.843  -17.624 1.00 44.69  ? 1234 VAL A CA     1 
ATOM   4019  C  C      . VAL A 1 272 ? -72.302  70.592  -18.464 1.00 40.44  ? 1234 VAL A C      1 
ATOM   4020  O  O      . VAL A 1 272 ? -71.212  70.371  -19.004 1.00 39.31  ? 1234 VAL A O      1 
ATOM   4021  C  CB     . VAL A 1 272 ? -72.451  71.510  -16.123 1.00 43.34  ? 1234 VAL A CB     1 
ATOM   4022  C  CG1    . VAL A 1 272 ? -71.016  71.171  -15.744 1.00 44.93  ? 1234 VAL A CG1    1 
ATOM   4023  C  CG2    . VAL A 1 272 ? -72.970  72.648  -15.271 1.00 49.59  ? 1234 VAL A CG2    1 
ATOM   4024  H  H      . VAL A 1 272 ? -74.383  72.460  -17.317 1.00 56.24  ? 1234 VAL A H      1 
ATOM   4025  H  HA     . VAL A 1 272 ? -71.815  72.470  -17.827 1.00 53.63  ? 1234 VAL A HA     1 
ATOM   4026  H  HB     . VAL A 1 272 ? -72.999  70.730  -15.945 1.00 52.01  ? 1234 VAL A HB     1 
ATOM   4027  H  HG11   . VAL A 1 272 ? -70.980  70.964  -14.798 1.00 53.91  ? 1234 VAL A HG11   1 
ATOM   4028  H  HG12   . VAL A 1 272 ? -70.726  70.405  -16.263 1.00 53.91  ? 1234 VAL A HG12   1 
ATOM   4029  H  HG13   . VAL A 1 272 ? -70.450  71.935  -15.938 1.00 53.91  ? 1234 VAL A HG13   1 
ATOM   4030  H  HG21   . VAL A 1 272 ? -72.904  72.397  -14.336 1.00 59.51  ? 1234 VAL A HG21   1 
ATOM   4031  H  HG22   . VAL A 1 272 ? -72.434  73.439  -15.440 1.00 59.51  ? 1234 VAL A HG22   1 
ATOM   4032  H  HG23   . VAL A 1 272 ? -73.896  72.819  -15.504 1.00 59.51  ? 1234 VAL A HG23   1 
ATOM   4033  N  N      . GLY A 1 273 ? -73.325  69.743  -18.567 1.00 39.85  ? 1235 GLY A N      1 
ATOM   4034  C  CA     . GLY A 1 273 ? -73.179  68.514  -19.327 1.00 42.74  ? 1235 GLY A CA     1 
ATOM   4035  C  C      . GLY A 1 273 ? -72.923  68.778  -20.796 1.00 44.06  ? 1235 GLY A C      1 
ATOM   4036  O  O      . GLY A 1 273 ? -72.118  68.094  -21.433 1.00 43.49  ? 1235 GLY A O      1 
ATOM   4037  H  H      . GLY A 1 273 ? -74.100  69.857  -18.211 1.00 47.82  ? 1235 GLY A H      1 
ATOM   4038  H  HA2    . GLY A 1 273 ? -72.437  68.000  -18.973 1.00 51.29  ? 1235 GLY A HA2    1 
ATOM   4039  H  HA3    . GLY A 1 273 ? -73.988  67.985  -19.246 1.00 51.29  ? 1235 GLY A HA3    1 
ATOM   4040  N  N      . GLN A 1 274 ? -73.629  69.756  -21.359 1.00 46.85  ? 1236 GLN A N      1 
ATOM   4041  C  CA     . GLN A 1 274 ? -73.362  70.185  -22.724 1.00 48.57  ? 1236 GLN A CA     1 
ATOM   4042  C  C      . GLN A 1 274 ? -71.899  70.573  -22.897 1.00 48.91  ? 1236 GLN A C      1 
ATOM   4043  O  O      . GLN A 1 274 ? -71.265  70.216  -23.896 1.00 48.53  ? 1236 GLN A O      1 
ATOM   4044  C  CB     . GLN A 1 274 ? -74.288  71.348  -23.070 1.00 50.14  ? 1236 GLN A CB     1 
ATOM   4045  C  CG     . GLN A 1 274 ? -74.204  71.808  -24.492 1.00 58.52  ? 1236 GLN A CG     1 
ATOM   4046  C  CD     . GLN A 1 274 ? -75.378  72.676  -24.879 1.00 61.74  ? 1236 GLN A CD     1 
ATOM   4047  O  OE1    . GLN A 1 274 ? -76.282  72.925  -24.073 1.00 58.00  ? 1236 GLN A OE1    1 
ATOM   4048  N  NE2    . GLN A 1 274 ? -75.376  73.142  -26.122 1.00 61.71  ? 1236 GLN A NE2    1 
ATOM   4049  H  H      . GLN A 1 274 ? -74.266  70.185  -20.971 1.00 56.22  ? 1236 GLN A H      1 
ATOM   4050  H  HA     . GLN A 1 274 ? -73.555  69.453  -23.331 1.00 58.28  ? 1236 GLN A HA     1 
ATOM   4051  H  HB2    . GLN A 1 274 ? -75.204  71.076  -22.903 1.00 60.17  ? 1236 GLN A HB2    1 
ATOM   4052  H  HB3    . GLN A 1 274 ? -74.063  72.103  -22.504 1.00 60.17  ? 1236 GLN A HB3    1 
ATOM   4053  H  HG2    . GLN A 1 274 ? -73.393  72.326  -24.612 1.00 70.22  ? 1236 GLN A HG2    1 
ATOM   4054  H  HG3    . GLN A 1 274 ? -74.196  71.034  -25.077 1.00 70.22  ? 1236 GLN A HG3    1 
ATOM   4055  H  HE21   . GLN A 1 274 ? -74.730  72.945  -26.655 1.00 74.05  ? 1236 GLN A HE21   1 
ATOM   4056  H  HE22   . GLN A 1 274 ? -76.020  73.642  -26.395 1.00 74.05  ? 1236 GLN A HE22   1 
ATOM   4057  N  N      . LEU A 1 275 ? -71.343  71.304  -21.925 1.00 47.63  ? 1237 LEU A N      1 
ATOM   4058  C  CA     . LEU A 1 275 ? -69.957  71.752  -22.026 1.00 47.43  ? 1237 LEU A CA     1 
ATOM   4059  C  C      . LEU A 1 275 ? -68.975  70.612  -21.797 1.00 44.21  ? 1237 LEU A C      1 
ATOM   4060  O  O      . LEU A 1 275 ? -67.894  70.601  -22.396 1.00 43.70  ? 1237 LEU A O      1 
ATOM   4061  C  CB     . LEU A 1 275 ? -69.686  72.873  -21.022 1.00 47.21  ? 1237 LEU A CB     1 
ATOM   4062  C  CG     . LEU A 1 275 ? -70.347  74.223  -21.286 1.00 47.35  ? 1237 LEU A CG     1 
ATOM   4063  C  CD1    . LEU A 1 275 ? -70.209  75.117  -20.059 1.00 48.33  ? 1237 LEU A CD1    1 
ATOM   4064  C  CD2    . LEU A 1 275 ? -69.723  74.881  -22.503 1.00 47.84  ? 1237 LEU A CD2    1 
ATOM   4065  H  H      . LEU A 1 275 ? -71.745  71.550  -21.206 1.00 57.16  ? 1237 LEU A H      1 
ATOM   4066  H  HA     . LEU A 1 275 ? -69.804  72.104  -22.916 1.00 56.91  ? 1237 LEU A HA     1 
ATOM   4067  H  HB2    . LEU A 1 275 ? -69.987  72.574  -20.150 1.00 56.65  ? 1237 LEU A HB2    1 
ATOM   4068  H  HB3    . LEU A 1 275 ? -68.728  73.025  -20.994 1.00 56.65  ? 1237 LEU A HB3    1 
ATOM   4069  H  HG     . LEU A 1 275 ? -71.291  74.089  -21.462 1.00 56.81  ? 1237 LEU A HG     1 
ATOM   4070  H  HD11   . LEU A 1 275 ? -70.633  75.970  -20.242 1.00 58.00  ? 1237 LEU A HD11   1 
ATOM   4071  H  HD12   . LEU A 1 275 ? -70.642  74.687  -19.305 1.00 58.00  ? 1237 LEU A HD12   1 
ATOM   4072  H  HD13   . LEU A 1 275 ? -69.267  75.249  -19.869 1.00 58.00  ? 1237 LEU A HD13   1 
ATOM   4073  H  HD21   . LEU A 1 275 ? -70.155  75.736  -22.655 1.00 57.41  ? 1237 LEU A HD21   1 
ATOM   4074  H  HD22   . LEU A 1 275 ? -68.776  75.012  -22.341 1.00 57.41  ? 1237 LEU A HD22   1 
ATOM   4075  H  HD23   . LEU A 1 275 ? -69.850  74.305  -23.273 1.00 57.41  ? 1237 LEU A HD23   1 
ATOM   4076  N  N      . TRP A 1 276 ? -69.315  69.663  -20.925 1.00 45.19  ? 1238 TRP A N      1 
ATOM   4077  C  CA     . TRP A 1 276 ? -68.415  68.542  -20.676 1.00 45.29  ? 1238 TRP A CA     1 
ATOM   4078  C  C      . TRP A 1 276 ? -68.291  67.667  -21.915 1.00 43.88  ? 1238 TRP A C      1 
ATOM   4079  O  O      . TRP A 1 276 ? -67.182  67.294  -22.315 1.00 42.65  ? 1238 TRP A O      1 
ATOM   4080  C  CB     . TRP A 1 276 ? -68.898  67.726  -19.473 1.00 41.59  ? 1238 TRP A CB     1 
ATOM   4081  C  CG     . TRP A 1 276 ? -68.158  66.430  -19.307 1.00 40.57  ? 1238 TRP A CG     1 
ATOM   4082  C  CD1    . TRP A 1 276 ? -68.680  65.172  -19.384 1.00 44.03  ? 1238 TRP A CD1    1 
ATOM   4083  C  CD2    . TRP A 1 276 ? -66.757  66.267  -19.053 1.00 41.37  ? 1238 TRP A CD2    1 
ATOM   4084  N  NE1    . TRP A 1 276 ? -67.693  64.235  -19.190 1.00 42.95  ? 1238 TRP A NE1    1 
ATOM   4085  C  CE2    . TRP A 1 276 ? -66.504  64.881  -18.983 1.00 41.58  ? 1238 TRP A CE2    1 
ATOM   4086  C  CE3    . TRP A 1 276 ? -65.693  67.156  -18.876 1.00 41.84  ? 1238 TRP A CE3    1 
ATOM   4087  C  CZ2    . TRP A 1 276 ? -65.233  64.366  -18.746 1.00 43.29  ? 1238 TRP A CZ2    1 
ATOM   4088  C  CZ3    . TRP A 1 276 ? -64.431  66.643  -18.639 1.00 43.52  ? 1238 TRP A CZ3    1 
ATOM   4089  C  CH2    . TRP A 1 276 ? -64.211  65.261  -18.577 1.00 45.12  ? 1238 TRP A CH2    1 
ATOM   4090  H  H      . TRP A 1 276 ? -70.046  69.645  -20.474 1.00 54.23  ? 1238 TRP A H      1 
ATOM   4091  H  HA     . TRP A 1 276 ? -67.533  68.888  -20.466 1.00 54.35  ? 1238 TRP A HA     1 
ATOM   4092  H  HB2    . TRP A 1 276 ? -68.771  68.248  -18.665 1.00 49.90  ? 1238 TRP A HB2    1 
ATOM   4093  H  HB3    . TRP A 1 276 ? -69.839  67.520  -19.589 1.00 49.90  ? 1238 TRP A HB3    1 
ATOM   4094  H  HD1    . TRP A 1 276 ? -69.575  64.976  -19.544 1.00 52.84  ? 1238 TRP A HD1    1 
ATOM   4095  H  HE1    . TRP A 1 276 ? -67.804  63.382  -19.195 1.00 51.54  ? 1238 TRP A HE1    1 
ATOM   4096  H  HE3    . TRP A 1 276 ? -65.832  68.075  -18.918 1.00 50.21  ? 1238 TRP A HE3    1 
ATOM   4097  H  HZ2    . TRP A 1 276 ? -65.084  63.450  -18.702 1.00 51.94  ? 1238 TRP A HZ2    1 
ATOM   4098  H  HZ3    . TRP A 1 276 ? -63.716  67.225  -18.520 1.00 52.22  ? 1238 TRP A HZ3    1 
ATOM   4099  H  HH2    . TRP A 1 276 ? -63.352  64.944  -18.414 1.00 54.15  ? 1238 TRP A HH2    1 
ATOM   4100  N  N      . LEU A 1 277 ? -69.419  67.333  -22.543 1.00 44.91  ? 1239 LEU A N      1 
ATOM   4101  C  CA     . LEU A 1 277 ? -69.355  66.600  -23.802 1.00 50.16  ? 1239 LEU A CA     1 
ATOM   4102  C  C      . LEU A 1 277 ? -68.669  67.435  -24.875 1.00 51.31  ? 1239 LEU A C      1 
ATOM   4103  O  O      . LEU A 1 277 ? -67.930  66.901  -25.710 1.00 52.14  ? 1239 LEU A O      1 
ATOM   4104  C  CB     . LEU A 1 277 ? -70.759  66.186  -24.245 1.00 47.99  ? 1239 LEU A CB     1 
ATOM   4105  C  CG     . LEU A 1 277 ? -70.859  65.410  -25.561 1.00 51.84  ? 1239 LEU A CG     1 
ATOM   4106  C  CD1    . LEU A 1 277 ? -70.000  64.148  -25.530 1.00 51.83  ? 1239 LEU A CD1    1 
ATOM   4107  C  CD2    . LEU A 1 277 ? -72.312  65.052  -25.858 1.00 53.10  ? 1239 LEU A CD2    1 
ATOM   4108  H  H      . LEU A 1 277 ? -70.213  67.515  -22.269 1.00 53.89  ? 1239 LEU A H      1 
ATOM   4109  H  HA     . LEU A 1 277 ? -68.833  65.793  -23.671 1.00 60.19  ? 1239 LEU A HA     1 
ATOM   4110  H  HB2    . LEU A 1 277 ? -71.144  65.627  -23.552 1.00 57.58  ? 1239 LEU A HB2    1 
ATOM   4111  H  HB3    . LEU A 1 277 ? -71.295  66.989  -24.344 1.00 57.58  ? 1239 LEU A HB3    1 
ATOM   4112  H  HG     . LEU A 1 277 ? -70.537  65.972  -26.283 1.00 62.21  ? 1239 LEU A HG     1 
ATOM   4113  H  HD11   . LEU A 1 277 ? -70.089  63.685  -26.377 1.00 62.20  ? 1239 LEU A HD11   1 
ATOM   4114  H  HD12   . LEU A 1 277 ? -69.074  64.401  -25.386 1.00 62.20  ? 1239 LEU A HD12   1 
ATOM   4115  H  HD13   . LEU A 1 277 ? -70.304  63.578  -24.807 1.00 62.20  ? 1239 LEU A HD13   1 
ATOM   4116  H  HD21   . LEU A 1 277 ? -72.352  64.562  -26.694 1.00 63.72  ? 1239 LEU A HD21   1 
ATOM   4117  H  HD22   . LEU A 1 277 ? -72.656  64.504  -25.135 1.00 63.72  ? 1239 LEU A HD22   1 
ATOM   4118  H  HD23   . LEU A 1 277 ? -72.830  65.870  -25.928 1.00 63.72  ? 1239 LEU A HD23   1 
ATOM   4119  N  N      . GLY A 1 278 ? -68.882  68.752  -24.856 1.00 49.57  ? 1240 GLY A N      1 
ATOM   4120  C  CA     . GLY A 1 278 ? -68.197  69.615  -25.803 1.00 51.52  ? 1240 GLY A CA     1 
ATOM   4121  C  C      . GLY A 1 278 ? -66.690  69.577  -25.639 1.00 52.12  ? 1240 GLY A C      1 
ATOM   4122  O  O      . GLY A 1 278 ? -65.947  69.608  -26.625 1.00 52.74  ? 1240 GLY A O      1 
ATOM   4123  H  H      . GLY A 1 278 ? -69.410  69.160  -24.313 1.00 59.49  ? 1240 GLY A H      1 
ATOM   4124  H  HA2    . GLY A 1 278 ? -68.414  69.339  -26.707 1.00 61.83  ? 1240 GLY A HA2    1 
ATOM   4125  H  HA3    . GLY A 1 278 ? -68.496  70.530  -25.681 1.00 61.83  ? 1240 GLY A HA3    1 
ATOM   4126  N  N      . LEU A 1 279 ? -66.218  69.503  -24.392 1.00 46.52  ? 1241 LEU A N      1 
ATOM   4127  C  CA     . LEU A 1 279 ? -64.783  69.418  -24.140 1.00 46.54  ? 1241 LEU A CA     1 
ATOM   4128  C  C      . LEU A 1 279 ? -64.211  68.121  -24.699 1.00 45.40  ? 1241 LEU A C      1 
ATOM   4129  O  O      . LEU A 1 279 ? -63.172  68.123  -25.369 1.00 45.73  ? 1241 LEU A O      1 
ATOM   4130  C  CB     . LEU A 1 279 ? -64.512  69.533  -22.635 1.00 46.06  ? 1241 LEU A CB     1 
ATOM   4131  C  CG     . LEU A 1 279 ? -63.057  69.465  -22.156 1.00 43.88  ? 1241 LEU A CG     1 
ATOM   4132  C  CD1    . LEU A 1 279 ? -62.880  70.275  -20.884 1.00 44.39  ? 1241 LEU A CD1    1 
ATOM   4133  C  CD2    . LEU A 1 279 ? -62.606  68.027  -21.912 1.00 44.06  ? 1241 LEU A CD2    1 
ATOM   4134  H  H      . LEU A 1 279 ? -66.705  69.502  -23.684 1.00 55.83  ? 1241 LEU A H      1 
ATOM   4135  H  HA     . LEU A 1 279 ? -64.339  70.158  -24.583 1.00 55.85  ? 1241 LEU A HA     1 
ATOM   4136  H  HB2    . LEU A 1 279 ? -64.868  70.384  -22.332 1.00 55.27  ? 1241 LEU A HB2    1 
ATOM   4137  H  HB3    . LEU A 1 279 ? -64.989  68.815  -22.190 1.00 55.27  ? 1241 LEU A HB3    1 
ATOM   4138  H  HG     . LEU A 1 279 ? -62.482  69.847  -22.837 1.00 52.66  ? 1241 LEU A HG     1 
ATOM   4139  H  HD11   . LEU A 1 279 ? -61.955  70.218  -20.599 1.00 53.27  ? 1241 LEU A HD11   1 
ATOM   4140  H  HD12   . LEU A 1 279 ? -63.115  71.199  -21.064 1.00 53.27  ? 1241 LEU A HD12   1 
ATOM   4141  H  HD13   . LEU A 1 279 ? -63.461  69.914  -20.196 1.00 53.27  ? 1241 LEU A HD13   1 
ATOM   4142  H  HD21   . LEU A 1 279 ? -61.683  68.033  -21.612 1.00 52.87  ? 1241 LEU A HD21   1 
ATOM   4143  H  HD22   . LEU A 1 279 ? -63.173  67.629  -21.233 1.00 52.87  ? 1241 LEU A HD22   1 
ATOM   4144  H  HD23   . LEU A 1 279 ? -62.681  67.528  -22.740 1.00 52.87  ? 1241 LEU A HD23   1 
ATOM   4145  N  N      . LEU A 1 280 ? -64.874  66.995  -24.422 1.00 45.25  ? 1242 LEU A N      1 
ATOM   4146  C  CA     . LEU A 1 280 ? -64.407  65.716  -24.945 1.00 44.23  ? 1242 LEU A CA     1 
ATOM   4147  C  C      . LEU A 1 280 ? -64.366  65.732  -26.465 1.00 44.51  ? 1242 LEU A C      1 
ATOM   4148  O  O      . LEU A 1 280 ? -63.413  65.233  -27.074 1.00 46.04  ? 1242 LEU A O      1 
ATOM   4149  C  CB     . LEU A 1 280 ? -65.304  64.585  -24.441 1.00 44.91  ? 1242 LEU A CB     1 
ATOM   4150  C  CG     . LEU A 1 280 ? -65.300  64.378  -22.919 1.00 42.23  ? 1242 LEU A CG     1 
ATOM   4151  C  CD1    . LEU A 1 280 ? -66.393  63.415  -22.482 1.00 38.40  ? 1242 LEU A CD1    1 
ATOM   4152  C  CD2    . LEU A 1 280 ? -63.937  63.878  -22.455 1.00 41.45  ? 1242 LEU A CD2    1 
ATOM   4153  H  H      . LEU A 1 280 ? -65.586  66.948  -23.941 1.00 54.29  ? 1242 LEU A H      1 
ATOM   4154  H  HA     . LEU A 1 280 ? -63.508  65.552  -24.622 1.00 53.08  ? 1242 LEU A HA     1 
ATOM   4155  H  HB2    . LEU A 1 280 ? -66.218  64.774  -24.708 1.00 53.89  ? 1242 LEU A HB2    1 
ATOM   4156  H  HB3    . LEU A 1 280 ? -65.012  63.755  -24.849 1.00 53.89  ? 1242 LEU A HB3    1 
ATOM   4157  H  HG     . LEU A 1 280 ? -65.466  65.231  -22.488 1.00 50.68  ? 1242 LEU A HG     1 
ATOM   4158  H  HD11   . LEU A 1 280 ? -66.356  63.313  -21.518 1.00 46.08  ? 1242 LEU A HD11   1 
ATOM   4159  H  HD12   . LEU A 1 280 ? -67.255  63.776  -22.744 1.00 46.08  ? 1242 LEU A HD12   1 
ATOM   4160  H  HD13   . LEU A 1 280 ? -66.249  62.558  -22.912 1.00 46.08  ? 1242 LEU A HD13   1 
ATOM   4161  H  HD21   . LEU A 1 280 ? -63.957  63.755  -21.493 1.00 49.75  ? 1242 LEU A HD21   1 
ATOM   4162  H  HD22   . LEU A 1 280 ? -63.744  63.034  -22.893 1.00 49.75  ? 1242 LEU A HD22   1 
ATOM   4163  H  HD23   . LEU A 1 280 ? -63.263  64.535  -22.691 1.00 49.75  ? 1242 LEU A HD23   1 
ATOM   4164  N  N      . ARG A 1 281 ? -65.387  66.307  -27.097 1.00 46.00  ? 1243 ARG A N      1 
ATOM   4165  C  CA     . ARG A 1 281 ? -65.380  66.401  -28.549 1.00 47.72  ? 1243 ARG A CA     1 
ATOM   4166  C  C      . ARG A 1 281 ? -64.323  67.388  -29.024 1.00 48.28  ? 1243 ARG A C      1 
ATOM   4167  O  O      . ARG A 1 281 ? -63.673  67.166  -30.052 1.00 49.35  ? 1243 ARG A O      1 
ATOM   4168  C  CB     . ARG A 1 281 ? -66.758  66.814  -29.058 1.00 50.22  ? 1243 ARG A CB     1 
ATOM   4169  C  CG     . ARG A 1 281 ? -67.874  65.838  -28.732 1.00 51.54  ? 1243 ARG A CG     1 
ATOM   4170  C  CD     . ARG A 1 281 ? -69.174  66.307  -29.358 1.00 54.17  ? 1243 ARG A CD     1 
ATOM   4171  N  NE     . ARG A 1 281 ? -69.067  66.309  -30.814 1.00 56.93  ? 1243 ARG A NE     1 
ATOM   4172  C  CZ     . ARG A 1 281 ? -69.931  66.894  -31.637 1.00 62.18  ? 1243 ARG A CZ     1 
ATOM   4173  N  NH1    . ARG A 1 281 ? -70.985  67.541  -31.159 1.00 63.66  1 1243 ARG A NH1    1 
ATOM   4174  N  NH2    . ARG A 1 281 ? -69.738  66.831  -32.946 1.00 66.06  ? 1243 ARG A NH2    1 
ATOM   4175  H  H      . ARG A 1 281 ? -66.081  66.642  -26.715 1.00 55.20  ? 1243 ARG A H      1 
ATOM   4176  H  HA     . ARG A 1 281 ? -65.169  65.531  -28.922 1.00 57.27  ? 1243 ARG A HA     1 
ATOM   4177  H  HB2    . ARG A 1 281 ? -66.991  67.668  -28.662 1.00 60.27  ? 1243 ARG A HB2    1 
ATOM   4178  H  HB3    . ARG A 1 281 ? -66.718  66.902  -30.023 1.00 60.27  ? 1243 ARG A HB3    1 
ATOM   4179  H  HG2    . ARG A 1 281 ? -67.656  64.964  -29.092 1.00 61.84  ? 1243 ARG A HG2    1 
ATOM   4180  H  HG3    . ARG A 1 281 ? -67.993  65.790  -27.771 1.00 61.84  ? 1243 ARG A HG3    1 
ATOM   4181  H  HD2    . ARG A 1 281 ? -69.891  65.706  -29.102 1.00 65.01  ? 1243 ARG A HD2    1 
ATOM   4182  H  HD3    . ARG A 1 281 ? -69.367  67.211  -29.062 1.00 65.01  ? 1243 ARG A HD3    1 
ATOM   4183  H  HE     . ARG A 1 281 ? -68.396  65.902  -31.165 1.00 68.32  ? 1243 ARG A HE     1 
ATOM   4184  H  HH11   . ARG A 1 281 ? -71.115  67.583  -30.310 1.00 76.39  ? 1243 ARG A HH11   1 
ATOM   4185  H  HH12   . ARG A 1 281 ? -71.540  67.917  -31.698 1.00 76.39  ? 1243 ARG A HH12   1 
ATOM   4186  H  HH21   . ARG A 1 281 ? -69.055  66.413  -33.260 1.00 79.27  ? 1243 ARG A HH21   1 
ATOM   4187  H  HH22   . ARG A 1 281 ? -70.294  67.209  -33.481 1.00 79.27  ? 1243 ARG A HH22   1 
ATOM   4188  N  N      . PHE A 1 282 ? -64.132  68.479  -28.281 1.00 49.12  ? 1244 PHE A N      1 
ATOM   4189  C  CA     . PHE A 1 282 ? -63.170  69.499  -28.683 1.00 51.38  ? 1244 PHE A CA     1 
ATOM   4190  C  C      . PHE A 1 282 ? -61.766  68.920  -28.809 1.00 52.60  ? 1244 PHE A C      1 
ATOM   4191  O  O      . PHE A 1 282 ? -61.089  69.119  -29.825 1.00 52.01  ? 1244 PHE A O      1 
ATOM   4192  C  CB     . PHE A 1 282 ? -63.190  70.645  -27.674 1.00 49.90  ? 1244 PHE A CB     1 
ATOM   4193  C  CG     . PHE A 1 282 ? -62.128  71.676  -27.905 1.00 49.81  ? 1244 PHE A CG     1 
ATOM   4194  C  CD1    . PHE A 1 282 ? -62.196  72.532  -28.990 1.00 49.51  ? 1244 PHE A CD1    1 
ATOM   4195  C  CD2    . PHE A 1 282 ? -61.065  71.797  -27.026 1.00 47.28  ? 1244 PHE A CD2    1 
ATOM   4196  C  CE1    . PHE A 1 282 ? -61.219  73.484  -29.198 1.00 51.12  ? 1244 PHE A CE1    1 
ATOM   4197  C  CE2    . PHE A 1 282 ? -60.085  72.748  -27.229 1.00 49.31  ? 1244 PHE A CE2    1 
ATOM   4198  C  CZ     . PHE A 1 282 ? -60.162  73.593  -28.314 1.00 49.46  ? 1244 PHE A CZ     1 
ATOM   4199  H  H      . PHE A 1 282 ? -64.545  68.649  -27.546 1.00 58.94  ? 1244 PHE A H      1 
ATOM   4200  H  HA     . PHE A 1 282 ? -63.428  69.855  -29.548 1.00 61.66  ? 1244 PHE A HA     1 
ATOM   4201  H  HB2    . PHE A 1 282 ? -64.051  71.090  -27.724 1.00 59.88  ? 1244 PHE A HB2    1 
ATOM   4202  H  HB3    . PHE A 1 282 ? -63.061  70.281  -26.784 1.00 59.88  ? 1244 PHE A HB3    1 
ATOM   4203  H  HD1    . PHE A 1 282 ? -62.905  72.463  -29.587 1.00 59.42  ? 1244 PHE A HD1    1 
ATOM   4204  H  HD2    . PHE A 1 282 ? -61.009  71.230  -26.292 1.00 56.73  ? 1244 PHE A HD2    1 
ATOM   4205  H  HE1    . PHE A 1 282 ? -61.273  74.053  -29.931 1.00 61.35  ? 1244 PHE A HE1    1 
ATOM   4206  H  HE2    . PHE A 1 282 ? -59.375  72.818  -26.633 1.00 59.18  ? 1244 PHE A HE2    1 
ATOM   4207  H  HZ     . PHE A 1 282 ? -59.502  74.234  -28.454 1.00 59.36  ? 1244 PHE A HZ     1 
ATOM   4208  N  N      . TYR A 1 283 ? -61.317  68.184  -27.794 1.00 47.51  ? 1245 TYR A N      1 
ATOM   4209  C  CA     . TYR A 1 283 ? -59.957  67.660  -27.785 1.00 49.53  ? 1245 TYR A CA     1 
ATOM   4210  C  C      . TYR A 1 283 ? -59.806  66.354  -28.555 1.00 49.25  ? 1245 TYR A C      1 
ATOM   4211  O  O      . TYR A 1 283 ? -58.688  65.832  -28.627 1.00 51.03  ? 1245 TYR A O      1 
ATOM   4212  C  CB     . TYR A 1 283 ? -59.472  67.466  -26.344 1.00 44.53  ? 1245 TYR A CB     1 
ATOM   4213  C  CG     . TYR A 1 283 ? -59.099  68.754  -25.641 1.00 44.22  ? 1245 TYR A CG     1 
ATOM   4214  C  CD1    . TYR A 1 283 ? -58.101  69.580  -26.146 1.00 47.75  ? 1245 TYR A CD1    1 
ATOM   4215  C  CD2    . TYR A 1 283 ? -59.731  69.137  -24.467 1.00 45.33  ? 1245 TYR A CD2    1 
ATOM   4216  C  CE1    . TYR A 1 283 ? -57.754  70.758  -25.506 1.00 47.78  ? 1245 TYR A CE1    1 
ATOM   4217  C  CE2    . TYR A 1 283 ? -59.388  70.310  -23.819 1.00 46.02  ? 1245 TYR A CE2    1 
ATOM   4218  C  CZ     . TYR A 1 283 ? -58.400  71.115  -24.341 1.00 47.33  ? 1245 TYR A CZ     1 
ATOM   4219  O  OH     . TYR A 1 283 ? -58.059  72.282  -23.695 1.00 46.65  ? 1245 TYR A OH     1 
ATOM   4220  H  H      . TYR A 1 283 ? -61.780  67.974  -27.101 1.00 57.02  ? 1245 TYR A H      1 
ATOM   4221  H  HA     . TYR A 1 283 ? -59.374  68.313  -28.203 1.00 59.43  ? 1245 TYR A HA     1 
ATOM   4222  H  HB2    . TYR A 1 283 ? -60.179  67.043  -25.831 1.00 53.43  ? 1245 TYR A HB2    1 
ATOM   4223  H  HB3    . TYR A 1 283 ? -58.688  66.895  -26.353 1.00 53.43  ? 1245 TYR A HB3    1 
ATOM   4224  H  HD1    . TYR A 1 283 ? -57.664  69.342  -26.931 1.00 57.30  ? 1245 TYR A HD1    1 
ATOM   4225  H  HD2    . TYR A 1 283 ? -60.399  68.596  -24.110 1.00 54.40  ? 1245 TYR A HD2    1 
ATOM   4226  H  HE1    . TYR A 1 283 ? -57.086  71.302  -25.856 1.00 57.33  ? 1245 TYR A HE1    1 
ATOM   4227  H  HE2    . TYR A 1 283 ? -59.823  70.554  -23.034 1.00 55.23  ? 1245 TYR A HE2    1 
ATOM   4228  H  HH     . TYR A 1 283 ? -58.528  72.375  -23.004 1.00 55.98  ? 1245 TYR A HH     1 
ATOM   4229  N  N      . THR A 1 284 ? -60.886  65.799  -29.105 1.00 48.53  ? 1246 THR A N      1 
ATOM   4230  C  CA     . THR A 1 284 ? -60.797  64.623  -29.962 1.00 51.21  ? 1246 THR A CA     1 
ATOM   4231  C  C      . THR A 1 284 ? -61.113  64.912  -31.420 1.00 55.15  ? 1246 THR A C      1 
ATOM   4232  O  O      . THR A 1 284 ? -60.569  64.241  -32.297 1.00 59.01  ? 1246 THR A O      1 
ATOM   4233  C  CB     . THR A 1 284 ? -61.751  63.525  -29.475 1.00 52.65  ? 1246 THR A CB     1 
ATOM   4234  O  OG1    . THR A 1 284 ? -63.099  64.010  -29.507 1.00 53.48  ? 1246 THR A OG1    1 
ATOM   4235  C  CG2    . THR A 1 284 ? -61.398  63.087  -28.051 1.00 49.30  ? 1246 THR A CG2    1 
ATOM   4236  H  H      . THR A 1 284 ? -61.688  66.090  -28.995 1.00 58.24  ? 1246 THR A H      1 
ATOM   4237  H  HA     . THR A 1 284 ? -59.893  64.273  -29.917 1.00 61.46  ? 1246 THR A HA     1 
ATOM   4238  H  HB     . THR A 1 284 ? -61.675  62.753  -30.057 1.00 63.18  ? 1246 THR A HB     1 
ATOM   4239  H  HG1    . THR A 1 284 ? -63.174  64.682  -29.008 1.00 64.17  ? 1246 THR A HG1    1 
ATOM   4240  H  HG21   . THR A 1 284 ? -62.009  62.393  -27.756 1.00 59.16  ? 1246 THR A HG21   1 
ATOM   4241  H  HG22   . THR A 1 284 ? -60.492  62.741  -28.025 1.00 59.16  ? 1246 THR A HG22   1 
ATOM   4242  H  HG23   . THR A 1 284 ? -61.464  63.843  -27.446 1.00 59.16  ? 1246 THR A HG23   1 
ATOM   4243  N  N      . GLU A 1 285 ? -61.969  65.892  -31.698 1.00 54.12  ? 1247 GLU A N      1 
ATOM   4244  C  CA     . GLU A 1 285 ? -62.391  66.224  -33.054 1.00 56.02  ? 1247 GLU A CA     1 
ATOM   4245  C  C      . GLU A 1 285 ? -61.804  67.528  -33.565 1.00 59.18  ? 1247 GLU A C      1 
ATOM   4246  O  O      . GLU A 1 285 ? -61.390  67.603  -34.722 1.00 59.92  ? 1247 GLU A O      1 
ATOM   4247  C  CB     . GLU A 1 285 ? -63.921  66.326  -33.129 1.00 55.84  ? 1247 GLU A CB     1 
ATOM   4248  C  CG     . GLU A 1 285 ? -64.680  65.104  -32.636 1.00 58.02  ? 1247 GLU A CG     1 
ATOM   4249  C  CD     . GLU A 1 285 ? -66.179  65.344  -32.574 1.00 57.45  ? 1247 GLU A CD     1 
ATOM   4250  O  OE1    . GLU A 1 285 ? -66.656  66.293  -33.230 1.00 58.33  ? 1247 GLU A OE1    1 
ATOM   4251  O  OE2    . GLU A 1 285 ? -66.882  64.595  -31.863 1.00 58.07  1 1247 GLU A OE2    1 
ATOM   4252  H  H      . GLU A 1 285 ? -62.329  66.393  -31.098 1.00 64.95  ? 1247 GLU A H      1 
ATOM   4253  H  HA     . GLU A 1 285 ? -62.108  65.516  -33.653 1.00 67.22  ? 1247 GLU A HA     1 
ATOM   4254  H  HB2    . GLU A 1 285 ? -64.205  67.081  -32.591 1.00 67.01  ? 1247 GLU A HB2    1 
ATOM   4255  H  HB3    . GLU A 1 285 ? -64.174  66.473  -34.053 1.00 67.01  ? 1247 GLU A HB3    1 
ATOM   4256  H  HG2    . GLU A 1 285 ? -64.518  64.364  -33.242 1.00 69.62  ? 1247 GLU A HG2    1 
ATOM   4257  H  HG3    . GLU A 1 285 ? -64.374  64.878  -31.744 1.00 69.62  ? 1247 GLU A HG3    1 
ATOM   4258  N  N      . GLU A 1 286 ? -61.761  68.558  -32.724 1.00 61.78  ? 1248 GLU A N      1 
ATOM   4259  C  CA     . GLU A 1 286 ? -61.550  69.929  -33.168 1.00 64.18  ? 1248 GLU A CA     1 
ATOM   4260  C  C      . GLU A 1 286 ? -60.118  70.413  -32.967 1.00 60.87  ? 1248 GLU A C      1 
ATOM   4261  O  O      . GLU A 1 286 ? -59.503  70.927  -33.905 1.00 61.01  ? 1248 GLU A O      1 
ATOM   4262  C  CB     . GLU A 1 286 ? -62.532  70.838  -32.421 1.00 68.14  ? 1248 GLU A CB     1 
ATOM   4263  C  CG     . GLU A 1 286 ? -62.603  72.270  -32.912 1.00 74.09  ? 1248 GLU A CG     1 
ATOM   4264  C  CD     . GLU A 1 286 ? -63.650  73.077  -32.163 1.00 76.88  ? 1248 GLU A CD     1 
ATOM   4265  O  OE1    . GLU A 1 286 ? -64.429  72.473  -31.389 1.00 74.41  ? 1248 GLU A OE1    1 
ATOM   4266  O  OE2    . GLU A 1 286 ? -63.692  74.313  -32.344 1.00 78.44  1 1248 GLU A OE2    1 
ATOM   4267  H  H      . GLU A 1 286 ? -61.854  68.485  -31.872 1.00 74.14  ? 1248 GLU A H      1 
ATOM   4268  H  HA     . GLU A 1 286 ? -61.752  69.986  -34.115 1.00 77.01  ? 1248 GLU A HA     1 
ATOM   4269  H  HB2    . GLU A 1 286 ? -63.422  70.459  -32.501 1.00 81.77  ? 1248 GLU A HB2    1 
ATOM   4270  H  HB3    . GLU A 1 286 ? -62.275  70.864  -31.486 1.00 81.77  ? 1248 GLU A HB3    1 
ATOM   4271  H  HG2    . GLU A 1 286 ? -61.741  72.695  -32.779 1.00 88.90  ? 1248 GLU A HG2    1 
ATOM   4272  H  HG3    . GLU A 1 286 ? -62.836  72.272  -33.854 1.00 88.90  ? 1248 GLU A HG3    1 
ATOM   4273  N  N      . PHE A 1 287 ? -59.571  70.262  -31.765 1.00 60.90  ? 1249 PHE A N      1 
ATOM   4274  C  CA     . PHE A 1 287 ? -58.278  70.860  -31.454 1.00 60.63  ? 1249 PHE A CA     1 
ATOM   4275  C  C      . PHE A 1 287 ? -57.161  70.159  -32.218 1.00 60.40  ? 1249 PHE A C      1 
ATOM   4276  O  O      . PHE A 1 287 ? -57.089  68.926  -32.244 1.00 58.99  ? 1249 PHE A O      1 
ATOM   4277  C  CB     . PHE A 1 287 ? -58.013  70.800  -29.950 1.00 53.70  ? 1249 PHE A CB     1 
ATOM   4278  C  CG     . PHE A 1 287 ? -56.742  71.479  -29.535 1.00 51.29  ? 1249 PHE A CG     1 
ATOM   4279  C  CD1    . PHE A 1 287 ? -56.647  72.859  -29.544 1.00 51.01  ? 1249 PHE A CD1    1 
ATOM   4280  C  CD2    . PHE A 1 287 ? -55.642  70.739  -29.136 1.00 50.18  ? 1249 PHE A CD2    1 
ATOM   4281  C  CE1    . PHE A 1 287 ? -55.479  73.489  -29.167 1.00 52.03  ? 1249 PHE A CE1    1 
ATOM   4282  C  CE2    . PHE A 1 287 ? -54.470  71.364  -28.755 1.00 50.01  ? 1249 PHE A CE2    1 
ATOM   4283  C  CZ     . PHE A 1 287 ? -54.389  72.741  -28.771 1.00 50.11  ? 1249 PHE A CZ     1 
ATOM   4284  H  H      . PHE A 1 287 ? -59.924  69.822  -31.117 1.00 73.08  ? 1249 PHE A H      1 
ATOM   4285  H  HA     . PHE A 1 287 ? -58.287  71.793  -31.721 1.00 72.76  ? 1249 PHE A HA     1 
ATOM   4286  H  HB2    . PHE A 1 287 ? -58.746  71.232  -29.485 1.00 64.44  ? 1249 PHE A HB2    1 
ATOM   4287  H  HB3    . PHE A 1 287 ? -57.955  69.870  -29.679 1.00 64.44  ? 1249 PHE A HB3    1 
ATOM   4288  H  HD1    . PHE A 1 287 ? -57.378  73.368  -29.811 1.00 61.21  ? 1249 PHE A HD1    1 
ATOM   4289  H  HD2    . PHE A 1 287 ? -55.692  69.810  -29.124 1.00 60.21  ? 1249 PHE A HD2    1 
ATOM   4290  H  HE1    . PHE A 1 287 ? -55.426  74.417  -29.177 1.00 62.44  ? 1249 PHE A HE1    1 
ATOM   4291  H  HE2    . PHE A 1 287 ? -53.737  70.857  -28.489 1.00 60.01  ? 1249 PHE A HE2    1 
ATOM   4292  H  HZ     . PHE A 1 287 ? -53.602  73.164  -28.515 1.00 60.13  ? 1249 PHE A HZ     1 
ATOM   4293  N  N      . ASP A 1 288 ? -56.284  70.951  -32.835 1.00 64.51  ? 1250 ASP A N      1 
ATOM   4294  C  CA     . ASP A 1 288 ? -55.148  70.440  -33.602 1.00 68.81  ? 1250 ASP A CA     1 
ATOM   4295  C  C      . ASP A 1 288 ? -53.921  70.455  -32.696 1.00 69.29  ? 1250 ASP A C      1 
ATOM   4296  O  O      . ASP A 1 288 ? -53.260  71.486  -32.544 1.00 68.43  ? 1250 ASP A O      1 
ATOM   4297  C  CB     . ASP A 1 288 ? -54.929  71.279  -34.857 1.00 73.22  ? 1250 ASP A CB     1 
ATOM   4298  C  CG     . ASP A 1 288 ? -53.930  70.654  -35.814 1.00 77.41  ? 1250 ASP A CG     1 
ATOM   4299  O  OD1    . ASP A 1 288 ? -53.151  69.778  -35.381 1.00 78.42  ? 1250 ASP A OD1    1 
ATOM   4300  O  OD2    . ASP A 1 288 ? -53.920  71.043  -37.001 1.00 82.17  1 1250 ASP A OD2    1 
ATOM   4301  H  H      . ASP A 1 288 ? -56.328  71.810  -32.823 1.00 77.41  ? 1250 ASP A H      1 
ATOM   4302  H  HA     . ASP A 1 288 ? -55.323  69.524  -33.870 1.00 82.57  ? 1250 ASP A HA     1 
ATOM   4303  H  HB2    . ASP A 1 288 ? -55.774  71.373  -35.325 1.00 87.86  ? 1250 ASP A HB2    1 
ATOM   4304  H  HB3    . ASP A 1 288 ? -54.593  72.151  -34.600 1.00 87.86  ? 1250 ASP A HB3    1 
ATOM   4305  N  N      . PHE A 1 289 ? -53.605  69.298  -32.108 1.00 69.24  ? 1251 PHE A N      1 
ATOM   4306  C  CA     . PHE A 1 289 ? -52.496  69.222  -31.161 1.00 65.72  ? 1251 PHE A CA     1 
ATOM   4307  C  C      . PHE A 1 289 ? -51.157  69.476  -31.840 1.00 69.50  ? 1251 PHE A C      1 
ATOM   4308  O  O      . PHE A 1 289 ? -50.274  70.118  -31.259 1.00 68.59  ? 1251 PHE A O      1 
ATOM   4309  C  CB     . PHE A 1 289 ? -52.480  67.856  -30.480 1.00 64.38  ? 1251 PHE A CB     1 
ATOM   4310  C  CG     . PHE A 1 289 ? -53.526  67.691  -29.420 1.00 62.29  ? 1251 PHE A CG     1 
ATOM   4311  C  CD1    . PHE A 1 289 ? -53.332  68.216  -28.153 1.00 59.29  ? 1251 PHE A CD1    1 
ATOM   4312  C  CD2    . PHE A 1 289 ? -54.695  66.998  -29.681 1.00 61.18  ? 1251 PHE A CD2    1 
ATOM   4313  C  CE1    . PHE A 1 289 ? -54.292  68.062  -27.168 1.00 58.89  ? 1251 PHE A CE1    1 
ATOM   4314  C  CE2    . PHE A 1 289 ? -55.658  66.839  -28.699 1.00 59.57  ? 1251 PHE A CE2    1 
ATOM   4315  C  CZ     . PHE A 1 289 ? -55.455  67.371  -27.441 1.00 57.22  ? 1251 PHE A CZ     1 
ATOM   4316  H  H      . PHE A 1 289 ? -54.014  68.553  -32.240 1.00 83.09  ? 1251 PHE A H      1 
ATOM   4317  H  HA     . PHE A 1 289 ? -52.619  69.897  -30.476 1.00 78.87  ? 1251 PHE A HA     1 
ATOM   4318  H  HB2    . PHE A 1 289 ? -52.628  67.172  -31.151 1.00 77.26  ? 1251 PHE A HB2    1 
ATOM   4319  H  HB3    . PHE A 1 289 ? -51.614  67.726  -30.064 1.00 77.26  ? 1251 PHE A HB3    1 
ATOM   4320  H  HD1    . PHE A 1 289 ? -52.550  68.682  -27.964 1.00 71.15  ? 1251 PHE A HD1    1 
ATOM   4321  H  HD2    . PHE A 1 289 ? -54.837  66.638  -30.527 1.00 73.42  ? 1251 PHE A HD2    1 
ATOM   4322  H  HE1    . PHE A 1 289 ? -54.152  68.421  -26.321 1.00 70.67  ? 1251 PHE A HE1    1 
ATOM   4323  H  HE2    . PHE A 1 289 ? -56.441  66.374  -28.887 1.00 71.48  ? 1251 PHE A HE2    1 
ATOM   4324  H  HZ     . PHE A 1 289 ? -56.101  67.266  -26.781 1.00 68.66  ? 1251 PHE A HZ     1 
ATOM   4325  N  N      . LYS A 1 290 ? -50.974  68.971  -33.061 1.00 71.45  ? 1252 LYS A N      1 
ATOM   4326  C  CA     . LYS A 1 290 ? -49.691  69.134  -33.731 1.00 72.44  ? 1252 LYS A CA     1 
ATOM   4327  C  C      . LYS A 1 290 ? -49.465  70.557  -34.220 1.00 71.31  ? 1252 LYS A C      1 
ATOM   4328  O  O      . LYS A 1 290 ? -48.338  70.889  -34.601 1.00 71.59  ? 1252 LYS A O      1 
ATOM   4329  C  CB     . LYS A 1 290 ? -49.573  68.157  -34.905 1.00 74.67  ? 1252 LYS A CB     1 
ATOM   4330  C  CG     . LYS A 1 290 ? -48.162  68.081  -35.484 1.00 80.88  ? 1252 LYS A CG     1 
ATOM   4331  C  CD     . LYS A 1 290 ? -48.021  67.016  -36.561 1.00 85.84  ? 1252 LYS A CD     1 
ATOM   4332  C  CE     . LYS A 1 290 ? -46.590  66.967  -37.085 1.00 90.66  ? 1252 LYS A CE     1 
ATOM   4333  N  NZ     . LYS A 1 290 ? -46.409  65.979  -38.187 1.00 94.19  1 1252 LYS A NZ     1 
ATOM   4334  H  H      . LYS A 1 290 ? -51.566  68.539  -33.512 1.00 85.74  ? 1252 LYS A H      1 
ATOM   4335  H  HA     . LYS A 1 290 ? -48.984  68.924  -33.101 1.00 86.93  ? 1252 LYS A HA     1 
ATOM   4336  H  HB2    . LYS A 1 290 ? -49.819  67.269  -34.601 1.00 89.61  ? 1252 LYS A HB2    1 
ATOM   4337  H  HB3    . LYS A 1 290 ? -50.172  68.442  -35.613 1.00 89.61  ? 1252 LYS A HB3    1 
ATOM   4338  H  HG2    . LYS A 1 290 ? -47.936  68.938  -35.878 1.00 97.05  ? 1252 LYS A HG2    1 
ATOM   4339  H  HG3    . LYS A 1 290 ? -47.539  67.870  -34.770 1.00 97.05  ? 1252 LYS A HG3    1 
ATOM   4340  H  HD2    . LYS A 1 290 ? -48.241  66.148  -36.188 1.00 103.01 ? 1252 LYS A HD2    1 
ATOM   4341  H  HD3    . LYS A 1 290 ? -48.612  67.226  -37.301 1.00 103.01 ? 1252 LYS A HD3    1 
ATOM   4342  H  HE2    . LYS A 1 290 ? -46.348  67.843  -37.425 1.00 108.79 ? 1252 LYS A HE2    1 
ATOM   4343  H  HE3    . LYS A 1 290 ? -45.997  66.718  -36.359 1.00 108.79 ? 1252 LYS A HE3    1 
ATOM   4344  H  HZ1    . LYS A 1 290 ? -45.563  65.982  -38.463 1.00 113.02 ? 1252 LYS A HZ1    1 
ATOM   4345  H  HZ2    . LYS A 1 290 ? -46.617  65.162  -37.900 1.00 113.02 ? 1252 LYS A HZ2    1 
ATOM   4346  H  HZ3    . LYS A 1 290 ? -46.938  66.188  -38.872 1.00 113.02 ? 1252 LYS A HZ3    1 
ATOM   4347  N  N      . GLU A 1 291 ? -50.493  71.403  -34.211 1.00 71.90  ? 1253 GLU A N      1 
ATOM   4348  C  CA     . GLU A 1 291 ? -50.397  72.749  -34.761 1.00 76.28  ? 1253 GLU A CA     1 
ATOM   4349  C  C      . GLU A 1 291 ? -50.440  73.849  -33.713 1.00 74.15  ? 1253 GLU A C      1 
ATOM   4350  O  O      . GLU A 1 291 ? -49.833  74.902  -33.923 1.00 74.52  ? 1253 GLU A O      1 
ATOM   4351  C  CB     . GLU A 1 291 ? -51.536  72.989  -35.761 1.00 79.64  ? 1253 GLU A CB     1 
ATOM   4352  C  CG     . GLU A 1 291 ? -51.331  74.189  -36.661 1.00 86.92  ? 1253 GLU A CG     1 
ATOM   4353  C  CD     . GLU A 1 291 ? -50.170  74.002  -37.616 1.00 93.09  ? 1253 GLU A CD     1 
ATOM   4354  O  OE1    . GLU A 1 291 ? -50.375  73.398  -38.689 1.00 96.30  ? 1253 GLU A OE1    1 
ATOM   4355  O  OE2    . GLU A 1 291 ? -49.052  74.456  -37.294 1.00 96.82  1 1253 GLU A OE2    1 
ATOM   4356  H  H      . GLU A 1 291 ? -51.267  71.217  -33.887 1.00 86.28  ? 1253 GLU A H      1 
ATOM   4357  H  HA     . GLU A 1 291 ? -49.558  72.830  -35.241 1.00 91.53  ? 1253 GLU A HA     1 
ATOM   4358  H  HB2    . GLU A 1 291 ? -51.622  72.206  -36.328 1.00 95.57  ? 1253 GLU A HB2    1 
ATOM   4359  H  HB3    . GLU A 1 291 ? -52.359  73.128  -35.267 1.00 95.57  ? 1253 GLU A HB3    1 
ATOM   4360  H  HG2    . GLU A 1 291 ? -52.133  74.332  -37.186 1.00 104.30 ? 1253 GLU A HG2    1 
ATOM   4361  H  HG3    . GLU A 1 291 ? -51.148  74.968  -36.113 1.00 104.30 ? 1253 GLU A HG3    1 
ATOM   4362  N  N      . HIS A 1 292 ? -51.142  73.639  -32.600 1.00 68.63  ? 1254 HIS A N      1 
ATOM   4363  C  CA     . HIS A 1 292 ? -51.438  74.704  -31.653 1.00 67.38  ? 1254 HIS A CA     1 
ATOM   4364  C  C      . HIS A 1 292 ? -51.053  74.295  -30.238 1.00 62.94  ? 1254 HIS A C      1 
ATOM   4365  O  O      . HIS A 1 292 ? -51.014  73.109  -29.900 1.00 64.05  ? 1254 HIS A O      1 
ATOM   4366  C  CB     . HIS A 1 292 ? -52.921  75.073  -31.697 1.00 66.68  ? 1254 HIS A CB     1 
ATOM   4367  C  CG     . HIS A 1 292 ? -53.342  75.703  -32.986 1.00 67.53  ? 1254 HIS A CG     1 
ATOM   4368  N  ND1    . HIS A 1 292 ? -54.512  75.369  -33.632 1.00 67.57  ? 1254 HIS A ND1    1 
ATOM   4369  C  CD2    . HIS A 1 292 ? -52.745  76.647  -33.752 1.00 70.22  ? 1254 HIS A CD2    1 
ATOM   4370  C  CE1    . HIS A 1 292 ? -54.618  76.079  -34.741 1.00 71.28  ? 1254 HIS A CE1    1 
ATOM   4371  N  NE2    . HIS A 1 292 ? -53.559  76.863  -34.836 1.00 73.04  ? 1254 HIS A NE2    1 
ATOM   4372  H  H      . HIS A 1 292 ? -51.461  72.875  -32.370 1.00 82.35  ? 1254 HIS A H      1 
ATOM   4373  H  HA     . HIS A 1 292 ? -50.924  75.492  -31.890 1.00 80.86  ? 1254 HIS A HA     1 
ATOM   4374  H  HB2    . HIS A 1 292 ? -53.448  74.268  -31.573 1.00 80.01  ? 1254 HIS A HB2    1 
ATOM   4375  H  HB3    . HIS A 1 292 ? -53.109  75.702  -30.983 1.00 80.01  ? 1254 HIS A HB3    1 
ATOM   4376  H  HD2    . HIS A 1 292 ? -51.935  77.069  -33.576 1.00 84.26  ? 1254 HIS A HD2    1 
ATOM   4377  H  HE1    . HIS A 1 292 ? -55.320  76.036  -35.349 1.00 85.53  ? 1254 HIS A HE1    1 
ATOM   4378  H  HE2    . HIS A 1 292 ? -53.405  77.418  -35.474 1.00 87.65  ? 1254 HIS A HE2    1 
ATOM   4379  N  N      . VAL A 1 293 ? -50.776  75.303  -29.414 1.00 56.71  ? 1255 VAL A N      1 
ATOM   4380  C  CA     . VAL A 1 293 ? -50.377  75.118  -28.024 1.00 52.79  ? 1255 VAL A CA     1 
ATOM   4381  C  C      . VAL A 1 293 ? -51.549  75.500  -27.132 1.00 50.46  ? 1255 VAL A C      1 
ATOM   4382  O  O      . VAL A 1 293 ? -52.181  76.543  -27.336 1.00 50.15  ? 1255 VAL A O      1 
ATOM   4383  C  CB     . VAL A 1 293 ? -49.134  75.957  -27.681 1.00 54.20  ? 1255 VAL A CB     1 
ATOM   4384  C  CG1    . VAL A 1 293 ? -48.732  75.755  -26.221 1.00 55.86  ? 1255 VAL A CG1    1 
ATOM   4385  C  CG2    . VAL A 1 293 ? -47.981  75.607  -28.612 1.00 58.19  ? 1255 VAL A CG2    1 
ATOM   4386  H  H      . VAL A 1 293 ? -50.815  76.130  -29.647 1.00 68.05  ? 1255 VAL A H      1 
ATOM   4387  H  HA     . VAL A 1 293 ? -50.167  74.183  -27.871 1.00 63.35  ? 1255 VAL A HA     1 
ATOM   4388  H  HB     . VAL A 1 293 ? -49.344  76.895  -27.806 1.00 65.04  ? 1255 VAL A HB     1 
ATOM   4389  H  HG11   . VAL A 1 293 ? -47.948  76.294  -26.033 1.00 67.04  ? 1255 VAL A HG11   1 
ATOM   4390  H  HG12   . VAL A 1 293 ? -49.468  76.029  -25.651 1.00 67.04  ? 1255 VAL A HG12   1 
ATOM   4391  H  HG13   . VAL A 1 293 ? -48.532  74.817  -26.076 1.00 67.04  ? 1255 VAL A HG13   1 
ATOM   4392  H  HG21   . VAL A 1 293 ? -47.211  76.148  -28.377 1.00 69.83  ? 1255 VAL A HG21   1 
ATOM   4393  H  HG22   . VAL A 1 293 ? -47.769  74.666  -28.511 1.00 69.83  ? 1255 VAL A HG22   1 
ATOM   4394  H  HG23   . VAL A 1 293 ? -48.248  75.790  -29.527 1.00 69.83  ? 1255 VAL A HG23   1 
ATOM   4395  N  N      . ILE A 1 294 ? -51.825  74.666  -26.133 1.00 51.11  ? 1256 ILE A N      1 
ATOM   4396  C  CA     . ILE A 1 294 ? -52.850  74.971  -25.138 1.00 51.51  ? 1256 ILE A CA     1 
ATOM   4397  C  C      . ILE A 1 294 ? -52.299  76.059  -24.222 1.00 50.14  ? 1256 ILE A C      1 
ATOM   4398  O  O      . ILE A 1 294 ? -51.393  75.811  -23.423 1.00 50.18  ? 1256 ILE A O      1 
ATOM   4399  C  CB     . ILE A 1 294 ? -53.255  73.719  -24.354 1.00 48.61  ? 1256 ILE A CB     1 
ATOM   4400  C  CG1    . ILE A 1 294 ? -53.941  72.727  -25.301 1.00 47.04  ? 1256 ILE A CG1    1 
ATOM   4401  C  CG2    . ILE A 1 294 ? -54.175  74.074  -23.189 1.00 47.89  ? 1256 ILE A CG2    1 
ATOM   4402  C  CD1    . ILE A 1 294 ? -54.038  71.321  -24.765 1.00 49.17  ? 1256 ILE A CD1    1 
ATOM   4403  H  H      . ILE A 1 294 ? -51.431  73.912  -26.009 1.00 61.33  ? 1256 ILE A H      1 
ATOM   4404  H  HA     . ILE A 1 294 ? -53.637  75.318  -25.585 1.00 61.81  ? 1256 ILE A HA     1 
ATOM   4405  H  HB     . ILE A 1 294 ? -52.453  73.303  -24.000 1.00 58.34  ? 1256 ILE A HB     1 
ATOM   4406  H  HG12   . ILE A 1 294 ? -54.843  73.039  -25.475 1.00 56.45  ? 1256 ILE A HG12   1 
ATOM   4407  H  HG13   . ILE A 1 294 ? -53.441  72.693  -26.131 1.00 56.45  ? 1256 ILE A HG13   1 
ATOM   4408  H  HG21   . ILE A 1 294 ? -54.412  73.261  -22.715 1.00 57.47  ? 1256 ILE A HG21   1 
ATOM   4409  H  HG22   . ILE A 1 294 ? -53.710  74.681  -22.593 1.00 57.47  ? 1256 ILE A HG22   1 
ATOM   4410  H  HG23   . ILE A 1 294 ? -54.975  74.500  -23.537 1.00 57.47  ? 1256 ILE A HG23   1 
ATOM   4411  H  HD11   . ILE A 1 294 ? -54.482  70.763  -25.423 1.00 59.00  ? 1256 ILE A HD11   1 
ATOM   4412  H  HD12   . ILE A 1 294 ? -53.143  70.986  -24.597 1.00 59.00  ? 1256 ILE A HD12   1 
ATOM   4413  H  HD13   . ILE A 1 294 ? -54.548  71.332  -23.940 1.00 59.00  ? 1256 ILE A HD13   1 
ATOM   4414  N  N      . SER A 1 295 ? -52.841  77.271  -24.342 1.00 49.92  ? 1257 SER A N      1 
ATOM   4415  C  CA     . SER A 1 295 ? -52.282  78.453  -23.688 1.00 50.16  ? 1257 SER A CA     1 
ATOM   4416  C  C      . SER A 1 295 ? -53.427  79.337  -23.208 1.00 50.06  ? 1257 SER A C      1 
ATOM   4417  O  O      . SER A 1 295 ? -54.176  79.879  -24.026 1.00 50.50  ? 1257 SER A O      1 
ATOM   4418  C  CB     . SER A 1 295 ? -51.366  79.215  -24.649 1.00 50.30  ? 1257 SER A CB     1 
ATOM   4419  O  OG     . SER A 1 295 ? -51.002  80.482  -24.134 1.00 54.57  ? 1257 SER A OG     1 
ATOM   4420  H  H      . SER A 1 295 ? -53.546  77.437  -24.807 1.00 59.91  ? 1257 SER A H      1 
ATOM   4421  H  HA     . SER A 1 295 ? -51.760  78.180  -22.917 1.00 60.19  ? 1257 SER A HA     1 
ATOM   4422  H  HB2    . SER A 1 295 ? -50.561  78.693  -24.793 1.00 60.36  ? 1257 SER A HB2    1 
ATOM   4423  H  HB3    . SER A 1 295 ? -51.831  79.341  -25.490 1.00 60.36  ? 1257 SER A HB3    1 
ATOM   4424  H  HG     . SER A 1 295 ? -50.595  80.390  -23.405 1.00 65.49  ? 1257 SER A HG     1 
ATOM   4425  N  N      . ILE A 1 296 ? -53.558  79.496  -21.885 1.00 50.76  ? 1258 ILE A N      1 
ATOM   4426  C  CA     . ILE A 1 296 ? -54.663  80.270  -21.325 1.00 50.95  ? 1258 ILE A CA     1 
ATOM   4427  C  C      . ILE A 1 296 ? -54.309  81.733  -21.101 1.00 54.66  ? 1258 ILE A C      1 
ATOM   4428  O  O      . ILE A 1 296 ? -55.170  82.503  -20.653 1.00 56.23  ? 1258 ILE A O      1 
ATOM   4429  C  CB     . ILE A 1 296 ? -55.156  79.680  -19.987 1.00 49.86  ? 1258 ILE A CB     1 
ATOM   4430  C  CG1    . ILE A 1 296 ? -54.058  79.747  -18.920 1.00 51.03  ? 1258 ILE A CG1    1 
ATOM   4431  C  CG2    . ILE A 1 296 ? -55.614  78.247  -20.183 1.00 48.06  ? 1258 ILE A CG2    1 
ATOM   4432  C  CD1    . ILE A 1 296 ? -54.568  79.549  -17.509 1.00 49.10  ? 1258 ILE A CD1    1 
ATOM   4433  H  H      . ILE A 1 296 ? -53.022  79.167  -21.298 1.00 60.91  ? 1258 ILE A H      1 
ATOM   4434  H  HA     . ILE A 1 296 ? -55.405  80.241  -21.948 1.00 61.14  ? 1258 ILE A HA     1 
ATOM   4435  H  HB     . ILE A 1 296 ? -55.913  80.204  -19.682 1.00 59.83  ? 1258 ILE A HB     1 
ATOM   4436  H  HG12   . ILE A 1 296 ? -53.404  79.054  -19.099 1.00 61.24  ? 1258 ILE A HG12   1 
ATOM   4437  H  HG13   . ILE A 1 296 ? -53.634  80.619  -18.962 1.00 61.24  ? 1258 ILE A HG13   1 
ATOM   4438  H  HG21   . ILE A 1 296 ? -55.919  77.895  -19.333 1.00 57.67  ? 1258 ILE A HG21   1 
ATOM   4439  H  HG22   . ILE A 1 296 ? -56.339  78.233  -20.827 1.00 57.67  ? 1258 ILE A HG22   1 
ATOM   4440  H  HG23   . ILE A 1 296 ? -54.869  77.720  -20.512 1.00 57.67  ? 1258 ILE A HG23   1 
ATOM   4441  H  HD11   . ILE A 1 296 ? -53.821  79.605  -16.893 1.00 58.92  ? 1258 ILE A HD11   1 
ATOM   4442  H  HD12   . ILE A 1 296 ? -55.216  80.242  -17.307 1.00 58.92  ? 1258 ILE A HD12   1 
ATOM   4443  H  HD13   . ILE A 1 296 ? -54.986  78.676  -17.444 1.00 58.92  ? 1258 ILE A HD13   1 
ATOM   4444  N  N      . ARG A 1 297 ? -53.074  82.143  -21.390 1.00 56.09  ? 1259 ARG A N      1 
ATOM   4445  C  CA     . ARG A 1 297 ? -52.666  83.526  -21.179 1.00 59.16  ? 1259 ARG A CA     1 
ATOM   4446  C  C      . ARG A 1 297 ? -53.099  84.451  -22.306 1.00 60.47  ? 1259 ARG A C      1 
ATOM   4447  O  O      . ARG A 1 297 ? -53.037  85.674  -22.141 1.00 60.11  ? 1259 ARG A O      1 
ATOM   4448  C  CB     . ARG A 1 297 ? -51.145  83.608  -21.025 1.00 60.57  ? 1259 ARG A CB     1 
ATOM   4449  C  CG     . ARG A 1 297 ? -50.386  83.325  -22.314 1.00 63.19  ? 1259 ARG A CG     1 
ATOM   4450  C  CD     . ARG A 1 297 ? -48.892  83.466  -22.128 1.00 66.59  ? 1259 ARG A CD     1 
ATOM   4451  N  NE     . ARG A 1 297 ? -48.153  82.964  -23.285 1.00 69.65  ? 1259 ARG A NE     1 
ATOM   4452  C  CZ     . ARG A 1 297 ? -47.795  83.693  -24.339 1.00 69.11  ? 1259 ARG A CZ     1 
ATOM   4453  N  NH1    . ARG A 1 297 ? -48.099  84.982  -24.408 1.00 71.67  1 1259 ARG A NH1    1 
ATOM   4454  N  NH2    . ARG A 1 297 ? -47.124  83.126  -25.331 1.00 70.36  ? 1259 ARG A NH2    1 
ATOM   4455  H  H      . ARG A 1 297 ? -52.456  81.637  -21.709 1.00 67.31  ? 1259 ARG A H      1 
ATOM   4456  H  HA     . ARG A 1 297 ? -53.067  83.849  -20.357 1.00 70.99  ? 1259 ARG A HA     1 
ATOM   4457  H  HB2    . ARG A 1 297 ? -50.908  84.501  -20.731 1.00 72.68  ? 1259 ARG A HB2    1 
ATOM   4458  H  HB3    . ARG A 1 297 ? -50.862  82.957  -20.364 1.00 72.68  ? 1259 ARG A HB3    1 
ATOM   4459  H  HG2    . ARG A 1 297 ? -50.570  82.416  -22.600 1.00 75.83  ? 1259 ARG A HG2    1 
ATOM   4460  H  HG3    . ARG A 1 297 ? -50.667  83.955  -22.995 1.00 75.83  ? 1259 ARG A HG3    1 
ATOM   4461  H  HD2    . ARG A 1 297 ? -48.672  84.404  -22.011 1.00 79.91  ? 1259 ARG A HD2    1 
ATOM   4462  H  HD3    . ARG A 1 297 ? -48.617  82.958  -21.349 1.00 79.91  ? 1259 ARG A HD3    1 
ATOM   4463  H  HE     . ARG A 1 297 ? -47.932  82.133  -23.285 1.00 83.58  ? 1259 ARG A HE     1 
ATOM   4464  H  HH11   . ARG A 1 297 ? -48.534  85.356  -23.767 1.00 86.00  ? 1259 ARG A HH11   1 
ATOM   4465  H  HH12   . ARG A 1 297 ? -47.862  85.444  -25.094 1.00 86.00  ? 1259 ARG A HH12   1 
ATOM   4466  H  HH21   . ARG A 1 297 ? -46.924  82.290  -25.291 1.00 84.43  ? 1259 ARG A HH21   1 
ATOM   4467  H  HH22   . ARG A 1 297 ? -46.890  83.592  -26.014 1.00 84.43  ? 1259 ARG A HH22   1 
ATOM   4468  N  N      . ARG A 1 298 ? -53.510  83.904  -23.447 1.00 65.75  ? 1260 ARG A N      1 
ATOM   4469  C  CA     . ARG A 1 298 ? -53.875  84.707  -24.603 1.00 69.11  ? 1260 ARG A CA     1 
ATOM   4470  C  C      . ARG A 1 298 ? -55.004  84.014  -25.348 1.00 67.88  ? 1260 ARG A C      1 
ATOM   4471  O  O      . ARG A 1 298 ? -55.011  82.786  -25.470 1.00 65.42  ? 1260 ARG A O      1 
ATOM   4472  C  CB     . ARG A 1 298 ? -52.673  84.919  -25.530 1.00 72.59  ? 1260 ARG A CB     1 
ATOM   4473  C  CG     . ARG A 1 298 ? -51.874  83.650  -25.804 1.00 74.05  ? 1260 ARG A CG     1 
ATOM   4474  C  CD     . ARG A 1 298 ? -50.659  83.935  -26.672 1.00 76.86  ? 1260 ARG A CD     1 
ATOM   4475  N  NE     . ARG A 1 298 ? -50.996  84.002  -28.090 1.00 80.81  ? 1260 ARG A NE     1 
ATOM   4476  C  CZ     . ARG A 1 298 ? -50.204  84.517  -29.027 1.00 85.42  ? 1260 ARG A CZ     1 
ATOM   4477  N  NH1    . ARG A 1 298 ? -49.024  85.029  -28.701 1.00 88.05  1 1260 ARG A NH1    1 
ATOM   4478  N  NH2    . ARG A 1 298 ? -50.596  84.529  -30.292 1.00 85.16  ? 1260 ARG A NH2    1 
ATOM   4479  H  H      . ARG A 1 298 ? -53.585  83.057  -23.575 1.00 78.90  ? 1260 ARG A H      1 
ATOM   4480  H  HA     . ARG A 1 298 ? -54.191  85.575  -24.307 1.00 82.93  ? 1260 ARG A HA     1 
ATOM   4481  H  HB2    . ARG A 1 298 ? -52.991  85.259  -26.381 1.00 87.10  ? 1260 ARG A HB2    1 
ATOM   4482  H  HB3    . ARG A 1 298 ? -52.074  85.564  -25.122 1.00 87.10  ? 1260 ARG A HB3    1 
ATOM   4483  H  HG2    . ARG A 1 298 ? -51.567  83.277  -24.963 1.00 88.86  ? 1260 ARG A HG2    1 
ATOM   4484  H  HG3    . ARG A 1 298 ? -52.437  83.012  -26.270 1.00 88.86  ? 1260 ARG A HG3    1 
ATOM   4485  H  HD2    . ARG A 1 298 ? -50.276  84.788  -26.412 1.00 92.23  ? 1260 ARG A HD2    1 
ATOM   4486  H  HD3    . ARG A 1 298 ? -50.008  83.227  -26.549 1.00 92.23  ? 1260 ARG A HD3    1 
ATOM   4487  H  HE     . ARG A 1 298 ? -51.757  83.687  -28.337 1.00 96.97  ? 1260 ARG A HE     1 
ATOM   4488  H  HH11   . ARG A 1 298 ? -48.764  85.023  -27.881 1.00 105.66 ? 1260 ARG A HH11   1 
ATOM   4489  H  HH12   . ARG A 1 298 ? -48.517  85.363  -29.310 1.00 105.66 ? 1260 ARG A HH12   1 
ATOM   4490  H  HH21   . ARG A 1 298 ? -51.361  84.201  -30.508 1.00 102.19 ? 1260 ARG A HH21   1 
ATOM   4491  H  HH22   . ARG A 1 298 ? -50.086  84.866  -30.897 1.00 102.19 ? 1260 ARG A HH22   1 
ATOM   4492  N  N      . LYS A 1 299 ? -55.961  84.806  -25.838 1.00 69.51  ? 1261 LYS A N      1 
ATOM   4493  C  CA     . LYS A 1 299 ? -57.048  84.237  -26.625 1.00 69.80  ? 1261 LYS A CA     1 
ATOM   4494  C  C      . LYS A 1 299 ? -56.606  83.906  -28.041 1.00 68.14  ? 1261 LYS A C      1 
ATOM   4495  O  O      . LYS A 1 299 ? -57.135  82.968  -28.647 1.00 66.96  ? 1261 LYS A O      1 
ATOM   4496  C  CB     . LYS A 1 299 ? -58.240  85.189  -26.679 1.00 71.41  ? 1261 LYS A CB     1 
ATOM   4497  C  CG     . LYS A 1 299 ? -59.499  84.507  -27.187 1.00 70.63  ? 1261 LYS A CG     1 
ATOM   4498  C  CD     . LYS A 1 299 ? -60.704  85.423  -27.173 1.00 74.70  ? 1261 LYS A CD     1 
ATOM   4499  C  CE     . LYS A 1 299 ? -61.990  84.624  -27.318 1.00 76.43  ? 1261 LYS A CE     1 
ATOM   4500  N  NZ     . LYS A 1 299 ? -61.857  83.506  -28.296 1.00 78.78  1 1261 LYS A NZ     1 
ATOM   4501  H  H      . LYS A 1 299 ? -56.001  85.658  -25.730 1.00 83.41  ? 1261 LYS A H      1 
ATOM   4502  H  HA     . LYS A 1 299 ? -57.343  83.414  -26.205 1.00 83.76  ? 1261 LYS A HA     1 
ATOM   4503  H  HB2    . LYS A 1 299 ? -58.419  85.525  -25.787 1.00 85.70  ? 1261 LYS A HB2    1 
ATOM   4504  H  HB3    . LYS A 1 299 ? -58.033  85.924  -27.277 1.00 85.70  ? 1261 LYS A HB3    1 
ATOM   4505  H  HG2    . LYS A 1 299 ? -59.354  84.216  -28.100 1.00 84.75  ? 1261 LYS A HG2    1 
ATOM   4506  H  HG3    . LYS A 1 299 ? -59.695  83.744  -26.621 1.00 84.75  ? 1261 LYS A HG3    1 
ATOM   4507  H  HD2    . LYS A 1 299 ? -60.734  85.903  -26.330 1.00 89.63  ? 1261 LYS A HD2    1 
ATOM   4508  H  HD3    . LYS A 1 299 ? -60.644  86.046  -27.914 1.00 89.63  ? 1261 LYS A HD3    1 
ATOM   4509  H  HE2    . LYS A 1 299 ? -62.226  84.245  -26.457 1.00 91.72  ? 1261 LYS A HE2    1 
ATOM   4510  H  HE3    . LYS A 1 299 ? -62.696  85.213  -27.627 1.00 91.72  ? 1261 LYS A HE3    1 
ATOM   4511  H  HZ1    . LYS A 1 299 ? -62.626  83.061  -28.356 1.00 94.54  ? 1261 LYS A HZ1    1 
ATOM   4512  H  HZ2    . LYS A 1 299 ? -61.646  83.827  -29.099 1.00 94.54  ? 1261 LYS A HZ2    1 
ATOM   4513  H  HZ3    . LYS A 1 299 ? -61.219  82.945  -28.032 1.00 94.54  ? 1261 LYS A HZ3    1 
ATOM   4514  N  N      . SER A 1 300 ? -55.649  84.655  -28.580 1.00 70.12  ? 1262 SER A N      1 
ATOM   4515  C  CA     . SER A 1 300 ? -55.138  84.364  -29.909 1.00 72.08  ? 1262 SER A CA     1 
ATOM   4516  C  C      . SER A 1 300 ? -54.402  83.032  -29.904 1.00 68.89  ? 1262 SER A C      1 
ATOM   4517  O  O      . SER A 1 300 ? -53.613  82.741  -29.000 1.00 67.76  ? 1262 SER A O      1 
ATOM   4518  C  CB     . SER A 1 300 ? -54.202  85.478  -30.374 1.00 74.00  ? 1262 SER A CB     1 
ATOM   4519  O  OG     . SER A 1 300 ? -53.580  85.135  -31.597 1.00 77.71  ? 1262 SER A OG     1 
ATOM   4520  H  H      . SER A 1 300 ? -55.282  85.332  -28.197 1.00 84.14  ? 1262 SER A H      1 
ATOM   4521  H  HA     . SER A 1 300 ? -55.878  84.304  -30.533 1.00 86.49  ? 1262 SER A HA     1 
ATOM   4522  H  HB2    . SER A 1 300 ? -54.717  86.291  -30.498 1.00 88.80  ? 1262 SER A HB2    1 
ATOM   4523  H  HB3    . SER A 1 300 ? -53.519  85.618  -29.700 1.00 88.80  ? 1262 SER A HB3    1 
ATOM   4524  H  HG     . SER A 1 300 ? -53.068  85.754  -31.843 1.00 93.25  ? 1262 SER A HG     1 
ATOM   4525  N  N      . LEU A 1 301 ? -54.670  82.218  -30.922 1.00 66.56  ? 1263 LEU A N      1 
ATOM   4526  C  CA     . LEU A 1 301 ? -54.068  80.896  -31.000 1.00 63.74  ? 1263 LEU A CA     1 
ATOM   4527  C  C      . LEU A 1 301 ? -52.550  80.994  -30.985 1.00 65.84  ? 1263 LEU A C      1 
ATOM   4528  O  O      . LEU A 1 301 ? -51.958  81.895  -31.585 1.00 71.43  ? 1263 LEU A O      1 
ATOM   4529  C  CB     . LEU A 1 301 ? -54.537  80.177  -32.263 1.00 66.03  ? 1263 LEU A CB     1 
ATOM   4530  C  CG     . LEU A 1 301 ? -55.781  79.296  -32.134 1.00 63.84  ? 1263 LEU A CG     1 
ATOM   4531  C  CD1    . LEU A 1 301 ? -56.868  79.951  -31.285 1.00 62.81  ? 1263 LEU A CD1    1 
ATOM   4532  C  CD2    . LEU A 1 301 ? -56.311  78.989  -33.527 1.00 64.66  ? 1263 LEU A CD2    1 
ATOM   4533  H  H      . LEU A 1 301 ? -55.195  82.409  -31.576 1.00 79.87  ? 1263 LEU A H      1 
ATOM   4534  H  HA     . LEU A 1 301 ? -54.346  80.373  -30.232 1.00 76.48  ? 1263 LEU A HA     1 
ATOM   4535  H  HB2    . LEU A 1 301 ? -54.728  80.846  -32.939 1.00 79.24  ? 1263 LEU A HB2    1 
ATOM   4536  H  HB3    . LEU A 1 301 ? -53.814  79.608  -32.573 1.00 79.24  ? 1263 LEU A HB3    1 
ATOM   4537  H  HG     . LEU A 1 301 ? -55.534  78.458  -31.714 1.00 76.61  ? 1263 LEU A HG     1 
ATOM   4538  H  HD11   . LEU A 1 301 ? -57.631  79.354  -31.235 1.00 75.37  ? 1263 LEU A HD11   1 
ATOM   4539  H  HD12   . LEU A 1 301 ? -56.517  80.116  -30.396 1.00 75.37  ? 1263 LEU A HD12   1 
ATOM   4540  H  HD13   . LEU A 1 301 ? -57.129  80.789  -31.699 1.00 75.37  ? 1263 LEU A HD13   1 
ATOM   4541  H  HD21   . LEU A 1 301 ? -57.100  78.430  -33.448 1.00 77.59  ? 1263 LEU A HD21   1 
ATOM   4542  H  HD22   . LEU A 1 301 ? -56.537  79.822  -33.969 1.00 77.59  ? 1263 LEU A HD22   1 
ATOM   4543  H  HD23   . LEU A 1 301 ? -55.624  78.523  -34.030 1.00 77.59  ? 1263 LEU A HD23   1 
ATOM   4544  N  N      . LEU A 1 302 ? -51.927  80.063  -30.275 1.00 67.27  ? 1264 LEU A N      1 
ATOM   4545  C  CA     . LEU A 1 302 ? -50.479  79.967  -30.181 1.00 69.12  ? 1264 LEU A CA     1 
ATOM   4546  C  C      . LEU A 1 302 ? -50.031  78.709  -30.908 1.00 68.73  ? 1264 LEU A C      1 
ATOM   4547  O  O      . LEU A 1 302 ? -50.540  77.616  -30.638 1.00 69.83  ? 1264 LEU A O      1 
ATOM   4548  C  CB     . LEU A 1 302 ? -50.033  79.936  -28.717 1.00 67.19  ? 1264 LEU A CB     1 
ATOM   4549  C  CG     . LEU A 1 302 ? -48.530  79.835  -28.457 1.00 67.37  ? 1264 LEU A CG     1 
ATOM   4550  C  CD1    . LEU A 1 302 ? -47.779  80.992  -29.103 1.00 68.50  ? 1264 LEU A CD1    1 
ATOM   4551  C  CD2    . LEU A 1 302 ? -48.276  79.798  -26.960 1.00 65.17  ? 1264 LEU A CD2    1 
ATOM   4552  H  H      . LEU A 1 302 ? -52.337  79.456  -29.825 1.00 80.72  ? 1264 LEU A H      1 
ATOM   4553  H  HA     . LEU A 1 302 ? -50.073  80.735  -30.612 1.00 82.94  ? 1264 LEU A HA     1 
ATOM   4554  H  HB2    . LEU A 1 302 ? -50.344  80.749  -28.289 1.00 80.63  ? 1264 LEU A HB2    1 
ATOM   4555  H  HB3    . LEU A 1 302 ? -50.449  79.171  -28.290 1.00 80.63  ? 1264 LEU A HB3    1 
ATOM   4556  H  HG     . LEU A 1 302 ? -48.197  79.009  -28.840 1.00 80.85  ? 1264 LEU A HG     1 
ATOM   4557  H  HD11   . LEU A 1 302 ? -46.831  80.896  -28.918 1.00 82.20  ? 1264 LEU A HD11   1 
ATOM   4558  H  HD12   . LEU A 1 302 ? -47.933  80.972  -30.061 1.00 82.20  ? 1264 LEU A HD12   1 
ATOM   4559  H  HD13   . LEU A 1 302 ? -48.105  81.827  -28.732 1.00 82.20  ? 1264 LEU A HD13   1 
ATOM   4560  H  HD21   . LEU A 1 302 ? -47.321  79.734  -26.804 1.00 78.21  ? 1264 LEU A HD21   1 
ATOM   4561  H  HD22   . LEU A 1 302 ? -48.623  80.611  -26.561 1.00 78.21  ? 1264 LEU A HD22   1 
ATOM   4562  H  HD23   . LEU A 1 302 ? -48.725  79.025  -26.583 1.00 78.21  ? 1264 LEU A HD23   1 
ATOM   4563  N  N      . THR A 1 303 ? -49.097  78.863  -31.836 1.00 68.03  ? 1265 THR A N      1 
ATOM   4564  C  CA     . THR A 1 303 ? -48.661  77.748  -32.661 1.00 70.54  ? 1265 THR A CA     1 
ATOM   4565  C  C      . THR A 1 303 ? -47.466  77.041  -32.034 1.00 72.52  ? 1265 THR A C      1 
ATOM   4566  O  O      . THR A 1 303 ? -46.618  77.660  -31.385 1.00 68.97  ? 1265 THR A O      1 
ATOM   4567  C  CB     . THR A 1 303 ? -48.295  78.225  -34.066 1.00 70.57  ? 1265 THR A CB     1 
ATOM   4568  O  OG1    . THR A 1 303 ? -47.125  79.049  -33.999 1.00 72.55  ? 1265 THR A OG1    1 
ATOM   4569  C  CG2    . THR A 1 303 ? -49.444  79.016  -34.677 1.00 69.94  ? 1265 THR A CG2    1 
ATOM   4570  H  H      . THR A 1 303 ? -48.698  79.605  -32.008 1.00 81.64  ? 1265 THR A H      1 
ATOM   4571  H  HA     . THR A 1 303 ? -49.386  77.107  -32.738 1.00 84.65  ? 1265 THR A HA     1 
ATOM   4572  H  HB     . THR A 1 303 ? -48.117  77.457  -34.631 1.00 84.68  ? 1265 THR A HB     1 
ATOM   4573  H  HG1    . THR A 1 303 ? -46.917  79.315  -34.768 1.00 87.06  ? 1265 THR A HG1    1 
ATOM   4574  H  HG21   . THR A 1 303 ? -49.204  79.315  -35.568 1.00 83.93  ? 1265 THR A HG21   1 
ATOM   4575  H  HG22   . THR A 1 303 ? -50.236  78.459  -34.734 1.00 83.93  ? 1265 THR A HG22   1 
ATOM   4576  H  HG23   . THR A 1 303 ? -49.642  79.790  -34.127 1.00 83.93  ? 1265 THR A HG23   1 
ATOM   4577  N  N      . THR A 1 304 ? -47.413  75.722  -32.236 1.00 77.32  ? 1266 THR A N      1 
ATOM   4578  C  CA     . THR A 1 304 ? -46.258  74.952  -31.792 1.00 79.59  ? 1266 THR A CA     1 
ATOM   4579  C  C      . THR A 1 304 ? -44.994  75.391  -32.516 1.00 80.35  ? 1266 THR A C      1 
ATOM   4580  O  O      . THR A 1 304 ? -43.901  75.353  -31.939 1.00 80.69  ? 1266 THR A O      1 
ATOM   4581  C  CB     . THR A 1 304 ? -46.510  73.458  -32.011 1.00 81.76  ? 1266 THR A CB     1 
ATOM   4582  O  OG1    . THR A 1 304 ? -45.499  72.694  -31.341 1.00 84.21  ? 1266 THR A OG1    1 
ATOM   4583  C  CG2    . THR A 1 304 ? -46.513  73.109  -33.497 1.00 83.56  ? 1266 THR A CG2    1 
ATOM   4584  H  H      . THR A 1 304 ? -48.025  75.258  -32.623 1.00 92.78  ? 1266 THR A H      1 
ATOM   4585  H  HA     . THR A 1 304 ? -46.126  75.098  -30.842 1.00 95.50  ? 1266 THR A HA     1 
ATOM   4586  H  HB     . THR A 1 304 ? -47.378  73.226  -31.645 1.00 98.11  ? 1266 THR A HB     1 
ATOM   4587  H  HG1    . THR A 1 304 ? -45.514  72.857  -30.517 1.00 101.06 ? 1266 THR A HG1    1 
ATOM   4588  H  HG21   . THR A 1 304 ? -46.674  72.160  -33.614 1.00 100.27 ? 1266 THR A HG21   1 
ATOM   4589  H  HG22   . THR A 1 304 ? -47.210  73.606  -33.953 1.00 100.27 ? 1266 THR A HG22   1 
ATOM   4590  H  HG23   . THR A 1 304 ? -45.656  73.334  -33.892 1.00 100.27 ? 1266 THR A HG23   1 
ATOM   4591  N  N      . PHE A 1 305 ? -45.124  75.809  -33.778 1.00 82.56  ? 1267 PHE A N      1 
ATOM   4592  C  CA     . PHE A 1 305 ? -43.965  76.254  -34.544 1.00 83.30  ? 1267 PHE A CA     1 
ATOM   4593  C  C      . PHE A 1 305 ? -43.401  77.547  -33.974 1.00 86.80  ? 1267 PHE A C      1 
ATOM   4594  O  O      . PHE A 1 305 ? -42.181  77.696  -33.842 1.00 86.01  ? 1267 PHE A O      1 
ATOM   4595  C  CB     . PHE A 1 305 ? -44.354  76.432  -36.013 1.00 84.71  ? 1267 PHE A CB     1 
ATOM   4596  C  CG     . PHE A 1 305 ? -43.265  77.020  -36.868 1.00 88.18  ? 1267 PHE A CG     1 
ATOM   4597  C  CD1    . PHE A 1 305 ? -42.265  76.219  -37.395 1.00 91.33  ? 1267 PHE A CD1    1 
ATOM   4598  C  CD2    . PHE A 1 305 ? -43.249  78.376  -37.152 1.00 90.60  ? 1267 PHE A CD2    1 
ATOM   4599  C  CE1    . PHE A 1 305 ? -41.265  76.761  -38.186 1.00 94.44  ? 1267 PHE A CE1    1 
ATOM   4600  C  CE2    . PHE A 1 305 ? -42.252  78.924  -37.941 1.00 94.18  ? 1267 PHE A CE2    1 
ATOM   4601  C  CZ     . PHE A 1 305 ? -41.259  78.115  -38.458 1.00 95.33  ? 1267 PHE A CZ     1 
ATOM   4602  H  H      . PHE A 1 305 ? -45.868  75.844  -34.207 1.00 99.08  ? 1267 PHE A H      1 
ATOM   4603  H  HA     . PHE A 1 305 ? -43.273  75.576  -34.495 1.00 99.96  ? 1267 PHE A HA     1 
ATOM   4604  H  HB2    . PHE A 1 305 ? -44.584  75.565  -36.382 1.00 101.65 ? 1267 PHE A HB2    1 
ATOM   4605  H  HB3    . PHE A 1 305 ? -45.121  77.024  -36.063 1.00 101.65 ? 1267 PHE A HB3    1 
ATOM   4606  H  HD1    . PHE A 1 305 ? -42.264  75.306  -37.214 1.00 109.59 ? 1267 PHE A HD1    1 
ATOM   4607  H  HD2    . PHE A 1 305 ? -43.915  78.926  -36.806 1.00 108.72 ? 1267 PHE A HD2    1 
ATOM   4608  H  HE1    . PHE A 1 305 ? -40.597  76.214  -38.532 1.00 113.32 ? 1267 PHE A HE1    1 
ATOM   4609  H  HE2    . PHE A 1 305 ? -42.251  79.836  -38.123 1.00 113.02 ? 1267 PHE A HE2    1 
ATOM   4610  H  HZ     . PHE A 1 305 ? -40.589  78.481  -38.988 1.00 114.39 ? 1267 PHE A HZ     1 
ATOM   4611  N  N      . LYS A 1 306 ? -44.276  78.497  -33.639 1.00 91.70  ? 1268 LYS A N      1 
ATOM   4612  C  CA     . LYS A 1 306 ? -43.822  79.736  -33.020 1.00 96.34  ? 1268 LYS A CA     1 
ATOM   4613  C  C      . LYS A 1 306 ? -43.075  79.446  -31.723 1.00 94.37  ? 1268 LYS A C      1 
ATOM   4614  O  O      . LYS A 1 306 ? -42.069  80.096  -31.416 1.00 96.35  ? 1268 LYS A O      1 
ATOM   4615  C  CB     . LYS A 1 306 ? -45.020  80.656  -32.782 1.00 98.15  ? 1268 LYS A CB     1 
ATOM   4616  C  CG     . LYS A 1 306 ? -44.683  82.025  -32.222 1.00 100.39 ? 1268 LYS A CG     1 
ATOM   4617  C  CD     . LYS A 1 306 ? -45.955  82.818  -31.966 1.00 100.22 ? 1268 LYS A CD     1 
ATOM   4618  C  CE     . LYS A 1 306 ? -45.681  84.110  -31.220 1.00 100.87 ? 1268 LYS A CE     1 
ATOM   4619  N  NZ     . LYS A 1 306 ? -46.924  84.910  -31.059 1.00 100.66 ? 1268 LYS A NZ     1 
ATOM   4620  H  H      . LYS A 1 306 ? -45.126  78.447  -33.758 1.00 110.04 ? 1268 LYS A H      1 
ATOM   4621  H  HA     . LYS A 1 306 ? -43.211  80.187  -33.624 1.00 115.60 ? 1268 LYS A HA     1 
ATOM   4622  H  HB2    . LYS A 1 306 ? -45.476  80.791  -33.627 1.00 117.78 ? 1268 LYS A HB2    1 
ATOM   4623  H  HB3    . LYS A 1 306 ? -45.620  80.224  -32.154 1.00 117.78 ? 1268 LYS A HB3    1 
ATOM   4624  H  HG2    . LYS A 1 306 ? -44.209  81.923  -31.382 1.00 120.47 ? 1268 LYS A HG2    1 
ATOM   4625  H  HG3    . LYS A 1 306 ? -44.140  82.512  -32.862 1.00 120.47 ? 1268 LYS A HG3    1 
ATOM   4626  H  HD2    . LYS A 1 306 ? -46.368  83.041  -32.815 1.00 120.27 ? 1268 LYS A HD2    1 
ATOM   4627  H  HD3    . LYS A 1 306 ? -46.561  82.283  -31.430 1.00 120.27 ? 1268 LYS A HD3    1 
ATOM   4628  H  HE2    . LYS A 1 306 ? -45.333  83.905  -30.338 1.00 121.05 ? 1268 LYS A HE2    1 
ATOM   4629  H  HE3    . LYS A 1 306 ? -45.040  84.640  -31.720 1.00 121.05 ? 1268 LYS A HE3    1 
ATOM   4630  H  HZ1    . LYS A 1 306 ? -46.746  85.663  -30.620 1.00 120.79 ? 1268 LYS A HZ1    1 
ATOM   4631  H  HZ2    . LYS A 1 306 ? -47.261  85.112  -31.857 1.00 120.79 ? 1268 LYS A HZ2    1 
ATOM   4632  H  HZ3    . LYS A 1 306 ? -47.528  84.443  -30.600 1.00 120.79 ? 1268 LYS A HZ3    1 
ATOM   4633  N  N      . LYS A 1 307 ? -43.554  78.469  -30.951 1.00 90.69  ? 1269 LYS A N      1 
ATOM   4634  C  CA     . LYS A 1 307 ? -42.910  78.066  -29.706 1.00 87.38  ? 1269 LYS A CA     1 
ATOM   4635  C  C      . LYS A 1 307 ? -41.726  77.130  -29.897 1.00 88.04  ? 1269 LYS A C      1 
ATOM   4636  O  O      . LYS A 1 307 ? -40.995  76.889  -28.929 1.00 87.95  ? 1269 LYS A O      1 
ATOM   4637  C  CB     . LYS A 1 307 ? -43.926  77.385  -28.787 1.00 81.54  ? 1269 LYS A CB     1 
ATOM   4638  C  CG     . LYS A 1 307 ? -44.756  78.332  -27.967 1.00 78.04  ? 1269 LYS A CG     1 
ATOM   4639  C  CD     . LYS A 1 307 ? -43.866  78.968  -26.909 1.00 79.50  ? 1269 LYS A CD     1 
ATOM   4640  C  CE     . LYS A 1 307 ? -44.661  79.756  -25.909 1.00 77.46  ? 1269 LYS A CE     1 
ATOM   4641  N  NZ     . LYS A 1 307 ? -43.899  79.985  -24.653 1.00 74.22  ? 1269 LYS A NZ     1 
ATOM   4642  H  H      . LYS A 1 307 ? -44.263  78.018  -31.133 1.00 108.82 ? 1269 LYS A H      1 
ATOM   4643  H  HA     . LYS A 1 307 ? -42.587  78.861  -29.253 1.00 104.86 ? 1269 LYS A HA     1 
ATOM   4644  H  HB2    . LYS A 1 307 ? -44.532  76.858  -29.331 1.00 97.85  ? 1269 LYS A HB2    1 
ATOM   4645  H  HB3    . LYS A 1 307 ? -43.450  76.805  -28.173 1.00 97.85  ? 1269 LYS A HB3    1 
ATOM   4646  H  HG2    . LYS A 1 307 ? -45.116  79.031  -28.535 1.00 93.65  ? 1269 LYS A HG2    1 
ATOM   4647  H  HG3    . LYS A 1 307 ? -45.470  77.846  -27.524 1.00 93.65  ? 1269 LYS A HG3    1 
ATOM   4648  H  HD2    . LYS A 1 307 ? -43.387  78.271  -26.434 1.00 95.40  ? 1269 LYS A HD2    1 
ATOM   4649  H  HD3    . LYS A 1 307 ? -43.240  79.571  -27.340 1.00 95.40  ? 1269 LYS A HD3    1 
ATOM   4650  H  HE2    . LYS A 1 307 ? -44.886  80.619  -26.289 1.00 92.95  ? 1269 LYS A HE2    1 
ATOM   4651  H  HE3    . LYS A 1 307 ? -45.469  79.266  -25.688 1.00 92.95  ? 1269 LYS A HE3    1 
ATOM   4652  H  HZ1    . LYS A 1 307 ? -44.392  80.453  -24.079 1.00 89.06  ? 1269 LYS A HZ1    1 
ATOM   4653  H  HZ2    . LYS A 1 307 ? -43.684  79.206  -24.281 1.00 89.06  ? 1269 LYS A HZ2    1 
ATOM   4654  H  HZ3    . LYS A 1 307 ? -43.153  80.438  -24.829 1.00 89.06  ? 1269 LYS A HZ3    1 
ATOM   4655  N  N      . GLN A 1 308 ? -41.514  76.597  -31.098 1.00 88.08  ? 1270 GLN A N      1 
ATOM   4656  C  CA     . GLN A 1 308 ? -40.469  75.600  -31.314 1.00 88.26  ? 1270 GLN A CA     1 
ATOM   4657  C  C      . GLN A 1 308 ? -40.656  74.419  -30.361 1.00 86.26  ? 1270 GLN A C      1 
ATOM   4658  O  O      . GLN A 1 308 ? -39.694  73.879  -29.809 1.00 84.14  ? 1270 GLN A O      1 
ATOM   4659  C  CB     . GLN A 1 308 ? -39.077  76.218  -31.165 1.00 90.80  ? 1270 GLN A CB     1 
ATOM   4660  C  CG     . GLN A 1 308 ? -38.792  77.326  -32.171 1.00 97.38  ? 1270 GLN A CG     1 
ATOM   4661  C  CD     . GLN A 1 308 ? -37.390  77.897  -32.045 1.00 102.40 ? 1270 GLN A CD     1 
ATOM   4662  O  OE1    . GLN A 1 308 ? -37.200  79.008  -31.550 1.00 103.79 ? 1270 GLN A OE1    1 
ATOM   4663  N  NE2    . GLN A 1 308 ? -36.399  77.137  -32.500 1.00 104.56 ? 1270 GLN A NE2    1 
ATOM   4664  H  H      . GLN A 1 308 ? -41.962  76.797  -31.804 1.00 105.69 ? 1270 GLN A H      1 
ATOM   4665  H  HA     . GLN A 1 308 ? -40.545  75.262  -32.220 1.00 105.91 ? 1270 GLN A HA     1 
ATOM   4666  H  HB2    . GLN A 1 308 ? -38.995  76.596  -30.275 1.00 108.96 ? 1270 GLN A HB2    1 
ATOM   4667  H  HB3    . GLN A 1 308 ? -38.411  75.524  -31.290 1.00 108.96 ? 1270 GLN A HB3    1 
ATOM   4668  H  HG2    . GLN A 1 308 ? -38.891  76.971  -33.068 1.00 116.85 ? 1270 GLN A HG2    1 
ATOM   4669  H  HG3    . GLN A 1 308 ? -39.423  78.050  -32.030 1.00 116.85 ? 1270 GLN A HG3    1 
ATOM   4670  H  HE21   . GLN A 1 308 ? -36.570  76.368  -32.843 1.00 125.48 ? 1270 GLN A HE21   1 
ATOM   4671  H  HE22   . GLN A 1 308 ? -35.587  77.416  -32.451 1.00 125.48 ? 1270 GLN A HE22   1 
ATOM   4672  N  N      . TRP A 1 309 ? -41.915  74.021  -30.168 1.00 85.73  ? 1271 TRP A N      1 
ATOM   4673  C  CA     . TRP A 1 309 ? -42.277  72.904  -29.302 1.00 84.03  ? 1271 TRP A CA     1 
ATOM   4674  C  C      . TRP A 1 309 ? -42.934  71.787  -30.105 1.00 84.96  ? 1271 TRP A C      1 
ATOM   4675  O  O      . TRP A 1 309 ? -44.027  71.326  -29.760 1.00 86.96  ? 1271 TRP A O      1 
ATOM   4676  C  CB     . TRP A 1 309 ? -43.225  73.369  -28.190 1.00 80.12  ? 1271 TRP A CB     1 
ATOM   4677  C  CG     . TRP A 1 309 ? -42.570  74.110  -27.060 1.00 76.68  ? 1271 TRP A CG     1 
ATOM   4678  C  CD1    . TRP A 1 309 ? -41.233  74.294  -26.860 1.00 78.43  ? 1271 TRP A CD1    1 
ATOM   4679  C  CD2    . TRP A 1 309 ? -43.230  74.757  -25.965 1.00 72.02  ? 1271 TRP A CD2    1 
ATOM   4680  N  NE1    . TRP A 1 309 ? -41.020  75.015  -25.710 1.00 77.54  ? 1271 TRP A NE1    1 
ATOM   4681  C  CE2    . TRP A 1 309 ? -42.230  75.312  -25.142 1.00 73.17  ? 1271 TRP A CE2    1 
ATOM   4682  C  CE3    . TRP A 1 309 ? -44.570  74.923  -25.602 1.00 69.84  ? 1271 TRP A CE3    1 
ATOM   4683  C  CZ2    . TRP A 1 309 ? -42.527  76.020  -23.979 1.00 70.05  ? 1271 TRP A CZ2    1 
ATOM   4684  C  CZ3    . TRP A 1 309 ? -44.864  75.626  -24.444 1.00 68.59  ? 1271 TRP A CZ3    1 
ATOM   4685  C  CH2    . TRP A 1 309 ? -43.847  76.166  -23.648 1.00 67.84  ? 1271 TRP A CH2    1 
ATOM   4686  H  H      . TRP A 1 309 ? -42.594  74.396  -30.539 1.00 102.88 ? 1271 TRP A H      1 
ATOM   4687  H  HA     . TRP A 1 309 ? -41.476  72.548  -28.887 1.00 100.84 ? 1271 TRP A HA     1 
ATOM   4688  H  HB2    . TRP A 1 309 ? -43.890  73.959  -28.579 1.00 96.15  ? 1271 TRP A HB2    1 
ATOM   4689  H  HB3    . TRP A 1 309 ? -43.664  72.590  -27.813 1.00 96.15  ? 1271 TRP A HB3    1 
ATOM   4690  H  HD1    . TRP A 1 309 ? -40.562  73.974  -27.420 1.00 94.11  ? 1271 TRP A HD1    1 
ATOM   4691  H  HE1    . TRP A 1 309 ? -40.252  75.243  -25.399 1.00 93.05  ? 1271 TRP A HE1    1 
ATOM   4692  H  HE3    . TRP A 1 309 ? -45.251  74.565  -26.125 1.00 83.81  ? 1271 TRP A HE3    1 
ATOM   4693  H  HZ2    . TRP A 1 309 ? -41.854  76.381  -23.449 1.00 84.06  ? 1271 TRP A HZ2    1 
ATOM   4694  H  HZ3    . TRP A 1 309 ? -45.751  75.742  -24.192 1.00 82.30  ? 1271 TRP A HZ3    1 
ATOM   4695  H  HH2    . TRP A 1 309 ? -44.073  76.634  -22.877 1.00 81.41  ? 1271 TRP A HH2    1 
ATOM   4696  N  N      . THR A 1 310 ? -42.276  71.344  -31.172 1.00 79.45  ? 1272 THR A N      1 
ATOM   4697  C  CA     . THR A 1 310 ? -42.827  70.325  -32.055 1.00 79.27  ? 1272 THR A CA     1 
ATOM   4698  C  C      . THR A 1 310 ? -42.465  68.904  -31.638 1.00 81.57  ? 1272 THR A C      1 
ATOM   4699  O  O      . THR A 1 310 ? -42.913  67.953  -32.288 1.00 78.64  ? 1272 THR A O      1 
ATOM   4700  C  CB     . THR A 1 310 ? -42.351  70.568  -33.493 1.00 80.82  ? 1272 THR A CB     1 
ATOM   4701  O  OG1    . THR A 1 310 ? -40.928  70.736  -33.509 1.00 81.85  ? 1272 THR A OG1    1 
ATOM   4702  C  CG2    . THR A 1 310 ? -43.012  71.810  -34.070 1.00 81.86  ? 1272 THR A CG2    1 
ATOM   4703  H  H      . THR A 1 310 ? -41.497  71.622  -31.407 1.00 95.34  ? 1272 THR A H      1 
ATOM   4704  H  HA     . THR A 1 310 ? -43.794  70.397  -32.048 1.00 95.13  ? 1272 THR A HA     1 
ATOM   4705  H  HB     . THR A 1 310 ? -42.592  69.808  -34.045 1.00 96.99  ? 1272 THR A HB     1 
ATOM   4706  H  HG1    . THR A 1 310 ? -40.663  70.870  -34.296 1.00 98.22  ? 1272 THR A HG1    1 
ATOM   4707  H  HG21   . THR A 1 310 ? -42.705  71.956  -34.979 1.00 98.23  ? 1272 THR A HG21   1 
ATOM   4708  H  HG22   . THR A 1 310 ? -43.975  71.700  -34.076 1.00 98.23  ? 1272 THR A HG22   1 
ATOM   4709  H  HG23   . THR A 1 310 ? -42.786  72.585  -33.533 1.00 98.23  ? 1272 THR A HG23   1 
ATOM   4710  N  N      . SER A 1 311 ? -41.675  68.729  -30.575 1.00 91.85  ? 1273 SER A N      1 
ATOM   4711  C  CA     . SER A 1 311 ? -41.267  67.385  -30.176 1.00 94.09  ? 1273 SER A CA     1 
ATOM   4712  C  C      . SER A 1 311 ? -42.463  66.542  -29.749 1.00 90.08  ? 1273 SER A C      1 
ATOM   4713  O  O      . SER A 1 311 ? -42.556  65.361  -30.102 1.00 91.18  ? 1273 SER A O      1 
ATOM   4714  C  CB     . SER A 1 311 ? -40.242  67.462  -29.044 1.00 94.68  ? 1273 SER A CB     1 
ATOM   4715  O  OG     . SER A 1 311 ? -39.102  68.204  -29.440 1.00 98.72  ? 1273 SER A OG     1 
ATOM   4716  H  H      . SER A 1 311 ? -41.368  69.361  -30.079 1.00 110.22 ? 1273 SER A H      1 
ATOM   4717  H  HA     . SER A 1 311 ? -40.846  66.946  -30.931 1.00 112.91 ? 1273 SER A HA     1 
ATOM   4718  H  HB2    . SER A 1 311 ? -40.650  67.896  -28.279 1.00 113.61 ? 1273 SER A HB2    1 
ATOM   4719  H  HB3    . SER A 1 311 ? -39.966  66.563  -28.807 1.00 113.61 ? 1273 SER A HB3    1 
ATOM   4720  H  HG     . SER A 1 311 ? -38.548  68.238  -28.809 1.00 118.46 ? 1273 SER A HG     1 
ATOM   4721  N  N      . LYS A 1 312 ? -43.384  67.128  -28.994 1.00 85.08  ? 1274 LYS A N      1 
ATOM   4722  C  CA     . LYS A 1 312 ? -44.482  66.393  -28.386 1.00 79.48  ? 1274 LYS A CA     1 
ATOM   4723  C  C      . LYS A 1 312 ? -45.792  66.694  -29.104 1.00 75.29  ? 1274 LYS A C      1 
ATOM   4724  O  O      . LYS A 1 312 ? -45.908  67.652  -29.874 1.00 78.12  ? 1274 LYS A O      1 
ATOM   4725  C  CB     . LYS A 1 312 ? -44.596  66.737  -26.896 1.00 79.88  ? 1274 LYS A CB     1 
ATOM   4726  C  CG     . LYS A 1 312 ? -43.323  66.472  -26.101 1.00 80.96  ? 1274 LYS A CG     1 
ATOM   4727  C  CD     . LYS A 1 312 ? -42.960  64.993  -26.101 1.00 80.54  ? 1274 LYS A CD     1 
ATOM   4728  C  CE     . LYS A 1 312 ? -41.726  64.723  -25.261 1.00 81.44  ? 1274 LYS A CE     1 
ATOM   4729  N  NZ     . LYS A 1 312 ? -41.419  63.270  -25.175 1.00 81.23  1 1274 LYS A NZ     1 
ATOM   4730  H  H      . LYS A 1 312 ? -43.394  67.969  -28.816 1.00 102.09 ? 1274 LYS A H      1 
ATOM   4731  H  HA     . LYS A 1 312 ? -44.308  65.442  -28.463 1.00 95.38  ? 1274 LYS A HA     1 
ATOM   4732  H  HB2    . LYS A 1 312 ? -44.809  67.679  -26.809 1.00 95.86  ? 1274 LYS A HB2    1 
ATOM   4733  H  HB3    . LYS A 1 312 ? -45.305  66.202  -26.506 1.00 95.86  ? 1274 LYS A HB3    1 
ATOM   4734  H  HG2    . LYS A 1 312 ? -42.589  66.965  -26.500 1.00 97.16  ? 1274 LYS A HG2    1 
ATOM   4735  H  HG3    . LYS A 1 312 ? -43.456  66.753  -25.182 1.00 97.16  ? 1274 LYS A HG3    1 
ATOM   4736  H  HD2    . LYS A 1 312 ? -43.697  64.483  -25.730 1.00 96.65  ? 1274 LYS A HD2    1 
ATOM   4737  H  HD3    . LYS A 1 312 ? -42.778  64.708  -27.010 1.00 96.65  ? 1274 LYS A HD3    1 
ATOM   4738  H  HE2    . LYS A 1 312 ? -40.964  65.170  -25.662 1.00 97.73  ? 1274 LYS A HE2    1 
ATOM   4739  H  HE3    . LYS A 1 312 ? -41.873  65.055  -24.361 1.00 97.73  ? 1274 LYS A HE3    1 
ATOM   4740  H  HZ1    . LYS A 1 312 ? -40.692  63.142  -24.677 1.00 97.48  ? 1274 LYS A HZ1    1 
ATOM   4741  H  HZ2    . LYS A 1 312 ? -42.102  62.836  -24.805 1.00 97.48  ? 1274 LYS A HZ2    1 
ATOM   4742  H  HZ3    . LYS A 1 312 ? -41.274  62.941  -25.989 1.00 97.48  ? 1274 LYS A HZ3    1 
ATOM   4743  N  N      . TYR A 1 313 ? -46.787  65.849  -28.836 1.00 69.40  ? 1275 TYR A N      1 
ATOM   4744  C  CA     . TYR A 1 313 ? -48.127  66.015  -29.394 1.00 66.77  ? 1275 TYR A CA     1 
ATOM   4745  C  C      . TYR A 1 313 ? -48.977  66.920  -28.504 1.00 60.19  ? 1275 TYR A C      1 
ATOM   4746  O  O      . TYR A 1 313 ? -49.502  67.938  -28.964 1.00 62.51  ? 1275 TYR A O      1 
ATOM   4747  C  CB     . TYR A 1 313 ? -48.783  64.640  -29.577 1.00 66.95  ? 1275 TYR A CB     1 
ATOM   4748  C  CG     . TYR A 1 313 ? -50.074  64.642  -30.373 1.00 66.94  ? 1275 TYR A CG     1 
ATOM   4749  C  CD1    . TYR A 1 313 ? -50.060  64.792  -31.755 1.00 69.56  ? 1275 TYR A CD1    1 
ATOM   4750  C  CD2    . TYR A 1 313 ? -51.303  64.467  -29.746 1.00 64.74  ? 1275 TYR A CD2    1 
ATOM   4751  C  CE1    . TYR A 1 313 ? -51.233  64.785  -32.490 1.00 68.70  ? 1275 TYR A CE1    1 
ATOM   4752  C  CE2    . TYR A 1 313 ? -52.483  64.458  -30.473 1.00 65.07  ? 1275 TYR A CE2    1 
ATOM   4753  C  CZ     . TYR A 1 313 ? -52.441  64.614  -31.847 1.00 70.03  ? 1275 TYR A CZ     1 
ATOM   4754  O  OH     . TYR A 1 313 ? -53.609  64.610  -32.577 1.00 67.42  ? 1275 TYR A OH     1 
ATOM   4755  H  H      . TYR A 1 313 ? -46.709  65.161  -28.326 1.00 83.29  ? 1275 TYR A H      1 
ATOM   4756  H  HA     . TYR A 1 313 ? -48.056  66.433  -30.266 1.00 80.13  ? 1275 TYR A HA     1 
ATOM   4757  H  HB2    . TYR A 1 313 ? -48.157  64.059  -30.038 1.00 80.34  ? 1275 TYR A HB2    1 
ATOM   4758  H  HB3    . TYR A 1 313 ? -48.980  64.274  -28.701 1.00 80.34  ? 1275 TYR A HB3    1 
ATOM   4759  H  HD1    . TYR A 1 313 ? -49.247  64.906  -32.193 1.00 83.47  ? 1275 TYR A HD1    1 
ATOM   4760  H  HD2    . TYR A 1 313 ? -51.334  64.360  -28.823 1.00 77.69  ? 1275 TYR A HD2    1 
ATOM   4761  H  HE1    . TYR A 1 313 ? -51.206  64.891  -33.414 1.00 82.44  ? 1275 TYR A HE1    1 
ATOM   4762  H  HE2    . TYR A 1 313 ? -53.299  64.344  -30.039 1.00 78.09  ? 1275 TYR A HE2    1 
ATOM   4763  H  HH     . TYR A 1 313 ? -54.267  64.498  -32.067 1.00 80.90  ? 1275 TYR A HH     1 
ATOM   4764  N  N      . ILE A 1 314 ? -49.105  66.572  -27.228 1.00 57.64  ? 1276 ILE A N      1 
ATOM   4765  C  CA     . ILE A 1 314 ? -49.833  67.396  -26.268 1.00 52.15  ? 1276 ILE A CA     1 
ATOM   4766  C  C      . ILE A 1 314 ? -48.871  68.446  -25.731 1.00 51.42  ? 1276 ILE A C      1 
ATOM   4767  O  O      . ILE A 1 314 ? -47.869  68.113  -25.089 1.00 50.27  ? 1276 ILE A O      1 
ATOM   4768  C  CB     . ILE A 1 314 ? -50.422  66.550  -25.130 1.00 48.68  ? 1276 ILE A CB     1 
ATOM   4769  C  CG1    . ILE A 1 314 ? -51.386  65.501  -25.694 1.00 50.87  ? 1276 ILE A CG1    1 
ATOM   4770  C  CG2    . ILE A 1 314 ? -51.130  67.447  -24.114 1.00 49.36  ? 1276 ILE A CG2    1 
ATOM   4771  C  CD1    . ILE A 1 314 ? -51.897  64.503  -24.659 1.00 49.52  ? 1276 ILE A CD1    1 
ATOM   4772  H  H      . ILE A 1 314 ? -48.775  65.854  -26.888 1.00 69.17  ? 1276 ILE A H      1 
ATOM   4773  H  HA     . ILE A 1 314 ? -50.561  67.850  -26.720 1.00 62.58  ? 1276 ILE A HA     1 
ATOM   4774  H  HB     . ILE A 1 314 ? -49.696  66.091  -24.681 1.00 58.42  ? 1276 ILE A HB     1 
ATOM   4775  H  HG12   . ILE A 1 314 ? -52.155  65.955  -26.072 1.00 61.04  ? 1276 ILE A HG12   1 
ATOM   4776  H  HG13   . ILE A 1 314 ? -50.929  64.999  -26.388 1.00 61.04  ? 1276 ILE A HG13   1 
ATOM   4777  H  HG21   . ILE A 1 314 ? -51.495  66.894  -23.405 1.00 59.23  ? 1276 ILE A HG21   1 
ATOM   4778  H  HG22   . ILE A 1 314 ? -50.489  68.076  -23.747 1.00 59.23  ? 1276 ILE A HG22   1 
ATOM   4779  H  HG23   . ILE A 1 314 ? -51.846  67.926  -24.560 1.00 59.23  ? 1276 ILE A HG23   1 
ATOM   4780  H  HD11   . ILE A 1 314 ? -52.497  63.877  -25.094 1.00 59.43  ? 1276 ILE A HD11   1 
ATOM   4781  H  HD12   . ILE A 1 314 ? -51.141  64.028  -24.279 1.00 59.43  ? 1276 ILE A HD12   1 
ATOM   4782  H  HD13   . ILE A 1 314 ? -52.369  64.985  -23.963 1.00 59.43  ? 1276 ILE A HD13   1 
ATOM   4783  N  N      . VAL A 1 315 ? -49.170  69.712  -26.007 1.00 51.33  ? 1277 VAL A N      1 
ATOM   4784  C  CA     . VAL A 1 315 ? -48.295  70.827  -25.666 1.00 52.26  ? 1277 VAL A CA     1 
ATOM   4785  C  C      . VAL A 1 315 ? -49.109  71.819  -24.853 1.00 51.20  ? 1277 VAL A C      1 
ATOM   4786  O  O      . VAL A 1 315 ? -50.082  72.390  -25.358 1.00 50.57  ? 1277 VAL A O      1 
ATOM   4787  C  CB     . VAL A 1 315 ? -47.708  71.507  -26.913 1.00 55.70  ? 1277 VAL A CB     1 
ATOM   4788  C  CG1    . VAL A 1 315 ? -46.627  72.498  -26.510 1.00 56.17  ? 1277 VAL A CG1    1 
ATOM   4789  C  CG2    . VAL A 1 315 ? -47.158  70.469  -27.883 1.00 56.42  ? 1277 VAL A CG2    1 
ATOM   4790  H  H      . VAL A 1 315 ? -49.893  69.956  -26.403 1.00 61.60  ? 1277 VAL A H      1 
ATOM   4791  H  HA     . VAL A 1 315 ? -47.563  70.507  -25.117 1.00 62.71  ? 1277 VAL A HA     1 
ATOM   4792  H  HB     . VAL A 1 315 ? -48.411  71.998  -27.366 1.00 66.84  ? 1277 VAL A HB     1 
ATOM   4793  H  HG11   . VAL A 1 315 ? -46.269  72.916  -27.309 1.00 67.41  ? 1277 VAL A HG11   1 
ATOM   4794  H  HG12   . VAL A 1 315 ? -47.016  73.171  -25.930 1.00 67.41  ? 1277 VAL A HG12   1 
ATOM   4795  H  HG13   . VAL A 1 315 ? -45.923  72.023  -26.041 1.00 67.41  ? 1277 VAL A HG13   1 
ATOM   4796  H  HG21   . VAL A 1 315 ? -46.794  70.924  -28.659 1.00 67.71  ? 1277 VAL A HG21   1 
ATOM   4797  H  HG22   . VAL A 1 315 ? -46.460  69.961  -27.439 1.00 67.71  ? 1277 VAL A HG22   1 
ATOM   4798  H  HG23   . VAL A 1 315 ? -47.877  69.877  -28.153 1.00 67.71  ? 1277 VAL A HG23   1 
ATOM   4799  N  N      . ILE A 1 316 ? -48.715  72.021  -23.601 1.00 51.13  ? 1278 ILE A N      1 
ATOM   4800  C  CA     . ILE A 1 316 ? -49.454  72.870  -22.679 1.00 51.23  ? 1278 ILE A CA     1 
ATOM   4801  C  C      . ILE A 1 316 ? -48.480  73.876  -22.086 1.00 50.95  ? 1278 ILE A C      1 
ATOM   4802  O  O      . ILE A 1 316 ? -47.498  73.490  -21.440 1.00 52.77  ? 1278 ILE A O      1 
ATOM   4803  C  CB     . ILE A 1 316 ? -50.143  72.050  -21.574 1.00 49.36  ? 1278 ILE A CB     1 
ATOM   4804  C  CG1    . ILE A 1 316 ? -51.096  71.025  -22.197 1.00 46.01  ? 1278 ILE A CG1    1 
ATOM   4805  C  CG2    . ILE A 1 316 ? -50.900  72.971  -20.623 1.00 47.73  ? 1278 ILE A CG2    1 
ATOM   4806  C  CD1    . ILE A 1 316 ? -51.648  70.017  -21.220 1.00 46.44  ? 1278 ILE A CD1    1 
ATOM   4807  H  H      . ILE A 1 316 ? -48.009  71.671  -23.256 1.00 61.36  ? 1278 ILE A H      1 
ATOM   4808  H  HA     . ILE A 1 316 ? -50.136  73.357  -23.167 1.00 61.47  ? 1278 ILE A HA     1 
ATOM   4809  H  HB     . ILE A 1 316 ? -49.463  71.576  -21.071 1.00 59.24  ? 1278 ILE A HB     1 
ATOM   4810  H  HG12   . ILE A 1 316 ? -51.846  71.496  -22.590 1.00 55.21  ? 1278 ILE A HG12   1 
ATOM   4811  H  HG13   . ILE A 1 316 ? -50.619  70.536  -22.886 1.00 55.21  ? 1278 ILE A HG13   1 
ATOM   4812  H  HG21   . ILE A 1 316 ? -51.326  72.434  -19.937 1.00 57.28  ? 1278 ILE A HG21   1 
ATOM   4813  H  HG22   . ILE A 1 316 ? -50.273  73.591  -20.219 1.00 57.28  ? 1278 ILE A HG22   1 
ATOM   4814  H  HG23   . ILE A 1 316 ? -51.572  73.460  -21.125 1.00 57.28  ? 1278 ILE A HG23   1 
ATOM   4815  H  HD11   . ILE A 1 316 ? -52.238  69.409  -21.694 1.00 55.73  ? 1278 ILE A HD11   1 
ATOM   4816  H  HD12   . ILE A 1 316 ? -50.912  69.524  -20.826 1.00 55.73  ? 1278 ILE A HD12   1 
ATOM   4817  H  HD13   . ILE A 1 316 ? -52.141  70.485  -20.529 1.00 55.73  ? 1278 ILE A HD13   1 
ATOM   4818  N  N      . GLU A 1 317 ? -48.751  75.158  -22.306 1.00 50.30  ? 1279 GLU A N      1 
ATOM   4819  C  CA     . GLU A 1 317 ? -47.894  76.234  -21.834 1.00 53.26  ? 1279 GLU A CA     1 
ATOM   4820  C  C      . GLU A 1 317 ? -48.405  76.741  -20.491 1.00 52.22  ? 1279 GLU A C      1 
ATOM   4821  O  O      . GLU A 1 317 ? -49.610  76.949  -20.317 1.00 51.45  ? 1279 GLU A O      1 
ATOM   4822  C  CB     . GLU A 1 317 ? -47.871  77.377  -22.850 1.00 57.24  ? 1279 GLU A CB     1 
ATOM   4823  C  CG     . GLU A 1 317 ? -46.995  78.563  -22.464 1.00 58.70  ? 1279 GLU A CG     1 
ATOM   4824  C  CD     . GLU A 1 317 ? -47.326  79.806  -23.271 1.00 61.44  ? 1279 GLU A CD     1 
ATOM   4825  O  OE1    . GLU A 1 317 ? -46.428  80.343  -23.947 1.00 65.20  ? 1279 GLU A OE1    1 
ATOM   4826  O  OE2    . GLU A 1 317 ? -48.489  80.257  -23.223 1.00 58.45  1 1279 GLU A OE2    1 
ATOM   4827  H  H      . GLU A 1 317 ? -49.442  75.433  -22.738 1.00 60.36  ? 1279 GLU A H      1 
ATOM   4828  H  HA     . GLU A 1 317 ? -46.990  75.904  -21.717 1.00 63.91  ? 1279 GLU A HA     1 
ATOM   4829  H  HB2    . GLU A 1 317 ? -47.541  77.032  -23.694 1.00 68.69  ? 1279 GLU A HB2    1 
ATOM   4830  H  HB3    . GLU A 1 317 ? -48.776  77.707  -22.964 1.00 68.69  ? 1279 GLU A HB3    1 
ATOM   4831  H  HG2    . GLU A 1 317 ? -47.132  78.768  -21.526 1.00 70.44  ? 1279 GLU A HG2    1 
ATOM   4832  H  HG3    . GLU A 1 317 ? -46.066  78.338  -22.624 1.00 70.44  ? 1279 GLU A HG3    1 
ATOM   4833  N  N      . ASP A 1 318 ? -47.491  76.934  -19.546 1.00 50.47  ? 1280 ASP A N      1 
ATOM   4834  C  CA     . ASP A 1 318 ? -47.873  77.517  -18.270 1.00 49.80  ? 1280 ASP A CA     1 
ATOM   4835  C  C      . ASP A 1 318 ? -48.265  78.980  -18.470 1.00 50.82  ? 1280 ASP A C      1 
ATOM   4836  O  O      . ASP A 1 318 ? -47.632  79.690  -19.257 1.00 50.15  ? 1280 ASP A O      1 
ATOM   4837  C  CB     . ASP A 1 318 ? -46.726  77.417  -17.265 1.00 48.41  ? 1280 ASP A CB     1 
ATOM   4838  C  CG     . ASP A 1 318 ? -47.107  77.941  -15.893 1.00 49.67  ? 1280 ASP A CG     1 
ATOM   4839  O  OD1    . ASP A 1 318 ? -47.649  77.161  -15.077 1.00 48.34  1 1280 ASP A OD1    1 
ATOM   4840  O  OD2    . ASP A 1 318 ? -46.871  79.141  -15.636 1.00 46.75  ? 1280 ASP A OD2    1 
ATOM   4841  H  H      . ASP A 1 318 ? -46.656  76.739  -19.619 1.00 60.56  ? 1280 ASP A H      1 
ATOM   4842  H  HA     . ASP A 1 318 ? -48.638  77.040  -17.913 1.00 59.76  ? 1280 ASP A HA     1 
ATOM   4843  H  HB2    . ASP A 1 318 ? -46.469  76.487  -17.170 1.00 58.09  ? 1280 ASP A HB2    1 
ATOM   4844  H  HB3    . ASP A 1 318 ? -45.975  77.939  -17.588 1.00 58.09  ? 1280 ASP A HB3    1 
ATOM   4845  N  N      . PRO A 1 319 ? -49.297  79.464  -17.775 1.00 52.51  ? 1281 PRO A N      1 
ATOM   4846  C  CA     . PRO A 1 319 ? -49.721  80.859  -17.984 1.00 53.84  ? 1281 PRO A CA     1 
ATOM   4847  C  C      . PRO A 1 319 ? -48.665  81.890  -17.618 1.00 55.38  ? 1281 PRO A C      1 
ATOM   4848  O  O      . PRO A 1 319 ? -48.713  83.006  -18.148 1.00 59.18  ? 1281 PRO A O      1 
ATOM   4849  C  CB     . PRO A 1 319 ? -50.965  80.989  -17.092 1.00 56.62  ? 1281 PRO A CB     1 
ATOM   4850  C  CG     . PRO A 1 319 ? -50.859  79.867  -16.105 1.00 54.35  ? 1281 PRO A CG     1 
ATOM   4851  C  CD     . PRO A 1 319 ? -50.190  78.755  -16.843 1.00 53.33  ? 1281 PRO A CD     1 
ATOM   4852  H  HA     . PRO A 1 319 ? -49.982  80.991  -18.909 1.00 64.61  ? 1281 PRO A HA     1 
ATOM   4853  H  HB2    . PRO A 1 319 ? -50.953  81.847  -16.639 1.00 67.94  ? 1281 PRO A HB2    1 
ATOM   4854  H  HB3    . PRO A 1 319 ? -51.765  80.897  -17.632 1.00 67.94  ? 1281 PRO A HB3    1 
ATOM   4855  H  HG2    . PRO A 1 319 ? -50.322  80.148  -15.348 1.00 65.22  ? 1281 PRO A HG2    1 
ATOM   4856  H  HG3    . PRO A 1 319 ? -51.746  79.602  -15.816 1.00 65.22  ? 1281 PRO A HG3    1 
ATOM   4857  H  HD2    . PRO A 1 319 ? -49.675  78.205  -16.233 1.00 63.99  ? 1281 PRO A HD2    1 
ATOM   4858  H  HD3    . PRO A 1 319 ? -50.844  78.231  -17.332 1.00 63.99  ? 1281 PRO A HD3    1 
ATOM   4859  N  N      . PHE A 1 320 ? -47.720  81.564  -16.736 1.00 52.45  ? 1282 PHE A N      1 
ATOM   4860  C  CA     . PHE A 1 320 ? -46.688  82.505  -16.317 1.00 53.05  ? 1282 PHE A CA     1 
ATOM   4861  C  C      . PHE A 1 320 ? -45.293  82.101  -16.770 1.00 53.91  ? 1282 PHE A C      1 
ATOM   4862  O  O      . PHE A 1 320 ? -44.590  82.903  -17.393 1.00 59.20  ? 1282 PHE A O      1 
ATOM   4863  C  CB     . PHE A 1 320 ? -46.711  82.659  -14.789 1.00 54.27  ? 1282 PHE A CB     1 
ATOM   4864  C  CG     . PHE A 1 320 ? -47.973  83.281  -14.259 1.00 53.71  ? 1282 PHE A CG     1 
ATOM   4865  C  CD1    . PHE A 1 320 ? -48.548  84.370  -14.892 1.00 56.04  ? 1282 PHE A CD1    1 
ATOM   4866  C  CD2    . PHE A 1 320 ? -48.586  82.774  -13.125 1.00 53.77  ? 1282 PHE A CD2    1 
ATOM   4867  C  CE1    . PHE A 1 320 ? -49.707  84.942  -14.404 1.00 55.80  ? 1282 PHE A CE1    1 
ATOM   4868  C  CE2    . PHE A 1 320 ? -49.745  83.342  -12.633 1.00 53.48  ? 1282 PHE A CE2    1 
ATOM   4869  C  CZ     . PHE A 1 320 ? -50.306  84.428  -13.273 1.00 55.58  ? 1282 PHE A CZ     1 
ATOM   4870  H  H      . PHE A 1 320 ? -47.656  80.792  -16.362 1.00 62.94  ? 1282 PHE A H      1 
ATOM   4871  H  HA     . PHE A 1 320 ? -46.883  83.373  -16.704 1.00 63.66  ? 1282 PHE A HA     1 
ATOM   4872  H  HB2    . PHE A 1 320 ? -46.622  81.781  -14.385 1.00 65.12  ? 1282 PHE A HB2    1 
ATOM   4873  H  HB3    . PHE A 1 320 ? -45.968  83.221  -14.520 1.00 65.12  ? 1282 PHE A HB3    1 
ATOM   4874  H  HD1    . PHE A 1 320 ? -48.147  84.721  -15.655 1.00 67.24  ? 1282 PHE A HD1    1 
ATOM   4875  H  HD2    . PHE A 1 320 ? -48.212  82.043  -12.689 1.00 64.52  ? 1282 PHE A HD2    1 
ATOM   4876  H  HE1    . PHE A 1 320 ? -50.084  85.673  -14.838 1.00 66.96  ? 1282 PHE A HE1    1 
ATOM   4877  H  HE2    . PHE A 1 320 ? -50.147  82.993  -11.870 1.00 64.18  ? 1282 PHE A HE2    1 
ATOM   4878  H  HZ     . PHE A 1 320 ? -51.087  84.811  -12.944 1.00 66.70  ? 1282 PHE A HZ     1 
ATOM   4879  N  N      . ASP A 1 321 ? -44.861  80.882  -16.461 1.00 51.88  ? 1283 ASP A N      1 
ATOM   4880  C  CA     . ASP A 1 321 ? -43.549  80.389  -16.878 1.00 54.78  ? 1283 ASP A CA     1 
ATOM   4881  C  C      . ASP A 1 321 ? -43.664  79.919  -18.324 1.00 59.26  ? 1283 ASP A C      1 
ATOM   4882  O  O      . ASP A 1 321 ? -43.958  78.754  -18.604 1.00 55.55  ? 1283 ASP A O      1 
ATOM   4883  C  CB     . ASP A 1 321 ? -43.079  79.274  -15.953 1.00 57.77  ? 1283 ASP A CB     1 
ATOM   4884  C  CG     . ASP A 1 321 ? -41.663  78.822  -16.247 1.00 61.14  ? 1283 ASP A CG     1 
ATOM   4885  O  OD1    . ASP A 1 321 ? -41.111  79.205  -17.302 1.00 62.20  ? 1283 ASP A OD1    1 
ATOM   4886  O  OD2    . ASP A 1 321 ? -41.101  78.077  -15.414 1.00 61.70  1 1283 ASP A OD2    1 
ATOM   4887  H  H      . ASP A 1 321 ? -45.315  80.312  -16.004 1.00 62.25  ? 1283 ASP A H      1 
ATOM   4888  H  HA     . ASP A 1 321 ? -42.904  81.113  -16.840 1.00 65.74  ? 1283 ASP A HA     1 
ATOM   4889  H  HB2    . ASP A 1 321 ? -43.109  79.591  -15.037 1.00 69.32  ? 1283 ASP A HB2    1 
ATOM   4890  H  HB3    . ASP A 1 321 ? -43.666  78.509  -16.058 1.00 69.32  ? 1283 ASP A HB3    1 
ATOM   4891  N  N      . LEU A 1 322 ? -43.432  80.841  -19.261 1.00 60.87  ? 1284 LEU A N      1 
ATOM   4892  C  CA     . LEU A 1 322 ? -43.661  80.550  -20.671 1.00 62.00  ? 1284 LEU A CA     1 
ATOM   4893  C  C      . LEU A 1 322 ? -42.648  79.576  -21.258 1.00 62.02  ? 1284 LEU A C      1 
ATOM   4894  O  O      . LEU A 1 322 ? -42.845  79.119  -22.387 1.00 64.96  ? 1284 LEU A O      1 
ATOM   4895  C  CB     . LEU A 1 322 ? -43.656  81.850  -21.478 1.00 61.52  ? 1284 LEU A CB     1 
ATOM   4896  C  CG     . LEU A 1 322 ? -44.606  82.942  -20.975 1.00 61.82  ? 1284 LEU A CG     1 
ATOM   4897  C  CD1    . LEU A 1 322 ? -44.643  84.108  -21.948 1.00 60.65  ? 1284 LEU A CD1    1 
ATOM   4898  C  CD2    . LEU A 1 322 ? -46.012  82.402  -20.739 1.00 56.52  ? 1284 LEU A CD2    1 
ATOM   4899  H  H      . LEU A 1 322 ? -43.145  81.637  -19.104 1.00 73.05  ? 1284 LEU A H      1 
ATOM   4900  H  HA     . LEU A 1 322 ? -44.540  80.150  -20.765 1.00 74.40  ? 1284 LEU A HA     1 
ATOM   4901  H  HB2    . LEU A 1 322 ? -42.758  82.217  -21.463 1.00 73.82  ? 1284 LEU A HB2    1 
ATOM   4902  H  HB3    . LEU A 1 322 ? -43.907  81.645  -22.392 1.00 73.82  ? 1284 LEU A HB3    1 
ATOM   4903  H  HG     . LEU A 1 322 ? -44.273  83.276  -20.127 1.00 74.18  ? 1284 LEU A HG     1 
ATOM   4904  H  HD11   . LEU A 1 322 ? -45.249  84.784  -21.607 1.00 72.78  ? 1284 LEU A HD11   1 
ATOM   4905  H  HD12   . LEU A 1 322 ? -43.749  84.477  -22.031 1.00 72.78  ? 1284 LEU A HD12   1 
ATOM   4906  H  HD13   . LEU A 1 322 ? -44.952  83.790  -22.810 1.00 72.78  ? 1284 LEU A HD13   1 
ATOM   4907  H  HD21   . LEU A 1 322 ? -46.578  83.123  -20.423 1.00 67.83  ? 1284 LEU A HD21   1 
ATOM   4908  H  HD22   . LEU A 1 322 ? -46.359  82.050  -21.574 1.00 67.83  ? 1284 LEU A HD22   1 
ATOM   4909  H  HD23   . LEU A 1 322 ? -45.972  81.696  -20.075 1.00 67.83  ? 1284 LEU A HD23   1 
ATOM   4910  N  N      . ASN A 1 323 ? -41.586  79.241  -20.533 1.00 63.06  ? 1285 ASN A N      1 
ATOM   4911  C  CA     . ASN A 1 323 ? -40.641  78.228  -20.984 1.00 64.39  ? 1285 ASN A CA     1 
ATOM   4912  C  C      . ASN A 1 323 ? -41.020  76.825  -20.529 1.00 62.07  ? 1285 ASN A C      1 
ATOM   4913  O  O      . ASN A 1 323 ? -40.301  75.871  -20.846 1.00 61.39  ? 1285 ASN A O      1 
ATOM   4914  C  CB     . ASN A 1 323 ? -39.232  78.558  -20.483 1.00 68.46  ? 1285 ASN A CB     1 
ATOM   4915  C  CG     . ASN A 1 323 ? -38.631  79.759  -21.179 1.00 73.98  ? 1285 ASN A CG     1 
ATOM   4916  O  OD1    . ASN A 1 323 ? -39.055  80.135  -22.272 1.00 74.93  ? 1285 ASN A OD1    1 
ATOM   4917  N  ND2    . ASN A 1 323 ? -37.628  80.364  -20.553 1.00 76.84  ? 1285 ASN A ND2    1 
ATOM   4918  H  H      . ASN A 1 323 ? -41.389  79.588  -19.771 1.00 75.67  ? 1285 ASN A H      1 
ATOM   4919  H  HA     . ASN A 1 323 ? -40.620  78.230  -21.954 1.00 77.27  ? 1285 ASN A HA     1 
ATOM   4920  H  HB2    . ASN A 1 323 ? -39.271  78.750  -19.533 1.00 82.15  ? 1285 ASN A HB2    1 
ATOM   4921  H  HB3    . ASN A 1 323 ? -38.652  77.796  -20.644 1.00 82.15  ? 1285 ASN A HB3    1 
ATOM   4922  H  HD21   . ASN A 1 323 ? -37.252  81.052  -20.907 1.00 92.21  ? 1285 ASN A HD21   1 
ATOM   4923  H  HD22   . ASN A 1 323 ? -37.354  80.068  -19.793 1.00 92.21  ? 1285 ASN A HD22   1 
ATOM   4924  N  N      . HIS A 1 324 ? -42.120  76.674  -19.797 1.00 60.13  ? 1286 HIS A N      1 
ATOM   4925  C  CA     . HIS A 1 324 ? -42.511  75.393  -19.222 1.00 56.24  ? 1286 HIS A CA     1 
ATOM   4926  C  C      . HIS A 1 324 ? -43.617  74.781  -20.074 1.00 55.33  ? 1286 HIS A C      1 
ATOM   4927  O  O      . HIS A 1 324 ? -44.720  75.332  -20.164 1.00 50.38  ? 1286 HIS A O      1 
ATOM   4928  C  CB     . HIS A 1 324 ? -42.968  75.567  -17.776 1.00 57.39  ? 1286 HIS A CB     1 
ATOM   4929  C  CG     . HIS A 1 324 ? -43.272  74.277  -17.080 1.00 57.19  ? 1286 HIS A CG     1 
ATOM   4930  N  ND1    . HIS A 1 324 ? -42.866  73.054  -17.570 1.00 58.14  ? 1286 HIS A ND1    1 
ATOM   4931  C  CD2    . HIS A 1 324 ? -43.939  74.019  -15.931 1.00 55.32  ? 1286 HIS A CD2    1 
ATOM   4932  C  CE1    . HIS A 1 324 ? -43.273  72.098  -16.754 1.00 55.04  ? 1286 HIS A CE1    1 
ATOM   4933  N  NE2    . HIS A 1 324 ? -43.928  72.657  -15.752 1.00 56.32  ? 1286 HIS A NE2    1 
ATOM   4934  H  H      . HIS A 1 324 ? -42.667  77.312  -19.616 1.00 72.15  ? 1286 HIS A H      1 
ATOM   4935  H  HA     . HIS A 1 324 ? -41.750  74.791  -19.231 1.00 67.49  ? 1286 HIS A HA     1 
ATOM   4936  H  HB2    . HIS A 1 324 ? -42.266  76.014  -17.278 1.00 68.87  ? 1286 HIS A HB2    1 
ATOM   4937  H  HB3    . HIS A 1 324 ? -43.774  76.107  -17.765 1.00 68.87  ? 1286 HIS A HB3    1 
ATOM   4938  H  HD2    . HIS A 1 324 ? -44.335  74.646  -15.370 1.00 66.38  ? 1286 HIS A HD2    1 
ATOM   4939  H  HE1    . HIS A 1 324 ? -43.124  71.187  -16.865 1.00 66.04  ? 1286 HIS A HE1    1 
ATOM   4940  H  HE2    . HIS A 1 324 ? -44.286  72.237  -15.093 1.00 67.59  ? 1286 HIS A HE2    1 
ATOM   4941  N  N      . ASN A 1 325 ? -43.314  73.649  -20.704 1.00 56.41  ? 1287 ASN A N      1 
ATOM   4942  C  CA     . ASN A 1 325 ? -44.306  72.850  -21.415 1.00 54.00  ? 1287 ASN A CA     1 
ATOM   4943  C  C      . ASN A 1 325 ? -44.734  71.706  -20.500 1.00 48.12  ? 1287 ASN A C      1 
ATOM   4944  O  O      . ASN A 1 325 ? -43.973  70.759  -20.282 1.00 47.43  ? 1287 ASN A O      1 
ATOM   4945  C  CB     . ASN A 1 325 ? -43.742  72.321  -22.732 1.00 51.18  ? 1287 ASN A CB     1 
ATOM   4946  C  CG     . ASN A 1 325 ? -44.672  71.333  -23.410 1.00 51.49  ? 1287 ASN A CG     1 
ATOM   4947  O  OD1    . ASN A 1 325 ? -45.881  71.332  -23.168 1.00 52.35  ? 1287 ASN A OD1    1 
ATOM   4948  N  ND2    . ASN A 1 325 ? -44.111  70.475  -24.251 1.00 50.49  ? 1287 ASN A ND2    1 
ATOM   4949  H  H      . ASN A 1 325 ? -42.522  73.316  -20.734 1.00 67.69  ? 1287 ASN A H      1 
ATOM   4950  H  HA     . ASN A 1 325 ? -45.083  73.396  -21.610 1.00 64.80  ? 1287 ASN A HA     1 
ATOM   4951  H  HB2    . ASN A 1 325 ? -43.601  73.065  -23.338 1.00 61.42  ? 1287 ASN A HB2    1 
ATOM   4952  H  HB3    . ASN A 1 325 ? -42.901  71.870  -22.558 1.00 61.42  ? 1287 ASN A HB3    1 
ATOM   4953  H  HD21   . ASN A 1 325 ? -44.596  69.895  -24.661 1.00 60.59  ? 1287 ASN A HD21   1 
ATOM   4954  H  HD22   . ASN A 1 325 ? -43.262  70.499  -24.387 1.00 60.59  ? 1287 ASN A HD22   1 
ATOM   4955  N  N      . LEU A 1 326 ? -45.956  71.796  -19.969 1.00 49.42  ? 1288 LEU A N      1 
ATOM   4956  C  CA     . LEU A 1 326 ? -46.446  70.787  -19.033 1.00 52.12  ? 1288 LEU A CA     1 
ATOM   4957  C  C      . LEU A 1 326 ? -46.481  69.387  -19.641 1.00 51.61  ? 1288 LEU A C      1 
ATOM   4958  O  O      . LEU A 1 326 ? -46.486  68.402  -18.895 1.00 50.22  ? 1288 LEU A O      1 
ATOM   4959  C  CB     . LEU A 1 326 ? -47.844  71.171  -18.537 1.00 51.60  ? 1288 LEU A CB     1 
ATOM   4960  C  CG     . LEU A 1 326 ? -48.011  72.240  -17.446 1.00 51.69  ? 1288 LEU A CG     1 
ATOM   4961  C  CD1    . LEU A 1 326 ? -47.786  71.629  -16.093 1.00 53.64  ? 1288 LEU A CD1    1 
ATOM   4962  C  CD2    . LEU A 1 326 ? -47.085  73.427  -17.637 1.00 53.52  ? 1288 LEU A CD2    1 
ATOM   4963  H  H      . LEU A 1 326 ? -46.516  72.427  -20.134 1.00 59.31  ? 1288 LEU A H      1 
ATOM   4964  H  HA     . LEU A 1 326 ? -45.855  70.762  -18.264 1.00 62.54  ? 1288 LEU A HA     1 
ATOM   4965  H  HB2    . LEU A 1 326 ? -48.348  71.482  -19.305 1.00 61.92  ? 1288 LEU A HB2    1 
ATOM   4966  H  HB3    . LEU A 1 326 ? -48.262  70.365  -18.198 1.00 61.92  ? 1288 LEU A HB3    1 
ATOM   4967  H  HG     . LEU A 1 326 ? -48.923  72.570  -17.472 1.00 62.03  ? 1288 LEU A HG     1 
ATOM   4968  H  HD11   . LEU A 1 326 ? -47.895  72.314  -15.416 1.00 64.37  ? 1288 LEU A HD11   1 
ATOM   4969  H  HD12   . LEU A 1 326 ? -48.434  70.921  -15.955 1.00 64.37  ? 1288 LEU A HD12   1 
ATOM   4970  H  HD13   . LEU A 1 326 ? -46.887  71.267  -16.057 1.00 64.37  ? 1288 LEU A HD13   1 
ATOM   4971  H  HD21   . LEU A 1 326 ? -47.236  74.064  -16.921 1.00 64.22  ? 1288 LEU A HD21   1 
ATOM   4972  H  HD22   . LEU A 1 326 ? -46.166  73.116  -17.615 1.00 64.22  ? 1288 LEU A HD22   1 
ATOM   4973  H  HD23   . LEU A 1 326 ? -47.274  73.840  -18.494 1.00 64.22  ? 1288 LEU A HD23   1 
ATOM   4974  N  N      . GLY A 1 327 ? -46.501  69.270  -20.967 1.00 55.63  ? 1289 GLY A N      1 
ATOM   4975  C  CA     . GLY A 1 327 ? -46.565  67.966  -21.600 1.00 54.40  ? 1289 GLY A CA     1 
ATOM   4976  C  C      . GLY A 1 327 ? -45.216  67.489  -22.093 1.00 54.08  ? 1289 GLY A C      1 
ATOM   4977  O  O      . GLY A 1 327 ? -45.132  66.552  -22.891 1.00 58.69  ? 1289 GLY A O      1 
ATOM   4978  H  H      . GLY A 1 327 ? -46.478  69.931  -21.516 1.00 66.76  ? 1289 GLY A H      1 
ATOM   4979  H  HA2    . GLY A 1 327 ? -46.907  67.316  -20.967 1.00 65.28  ? 1289 GLY A HA2    1 
ATOM   4980  H  HA3    . GLY A 1 327 ? -47.171  68.005  -22.357 1.00 65.28  ? 1289 GLY A HA3    1 
ATOM   4981  N  N      . ALA A 1 328 ? -44.146  68.119  -21.607 1.00 55.48  ? 1290 ALA A N      1 
ATOM   4982  C  CA     . ALA A 1 328 ? -42.807  67.812  -22.093 1.00 57.27  ? 1290 ALA A CA     1 
ATOM   4983  C  C      . ALA A 1 328 ? -42.318  66.440  -21.648 1.00 57.54  ? 1290 ALA A C      1 
ATOM   4984  O  O      . ALA A 1 328 ? -41.336  65.939  -22.205 1.00 58.07  ? 1290 ALA A O      1 
ATOM   4985  C  CB     . ALA A 1 328 ? -41.825  68.885  -21.622 1.00 55.53  ? 1290 ALA A CB     1 
ATOM   4986  H  H      . ALA A 1 328 ? -44.171  68.725  -20.997 1.00 66.57  ? 1290 ALA A H      1 
ATOM   4987  H  HA     . ALA A 1 328 ? -42.816  67.823  -23.063 1.00 68.73  ? 1290 ALA A HA     1 
ATOM   4988  H  HB1    . ALA A 1 328 ? -40.939  68.668  -21.952 1.00 66.64  ? 1290 ALA A HB1    1 
ATOM   4989  H  HB2    . ALA A 1 328 ? -42.107  69.745  -21.969 1.00 66.64  ? 1290 ALA A HB2    1 
ATOM   4990  H  HB3    . ALA A 1 328 ? -41.821  68.904  -20.652 1.00 66.64  ? 1290 ALA A HB3    1 
ATOM   4991  N  N      . GLY A 1 329 ? -42.968  65.826  -20.663 1.00 57.58  ? 1291 GLY A N      1 
ATOM   4992  C  CA     . GLY A 1 329 ? -42.530  64.538  -20.164 1.00 59.13  ? 1291 GLY A CA     1 
ATOM   4993  C  C      . GLY A 1 329 ? -43.240  63.343  -20.768 1.00 60.13  ? 1291 GLY A C      1 
ATOM   4994  O  O      . GLY A 1 329 ? -42.808  62.203  -20.572 1.00 64.57  ? 1291 GLY A O      1 
ATOM   4995  H  H      . GLY A 1 329 ? -43.666  66.138  -20.270 1.00 69.10  ? 1291 GLY A H      1 
ATOM   4996  H  HA2    . GLY A 1 329 ? -41.581  64.439  -20.336 1.00 70.96  ? 1291 GLY A HA2    1 
ATOM   4997  H  HA3    . GLY A 1 329 ? -42.665  64.511  -19.203 1.00 70.96  ? 1291 GLY A HA3    1 
ATOM   4998  N  N      . LEU A 1 330 ? -44.325  63.573  -21.502 1.00 53.79  ? 1292 LEU A N      1 
ATOM   4999  C  CA     . LEU A 1 330 ? -45.127  62.464  -22.001 1.00 52.15  ? 1292 LEU A CA     1 
ATOM   5000  C  C      . LEU A 1 330 ? -44.365  61.676  -23.062 1.00 48.83  ? 1292 LEU A C      1 
ATOM   5001  O  O      . LEU A 1 330 ? -43.811  62.251  -24.004 1.00 50.37  ? 1292 LEU A O      1 
ATOM   5002  C  CB     . LEU A 1 330 ? -46.445  62.974  -22.580 1.00 50.63  ? 1292 LEU A CB     1 
ATOM   5003  C  CG     . LEU A 1 330 ? -47.396  63.684  -21.614 1.00 52.28  ? 1292 LEU A CG     1 
ATOM   5004  C  CD1    . LEU A 1 330 ? -48.671  64.062  -22.356 1.00 48.16  ? 1292 LEU A CD1    1 
ATOM   5005  C  CD2    . LEU A 1 330 ? -47.701  62.844  -20.370 1.00 50.27  ? 1292 LEU A CD2    1 
ATOM   5006  H  H      . LEU A 1 330 ? -44.614  64.353  -21.723 1.00 64.55  ? 1292 LEU A H      1 
ATOM   5007  H  HA     . LEU A 1 330 ? -45.332  61.863  -21.267 1.00 62.58  ? 1292 LEU A HA     1 
ATOM   5008  H  HB2    . LEU A 1 330 ? -46.240  63.601  -23.292 1.00 60.75  ? 1292 LEU A HB2    1 
ATOM   5009  H  HB3    . LEU A 1 330 ? -46.926  62.217  -22.950 1.00 60.75  ? 1292 LEU A HB3    1 
ATOM   5010  H  HG     . LEU A 1 330 ? -46.976  64.506  -21.316 1.00 62.73  ? 1292 LEU A HG     1 
ATOM   5011  H  HD11   . LEU A 1 330 ? -49.272  64.512  -21.741 1.00 57.79  ? 1292 LEU A HD11   1 
ATOM   5012  H  HD12   . LEU A 1 330 ? -48.445  64.654  -23.091 1.00 57.79  ? 1292 LEU A HD12   1 
ATOM   5013  H  HD13   . LEU A 1 330 ? -49.089  63.255  -22.697 1.00 57.79  ? 1292 LEU A HD13   1 
ATOM   5014  H  HD21   . LEU A 1 330 ? -48.304  63.340  -19.795 1.00 60.33  ? 1292 LEU A HD21   1 
ATOM   5015  H  HD22   . LEU A 1 330 ? -48.114  62.011  -20.646 1.00 60.33  ? 1292 LEU A HD22   1 
ATOM   5016  H  HD23   . LEU A 1 330 ? -46.871  62.662  -19.901 1.00 60.33  ? 1292 LEU A HD23   1 
ATOM   5017  N  N      . SER A 1 331 ? -44.347  60.356  -22.909 1.00 42.34  ? 1293 SER A N      1 
ATOM   5018  C  CA     . SER A 1 331 ? -43.837  59.480  -23.945 1.00 45.71  ? 1293 SER A CA     1 
ATOM   5019  C  C      . SER A 1 331 ? -44.892  59.290  -25.030 1.00 48.86  ? 1293 SER A C      1 
ATOM   5020  O  O      . SER A 1 331 ? -46.044  59.714  -24.897 1.00 49.46  ? 1293 SER A O      1 
ATOM   5021  C  CB     . SER A 1 331 ? -43.452  58.122  -23.364 1.00 45.62  ? 1293 SER A CB     1 
ATOM   5022  O  OG     . SER A 1 331 ? -44.615  57.400  -22.995 1.00 44.30  ? 1293 SER A OG     1 
ATOM   5023  H  H      . SER A 1 331 ? -44.628  59.945  -22.208 1.00 50.81  ? 1293 SER A H      1 
ATOM   5024  H  HA     . SER A 1 331 ? -43.049  59.878  -24.347 1.00 54.86  ? 1293 SER A HA     1 
ATOM   5025  H  HB2    . SER A 1 331 ? -42.963  57.617  -24.033 1.00 54.74  ? 1293 SER A HB2    1 
ATOM   5026  H  HB3    . SER A 1 331 ? -42.899  58.258  -22.578 1.00 54.74  ? 1293 SER A HB3    1 
ATOM   5027  H  HG     . SER A 1 331 ? -44.400  56.653  -22.675 1.00 53.16  ? 1293 SER A HG     1 
ATOM   5028  N  N      . ARG A 1 332 ? -44.491  58.619  -26.111 1.00 62.11  ? 1294 ARG A N      1 
ATOM   5029  C  CA     . ARG A 1 332 ? -45.437  58.309  -27.176 1.00 64.75  ? 1294 ARG A CA     1 
ATOM   5030  C  C      . ARG A 1 332 ? -46.543  57.392  -26.668 1.00 57.64  ? 1294 ARG A C      1 
ATOM   5031  O  O      . ARG A 1 332 ? -47.731  57.645  -26.899 1.00 52.27  ? 1294 ARG A O      1 
ATOM   5032  C  CB     . ARG A 1 332 ? -44.703  57.675  -28.359 1.00 72.47  ? 1294 ARG A CB     1 
ATOM   5033  C  CG     . ARG A 1 332 ? -43.703  58.602  -29.040 1.00 82.49  ? 1294 ARG A CG     1 
ATOM   5034  C  CD     . ARG A 1 332 ? -42.857  57.856  -30.069 1.00 92.29  ? 1294 ARG A CD     1 
ATOM   5035  N  NE     . ARG A 1 332 ? -42.062  56.793  -29.454 1.00 99.22  ? 1294 ARG A NE     1 
ATOM   5036  C  CZ     . ARG A 1 332 ? -40.811  56.932  -29.021 1.00 106.29 ? 1294 ARG A CZ     1 
ATOM   5037  N  NH1    . ARG A 1 332 ? -40.179  58.093  -29.134 1.00 109.92 1 1294 ARG A NH1    1 
ATOM   5038  N  NH2    . ARG A 1 332 ? -40.184  55.899  -28.474 1.00 108.99 ? 1294 ARG A NH2    1 
ATOM   5039  H  H      . ARG A 1 332 ? -43.690  58.337  -26.247 1.00 74.53  ? 1294 ARG A H      1 
ATOM   5040  H  HA     . ARG A 1 332 ? -45.847  59.133  -27.484 1.00 77.70  ? 1294 ARG A HA     1 
ATOM   5041  H  HB2    . ARG A 1 332 ? -44.217  56.897  -28.043 1.00 86.96  ? 1294 ARG A HB2    1 
ATOM   5042  H  HB3    . ARG A 1 332 ? -45.356  57.405  -29.023 1.00 86.96  ? 1294 ARG A HB3    1 
ATOM   5043  H  HG2    . ARG A 1 332 ? -44.184  59.309  -29.498 1.00 98.98  ? 1294 ARG A HG2    1 
ATOM   5044  H  HG3    . ARG A 1 332 ? -43.109  58.977  -28.372 1.00 98.98  ? 1294 ARG A HG3    1 
ATOM   5045  H  HD2    . ARG A 1 332 ? -43.440  57.453  -30.731 1.00 110.75 ? 1294 ARG A HD2    1 
ATOM   5046  H  HD3    . ARG A 1 332 ? -42.249  58.480  -30.495 1.00 110.75 ? 1294 ARG A HD3    1 
ATOM   5047  H  HE     . ARG A 1 332 ? -42.431  56.021  -29.366 1.00 119.06 ? 1294 ARG A HE     1 
ATOM   5048  H  HH11   . ARG A 1 332 ? -40.580  58.767  -29.487 1.00 131.91 ? 1294 ARG A HH11   1 
ATOM   5049  H  HH12   . ARG A 1 332 ? -39.371  58.172  -28.852 1.00 131.91 ? 1294 ARG A HH12   1 
ATOM   5050  H  HH21   . ARG A 1 332 ? -40.586  55.142  -28.398 1.00 130.79 ? 1294 ARG A HH21   1 
ATOM   5051  H  HH22   . ARG A 1 332 ? -39.375  55.985  -28.195 1.00 130.79 ? 1294 ARG A HH22   1 
ATOM   5052  N  N      . LYS A 1 333 ? -46.169  56.322  -25.960 1.00 58.08  ? 1295 LYS A N      1 
ATOM   5053  C  CA     . LYS A 1 333 ? -47.165  55.389  -25.443 1.00 56.95  ? 1295 LYS A CA     1 
ATOM   5054  C  C      . LYS A 1 333 ? -48.175  56.098  -24.551 1.00 54.65  ? 1295 LYS A C      1 
ATOM   5055  O  O      . LYS A 1 333 ? -49.388  55.904  -24.691 1.00 51.35  ? 1295 LYS A O      1 
ATOM   5056  C  CB     . LYS A 1 333 ? -46.486  54.255  -24.677 1.00 60.48  ? 1295 LYS A CB     1 
ATOM   5057  C  CG     . LYS A 1 333 ? -45.724  53.281  -25.555 1.00 69.03  ? 1295 LYS A CG     1 
ATOM   5058  C  CD     . LYS A 1 333 ? -45.121  52.137  -24.748 1.00 74.39  ? 1295 LYS A CD     1 
ATOM   5059  C  CE     . LYS A 1 333 ? -46.201  51.241  -24.150 1.00 72.88  ? 1295 LYS A CE     1 
ATOM   5060  N  NZ     . LYS A 1 333 ? -45.634  50.008  -23.533 1.00 76.64  1 1295 LYS A NZ     1 
ATOM   5061  H  H      . LYS A 1 333 ? -45.355  56.119  -25.769 1.00 69.70  ? 1295 LYS A H      1 
ATOM   5062  H  HA     . LYS A 1 333 ? -47.647  54.999  -26.189 1.00 68.34  ? 1295 LYS A HA     1 
ATOM   5063  H  HB2    . LYS A 1 333 ? -45.856  54.638  -24.046 1.00 72.58  ? 1295 LYS A HB2    1 
ATOM   5064  H  HB3    . LYS A 1 333 ? -47.164  53.753  -24.198 1.00 72.58  ? 1295 LYS A HB3    1 
ATOM   5065  H  HG2    . LYS A 1 333 ? -46.330  52.902  -26.211 1.00 82.84  ? 1295 LYS A HG2    1 
ATOM   5066  H  HG3    . LYS A 1 333 ? -45.002  53.752  -26.000 1.00 82.84  ? 1295 LYS A HG3    1 
ATOM   5067  H  HD2    . LYS A 1 333 ? -44.563  51.596  -25.328 1.00 89.26  ? 1295 LYS A HD2    1 
ATOM   5068  H  HD3    . LYS A 1 333 ? -44.593  52.503  -24.021 1.00 89.26  ? 1295 LYS A HD3    1 
ATOM   5069  H  HE2    . LYS A 1 333 ? -46.676  51.732  -23.461 1.00 87.46  ? 1295 LYS A HE2    1 
ATOM   5070  H  HE3    . LYS A 1 333 ? -46.815  50.972  -24.852 1.00 87.46  ? 1295 LYS A HE3    1 
ATOM   5071  H  HZ1    . LYS A 1 333 ? -46.288  49.509  -23.195 1.00 91.97  ? 1295 LYS A HZ1    1 
ATOM   5072  H  HZ2    . LYS A 1 333 ? -45.196  49.534  -24.147 1.00 91.97  ? 1295 LYS A HZ2    1 
ATOM   5073  H  HZ3    . LYS A 1 333 ? -45.070  50.227  -22.880 1.00 91.97  ? 1295 LYS A HZ3    1 
ATOM   5074  N  N      . MET A 1 334 ? -47.693  56.920  -23.615 1.00 55.34  ? 1296 MET A N      1 
ATOM   5075  C  CA     . MET A 1 334 ? -48.604  57.606  -22.705 1.00 52.34  ? 1296 MET A CA     1 
ATOM   5076  C  C      . MET A 1 334 ? -49.525  58.557  -23.457 1.00 48.53  ? 1296 MET A C      1 
ATOM   5077  O  O      . MET A 1 334 ? -50.699  58.709  -23.101 1.00 46.71  ? 1296 MET A O      1 
ATOM   5078  C  CB     . MET A 1 334 ? -47.811  58.365  -21.639 1.00 51.52  ? 1296 MET A CB     1 
ATOM   5079  C  CG     . MET A 1 334 ? -48.678  59.035  -20.592 1.00 50.61  ? 1296 MET A CG     1 
ATOM   5080  S  SD     . MET A 1 334 ? -49.638  57.841  -19.640 1.00 50.51  ? 1296 MET A SD     1 
ATOM   5081  C  CE     . MET A 1 334 ? -48.362  57.166  -18.579 1.00 50.51  ? 1296 MET A CE     1 
ATOM   5082  H  H      . MET A 1 334 ? -46.860  57.093  -23.490 1.00 66.41  ? 1296 MET A H      1 
ATOM   5083  H  HA     . MET A 1 334 ? -49.148  56.943  -22.251 1.00 62.80  ? 1296 MET A HA     1 
ATOM   5084  H  HB2    . MET A 1 334 ? -47.224  57.742  -21.184 1.00 61.82  ? 1296 MET A HB2    1 
ATOM   5085  H  HB3    . MET A 1 334 ? -47.285  59.055  -22.074 1.00 61.82  ? 1296 MET A HB3    1 
ATOM   5086  H  HG2    . MET A 1 334 ? -48.111  59.526  -19.976 1.00 60.73  ? 1296 MET A HG2    1 
ATOM   5087  H  HG3    . MET A 1 334 ? -49.297  59.640  -21.030 1.00 60.73  ? 1296 MET A HG3    1 
ATOM   5088  H  HE1    . MET A 1 334 ? -48.755  56.493  -18.001 1.00 60.62  ? 1296 MET A HE1    1 
ATOM   5089  H  HE2    . MET A 1 334 ? -47.672  56.765  -19.132 1.00 60.62  ? 1296 MET A HE2    1 
ATOM   5090  H  HE3    . MET A 1 334 ? -47.985  57.882  -18.045 1.00 60.62  ? 1296 MET A HE3    1 
ATOM   5091  N  N      . THR A 1 335 ? -49.016  59.201  -24.509 1.00 51.23  ? 1297 THR A N      1 
ATOM   5092  C  CA     . THR A 1 335 ? -49.864  60.086  -25.300 1.00 51.68  ? 1297 THR A CA     1 
ATOM   5093  C  C      . THR A 1 335 ? -50.983  59.306  -25.977 1.00 48.75  ? 1297 THR A C      1 
ATOM   5094  O  O      . THR A 1 335 ? -52.137  59.749  -25.993 1.00 44.26  ? 1297 THR A O      1 
ATOM   5095  C  CB     . THR A 1 335 ? -49.022  60.839  -26.331 1.00 54.01  ? 1297 THR A CB     1 
ATOM   5096  O  OG1    . THR A 1 335 ? -47.974  61.554  -25.664 1.00 53.33  ? 1297 THR A OG1    1 
ATOM   5097  C  CG2    . THR A 1 335 ? -49.877  61.830  -27.108 1.00 54.40  ? 1297 THR A CG2    1 
ATOM   5098  H  H      . THR A 1 335 ? -48.202  59.143  -24.779 1.00 61.48  ? 1297 THR A H      1 
ATOM   5099  H  HA     . THR A 1 335 ? -50.270  60.741  -24.711 1.00 62.02  ? 1297 THR A HA     1 
ATOM   5100  H  HB     . THR A 1 335 ? -48.636  60.207  -26.958 1.00 64.81  ? 1297 THR A HB     1 
ATOM   5101  H  HG1    . THR A 1 335 ? -47.482  61.017  -25.245 1.00 64.00  ? 1297 THR A HG1    1 
ATOM   5102  H  HG21   . THR A 1 335 ? -49.332  62.301  -27.758 1.00 65.28  ? 1297 THR A HG21   1 
ATOM   5103  H  HG22   . THR A 1 335 ? -50.588  61.362  -27.573 1.00 65.28  ? 1297 THR A HG22   1 
ATOM   5104  H  HG23   . THR A 1 335 ? -50.271  62.476  -26.500 1.00 65.28  ? 1297 THR A HG23   1 
ATOM   5105  N  N      . ASN A 1 336 ? -50.665  58.136  -26.539 1.00 54.10  ? 1298 ASN A N      1 
ATOM   5106  C  CA     . ASN A 1 336 ? -51.704  57.296  -27.126 1.00 56.64  ? 1298 ASN A CA     1 
ATOM   5107  C  C      . ASN A 1 336 ? -52.712  56.847  -26.076 1.00 52.70  ? 1298 ASN A C      1 
ATOM   5108  O  O      . ASN A 1 336 ? -53.924  56.875  -26.317 1.00 51.09  ? 1298 ASN A O      1 
ATOM   5109  C  CB     . ASN A 1 336 ? -51.075  56.082  -27.808 1.00 60.41  ? 1298 ASN A CB     1 
ATOM   5110  C  CG     . ASN A 1 336 ? -50.343  56.446  -29.075 1.00 66.75  ? 1298 ASN A CG     1 
ATOM   5111  O  OD1    . ASN A 1 336 ? -50.606  57.487  -29.678 1.00 68.26  ? 1298 ASN A OD1    1 
ATOM   5112  N  ND2    . ASN A 1 336 ? -49.416  55.591  -29.491 1.00 72.56  ? 1298 ASN A ND2    1 
ATOM   5113  H  H      . ASN A 1 336 ? -49.870  57.814  -26.591 1.00 64.92  ? 1298 ASN A H      1 
ATOM   5114  H  HA     . ASN A 1 336 ? -52.180  57.806  -27.801 1.00 67.97  ? 1298 ASN A HA     1 
ATOM   5115  H  HB2    . ASN A 1 336 ? -50.439  55.672  -27.201 1.00 72.49  ? 1298 ASN A HB2    1 
ATOM   5116  H  HB3    . ASN A 1 336 ? -51.774  55.449  -28.036 1.00 72.49  ? 1298 ASN A HB3    1 
ATOM   5117  H  HD21   . ASN A 1 336 ? -48.971  55.754  -30.208 1.00 87.07  ? 1298 ASN A HD21   1 
ATOM   5118  H  HD22   . ASN A 1 336 ? -49.261  54.874  -29.042 1.00 87.07  ? 1298 ASN A HD22   1 
ATOM   5119  N  N      . PHE A 1 337 ? -52.231  56.429  -24.903 1.00 51.95  ? 1299 PHE A N      1 
ATOM   5120  C  CA     . PHE A 1 337 ? -53.132  55.976  -23.847 1.00 48.11  ? 1299 PHE A CA     1 
ATOM   5121  C  C      . PHE A 1 337 ? -54.075  57.091  -23.418 1.00 46.90  ? 1299 PHE A C      1 
ATOM   5122  O  O      . PHE A 1 337 ? -55.277  56.864  -23.229 1.00 44.34  ? 1299 PHE A O      1 
ATOM   5123  C  CB     . PHE A 1 337 ? -52.319  55.469  -22.658 1.00 46.80  ? 1299 PHE A CB     1 
ATOM   5124  C  CG     . PHE A 1 337 ? -53.141  54.795  -21.600 1.00 47.77  ? 1299 PHE A CG     1 
ATOM   5125  C  CD1    . PHE A 1 337 ? -53.456  53.450  -21.698 1.00 45.99  ? 1299 PHE A CD1    1 
ATOM   5126  C  CD2    . PHE A 1 337 ? -53.587  55.506  -20.495 1.00 45.30  ? 1299 PHE A CD2    1 
ATOM   5127  C  CE1    . PHE A 1 337 ? -54.211  52.826  -20.719 1.00 46.89  ? 1299 PHE A CE1    1 
ATOM   5128  C  CE2    . PHE A 1 337 ? -54.341  54.888  -19.511 1.00 44.16  ? 1299 PHE A CE2    1 
ATOM   5129  C  CZ     . PHE A 1 337 ? -54.653  53.547  -19.623 1.00 46.33  ? 1299 PHE A CZ     1 
ATOM   5130  H  H      . PHE A 1 337 ? -51.396  56.400  -24.697 1.00 62.34  ? 1299 PHE A H      1 
ATOM   5131  H  HA     . PHE A 1 337 ? -53.668  55.240  -24.182 1.00 57.73  ? 1299 PHE A HA     1 
ATOM   5132  H  HB2    . PHE A 1 337 ? -51.666  54.827  -22.978 1.00 56.16  ? 1299 PHE A HB2    1 
ATOM   5133  H  HB3    . PHE A 1 337 ? -51.866  56.221  -22.246 1.00 56.16  ? 1299 PHE A HB3    1 
ATOM   5134  H  HD1    . PHE A 1 337 ? -53.162  52.962  -22.432 1.00 55.18  ? 1299 PHE A HD1    1 
ATOM   5135  H  HD2    . PHE A 1 337 ? -53.380  56.409  -20.416 1.00 54.35  ? 1299 PHE A HD2    1 
ATOM   5136  H  HE1    . PHE A 1 337 ? -54.419  51.923  -20.796 1.00 56.27  ? 1299 PHE A HE1    1 
ATOM   5137  H  HE2    . PHE A 1 337 ? -54.637  55.376  -18.776 1.00 52.99  ? 1299 PHE A HE2    1 
ATOM   5138  H  HZ     . PHE A 1 337 ? -55.160  53.130  -18.964 1.00 55.60  ? 1299 PHE A HZ     1 
ATOM   5139  N  N      . ILE A 1 338 ? -53.550  58.308  -23.277 1.00 45.21  ? 1300 ILE A N      1 
ATOM   5140  C  CA     . ILE A 1 338 ? -54.380  59.441  -22.879 1.00 44.53  ? 1300 ILE A CA     1 
ATOM   5141  C  C      . ILE A 1 338 ? -55.434  59.721  -23.943 1.00 47.94  ? 1300 ILE A C      1 
ATOM   5142  O  O      . ILE A 1 338 ? -56.620  59.895  -23.635 1.00 45.01  ? 1300 ILE A O      1 
ATOM   5143  C  CB     . ILE A 1 338 ? -53.496  60.673  -22.608 1.00 44.90  ? 1300 ILE A CB     1 
ATOM   5144  C  CG1    . ILE A 1 338 ? -52.654  60.436  -21.353 1.00 47.94  ? 1300 ILE A CG1    1 
ATOM   5145  C  CG2    . ILE A 1 338 ? -54.341  61.937  -22.450 1.00 44.05  ? 1300 ILE A CG2    1 
ATOM   5146  C  CD1    . ILE A 1 338 ? -51.545  61.443  -21.148 1.00 51.65  ? 1300 ILE A CD1    1 
ATOM   5147  H  H      . ILE A 1 338 ? -52.721  58.502  -23.404 1.00 54.25  ? 1300 ILE A H      1 
ATOM   5148  H  HA     . ILE A 1 338 ? -54.840  59.218  -22.055 1.00 53.44  ? 1300 ILE A HA     1 
ATOM   5149  H  HB     . ILE A 1 338 ? -52.898  60.795  -23.362 1.00 53.88  ? 1300 ILE A HB     1 
ATOM   5150  H  HG12   . ILE A 1 338 ? -53.235  60.476  -20.577 1.00 57.53  ? 1300 ILE A HG12   1 
ATOM   5151  H  HG13   . ILE A 1 338 ? -52.248  59.558  -21.412 1.00 57.53  ? 1300 ILE A HG13   1 
ATOM   5152  H  HG21   . ILE A 1 338 ? -53.753  62.690  -22.281 1.00 52.86  ? 1300 ILE A HG21   1 
ATOM   5153  H  HG22   . ILE A 1 338 ? -54.843  62.085  -23.266 1.00 52.86  ? 1300 ILE A HG22   1 
ATOM   5154  H  HG23   . ILE A 1 338 ? -54.949  61.818  -21.704 1.00 52.86  ? 1300 ILE A HG23   1 
ATOM   5155  H  HD11   . ILE A 1 338 ? -51.064  61.221  -20.335 1.00 61.98  ? 1300 ILE A HD11   1 
ATOM   5156  H  HD12   . ILE A 1 338 ? -50.944  61.409  -21.908 1.00 61.98  ? 1300 ILE A HD12   1 
ATOM   5157  H  HD13   . ILE A 1 338 ? -51.933  62.329  -21.071 1.00 61.98  ? 1300 ILE A HD13   1 
ATOM   5158  N  N      . MET A 1 339 ? -55.020  59.766  -25.213 1.00 50.05  ? 1301 MET A N      1 
ATOM   5159  C  CA     . MET A 1 339 ? -55.959  60.086  -26.283 1.00 53.13  ? 1301 MET A CA     1 
ATOM   5160  C  C      . MET A 1 339 ? -57.050  59.027  -26.397 1.00 51.89  ? 1301 MET A C      1 
ATOM   5161  O  O      . MET A 1 339 ? -58.215  59.353  -26.652 1.00 49.35  ? 1301 MET A O      1 
ATOM   5162  C  CB     . MET A 1 339 ? -55.215  60.232  -27.613 1.00 57.21  ? 1301 MET A CB     1 
ATOM   5163  C  CG     . MET A 1 339 ? -54.294  61.449  -27.698 1.00 60.84  ? 1301 MET A CG     1 
ATOM   5164  S  SD     . MET A 1 339 ? -55.117  63.024  -27.357 1.00 65.04  ? 1301 MET A SD     1 
ATOM   5165  C  CE     . MET A 1 339 ? -56.438  62.989  -28.572 1.00 61.58  ? 1301 MET A CE     1 
ATOM   5166  H  H      . MET A 1 339 ? -54.214  59.618  -25.474 1.00 60.06  ? 1301 MET A H      1 
ATOM   5167  H  HA     . MET A 1 339 ? -56.376  60.939  -26.085 1.00 63.76  ? 1301 MET A HA     1 
ATOM   5168  H  HB2    . MET A 1 339 ? -54.670  59.441  -27.751 1.00 68.65  ? 1301 MET A HB2    1 
ATOM   5169  H  HB3    . MET A 1 339 ? -55.868  60.306  -28.327 1.00 68.65  ? 1301 MET A HB3    1 
ATOM   5170  H  HG2    . MET A 1 339 ? -53.578  61.344  -27.053 1.00 73.01  ? 1301 MET A HG2    1 
ATOM   5171  H  HG3    . MET A 1 339 ? -53.924  61.497  -28.594 1.00 73.01  ? 1301 MET A HG3    1 
ATOM   5172  H  HE1    . MET A 1 339 ? -56.964  63.800  -28.489 1.00 73.89  ? 1301 MET A HE1    1 
ATOM   5173  H  HE2    . MET A 1 339 ? -56.049  62.936  -29.459 1.00 73.89  ? 1301 MET A HE2    1 
ATOM   5174  H  HE3    . MET A 1 339 ? -56.997  62.214  -28.408 1.00 73.89  ? 1301 MET A HE3    1 
ATOM   5175  N  N      . LYS A 1 340 ? -56.695  57.753  -26.210 1.00 53.36  ? 1302 LYS A N      1 
ATOM   5176  C  CA     . LYS A 1 340 ? -57.704  56.700  -26.243 1.00 53.02  ? 1302 LYS A CA     1 
ATOM   5177  C  C      . LYS A 1 340 ? -58.704  56.867  -25.106 1.00 51.90  ? 1302 LYS A C      1 
ATOM   5178  O  O      . LYS A 1 340 ? -59.900  56.597  -25.276 1.00 47.14  ? 1302 LYS A O      1 
ATOM   5179  C  CB     . LYS A 1 340 ? -57.043  55.322  -26.184 1.00 55.43  ? 1302 LYS A CB     1 
ATOM   5180  C  CG     . LYS A 1 340 ? -56.374  54.890  -27.490 1.00 64.30  ? 1302 LYS A CG     1 
ATOM   5181  C  CD     . LYS A 1 340 ? -55.578  53.605  -27.306 1.00 67.75  ? 1302 LYS A CD     1 
ATOM   5182  C  CE     . LYS A 1 340 ? -54.875  53.177  -28.582 1.00 69.95  ? 1302 LYS A CE     1 
ATOM   5183  N  NZ     . LYS A 1 340 ? -55.833  52.740  -29.639 1.00 75.70  1 1302 LYS A NZ     1 
ATOM   5184  H  H      . LYS A 1 340 ? -55.892  57.480  -26.064 1.00 64.03  ? 1302 LYS A H      1 
ATOM   5185  H  HA     . LYS A 1 340 ? -58.192  56.760  -27.079 1.00 63.62  ? 1302 LYS A HA     1 
ATOM   5186  H  HB2    . LYS A 1 340 ? -56.362  55.332  -25.493 1.00 66.51  ? 1302 LYS A HB2    1 
ATOM   5187  H  HB3    . LYS A 1 340 ? -57.719  54.661  -25.967 1.00 66.51  ? 1302 LYS A HB3    1 
ATOM   5188  H  HG2    . LYS A 1 340 ? -57.055  54.733  -28.163 1.00 77.16  ? 1302 LYS A HG2    1 
ATOM   5189  H  HG3    . LYS A 1 340 ? -55.765  55.586  -27.784 1.00 77.16  ? 1302 LYS A HG3    1 
ATOM   5190  H  HD2    . LYS A 1 340 ? -54.905  53.743  -26.621 1.00 81.30  ? 1302 LYS A HD2    1 
ATOM   5191  H  HD3    . LYS A 1 340 ? -56.182  52.893  -27.040 1.00 81.30  ? 1302 LYS A HD3    1 
ATOM   5192  H  HE2    . LYS A 1 340 ? -54.364  53.924  -28.928 1.00 83.94  ? 1302 LYS A HE2    1 
ATOM   5193  H  HE3    . LYS A 1 340 ? -54.284  52.433  -28.384 1.00 83.94  ? 1302 LYS A HE3    1 
ATOM   5194  H  HZ1    . LYS A 1 340 ? -55.388  52.496  -30.371 1.00 90.83  ? 1302 LYS A HZ1    1 
ATOM   5195  H  HZ2    . LYS A 1 340 ? -56.312  52.048  -29.348 1.00 90.83  ? 1302 LYS A HZ2    1 
ATOM   5196  H  HZ3    . LYS A 1 340 ? -56.384  53.408  -29.844 1.00 90.83  ? 1302 LYS A HZ3    1 
ATOM   5197  N  N      . ALA A 1 341 ? -58.235  57.306  -23.935 1.00 47.63  ? 1303 ALA A N      1 
ATOM   5198  C  CA     . ALA A 1 341 ? -59.148  57.566  -22.828 1.00 46.74  ? 1303 ALA A CA     1 
ATOM   5199  C  C      . ALA A 1 341 ? -60.164  58.638  -23.207 1.00 44.03  ? 1303 ALA A C      1 
ATOM   5200  O  O      . ALA A 1 341 ? -61.367  58.481  -22.973 1.00 41.86  ? 1303 ALA A O      1 
ATOM   5201  C  CB     . ALA A 1 341 ? -58.363  57.979  -21.581 1.00 45.46  ? 1303 ALA A CB     1 
ATOM   5202  H  H      . ALA A 1 341 ? -57.406  57.458  -23.761 1.00 57.16  ? 1303 ALA A H      1 
ATOM   5203  H  HA     . ALA A 1 341 ? -59.634  56.752  -22.621 1.00 56.09  ? 1303 ALA A HA     1 
ATOM   5204  H  HB1    . ALA A 1 341 ? -58.986  58.147  -20.857 1.00 54.56  ? 1303 ALA A HB1    1 
ATOM   5205  H  HB2    . ALA A 1 341 ? -57.758  57.260  -21.338 1.00 54.56  ? 1303 ALA A HB2    1 
ATOM   5206  H  HB3    . ALA A 1 341 ? -57.859  58.784  -21.778 1.00 54.56  ? 1303 ALA A HB3    1 
ATOM   5207  N  N      . PHE A 1 342 ? -59.697  59.736  -23.805 1.00 42.32  ? 1304 PHE A N      1 
ATOM   5208  C  CA     . PHE A 1 342 ? -60.614  60.803  -24.193 1.00 45.92  ? 1304 PHE A CA     1 
ATOM   5209  C  C      . PHE A 1 342 ? -61.573  60.341  -25.286 1.00 49.51  ? 1304 PHE A C      1 
ATOM   5210  O  O      . PHE A 1 342 ? -62.757  60.698  -25.271 1.00 50.12  ? 1304 PHE A O      1 
ATOM   5211  C  CB     . PHE A 1 342 ? -59.824  62.028  -24.649 1.00 45.83  ? 1304 PHE A CB     1 
ATOM   5212  C  CG     . PHE A 1 342 ? -59.337  62.882  -23.521 1.00 50.62  ? 1304 PHE A CG     1 
ATOM   5213  C  CD1    . PHE A 1 342 ? -58.141  62.599  -22.887 1.00 52.98  ? 1304 PHE A CD1    1 
ATOM   5214  C  CD2    . PHE A 1 342 ? -60.081  63.964  -23.083 1.00 52.86  ? 1304 PHE A CD2    1 
ATOM   5215  C  CE1    . PHE A 1 342 ? -57.692  63.382  -21.839 1.00 52.50  ? 1304 PHE A CE1    1 
ATOM   5216  C  CE2    . PHE A 1 342 ? -59.637  64.751  -22.037 1.00 54.15  ? 1304 PHE A CE2    1 
ATOM   5217  C  CZ     . PHE A 1 342 ? -58.441  64.459  -21.415 1.00 52.39  ? 1304 PHE A CZ     1 
ATOM   5218  H  H      . PHE A 1 342 ? -58.871  59.883  -23.993 1.00 50.78  ? 1304 PHE A H      1 
ATOM   5219  H  HA     . PHE A 1 342 ? -61.143  61.059  -23.422 1.00 55.11  ? 1304 PHE A HA     1 
ATOM   5220  H  HB2    . PHE A 1 342 ? -59.050  61.732  -25.153 1.00 55.00  ? 1304 PHE A HB2    1 
ATOM   5221  H  HB3    . PHE A 1 342 ? -60.393  62.576  -25.212 1.00 55.00  ? 1304 PHE A HB3    1 
ATOM   5222  H  HD1    . PHE A 1 342 ? -57.632  61.873  -23.169 1.00 63.58  ? 1304 PHE A HD1    1 
ATOM   5223  H  HD2    . PHE A 1 342 ? -60.888  64.165  -23.498 1.00 63.43  ? 1304 PHE A HD2    1 
ATOM   5224  H  HE1    . PHE A 1 342 ? -56.885  63.184  -21.422 1.00 63.00  ? 1304 PHE A HE1    1 
ATOM   5225  H  HE2    . PHE A 1 342 ? -60.145  65.477  -21.753 1.00 64.97  ? 1304 PHE A HE2    1 
ATOM   5226  H  HZ     . PHE A 1 342 ? -58.140  64.988  -20.711 1.00 62.86  ? 1304 PHE A HZ     1 
ATOM   5227  N  N      . ILE A 1 343 ? -61.088  59.538  -26.237 1.00 45.76  ? 1305 ILE A N      1 
ATOM   5228  C  CA     . ILE A 1 343 ? -61.968  59.008  -27.276 1.00 45.29  ? 1305 ILE A CA     1 
ATOM   5229  C  C      . ILE A 1 343 ? -63.041  58.126  -26.654 1.00 45.76  ? 1305 ILE A C      1 
ATOM   5230  O  O      . ILE A 1 343 ? -64.230  58.244  -26.971 1.00 45.24  ? 1305 ILE A O      1 
ATOM   5231  C  CB     . ILE A 1 343 ? -61.151  58.241  -28.334 1.00 43.41  ? 1305 ILE A CB     1 
ATOM   5232  C  CG1    . ILE A 1 343 ? -60.248  59.200  -29.112 1.00 42.43  ? 1305 ILE A CG1    1 
ATOM   5233  C  CG2    . ILE A 1 343 ? -62.073  57.495  -29.300 1.00 46.42  ? 1305 ILE A CG2    1 
ATOM   5234  C  CD1    . ILE A 1 343 ? -59.219  58.499  -29.984 1.00 44.58  ? 1305 ILE A CD1    1 
ATOM   5235  H  H      . ILE A 1 343 ? -60.268  59.289  -26.300 1.00 54.91  ? 1305 ILE A H      1 
ATOM   5236  H  HA     . ILE A 1 343 ? -62.410  59.748  -27.720 1.00 54.34  ? 1305 ILE A HA     1 
ATOM   5237  H  HB     . ILE A 1 343 ? -60.592  57.592  -27.879 1.00 52.09  ? 1305 ILE A HB     1 
ATOM   5238  H  HG12   . ILE A 1 343 ? -60.800  59.751  -29.689 1.00 50.91  ? 1305 ILE A HG12   1 
ATOM   5239  H  HG13   . ILE A 1 343 ? -59.770  59.760  -28.481 1.00 50.91  ? 1305 ILE A HG13   1 
ATOM   5240  H  HG21   . ILE A 1 343 ? -61.531  57.023  -29.952 1.00 55.71  ? 1305 ILE A HG21   1 
ATOM   5241  H  HG22   . ILE A 1 343 ? -62.611  56.863  -28.798 1.00 55.71  ? 1305 ILE A HG22   1 
ATOM   5242  H  HG23   . ILE A 1 343 ? -62.646  58.136  -29.748 1.00 55.71  ? 1305 ILE A HG23   1 
ATOM   5243  H  HD11   . ILE A 1 343 ? -58.687  59.168  -30.443 1.00 53.49  ? 1305 ILE A HD11   1 
ATOM   5244  H  HD12   . ILE A 1 343 ? -58.649  57.952  -29.421 1.00 53.49  ? 1305 ILE A HD12   1 
ATOM   5245  H  HD13   . ILE A 1 343 ? -59.681  57.942  -30.630 1.00 53.49  ? 1305 ILE A HD13   1 
ATOM   5246  N  N      . ASN A 1 344 ? -62.638  57.233  -25.749 1.00 48.65  ? 1306 ASN A N      1 
ATOM   5247  C  CA     . ASN A 1 344 ? -63.611  56.382  -25.075 1.00 50.79  ? 1306 ASN A CA     1 
ATOM   5248  C  C      . ASN A 1 344 ? -64.562  57.211  -24.221 1.00 44.62  ? 1306 ASN A C      1 
ATOM   5249  O  O      . ASN A 1 344 ? -65.757  56.906  -24.134 1.00 43.82  ? 1306 ASN A O      1 
ATOM   5250  C  CB     . ASN A 1 344 ? -62.894  55.333  -24.229 1.00 51.90  ? 1306 ASN A CB     1 
ATOM   5251  C  CG     . ASN A 1 344 ? -62.195  54.291  -25.073 1.00 51.78  ? 1306 ASN A CG     1 
ATOM   5252  O  OD1    . ASN A 1 344 ? -62.576  54.050  -26.215 1.00 53.91  ? 1306 ASN A OD1    1 
ATOM   5253  N  ND2    . ASN A 1 344 ? -61.172  53.660  -24.511 1.00 54.09  ? 1306 ASN A ND2    1 
ATOM   5254  H  H      . ASN A 1 344 ? -61.821  57.103  -25.512 1.00 58.38  ? 1306 ASN A H      1 
ATOM   5255  H  HA     . ASN A 1 344 ? -64.139  55.918  -25.743 1.00 60.94  ? 1306 ASN A HA     1 
ATOM   5256  H  HB2    . ASN A 1 344 ? -62.227  55.772  -23.678 1.00 62.28  ? 1306 ASN A HB2    1 
ATOM   5257  H  HB3    . ASN A 1 344 ? -63.543  54.880  -23.668 1.00 62.28  ? 1306 ASN A HB3    1 
ATOM   5258  H  HD21   . ASN A 1 344 ? -60.743  53.059  -24.952 1.00 64.91  ? 1306 ASN A HD21   1 
ATOM   5259  H  HD22   . ASN A 1 344 ? -60.937  53.851  -23.706 1.00 64.91  ? 1306 ASN A HD22   1 
ATOM   5260  N  N      . GLY A 1 345 ? -64.049  58.258  -23.573 1.00 46.56  ? 1307 GLY A N      1 
ATOM   5261  C  CA     . GLY A 1 345 ? -64.923  59.159  -22.839 1.00 50.45  ? 1307 GLY A CA     1 
ATOM   5262  C  C      . GLY A 1 345 ? -65.950  59.817  -23.741 1.00 49.35  ? 1307 GLY A C      1 
ATOM   5263  O  O      . GLY A 1 345 ? -67.122  59.942  -23.378 1.00 48.31  ? 1307 GLY A O      1 
ATOM   5264  H  H      . GLY A 1 345 ? -63.214  58.462  -23.546 1.00 55.88  ? 1307 GLY A H      1 
ATOM   5265  H  HA2    . GLY A 1 345 ? -65.391  58.665  -22.148 1.00 60.55  ? 1307 GLY A HA2    1 
ATOM   5266  H  HA3    . GLY A 1 345 ? -64.393  59.853  -22.417 1.00 60.55  ? 1307 GLY A HA3    1 
ATOM   5267  N  N      . ARG A 1 346 ? -65.520  60.244  -24.931 1.00 47.88  ? 1308 ARG A N      1 
ATOM   5268  C  CA     . ARG A 1 346 ? -66.448  60.801  -25.908 1.00 46.52  ? 1308 ARG A CA     1 
ATOM   5269  C  C      . ARG A 1 346 ? -67.569  59.816  -26.217 1.00 47.83  ? 1308 ARG A C      1 
ATOM   5270  O  O      . ARG A 1 346 ? -68.730  60.212  -26.378 1.00 49.38  ? 1308 ARG A O      1 
ATOM   5271  C  CB     . ARG A 1 346 ? -65.690  61.173  -27.184 1.00 45.57  ? 1308 ARG A CB     1 
ATOM   5272  C  CG     . ARG A 1 346 ? -66.565  61.588  -28.357 1.00 42.94  ? 1308 ARG A CG     1 
ATOM   5273  C  CD     . ARG A 1 346 ? -65.727  61.847  -29.592 1.00 43.97  ? 1308 ARG A CD     1 
ATOM   5274  N  NE     . ARG A 1 346 ? -66.558  62.183  -30.742 1.00 41.97  ? 1308 ARG A NE     1 
ATOM   5275  C  CZ     . ARG A 1 346 ? -67.111  61.294  -31.560 1.00 45.03  ? 1308 ARG A CZ     1 
ATOM   5276  N  NH1    . ARG A 1 346 ? -66.928  59.995  -31.375 1.00 47.06  1 1308 ARG A NH1    1 
ATOM   5277  N  NH2    . ARG A 1 346 ? -67.856  61.709  -32.571 1.00 45.97  ? 1308 ARG A NH2    1 
ATOM   5278  H  H      . ARG A 1 346 ? -64.701  60.221  -25.192 1.00 57.46  ? 1308 ARG A H      1 
ATOM   5279  H  HA     . ARG A 1 346 ? -66.846  61.608  -25.546 1.00 55.83  ? 1308 ARG A HA     1 
ATOM   5280  H  HB2    . ARG A 1 346 ? -65.098  61.915  -26.985 1.00 54.69  ? 1308 ARG A HB2    1 
ATOM   5281  H  HB3    . ARG A 1 346 ? -65.167  60.407  -27.467 1.00 54.69  ? 1308 ARG A HB3    1 
ATOM   5282  H  HG2    . ARG A 1 346 ? -67.193  60.876  -28.557 1.00 51.53  ? 1308 ARG A HG2    1 
ATOM   5283  H  HG3    . ARG A 1 346 ? -67.040  62.403  -28.132 1.00 51.53  ? 1308 ARG A HG3    1 
ATOM   5284  H  HD2    . ARG A 1 346 ? -65.129  62.592  -29.422 1.00 52.76  ? 1308 ARG A HD2    1 
ATOM   5285  H  HD3    . ARG A 1 346 ? -65.218  61.050  -29.807 1.00 52.76  ? 1308 ARG A HD3    1 
ATOM   5286  H  HE     . ARG A 1 346 ? -66.700  63.016  -30.902 1.00 50.36  ? 1308 ARG A HE     1 
ATOM   5287  H  HH11   . ARG A 1 346 ? -66.446  59.718  -30.718 1.00 56.47  ? 1308 ARG A HH11   1 
ATOM   5288  H  HH12   . ARG A 1 346 ? -67.290  59.428  -31.911 1.00 56.47  ? 1308 ARG A HH12   1 
ATOM   5289  H  HH21   . ARG A 1 346 ? -67.978  62.550  -32.698 1.00 55.17  ? 1308 ARG A HH21   1 
ATOM   5290  H  HH22   . ARG A 1 346 ? -68.213  61.137  -33.105 1.00 55.17  ? 1308 ARG A HH22   1 
ATOM   5291  N  N      . ARG A 1 347 ? -67.239  58.526  -26.310 1.00 41.35  ? 1309 ARG A N      1 
ATOM   5292  C  CA     . ARG A 1 347 ? -68.250  57.524  -26.629 1.00 43.81  ? 1309 ARG A CA     1 
ATOM   5293  C  C      . ARG A 1 347 ? -69.204  57.300  -25.458 1.00 47.60  ? 1309 ARG A C      1 
ATOM   5294  O  O      . ARG A 1 347 ? -70.422  57.220  -25.653 1.00 44.46  ? 1309 ARG A O      1 
ATOM   5295  C  CB     . ARG A 1 347 ? -67.570  56.213  -27.029 1.00 49.04  ? 1309 ARG A CB     1 
ATOM   5296  C  CG     . ARG A 1 347 ? -68.524  55.187  -27.617 1.00 57.99  ? 1309 ARG A CG     1 
ATOM   5297  C  CD     . ARG A 1 347 ? -67.834  53.887  -28.016 1.00 63.01  ? 1309 ARG A CD     1 
ATOM   5298  N  NE     . ARG A 1 347 ? -67.080  53.293  -26.916 1.00 68.51  ? 1309 ARG A NE     1 
ATOM   5299  C  CZ     . ARG A 1 347 ? -65.754  53.344  -26.789 1.00 72.49  ? 1309 ARG A CZ     1 
ATOM   5300  N  NH1    . ARG A 1 347 ? -65.005  53.951  -27.703 1.00 71.25  1 1309 ARG A NH1    1 
ATOM   5301  N  NH2    . ARG A 1 347 ? -65.172  52.774  -25.741 1.00 73.96  ? 1309 ARG A NH2    1 
ATOM   5302  H  H      . ARG A 1 347 ? -66.447  58.211  -26.196 1.00 49.62  ? 1309 ARG A H      1 
ATOM   5303  H  HA     . ARG A 1 347 ? -68.772  57.833  -27.385 1.00 52.57  ? 1309 ARG A HA     1 
ATOM   5304  H  HB2    . ARG A 1 347 ? -66.891  56.403  -27.695 1.00 58.85  ? 1309 ARG A HB2    1 
ATOM   5305  H  HB3    . ARG A 1 347 ? -67.159  55.820  -26.243 1.00 58.85  ? 1309 ARG A HB3    1 
ATOM   5306  H  HG2    . ARG A 1 347 ? -69.203  54.974  -26.958 1.00 69.59  ? 1309 ARG A HG2    1 
ATOM   5307  H  HG3    . ARG A 1 347 ? -68.938  55.561  -28.410 1.00 69.59  ? 1309 ARG A HG3    1 
ATOM   5308  H  HD2    . ARG A 1 347 ? -68.505  53.247  -28.301 1.00 75.62  ? 1309 ARG A HD2    1 
ATOM   5309  H  HD3    . ARG A 1 347 ? -67.217  54.067  -28.742 1.00 75.62  ? 1309 ARG A HD3    1 
ATOM   5310  H  HE     . ARG A 1 347 ? -67.523  52.881  -26.305 1.00 82.21  ? 1309 ARG A HE     1 
ATOM   5311  H  HH11   . ARG A 1 347 ? -65.375  54.324  -28.383 1.00 85.50  ? 1309 ARG A HH11   1 
ATOM   5312  H  HH12   . ARG A 1 347 ? -64.150  53.975  -27.611 1.00 85.50  ? 1309 ARG A HH12   1 
ATOM   5313  H  HH21   . ARG A 1 347 ? -65.650  52.376  -25.147 1.00 88.75  ? 1309 ARG A HH21   1 
ATOM   5314  H  HH22   . ARG A 1 347 ? -64.317  52.800  -25.658 1.00 88.75  ? 1309 ARG A HH22   1 
ATOM   5315  N  N      . VAL A 1 348 ? -68.671  57.214  -24.234 1.00 42.76  ? 1310 VAL A N      1 
ATOM   5316  C  CA     . VAL A 1 348 ? -69.502  56.890  -23.077 1.00 45.71  ? 1310 VAL A CA     1 
ATOM   5317  C  C      . VAL A 1 348 ? -70.434  58.047  -22.736 1.00 46.11  ? 1310 VAL A C      1 
ATOM   5318  O  O      . VAL A 1 348 ? -71.608  57.836  -22.413 1.00 46.46  ? 1310 VAL A O      1 
ATOM   5319  C  CB     . VAL A 1 348 ? -68.617  56.497  -21.879 1.00 49.21  ? 1310 VAL A CB     1 
ATOM   5320  C  CG1    . VAL A 1 348 ? -69.467  56.190  -20.657 1.00 49.07  ? 1310 VAL A CG1    1 
ATOM   5321  C  CG2    . VAL A 1 348 ? -67.770  55.282  -22.227 1.00 51.88  ? 1310 VAL A CG2    1 
ATOM   5322  H  H      . VAL A 1 348 ? -67.840  57.339  -24.052 1.00 51.32  ? 1310 VAL A H      1 
ATOM   5323  H  HA     . VAL A 1 348 ? -70.054  56.124  -23.297 1.00 54.86  ? 1310 VAL A HA     1 
ATOM   5324  H  HB     . VAL A 1 348 ? -68.022  57.232  -21.662 1.00 59.05  ? 1310 VAL A HB     1 
ATOM   5325  H  HG11   . VAL A 1 348 ? -68.885  55.947  -19.920 1.00 58.89  ? 1310 VAL A HG11   1 
ATOM   5326  H  HG12   . VAL A 1 348 ? -69.982  56.979  -20.425 1.00 58.89  ? 1310 VAL A HG12   1 
ATOM   5327  H  HG13   . VAL A 1 348 ? -70.064  55.454  -20.865 1.00 58.89  ? 1310 VAL A HG13   1 
ATOM   5328  H  HG21   . VAL A 1 348 ? -67.221  55.050  -21.462 1.00 62.26  ? 1310 VAL A HG21   1 
ATOM   5329  H  HG22   . VAL A 1 348 ? -68.357  54.542  -22.450 1.00 62.26  ? 1310 VAL A HG22   1 
ATOM   5330  H  HG23   . VAL A 1 348 ? -67.206  55.498  -22.986 1.00 62.26  ? 1310 VAL A HG23   1 
ATOM   5331  N  N      . PHE A 1 349 ? -69.929  59.279  -22.776 1.00 45.39  ? 1311 PHE A N      1 
ATOM   5332  C  CA     . PHE A 1 349 ? -70.754  60.434  -22.445 1.00 46.24  ? 1311 PHE A CA     1 
ATOM   5333  C  C      . PHE A 1 349 ? -71.603  60.926  -23.610 1.00 47.44  ? 1311 PHE A C      1 
ATOM   5334  O  O      . PHE A 1 349 ? -72.542  61.695  -23.380 1.00 49.56  ? 1311 PHE A O      1 
ATOM   5335  C  CB     . PHE A 1 349 ? -69.871  61.583  -21.945 1.00 46.64  ? 1311 PHE A CB     1 
ATOM   5336  C  CG     . PHE A 1 349 ? -69.305  61.363  -20.571 1.00 43.21  ? 1311 PHE A CG     1 
ATOM   5337  C  CD1    . PHE A 1 349 ? -70.016  61.753  -19.447 1.00 47.92  ? 1311 PHE A CD1    1 
ATOM   5338  C  CD2    . PHE A 1 349 ? -68.071  60.760  -20.400 1.00 41.95  ? 1311 PHE A CD2    1 
ATOM   5339  C  CE1    . PHE A 1 349 ? -69.505  61.555  -18.173 1.00 43.50  ? 1311 PHE A CE1    1 
ATOM   5340  C  CE2    . PHE A 1 349 ? -67.552  60.555  -19.128 1.00 45.62  ? 1311 PHE A CE2    1 
ATOM   5341  C  CZ     . PHE A 1 349 ? -68.272  60.955  -18.013 1.00 42.64  ? 1311 PHE A CZ     1 
ATOM   5342  H  H      . PHE A 1 349 ? -69.119  59.470  -22.990 1.00 54.46  ? 1311 PHE A H      1 
ATOM   5343  H  HA     . PHE A 1 349 ? -71.355  60.189  -21.724 1.00 55.49  ? 1311 PHE A HA     1 
ATOM   5344  H  HB2    . PHE A 1 349 ? -69.127  61.695  -22.557 1.00 55.97  ? 1311 PHE A HB2    1 
ATOM   5345  H  HB3    . PHE A 1 349 ? -70.401  62.396  -21.920 1.00 55.97  ? 1311 PHE A HB3    1 
ATOM   5346  H  HD1    . PHE A 1 349 ? -70.847  62.160  -19.548 1.00 57.50  ? 1311 PHE A HD1    1 
ATOM   5347  H  HD2    . PHE A 1 349 ? -67.584  60.491  -21.145 1.00 50.34  ? 1311 PHE A HD2    1 
ATOM   5348  H  HE1    . PHE A 1 349 ? -69.992  61.824  -17.428 1.00 52.20  ? 1311 PHE A HE1    1 
ATOM   5349  H  HE2    . PHE A 1 349 ? -66.721  60.151  -19.024 1.00 54.75  ? 1311 PHE A HE2    1 
ATOM   5350  H  HZ     . PHE A 1 349 ? -67.926  60.819  -17.161 1.00 51.17  ? 1311 PHE A HZ     1 
ATOM   5351  N  N      . GLY A 1 350 ? -71.318  60.503  -24.840 1.00 49.51  ? 1312 GLY A N      1 
ATOM   5352  C  CA     . GLY A 1 350 ? -72.036  61.033  -25.984 1.00 47.06  ? 1312 GLY A CA     1 
ATOM   5353  C  C      . GLY A 1 350 ? -73.048  60.081  -26.588 1.00 51.09  ? 1312 GLY A C      1 
ATOM   5354  O  O      . GLY A 1 350 ? -73.957  60.516  -27.302 1.00 52.04  ? 1312 GLY A O      1 
ATOM   5355  H  H      . GLY A 1 350 ? -70.720  59.916  -25.033 1.00 59.41  ? 1312 GLY A H      1 
ATOM   5356  H  HA2    . GLY A 1 350 ? -72.505  61.839  -25.716 1.00 56.47  ? 1312 GLY A HA2    1 
ATOM   5357  H  HA3    . GLY A 1 350 ? -71.398  61.271  -26.674 1.00 56.47  ? 1312 GLY A HA3    1 
ATOM   5358  N  N      . ILE A 1 351 ? -72.912  58.789  -26.317 1.00 55.62  ? 1313 ILE A N      1 
ATOM   5359  C  CA     . ILE A 1 351 ? -73.752  57.763  -26.918 1.00 59.08  ? 1313 ILE A CA     1 
ATOM   5360  C  C      . ILE A 1 351 ? -74.586  57.093  -25.830 1.00 60.81  ? 1313 ILE A C      1 
ATOM   5361  O  O      . ILE A 1 351 ? -74.100  56.221  -25.110 1.00 62.13  ? 1313 ILE A O      1 
ATOM   5362  C  CB     . ILE A 1 351 ? -72.911  56.727  -27.686 1.00 59.86  ? 1313 ILE A CB     1 
ATOM   5363  C  CG1    . ILE A 1 351 ? -72.152  57.431  -28.813 1.00 58.03  ? 1313 ILE A CG1    1 
ATOM   5364  C  CG2    . ILE A 1 351 ? -73.807  55.614  -28.222 1.00 61.37  ? 1313 ILE A CG2    1 
ATOM   5365  C  CD1    . ILE A 1 351 ? -71.424  56.515  -29.766 1.00 60.59  ? 1313 ILE A CD1    1 
ATOM   5366  H  H      . ILE A 1 351 ? -72.325  58.475  -25.773 1.00 66.75  ? 1313 ILE A H      1 
ATOM   5367  H  HA     . ILE A 1 351 ? -74.360  58.182  -27.548 1.00 70.90  ? 1313 ILE A HA     1 
ATOM   5368  H  HB     . ILE A 1 351 ? -72.266  56.338  -27.075 1.00 71.83  ? 1313 ILE A HB     1 
ATOM   5369  H  HG12   . ILE A 1 351 ? -72.785  57.950  -29.333 1.00 69.64  ? 1313 ILE A HG12   1 
ATOM   5370  H  HG13   . ILE A 1 351 ? -71.493  58.024  -28.418 1.00 69.64  ? 1313 ILE A HG13   1 
ATOM   5371  H  HG21   . ILE A 1 351 ? -73.260  54.972  -28.702 1.00 73.65  ? 1313 ILE A HG21   1 
ATOM   5372  H  HG22   . ILE A 1 351 ? -74.251  55.179  -27.477 1.00 73.65  ? 1313 ILE A HG22   1 
ATOM   5373  H  HG23   . ILE A 1 351 ? -74.466  56.000  -28.821 1.00 73.65  ? 1313 ILE A HG23   1 
ATOM   5374  H  HD11   . ILE A 1 351 ? -70.977  57.051  -30.439 1.00 72.71  ? 1313 ILE A HD11   1 
ATOM   5375  H  HD12   . ILE A 1 351 ? -70.772  55.996  -29.268 1.00 72.71  ? 1313 ILE A HD12   1 
ATOM   5376  H  HD13   . ILE A 1 351 ? -72.067  55.923  -30.186 1.00 72.71  ? 1313 ILE A HD13   1 
ATOM   5377  N  N      . PRO A 1 352 ? -75.864  57.455  -25.700 1.00 60.53  ? 1314 PRO A N      1 
ATOM   5378  C  CA     . PRO A 1 352 ? -76.730  56.760  -24.739 1.00 61.89  ? 1314 PRO A CA     1 
ATOM   5379  C  C      . PRO A 1 352 ? -76.829  55.281  -25.090 1.00 66.24  ? 1314 PRO A C      1 
ATOM   5380  O  O      . PRO A 1 352 ? -76.804  54.897  -26.261 1.00 70.35  ? 1314 PRO A O      1 
ATOM   5381  C  CB     . PRO A 1 352 ? -78.077  57.474  -24.884 1.00 63.39  ? 1314 PRO A CB     1 
ATOM   5382  C  CG     . PRO A 1 352 ? -77.726  58.825  -25.388 1.00 63.55  ? 1314 PRO A CG     1 
ATOM   5383  C  CD     . PRO A 1 352 ? -76.539  58.626  -26.288 1.00 60.13  ? 1314 PRO A CD     1 
ATOM   5384  H  HA     . PRO A 1 352 ? -76.396  56.864  -23.834 1.00 74.27  ? 1314 PRO A HA     1 
ATOM   5385  H  HB2    . PRO A 1 352 ? -78.633  57.001  -25.522 1.00 76.07  ? 1314 PRO A HB2    1 
ATOM   5386  H  HB3    . PRO A 1 352 ? -78.514  57.531  -24.020 1.00 76.07  ? 1314 PRO A HB3    1 
ATOM   5387  H  HG2    . PRO A 1 352 ? -78.474  59.192  -25.885 1.00 76.27  ? 1314 PRO A HG2    1 
ATOM   5388  H  HG3    . PRO A 1 352 ? -77.495  59.401  -24.642 1.00 76.27  ? 1314 PRO A HG3    1 
ATOM   5389  H  HD2    . PRO A 1 352 ? -76.830  58.430  -27.193 1.00 72.16  ? 1314 PRO A HD2    1 
ATOM   5390  H  HD3    . PRO A 1 352 ? -75.958  59.402  -26.259 1.00 72.16  ? 1314 PRO A HD3    1 
ATOM   5391  N  N      . VAL A 1 353 ? -76.929  54.443  -24.058 1.00 72.27  ? 1315 VAL A N      1 
ATOM   5392  C  CA     . VAL A 1 353 ? -76.970  52.996  -24.231 1.00 76.03  ? 1315 VAL A CA     1 
ATOM   5393  C  C      . VAL A 1 353 ? -78.310  52.439  -23.764 1.00 83.82  ? 1315 VAL A C      1 
ATOM   5394  O  O      . VAL A 1 353 ? -78.983  53.005  -22.896 1.00 85.37  ? 1315 VAL A O      1 
ATOM   5395  C  CB     . VAL A 1 353 ? -75.807  52.335  -23.455 1.00 75.35  ? 1315 VAL A CB     1 
ATOM   5396  C  CG1    . VAL A 1 353 ? -75.848  50.816  -23.566 1.00 78.75  ? 1315 VAL A CG1    1 
ATOM   5397  C  CG2    . VAL A 1 353 ? -74.474  52.869  -23.952 1.00 70.96  ? 1315 VAL A CG2    1 
ATOM   5398  H  H      . VAL A 1 353 ? -76.974  54.695  -23.237 1.00 86.72  ? 1315 VAL A H      1 
ATOM   5399  H  HA     . VAL A 1 353 ? -76.866  52.784  -25.172 1.00 91.24  ? 1315 VAL A HA     1 
ATOM   5400  H  HB     . VAL A 1 353 ? -75.887  52.565  -22.516 1.00 90.41  ? 1315 VAL A HB     1 
ATOM   5401  H  HG11   . VAL A 1 353 ? -75.104  50.443  -23.067 1.00 94.50  ? 1315 VAL A HG11   1 
ATOM   5402  H  HG12   . VAL A 1 353 ? -76.687  50.495  -23.198 1.00 94.50  ? 1315 VAL A HG12   1 
ATOM   5403  H  HG13   . VAL A 1 353 ? -75.779  50.566  -24.500 1.00 94.50  ? 1315 VAL A HG13   1 
ATOM   5404  H  HG21   . VAL A 1 353 ? -73.758  52.443  -23.454 1.00 85.15  ? 1315 VAL A HG21   1 
ATOM   5405  H  HG22   . VAL A 1 353 ? -74.386  52.667  -24.897 1.00 85.15  ? 1315 VAL A HG22   1 
ATOM   5406  H  HG23   . VAL A 1 353 ? -74.447  53.828  -23.814 1.00 85.15  ? 1315 VAL A HG23   1 
ATOM   5407  N  N      . LYS A 1 354 ? -78.699  51.319  -24.375 1.00 89.78  ? 1316 LYS A N      1 
ATOM   5408  C  CA     . LYS A 1 354 ? -79.907  50.606  -23.983 1.00 96.79  ? 1316 LYS A CA     1 
ATOM   5409  C  C      . LYS A 1 354 ? -79.821  50.178  -22.522 1.00 99.80  ? 1316 LYS A C      1 
ATOM   5410  O  O      . LYS A 1 354 ? -78.744  49.876  -21.999 1.00 98.47  ? 1316 LYS A O      1 
ATOM   5411  C  CB     . LYS A 1 354 ? -80.109  49.382  -24.885 1.00 98.92  ? 1316 LYS A CB     1 
ATOM   5412  C  CG     . LYS A 1 354 ? -81.296  48.495  -24.516 1.00 104.46 ? 1316 LYS A CG     1 
ATOM   5413  C  CD     . LYS A 1 354 ? -81.504  47.380  -25.540 1.00 107.50 ? 1316 LYS A CD     1 
ATOM   5414  C  CE     . LYS A 1 354 ? -82.599  46.409  -25.106 1.00 112.98 ? 1316 LYS A CE     1 
ATOM   5415  N  NZ     . LYS A 1 354 ? -82.887  45.371  -26.139 1.00 116.12 1 1316 LYS A NZ     1 
ATOM   5416  H  H      . LYS A 1 354 ? -78.273  50.951  -25.025 1.00 107.74 ? 1316 LYS A H      1 
ATOM   5417  H  HA     . LYS A 1 354 ? -80.673  51.191  -24.086 1.00 116.15 ? 1316 LYS A HA     1 
ATOM   5418  H  HB2    . LYS A 1 354 ? -80.244  49.688  -25.795 1.00 118.70 ? 1316 LYS A HB2    1 
ATOM   5419  H  HB3    . LYS A 1 354 ? -79.310  48.833  -24.843 1.00 118.70 ? 1316 LYS A HB3    1 
ATOM   5420  H  HG2    . LYS A 1 354 ? -81.133  48.086  -23.651 1.00 125.35 ? 1316 LYS A HG2    1 
ATOM   5421  H  HG3    . LYS A 1 354 ? -82.101  49.035  -24.486 1.00 125.35 ? 1316 LYS A HG3    1 
ATOM   5422  H  HD2    . LYS A 1 354 ? -81.765  47.772  -26.389 1.00 129.01 ? 1316 LYS A HD2    1 
ATOM   5423  H  HD3    . LYS A 1 354 ? -80.679  46.881  -25.641 1.00 129.01 ? 1316 LYS A HD3    1 
ATOM   5424  H  HE2    . LYS A 1 354 ? -82.317  45.957  -24.295 1.00 135.57 ? 1316 LYS A HE2    1 
ATOM   5425  H  HE3    . LYS A 1 354 ? -83.416  46.905  -24.943 1.00 135.57 ? 1316 LYS A HE3    1 
ATOM   5426  H  HZ1    . LYS A 1 354 ? -83.528  44.825  -25.850 1.00 139.34 ? 1316 LYS A HZ1    1 
ATOM   5427  H  HZ2    . LYS A 1 354 ? -83.155  45.759  -26.893 1.00 139.34 ? 1316 LYS A HZ2    1 
ATOM   5428  H  HZ3    . LYS A 1 354 ? -82.154  44.894  -26.303 1.00 139.34 ? 1316 LYS A HZ3    1 
ATOM   5429  N  N      . GLY A 1 355 ? -80.975  50.155  -21.860 1.00 102.60 ? 1317 GLY A N      1 
ATOM   5430  C  CA     . GLY A 1 355 ? -81.036  49.823  -20.453 1.00 104.59 ? 1317 GLY A CA     1 
ATOM   5431  C  C      . GLY A 1 355 ? -80.597  50.930  -19.522 1.00 102.08 ? 1317 GLY A C      1 
ATOM   5432  O  O      . GLY A 1 355 ? -80.666  50.749  -18.298 1.00 101.43 ? 1317 GLY A O      1 
ATOM   5433  H  H      . GLY A 1 355 ? -81.740  50.330  -22.212 1.00 123.12 ? 1317 GLY A H      1 
ATOM   5434  H  HA2    . GLY A 1 355 ? -81.948  49.585  -20.226 1.00 125.51 ? 1317 GLY A HA2    1 
ATOM   5435  H  HA3    . GLY A 1 355 ? -80.473  49.051  -20.287 1.00 125.51 ? 1317 GLY A HA3    1 
ATOM   5436  N  N      . PHE A 1 356 ? -80.150  52.064  -20.053 1.00 98.94  ? 1318 PHE A N      1 
ATOM   5437  C  CA     . PHE A 1 356 ? -79.731  53.190  -19.228 1.00 95.41  ? 1318 PHE A CA     1 
ATOM   5438  C  C      . PHE A 1 356 ? -80.884  54.187  -19.097 1.00 96.22  ? 1318 PHE A C      1 
ATOM   5439  O  O      . PHE A 1 356 ? -81.595  54.432  -20.068 1.00 98.37  ? 1318 PHE A O      1 
ATOM   5440  C  CB     . PHE A 1 356 ? -78.498  53.870  -19.834 1.00 89.44  ? 1318 PHE A CB     1 
ATOM   5441  C  CG     . PHE A 1 356 ? -77.869  54.896  -18.937 1.00 86.43  ? 1318 PHE A CG     1 
ATOM   5442  C  CD1    . PHE A 1 356 ? -76.926  54.525  -17.992 1.00 82.08  ? 1318 PHE A CD1    1 
ATOM   5443  C  CD2    . PHE A 1 356 ? -78.220  56.232  -19.035 1.00 86.29  ? 1318 PHE A CD2    1 
ATOM   5444  C  CE1    . PHE A 1 356 ? -76.348  55.466  -17.164 1.00 79.38  ? 1318 PHE A CE1    1 
ATOM   5445  C  CE2    . PHE A 1 356 ? -77.643  57.176  -18.206 1.00 83.22  ? 1318 PHE A CE2    1 
ATOM   5446  C  CZ     . PHE A 1 356 ? -76.706  56.791  -17.271 1.00 79.28  ? 1318 PHE A CZ     1 
ATOM   5447  H  H      . PHE A 1 356 ? -80.079  52.207  -20.898 1.00 118.73 ? 1318 PHE A H      1 
ATOM   5448  H  HA     . PHE A 1 356 ? -79.500  52.872  -18.341 1.00 114.50 ? 1318 PHE A HA     1 
ATOM   5449  H  HB2    . PHE A 1 356 ? -77.830  53.193  -20.024 1.00 107.33 ? 1318 PHE A HB2    1 
ATOM   5450  H  HB3    . PHE A 1 356 ? -78.759  54.314  -20.656 1.00 107.33 ? 1318 PHE A HB3    1 
ATOM   5451  H  HD1    . PHE A 1 356 ? -76.680  53.631  -17.915 1.00 98.50  ? 1318 PHE A HD1    1 
ATOM   5452  H  HD2    . PHE A 1 356 ? -78.852  56.497  -19.663 1.00 103.54 ? 1318 PHE A HD2    1 
ATOM   5453  H  HE1    . PHE A 1 356 ? -75.716  55.204  -16.534 1.00 95.25  ? 1318 PHE A HE1    1 
ATOM   5454  H  HE2    . PHE A 1 356 ? -77.886  58.071  -18.280 1.00 99.87  ? 1318 PHE A HE2    1 
ATOM   5455  H  HZ     . PHE A 1 356 ? -76.316  57.426  -16.714 1.00 95.13  ? 1318 PHE A HZ     1 
ATOM   5456  N  N      . PRO A 1 357 ? -81.080  54.769  -17.900 1.00 94.54  ? 1319 PRO A N      1 
ATOM   5457  C  CA     . PRO A 1 357 ? -80.350  54.594  -16.639 1.00 90.25  ? 1319 PRO A CA     1 
ATOM   5458  C  C      . PRO A 1 357 ? -80.998  53.610  -15.668 1.00 89.38  ? 1319 PRO A C      1 
ATOM   5459  O  O      . PRO A 1 357 ? -80.513  53.468  -14.547 1.00 92.00  ? 1319 PRO A O      1 
ATOM   5460  C  CB     . PRO A 1 357 ? -80.371  56.000  -16.049 1.00 90.07  ? 1319 PRO A CB     1 
ATOM   5461  C  CG     . PRO A 1 357 ? -81.710  56.533  -16.471 1.00 94.63  ? 1319 PRO A CG     1 
ATOM   5462  C  CD     . PRO A 1 357 ? -82.036  55.888  -17.807 1.00 95.65  ? 1319 PRO A CD     1 
ATOM   5463  H  HA     . PRO A 1 357 ? -79.433  54.327  -16.810 1.00 108.30 ? 1319 PRO A HA     1 
ATOM   5464  H  HB2    . PRO A 1 357 ? -80.303  55.956  -15.083 1.00 108.09 ? 1319 PRO A HB2    1 
ATOM   5465  H  HB3    . PRO A 1 357 ? -79.651  56.529  -16.427 1.00 108.09 ? 1319 PRO A HB3    1 
ATOM   5466  H  HG2    . PRO A 1 357 ? -82.376  56.292  -15.808 1.00 113.56 ? 1319 PRO A HG2    1 
ATOM   5467  H  HG3    . PRO A 1 357 ? -81.658  57.497  -16.564 1.00 113.56 ? 1319 PRO A HG3    1 
ATOM   5468  H  HD2    . PRO A 1 357 ? -82.947  55.555  -17.807 1.00 114.78 ? 1319 PRO A HD2    1 
ATOM   5469  H  HD3    . PRO A 1 357 ? -81.889  56.518  -18.530 1.00 114.78 ? 1319 PRO A HD3    1 
ATOM   5470  N  N      . LYS A 1 358 ? -82.070  52.937  -16.089 1.00 88.90  ? 1320 LYS A N      1 
ATOM   5471  C  CA     . LYS A 1 358 ? -82.875  52.155  -15.158 1.00 92.40  ? 1320 LYS A CA     1 
ATOM   5472  C  C      . LYS A 1 358 ? -82.215  50.847  -14.736 1.00 90.98  ? 1320 LYS A C      1 
ATOM   5473  O  O      . LYS A 1 358 ? -82.616  50.273  -13.717 1.00 89.96  ? 1320 LYS A O      1 
ATOM   5474  C  CB     . LYS A 1 358 ? -84.247  51.860  -15.771 1.00 99.62  ? 1320 LYS A CB     1 
ATOM   5475  C  CG     . LYS A 1 358 ? -84.974  53.093  -16.304 1.00 104.62 ? 1320 LYS A CG     1 
ATOM   5476  C  CD     . LYS A 1 358 ? -84.872  54.281  -15.350 1.00 105.48 ? 1320 LYS A CD     1 
ATOM   5477  C  CE     . LYS A 1 358 ? -85.827  55.402  -15.743 1.00 109.64 ? 1320 LYS A CE     1 
ATOM   5478  N  NZ     . LYS A 1 358 ? -85.674  55.815  -17.168 1.00 108.22 1 1320 LYS A NZ     1 
ATOM   5479  H  H      . LYS A 1 358 ? -82.349  52.918  -16.902 1.00 106.68 ? 1320 LYS A H      1 
ATOM   5480  H  HA     . LYS A 1 358 ? -83.019  52.682  -14.356 1.00 110.88 ? 1320 LYS A HA     1 
ATOM   5481  H  HB2    . LYS A 1 358 ? -84.131  51.243  -16.510 1.00 119.54 ? 1320 LYS A HB2    1 
ATOM   5482  H  HB3    . LYS A 1 358 ? -84.810  51.456  -15.093 1.00 119.54 ? 1320 LYS A HB3    1 
ATOM   5483  H  HG2    . LYS A 1 358 ? -84.580  53.352  -17.152 1.00 125.54 ? 1320 LYS A HG2    1 
ATOM   5484  H  HG3    . LYS A 1 358 ? -85.913  52.881  -16.423 1.00 125.54 ? 1320 LYS A HG3    1 
ATOM   5485  H  HD2    . LYS A 1 358 ? -85.098  53.990  -14.453 1.00 126.58 ? 1320 LYS A HD2    1 
ATOM   5486  H  HD3    . LYS A 1 358 ? -83.968  54.631  -15.371 1.00 126.58 ? 1320 LYS A HD3    1 
ATOM   5487  H  HE2    . LYS A 1 358 ? -86.740  55.100  -15.614 1.00 131.57 ? 1320 LYS A HE2    1 
ATOM   5488  H  HE3    . LYS A 1 358 ? -85.652  56.177  -15.185 1.00 131.57 ? 1320 LYS A HE3    1 
ATOM   5489  H  HZ1    . LYS A 1 358 ? -84.845  56.105  -17.314 1.00 129.86 ? 1320 LYS A HZ1    1 
ATOM   5490  H  HZ2    . LYS A 1 358 ? -85.837  55.124  -17.704 1.00 129.86 ? 1320 LYS A HZ2    1 
ATOM   5491  H  HZ3    . LYS A 1 358 ? -86.247  56.470  -17.358 1.00 129.86 ? 1320 LYS A HZ3    1 
ATOM   5492  N  N      . ASP A 1 359 ? -81.224  50.363  -15.479 1.00 93.32  ? 1321 ASP A N      1 
ATOM   5493  C  CA     . ASP A 1 359 ? -80.513  49.144  -15.111 1.00 95.19  ? 1321 ASP A CA     1 
ATOM   5494  C  C      . ASP A 1 359 ? -79.256  49.409  -14.291 1.00 92.01  ? 1321 ASP A C      1 
ATOM   5495  O  O      . ASP A 1 359 ? -78.529  48.460  -13.980 1.00 90.84  ? 1321 ASP A O      1 
ATOM   5496  C  CB     . ASP A 1 359 ? -80.133  48.351  -16.367 1.00 95.91  ? 1321 ASP A CB     1 
ATOM   5497  C  CG     . ASP A 1 359 ? -81.341  47.808  -17.106 1.00 102.17 ? 1321 ASP A CG     1 
ATOM   5498  O  OD1    . ASP A 1 359 ? -82.425  47.708  -16.493 1.00 106.72 ? 1321 ASP A OD1    1 
ATOM   5499  O  OD2    . ASP A 1 359 ? -81.200  47.472  -18.300 1.00 101.88 1 1321 ASP A OD2    1 
ATOM   5500  H  H      . ASP A 1 359 ? -80.942  50.726  -16.206 1.00 111.98 ? 1321 ASP A H      1 
ATOM   5501  H  HA     . ASP A 1 359 ? -81.103  48.589  -14.577 1.00 114.23 ? 1321 ASP A HA     1 
ATOM   5502  H  HB2    . ASP A 1 359 ? -79.648  48.932  -16.973 1.00 115.09 ? 1321 ASP A HB2    1 
ATOM   5503  H  HB3    . ASP A 1 359 ? -79.576  47.599  -16.110 1.00 115.09 ? 1321 ASP A HB3    1 
ATOM   5504  N  N      . TYR A 1 360 ? -78.987  50.658  -13.928 1.00 85.97  ? 1322 TYR A N      1 
ATOM   5505  C  CA     . TYR A 1 360 ? -77.747  51.030  -13.249 1.00 80.04  ? 1322 TYR A CA     1 
ATOM   5506  C  C      . TYR A 1 360 ? -78.080  51.797  -11.976 1.00 77.07  ? 1322 TYR A C      1 
ATOM   5507  O  O      . TYR A 1 360 ? -78.527  52.959  -12.061 1.00 77.77  ? 1322 TYR A O      1 
ATOM   5508  C  CB     . TYR A 1 360 ? -76.866  51.871  -14.170 1.00 77.59  ? 1322 TYR A CB     1 
ATOM   5509  C  CG     . TYR A 1 360 ? -76.679  51.271  -15.548 1.00 79.21  ? 1322 TYR A CG     1 
ATOM   5510  C  CD1    . TYR A 1 360 ? -77.647  51.430  -16.531 1.00 82.18  ? 1322 TYR A CD1    1 
ATOM   5511  C  CD2    . TYR A 1 360 ? -75.536  50.547  -15.866 1.00 75.79  ? 1322 TYR A CD2    1 
ATOM   5512  C  CE1    . TYR A 1 360 ? -77.486  50.883  -17.790 1.00 83.37  ? 1322 TYR A CE1    1 
ATOM   5513  C  CE2    . TYR A 1 360 ? -75.364  49.998  -17.125 1.00 76.14  ? 1322 TYR A CE2    1 
ATOM   5514  C  CZ     . TYR A 1 360 ? -76.344  50.169  -18.084 1.00 81.49  ? 1322 TYR A CZ     1 
ATOM   5515  O  OH     . TYR A 1 360 ? -76.189  49.627  -19.342 1.00 82.89  ? 1322 TYR A OH     1 
ATOM   5516  H  H      . TYR A 1 360 ? -79.516  51.322  -14.066 1.00 103.16 ? 1322 TYR A H      1 
ATOM   5517  H  HA     . TYR A 1 360 ? -77.258  50.228  -13.006 1.00 96.05  ? 1322 TYR A HA     1 
ATOM   5518  H  HB2    . TYR A 1 360 ? -77.273  52.745  -14.280 1.00 93.11  ? 1322 TYR A HB2    1 
ATOM   5519  H  HB3    . TYR A 1 360 ? -75.990  51.965  -13.766 1.00 93.11  ? 1322 TYR A HB3    1 
ATOM   5520  H  HD1    . TYR A 1 360 ? -78.419  51.910  -16.338 1.00 98.62  ? 1322 TYR A HD1    1 
ATOM   5521  H  HD2    . TYR A 1 360 ? -74.875  50.430  -15.222 1.00 90.95  ? 1322 TYR A HD2    1 
ATOM   5522  H  HE1    . TYR A 1 360 ? -78.144  50.999  -18.437 1.00 100.04 ? 1322 TYR A HE1    1 
ATOM   5523  H  HE2    . TYR A 1 360 ? -74.595  49.515  -17.324 1.00 91.37  ? 1322 TYR A HE2    1 
ATOM   5524  H  HH     . TYR A 1 360 ? -75.456  49.220  -19.391 1.00 99.46  ? 1322 TYR A HH     1 
ATOM   5525  N  N      . PRO A 1 361 ? -77.884  51.212  -10.787 1.00 73.66  ? 1323 PRO A N      1 
ATOM   5526  C  CA     . PRO A 1 361 ? -78.191  51.943  -9.547  1.00 69.87  ? 1323 PRO A CA     1 
ATOM   5527  C  C      . PRO A 1 361 ? -77.208  53.055  -9.221  1.00 62.49  ? 1323 PRO A C      1 
ATOM   5528  O  O      . PRO A 1 361 ? -77.394  53.742  -8.211  1.00 65.37  ? 1323 PRO A O      1 
ATOM   5529  C  CB     . PRO A 1 361 ? -78.151  50.843  -8.476  1.00 70.61  ? 1323 PRO A CB     1 
ATOM   5530  C  CG     . PRO A 1 361 ? -77.206  49.840  -9.017  1.00 70.22  ? 1323 PRO A CG     1 
ATOM   5531  C  CD     . PRO A 1 361 ? -77.403  49.846  -10.509 1.00 69.90  ? 1323 PRO A CD     1 
ATOM   5532  H  HA     . PRO A 1 361 ? -79.087  52.313  -9.590  1.00 83.84  ? 1323 PRO A HA     1 
ATOM   5533  H  HB2    . PRO A 1 361 ? -77.824  51.210  -7.640  1.00 84.74  ? 1323 PRO A HB2    1 
ATOM   5534  H  HB3    . PRO A 1 361 ? -79.035  50.460  -8.365  1.00 84.74  ? 1323 PRO A HB3    1 
ATOM   5535  H  HG2    . PRO A 1 361 ? -76.298  50.096  -8.793  1.00 84.27  ? 1323 PRO A HG2    1 
ATOM   5536  H  HG3    . PRO A 1 361 ? -77.415  48.967  -8.650  1.00 84.27  ? 1323 PRO A HG3    1 
ATOM   5537  H  HD2    . PRO A 1 361 ? -76.561  49.685  -10.961 1.00 83.88  ? 1323 PRO A HD2    1 
ATOM   5538  H  HD3    . PRO A 1 361 ? -78.074  49.193  -10.763 1.00 83.88  ? 1323 PRO A HD3    1 
ATOM   5539  N  N      . SER A 1 362 ? -76.168  53.254  -10.027 1.00 58.39  ? 1324 SER A N      1 
ATOM   5540  C  CA     . SER A 1 362 ? -75.244  54.368  -9.843  1.00 56.33  ? 1324 SER A CA     1 
ATOM   5541  C  C      . SER A 1 362 ? -74.798  54.854  -11.211 1.00 52.45  ? 1324 SER A C      1 
ATOM   5542  O  O      . SER A 1 362 ? -74.128  54.120  -11.942 1.00 50.49  ? 1324 SER A O      1 
ATOM   5543  C  CB     . SER A 1 362 ? -74.031  53.959  -8.999  1.00 52.62  ? 1324 SER A CB     1 
ATOM   5544  O  OG     . SER A 1 362 ? -73.068  54.999  -8.968  1.00 49.30  ? 1324 SER A OG     1 
ATOM   5545  H  H      . SER A 1 362 ? -75.974  52.751  -10.697 1.00 70.07  ? 1324 SER A H      1 
ATOM   5546  H  HA     . SER A 1 362 ? -75.701  55.095  -9.392  1.00 67.60  ? 1324 SER A HA     1 
ATOM   5547  H  HB2    . SER A 1 362 ? -74.325  53.772  -8.094  1.00 63.14  ? 1324 SER A HB2    1 
ATOM   5548  H  HB3    . SER A 1 362 ? -73.629  53.166  -9.388  1.00 63.14  ? 1324 SER A HB3    1 
ATOM   5549  H  HG     . SER A 1 362 ? -73.405  55.692  -8.634  1.00 59.17  ? 1324 SER A HG     1 
ATOM   5550  N  N      . LYS A 1 363 ? -75.160  56.094  -11.547 1.00 49.98  ? 1325 LYS A N      1 
ATOM   5551  C  CA     . LYS A 1 363 ? -74.726  56.687  -12.807 1.00 55.33  ? 1325 LYS A CA     1 
ATOM   5552  C  C      . LYS A 1 363 ? -73.238  57.009  -12.796 1.00 57.08  ? 1325 LYS A C      1 
ATOM   5553  O  O      . LYS A 1 363 ? -72.586  56.947  -13.844 1.00 55.16  ? 1325 LYS A O      1 
ATOM   5554  C  CB     . LYS A 1 363 ? -75.545  57.942  -13.101 1.00 57.03  ? 1325 LYS A CB     1 
ATOM   5555  C  CG     . LYS A 1 363 ? -77.024  57.663  -13.312 1.00 59.84  ? 1325 LYS A CG     1 
ATOM   5556  C  CD     . LYS A 1 363 ? -77.864  58.907  -13.105 1.00 62.41  ? 1325 LYS A CD     1 
ATOM   5557  C  CE     . LYS A 1 363 ? -79.343  58.611  -13.283 1.00 65.81  ? 1325 LYS A CE     1 
ATOM   5558  N  NZ     . LYS A 1 363 ? -80.191  59.728  -12.775 1.00 69.43  1 1325 LYS A NZ     1 
ATOM   5559  H  H      . LYS A 1 363 ? -75.652  56.608  -11.064 1.00 59.98  ? 1325 LYS A H      1 
ATOM   5560  H  HA     . LYS A 1 363 ? -74.887  56.052  -13.523 1.00 66.39  ? 1325 LYS A HA     1 
ATOM   5561  H  HB2    . LYS A 1 363 ? -75.462  58.553  -12.352 1.00 68.44  ? 1325 LYS A HB2    1 
ATOM   5562  H  HB3    . LYS A 1 363 ? -75.203  58.359  -13.907 1.00 68.44  ? 1325 LYS A HB3    1 
ATOM   5563  H  HG2    . LYS A 1 363 ? -77.163  57.350  -14.219 1.00 71.80  ? 1325 LYS A HG2    1 
ATOM   5564  H  HG3    . LYS A 1 363 ? -77.316  56.990  -12.677 1.00 71.80  ? 1325 LYS A HG3    1 
ATOM   5565  H  HD2    . LYS A 1 363 ? -77.726  59.241  -12.205 1.00 74.89  ? 1325 LYS A HD2    1 
ATOM   5566  H  HD3    . LYS A 1 363 ? -77.607  59.579  -13.756 1.00 74.89  ? 1325 LYS A HD3    1 
ATOM   5567  H  HE2    . LYS A 1 363 ? -79.534  58.489  -14.226 1.00 78.97  ? 1325 LYS A HE2    1 
ATOM   5568  H  HE3    . LYS A 1 363 ? -79.570  57.808  -12.789 1.00 78.97  ? 1325 LYS A HE3    1 
ATOM   5569  H  HZ1    . LYS A 1 363 ? -81.052  59.533  -12.889 1.00 83.32  ? 1325 LYS A HZ1    1 
ATOM   5570  H  HZ2    . LYS A 1 363 ? -80.037  59.857  -11.908 1.00 83.32  ? 1325 LYS A HZ2    1 
ATOM   5571  H  HZ3    . LYS A 1 363 ? -80.003  60.478  -13.216 1.00 83.32  ? 1325 LYS A HZ3    1 
ATOM   5572  N  N      . MET A 1 364 ? -72.686  57.356  -11.630 1.00 58.26  ? 1326 MET A N      1 
ATOM   5573  C  CA     . MET A 1 364 ? -71.258  57.638  -11.540 1.00 57.58  ? 1326 MET A CA     1 
ATOM   5574  C  C      . MET A 1 364 ? -70.432  56.428  -11.955 1.00 55.83  ? 1326 MET A C      1 
ATOM   5575  O  O      . MET A 1 364 ? -69.421  56.567  -12.653 1.00 51.57  ? 1326 MET A O      1 
ATOM   5576  C  CB     . MET A 1 364 ? -70.900  58.058  -10.115 1.00 62.08  ? 1326 MET A CB     1 
ATOM   5577  C  CG     . MET A 1 364 ? -71.513  59.374  -9.680  1.00 65.33  ? 1326 MET A CG     1 
ATOM   5578  S  SD     . MET A 1 364 ? -70.706  60.783  -10.459 1.00 66.42  ? 1326 MET A SD     1 
ATOM   5579  C  CE     . MET A 1 364 ? -69.163  60.818  -9.550  1.00 66.84  ? 1326 MET A CE     1 
ATOM   5580  H  H      . MET A 1 364 ? -73.114  57.434  -10.888 1.00 69.91  ? 1326 MET A H      1 
ATOM   5581  H  HA     . MET A 1 364 ? -71.047  58.379  -12.131 1.00 69.10  ? 1326 MET A HA     1 
ATOM   5582  H  HB2    . MET A 1 364 ? -71.209  57.372  -9.502  1.00 74.50  ? 1326 MET A HB2    1 
ATOM   5583  H  HB3    . MET A 1 364 ? -69.936  58.146  -10.049 1.00 74.50  ? 1326 MET A HB3    1 
ATOM   5584  H  HG2    . MET A 1 364 ? -72.451  59.387  -9.929  1.00 78.40  ? 1326 MET A HG2    1 
ATOM   5585  H  HG3    . MET A 1 364 ? -71.422  59.467  -8.719  1.00 78.40  ? 1326 MET A HG3    1 
ATOM   5586  H  HE1    . MET A 1 364 ? -69.355  60.945  -8.608  1.00 80.21  ? 1326 MET A HE1    1 
ATOM   5587  H  HE2    . MET A 1 364 ? -68.700  59.975  -9.683  1.00 80.21  ? 1326 MET A HE2    1 
ATOM   5588  H  HE3    . MET A 1 364 ? -68.619  61.550  -9.879  1.00 80.21  ? 1326 MET A HE3    1 
ATOM   5589  N  N      . GLU A 1 365 ? -70.846  55.230  -11.532 1.00 57.36  ? 1327 GLU A N      1 
ATOM   5590  C  CA     . GLU A 1 365 ? -70.099  54.025  -11.877 1.00 58.16  ? 1327 GLU A CA     1 
ATOM   5591  C  C      . GLU A 1 365 ? -70.230  53.677  -13.355 1.00 57.15  ? 1327 GLU A C      1 
ATOM   5592  O  O      . GLU A 1 365 ? -69.340  53.027  -13.915 1.00 55.66  ? 1327 GLU A O      1 
ATOM   5593  C  CB     . GLU A 1 365 ? -70.556  52.851  -11.014 1.00 59.18  ? 1327 GLU A CB     1 
ATOM   5594  C  CG     . GLU A 1 365 ? -70.115  52.957  -9.568  1.00 66.19  ? 1327 GLU A CG     1 
ATOM   5595  C  CD     . GLU A 1 365 ? -70.667  51.848  -8.700  1.00 69.32  ? 1327 GLU A CD     1 
ATOM   5596  O  OE1    . GLU A 1 365 ? -70.627  51.990  -7.461  1.00 72.03  ? 1327 GLU A OE1    1 
ATOM   5597  O  OE2    . GLU A 1 365 ? -71.146  50.837  -9.255  1.00 72.35  1 1327 GLU A OE2    1 
ATOM   5598  H  H      . GLU A 1 365 ? -71.546  55.093  -11.052 1.00 68.84  ? 1327 GLU A H      1 
ATOM   5599  H  HA     . GLU A 1 365 ? -69.159  54.179  -11.693 1.00 69.80  ? 1327 GLU A HA     1 
ATOM   5600  H  HB2    . GLU A 1 365 ? -71.525  52.810  -11.027 1.00 71.02  ? 1327 GLU A HB2    1 
ATOM   5601  H  HB3    . GLU A 1 365 ? -70.187  52.031  -11.378 1.00 71.02  ? 1327 GLU A HB3    1 
ATOM   5602  H  HG2    . GLU A 1 365 ? -69.147  52.913  -9.530  1.00 79.43  ? 1327 GLU A HG2    1 
ATOM   5603  H  HG3    . GLU A 1 365 ? -70.423  53.803  -9.206  1.00 79.43  ? 1327 GLU A HG3    1 
ATOM   5604  N  N      . TYR A 1 366 ? -71.321  54.088  -14.005 1.00 56.79  ? 1328 TYR A N      1 
ATOM   5605  C  CA     . TYR A 1 366 ? -71.476  53.789  -15.425 1.00 56.96  ? 1328 TYR A CA     1 
ATOM   5606  C  C      . TYR A 1 366 ? -70.573  54.673  -16.276 1.00 54.80  ? 1328 TYR A C      1 
ATOM   5607  O  O      . TYR A 1 366 ? -69.861  54.180  -17.159 1.00 56.32  ? 1328 TYR A O      1 
ATOM   5608  C  CB     . TYR A 1 366 ? -72.932  53.957  -15.860 1.00 56.64  ? 1328 TYR A CB     1 
ATOM   5609  C  CG     . TYR A 1 366 ? -73.074  53.957  -17.364 1.00 55.65  ? 1328 TYR A CG     1 
ATOM   5610  C  CD1    . TYR A 1 366 ? -73.163  52.766  -18.071 1.00 58.25  ? 1328 TYR A CD1    1 
ATOM   5611  C  CD2    . TYR A 1 366 ? -73.094  55.146  -18.081 1.00 55.58  ? 1328 TYR A CD2    1 
ATOM   5612  C  CE1    . TYR A 1 366 ? -73.275  52.758  -19.448 1.00 57.70  ? 1328 TYR A CE1    1 
ATOM   5613  C  CE2    . TYR A 1 366 ? -73.204  55.149  -19.457 1.00 55.73  ? 1328 TYR A CE2    1 
ATOM   5614  C  CZ     . TYR A 1 366 ? -73.295  53.951  -20.135 1.00 56.56  ? 1328 TYR A CZ     1 
ATOM   5615  O  OH     . TYR A 1 366 ? -73.408  53.946  -21.507 1.00 58.11  ? 1328 TYR A OH     1 
ATOM   5616  H  H      . TYR A 1 366 ? -71.969  54.531  -13.655 1.00 68.15  ? 1328 TYR A H      1 
ATOM   5617  H  HA     . TYR A 1 366 ? -71.222  52.866  -15.581 1.00 68.35  ? 1328 TYR A HA     1 
ATOM   5618  H  HB2    . TYR A 1 366 ? -73.458  53.223  -15.506 1.00 67.97  ? 1328 TYR A HB2    1 
ATOM   5619  H  HB3    . TYR A 1 366 ? -73.270  54.803  -15.524 1.00 67.97  ? 1328 TYR A HB3    1 
ATOM   5620  H  HD1    . TYR A 1 366 ? -73.146  51.958  -17.610 1.00 69.90  ? 1328 TYR A HD1    1 
ATOM   5621  H  HD2    . TYR A 1 366 ? -73.029  55.955  -17.626 1.00 66.70  ? 1328 TYR A HD2    1 
ATOM   5622  H  HE1    . TYR A 1 366 ? -73.337  51.952  -19.907 1.00 69.25  ? 1328 TYR A HE1    1 
ATOM   5623  H  HE2    . TYR A 1 366 ? -73.219  55.953  -19.924 1.00 66.87  ? 1328 TYR A HE2    1 
ATOM   5624  H  HH     . TYR A 1 366 ? -73.408  54.734  -21.798 1.00 69.74  ? 1328 TYR A HH     1 
ATOM   5625  N  N      . PHE A 1 367 ? -70.595  55.984  -16.035 1.00 49.32  ? 1329 PHE A N      1 
ATOM   5626  C  CA     . PHE A 1 367 ? -69.892  56.904  -16.921 1.00 51.67  ? 1329 PHE A CA     1 
ATOM   5627  C  C      . PHE A 1 367 ? -68.384  56.884  -16.703 1.00 49.93  ? 1329 PHE A C      1 
ATOM   5628  O  O      . PHE A 1 367 ? -67.628  57.132  -17.649 1.00 47.95  ? 1329 PHE A O      1 
ATOM   5629  C  CB     . PHE A 1 367 ? -70.420  58.326  -16.735 1.00 48.18  ? 1329 PHE A CB     1 
ATOM   5630  C  CG     . PHE A 1 367 ? -71.775  58.552  -17.341 1.00 51.75  ? 1329 PHE A CG     1 
ATOM   5631  C  CD1    . PHE A 1 367 ? -71.931  58.618  -18.717 1.00 51.73  ? 1329 PHE A CD1    1 
ATOM   5632  C  CD2    . PHE A 1 367 ? -72.890  58.714  -16.536 1.00 50.38  ? 1329 PHE A CD2    1 
ATOM   5633  C  CE1    . PHE A 1 367 ? -73.177  58.827  -19.280 1.00 52.17  ? 1329 PHE A CE1    1 
ATOM   5634  C  CE2    . PHE A 1 367 ? -74.137  58.927  -17.093 1.00 54.41  ? 1329 PHE A CE2    1 
ATOM   5635  C  CZ     . PHE A 1 367 ? -74.280  58.984  -18.468 1.00 52.64  ? 1329 PHE A CZ     1 
ATOM   5636  H  H      . PHE A 1 367 ? -71.003  56.358  -15.376 1.00 59.18  ? 1329 PHE A H      1 
ATOM   5637  H  HA     . PHE A 1 367 ? -70.061  56.642  -17.839 1.00 62.00  ? 1329 PHE A HA     1 
ATOM   5638  H  HB2    . PHE A 1 367 ? -70.484  58.515  -15.786 1.00 57.81  ? 1329 PHE A HB2    1 
ATOM   5639  H  HB3    . PHE A 1 367 ? -69.802  58.946  -17.153 1.00 57.81  ? 1329 PHE A HB3    1 
ATOM   5640  H  HD1    . PHE A 1 367 ? -71.190  58.511  -19.269 1.00 62.07  ? 1329 PHE A HD1    1 
ATOM   5641  H  HD2    . PHE A 1 367 ? -72.800  58.676  -15.611 1.00 60.46  ? 1329 PHE A HD2    1 
ATOM   5642  H  HE1    . PHE A 1 367 ? -73.270  58.867  -20.204 1.00 62.60  ? 1329 PHE A HE1    1 
ATOM   5643  H  HE2    . PHE A 1 367 ? -74.880  59.031  -16.544 1.00 65.29  ? 1329 PHE A HE2    1 
ATOM   5644  H  HZ     . PHE A 1 367 ? -75.119  59.127  -18.844 1.00 63.17  ? 1329 PHE A HZ     1 
ATOM   5645  N  N      . PHE A 1 368 ? -67.929  56.590  -15.486 1.00 43.95  ? 1330 PHE A N      1 
ATOM   5646  C  CA     . PHE A 1 368 ? -66.511  56.611  -15.146 1.00 41.58  ? 1330 PHE A CA     1 
ATOM   5647  C  C      . PHE A 1 368 ? -65.974  55.203  -14.909 1.00 42.86  ? 1330 PHE A C      1 
ATOM   5648  O  O      . PHE A 1 368 ? -65.102  54.986  -14.067 1.00 48.02  ? 1330 PHE A O      1 
ATOM   5649  C  CB     . PHE A 1 368 ? -66.266  57.484  -13.917 1.00 41.21  ? 1330 PHE A CB     1 
ATOM   5650  C  CG     . PHE A 1 368 ? -66.566  58.938  -14.135 1.00 41.56  ? 1330 PHE A CG     1 
ATOM   5651  C  CD1    . PHE A 1 368 ? -65.675  59.749  -14.819 1.00 40.39  ? 1330 PHE A CD1    1 
ATOM   5652  C  CD2    . PHE A 1 368 ? -67.737  59.496  -13.651 1.00 41.21  ? 1330 PHE A CD2    1 
ATOM   5653  C  CE1    . PHE A 1 368 ? -65.947  61.088  -15.017 1.00 41.62  ? 1330 PHE A CE1    1 
ATOM   5654  C  CE2    . PHE A 1 368 ? -68.016  60.835  -13.847 1.00 41.49  ? 1330 PHE A CE2    1 
ATOM   5655  C  CZ     . PHE A 1 368 ? -67.121  61.632  -14.529 1.00 42.70  ? 1330 PHE A CZ     1 
ATOM   5656  H  H      . PHE A 1 368 ? -68.436  56.370  -14.827 1.00 52.74  ? 1330 PHE A H      1 
ATOM   5657  H  HA     . PHE A 1 368 ? -66.017  56.997  -15.887 1.00 49.90  ? 1330 PHE A HA     1 
ATOM   5658  H  HB2    . PHE A 1 368 ? -66.832  57.170  -13.194 1.00 49.45  ? 1330 PHE A HB2    1 
ATOM   5659  H  HB3    . PHE A 1 368 ? -65.334  57.408  -13.661 1.00 49.45  ? 1330 PHE A HB3    1 
ATOM   5660  H  HD1    . PHE A 1 368 ? -64.884  59.387  -15.148 1.00 48.47  ? 1330 PHE A HD1    1 
ATOM   5661  H  HD2    . PHE A 1 368 ? -68.343  58.963  -13.190 1.00 49.46  ? 1330 PHE A HD2    1 
ATOM   5662  H  HE1    . PHE A 1 368 ? -65.342  61.624  -15.478 1.00 49.94  ? 1330 PHE A HE1    1 
ATOM   5663  H  HE2    . PHE A 1 368 ? -68.806  61.199  -13.518 1.00 49.79  ? 1330 PHE A HE2    1 
ATOM   5664  H  HZ     . PHE A 1 368 ? -67.307  62.534  -14.662 1.00 51.24  ? 1330 PHE A HZ     1 
ATOM   5665  N  N      . ASP A 1 369 ? -66.468  54.241  -15.669 1.00 42.66  ? 1331 ASP A N      1 
ATOM   5666  C  CA     . ASP A 1 369 ? -66.016  52.860  -15.541 1.00 45.56  ? 1331 ASP A CA     1 
ATOM   5667  C  C      . ASP A 1 369 ? -64.631  52.715  -16.162 1.00 48.00  ? 1331 ASP A C      1 
ATOM   5668  O  O      . ASP A 1 369 ? -64.488  52.906  -17.377 1.00 51.53  ? 1331 ASP A O      1 
ATOM   5669  C  CB     . ASP A 1 369 ? -67.005  51.923  -16.227 1.00 49.49  ? 1331 ASP A CB     1 
ATOM   5670  C  CG     . ASP A 1 369 ? -66.686  50.462  -15.994 1.00 52.96  ? 1331 ASP A CG     1 
ATOM   5671  O  OD1    . ASP A 1 369 ? -65.584  50.159  -15.487 1.00 53.49  ? 1331 ASP A OD1    1 
ATOM   5672  O  OD2    . ASP A 1 369 ? -67.540  49.612  -16.326 1.00 57.49  1 1331 ASP A OD2    1 
ATOM   5673  H  H      . ASP A 1 369 ? -67.070  54.359  -16.272 1.00 51.19  ? 1331 ASP A H      1 
ATOM   5674  H  HA     . ASP A 1 369 ? -65.962  52.620  -14.603 1.00 54.67  ? 1331 ASP A HA     1 
ATOM   5675  H  HB2    . ASP A 1 369 ? -67.895  52.095  -15.880 1.00 59.39  ? 1331 ASP A HB2    1 
ATOM   5676  H  HB3    . ASP A 1 369 ? -66.985  52.087  -17.182 1.00 59.39  ? 1331 ASP A HB3    1 
ATOM   5677  N  N      . PRO A 1 370 ? -63.589  52.390  -15.386 1.00 46.08  ? 1332 PRO A N      1 
ATOM   5678  C  CA     . PRO A 1 370 ? -62.247  52.295  -15.988 1.00 46.17  ? 1332 PRO A CA     1 
ATOM   5679  C  C      . PRO A 1 370 ? -62.127  51.207  -17.037 1.00 48.82  ? 1332 PRO A C      1 
ATOM   5680  O  O      . PRO A 1 370 ? -61.393  51.382  -18.015 1.00 48.23  ? 1332 PRO A O      1 
ATOM   5681  C  CB     . PRO A 1 370 ? -61.336  52.012  -14.782 1.00 47.51  ? 1332 PRO A CB     1 
ATOM   5682  C  CG     . PRO A 1 370 ? -62.122  52.413  -13.589 1.00 46.10  ? 1332 PRO A CG     1 
ATOM   5683  C  CD     . PRO A 1 370 ? -63.551  52.149  -13.934 1.00 46.43  ? 1332 PRO A CD     1 
ATOM   5684  H  HA     . PRO A 1 370 ? -61.997  53.146  -16.382 1.00 55.40  ? 1332 PRO A HA     1 
ATOM   5685  H  HB2    . PRO A 1 370 ? -61.123  51.066  -14.749 1.00 57.02  ? 1332 PRO A HB2    1 
ATOM   5686  H  HB3    . PRO A 1 370 ? -60.527  52.543  -14.853 1.00 57.02  ? 1332 PRO A HB3    1 
ATOM   5687  H  HG2    . PRO A 1 370 ? -61.851  51.879  -12.826 1.00 55.31  ? 1332 PRO A HG2    1 
ATOM   5688  H  HG3    . PRO A 1 370 ? -61.984  53.357  -13.411 1.00 55.31  ? 1332 PRO A HG3    1 
ATOM   5689  H  HD2    . PRO A 1 370 ? -63.783  51.228  -13.736 1.00 55.71  ? 1332 PRO A HD2    1 
ATOM   5690  H  HD3    . PRO A 1 370 ? -64.133  52.772  -13.471 1.00 55.71  ? 1332 PRO A HD3    1 
ATOM   5691  N  N      . ASP A 1 371 ? -62.816  50.078  -16.857 1.00 58.14  ? 1333 ASP A N      1 
ATOM   5692  C  CA     . ASP A 1 371 ? -62.751  49.005  -17.842 1.00 65.07  ? 1333 ASP A CA     1 
ATOM   5693  C  C      . ASP A 1 371 ? -63.272  49.437  -19.205 1.00 63.77  ? 1333 ASP A C      1 
ATOM   5694  O  O      . ASP A 1 371 ? -62.894  48.836  -20.216 1.00 68.68  ? 1333 ASP A O      1 
ATOM   5695  C  CB     . ASP A 1 371 ? -63.529  47.785  -17.346 1.00 69.89  ? 1333 ASP A CB     1 
ATOM   5696  C  CG     . ASP A 1 371 ? -62.912  47.166  -16.104 1.00 71.92  ? 1333 ASP A CG     1 
ATOM   5697  O  OD1    . ASP A 1 371 ? -61.677  47.275  -15.934 1.00 69.45  ? 1333 ASP A OD1    1 
ATOM   5698  O  OD2    . ASP A 1 371 ? -63.658  46.567  -15.300 1.00 75.70  1 1333 ASP A OD2    1 
ATOM   5699  H  H      . ASP A 1 371 ? -63.321  49.913  -16.180 1.00 69.77  ? 1333 ASP A H      1 
ATOM   5700  H  HA     . ASP A 1 371 ? -61.824  48.740  -17.951 1.00 78.09  ? 1333 ASP A HA     1 
ATOM   5701  H  HB2    . ASP A 1 371 ? -64.435  48.053  -17.130 1.00 83.86  ? 1333 ASP A HB2    1 
ATOM   5702  H  HB3    . ASP A 1 371 ? -63.539  47.111  -18.044 1.00 83.86  ? 1333 ASP A HB3    1 
ATOM   5703  N  N      . VAL A 1 372 ? -64.126  50.453  -19.258 1.00 54.13  ? 1334 VAL A N      1 
ATOM   5704  C  CA     . VAL A 1 372 ? -64.608  50.973  -20.533 1.00 47.46  ? 1334 VAL A CA     1 
ATOM   5705  C  C      . VAL A 1 372 ? -63.709  52.090  -21.040 1.00 45.32  ? 1334 VAL A C      1 
ATOM   5706  O  O      . VAL A 1 372 ? -63.317  52.106  -22.209 1.00 47.78  ? 1334 VAL A O      1 
ATOM   5707  C  CB     . VAL A 1 372 ? -66.072  51.447  -20.391 1.00 49.30  ? 1334 VAL A CB     1 
ATOM   5708  C  CG1    . VAL A 1 372 ? -66.590  52.014  -21.712 1.00 46.51  ? 1334 VAL A CG1    1 
ATOM   5709  C  CG2    . VAL A 1 372 ? -66.962  50.307  -19.912 1.00 46.78  ? 1334 VAL A CG2    1 
ATOM   5710  H  H      . VAL A 1 372 ? -64.443  50.859  -18.570 1.00 64.96  ? 1334 VAL A H      1 
ATOM   5711  H  HA     . VAL A 1 372 ? -64.591  50.258  -21.188 1.00 56.95  ? 1334 VAL A HA     1 
ATOM   5712  H  HB     . VAL A 1 372 ? -66.110  52.154  -19.728 1.00 59.16  ? 1334 VAL A HB     1 
ATOM   5713  H  HG11   . VAL A 1 372 ? -67.508  52.303  -21.593 1.00 55.82  ? 1334 VAL A HG11   1 
ATOM   5714  H  HG12   . VAL A 1 372 ? -66.036  52.767  -21.971 1.00 55.82  ? 1334 VAL A HG12   1 
ATOM   5715  H  HG13   . VAL A 1 372 ? -66.545  51.322  -22.391 1.00 55.82  ? 1334 VAL A HG13   1 
ATOM   5716  H  HG21   . VAL A 1 372 ? -67.873  50.631  -19.832 1.00 56.14  ? 1334 VAL A HG21   1 
ATOM   5717  H  HG22   . VAL A 1 372 ? -66.924  49.585  -20.558 1.00 56.14  ? 1334 VAL A HG22   1 
ATOM   5718  H  HG23   . VAL A 1 372 ? -66.643  49.998  -19.050 1.00 56.14  ? 1334 VAL A HG23   1 
ATOM   5719  N  N      . LEU A 1 373 ? -63.348  53.027  -20.162 1.00 47.48  ? 1335 LEU A N      1 
ATOM   5720  C  CA     . LEU A 1 373 ? -62.605  54.205  -20.597 1.00 48.87  ? 1335 LEU A CA     1 
ATOM   5721  C  C      . LEU A 1 373 ? -61.186  53.855  -21.026 1.00 48.24  ? 1335 LEU A C      1 
ATOM   5722  O  O      . LEU A 1 373 ? -60.632  54.518  -21.909 1.00 48.78  ? 1335 LEU A O      1 
ATOM   5723  C  CB     . LEU A 1 373 ? -62.579  55.253  -19.483 1.00 48.53  ? 1335 LEU A CB     1 
ATOM   5724  C  CG     . LEU A 1 373 ? -63.933  55.842  -19.077 1.00 49.88  ? 1335 LEU A CG     1 
ATOM   5725  C  CD1    . LEU A 1 373 ? -63.766  56.785  -17.908 1.00 46.09  ? 1335 LEU A CD1    1 
ATOM   5726  C  CD2    . LEU A 1 373 ? -64.602  56.557  -20.255 1.00 53.12  ? 1335 LEU A CD2    1 
ATOM   5727  H  H      . LEU A 1 373 ? -63.519  53.004  -19.320 1.00 56.98  ? 1335 LEU A H      1 
ATOM   5728  H  HA     . LEU A 1 373 ? -63.058  54.595  -21.361 1.00 58.64  ? 1335 LEU A HA     1 
ATOM   5729  H  HB2    . LEU A 1 373 ? -62.192  54.847  -18.692 1.00 58.23  ? 1335 LEU A HB2    1 
ATOM   5730  H  HB3    . LEU A 1 373 ? -62.019  55.991  -19.773 1.00 58.23  ? 1335 LEU A HB3    1 
ATOM   5731  H  HG     . LEU A 1 373 ? -64.517  55.120  -18.797 1.00 59.85  ? 1335 LEU A HG     1 
ATOM   5732  H  HD11   . LEU A 1 373 ? -64.634  57.146  -17.668 1.00 55.31  ? 1335 LEU A HD11   1 
ATOM   5733  H  HD12   . LEU A 1 373 ? -63.392  56.296  -17.159 1.00 55.31  ? 1335 LEU A HD12   1 
ATOM   5734  H  HD13   . LEU A 1 373 ? -63.169  57.504  -18.166 1.00 55.31  ? 1335 LEU A HD13   1 
ATOM   5735  H  HD21   . LEU A 1 373 ? -65.455  56.916  -19.963 1.00 63.75  ? 1335 LEU A HD21   1 
ATOM   5736  H  HD22   . LEU A 1 373 ? -64.025  57.276  -20.556 1.00 63.75  ? 1335 LEU A HD22   1 
ATOM   5737  H  HD23   . LEU A 1 373 ? -64.740  55.920  -20.974 1.00 63.75  ? 1335 LEU A HD23   1 
ATOM   5738  N  N      . THR A 1 374 ? -60.576  52.844  -20.408 1.00 50.21  ? 1336 THR A N      1 
ATOM   5739  C  CA     . THR A 1 374 ? -59.235  52.405  -20.774 1.00 55.84  ? 1336 THR A CA     1 
ATOM   5740  C  C      . THR A 1 374 ? -59.222  50.982  -21.317 1.00 62.34  ? 1336 THR A C      1 
ATOM   5741  O  O      . THR A 1 374 ? -58.141  50.432  -21.554 1.00 62.29  ? 1336 THR A O      1 
ATOM   5742  C  CB     . THR A 1 374 ? -58.283  52.504  -19.577 1.00 55.87  ? 1336 THR A CB     1 
ATOM   5743  O  OG1    . THR A 1 374 ? -58.753  51.665  -18.515 1.00 58.66  ? 1336 THR A OG1    1 
ATOM   5744  C  CG2    . THR A 1 374 ? -58.177  53.942  -19.087 1.00 56.48  ? 1336 THR A CG2    1 
ATOM   5745  H  H      . THR A 1 374 ? -60.924  52.393  -19.764 1.00 60.25  ? 1336 THR A H      1 
ATOM   5746  H  HA     . THR A 1 374 ? -58.896  52.989  -21.470 1.00 67.00  ? 1336 THR A HA     1 
ATOM   5747  H  HB     . THR A 1 374 ? -57.399  52.211  -19.848 1.00 67.04  ? 1336 THR A HB     1 
ATOM   5748  H  HG1    . THR A 1 374 ? -59.521  51.907  -18.276 1.00 70.39  ? 1336 THR A HG1    1 
ATOM   5749  H  HG21   . THR A 1 374 ? -57.573  53.990  -18.330 1.00 67.77  ? 1336 THR A HG21   1 
ATOM   5750  H  HG22   . THR A 1 374 ? -57.840  54.510  -19.797 1.00 67.77  ? 1336 THR A HG22   1 
ATOM   5751  H  HG23   . THR A 1 374 ? -59.051  54.264  -18.814 1.00 67.77  ? 1336 THR A HG23   1 
ATOM   5752  N  N      . GLU A 1 375 ? -60.391  50.376  -21.523 1.00 69.33  ? 1337 GLU A N      1 
ATOM   5753  C  CA     . GLU A 1 375 ? -60.486  49.045  -22.121 1.00 73.24  ? 1337 GLU A CA     1 
ATOM   5754  C  C      . GLU A 1 375 ? -59.703  48.016  -21.310 1.00 73.69  ? 1337 GLU A C      1 
ATOM   5755  O  O      . GLU A 1 375 ? -59.066  47.117  -21.862 1.00 76.71  ? 1337 GLU A O      1 
ATOM   5756  C  CB     . GLU A 1 375 ? -60.013  49.067  -23.574 1.00 75.40  ? 1337 GLU A CB     1 
ATOM   5757  C  CG     . GLU A 1 375 ? -60.752  50.081  -24.429 1.00 78.36  ? 1337 GLU A CG     1 
ATOM   5758  C  CD     . GLU A 1 375 ? -60.299  50.067  -25.870 1.00 82.01  ? 1337 GLU A CD     1 
ATOM   5759  O  OE1    . GLU A 1 375 ? -59.713  49.050  -26.295 1.00 84.64  ? 1337 GLU A OE1    1 
ATOM   5760  O  OE2    . GLU A 1 375 ? -60.526  51.072  -26.576 1.00 83.86  1 1337 GLU A OE2    1 
ATOM   5761  H  H      . GLU A 1 375 ? -61.153  50.719  -21.322 1.00 83.20  ? 1337 GLU A H      1 
ATOM   5762  H  HA     . GLU A 1 375 ? -61.417  48.772  -22.121 1.00 87.89  ? 1337 GLU A HA     1 
ATOM   5763  H  HB2    . GLU A 1 375 ? -59.069  49.291  -23.594 1.00 90.48  ? 1337 GLU A HB2    1 
ATOM   5764  H  HB3    . GLU A 1 375 ? -60.153  48.190  -23.964 1.00 90.48  ? 1337 GLU A HB3    1 
ATOM   5765  H  HG2    . GLU A 1 375 ? -61.700  49.879  -24.410 1.00 94.03  ? 1337 GLU A HG2    1 
ATOM   5766  H  HG3    . GLU A 1 375 ? -60.594  50.970  -24.074 1.00 94.03  ? 1337 GLU A HG3    1 
ATOM   5767  N  N      . GLY A 1 376 ? -59.752  48.150  -19.984 1.00 68.94  ? 1338 GLY A N      1 
ATOM   5768  C  CA     . GLY A 1 376 ? -59.096  47.222  -19.087 1.00 69.13  ? 1338 GLY A CA     1 
ATOM   5769  C  C      . GLY A 1 376 ? -57.589  47.322  -19.030 1.00 71.20  ? 1338 GLY A C      1 
ATOM   5770  O  O      . GLY A 1 376 ? -56.975  46.634  -18.206 1.00 69.74  ? 1338 GLY A O      1 
ATOM   5771  H  H      . GLY A 1 376 ? -60.167  48.786  -19.580 1.00 82.73  ? 1338 GLY A H      1 
ATOM   5772  H  HA2    . GLY A 1 376 ? -59.436  47.362  -18.190 1.00 82.95  ? 1338 GLY A HA2    1 
ATOM   5773  H  HA3    . GLY A 1 376 ? -59.323  46.317  -19.354 1.00 82.95  ? 1338 GLY A HA3    1 
ATOM   5774  N  N      . GLU A 1 377 ? -56.968  48.146  -19.868 1.00 77.50  ? 1339 GLU A N      1 
ATOM   5775  C  CA     . GLU A 1 377 ? -55.522  48.298  -19.858 1.00 79.04  ? 1339 GLU A CA     1 
ATOM   5776  C  C      . GLU A 1 377 ? -55.084  49.237  -18.740 1.00 74.97  ? 1339 GLU A C      1 
ATOM   5777  O  O      . GLU A 1 377 ? -55.814  50.150  -18.341 1.00 75.59  ? 1339 GLU A O      1 
ATOM   5778  C  CB     . GLU A 1 377 ? -55.031  48.840  -21.202 1.00 82.13  ? 1339 GLU A CB     1 
ATOM   5779  C  CG     . GLU A 1 377 ? -55.320  47.936  -22.388 1.00 86.57  ? 1339 GLU A CG     1 
ATOM   5780  C  CD     . GLU A 1 377 ? -54.573  46.615  -22.316 1.00 89.77  ? 1339 GLU A CD     1 
ATOM   5781  O  OE1    . GLU A 1 377 ? -53.475  46.584  -21.721 1.00 90.51  ? 1339 GLU A OE1    1 
ATOM   5782  O  OE2    . GLU A 1 377 ? -55.084  45.609  -22.850 1.00 92.09  1 1339 GLU A OE2    1 
ATOM   5783  H  H      . GLU A 1 377 ? -57.367  48.632  -20.455 1.00 93.01  ? 1339 GLU A H      1 
ATOM   5784  H  HA     . GLU A 1 377 ? -55.109  47.433  -19.708 1.00 94.85  ? 1339 GLU A HA     1 
ATOM   5785  H  HB2    . GLU A 1 377 ? -55.462  49.693  -21.369 1.00 98.55  ? 1339 GLU A HB2    1 
ATOM   5786  H  HB3    . GLU A 1 377 ? -54.070  48.965  -21.153 1.00 98.55  ? 1339 GLU A HB3    1 
ATOM   5787  H  HG2    . GLU A 1 377 ? -56.270  47.743  -22.414 1.00 103.89 ? 1339 GLU A HG2    1 
ATOM   5788  H  HG3    . GLU A 1 377 ? -55.051  48.388  -23.203 1.00 103.89 ? 1339 GLU A HG3    1 
ATOM   5789  N  N      . LEU A 1 378 ? -53.878  49.001  -18.236 1.00 68.07  ? 1340 LEU A N      1 
ATOM   5790  C  CA     . LEU A 1 378 ? -53.262  49.888  -17.264 1.00 61.27  ? 1340 LEU A CA     1 
ATOM   5791  C  C      . LEU A 1 378 ? -52.415  50.932  -17.976 1.00 57.20  ? 1340 LEU A C      1 
ATOM   5792  O  O      . LEU A 1 378 ? -51.945  50.721  -19.098 1.00 60.44  ? 1340 LEU A O      1 
ATOM   5793  C  CB     . LEU A 1 378 ? -52.391  49.105  -16.281 1.00 64.64  ? 1340 LEU A CB     1 
ATOM   5794  C  CG     . LEU A 1 378 ? -53.093  48.131  -15.334 1.00 64.92  ? 1340 LEU A CG     1 
ATOM   5795  C  CD1    . LEU A 1 378 ? -52.065  47.357  -14.528 1.00 66.56  ? 1340 LEU A CD1    1 
ATOM   5796  C  CD2    . LEU A 1 378 ? -54.045  48.870  -14.408 1.00 63.64  ? 1340 LEU A CD2    1 
ATOM   5797  H  H      . LEU A 1 378 ? -53.391  48.324  -18.445 1.00 81.68  ? 1340 LEU A H      1 
ATOM   5798  H  HA     . LEU A 1 378 ? -53.955  50.346  -16.762 1.00 73.52  ? 1340 LEU A HA     1 
ATOM   5799  H  HB2    . LEU A 1 378 ? -51.750  48.589  -16.795 1.00 77.57  ? 1340 LEU A HB2    1 
ATOM   5800  H  HB3    . LEU A 1 378 ? -51.914  49.744  -15.728 1.00 77.57  ? 1340 LEU A HB3    1 
ATOM   5801  H  HG     . LEU A 1 378 ? -53.609  47.496  -15.855 1.00 77.91  ? 1340 LEU A HG     1 
ATOM   5802  H  HD11   . LEU A 1 378 ? -52.526  46.745  -13.933 1.00 79.87  ? 1340 LEU A HD11   1 
ATOM   5803  H  HD12   . LEU A 1 378 ? -51.495  46.862  -15.137 1.00 79.87  ? 1340 LEU A HD12   1 
ATOM   5804  H  HD13   . LEU A 1 378 ? -51.533  47.983  -14.012 1.00 79.87  ? 1340 LEU A HD13   1 
ATOM   5805  H  HD21   . LEU A 1 378 ? -54.475  48.229  -13.820 1.00 76.37  ? 1340 LEU A HD21   1 
ATOM   5806  H  HD22   . LEU A 1 378 ? -53.541  49.513  -13.885 1.00 76.37  ? 1340 LEU A HD22   1 
ATOM   5807  H  HD23   . LEU A 1 378 ? -54.713  49.328  -14.943 1.00 76.37  ? 1340 LEU A HD23   1 
ATOM   5808  N  N      . ALA A 1 379 ? -52.226  52.066  -17.314 1.00 51.08  ? 1341 ALA A N      1 
ATOM   5809  C  CA     . ALA A 1 379 ? -51.416  53.124  -17.893 1.00 53.98  ? 1341 ALA A CA     1 
ATOM   5810  C  C      . ALA A 1 379 ? -49.982  52.629  -18.075 1.00 52.02  ? 1341 ALA A C      1 
ATOM   5811  O  O      . ALA A 1 379 ? -49.463  51.907  -17.215 1.00 50.13  ? 1341 ALA A O      1 
ATOM   5812  C  CB     . ALA A 1 379 ? -51.438  54.365  -16.998 1.00 51.30  ? 1341 ALA A CB     1 
ATOM   5813  H  H      . ALA A 1 379 ? -52.552  52.246  -16.539 1.00 61.29  ? 1341 ALA A H      1 
ATOM   5814  H  HA     . ALA A 1 379 ? -51.771  53.365  -18.763 1.00 64.78  ? 1341 ALA A HA     1 
ATOM   5815  H  HB1    . ALA A 1 379 ? -50.892  55.056  -17.404 1.00 61.56  ? 1341 ALA A HB1    1 
ATOM   5816  H  HB2    . ALA A 1 379 ? -52.353  54.675  -16.911 1.00 61.56  ? 1341 ALA A HB2    1 
ATOM   5817  H  HB3    . ALA A 1 379 ? -51.083  54.132  -16.126 1.00 61.56  ? 1341 ALA A HB3    1 
ATOM   5818  N  N      . PRO A 1 380 ? -49.314  52.982  -19.173 1.00 52.43  ? 1342 PRO A N      1 
ATOM   5819  C  CA     . PRO A 1 380 ? -47.921  52.552  -19.337 1.00 54.00  ? 1342 PRO A CA     1 
ATOM   5820  C  C      . PRO A 1 380 ? -47.037  53.146  -18.249 1.00 54.80  ? 1342 PRO A C      1 
ATOM   5821  O  O      . PRO A 1 380 ? -47.319  54.215  -17.704 1.00 49.50  ? 1342 PRO A O      1 
ATOM   5822  C  CB     . PRO A 1 380 ? -47.545  53.073  -20.730 1.00 53.17  ? 1342 PRO A CB     1 
ATOM   5823  C  CG     . PRO A 1 380 ? -48.520  54.158  -21.022 1.00 53.32  ? 1342 PRO A CG     1 
ATOM   5824  C  CD     . PRO A 1 380 ? -49.787  53.782  -20.315 1.00 53.36  ? 1342 PRO A CD     1 
ATOM   5825  H  HA     . PRO A 1 380 ? -47.856  51.585  -19.321 1.00 64.80  ? 1342 PRO A HA     1 
ATOM   5826  H  HB2    . PRO A 1 380 ? -46.639  53.421  -20.715 1.00 63.81  ? 1342 PRO A HB2    1 
ATOM   5827  H  HB3    . PRO A 1 380 ? -47.625  52.356  -21.379 1.00 63.81  ? 1342 PRO A HB3    1 
ATOM   5828  H  HG2    . PRO A 1 380 ? -48.179  55.000  -20.683 1.00 63.98  ? 1342 PRO A HG2    1 
ATOM   5829  H  HG3    . PRO A 1 380 ? -48.668  54.211  -21.980 1.00 63.98  ? 1342 PRO A HG3    1 
ATOM   5830  H  HD2    . PRO A 1 380 ? -50.249  54.576  -20.005 1.00 64.03  ? 1342 PRO A HD2    1 
ATOM   5831  H  HD3    . PRO A 1 380 ? -50.350  53.245  -20.894 1.00 64.03  ? 1342 PRO A HD3    1 
ATOM   5832  N  N      . ASN A 1 381 ? -45.954  52.430  -17.931 1.00 62.28  ? 1343 ASN A N      1 
ATOM   5833  C  CA     . ASN A 1 381 ? -45.071  52.821  -16.840 1.00 66.54  ? 1343 ASN A CA     1 
ATOM   5834  C  C      . ASN A 1 381 ? -43.616  52.492  -17.148 1.00 71.37  ? 1343 ASN A C      1 
ATOM   5835  O  O      . ASN A 1 381 ? -42.848  52.156  -16.240 1.00 71.16  ? 1343 ASN A O      1 
ATOM   5836  C  CB     . ASN A 1 381 ? -45.485  52.133  -15.538 1.00 66.28  ? 1343 ASN A CB     1 
ATOM   5837  C  CG     . ASN A 1 381 ? -45.254  50.636  -15.576 1.00 66.85  ? 1343 ASN A CG     1 
ATOM   5838  O  OD1    . ASN A 1 381 ? -45.081  50.051  -16.645 1.00 67.91  ? 1343 ASN A OD1    1 
ATOM   5839  N  ND2    . ASN A 1 381 ? -45.254  50.007  -14.408 1.00 69.39  ? 1343 ASN A ND2    1 
ATOM   5840  H  H      . ASN A 1 381 ? -45.713  51.711  -18.336 1.00 74.74  ? 1343 ASN A H      1 
ATOM   5841  H  HA     . ASN A 1 381 ? -45.139  53.780  -16.707 1.00 79.85  ? 1343 ASN A HA     1 
ATOM   5842  H  HB2    . ASN A 1 381 ? -44.964  52.499  -14.806 1.00 79.53  ? 1343 ASN A HB2    1 
ATOM   5843  H  HB3    . ASN A 1 381 ? -46.430  52.288  -15.384 1.00 79.53  ? 1343 ASN A HB3    1 
ATOM   5844  H  HD21   . ASN A 1 381 ? -45.128  49.157  -14.377 1.00 83.26  ? 1343 ASN A HD21   1 
ATOM   5845  H  HD22   . ASN A 1 381 ? -45.381  50.450  -13.682 1.00 83.26  ? 1343 ASN A HD22   1 
ATOM   5846  N  N      . ASP A 1 382 ? -43.216  52.584  -18.417 1.00 76.89  ? 1344 ASP A N      1 
ATOM   5847  C  CA     . ASP A 1 382 ? -41.870  52.167  -18.797 1.00 81.43  ? 1344 ASP A CA     1 
ATOM   5848  C  C      . ASP A 1 382 ? -40.806  53.112  -18.252 1.00 81.20  ? 1344 ASP A C      1 
ATOM   5849  O  O      . ASP A 1 382 ? -39.703  52.669  -17.915 1.00 83.24  ? 1344 ASP A O      1 
ATOM   5850  C  CB     . ASP A 1 382 ? -41.770  52.064  -20.318 1.00 82.90  ? 1344 ASP A CB     1 
ATOM   5851  C  CG     . ASP A 1 382 ? -42.803  51.122  -20.902 1.00 82.87  ? 1344 ASP A CG     1 
ATOM   5852  O  OD1    . ASP A 1 382 ? -43.329  50.277  -20.147 1.00 82.08  ? 1344 ASP A OD1    1 
ATOM   5853  O  OD2    . ASP A 1 382 ? -43.089  51.226  -22.112 1.00 85.16  1 1344 ASP A OD2    1 
ATOM   5854  H  H      . ASP A 1 382 ? -43.697  52.879  -19.066 1.00 92.27  ? 1344 ASP A H      1 
ATOM   5855  H  HA     . ASP A 1 382 ? -41.700  51.286  -18.428 1.00 97.71  ? 1344 ASP A HA     1 
ATOM   5856  H  HB2    . ASP A 1 382 ? -41.910  52.942  -20.705 1.00 99.48  ? 1344 ASP A HB2    1 
ATOM   5857  H  HB3    . ASP A 1 382 ? -40.891  51.731  -20.556 1.00 99.48  ? 1344 ASP A HB3    1 
ATOM   5858  N  N      . ARG A 1 383 ? -41.109  54.408  -18.160 1.00 79.25  ? 1345 ARG A N      1 
ATOM   5859  C  CA     . ARG A 1 383 ? -40.183  55.360  -17.557 1.00 78.87  ? 1345 ARG A CA     1 
ATOM   5860  C  C      . ARG A 1 383 ? -40.046  55.177  -16.052 1.00 74.32  ? 1345 ARG A C      1 
ATOM   5861  O  O      . ARG A 1 383 ? -39.171  55.807  -15.447 1.00 76.61  ? 1345 ARG A O      1 
ATOM   5862  C  CB     . ARG A 1 383 ? -40.641  56.795  -17.823 1.00 81.17  ? 1345 ARG A CB     1 
ATOM   5863  C  CG     . ARG A 1 383 ? -40.744  57.199  -19.284 1.00 84.43  ? 1345 ARG A CG     1 
ATOM   5864  C  CD     . ARG A 1 383 ? -41.398  58.572  -19.392 1.00 85.44  ? 1345 ARG A CD     1 
ATOM   5865  N  NE     . ARG A 1 383 ? -40.729  59.553  -18.539 1.00 89.60  ? 1345 ARG A NE     1 
ATOM   5866  C  CZ     . ARG A 1 383 ? -41.289  60.671  -18.083 1.00 89.52  ? 1345 ARG A CZ     1 
ATOM   5867  N  NH1    . ARG A 1 383 ? -42.545  60.969  -18.385 1.00 88.97  1 1345 ARG A NH1    1 
ATOM   5868  N  NH2    . ARG A 1 383 ? -40.590  61.494  -17.313 1.00 90.82  ? 1345 ARG A NH2    1 
ATOM   5869  H  H      . ARG A 1 383 ? -41.843  54.759  -18.438 1.00 95.11  ? 1345 ARG A H      1 
ATOM   5870  H  HA     . ARG A 1 383 ? -39.306  55.244  -17.956 1.00 94.64  ? 1345 ARG A HA     1 
ATOM   5871  H  HB2    . ARG A 1 383 ? -41.519  56.913  -17.428 1.00 97.41  ? 1345 ARG A HB2    1 
ATOM   5872  H  HB3    . ARG A 1 383 ? -40.012  57.400  -17.399 1.00 97.41  ? 1345 ARG A HB3    1 
ATOM   5873  H  HG2    . ARG A 1 383 ? -39.857  57.247  -19.672 1.00 101.31 ? 1345 ARG A HG2    1 
ATOM   5874  H  HG3    . ARG A 1 383 ? -41.292  56.557  -19.762 1.00 101.31 ? 1345 ARG A HG3    1 
ATOM   5875  H  HD2    . ARG A 1 383 ? -41.344  58.881  -20.310 1.00 102.53 ? 1345 ARG A HD2    1 
ATOM   5876  H  HD3    . ARG A 1 383 ? -42.325  58.509  -19.113 1.00 102.53 ? 1345 ARG A HD3    1 
ATOM   5877  H  HE     . ARG A 1 383 ? -39.913  59.396  -18.315 1.00 107.52 ? 1345 ARG A HE     1 
ATOM   5878  H  HH11   . ARG A 1 383 ? -43.005  60.440  -18.883 1.00 106.76 ? 1345 ARG A HH11   1 
ATOM   5879  H  HH12   . ARG A 1 383 ? -42.900  61.693  -18.085 1.00 106.76 ? 1345 ARG A HH12   1 
ATOM   5880  H  HH21   . ARG A 1 383 ? -39.775  61.307  -17.112 1.00 108.99 ? 1345 ARG A HH21   1 
ATOM   5881  H  HH22   . ARG A 1 383 ? -40.951  62.216  -17.016 1.00 108.99 ? 1345 ARG A HH22   1 
ATOM   5882  N  N      . CYS A 1 384 ? -40.882  54.350  -15.436 1.00 68.08  ? 1346 CYS A N      1 
ATOM   5883  C  CA     . CYS A 1 384 ? -40.996  54.316  -13.987 1.00 64.36  ? 1346 CYS A CA     1 
ATOM   5884  C  C      . CYS A 1 384 ? -40.087  53.260  -13.375 1.00 60.93  ? 1346 CYS A C      1 
ATOM   5885  O  O      . CYS A 1 384 ? -39.799  52.223  -13.979 1.00 60.28  ? 1346 CYS A O      1 
ATOM   5886  C  CB     . CYS A 1 384 ? -42.441  54.045  -13.571 1.00 60.43  ? 1346 CYS A CB     1 
ATOM   5887  S  SG     . CYS A 1 384 ? -43.601  55.329  -14.068 1.00 57.30  ? 1346 CYS A SG     1 
ATOM   5888  H  H      . CYS A 1 384 ? -41.398  53.794  -15.840 1.00 81.70  ? 1346 CYS A H      1 
ATOM   5889  H  HA     . CYS A 1 384 ? -40.736  55.180  -13.629 1.00 77.23  ? 1346 CYS A HA     1 
ATOM   5890  H  HB2    . CYS A 1 384 ? -42.730  53.212  -13.975 1.00 72.52  ? 1346 CYS A HB2    1 
ATOM   5891  H  HB3    . CYS A 1 384 ? -42.478  53.971  -12.604 1.00 72.52  ? 1346 CYS A HB3    1 
ATOM   5892  H  HG     . CYS A 1 384 ? -44.701  55.026  -13.698 1.00 68.76  ? 1346 CYS A HG     1 
ATOM   5893  N  N      . CYS A 1 385 ? -39.642  53.545  -12.155 1.00 60.49  ? 1347 CYS A N      1 
ATOM   5894  C  CA     . CYS A 1 385 ? -38.899  52.576  -11.364 1.00 61.71  ? 1347 CYS A CA     1 
ATOM   5895  C  C      . CYS A 1 385 ? -39.740  51.325  -11.145 1.00 60.36  ? 1347 CYS A C      1 
ATOM   5896  O  O      . CYS A 1 385 ? -40.947  51.402  -10.901 1.00 59.24  ? 1347 CYS A O      1 
ATOM   5897  C  CB     . CYS A 1 385 ? -38.505  53.208  -10.025 1.00 60.73  ? 1347 CYS A CB     1 
ATOM   5898  S  SG     . CYS A 1 385 ? -37.789  52.092  -8.798  1.00 66.12  ? 1347 CYS A SG     1 
ATOM   5899  H  H      . CYS A 1 385 ? -39.759  54.301  -11.761 1.00 72.59  ? 1347 CYS A H      1 
ATOM   5900  H  HA     . CYS A 1 385 ? -38.089  52.325  -11.836 1.00 74.05  ? 1347 CYS A HA     1 
ATOM   5901  H  HB2    . CYS A 1 385 ? -37.852  53.905  -10.197 1.00 72.88  ? 1347 CYS A HB2    1 
ATOM   5902  H  HB3    . CYS A 1 385 ? -39.298  53.601  -9.629  1.00 72.88  ? 1347 CYS A HB3    1 
ATOM   5903  N  N      . ARG A 1 386 ? -39.097  50.160  -11.240 1.00 63.38  ? 1348 ARG A N      1 
ATOM   5904  C  CA     . ARG A 1 386 ? -39.806  48.896  -11.085 1.00 65.64  ? 1348 ARG A CA     1 
ATOM   5905  C  C      . ARG A 1 386 ? -40.130  48.568  -9.632  1.00 67.48  ? 1348 ARG A C      1 
ATOM   5906  O  O      . ARG A 1 386 ? -40.864  47.606  -9.381  1.00 66.47  ? 1348 ARG A O      1 
ATOM   5907  C  CB     . ARG A 1 386 ? -38.986  47.756  -11.696 1.00 64.02  ? 1348 ARG A CB     1 
ATOM   5908  C  CG     . ARG A 1 386 ? -37.686  47.460  -10.965 1.00 67.86  ? 1348 ARG A CG     1 
ATOM   5909  C  CD     . ARG A 1 386 ? -36.883  46.390  -11.684 1.00 68.41  ? 1348 ARG A CD     1 
ATOM   5910  N  NE     . ARG A 1 386 ? -36.441  46.837  -13.001 1.00 68.04  ? 1348 ARG A NE     1 
ATOM   5911  C  CZ     . ARG A 1 386 ? -35.725  46.099  -13.844 1.00 69.42  ? 1348 ARG A CZ     1 
ATOM   5912  N  NH1    . ARG A 1 386 ? -35.363  44.865  -13.514 1.00 71.79  1 1348 ARG A NH1    1 
ATOM   5913  N  NH2    . ARG A 1 386 ? -35.369  46.596  -15.019 1.00 67.30  ? 1348 ARG A NH2    1 
ATOM   5914  H  H      . ARG A 1 386 ? -38.255  50.078  -11.394 1.00 76.06  ? 1348 ARG A H      1 
ATOM   5915  H  HA     . ARG A 1 386 ? -40.645  48.949  -11.569 1.00 78.77  ? 1348 ARG A HA     1 
ATOM   5916  H  HB2    . ARG A 1 386 ? -39.522  46.947  -11.685 1.00 76.83  ? 1348 ARG A HB2    1 
ATOM   5917  H  HB3    . ARG A 1 386 ? -38.764  47.989  -12.611 1.00 76.83  ? 1348 ARG A HB3    1 
ATOM   5918  H  HG2    . ARG A 1 386 ? -37.150  48.267  -10.924 1.00 81.43  ? 1348 ARG A HG2    1 
ATOM   5919  H  HG3    . ARG A 1 386 ? -37.886  47.143  -10.071 1.00 81.43  ? 1348 ARG A HG3    1 
ATOM   5920  H  HD2    . ARG A 1 386 ? -36.098  46.173  -11.157 1.00 82.09  ? 1348 ARG A HD2    1 
ATOM   5921  H  HD3    . ARG A 1 386 ? -37.436  45.602  -11.801 1.00 82.09  ? 1348 ARG A HD3    1 
ATOM   5922  H  HE     . ARG A 1 386 ? -36.658  47.632  -13.249 1.00 81.65  ? 1348 ARG A HE     1 
ATOM   5923  H  HH11   . ARG A 1 386 ? -35.591  44.539  -12.752 1.00 86.15  ? 1348 ARG A HH11   1 
ATOM   5924  H  HH12   . ARG A 1 386 ? -34.900  44.392  -14.063 1.00 86.15  ? 1348 ARG A HH12   1 
ATOM   5925  H  HH21   . ARG A 1 386 ? -35.602  47.395  -15.236 1.00 80.76  ? 1348 ARG A HH21   1 
ATOM   5926  H  HH22   . ARG A 1 386 ? -34.906  46.120  -15.565 1.00 80.76  ? 1348 ARG A HH22   1 
ATOM   5927  N  N      . ILE A 1 387 ? -39.613  49.336  -8.679  1.00 69.77  ? 1349 ILE A N      1 
ATOM   5928  C  CA     . ILE A 1 387 ? -39.868  49.075  -7.266  1.00 72.71  ? 1349 ILE A CA     1 
ATOM   5929  C  C      . ILE A 1 387 ? -41.077  49.856  -6.769  1.00 73.22  ? 1349 ILE A C      1 
ATOM   5930  O  O      . ILE A 1 387 ? -41.986  49.289  -6.158  1.00 73.02  ? 1349 ILE A O      1 
ATOM   5931  C  CB     . ILE A 1 387 ? -38.606  49.404  -6.440  1.00 78.21  ? 1349 ILE A CB     1 
ATOM   5932  C  CG1    . ILE A 1 387 ? -37.428  48.548  -6.915  1.00 80.02  ? 1349 ILE A CG1    1 
ATOM   5933  C  CG2    . ILE A 1 387 ? -38.871  49.180  -4.955  1.00 80.17  ? 1349 ILE A CG2    1 
ATOM   5934  C  CD1    . ILE A 1 387 ? -36.103  48.909  -6.278  1.00 83.62  ? 1349 ILE A CD1    1 
ATOM   5935  H  H      . ILE A 1 387 ? -39.109  50.017  -8.824  1.00 83.72  ? 1349 ILE A H      1 
ATOM   5936  H  HA     . ILE A 1 387 ? -40.058  48.131  -7.152  1.00 87.25  ? 1349 ILE A HA     1 
ATOM   5937  H  HB     . ILE A 1 387 ? -38.383  50.338  -6.576  1.00 93.86  ? 1349 ILE A HB     1 
ATOM   5938  H  HG12   . ILE A 1 387 ? -37.613  47.619  -6.705  1.00 96.03  ? 1349 ILE A HG12   1 
ATOM   5939  H  HG13   . ILE A 1 387 ? -37.332  48.654  -7.874  1.00 96.03  ? 1349 ILE A HG13   1 
ATOM   5940  H  HG21   . ILE A 1 387 ? -38.067  49.392  -4.456  1.00 96.21  ? 1349 ILE A HG21   1 
ATOM   5941  H  HG22   . ILE A 1 387 ? -39.597  49.758  -4.673  1.00 96.21  ? 1349 ILE A HG22   1 
ATOM   5942  H  HG23   . ILE A 1 387 ? -39.113  48.251  -4.814  1.00 96.21  ? 1349 ILE A HG23   1 
ATOM   5943  H  HD11   . ILE A 1 387 ? -35.414  48.324  -6.630  1.00 100.35 ? 1349 ILE A HD11   1 
ATOM   5944  H  HD12   . ILE A 1 387 ? -35.893  49.832  -6.488  1.00 100.35 ? 1349 ILE A HD12   1 
ATOM   5945  H  HD13   . ILE A 1 387 ? -36.174  48.796  -5.317  1.00 100.35 ? 1349 ILE A HD13   1 
ATOM   5946  N  N      . CYS A 1 388 ? -41.107  51.168  -7.020  1.00 76.02  ? 1350 CYS A N      1 
ATOM   5947  C  CA     . CYS A 1 388 ? -42.164  52.031  -6.511  1.00 76.92  ? 1350 CYS A CA     1 
ATOM   5948  C  C      . CYS A 1 388 ? -43.100  52.558  -7.586  1.00 74.13  ? 1350 CYS A C      1 
ATOM   5949  O  O      . CYS A 1 388 ? -44.228  52.943  -7.261  1.00 75.13  ? 1350 CYS A O      1 
ATOM   5950  C  CB     . CYS A 1 388 ? -41.556  53.228  -5.765  1.00 80.28  ? 1350 CYS A CB     1 
ATOM   5951  S  SG     . CYS A 1 388 ? -40.629  54.360  -6.823  1.00 78.89  ? 1350 CYS A SG     1 
ATOM   5952  H  H      . CYS A 1 388 ? -40.518  51.582  -7.490  1.00 91.22  ? 1350 CYS A H      1 
ATOM   5953  H  HA     . CYS A 1 388 ? -42.697  51.527  -5.876  1.00 92.30  ? 1350 CYS A HA     1 
ATOM   5954  H  HB2    . CYS A 1 388 ? -42.273  53.732  -5.349  1.00 96.34  ? 1350 CYS A HB2    1 
ATOM   5955  H  HB3    . CYS A 1 388 ? -40.950  52.896  -5.084  1.00 96.34  ? 1350 CYS A HB3    1 
ATOM   5956  N  N      . GLY A 1 389 ? -42.671  52.588  -8.845  1.00 67.67  ? 1351 GLY A N      1 
ATOM   5957  C  CA     . GLY A 1 389 ? -43.503  53.092  -9.916  1.00 58.63  ? 1351 GLY A CA     1 
ATOM   5958  C  C      . GLY A 1 389 ? -43.384  54.575  -10.179 1.00 55.88  ? 1351 GLY A C      1 
ATOM   5959  O  O      . GLY A 1 389 ? -44.205  55.119  -10.927 1.00 56.96  ? 1351 GLY A O      1 
ATOM   5960  H  H      . GLY A 1 389 ? -41.895  52.319  -9.100  1.00 81.21  ? 1351 GLY A H      1 
ATOM   5961  H  HA2    . GLY A 1 389 ? -43.276  52.625  -10.735 1.00 70.35  ? 1351 GLY A HA2    1 
ATOM   5962  H  HA3    . GLY A 1 389 ? -44.431  52.900  -9.709  1.00 70.35  ? 1351 GLY A HA3    1 
ATOM   5963  N  N      . LYS A 1 390 ? -42.394  55.243  -9.595  1.00 56.85  ? 1352 LYS A N      1 
ATOM   5964  C  CA     . LYS A 1 390 ? -42.154  56.661  -9.811  1.00 56.92  ? 1352 LYS A CA     1 
ATOM   5965  C  C      . LYS A 1 390 ? -41.006  56.859  -10.795 1.00 56.32  ? 1352 LYS A C      1 
ATOM   5966  O  O      . LYS A 1 390 ? -40.157  55.985  -10.984 1.00 58.78  ? 1352 LYS A O      1 
ATOM   5967  C  CB     . LYS A 1 390 ? -41.829  57.368  -8.490  1.00 63.58  ? 1352 LYS A CB     1 
ATOM   5968  C  CG     . LYS A 1 390 ? -42.921  57.285  -7.430  1.00 64.48  ? 1352 LYS A CG     1 
ATOM   5969  C  CD     . LYS A 1 390 ? -44.209  57.946  -7.894  1.00 65.34  ? 1352 LYS A CD     1 
ATOM   5970  C  CE     . LYS A 1 390 ? -45.167  58.178  -6.732  1.00 68.04  ? 1352 LYS A CE     1 
ATOM   5971  N  NZ     . LYS A 1 390 ? -44.690  59.243  -5.807  1.00 70.79  1 1352 LYS A NZ     1 
ATOM   5972  H  H      . LYS A 1 390 ? -41.832  54.882  -9.054  1.00 68.22  ? 1352 LYS A H      1 
ATOM   5973  H  HA     . LYS A 1 390 ? -42.951  57.068  -10.187 1.00 68.30  ? 1352 LYS A HA     1 
ATOM   5974  H  HB2    . LYS A 1 390 ? -41.028  56.970  -8.116  1.00 76.29  ? 1352 LYS A HB2    1 
ATOM   5975  H  HB3    . LYS A 1 390 ? -41.671  58.307  -8.673  1.00 76.29  ? 1352 LYS A HB3    1 
ATOM   5976  H  HG2    . LYS A 1 390 ? -43.111  56.353  -7.239  1.00 77.38  ? 1352 LYS A HG2    1 
ATOM   5977  H  HG3    . LYS A 1 390 ? -42.621  57.737  -6.626  1.00 77.38  ? 1352 LYS A HG3    1 
ATOM   5978  H  HD2    . LYS A 1 390 ? -44.002  58.805  -8.293  1.00 78.41  ? 1352 LYS A HD2    1 
ATOM   5979  H  HD3    . LYS A 1 390 ? -44.649  57.372  -8.541  1.00 78.41  ? 1352 LYS A HD3    1 
ATOM   5980  H  HE2    . LYS A 1 390 ? -46.030  58.447  -7.081  1.00 81.64  ? 1352 LYS A HE2    1 
ATOM   5981  H  HE3    . LYS A 1 390 ? -45.255  57.356  -6.224  1.00 81.64  ? 1352 LYS A HE3    1 
ATOM   5982  H  HZ1    . LYS A 1 390 ? -45.272  59.351  -5.142  1.00 84.95  ? 1352 LYS A HZ1    1 
ATOM   5983  H  HZ2    . LYS A 1 390 ? -43.899  59.018  -5.466  1.00 84.95  ? 1352 LYS A HZ2    1 
ATOM   5984  H  HZ3    . LYS A 1 390 ? -44.606  60.012  -6.247  1.00 84.95  ? 1352 LYS A HZ3    1 
ATOM   5985  N  N      . ILE A 1 391 ? -40.987  58.031  -11.418 1.00 52.81  ? 1353 ILE A N      1 
ATOM   5986  C  CA     . ILE A 1 391 ? -39.937  58.393  -12.352 1.00 53.25  ? 1353 ILE A CA     1 
ATOM   5987  C  C      . ILE A 1 391 ? -38.898  59.234  -11.621 1.00 59.74  ? 1353 ILE A C      1 
ATOM   5988  O  O      . ILE A 1 391 ? -39.140  59.770  -10.536 1.00 59.15  ? 1353 ILE A O      1 
ATOM   5989  C  CB     . ILE A 1 391 ? -40.497  59.148  -13.583 1.00 52.81  ? 1353 ILE A CB     1 
ATOM   5990  C  CG1    . ILE A 1 391 ? -41.149  60.471  -13.164 1.00 53.95  ? 1353 ILE A CG1    1 
ATOM   5991  C  CG2    . ILE A 1 391 ? -41.503  58.284  -14.336 1.00 50.18  ? 1353 ILE A CG2    1 
ATOM   5992  C  CD1    . ILE A 1 391 ? -40.250  61.681  -13.314 1.00 55.53  ? 1353 ILE A CD1    1 
ATOM   5993  H  H      . ILE A 1 391 ? -41.583  58.642  -11.313 1.00 63.37  ? 1353 ILE A H      1 
ATOM   5994  H  HA     . ILE A 1 391 ? -39.502  57.586  -12.668 1.00 63.91  ? 1353 ILE A HA     1 
ATOM   5995  H  HB     . ILE A 1 391 ? -39.759  59.348  -14.180 1.00 63.37  ? 1353 ILE A HB     1 
ATOM   5996  H  HG12   . ILE A 1 391 ? -41.936  60.617  -13.713 1.00 64.74  ? 1353 ILE A HG12   1 
ATOM   5997  H  HG13   . ILE A 1 391 ? -41.408  60.408  -12.231 1.00 64.74  ? 1353 ILE A HG13   1 
ATOM   5998  H  HG21   . ILE A 1 391 ? -41.836  58.780  -15.100 1.00 60.21  ? 1353 ILE A HG21   1 
ATOM   5999  H  HG22   . ILE A 1 391 ? -41.060  57.474  -14.636 1.00 60.21  ? 1353 ILE A HG22   1 
ATOM   6000  H  HG23   . ILE A 1 391 ? -42.235  58.060  -13.741 1.00 60.21  ? 1353 ILE A HG23   1 
ATOM   6001  H  HD11   . ILE A 1 391 ? -40.736  62.471  -13.030 1.00 66.63  ? 1353 ILE A HD11   1 
ATOM   6002  H  HD12   . ILE A 1 391 ? -39.463  61.559  -12.761 1.00 66.63  ? 1353 ILE A HD12   1 
ATOM   6003  H  HD13   . ILE A 1 391 ? -39.991  61.768  -14.245 1.00 66.63  ? 1353 ILE A HD13   1 
ATOM   6004  N  N      . GLY A 1 392 ? -37.714  59.333  -12.216 1.00 65.47  ? 1354 GLY A N      1 
ATOM   6005  C  CA     . GLY A 1 392 ? -36.707  60.273  -11.771 1.00 69.19  ? 1354 GLY A CA     1 
ATOM   6006  C  C      . GLY A 1 392 ? -35.653  59.750  -10.816 1.00 70.45  ? 1354 GLY A C      1 
ATOM   6007  O  O      . GLY A 1 392 ? -35.014  60.562  -10.139 1.00 75.40  ? 1354 GLY A O      1 
ATOM   6008  H  H      . GLY A 1 392 ? -37.471  58.857  -12.889 1.00 78.57  ? 1354 GLY A H      1 
ATOM   6009  H  HA2    . GLY A 1 392 ? -36.247  60.622  -12.550 1.00 83.03  ? 1354 GLY A HA2    1 
ATOM   6010  H  HA3    . GLY A 1 392 ? -37.152  61.016  -11.335 1.00 83.03  ? 1354 GLY A HA3    1 
ATOM   6011  N  N      . HIS A 1 393 ? -35.441  58.438  -10.740 1.00 65.33  ? 1355 HIS A N      1 
ATOM   6012  C  CA     . HIS A 1 393 ? -34.397  57.917  -9.868  1.00 64.61  ? 1355 HIS A CA     1 
ATOM   6013  C  C      . HIS A 1 393 ? -34.029  56.503  -10.293 1.00 66.04  ? 1355 HIS A C      1 
ATOM   6014  O  O      . HIS A 1 393 ? -34.865  55.754  -10.803 1.00 62.21  ? 1355 HIS A O      1 
ATOM   6015  C  CB     . HIS A 1 393 ? -34.829  57.926  -8.394  1.00 63.41  ? 1355 HIS A CB     1 
ATOM   6016  C  CG     . HIS A 1 393 ? -35.896  56.926  -8.062  1.00 58.55  ? 1355 HIS A CG     1 
ATOM   6017  N  ND1    . HIS A 1 393 ? -37.193  57.291  -7.775  1.00 54.96  ? 1355 HIS A ND1    1 
ATOM   6018  C  CD2    . HIS A 1 393 ? -35.855  55.575  -7.958  1.00 56.22  ? 1355 HIS A CD2    1 
ATOM   6019  C  CE1    . HIS A 1 393 ? -37.906  56.209  -7.516  1.00 52.63  ? 1355 HIS A CE1    1 
ATOM   6020  N  NE2    . HIS A 1 393 ? -37.118  55.155  -7.621  1.00 53.75  ? 1355 HIS A NE2    1 
ATOM   6021  H  H      . HIS A 1 393 ? -35.880  57.839  -11.174 1.00 78.40  ? 1355 HIS A H      1 
ATOM   6022  H  HA     . HIS A 1 393 ? -33.606  58.472  -9.953  1.00 77.53  ? 1355 HIS A HA     1 
ATOM   6023  H  HB2    . HIS A 1 393 ? -34.057  57.729  -7.842  1.00 76.10  ? 1355 HIS A HB2    1 
ATOM   6024  H  HB3    . HIS A 1 393 ? -35.173  58.807  -8.176  1.00 76.10  ? 1355 HIS A HB3    1 
ATOM   6025  H  HD1    . HIS A 1 393 ? -37.492  58.097  -7.769  1.00 65.95  ? 1355 HIS A HD1    1 
ATOM   6026  H  HD2    . HIS A 1 393 ? -35.111  55.033  -8.095  1.00 67.47  ? 1355 HIS A HD2    1 
ATOM   6027  H  HE1    . HIS A 1 393 ? -38.810  56.193  -7.297  1.00 63.16  ? 1355 HIS A HE1    1 
ATOM   6028  N  N      . PHE A 1 394 ? -32.768  56.147  -10.059 1.00 75.88  ? 1356 PHE A N      1 
ATOM   6029  C  CA     . PHE A 1 394 ? -32.312  54.787  -10.285 1.00 80.15  ? 1356 PHE A CA     1 
ATOM   6030  C  C      . PHE A 1 394 ? -32.636  53.915  -9.076  1.00 83.73  ? 1356 PHE A C      1 
ATOM   6031  O  O      . PHE A 1 394 ? -32.915  54.404  -7.978  1.00 87.55  ? 1356 PHE A O      1 
ATOM   6032  C  CB     . PHE A 1 394 ? -30.812  54.766  -10.579 1.00 84.87  ? 1356 PHE A CB     1 
ATOM   6033  C  CG     . PHE A 1 394 ? -30.444  55.442  -11.869 1.00 87.62  ? 1356 PHE A CG     1 
ATOM   6034  C  CD1    . PHE A 1 394 ? -30.782  54.871  -13.086 1.00 87.00  ? 1356 PHE A CD1    1 
ATOM   6035  C  CD2    . PHE A 1 394 ? -29.765  56.648  -11.868 1.00 91.13  ? 1356 PHE A CD2    1 
ATOM   6036  C  CE1    . PHE A 1 394 ? -30.449  55.490  -14.276 1.00 88.40  ? 1356 PHE A CE1    1 
ATOM   6037  C  CE2    . PHE A 1 394 ? -29.428  57.272  -13.056 1.00 92.78  ? 1356 PHE A CE2    1 
ATOM   6038  C  CZ     . PHE A 1 394 ? -29.770  56.692  -14.260 1.00 91.60  ? 1356 PHE A CZ     1 
ATOM   6039  H  H      . PHE A 1 394 ? -32.158  56.679  -9.768  1.00 91.06  ? 1356 PHE A H      1 
ATOM   6040  H  HA     . PHE A 1 394 ? -32.775  54.421  -11.055 1.00 96.18  ? 1356 PHE A HA     1 
ATOM   6041  H  HB2    . PHE A 1 394 ? -30.345  55.221  -9.861  1.00 101.85 ? 1356 PHE A HB2    1 
ATOM   6042  H  HB3    . PHE A 1 394 ? -30.516  53.843  -10.632 1.00 101.85 ? 1356 PHE A HB3    1 
ATOM   6043  H  HD1    . PHE A 1 394 ? -31.239  54.061  -13.102 1.00 104.41 ? 1356 PHE A HD1    1 
ATOM   6044  H  HD2    . PHE A 1 394 ? -29.532  57.044  -11.059 1.00 109.36 ? 1356 PHE A HD2    1 
ATOM   6045  H  HE1    . PHE A 1 394 ? -30.680  55.097  -15.086 1.00 106.08 ? 1356 PHE A HE1    1 
ATOM   6046  H  HE2    . PHE A 1 394 ? -28.971  58.082  -13.043 1.00 111.34 ? 1356 PHE A HE2    1 
ATOM   6047  H  HZ     . PHE A 1 394 ? -29.545  57.110  -15.060 1.00 109.92 ? 1356 PHE A HZ     1 
ATOM   6048  N  N      . MET A 1 395 ? -32.596  52.598  -9.293  1.00 84.97  ? 1357 MET A N      1 
ATOM   6049  C  CA     . MET A 1 395 ? -33.088  51.666  -8.284  1.00 86.16  ? 1357 MET A CA     1 
ATOM   6050  C  C      . MET A 1 395 ? -32.300  51.757  -6.984  1.00 91.21  ? 1357 MET A C      1 
ATOM   6051  O  O      . MET A 1 395 ? -32.851  51.493  -5.909  1.00 91.54  ? 1357 MET A O      1 
ATOM   6052  C  CB     . MET A 1 395 ? -33.052  50.240  -8.829  1.00 86.06  ? 1357 MET A CB     1 
ATOM   6053  C  CG     . MET A 1 395 ? -34.395  49.758  -9.340  1.00 82.37  ? 1357 MET A CG     1 
ATOM   6054  S  SD     . MET A 1 395 ? -34.282  48.170  -10.176 1.00 85.26  ? 1357 MET A SD     1 
ATOM   6055  C  CE     . MET A 1 395 ? -33.561  48.675  -11.735 1.00 85.19  ? 1357 MET A CE     1 
ATOM   6056  H  H      . MET A 1 395 ? -32.293  52.227  -10.007 1.00 101.97 ? 1357 MET A H      1 
ATOM   6057  H  HA     . MET A 1 395 ? -34.015  51.881  -8.095  1.00 103.39 ? 1357 MET A HA     1 
ATOM   6058  H  HB2    . MET A 1 395 ? -32.421  50.201  -9.566  1.00 103.27 ? 1357 MET A HB2    1 
ATOM   6059  H  HB3    . MET A 1 395 ? -32.769  49.640  -8.121  1.00 103.27 ? 1357 MET A HB3    1 
ATOM   6060  H  HG2    . MET A 1 395 ? -35.003  49.661  -8.591  1.00 98.85  ? 1357 MET A HG2    1 
ATOM   6061  H  HG3    . MET A 1 395 ? -34.745  50.406  -9.972  1.00 98.85  ? 1357 MET A HG3    1 
ATOM   6062  H  HE1    . MET A 1 395 ? -33.443  47.893  -12.296 1.00 102.22 ? 1357 MET A HE1    1 
ATOM   6063  H  HE2    . MET A 1 395 ? -34.156  49.307  -12.168 1.00 102.22 ? 1357 MET A HE2    1 
ATOM   6064  H  HE3    . MET A 1 395 ? -32.702  49.093  -11.564 1.00 102.22 ? 1357 MET A HE3    1 
ATOM   6065  N  N      . LYS A 1 396 ? -31.018  52.122  -7.052  1.00 92.78  ? 1358 LYS A N      1 
ATOM   6066  C  CA     . LYS A 1 396 ? -30.234  52.270  -5.832  1.00 96.42  ? 1358 LYS A CA     1 
ATOM   6067  C  C      . LYS A 1 396 ? -30.713  53.438  -4.977  1.00 98.39  ? 1358 LYS A C      1 
ATOM   6068  O  O      . LYS A 1 396 ? -30.393  53.489  -3.784  1.00 100.73 ? 1358 LYS A O      1 
ATOM   6069  C  CB     . LYS A 1 396 ? -28.755  52.445  -6.177  1.00 99.09  ? 1358 LYS A CB     1 
ATOM   6070  C  CG     . LYS A 1 396 ? -28.134  51.221  -6.829  1.00 101.47 ? 1358 LYS A CG     1 
ATOM   6071  C  CD     . LYS A 1 396 ? -26.632  51.380  -7.009  1.00 106.67 ? 1358 LYS A CD     1 
ATOM   6072  C  CE     . LYS A 1 396 ? -25.994  50.094  -7.517  1.00 107.52 ? 1358 LYS A CE     1 
ATOM   6073  N  NZ     . LYS A 1 396 ? -24.512  50.205  -7.625  1.00 112.20 1 1358 LYS A NZ     1 
ATOM   6074  H  H      . LYS A 1 396 ? -30.589  52.287  -7.779  1.00 111.34 ? 1358 LYS A H      1 
ATOM   6075  H  HA     . LYS A 1 396 ? -30.322  51.461  -5.304  1.00 115.71 ? 1358 LYS A HA     1 
ATOM   6076  H  HB2    . LYS A 1 396 ? -28.663  53.189  -6.793  1.00 118.91 ? 1358 LYS A HB2    1 
ATOM   6077  H  HB3    . LYS A 1 396 ? -28.263  52.630  -5.362  1.00 118.91 ? 1358 LYS A HB3    1 
ATOM   6078  H  HG2    . LYS A 1 396 ? -28.291  50.446  -6.268  1.00 121.76 ? 1358 LYS A HG2    1 
ATOM   6079  H  HG3    . LYS A 1 396 ? -28.532  51.088  -7.704  1.00 121.76 ? 1358 LYS A HG3    1 
ATOM   6080  H  HD2    . LYS A 1 396 ? -26.459  52.081  -7.657  1.00 128.00 ? 1358 LYS A HD2    1 
ATOM   6081  H  HD3    . LYS A 1 396 ? -26.228  51.604  -6.156  1.00 128.00 ? 1358 LYS A HD3    1 
ATOM   6082  H  HE2    . LYS A 1 396 ? -26.198  49.373  -6.900  1.00 129.02 ? 1358 LYS A HE2    1 
ATOM   6083  H  HE3    . LYS A 1 396 ? -26.346  49.889  -8.397  1.00 129.02 ? 1358 LYS A HE3    1 
ATOM   6084  H  HZ1    . LYS A 1 396 ? -24.170  49.439  -7.923  1.00 134.64 ? 1358 LYS A HZ1    1 
ATOM   6085  H  HZ2    . LYS A 1 396 ? -24.297  50.857  -8.191  1.00 134.64 ? 1358 LYS A HZ2    1 
ATOM   6086  H  HZ3    . LYS A 1 396 ? -24.162  50.387  -6.827  1.00 134.64 ? 1358 LYS A HZ3    1 
ATOM   6087  N  N      . ASP A 1 397 ? -31.477  54.364  -5.554  1.00 97.21  ? 1359 ASP A N      1 
ATOM   6088  C  CA     . ASP A 1 397 ? -31.966  55.540  -4.846  1.00 96.20  ? 1359 ASP A CA     1 
ATOM   6089  C  C      . ASP A 1 397 ? -33.447  55.437  -4.495  1.00 91.75  ? 1359 ASP A C      1 
ATOM   6090  O  O      . ASP A 1 397 ? -34.033  56.420  -4.030  1.00 92.63  ? 1359 ASP A O      1 
ATOM   6091  C  CB     . ASP A 1 397 ? -31.718  56.793  -5.691  1.00 95.90  ? 1359 ASP A CB     1 
ATOM   6092  C  CG     . ASP A 1 397 ? -30.346  56.795  -6.346  1.00 98.76  ? 1359 ASP A CG     1 
ATOM   6093  O  OD1    . ASP A 1 397 ? -29.348  56.495  -5.656  1.00 101.05 ? 1359 ASP A OD1    1 
ATOM   6094  O  OD2    . ASP A 1 397 ? -30.270  57.086  -7.559  1.00 97.51  1 1359 ASP A OD2    1 
ATOM   6095  H  H      . ASP A 1 397 ? -31.731  54.330  -6.375  1.00 116.65 ? 1359 ASP A H      1 
ATOM   6096  H  HA     . ASP A 1 397 ? -31.470  55.635  -4.018  1.00 115.44 ? 1359 ASP A HA     1 
ATOM   6097  H  HB2    . ASP A 1 397 ? -32.386  56.839  -6.392  1.00 115.08 ? 1359 ASP A HB2    1 
ATOM   6098  H  HB3    . ASP A 1 397 ? -31.780  57.575  -5.121  1.00 115.08 ? 1359 ASP A HB3    1 
ATOM   6099  N  N      . CYS A 1 398 ? -34.060  54.274  -4.699  1.00 84.93  ? 1360 CYS A N      1 
ATOM   6100  C  CA     . CYS A 1 398 ? -35.490  54.133  -4.470  1.00 78.10  ? 1360 CYS A CA     1 
ATOM   6101  C  C      . CYS A 1 398 ? -35.787  54.098  -2.969  1.00 84.58  ? 1360 CYS A C      1 
ATOM   6102  O  O      . CYS A 1 398 ? -35.091  53.411  -2.214  1.00 85.41  ? 1360 CYS A O      1 
ATOM   6103  C  CB     . CYS A 1 398 ? -36.009  52.857  -5.130  1.00 73.89  ? 1360 CYS A CB     1 
ATOM   6104  S  SG     . CYS A 1 398 ? -37.802  52.653  -5.064  1.00 72.77  ? 1360 CYS A SG     1 
ATOM   6105  H  H      . CYS A 1 398 ? -33.671  53.556  -4.970  1.00 101.92 ? 1360 CYS A H      1 
ATOM   6106  H  HA     . CYS A 1 398 ? -35.956  54.891  -4.857  1.00 93.72  ? 1360 CYS A HA     1 
ATOM   6107  H  HB2    . CYS A 1 398 ? -35.748  52.863  -6.064  1.00 88.67  ? 1360 CYS A HB2    1 
ATOM   6108  H  HB3    . CYS A 1 398 ? -35.609  52.094  -4.684  1.00 88.67  ? 1360 CYS A HB3    1 
ATOM   6109  N  N      . PRO A 1 399 ? -36.807  54.827  -2.502  1.00 87.05  ? 1361 PRO A N      1 
ATOM   6110  C  CA     . PRO A 1 399 ? -37.173  54.712  -1.078  1.00 89.20  ? 1361 PRO A CA     1 
ATOM   6111  C  C      . PRO A 1 399 ? -37.706  53.341  -0.700  1.00 89.19  ? 1361 PRO A C      1 
ATOM   6112  O  O      . PRO A 1 399 ? -37.396  52.842  0.390   1.00 94.20  ? 1361 PRO A O      1 
ATOM   6113  C  CB     . PRO A 1 399 ? -38.240  55.802  -0.899  1.00 87.80  ? 1361 PRO A CB     1 
ATOM   6114  C  CG     . PRO A 1 399 ? -38.023  56.750  -2.025  1.00 85.24  ? 1361 PRO A CG     1 
ATOM   6115  C  CD     . PRO A 1 399 ? -37.530  55.924  -3.168  1.00 83.98  ? 1361 PRO A CD     1 
ATOM   6116  H  HA     . PRO A 1 399 ? -36.408  54.921  -0.519  1.00 107.03 ? 1361 PRO A HA     1 
ATOM   6117  H  HB2    . PRO A 1 399 ? -39.124  55.405  -0.951  1.00 105.36 ? 1361 PRO A HB2    1 
ATOM   6118  H  HB3    . PRO A 1 399 ? -38.113  56.247  -0.047  1.00 105.36 ? 1361 PRO A HB3    1 
ATOM   6119  H  HG2    . PRO A 1 399 ? -38.862  57.181  -2.253  1.00 102.29 ? 1361 PRO A HG2    1 
ATOM   6120  H  HG3    . PRO A 1 399 ? -37.359  57.410  -1.770  1.00 102.29 ? 1361 PRO A HG3    1 
ATOM   6121  H  HD2    . PRO A 1 399 ? -38.275  55.576  -3.681  1.00 100.78 ? 1361 PRO A HD2    1 
ATOM   6122  H  HD3    . PRO A 1 399 ? -36.924  56.440  -3.723  1.00 100.78 ? 1361 PRO A HD3    1 
ATOM   6123  N  N      . MET A 1 400 ? -38.506  52.718  -1.565  1.00 85.22  ? 1362 MET A N      1 
ATOM   6124  C  CA     . MET A 1 400 ? -39.118  51.426  -1.272  1.00 83.83  ? 1362 MET A CA     1 
ATOM   6125  C  C      . MET A 1 400 ? -38.152  50.255  -1.441  1.00 86.41  ? 1362 MET A C      1 
ATOM   6126  O  O      . MET A 1 400 ? -38.600  49.104  -1.459  1.00 86.46  ? 1362 MET A O      1 
ATOM   6127  C  CB     . MET A 1 400 ? -40.343  51.214  -2.167  1.00 80.03  ? 1362 MET A CB     1 
ATOM   6128  C  CG     . MET A 1 400 ? -41.468  52.230  -1.972  1.00 79.53  ? 1362 MET A CG     1 
ATOM   6129  S  SD     . MET A 1 400 ? -42.284  52.118  -0.361  1.00 86.93  ? 1362 MET A SD     1 
ATOM   6130  C  CE     . MET A 1 400 ? -41.400  53.361  0.577   1.00 89.66  ? 1362 MET A CE     1 
ATOM   6131  H  H      . MET A 1 400 ? -38.711  53.029  -2.339  1.00 102.26 ? 1362 MET A H      1 
ATOM   6132  H  HA     . MET A 1 400 ? -39.428  51.437  -0.353  1.00 100.60 ? 1362 MET A HA     1 
ATOM   6133  H  HB2    . MET A 1 400 ? -40.061  51.264  -3.094  1.00 96.04  ? 1362 MET A HB2    1 
ATOM   6134  H  HB3    . MET A 1 400 ? -40.709  50.334  -1.986  1.00 96.04  ? 1362 MET A HB3    1 
ATOM   6135  H  HG2    . MET A 1 400 ? -41.100  53.123  -2.056  1.00 95.44  ? 1362 MET A HG2    1 
ATOM   6136  H  HG3    . MET A 1 400 ? -42.141  52.086  -2.655  1.00 95.44  ? 1362 MET A HG3    1 
ATOM   6137  H  HE1    . MET A 1 400 ? -41.759  53.392  1.477   1.00 107.59 ? 1362 MET A HE1    1 
ATOM   6138  H  HE2    . MET A 1 400 ? -40.459  53.126  0.603   1.00 107.59 ? 1362 MET A HE2    1 
ATOM   6139  H  HE3    . MET A 1 400 ? -41.514  54.222  0.145   1.00 107.59 ? 1362 MET A HE3    1 
ATOM   6140  N  N      . ARG A 1 401 ? -36.854  50.516  -1.566  1.00 88.32  ? 1363 ARG A N      1 
ATOM   6141  C  CA     . ARG A 1 401 ? -35.858  49.453  -1.650  1.00 91.55  ? 1363 ARG A CA     1 
ATOM   6142  C  C      . ARG A 1 401 ? -35.589  48.860  -0.269  1.00 96.61  ? 1363 ARG A C      1 
ATOM   6143  O  O      . ARG A 1 401 ? -35.912  47.701  -0.003  1.00 97.38  ? 1363 ARG A O      1 
ATOM   6144  C  CB     . ARG A 1 401 ? -34.561  49.991  -2.260  1.00 93.02  ? 1363 ARG A CB     1 
ATOM   6145  C  CG     . ARG A 1 401 ? -33.417  48.984  -2.325  1.00 96.38  ? 1363 ARG A CG     1 
ATOM   6146  C  CD     . ARG A 1 401 ? -32.188  49.601  -2.981  1.00 96.80  ? 1363 ARG A CD     1 
ATOM   6147  N  NE     . ARG A 1 401 ? -31.068  48.667  -3.078  1.00 99.80  ? 1363 ARG A NE     1 
ATOM   6148  C  CZ     . ARG A 1 401 ? -30.118  48.522  -2.157  1.00 103.27 ? 1363 ARG A CZ     1 
ATOM   6149  N  NH1    . ARG A 1 401 ? -30.137  49.248  -1.047  1.00 104.92 1 1363 ARG A NH1    1 
ATOM   6150  N  NH2    . ARG A 1 401 ? -29.142  47.645  -2.345  1.00 105.70 ? 1363 ARG A NH2    1 
ATOM   6151  H  H      . ARG A 1 401 ? -36.522  51.308  -1.606  1.00 105.98 ? 1363 ARG A H      1 
ATOM   6152  H  HA     . ARG A 1 401 ? -36.193  48.746  -2.224  1.00 109.86 ? 1363 ARG A HA     1 
ATOM   6153  H  HB2    . ARG A 1 401 ? -34.744  50.285  -3.165  1.00 111.63 ? 1363 ARG A HB2    1 
ATOM   6154  H  HB3    . ARG A 1 401 ? -34.258  50.743  -1.728  1.00 111.63 ? 1363 ARG A HB3    1 
ATOM   6155  H  HG2    . ARG A 1 401 ? -33.178  48.708  -1.426  1.00 115.65 ? 1363 ARG A HG2    1 
ATOM   6156  H  HG3    . ARG A 1 401 ? -33.692  48.217  -2.852  1.00 115.65 ? 1363 ARG A HG3    1 
ATOM   6157  H  HD2    . ARG A 1 401 ? -32.419  49.886  -3.879  1.00 116.17 ? 1363 ARG A HD2    1 
ATOM   6158  H  HD3    . ARG A 1 401 ? -31.899  50.362  -2.455  1.00 116.17 ? 1363 ARG A HD3    1 
ATOM   6159  H  HE     . ARG A 1 401 ? -31.019  48.174  -3.782  1.00 119.76 ? 1363 ARG A HE     1 
ATOM   6160  H  HH11   . ARG A 1 401 ? -30.767  49.820  -0.917  1.00 125.90 ? 1363 ARG A HH11   1 
ATOM   6161  H  HH12   . ARG A 1 401 ? -29.520  49.148  -0.457  1.00 125.90 ? 1363 ARG A HH12   1 
ATOM   6162  H  HH21   . ARG A 1 401 ? -29.123  47.170  -3.062  1.00 126.84 ? 1363 ARG A HH21   1 
ATOM   6163  H  HH22   . ARG A 1 401 ? -28.528  47.550  -1.750  1.00 126.84 ? 1363 ARG A HH22   1 
ATOM   6164  N  N      . LEU B 1 25  ? -77.034  97.622  16.304  1.00 73.69  ? 987  LEU B N      1 
ATOM   6165  C  CA     . LEU B 1 25  ? -76.876  96.632  15.242  1.00 73.73  ? 987  LEU B CA     1 
ATOM   6166  C  C      . LEU B 1 25  ? -77.657  97.009  13.989  1.00 85.34  ? 987  LEU B C      1 
ATOM   6167  O  O      . LEU B 1 25  ? -78.680  97.691  14.059  1.00 75.26  ? 987  LEU B O      1 
ATOM   6168  C  CB     . LEU B 1 25  ? -77.327  95.251  15.720  1.00 67.16  ? 987  LEU B CB     1 
ATOM   6169  C  CG     . LEU B 1 25  ? -76.570  94.623  16.890  1.00 68.49  ? 987  LEU B CG     1 
ATOM   6170  C  CD1    . LEU B 1 25  ? -77.130  93.240  17.185  1.00 65.42  ? 987  LEU B CD1    1 
ATOM   6171  C  CD2    . LEU B 1 25  ? -75.079  94.546  16.602  1.00 69.16  ? 987  LEU B CD2    1 
ATOM   6172  H  HA     . LEU B 1 25  ? -75.938  96.574  15.003  1.00 88.48  ? 987  LEU B HA     1 
ATOM   6173  H  HB2    . LEU B 1 25  ? -78.257  95.316  15.986  1.00 80.60  ? 987  LEU B HB2    1 
ATOM   6174  H  HB3    . LEU B 1 25  ? -77.253  94.637  14.972  1.00 80.60  ? 987  LEU B HB3    1 
ATOM   6175  H  HG     . LEU B 1 25  ? -76.696  95.173  17.679  1.00 82.18  ? 987  LEU B HG     1 
ATOM   6176  H  HD11   . LEU B 1 25  ? -76.641  92.854  17.928  1.00 78.50  ? 987  LEU B HD11   1 
ATOM   6177  H  HD12   . LEU B 1 25  ? -78.069  93.321  17.412  1.00 78.50  ? 987  LEU B HD12   1 
ATOM   6178  H  HD13   . LEU B 1 25  ? -77.027  92.684  16.396  1.00 78.50  ? 987  LEU B HD13   1 
ATOM   6179  H  HD21   . LEU B 1 25  ? -74.632  94.144  17.363  1.00 82.99  ? 987  LEU B HD21   1 
ATOM   6180  H  HD22   . LEU B 1 25  ? -74.939  94.003  15.810  1.00 82.99  ? 987  LEU B HD22   1 
ATOM   6181  H  HD23   . LEU B 1 25  ? -74.740  95.442  16.454  1.00 82.99  ? 987  LEU B HD23   1 
ATOM   6182  N  N      . GLU B 1 26  ? -77.163  96.553  12.844  1.00 109.23 ? 988  GLU B N      1 
ATOM   6183  C  CA     . GLU B 1 26  ? -77.844  96.811  11.586  1.00 113.95 ? 988  GLU B CA     1 
ATOM   6184  C  C      . GLU B 1 26  ? -79.252  96.222  11.632  1.00 108.06 ? 988  GLU B C      1 
ATOM   6185  O  O      . GLU B 1 26  ? -79.435  95.093  12.101  1.00 107.91 ? 988  GLU B O      1 
ATOM   6186  C  CB     . GLU B 1 26  ? -77.068  96.193  10.420  1.00 113.72 ? 988  GLU B CB     1 
ATOM   6187  C  CG     . GLU B 1 26  ? -75.597  96.574  10.363  1.00 114.71 ? 988  GLU B CG     1 
ATOM   6188  C  CD     . GLU B 1 26  ? -74.850  95.830  9.273   1.00 112.58 ? 988  GLU B CD     1 
ATOM   6189  O  OE1    . GLU B 1 26  ? -75.434  95.615  8.190   1.00 111.77 ? 988  GLU B OE1    1 
ATOM   6190  O  OE2    . GLU B 1 26  ? -73.680  95.456  9.503   1.00 111.46 1 988  GLU B OE2    1 
ATOM   6191  H  H      . GLU B 1 26  ? -76.439  96.094  12.770  1.00 131.07 ? 988  GLU B H      1 
ATOM   6192  H  HA     . GLU B 1 26  ? -77.911  97.768  11.441  1.00 136.74 ? 988  GLU B HA     1 
ATOM   6193  H  HB2    . GLU B 1 26  ? -77.118  95.227  10.493  1.00 136.46 ? 988  GLU B HB2    1 
ATOM   6194  H  HB3    . GLU B 1 26  ? -77.478  96.480  9.589   1.00 136.46 ? 988  GLU B HB3    1 
ATOM   6195  H  HG2    . GLU B 1 26  ? -75.522  97.525  10.184  1.00 137.65 ? 988  GLU B HG2    1 
ATOM   6196  H  HG3    . GLU B 1 26  ? -75.180  96.361  11.213  1.00 137.65 ? 988  GLU B HG3    1 
ATOM   6197  N  N      . PRO B 1 27  ? -80.267  96.943  11.155  1.00 102.03 ? 989  PRO B N      1 
ATOM   6198  C  CA     . PRO B 1 27  ? -81.595  96.328  11.034  1.00 96.04  ? 989  PRO B CA     1 
ATOM   6199  C  C      . PRO B 1 27  ? -81.609  95.270  9.942   1.00 87.03  ? 989  PRO B C      1 
ATOM   6200  O  O      . PRO B 1 27  ? -80.977  95.425  8.894   1.00 88.59  ? 989  PRO B O      1 
ATOM   6201  C  CB     . PRO B 1 27  ? -82.505  97.510  10.687  1.00 99.86  ? 989  PRO B CB     1 
ATOM   6202  C  CG     . PRO B 1 27  ? -81.604  98.483  10.012  1.00 101.60 ? 989  PRO B CG     1 
ATOM   6203  C  CD     . PRO B 1 27  ? -80.265  98.339  10.685  1.00 101.69 ? 989  PRO B CD     1 
ATOM   6204  H  HA     . PRO B 1 27  ? -81.871  95.936  11.877  1.00 115.25 ? 989  PRO B HA     1 
ATOM   6205  H  HB2    . PRO B 1 27  ? -83.209  97.218  10.087  1.00 119.84 ? 989  PRO B HB2    1 
ATOM   6206  H  HB3    . PRO B 1 27  ? -82.876  97.889  11.499  1.00 119.84 ? 989  PRO B HB3    1 
ATOM   6207  H  HG2    . PRO B 1 27  ? -81.537  98.263  9.069   1.00 121.92 ? 989  PRO B HG2    1 
ATOM   6208  H  HG3    . PRO B 1 27  ? -81.950  99.381  10.129  1.00 121.92 ? 989  PRO B HG3    1 
ATOM   6209  H  HD2    . PRO B 1 27  ? -79.549  98.480  10.046  1.00 122.02 ? 989  PRO B HD2    1 
ATOM   6210  H  HD3    . PRO B 1 27  ? -80.197  98.949  11.436  1.00 122.02 ? 989  PRO B HD3    1 
ATOM   6211  N  N      . LEU B 1 28  ? -82.323  94.185  10.204  1.00 79.56  ? 990  LEU B N      1 
ATOM   6212  C  CA     . LEU B 1 28  ? -82.404  93.099  9.235   1.00 69.97  ? 990  LEU B CA     1 
ATOM   6213  C  C      . LEU B 1 28  ? -83.624  93.287  8.343   1.00 68.34  ? 990  LEU B C      1 
ATOM   6214  O  O      . LEU B 1 28  ? -84.710  93.584  8.850   1.00 70.26  ? 990  LEU B O      1 
ATOM   6215  C  CB     . LEU B 1 28  ? -82.494  91.749  9.930   1.00 66.07  ? 990  LEU B CB     1 
ATOM   6216  C  CG     . LEU B 1 28  ? -81.272  91.284  10.721  1.00 64.44  ? 990  LEU B CG     1 
ATOM   6217  C  CD1    . LEU B 1 28  ? -81.555  89.934  11.358  1.00 63.23  ? 990  LEU B CD1    1 
ATOM   6218  C  CD2    . LEU B 1 28  ? -80.033  91.211  9.843   1.00 63.23  ? 990  LEU B CD2    1 
ATOM   6219  H  H      . LEU B 1 28  ? -82.767  94.051  10.929  1.00 95.47  ? 990  LEU B H      1 
ATOM   6220  H  HA     . LEU B 1 28  ? -81.612  93.104  8.676   1.00 83.96  ? 990  LEU B HA     1 
ATOM   6221  H  HB2    . LEU B 1 28  ? -83.239  91.779  10.550  1.00 79.28  ? 990  LEU B HB2    1 
ATOM   6222  H  HB3    . LEU B 1 28  ? -82.669  91.074  9.255   1.00 79.28  ? 990  LEU B HB3    1 
ATOM   6223  H  HG     . LEU B 1 28  ? -81.097  91.920  11.433  1.00 77.33  ? 990  LEU B HG     1 
ATOM   6224  H  HD11   . LEU B 1 28  ? -80.773  89.650  11.857  1.00 75.87  ? 990  LEU B HD11   1 
ATOM   6225  H  HD12   . LEU B 1 28  ? -82.315  90.020  11.955  1.00 75.87  ? 990  LEU B HD12   1 
ATOM   6226  H  HD13   . LEU B 1 28  ? -81.753  89.291  10.660  1.00 75.87  ? 990  LEU B HD13   1 
ATOM   6227  H  HD21   . LEU B 1 28  ? -79.283  90.913  10.381  1.00 75.88  ? 990  LEU B HD21   1 
ATOM   6228  H  HD22   . LEU B 1 28  ? -80.194  90.582  9.123   1.00 75.88  ? 990  LEU B HD22   1 
ATOM   6229  H  HD23   . LEU B 1 28  ? -79.852  92.091  9.480   1.00 75.88  ? 990  LEU B HD23   1 
ATOM   6230  N  N      . PRO B 1 29  ? -83.503  93.131  7.030   1.00 67.22  ? 991  PRO B N      1 
ATOM   6231  C  CA     . PRO B 1 29  ? -84.685  93.196  6.177   1.00 69.02  ? 991  PRO B CA     1 
ATOM   6232  C  C      . PRO B 1 29  ? -85.536  91.953  6.365   1.00 68.06  ? 991  PRO B C      1 
ATOM   6233  O  O      . PRO B 1 29  ? -85.037  90.913  6.821   1.00 62.63  ? 991  PRO B O      1 
ATOM   6234  C  CB     . PRO B 1 29  ? -84.096  93.273  4.763   1.00 65.73  ? 991  PRO B CB     1 
ATOM   6235  C  CG     . PRO B 1 29  ? -82.825  92.578  4.878   1.00 64.32  ? 991  PRO B CG     1 
ATOM   6236  C  CD     . PRO B 1 29  ? -82.286  92.879  6.243   1.00 65.32  ? 991  PRO B CD     1 
ATOM   6237  H  HA     . PRO B 1 29  ? -85.208  93.991  6.364   1.00 82.82  ? 991  PRO B HA     1 
ATOM   6238  H  HB2    . PRO B 1 29  ? -84.682  92.822  4.135   1.00 78.88  ? 991  PRO B HB2    1 
ATOM   6239  H  HB3    . PRO B 1 29  ? -83.962  94.200  4.510   1.00 78.88  ? 991  PRO B HB3    1 
ATOM   6240  H  HG2    . PRO B 1 29  ? -82.970  91.624  4.774   1.00 77.18  ? 991  PRO B HG2    1 
ATOM   6241  H  HG3    . PRO B 1 29  ? -82.218  92.903  4.195   1.00 77.18  ? 991  PRO B HG3    1 
ATOM   6242  H  HD2    . PRO B 1 29  ? -81.806  92.113  6.595   1.00 78.39  ? 991  PRO B HD2    1 
ATOM   6243  H  HD3    . PRO B 1 29  ? -81.727  93.672  6.220   1.00 78.39  ? 991  PRO B HD3    1 
ATOM   6244  N  N      . PRO B 1 30  ? -86.826  92.021  6.045   1.00 71.21  ? 992  PRO B N      1 
ATOM   6245  C  CA     . PRO B 1 30  ? -87.698  90.857  6.247   1.00 72.45  ? 992  PRO B CA     1 
ATOM   6246  C  C      . PRO B 1 30  ? -87.240  89.655  5.437   1.00 73.35  ? 992  PRO B C      1 
ATOM   6247  O  O      . PRO B 1 30  ? -86.642  89.789  4.367   1.00 71.19  ? 992  PRO B O      1 
ATOM   6248  C  CB     . PRO B 1 30  ? -89.071  91.355  5.781   1.00 73.83  ? 992  PRO B CB     1 
ATOM   6249  C  CG     . PRO B 1 30  ? -88.775  92.496  4.867   1.00 74.99  ? 992  PRO B CG     1 
ATOM   6250  C  CD     . PRO B 1 30  ? -87.538  93.141  5.408   1.00 74.80  ? 992  PRO B CD     1 
ATOM   6251  H  HA     . PRO B 1 30  ? -87.739  90.621  7.187   1.00 86.94  ? 992  PRO B HA     1 
ATOM   6252  H  HB2    . PRO B 1 30  ? -89.533  90.646  5.307   1.00 88.60  ? 992  PRO B HB2    1 
ATOM   6253  H  HB3    . PRO B 1 30  ? -89.589  91.653  6.546   1.00 88.60  ? 992  PRO B HB3    1 
ATOM   6254  H  HG2    . PRO B 1 30  ? -88.622  92.162  3.970   1.00 89.99  ? 992  PRO B HG2    1 
ATOM   6255  H  HG3    . PRO B 1 30  ? -89.517  93.121  4.877   1.00 89.99  ? 992  PRO B HG3    1 
ATOM   6256  H  HD2    . PRO B 1 30  ? -87.007  93.513  4.686   1.00 89.76  ? 992  PRO B HD2    1 
ATOM   6257  H  HD3    . PRO B 1 30  ? -87.767  93.815  6.066   1.00 89.76  ? 992  PRO B HD3    1 
ATOM   6258  N  N      . LEU B 1 31  ? -87.526  88.465  5.960   1.00 75.76  ? 993  LEU B N      1 
ATOM   6259  C  CA     . LEU B 1 31  ? -87.150  87.247  5.263   1.00 75.59  ? 993  LEU B CA     1 
ATOM   6260  C  C      . LEU B 1 31  ? -88.148  86.958  4.156   1.00 75.39  ? 993  LEU B C      1 
ATOM   6261  O  O      . LEU B 1 31  ? -89.341  87.253  4.267   1.00 80.06  ? 993  LEU B O      1 
ATOM   6262  C  CB     . LEU B 1 31  ? -87.125  86.039  6.204   1.00 75.81  ? 993  LEU B CB     1 
ATOM   6263  C  CG     . LEU B 1 31  ? -86.109  85.902  7.333   1.00 78.18  ? 993  LEU B CG     1 
ATOM   6264  C  CD1    . LEU B 1 31  ? -86.334  84.570  8.033   1.00 75.91  ? 993  LEU B CD1    1 
ATOM   6265  C  CD2    . LEU B 1 31  ? -84.698  85.965  6.779   1.00 76.68  ? 993  LEU B CD2    1 
ATOM   6266  H  H      . LEU B 1 31  ? -87.932  88.340  6.707   1.00 90.91  ? 993  LEU B H      1 
ATOM   6267  H  HA     . LEU B 1 31  ? -86.270  87.354  4.869   1.00 90.71  ? 993  LEU B HA     1 
ATOM   6268  H  HB2    . LEU B 1 31  ? -87.998  85.993  6.625   1.00 90.97  ? 993  LEU B HB2    1 
ATOM   6269  H  HB3    . LEU B 1 31  ? -87.013  85.252  5.649   1.00 90.97  ? 993  LEU B HB3    1 
ATOM   6270  H  HG     . LEU B 1 31  ? -86.229  86.620  7.975   1.00 93.82  ? 993  LEU B HG     1 
ATOM   6271  H  HD11   . LEU B 1 31  ? -85.689  84.479  8.752   1.00 91.09  ? 993  LEU B HD11   1 
ATOM   6272  H  HD12   . LEU B 1 31  ? -87.235  84.550  8.392   1.00 91.09  ? 993  LEU B HD12   1 
ATOM   6273  H  HD13   . LEU B 1 31  ? -86.217  83.852  7.391   1.00 91.09  ? 993  LEU B HD13   1 
ATOM   6274  H  HD21   . LEU B 1 31  ? -84.068  85.876  7.511   1.00 92.02  ? 993  LEU B HD21   1 
ATOM   6275  H  HD22   . LEU B 1 31  ? -84.575  85.241  6.146   1.00 92.02  ? 993  LEU B HD22   1 
ATOM   6276  H  HD23   . LEU B 1 31  ? -84.572  86.818  6.335   1.00 92.02  ? 993  LEU B HD23   1 
ATOM   6277  N  N      . THR B 1 32  ? -87.665  86.388  3.130   1.00 69.90  ? 994  THR B N      1 
ATOM   6278  C  CA     . THR B 1 32  ? -88.502  85.909  2.055   1.00 68.15  ? 994  THR B CA     1 
ATOM   6279  C  C      . THR B 1 32  ? -88.728  84.413  2.210   1.00 66.60  ? 994  THR B C      1 
ATOM   6280  O  O      . THR B 1 32  ? -87.892  83.715  2.790   1.00 60.43  ? 994  THR B O      1 
ATOM   6281  C  CB     . THR B 1 32  ? -87.840  86.184  0.703   1.00 65.66  ? 994  THR B CB     1 
ATOM   6282  O  OG1    . THR B 1 32  ? -86.585  85.496  0.639   1.00 65.25  ? 994  THR B OG1    1 
ATOM   6283  C  CG2    . THR B 1 32  ? -87.598  87.672  0.524   1.00 67.37  ? 994  THR B CG2    1 
ATOM   6284  H  H      . THR B 1 32  ? -86.826  86.250  3.005   1.00 83.88  ? 994  THR B H      1 
ATOM   6285  H  HA     . THR B 1 32  ? -89.361  86.360  2.080   1.00 81.78  ? 994  THR B HA     1 
ATOM   6286  H  HB     . THR B 1 32  ? -88.418  85.875  -0.012  1.00 78.79  ? 994  THR B HB     1 
ATOM   6287  H  HG1    . THR B 1 32  ? -86.215  85.642  -0.101  1.00 78.30  ? 994  THR B HG1    1 
ATOM   6288  H  HG21   . THR B 1 32  ? -87.178  87.838  -0.334  1.00 80.84  ? 994  THR B HG21   1 
ATOM   6289  H  HG22   . THR B 1 32  ? -88.440  88.151  0.561   1.00 80.84  ? 994  THR B HG22   1 
ATOM   6290  H  HG23   . THR B 1 32  ? -87.016  88.000  1.228   1.00 80.84  ? 994  THR B HG23   1 
ATOM   6291  N  N      . PRO B 1 33  ? -89.837  83.868  1.705   1.00 69.83  ? 995  PRO B N      1 
ATOM   6292  C  CA     . PRO B 1 33  ? -89.968  82.405  1.708   1.00 71.64  ? 995  PRO B CA     1 
ATOM   6293  C  C      . PRO B 1 33  ? -88.816  81.761  0.973   1.00 68.34  ? 995  PRO B C      1 
ATOM   6294  O  O      . PRO B 1 33  ? -88.428  80.621  1.259   1.00 67.59  ? 995  PRO B O      1 
ATOM   6295  C  CB     . PRO B 1 33  ? -91.306  82.165  0.995   1.00 73.50  ? 995  PRO B CB     1 
ATOM   6296  C  CG     . PRO B 1 33  ? -92.035  83.466  1.070   1.00 76.06  ? 995  PRO B CG     1 
ATOM   6297  C  CD     . PRO B 1 33  ? -90.981  84.525  1.053   1.00 73.63  ? 995  PRO B CD     1 
ATOM   6298  H  HA     . PRO B 1 33  ? -90.013  82.064  2.616   1.00 85.96  ? 995  PRO B HA     1 
ATOM   6299  H  HB2    . PRO B 1 33  ? -91.143  81.917  0.071   1.00 88.20  ? 995  PRO B HB2    1 
ATOM   6300  H  HB3    . PRO B 1 33  ? -91.801  81.469  1.455   1.00 88.20  ? 995  PRO B HB3    1 
ATOM   6301  H  HG2    . PRO B 1 33  ? -92.621  83.556  0.302   1.00 91.27  ? 995  PRO B HG2    1 
ATOM   6302  H  HG3    . PRO B 1 33  ? -92.545  83.506  1.895   1.00 91.27  ? 995  PRO B HG3    1 
ATOM   6303  H  HD2    . PRO B 1 33  ? -90.758  84.767  0.140   1.00 88.35  ? 995  PRO B HD2    1 
ATOM   6304  H  HD3    . PRO B 1 33  ? -91.266  85.297  1.567   1.00 88.35  ? 995  PRO B HD3    1 
ATOM   6305  N  N      . LYS B 1 34  ? -88.234  82.516  0.046   1.00 63.18  ? 996  LYS B N      1 
ATOM   6306  C  CA     . LYS B 1 34  ? -87.163  82.032  -0.807  1.00 61.15  ? 996  LYS B CA     1 
ATOM   6307  C  C      . LYS B 1 34  ? -85.848  81.927  -0.036  1.00 60.06  ? 996  LYS B C      1 
ATOM   6308  O  O      . LYS B 1 34  ? -85.229  80.856  0.019   1.00 53.53  ? 996  LYS B O      1 
ATOM   6309  C  CB     . LYS B 1 34  ? -87.071  82.972  -2.016  1.00 65.09  ? 996  LYS B CB     1 
ATOM   6310  C  CG     . LYS B 1 34  ? -88.025  82.620  -3.132  1.00 70.74  ? 996  LYS B CG     1 
ATOM   6311  C  CD     . LYS B 1 34  ? -87.928  83.611  -4.289  1.00 72.19  ? 996  LYS B CD     1 
ATOM   6312  C  CE     . LYS B 1 34  ? -88.916  83.280  -5.401  1.00 74.82  ? 996  LYS B CE     1 
ATOM   6313  N  NZ     . LYS B 1 34  ? -88.973  84.345  -6.441  1.00 76.06  1 996  LYS B NZ     1 
ATOM   6314  H  H      . LYS B 1 34  ? -88.451  83.334  -0.109  1.00 75.82  ? 996  LYS B H      1 
ATOM   6315  H  HA     . LYS B 1 34  ? -87.392  81.147  -1.131  1.00 73.38  ? 996  LYS B HA     1 
ATOM   6316  H  HB2    . LYS B 1 34  ? -87.274  83.875  -1.726  1.00 78.10  ? 996  LYS B HB2    1 
ATOM   6317  H  HB3    . LYS B 1 34  ? -86.170  82.935  -2.373  1.00 78.10  ? 996  LYS B HB3    1 
ATOM   6318  H  HG2    . LYS B 1 34  ? -87.809  81.737  -3.470  1.00 84.89  ? 996  LYS B HG2    1 
ATOM   6319  H  HG3    . LYS B 1 34  ? -88.934  82.637  -2.793  1.00 84.89  ? 996  LYS B HG3    1 
ATOM   6320  H  HD2    . LYS B 1 34  ? -88.126  84.502  -3.962  1.00 86.63  ? 996  LYS B HD2    1 
ATOM   6321  H  HD3    . LYS B 1 34  ? -87.033  83.581  -4.660  1.00 86.63  ? 996  LYS B HD3    1 
ATOM   6322  H  HE2    . LYS B 1 34  ? -88.645  82.454  -5.831  1.00 89.78  ? 996  LYS B HE2    1 
ATOM   6323  H  HE3    . LYS B 1 34  ? -89.803  83.183  -5.020  1.00 89.78  ? 996  LYS B HE3    1 
ATOM   6324  H  HZ1    . LYS B 1 34  ? -89.558  84.121  -7.073  1.00 91.27  ? 996  LYS B HZ1    1 
ATOM   6325  H  HZ2    . LYS B 1 34  ? -89.226  85.116  -6.073  1.00 91.27  ? 996  LYS B HZ2    1 
ATOM   6326  H  HZ3    . LYS B 1 34  ? -88.171  84.451  -6.812  1.00 91.27  ? 996  LYS B HZ3    1 
ATOM   6327  N  N      . PHE B 1 35  ? -85.393  83.034  0.556   1.00 59.31  ? 997  PHE B N      1 
ATOM   6328  C  CA     . PHE B 1 35  ? -84.158  82.996  1.335   1.00 57.30  ? 997  PHE B CA     1 
ATOM   6329  C  C      . PHE B 1 35  ? -84.309  82.121  2.572   1.00 54.45  ? 997  PHE B C      1 
ATOM   6330  O  O      . PHE B 1 35  ? -83.356  81.448  2.986   1.00 48.93  ? 997  PHE B O      1 
ATOM   6331  C  CB     . PHE B 1 35  ? -83.739  84.412  1.735   1.00 56.31  ? 997  PHE B CB     1 
ATOM   6332  C  CG     . PHE B 1 35  ? -82.461  84.465  2.532   1.00 52.14  ? 997  PHE B CG     1 
ATOM   6333  C  CD1    . PHE B 1 35  ? -81.232  84.274  1.923   1.00 49.98  ? 997  PHE B CD1    1 
ATOM   6334  C  CD2    . PHE B 1 35  ? -82.495  84.738  3.893   1.00 52.22  ? 997  PHE B CD2    1 
ATOM   6335  C  CE1    . PHE B 1 35  ? -80.058  84.330  2.663   1.00 51.84  ? 997  PHE B CE1    1 
ATOM   6336  C  CE2    . PHE B 1 35  ? -81.327  84.800  4.636   1.00 51.04  ? 997  PHE B CE2    1 
ATOM   6337  C  CZ     . PHE B 1 35  ? -80.108  84.598  4.021   1.00 49.36  ? 997  PHE B CZ     1 
ATOM   6338  H  H      . PHE B 1 35  ? -85.774  83.804  0.523   1.00 71.17  ? 997  PHE B H      1 
ATOM   6339  H  HA     . PHE B 1 35  ? -83.452  82.619  0.786   1.00 68.76  ? 997  PHE B HA     1 
ATOM   6340  H  HB2    . PHE B 1 35  ? -83.608  84.938  0.930   1.00 67.57  ? 997  PHE B HB2    1 
ATOM   6341  H  HB3    . PHE B 1 35  ? -84.442  84.805  2.274   1.00 67.57  ? 997  PHE B HB3    1 
ATOM   6342  H  HD1    . PHE B 1 35  ? -81.193  84.093  1.012   1.00 59.97  ? 997  PHE B HD1    1 
ATOM   6343  H  HD2    . PHE B 1 35  ? -83.314  84.874  4.313   1.00 62.67  ? 997  PHE B HD2    1 
ATOM   6344  H  HE1    . PHE B 1 35  ? -79.238  84.195  2.245   1.00 62.21  ? 997  PHE B HE1    1 
ATOM   6345  H  HE2    . PHE B 1 35  ? -81.365  84.978  5.548   1.00 61.25  ? 997  PHE B HE2    1 
ATOM   6346  H  HZ     . PHE B 1 35  ? -79.323  84.638  4.518   1.00 59.23  ? 997  PHE B HZ     1 
ATOM   6347  N  N      . LEU B 1 36  ? -85.492  82.125  3.184   1.00 52.74  ? 998  LEU B N      1 
ATOM   6348  C  CA     . LEU B 1 36  ? -85.719  81.274  4.346   1.00 57.54  ? 998  LEU B CA     1 
ATOM   6349  C  C      . LEU B 1 36  ? -85.482  79.808  3.999   1.00 56.67  ? 998  LEU B C      1 
ATOM   6350  O  O      . LEU B 1 36  ? -84.886  79.063  4.786   1.00 52.41  ? 998  LEU B O      1 
ATOM   6351  C  CB     . LEU B 1 36  ? -87.136  81.498  4.880   1.00 59.95  ? 998  LEU B CB     1 
ATOM   6352  C  CG     . LEU B 1 36  ? -87.584  80.751  6.143   1.00 64.05  ? 998  LEU B CG     1 
ATOM   6353  C  CD1    . LEU B 1 36  ? -88.185  79.390  5.803   1.00 64.10  ? 998  LEU B CD1    1 
ATOM   6354  C  CD2    . LEU B 1 36  ? -86.442  80.605  7.151   1.00 61.44  ? 998  LEU B CD2    1 
ATOM   6355  H  H      . LEU B 1 36  ? -86.168  82.603  2.951   1.00 63.28  ? 998  LEU B H      1 
ATOM   6356  H  HA     . LEU B 1 36  ? -85.093  81.521  5.044   1.00 69.05  ? 998  LEU B HA     1 
ATOM   6357  H  HB2    . LEU B 1 36  ? -87.233  82.445  5.068   1.00 71.94  ? 998  LEU B HB2    1 
ATOM   6358  H  HB3    . LEU B 1 36  ? -87.758  81.253  4.177   1.00 71.94  ? 998  LEU B HB3    1 
ATOM   6359  H  HG     . LEU B 1 36  ? -88.280  81.273  6.572   1.00 76.86  ? 998  LEU B HG     1 
ATOM   6360  H  HD11   . LEU B 1 36  ? -88.455  78.951  6.624   1.00 76.92  ? 998  LEU B HD11   1 
ATOM   6361  H  HD12   . LEU B 1 36  ? -88.956  79.521  5.228   1.00 76.92  ? 998  LEU B HD12   1 
ATOM   6362  H  HD13   . LEU B 1 36  ? -87.517  78.856  5.345   1.00 76.92  ? 998  LEU B HD13   1 
ATOM   6363  H  HD21   . LEU B 1 36  ? -86.768  80.129  7.930   1.00 73.73  ? 998  LEU B HD21   1 
ATOM   6364  H  HD22   . LEU B 1 36  ? -85.718  80.108  6.737   1.00 73.73  ? 998  LEU B HD22   1 
ATOM   6365  H  HD23   . LEU B 1 36  ? -86.133  81.488  7.407   1.00 73.73  ? 998  LEU B HD23   1 
ATOM   6366  N  N      . ASN B 1 37  ? -85.920  79.380  2.813   1.00 60.40  ? 999  ASN B N      1 
ATOM   6367  C  CA     . ASN B 1 37  ? -85.694  77.999  2.399   1.00 61.90  ? 999  ASN B CA     1 
ATOM   6368  C  C      . ASN B 1 37  ? -84.210  77.678  2.297   1.00 62.09  ? 999  ASN B C      1 
ATOM   6369  O  O      . ASN B 1 37  ? -83.801  76.544  2.575   1.00 59.23  ? 999  ASN B O      1 
ATOM   6370  C  CB     . ASN B 1 37  ? -86.382  77.733  1.063   1.00 67.93  ? 999  ASN B CB     1 
ATOM   6371  C  CG     . ASN B 1 37  ? -86.354  76.271  0.682   1.00 67.88  ? 999  ASN B CG     1 
ATOM   6372  O  OD1    . ASN B 1 37  ? -85.777  75.894  -0.338  1.00 64.98  ? 999  ASN B OD1    1 
ATOM   6373  N  ND2    . ASN B 1 37  ? -86.960  75.432  1.514   1.00 71.20  ? 999  ASN B ND2    1 
ATOM   6374  H  H      . ASN B 1 37  ? -86.343  79.862  2.240   1.00 72.49  ? 999  ASN B H      1 
ATOM   6375  H  HA     . ASN B 1 37  ? -86.084  77.406  3.060   1.00 74.28  ? 999  ASN B HA     1 
ATOM   6376  H  HB2    . ASN B 1 37  ? -87.310  78.010  1.123   1.00 81.52  ? 999  ASN B HB2    1 
ATOM   6377  H  HB3    . ASN B 1 37  ? -85.929  78.234  0.367   1.00 81.52  ? 999  ASN B HB3    1 
ATOM   6378  H  HD21   . ASN B 1 37  ? -86.972  74.590  1.342   1.00 85.45  ? 999  ASN B HD21   1 
ATOM   6379  H  HD22   . ASN B 1 37  ? -87.340  75.732  2.225   1.00 85.45  ? 999  ASN B HD22   1 
ATOM   6380  N  N      . ILE B 1 38  ? -83.389  78.650  1.895   1.00 60.95  ? 1000 ILE B N      1 
ATOM   6381  C  CA     . ILE B 1 38  ? -81.947  78.428  1.865   1.00 57.67  ? 1000 ILE B CA     1 
ATOM   6382  C  C      . ILE B 1 38  ? -81.412  78.219  3.276   1.00 57.20  ? 1000 ILE B C      1 
ATOM   6383  O  O      . ILE B 1 38  ? -80.565  77.348  3.509   1.00 56.11  ? 1000 ILE B O      1 
ATOM   6384  C  CB     . ILE B 1 38  ? -81.235  79.591  1.148   1.00 57.85  ? 1000 ILE B CB     1 
ATOM   6385  C  CG1    . ILE B 1 38  ? -81.466  79.490  -0.360  1.00 60.99  ? 1000 ILE B CG1    1 
ATOM   6386  C  CG2    . ILE B 1 38  ? -79.740  79.605  1.453   1.00 56.64  ? 1000 ILE B CG2    1 
ATOM   6387  C  CD1    . ILE B 1 38  ? -80.959  80.682  -1.136  1.00 60.87  ? 1000 ILE B CD1    1 
ATOM   6388  H  H      . ILE B 1 38  ? -83.638  79.433  1.641   1.00 73.14  ? 1000 ILE B H      1 
ATOM   6389  H  HA     . ILE B 1 38  ? -81.768  77.619  1.360   1.00 69.20  ? 1000 ILE B HA     1 
ATOM   6390  H  HB     . ILE B 1 38  ? -81.620  80.425  1.461   1.00 69.42  ? 1000 ILE B HB     1 
ATOM   6391  H  HG12   . ILE B 1 38  ? -81.009  78.703  -0.694  1.00 73.19  ? 1000 ILE B HG12   1 
ATOM   6392  H  HG13   . ILE B 1 38  ? -82.419  79.412  -0.526  1.00 73.19  ? 1000 ILE B HG13   1 
ATOM   6393  H  HG21   . ILE B 1 38  ? -79.330  80.349  0.985   1.00 67.97  ? 1000 ILE B HG21   1 
ATOM   6394  H  HG22   . ILE B 1 38  ? -79.615  79.706  2.410   1.00 67.97  ? 1000 ILE B HG22   1 
ATOM   6395  H  HG23   . ILE B 1 38  ? -79.349  78.770  1.154   1.00 67.97  ? 1000 ILE B HG23   1 
ATOM   6396  H  HD11   . ILE B 1 38  ? -81.140  80.545  -2.079  1.00 73.04  ? 1000 ILE B HD11   1 
ATOM   6397  H  HD12   . ILE B 1 38  ? -81.415  81.479  -0.823  1.00 73.04  ? 1000 ILE B HD12   1 
ATOM   6398  H  HD13   . ILE B 1 38  ? -80.003  80.768  -0.992  1.00 73.04  ? 1000 ILE B HD13   1 
ATOM   6399  N  N      . LEU B 1 39  ? -81.887  79.017  4.238   1.00 54.21  ? 1001 LEU B N      1 
ATOM   6400  C  CA     . LEU B 1 39  ? -81.450  78.846  5.620   1.00 52.39  ? 1001 LEU B CA     1 
ATOM   6401  C  C      . LEU B 1 39  ? -81.803  77.459  6.144   1.00 50.06  ? 1001 LEU B C      1 
ATOM   6402  O  O      . LEU B 1 39  ? -80.990  76.817  6.817   1.00 47.49  ? 1001 LEU B O      1 
ATOM   6403  C  CB     . LEU B 1 39  ? -82.075  79.924  6.506   1.00 51.11  ? 1001 LEU B CB     1 
ATOM   6404  C  CG     . LEU B 1 39  ? -81.627  81.366  6.264   1.00 53.77  ? 1001 LEU B CG     1 
ATOM   6405  C  CD1    . LEU B 1 39  ? -82.413  82.322  7.146   1.00 54.88  ? 1001 LEU B CD1    1 
ATOM   6406  C  CD2    . LEU B 1 39  ? -80.136  81.519  6.519   1.00 51.13  ? 1001 LEU B CD2    1 
ATOM   6407  H  H      . LEU B 1 39  ? -82.454  79.653  4.116   1.00 65.05  ? 1001 LEU B H      1 
ATOM   6408  H  HA     . LEU B 1 39  ? -80.486  78.945  5.661   1.00 62.87  ? 1001 LEU B HA     1 
ATOM   6409  H  HB2    . LEU B 1 39  ? -83.037  79.899  6.380   1.00 61.33  ? 1001 LEU B HB2    1 
ATOM   6410  H  HB3    . LEU B 1 39  ? -81.869  79.713  7.430   1.00 61.33  ? 1001 LEU B HB3    1 
ATOM   6411  H  HG     . LEU B 1 39  ? -81.800  81.600  5.339   1.00 64.52  ? 1001 LEU B HG     1 
ATOM   6412  H  HD11   . LEU B 1 39  ? -82.112  83.228  6.975   1.00 65.86  ? 1001 LEU B HD11   1 
ATOM   6413  H  HD12   . LEU B 1 39  ? -83.357  82.241  6.936   1.00 65.86  ? 1001 LEU B HD12   1 
ATOM   6414  H  HD13   . LEU B 1 39  ? -82.260  82.092  8.076   1.00 65.86  ? 1001 LEU B HD13   1 
ATOM   6415  H  HD21   . LEU B 1 39  ? -79.881  82.441  6.358   1.00 61.36  ? 1001 LEU B HD21   1 
ATOM   6416  H  HD22   . LEU B 1 39  ? -79.947  81.279  7.440   1.00 61.36  ? 1001 LEU B HD22   1 
ATOM   6417  H  HD23   . LEU B 1 39  ? -79.651  80.932  5.918   1.00 61.36  ? 1001 LEU B HD23   1 
ATOM   6418  N  N      . ASP B 1 40  ? -83.007  76.974  5.836   1.00 53.54  ? 1002 ASP B N      1 
ATOM   6419  C  CA     . ASP B 1 40  ? -83.380  75.627  6.253   1.00 56.96  ? 1002 ASP B CA     1 
ATOM   6420  C  C      . ASP B 1 40  ? -82.410  74.594  5.691   1.00 58.62  ? 1002 ASP B C      1 
ATOM   6421  O  O      . ASP B 1 40  ? -81.993  73.671  6.402   1.00 59.19  ? 1002 ASP B O      1 
ATOM   6422  C  CB     . ASP B 1 40  ? -84.810  75.314  5.816   1.00 56.85  ? 1002 ASP B CB     1 
ATOM   6423  C  CG     . ASP B 1 40  ? -85.834  76.202  6.492   1.00 61.20  ? 1002 ASP B CG     1 
ATOM   6424  O  OD1    . ASP B 1 40  ? -85.527  76.757  7.567   1.00 64.46  ? 1002 ASP B OD1    1 
ATOM   6425  O  OD2    . ASP B 1 40  ? -86.953  76.333  5.957   1.00 64.67  1 1002 ASP B OD2    1 
ATOM   6426  H  H      . ASP B 1 40  ? -83.613  77.396  5.395   1.00 64.25  ? 1002 ASP B H      1 
ATOM   6427  H  HA     . ASP B 1 40  ? -83.344  75.575  7.221   1.00 68.35  ? 1002 ASP B HA     1 
ATOM   6428  H  HB2    . ASP B 1 40  ? -84.884  75.446  4.858   1.00 68.22  ? 1002 ASP B HB2    1 
ATOM   6429  H  HB3    . ASP B 1 40  ? -85.016  74.393  6.041   1.00 68.22  ? 1002 ASP B HB3    1 
ATOM   6430  N  N      . GLN B 1 41  ? -82.045  74.730  4.413   1.00 57.86  ? 1003 GLN B N      1 
ATOM   6431  C  CA     . GLN B 1 41  ? -81.168  73.750  3.780   1.00 59.74  ? 1003 GLN B CA     1 
ATOM   6432  C  C      . GLN B 1 41  ? -79.779  73.756  4.408   1.00 52.66  ? 1003 GLN B C      1 
ATOM   6433  O  O      . GLN B 1 41  ? -79.160  72.698  4.566   1.00 50.32  ? 1003 GLN B O      1 
ATOM   6434  C  CB     . GLN B 1 41  ? -81.079  74.017  2.276   1.00 60.59  ? 1003 GLN B CB     1 
ATOM   6435  C  CG     . GLN B 1 41  ? -82.366  73.727  1.526   1.00 67.58  ? 1003 GLN B CG     1 
ATOM   6436  C  CD     . GLN B 1 41  ? -82.356  74.267  0.106   1.00 75.65  ? 1003 GLN B CD     1 
ATOM   6437  O  OE1    . GLN B 1 41  ? -81.439  74.987  -0.295  1.00 77.14  ? 1003 GLN B OE1    1 
ATOM   6438  N  NE2    . GLN B 1 41  ? -83.383  73.920  -0.665  1.00 76.84  ? 1003 GLN B NE2    1 
ATOM   6439  H  H      . GLN B 1 41  ? -82.290  75.374  3.899   1.00 69.43  ? 1003 GLN B H      1 
ATOM   6440  H  HA     . GLN B 1 41  ? -81.546  72.865  3.903   1.00 71.69  ? 1003 GLN B HA     1 
ATOM   6441  H  HB2    . GLN B 1 41  ? -80.860  74.952  2.137   1.00 72.70  ? 1003 GLN B HB2    1 
ATOM   6442  H  HB3    . GLN B 1 41  ? -80.383  73.456  1.899   1.00 72.70  ? 1003 GLN B HB3    1 
ATOM   6443  H  HG2    . GLN B 1 41  ? -82.494  72.766  1.480   1.00 81.10  ? 1003 GLN B HG2    1 
ATOM   6444  H  HG3    . GLN B 1 41  ? -83.106  74.138  1.998   1.00 81.10  ? 1003 GLN B HG3    1 
ATOM   6445  H  HE21   . GLN B 1 41  ? -84.005  73.416  -0.351  1.00 92.21  ? 1003 GLN B HE21   1 
ATOM   6446  H  HE22   . GLN B 1 41  ? -83.424  74.200  -1.477  1.00 92.21  ? 1003 GLN B HE22   1 
ATOM   6447  N  N      . VAL B 1 42  ? -79.264  74.937  4.754   1.00 49.34  ? 1004 VAL B N      1 
ATOM   6448  C  CA     . VAL B 1 42  ? -77.931  75.017  5.347   1.00 51.58  ? 1004 VAL B CA     1 
ATOM   6449  C  C      . VAL B 1 42  ? -77.908  74.305  6.694   1.00 48.70  ? 1004 VAL B C      1 
ATOM   6450  O  O      . VAL B 1 42  ? -77.000  73.518  6.986   1.00 45.72  ? 1004 VAL B O      1 
ATOM   6451  C  CB     . VAL B 1 42  ? -77.492  76.486  5.480   1.00 51.09  ? 1004 VAL B CB     1 
ATOM   6452  C  CG1    . VAL B 1 42  ? -76.180  76.594  6.249   1.00 51.17  ? 1004 VAL B CG1    1 
ATOM   6453  C  CG2    . VAL B 1 42  ? -77.346  77.113  4.113   1.00 54.31  ? 1004 VAL B CG2    1 
ATOM   6454  H  H      . VAL B 1 42  ? -79.659  75.694  4.657   1.00 59.21  ? 1004 VAL B H      1 
ATOM   6455  H  HA     . VAL B 1 42  ? -77.299  74.569  4.763   1.00 61.89  ? 1004 VAL B HA     1 
ATOM   6456  H  HB     . VAL B 1 42  ? -78.170  76.979  5.968   1.00 61.31  ? 1004 VAL B HB     1 
ATOM   6457  H  HG11   . VAL B 1 42  ? -75.930  77.529  6.316   1.00 61.41  ? 1004 VAL B HG11   1 
ATOM   6458  H  HG12   . VAL B 1 42  ? -76.302  76.219  7.135   1.00 61.41  ? 1004 VAL B HG12   1 
ATOM   6459  H  HG13   . VAL B 1 42  ? -75.494  76.101  5.772   1.00 61.41  ? 1004 VAL B HG13   1 
ATOM   6460  H  HG21   . VAL B 1 42  ? -77.070  78.037  4.218   1.00 65.17  ? 1004 VAL B HG21   1 
ATOM   6461  H  HG22   . VAL B 1 42  ? -76.677  76.622  3.611   1.00 65.17  ? 1004 VAL B HG22   1 
ATOM   6462  H  HG23   . VAL B 1 42  ? -78.200  77.073  3.655   1.00 65.17  ? 1004 VAL B HG23   1 
ATOM   6463  N  N      . CYS B 1 43  ? -78.914  74.564  7.531   1.00 47.92  ? 1005 CYS B N      1 
ATOM   6464  C  CA     . CYS B 1 43  ? -78.969  73.921  8.840   1.00 51.59  ? 1005 CYS B CA     1 
ATOM   6465  C  C      . CYS B 1 43  ? -79.053  72.408  8.699   1.00 51.33  ? 1005 CYS B C      1 
ATOM   6466  O  O      . CYS B 1 43  ? -78.417  71.668  9.458   1.00 46.68  ? 1005 CYS B O      1 
ATOM   6467  C  CB     . CYS B 1 43  ? -80.165  74.446  9.634   1.00 50.83  ? 1005 CYS B CB     1 
ATOM   6468  S  SG     . CYS B 1 43  ? -80.057  76.182  10.073  1.00 50.47  ? 1005 CYS B SG     1 
ATOM   6469  H  H      . CYS B 1 43  ? -79.567  75.100  7.367   1.00 57.50  ? 1005 CYS B H      1 
ATOM   6470  H  HA     . CYS B 1 43  ? -78.162  74.134  9.333   1.00 61.91  ? 1005 CYS B HA     1 
ATOM   6471  H  HB2    . CYS B 1 43  ? -80.968  74.326  9.103   1.00 60.99  ? 1005 CYS B HB2    1 
ATOM   6472  H  HB3    . CYS B 1 43  ? -80.239  73.939  10.457  1.00 60.99  ? 1005 CYS B HB3    1 
ATOM   6473  H  HG     . CYS B 1 43  ? -79.982  76.835  9.068   1.00 60.56  ? 1005 CYS B HG     1 
ATOM   6474  N  N      . ILE B 1 44  ? -79.835  71.930  7.731   1.00 49.13  ? 1006 ILE B N      1 
ATOM   6475  C  CA     . ILE B 1 44  ? -79.973  70.492  7.534   1.00 50.71  ? 1006 ILE B CA     1 
ATOM   6476  C  C      . ILE B 1 44  ? -78.691  69.913  6.948   1.00 50.61  ? 1006 ILE B C      1 
ATOM   6477  O  O      . ILE B 1 44  ? -78.292  68.791  7.284   1.00 50.04  ? 1006 ILE B O      1 
ATOM   6478  C  CB     . ILE B 1 44  ? -81.200  70.202  6.651   1.00 51.14  ? 1006 ILE B CB     1 
ATOM   6479  C  CG1    . ILE B 1 44  ? -82.472  70.635  7.385   1.00 52.57  ? 1006 ILE B CG1    1 
ATOM   6480  C  CG2    . ILE B 1 44  ? -81.274  68.722  6.288   1.00 51.79  ? 1006 ILE B CG2    1 
ATOM   6481  C  CD1    . ILE B 1 44  ? -83.708  70.634  6.529   1.00 53.33  ? 1006 ILE B CD1    1 
ATOM   6482  H  H      . ILE B 1 44  ? -80.290  72.411  7.183   1.00 58.95  ? 1006 ILE B H      1 
ATOM   6483  H  HA     . ILE B 1 44  ? -80.121  70.071  8.395   1.00 60.85  ? 1006 ILE B HA     1 
ATOM   6484  H  HB     . ILE B 1 44  ? -81.122  70.718  5.833   1.00 61.37  ? 1006 ILE B HB     1 
ATOM   6485  H  HG12   . ILE B 1 44  ? -82.625  70.028  8.126   1.00 63.08  ? 1006 ILE B HG12   1 
ATOM   6486  H  HG13   . ILE B 1 44  ? -82.346  71.536  7.720   1.00 63.08  ? 1006 ILE B HG13   1 
ATOM   6487  H  HG21   . ILE B 1 44  ? -82.056  68.572  5.733   1.00 62.15  ? 1006 ILE B HG21   1 
ATOM   6488  H  HG22   . ILE B 1 44  ? -80.471  68.475  5.803   1.00 62.15  ? 1006 ILE B HG22   1 
ATOM   6489  H  HG23   . ILE B 1 44  ? -81.342  68.200  7.103   1.00 62.15  ? 1006 ILE B HG23   1 
ATOM   6490  H  HD11   . ILE B 1 44  ? -84.463  70.918  7.067   1.00 64.00  ? 1006 ILE B HD11   1 
ATOM   6491  H  HD12   . ILE B 1 44  ? -83.579  71.246  5.788   1.00 64.00  ? 1006 ILE B HD12   1 
ATOM   6492  H  HD13   . ILE B 1 44  ? -83.859  69.736  6.195   1.00 64.00  ? 1006 ILE B HD13   1 
ATOM   6493  N  N      . GLN B 1 45  ? -78.021  70.666  6.071   1.00 50.99  ? 1007 GLN B N      1 
ATOM   6494  C  CA     . GLN B 1 45  ? -76.721  70.236  5.565   1.00 56.04  ? 1007 GLN B CA     1 
ATOM   6495  C  C      . GLN B 1 45  ? -75.749  69.966  6.707   1.00 54.17  ? 1007 GLN B C      1 
ATOM   6496  O  O      . GLN B 1 45  ? -75.008  68.976  6.684   1.00 52.41  ? 1007 GLN B O      1 
ATOM   6497  C  CB     . GLN B 1 45  ? -76.147  71.295  4.620   1.00 57.15  ? 1007 GLN B CB     1 
ATOM   6498  C  CG     . GLN B 1 45  ? -76.488  71.080  3.158   1.00 64.69  ? 1007 GLN B CG     1 
ATOM   6499  C  CD     . GLN B 1 45  ? -75.803  69.862  2.578   1.00 64.38  ? 1007 GLN B CD     1 
ATOM   6500  O  OE1    . GLN B 1 45  ? -74.584  69.719  2.670   1.00 63.86  ? 1007 GLN B OE1    1 
ATOM   6501  N  NE2    . GLN B 1 45  ? -76.587  68.971  1.982   1.00 64.77  ? 1007 GLN B NE2    1 
ATOM   6502  H  H      . GLN B 1 45  ? -78.295  71.420  5.760   1.00 61.19  ? 1007 GLN B H      1 
ATOM   6503  H  HA     . GLN B 1 45  ? -76.833  69.413  5.064   1.00 67.25  ? 1007 GLN B HA     1 
ATOM   6504  H  HB2    . GLN B 1 45  ? -76.495  72.163  4.879   1.00 68.58  ? 1007 GLN B HB2    1 
ATOM   6505  H  HB3    . GLN B 1 45  ? -75.181  71.292  4.701   1.00 68.58  ? 1007 GLN B HB3    1 
ATOM   6506  H  HG2    . GLN B 1 45  ? -77.446  70.956  3.071   1.00 77.63  ? 1007 GLN B HG2    1 
ATOM   6507  H  HG3    . GLN B 1 45  ? -76.204  71.855  2.650   1.00 77.63  ? 1007 GLN B HG3    1 
ATOM   6508  H  HE21   . GLN B 1 45  ? -77.436  69.104  1.942   1.00 77.72  ? 1007 GLN B HE21   1 
ATOM   6509  H  HE22   . GLN B 1 45  ? -76.246  68.261  1.637   1.00 77.72  ? 1007 GLN B HE22   1 
ATOM   6510  N  N      . CYS B 1 46  ? -75.737  70.838  7.716   1.00 49.44  ? 1008 CYS B N      1 
ATOM   6511  C  CA     . CYS B 1 46  ? -74.838  70.643  8.847   1.00 50.30  ? 1008 CYS B CA     1 
ATOM   6512  C  C      . CYS B 1 46  ? -75.020  69.259  9.458   1.00 47.87  ? 1008 CYS B C      1 
ATOM   6513  O  O      . CYS B 1 46  ? -74.045  68.618  9.866   1.00 48.40  ? 1008 CYS B O      1 
ATOM   6514  C  CB     . CYS B 1 46  ? -75.082  71.734  9.891   1.00 46.43  ? 1008 CYS B CB     1 
ATOM   6515  S  SG     . CYS B 1 46  ? -74.501  73.368  9.379   1.00 41.97  ? 1008 CYS B SG     1 
ATOM   6516  H  H      . CYS B 1 46  ? -76.231  71.539  7.767   1.00 59.33  ? 1008 CYS B H      1 
ATOM   6517  H  HA     . CYS B 1 46  ? -73.921  70.719  8.541   1.00 60.36  ? 1008 CYS B HA     1 
ATOM   6518  H  HB2    . CYS B 1 46  ? -76.035  71.797  10.062  1.00 55.72  ? 1008 CYS B HB2    1 
ATOM   6519  H  HB3    . CYS B 1 46  ? -74.616  71.495  10.708  1.00 55.72  ? 1008 CYS B HB3    1 
ATOM   6520  H  HG     . CYS B 1 46  ? -75.076  73.690  8.376   1.00 50.37  ? 1008 CYS B HG     1 
ATOM   6521  N  N      . TYR B 1 47  ? -76.258  68.768  9.505   1.00 44.12  ? 1009 TYR B N      1 
ATOM   6522  C  CA     . TYR B 1 47  ? -76.507  67.436  10.045  1.00 47.22  ? 1009 TYR B CA     1 
ATOM   6523  C  C      . TYR B 1 47  ? -76.094  66.351  9.056   1.00 47.39  ? 1009 TYR B C      1 
ATOM   6524  O  O      . TYR B 1 47  ? -75.392  65.402  9.421   1.00 42.80  ? 1009 TYR B O      1 
ATOM   6525  C  CB     . TYR B 1 47  ? -77.982  67.281  10.410  1.00 49.04  ? 1009 TYR B CB     1 
ATOM   6526  C  CG     . TYR B 1 47  ? -78.352  65.877  10.825  1.00 51.90  ? 1009 TYR B CG     1 
ATOM   6527  C  CD1    . TYR B 1 47  ? -77.971  65.383  12.065  1.00 52.13  ? 1009 TYR B CD1    1 
ATOM   6528  C  CD2    . TYR B 1 47  ? -79.071  65.043  9.978   1.00 51.59  ? 1009 TYR B CD2    1 
ATOM   6529  C  CE1    . TYR B 1 47  ? -78.302  64.101  12.458  1.00 51.24  ? 1009 TYR B CE1    1 
ATOM   6530  C  CE2    . TYR B 1 47  ? -79.405  63.756  10.361  1.00 54.06  ? 1009 TYR B CE2    1 
ATOM   6531  C  CZ     . TYR B 1 47  ? -79.015  63.291  11.605  1.00 55.57  ? 1009 TYR B CZ     1 
ATOM   6532  O  OH     . TYR B 1 47  ? -79.340  62.015  12.003  1.00 59.18  ? 1009 TYR B OH     1 
ATOM   6533  H  H      . TYR B 1 47  ? -76.962  69.181  9.233   1.00 52.95  ? 1009 TYR B H      1 
ATOM   6534  H  HA     . TYR B 1 47  ? -75.984  67.320  10.853  1.00 56.66  ? 1009 TYR B HA     1 
ATOM   6535  H  HB2    . TYR B 1 47  ? -78.186  67.874  11.151  1.00 58.84  ? 1009 TYR B HB2    1 
ATOM   6536  H  HB3    . TYR B 1 47  ? -78.523  67.517  9.640   1.00 58.84  ? 1009 TYR B HB3    1 
ATOM   6537  H  HD1    . TYR B 1 47  ? -77.489  65.927  12.645  1.00 62.55  ? 1009 TYR B HD1    1 
ATOM   6538  H  HD2    . TYR B 1 47  ? -79.334  65.354  9.142   1.00 61.91  ? 1009 TYR B HD2    1 
ATOM   6539  H  HE1    . TYR B 1 47  ? -78.040  63.786  13.293  1.00 61.49  ? 1009 TYR B HE1    1 
ATOM   6540  H  HE2    . TYR B 1 47  ? -79.888  63.207  9.787   1.00 64.88  ? 1009 TYR B HE2    1 
ATOM   6541  H  HH     . TYR B 1 47  ? -79.772  61.626  11.398  1.00 71.02  ? 1009 TYR B HH     1 
ATOM   6542  N  N      . LYS B 1 48  ? -76.519  66.476  7.796   1.00 51.52  ? 1010 LYS B N      1 
ATOM   6543  C  CA     . LYS B 1 48  ? -76.248  65.428  6.816   1.00 56.52  ? 1010 LYS B CA     1 
ATOM   6544  C  C      . LYS B 1 48  ? -74.754  65.286  6.558   1.00 52.84  ? 1010 LYS B C      1 
ATOM   6545  O  O      . LYS B 1 48  ? -74.251  64.172  6.373   1.00 54.87  ? 1010 LYS B O      1 
ATOM   6546  C  CB     . LYS B 1 48  ? -76.994  65.729  5.515   1.00 62.31  ? 1010 LYS B CB     1 
ATOM   6547  C  CG     . LYS B 1 48  ? -78.508  65.670  5.662   1.00 67.87  ? 1010 LYS B CG     1 
ATOM   6548  C  CD     . LYS B 1 48  ? -79.221  65.569  4.320   1.00 68.70  ? 1010 LYS B CD     1 
ATOM   6549  C  CE     . LYS B 1 48  ? -79.025  66.819  3.479   1.00 71.51  ? 1010 LYS B CE     1 
ATOM   6550  N  NZ     . LYS B 1 48  ? -79.768  66.736  2.184   1.00 76.49  1 1010 LYS B NZ     1 
ATOM   6551  H  H      . LYS B 1 48  ? -76.959  67.148  7.490   1.00 61.83  ? 1010 LYS B H      1 
ATOM   6552  H  HA     . LYS B 1 48  ? -76.575  64.582  7.160   1.00 67.83  ? 1010 LYS B HA     1 
ATOM   6553  H  HB2    . LYS B 1 48  ? -76.758  66.621  5.216   1.00 74.78  ? 1010 LYS B HB2    1 
ATOM   6554  H  HB3    . LYS B 1 48  ? -76.734  65.077  4.846   1.00 74.78  ? 1010 LYS B HB3    1 
ATOM   6555  H  HG2    . LYS B 1 48  ? -78.745  64.891  6.189   1.00 81.44  ? 1010 LYS B HG2    1 
ATOM   6556  H  HG3    . LYS B 1 48  ? -78.814  66.477  6.106   1.00 81.44  ? 1010 LYS B HG3    1 
ATOM   6557  H  HD2    . LYS B 1 48  ? -78.866  64.813  3.827   1.00 82.44  ? 1010 LYS B HD2    1 
ATOM   6558  H  HD3    . LYS B 1 48  ? -80.172  65.452  4.473   1.00 82.44  ? 1010 LYS B HD3    1 
ATOM   6559  H  HE2    . LYS B 1 48  ? -79.355  67.589  3.969   1.00 85.81  ? 1010 LYS B HE2    1 
ATOM   6560  H  HE3    . LYS B 1 48  ? -78.082  66.926  3.280   1.00 85.81  ? 1010 LYS B HE3    1 
ATOM   6561  H  HZ1    . LYS B 1 48  ? -79.638  67.478  1.711   1.00 91.79  ? 1010 LYS B HZ1    1 
ATOM   6562  H  HZ2    . LYS B 1 48  ? -79.481  66.038  1.713   1.00 91.79  ? 1010 LYS B HZ2    1 
ATOM   6563  H  HZ3    . LYS B 1 48  ? -80.640  66.641  2.339   1.00 91.79  ? 1010 LYS B HZ3    1 
ATOM   6564  N  N      . ASP B 1 49  ? -74.024  66.401  6.551   1.00 46.56  ? 1011 ASP B N      1 
ATOM   6565  C  CA     . ASP B 1 49  ? -72.601  66.349  6.238   1.00 47.13  ? 1011 ASP B CA     1 
ATOM   6566  C  C      . ASP B 1 49  ? -71.781  65.744  7.375   1.00 45.86  ? 1011 ASP B C      1 
ATOM   6567  O  O      . ASP B 1 49  ? -70.761  65.098  7.116   1.00 43.92  ? 1011 ASP B O      1 
ATOM   6568  C  CB     . ASP B 1 49  ? -72.083  67.750  5.902   1.00 49.38  ? 1011 ASP B CB     1 
ATOM   6569  C  CG     . ASP B 1 49  ? -72.345  68.146  4.453   1.00 54.29  ? 1011 ASP B CG     1 
ATOM   6570  O  OD1    . ASP B 1 49  ? -73.123  67.452  3.761   1.00 55.08  ? 1011 ASP B OD1    1 
ATOM   6571  O  OD2    . ASP B 1 49  ? -71.767  69.159  4.005   1.00 57.84  1 1011 ASP B OD2    1 
ATOM   6572  H  H      . ASP B 1 49  ? -74.325  67.189  6.723   1.00 55.87  ? 1011 ASP B H      1 
ATOM   6573  H  HA     . ASP B 1 49  ? -72.475  65.791  5.454   1.00 56.56  ? 1011 ASP B HA     1 
ATOM   6574  H  HB2    . ASP B 1 49  ? -72.526  68.396  6.474   1.00 59.26  ? 1011 ASP B HB2    1 
ATOM   6575  H  HB3    . ASP B 1 49  ? -71.125  67.777  6.051   1.00 59.26  ? 1011 ASP B HB3    1 
ATOM   6576  N  N      . PHE B 1 50  ? -72.193  65.935  8.633   1.00 45.48  ? 1012 PHE B N      1 
ATOM   6577  C  CA     . PHE B 1 50  ? -71.322  65.626  9.757   1.00 46.03  ? 1012 PHE B CA     1 
ATOM   6578  C  C      . PHE B 1 50  ? -71.868  64.591  10.734  1.00 45.71  ? 1012 PHE B C      1 
ATOM   6579  O  O      . PHE B 1 50  ? -71.114  64.151  11.607  1.00 44.88  ? 1012 PHE B O      1 
ATOM   6580  C  CB     . PHE B 1 50  ? -70.987  66.914  10.527  1.00 39.98  ? 1012 PHE B CB     1 
ATOM   6581  C  CG     . PHE B 1 50  ? -70.391  67.991  9.663   1.00 44.70  ? 1012 PHE B CG     1 
ATOM   6582  C  CD1    . PHE B 1 50  ? -69.190  67.783  9.002   1.00 47.10  ? 1012 PHE B CD1    1 
ATOM   6583  C  CD2    . PHE B 1 50  ? -71.039  69.203  9.494   1.00 45.39  ? 1012 PHE B CD2    1 
ATOM   6584  C  CE1    . PHE B 1 50  ? -68.644  68.768  8.195   1.00 44.84  ? 1012 PHE B CE1    1 
ATOM   6585  C  CE2    . PHE B 1 50  ? -70.496  70.191  8.690   1.00 44.86  ? 1012 PHE B CE2    1 
ATOM   6586  C  CZ     . PHE B 1 50  ? -69.299  69.972  8.040   1.00 43.77  ? 1012 PHE B CZ     1 
ATOM   6587  H  H      . PHE B 1 50  ? -72.966  66.240  8.855   1.00 54.57  ? 1012 PHE B H      1 
ATOM   6588  H  HA     . PHE B 1 50  ? -70.488  65.276  9.405   1.00 55.24  ? 1012 PHE B HA     1 
ATOM   6589  H  HB2    . PHE B 1 50  ? -71.802  67.265  10.920  1.00 47.97  ? 1012 PHE B HB2    1 
ATOM   6590  H  HB3    . PHE B 1 50  ? -70.348  66.705  11.226  1.00 47.97  ? 1012 PHE B HB3    1 
ATOM   6591  H  HD1    . PHE B 1 50  ? -68.745  66.973  9.102   1.00 56.53  ? 1012 PHE B HD1    1 
ATOM   6592  H  HD2    . PHE B 1 50  ? -71.847  69.356  9.928   1.00 54.46  ? 1012 PHE B HD2    1 
ATOM   6593  H  HE1    . PHE B 1 50  ? -67.836  68.618  7.760   1.00 53.80  ? 1012 PHE B HE1    1 
ATOM   6594  H  HE2    . PHE B 1 50  ? -70.939  71.002  8.587   1.00 53.83  ? 1012 PHE B HE2    1 
ATOM   6595  H  HZ     . PHE B 1 50  ? -68.932  70.635  7.501   1.00 52.52  ? 1012 PHE B HZ     1 
ATOM   6596  N  N      . SER B 1 51  ? -73.127  64.158  10.608  1.00 50.02  ? 1013 SER B N      1 
ATOM   6597  C  CA     . SER B 1 51  ? -73.589  63.140  11.544  1.00 50.36  ? 1013 SER B CA     1 
ATOM   6598  C  C      . SER B 1 51  ? -73.062  61.759  11.147  1.00 51.22  ? 1013 SER B C      1 
ATOM   6599  O  O      . SER B 1 51  ? -72.913  61.465  9.958   1.00 50.85  ? 1013 SER B O      1 
ATOM   6600  C  CB     . SER B 1 51  ? -75.110  63.107  11.597  1.00 49.85  ? 1013 SER B CB     1 
ATOM   6601  O  OG     . SER B 1 51  ? -75.659  62.797  10.327  1.00 54.15  ? 1013 SER B OG     1 
ATOM   6602  H  H      . SER B 1 51  ? -73.700  64.421  10.024  1.00 60.02  ? 1013 SER B H      1 
ATOM   6603  H  HA     . SER B 1 51  ? -73.258  63.348  12.432  1.00 60.43  ? 1013 SER B HA     1 
ATOM   6604  H  HB2    . SER B 1 51  ? -75.389  62.430  12.234  1.00 59.82  ? 1013 SER B HB2    1 
ATOM   6605  H  HB3    . SER B 1 51  ? -75.435  63.977  11.876  1.00 59.82  ? 1013 SER B HB3    1 
ATOM   6606  H  HG     . SER B 1 51  ? -75.426  63.375  9.765   1.00 64.97  ? 1013 SER B HG     1 
ATOM   6607  N  N      . PRO B 1 52  ? -72.776  60.892  12.119  1.00 51.94  ? 1014 PRO B N      1 
ATOM   6608  C  CA     . PRO B 1 52  ? -72.252  59.563  11.781  1.00 50.74  ? 1014 PRO B CA     1 
ATOM   6609  C  C      . PRO B 1 52  ? -73.318  58.644  11.205  1.00 49.37  ? 1014 PRO B C      1 
ATOM   6610  O  O      . PRO B 1 52  ? -74.504  58.752  11.521  1.00 52.42  ? 1014 PRO B O      1 
ATOM   6611  C  CB     . PRO B 1 52  ? -71.743  59.024  13.125  1.00 52.69  ? 1014 PRO B CB     1 
ATOM   6612  C  CG     . PRO B 1 52  ? -71.696  60.197  14.038  1.00 52.67  ? 1014 PRO B CG     1 
ATOM   6613  C  CD     . PRO B 1 52  ? -72.761  61.119  13.573  1.00 51.60  ? 1014 PRO B CD     1 
ATOM   6614  H  HA     . PRO B 1 52  ? -71.512  59.635  11.158  1.00 60.88  ? 1014 PRO B HA     1 
ATOM   6615  H  HB2    . PRO B 1 52  ? -72.360  58.355  13.461  1.00 63.23  ? 1014 PRO B HB2    1 
ATOM   6616  H  HB3    . PRO B 1 52  ? -70.858  58.646  13.009  1.00 63.23  ? 1014 PRO B HB3    1 
ATOM   6617  H  HG2    . PRO B 1 52  ? -71.869  59.907  14.948  1.00 63.21  ? 1014 PRO B HG2    1 
ATOM   6618  H  HG3    . PRO B 1 52  ? -70.826  60.622  13.976  1.00 63.21  ? 1014 PRO B HG3    1 
ATOM   6619  H  HD2    . PRO B 1 52  ? -73.616  60.875  13.963  1.00 61.91  ? 1014 PRO B HD2    1 
ATOM   6620  H  HD3    . PRO B 1 52  ? -72.526  62.038  13.771  1.00 61.91  ? 1014 PRO B HD3    1 
ATOM   6621  N  N      . THR B 1 53  ? -72.873  57.719  10.357  1.00 46.60  ? 1015 THR B N      1 
ATOM   6622  C  CA     . THR B 1 53  ? -73.711  56.603  9.950   1.00 48.77  ? 1015 THR B CA     1 
ATOM   6623  C  C      . THR B 1 53  ? -73.860  55.613  11.105  1.00 48.39  ? 1015 THR B C      1 
ATOM   6624  O  O      . THR B 1 53  ? -73.153  55.680  12.116  1.00 47.46  ? 1015 THR B O      1 
ATOM   6625  C  CB     . THR B 1 53  ? -73.119  55.883  8.737   1.00 52.38  ? 1015 THR B CB     1 
ATOM   6626  O  OG1    . THR B 1 53  ? -71.871  55.279  9.106   1.00 50.60  ? 1015 THR B OG1    1 
ATOM   6627  C  CG2    . THR B 1 53  ? -72.909  56.843  7.570   1.00 48.87  ? 1015 THR B CG2    1 
ATOM   6628  H  H      . THR B 1 53  ? -72.089  57.719  10.004  1.00 55.92  ? 1015 THR B H      1 
ATOM   6629  H  HA     . THR B 1 53  ? -74.592  56.931  9.712   1.00 58.52  ? 1015 THR B HA     1 
ATOM   6630  H  HB     . THR B 1 53  ? -73.734  55.190  8.450   1.00 62.86  ? 1015 THR B HB     1 
ATOM   6631  H  HG1    . THR B 1 53  ? -71.539  54.881  8.445   1.00 60.71  ? 1015 THR B HG1    1 
ATOM   6632  H  HG21   . THR B 1 53  ? -72.534  56.367  6.812   1.00 58.65  ? 1015 THR B HG21   1 
ATOM   6633  H  HG22   . THR B 1 53  ? -73.757  57.235  7.307   1.00 58.65  ? 1015 THR B HG22   1 
ATOM   6634  H  HG23   . THR B 1 53  ? -72.301  57.553  7.829   1.00 58.65  ? 1015 THR B HG23   1 
ATOM   6635  N  N      . ILE B 1 54  ? -74.807  54.683  10.952  1.00 43.89  ? 1016 ILE B N      1 
ATOM   6636  C  CA     . ILE B 1 54  ? -74.967  53.639  11.959  1.00 43.63  ? 1016 ILE B CA     1 
ATOM   6637  C  C      . ILE B 1 54  ? -73.718  52.770  12.035  1.00 45.74  ? 1016 ILE B C      1 
ATOM   6638  O  O      . ILE B 1 54  ? -73.368  52.269  13.111  1.00 50.42  ? 1016 ILE B O      1 
ATOM   6639  C  CB     . ILE B 1 54  ? -76.230  52.797  11.678  1.00 46.75  ? 1016 ILE B CB     1 
ATOM   6640  C  CG1    . ILE B 1 54  ? -76.173  52.170  10.278  1.00 47.45  ? 1016 ILE B CG1    1 
ATOM   6641  C  CG2    . ILE B 1 54  ? -77.478  53.660  11.845  1.00 46.66  ? 1016 ILE B CG2    1 
ATOM   6642  C  CD1    . ILE B 1 54  ? -77.319  51.222  9.975   1.00 50.60  ? 1016 ILE B CD1    1 
ATOM   6643  H  H      . ILE B 1 54  ? -75.355  54.637  10.291  1.00 52.67  ? 1016 ILE B H      1 
ATOM   6644  H  HA     . ILE B 1 54  ? -75.083  54.060  12.825  1.00 52.36  ? 1016 ILE B HA     1 
ATOM   6645  H  HB     . ILE B 1 54  ? -76.268  52.080  12.330  1.00 56.10  ? 1016 ILE B HB     1 
ATOM   6646  H  HG12   . ILE B 1 54  ? -76.194  52.880  9.618   1.00 56.94  ? 1016 ILE B HG12   1 
ATOM   6647  H  HG13   . ILE B 1 54  ? -75.346  51.670  10.195  1.00 56.94  ? 1016 ILE B HG13   1 
ATOM   6648  H  HG21   . ILE B 1 54  ? -78.262  53.118  11.665  1.00 55.99  ? 1016 ILE B HG21   1 
ATOM   6649  H  HG22   . ILE B 1 54  ? -77.508  53.997  12.754  1.00 55.99  ? 1016 ILE B HG22   1 
ATOM   6650  H  HG23   . ILE B 1 54  ? -77.436  54.400  11.219  1.00 55.99  ? 1016 ILE B HG23   1 
ATOM   6651  H  HD11   . ILE B 1 54  ? -77.209  50.871  9.078   1.00 60.72  ? 1016 ILE B HD11   1 
ATOM   6652  H  HD12   . ILE B 1 54  ? -77.306  50.496  10.619  1.00 60.72  ? 1016 ILE B HD12   1 
ATOM   6653  H  HD13   . ILE B 1 54  ? -78.156  51.708  10.041  1.00 60.72  ? 1016 ILE B HD13   1 
ATOM   6654  N  N      . ILE B 1 55  ? -73.015  52.590  10.911  1.00 47.16  ? 1017 ILE B N      1 
ATOM   6655  C  CA     . ILE B 1 55  ? -71.782  51.806  10.923  1.00 47.53  ? 1017 ILE B CA     1 
ATOM   6656  C  C      . ILE B 1 55  ? -70.689  52.555  11.671  1.00 44.60  ? 1017 ILE B C      1 
ATOM   6657  O  O      . ILE B 1 55  ? -69.889  51.954  12.397  1.00 43.82  ? 1017 ILE B O      1 
ATOM   6658  C  CB     . ILE B 1 55  ? -71.342  51.462  9.485   1.00 49.92  ? 1017 ILE B CB     1 
ATOM   6659  C  CG1    . ILE B 1 55  ? -72.423  50.658  8.756   1.00 52.02  ? 1017 ILE B CG1    1 
ATOM   6660  C  CG2    . ILE B 1 55  ? -70.009  50.702  9.492   1.00 45.92  ? 1017 ILE B CG2    1 
ATOM   6661  C  CD1    . ILE B 1 55  ? -72.685  49.277  9.332   1.00 55.44  ? 1017 ILE B CD1    1 
ATOM   6662  H  H      . ILE B 1 55  ? -73.230  52.907  10.141  1.00 56.60  ? 1017 ILE B H      1 
ATOM   6663  H  HA     . ILE B 1 55  ? -71.944  50.972  11.392  1.00 57.03  ? 1017 ILE B HA     1 
ATOM   6664  H  HB     . ILE B 1 55  ? -71.210  52.294  9.005   1.00 59.90  ? 1017 ILE B HB     1 
ATOM   6665  H  HG12   . ILE B 1 55  ? -73.256  51.154  8.794   1.00 62.43  ? 1017 ILE B HG12   1 
ATOM   6666  H  HG13   . ILE B 1 55  ? -72.154  50.544  7.831   1.00 62.43  ? 1017 ILE B HG13   1 
ATOM   6667  H  HG21   . ILE B 1 55  ? -69.757  50.499  8.577   1.00 55.10  ? 1017 ILE B HG21   1 
ATOM   6668  H  HG22   . ILE B 1 55  ? -69.331  51.258  9.906   1.00 55.10  ? 1017 ILE B HG22   1 
ATOM   6669  H  HG23   . ILE B 1 55  ? -70.117  49.880  9.996   1.00 55.10  ? 1017 ILE B HG23   1 
ATOM   6670  H  HD11   . ILE B 1 55  ? -73.380  48.845  8.810   1.00 66.53  ? 1017 ILE B HD11   1 
ATOM   6671  H  HD12   . ILE B 1 55  ? -71.867  48.757  9.289   1.00 66.53  ? 1017 ILE B HD12   1 
ATOM   6672  H  HD13   . ILE B 1 55  ? -72.972  49.369  10.254  1.00 66.53  ? 1017 ILE B HD13   1 
ATOM   6673  N  N      . GLU B 1 56  ? -70.623  53.874  11.492  1.00 50.88  ? 1018 GLU B N      1 
ATOM   6674  C  CA     . GLU B 1 56  ? -69.641  54.671  12.218  1.00 55.78  ? 1018 GLU B CA     1 
ATOM   6675  C  C      . GLU B 1 56  ? -69.938  54.700  13.714  1.00 55.00  ? 1018 GLU B C      1 
ATOM   6676  O  O      . GLU B 1 56  ? -69.007  54.731  14.527  1.00 53.08  ? 1018 GLU B O      1 
ATOM   6677  C  CB     . GLU B 1 56  ? -69.599  56.085  11.637  1.00 53.63  ? 1018 GLU B CB     1 
ATOM   6678  C  CG     . GLU B 1 56  ? -68.875  56.157  10.294  1.00 55.39  ? 1018 GLU B CG     1 
ATOM   6679  C  CD     . GLU B 1 56  ? -69.171  57.426  9.514   1.00 56.01  ? 1018 GLU B CD     1 
ATOM   6680  O  OE1    . GLU B 1 56  ? -70.112  58.158  9.885   1.00 56.02  ? 1018 GLU B OE1    1 
ATOM   6681  O  OE2    . GLU B 1 56  ? -68.455  57.695  8.527   1.00 57.90  1 1018 GLU B OE2    1 
ATOM   6682  H  H      . GLU B 1 56  ? -71.130  54.325  10.963  1.00 61.05  ? 1018 GLU B H      1 
ATOM   6683  H  HA     . GLU B 1 56  ? -68.764  54.274  12.097  1.00 66.94  ? 1018 GLU B HA     1 
ATOM   6684  H  HB2    . GLU B 1 56  ? -70.507  56.398  11.504  1.00 64.36  ? 1018 GLU B HB2    1 
ATOM   6685  H  HB3    . GLU B 1 56  ? -69.135  56.668  12.259  1.00 64.36  ? 1018 GLU B HB3    1 
ATOM   6686  H  HG2    . GLU B 1 56  ? -67.918  56.122  10.452  1.00 66.46  ? 1018 GLU B HG2    1 
ATOM   6687  H  HG3    . GLU B 1 56  ? -69.148  55.402  9.750   1.00 66.46  ? 1018 GLU B HG3    1 
ATOM   6688  N  N      . ASP B 1 57  ? -71.219  54.685  14.098  1.00 57.17  ? 1019 ASP B N      1 
ATOM   6689  C  CA     . ASP B 1 57  ? -71.572  54.595  15.513  1.00 57.36  ? 1019 ASP B CA     1 
ATOM   6690  C  C      . ASP B 1 57  ? -71.157  53.252  16.097  1.00 55.76  ? 1019 ASP B C      1 
ATOM   6691  O  O      . ASP B 1 57  ? -70.579  53.191  17.187  1.00 53.53  ? 1019 ASP B O      1 
ATOM   6692  C  CB     . ASP B 1 57  ? -73.073  54.812  15.702  1.00 58.78  ? 1019 ASP B CB     1 
ATOM   6693  C  CG     . ASP B 1 57  ? -73.469  56.269  15.606  1.00 59.39  ? 1019 ASP B CG     1 
ATOM   6694  O  OD1    . ASP B 1 57  ? -72.637  57.141  15.938  1.00 56.63  ? 1019 ASP B OD1    1 
ATOM   6695  O  OD2    . ASP B 1 57  ? -74.619  56.539  15.198  1.00 62.78  1 1019 ASP B OD2    1 
ATOM   6696  H  H      . ASP B 1 57  ? -71.892  54.726  13.564  1.00 68.60  ? 1019 ASP B H      1 
ATOM   6697  H  HA     . ASP B 1 57  ? -71.104  55.292  16.000  1.00 68.84  ? 1019 ASP B HA     1 
ATOM   6698  H  HB2    . ASP B 1 57  ? -73.552  54.325  15.014  1.00 70.53  ? 1019 ASP B HB2    1 
ATOM   6699  H  HB3    . ASP B 1 57  ? -73.331  54.488  16.579  1.00 70.53  ? 1019 ASP B HB3    1 
ATOM   6700  N  N      . GLN B 1 58  ? -71.441  52.159  15.384  1.00 55.74  ? 1020 GLN B N      1 
ATOM   6701  C  CA     . GLN B 1 58  ? -71.058  50.844  15.885  1.00 58.06  ? 1020 GLN B CA     1 
ATOM   6702  C  C      . GLN B 1 58  ? -69.552  50.750  16.083  1.00 53.71  ? 1020 GLN B C      1 
ATOM   6703  O  O      . GLN B 1 58  ? -69.080  50.108  17.028  1.00 53.58  ? 1020 GLN B O      1 
ATOM   6704  C  CB     . GLN B 1 58  ? -71.526  49.750  14.930  1.00 61.29  ? 1020 GLN B CB     1 
ATOM   6705  C  CG     . GLN B 1 58  ? -71.485  48.362  15.548  1.00 68.30  ? 1020 GLN B CG     1 
ATOM   6706  C  CD     . GLN B 1 58  ? -71.419  47.258  14.513  1.00 74.50  ? 1020 GLN B CD     1 
ATOM   6707  O  OE1    . GLN B 1 58  ? -70.699  47.366  13.521  1.00 75.29  ? 1020 GLN B OE1    1 
ATOM   6708  N  NE2    . GLN B 1 58  ? -72.164  46.182  14.744  1.00 78.42  ? 1020 GLN B NE2    1 
ATOM   6709  H  H      . GLN B 1 58  ? -71.845  52.153  14.625  1.00 66.89  ? 1020 GLN B H      1 
ATOM   6710  H  HA     . GLN B 1 58  ? -71.484  50.696  16.744  1.00 69.67  ? 1020 GLN B HA     1 
ATOM   6711  H  HB2    . GLN B 1 58  ? -72.441  49.933  14.666  1.00 73.55  ? 1020 GLN B HB2    1 
ATOM   6712  H  HB3    . GLN B 1 58  ? -70.950  49.746  14.149  1.00 73.55  ? 1020 GLN B HB3    1 
ATOM   6713  H  HG2    . GLN B 1 58  ? -70.698  48.291  16.112  1.00 81.96  ? 1020 GLN B HG2    1 
ATOM   6714  H  HG3    . GLN B 1 58  ? -72.286  48.229  16.078  1.00 81.96  ? 1020 GLN B HG3    1 
ATOM   6715  H  HE21   . GLN B 1 58  ? -72.650  46.140  15.452  1.00 94.11  ? 1020 GLN B HE21   1 
ATOM   6716  H  HE22   . GLN B 1 58  ? -72.161  45.529  14.185  1.00 94.11  ? 1020 GLN B HE22   1 
ATOM   6717  N  N      . ALA B 1 59  ? -68.779  51.378  15.195  1.00 51.47  ? 1021 ALA B N      1 
ATOM   6718  C  CA     . ALA B 1 59  ? -67.329  51.366  15.343  1.00 51.42  ? 1021 ALA B CA     1 
ATOM   6719  C  C      . ALA B 1 59  ? -66.907  51.980  16.671  1.00 47.31  ? 1021 ALA B C      1 
ATOM   6720  O  O      . ALA B 1 59  ? -65.966  51.500  17.312  1.00 47.59  ? 1021 ALA B O      1 
ATOM   6721  C  CB     . ALA B 1 59  ? -66.680  52.111  14.177  1.00 46.16  ? 1021 ALA B CB     1 
ATOM   6722  H  H      . ALA B 1 59  ? -69.067  51.812  14.510  1.00 61.76  ? 1021 ALA B H      1 
ATOM   6723  H  HA     . ALA B 1 59  ? -67.017  50.448  15.324  1.00 61.71  ? 1021 ALA B HA     1 
ATOM   6724  H  HB1    . ALA B 1 59  ? -65.716  52.094  14.290  1.00 55.39  ? 1021 ALA B HB1    1 
ATOM   6725  H  HB2    . ALA B 1 59  ? -66.924  51.673  13.347  1.00 55.39  ? 1021 ALA B HB2    1 
ATOM   6726  H  HB3    . ALA B 1 59  ? -66.997  53.028  14.173  1.00 55.39  ? 1021 ALA B HB3    1 
ATOM   6727  N  N      . ARG B 1 60  ? -67.588  53.048  17.098  1.00 45.36  ? 1022 ARG B N      1 
ATOM   6728  C  CA     . ARG B 1 60  ? -67.273  53.660  18.386  1.00 47.45  ? 1022 ARG B CA     1 
ATOM   6729  C  C      . ARG B 1 60  ? -67.576  52.710  19.536  1.00 45.79  ? 1022 ARG B C      1 
ATOM   6730  O  O      . ARG B 1 60  ? -66.812  52.631  20.504  1.00 46.31  ? 1022 ARG B O      1 
ATOM   6731  C  CB     . ARG B 1 60  ? -68.045  54.968  18.556  1.00 46.76  ? 1022 ARG B CB     1 
ATOM   6732  C  CG     . ARG B 1 60  ? -67.517  56.090  17.691  1.00 43.65  ? 1022 ARG B CG     1 
ATOM   6733  C  CD     . ARG B 1 60  ? -68.402  57.322  17.725  1.00 42.51  ? 1022 ARG B CD     1 
ATOM   6734  N  NE     . ARG B 1 60  ? -67.810  58.391  16.924  1.00 44.17  ? 1022 ARG B NE     1 
ATOM   6735  C  CZ     . ARG B 1 60  ? -67.067  59.381  17.413  1.00 44.89  ? 1022 ARG B CZ     1 
ATOM   6736  N  NH1    . ARG B 1 60  ? -66.830  59.474  18.717  1.00 43.71  1 1022 ARG B NH1    1 
ATOM   6737  N  NH2    . ARG B 1 60  ? -66.563  60.290  16.591  1.00 41.25  ? 1022 ARG B NH2    1 
ATOM   6738  H  H      . ARG B 1 60  ? -68.227  53.429  16.667  1.00 54.44  ? 1022 ARG B H      1 
ATOM   6739  H  HA     . ARG B 1 60  ? -66.326  53.867  18.412  1.00 56.94  ? 1022 ARG B HA     1 
ATOM   6740  H  HB2    . ARG B 1 60  ? -68.973  54.818  18.316  1.00 56.11  ? 1022 ARG B HB2    1 
ATOM   6741  H  HB3    . ARG B 1 60  ? -67.985  55.251  19.482  1.00 56.11  ? 1022 ARG B HB3    1 
ATOM   6742  H  HG2    . ARG B 1 60  ? -66.636  56.344  18.007  1.00 52.38  ? 1022 ARG B HG2    1 
ATOM   6743  H  HG3    . ARG B 1 60  ? -67.464  55.783  16.773  1.00 52.38  ? 1022 ARG B HG3    1 
ATOM   6744  H  HD2    . ARG B 1 60  ? -69.273  57.106  17.356  1.00 51.01  ? 1022 ARG B HD2    1 
ATOM   6745  H  HD3    . ARG B 1 60  ? -68.489  57.634  18.640  1.00 51.01  ? 1022 ARG B HD3    1 
ATOM   6746  H  HE     . ARG B 1 60  ? -67.952  58.379  16.076  1.00 53.00  ? 1022 ARG B HE     1 
ATOM   6747  H  HH11   . ARG B 1 60  ? -67.151  58.885  19.255  1.00 52.45  ? 1022 ARG B HH11   1 
ATOM   6748  H  HH12   . ARG B 1 60  ? -66.352  60.120  19.022  1.00 52.45  ? 1022 ARG B HH12   1 
ATOM   6749  H  HH21   . ARG B 1 60  ? -66.717  60.239  15.747  1.00 49.50  ? 1022 ARG B HH21   1 
ATOM   6750  H  HH22   . ARG B 1 60  ? -66.090  60.937  16.904  1.00 49.50  ? 1022 ARG B HH22   1 
ATOM   6751  N  N      . GLU B 1 61  ? -68.690  51.981  19.449  1.00 46.92  ? 1023 GLU B N      1 
ATOM   6752  C  CA     . GLU B 1 61  ? -69.008  50.999  20.478  1.00 51.48  ? 1023 GLU B CA     1 
ATOM   6753  C  C      . GLU B 1 61  ? -67.972  49.882  20.501  1.00 52.89  ? 1023 GLU B C      1 
ATOM   6754  O  O      . GLU B 1 61  ? -67.608  49.386  21.573  1.00 55.20  ? 1023 GLU B O      1 
ATOM   6755  C  CB     . GLU B 1 61  ? -70.413  50.440  20.244  1.00 53.57  ? 1023 GLU B CB     1 
ATOM   6756  C  CG     . GLU B 1 61  ? -70.778  49.240  21.107  1.00 57.77  ? 1023 GLU B CG     1 
ATOM   6757  C  CD     . GLU B 1 61  ? -70.580  49.491  22.593  1.00 58.16  ? 1023 GLU B CD     1 
ATOM   6758  O  OE1    . GLU B 1 61  ? -70.583  50.670  23.015  1.00 54.29  ? 1023 GLU B OE1    1 
ATOM   6759  O  OE2    . GLU B 1 61  ? -70.422  48.502  23.340  1.00 59.45  1 1023 GLU B OE2    1 
ATOM   6760  H  H      . GLU B 1 61  ? -69.267  52.036  18.814  1.00 56.30  ? 1023 GLU B H      1 
ATOM   6761  H  HA     . GLU B 1 61  ? -68.999  51.435  21.344  1.00 61.78  ? 1023 GLU B HA     1 
ATOM   6762  H  HB2    . GLU B 1 61  ? -71.059  51.140  20.429  1.00 64.29  ? 1023 GLU B HB2    1 
ATOM   6763  H  HB3    . GLU B 1 61  ? -70.487  50.167  19.316  1.00 64.29  ? 1023 GLU B HB3    1 
ATOM   6764  H  HG2    . GLU B 1 61  ? -71.711  49.020  20.962  1.00 69.32  ? 1023 GLU B HG2    1 
ATOM   6765  H  HG3    . GLU B 1 61  ? -70.218  48.489  20.854  1.00 69.32  ? 1023 GLU B HG3    1 
ATOM   6766  N  N      . HIS B 1 62  ? -67.472  49.484  19.328  1.00 55.09  ? 1024 HIS B N      1 
ATOM   6767  C  CA     . HIS B 1 62  ? -66.440  48.452  19.275  1.00 56.86  ? 1024 HIS B CA     1 
ATOM   6768  C  C      . HIS B 1 62  ? -65.152  48.926  19.934  1.00 55.56  ? 1024 HIS B C      1 
ATOM   6769  O  O      . HIS B 1 62  ? -64.472  48.147  20.612  1.00 53.76  ? 1024 HIS B O      1 
ATOM   6770  C  CB     . HIS B 1 62  ? -66.172  48.047  17.826  1.00 59.79  ? 1024 HIS B CB     1 
ATOM   6771  C  CG     . HIS B 1 62  ? -67.247  47.196  17.226  1.00 67.18  ? 1024 HIS B CG     1 
ATOM   6772  N  ND1    . HIS B 1 62  ? -68.261  46.638  17.973  1.00 70.49  ? 1024 HIS B ND1    1 
ATOM   6773  C  CD2    . HIS B 1 62  ? -67.465  46.808  15.947  1.00 71.32  ? 1024 HIS B CD2    1 
ATOM   6774  C  CE1    . HIS B 1 62  ? -69.057  45.941  17.181  1.00 72.19  ? 1024 HIS B CE1    1 
ATOM   6775  N  NE2    . HIS B 1 62  ? -68.597  46.029  15.946  1.00 73.04  ? 1024 HIS B NE2    1 
ATOM   6776  H  H      . HIS B 1 62  ? -67.711  49.791  18.562  1.00 66.11  ? 1024 HIS B H      1 
ATOM   6777  H  HA     . HIS B 1 62  ? -66.752  47.668  19.753  1.00 68.24  ? 1024 HIS B HA     1 
ATOM   6778  H  HB2    . HIS B 1 62  ? -66.093  48.849  17.287  1.00 71.75  ? 1024 HIS B HB2    1 
ATOM   6779  H  HB3    . HIS B 1 62  ? -65.343  47.544  17.791  1.00 71.75  ? 1024 HIS B HB3    1 
ATOM   6780  H  HD2    . HIS B 1 62  ? -66.946  47.027  15.207  1.00 85.58  ? 1024 HIS B HD2    1 
ATOM   6781  H  HE1    . HIS B 1 62  ? -69.814  45.471  17.448  1.00 86.63  ? 1024 HIS B HE1    1 
ATOM   6782  H  HE2    . HIS B 1 62  ? -68.948  45.658  15.255  1.00 87.65  ? 1024 HIS B HE2    1 
ATOM   6783  N  N      . ILE B 1 63  ? -64.792  50.196  19.738  1.00 54.05  ? 1025 ILE B N      1 
ATOM   6784  C  CA     . ILE B 1 63  ? -63.596  50.727  20.387  1.00 55.34  ? 1025 ILE B CA     1 
ATOM   6785  C  C      . ILE B 1 63  ? -63.736  50.629  21.901  1.00 51.88  ? 1025 ILE B C      1 
ATOM   6786  O  O      . ILE B 1 63  ? -62.851  50.109  22.590  1.00 55.08  ? 1025 ILE B O      1 
ATOM   6787  C  CB     . ILE B 1 63  ? -63.329  52.174  19.932  1.00 53.60  ? 1025 ILE B CB     1 
ATOM   6788  C  CG1    . ILE B 1 63  ? -62.951  52.193  18.450  1.00 52.44  ? 1025 ILE B CG1    1 
ATOM   6789  C  CG2    . ILE B 1 63  ? -62.213  52.813  20.770  1.00 51.55  ? 1025 ILE B CG2    1 
ATOM   6790  C  CD1    . ILE B 1 63  ? -62.906  53.577  17.844  1.00 51.17  ? 1025 ILE B CD1    1 
ATOM   6791  H  H      . ILE B 1 63  ? -65.214  50.759  19.244  1.00 64.86  ? 1025 ILE B H      1 
ATOM   6792  H  HA     . ILE B 1 63  ? -62.833  50.189  20.125  1.00 66.41  ? 1025 ILE B HA     1 
ATOM   6793  H  HB     . ILE B 1 63  ? -64.141  52.691  20.051  1.00 64.32  ? 1025 ILE B HB     1 
ATOM   6794  H  HG12   . ILE B 1 63  ? -62.072  51.796  18.348  1.00 62.93  ? 1025 ILE B HG12   1 
ATOM   6795  H  HG13   . ILE B 1 63  ? -63.605  51.675  17.955  1.00 62.93  ? 1025 ILE B HG13   1 
ATOM   6796  H  HG21   . ILE B 1 63  ? -62.067  53.721  20.461  1.00 61.86  ? 1025 ILE B HG21   1 
ATOM   6797  H  HG22   . ILE B 1 63  ? -62.482  52.820  21.702  1.00 61.86  ? 1025 ILE B HG22   1 
ATOM   6798  H  HG23   . ILE B 1 63  ? -61.401  52.293  20.663  1.00 61.86  ? 1025 ILE B HG23   1 
ATOM   6799  H  HD11   . ILE B 1 63  ? -62.660  53.503  16.908  1.00 61.40  ? 1025 ILE B HD11   1 
ATOM   6800  H  HD12   . ILE B 1 63  ? -63.781  53.986  17.926  1.00 61.40  ? 1025 ILE B HD12   1 
ATOM   6801  H  HD13   . ILE B 1 63  ? -62.246  54.107  18.319  1.00 61.40  ? 1025 ILE B HD13   1 
ATOM   6802  N  N      . ARG B 1 64  ? -64.853  51.126  22.441  1.00 47.66  ? 1026 ARG B N      1 
ATOM   6803  C  CA     . ARG B 1 64  ? -65.105  50.987  23.873  1.00 48.47  ? 1026 ARG B CA     1 
ATOM   6804  C  C      . ARG B 1 64  ? -64.958  49.536  24.297  1.00 51.08  ? 1026 ARG B C      1 
ATOM   6805  O  O      . ARG B 1 64  ? -64.342  49.233  25.324  1.00 50.47  ? 1026 ARG B O      1 
ATOM   6806  C  CB     . ARG B 1 64  ? -66.507  51.494  24.219  1.00 43.58  ? 1026 ARG B CB     1 
ATOM   6807  C  CG     . ARG B 1 64  ? -66.823  51.497  25.715  1.00 46.28  ? 1026 ARG B CG     1 
ATOM   6808  C  CD     . ARG B 1 64  ? -68.310  51.289  25.993  1.00 46.66  ? 1026 ARG B CD     1 
ATOM   6809  N  NE     . ARG B 1 64  ? -68.766  49.963  25.587  1.00 48.68  ? 1026 ARG B NE     1 
ATOM   6810  C  CZ     . ARG B 1 64  ? -68.566  48.853  26.291  1.00 50.59  ? 1026 ARG B CZ     1 
ATOM   6811  N  NH1    . ARG B 1 64  ? -67.912  48.898  27.445  1.00 51.15  1 1026 ARG B NH1    1 
ATOM   6812  N  NH2    . ARG B 1 64  ? -69.016  47.690  25.839  1.00 53.06  ? 1026 ARG B NH2    1 
ATOM   6813  H  H      . ARG B 1 64  ? -65.468  51.542  22.007  1.00 57.19  ? 1026 ARG B H      1 
ATOM   6814  H  HA     . ARG B 1 64  ? -64.459  51.517  24.366  1.00 58.16  ? 1026 ARG B HA     1 
ATOM   6815  H  HB2    . ARG B 1 64  ? -66.597  52.404  23.897  1.00 52.29  ? 1026 ARG B HB2    1 
ATOM   6816  H  HB3    . ARG B 1 64  ? -67.160  50.926  23.781  1.00 52.29  ? 1026 ARG B HB3    1 
ATOM   6817  H  HG2    . ARG B 1 64  ? -66.333  50.778  26.145  1.00 55.53  ? 1026 ARG B HG2    1 
ATOM   6818  H  HG3    . ARG B 1 64  ? -66.562  52.351  26.093  1.00 55.53  ? 1026 ARG B HG3    1 
ATOM   6819  H  HD2    . ARG B 1 64  ? -68.472  51.386  26.944  1.00 55.99  ? 1026 ARG B HD2    1 
ATOM   6820  H  HD3    . ARG B 1 64  ? -68.821  51.949  25.498  1.00 55.99  ? 1026 ARG B HD3    1 
ATOM   6821  H  HE     . ARG B 1 64  ? -69.193  49.895  24.843  1.00 58.41  ? 1026 ARG B HE     1 
ATOM   6822  H  HH11   . ARG B 1 64  ? -67.617  49.648  27.743  1.00 61.38  ? 1026 ARG B HH11   1 
ATOM   6823  H  HH12   . ARG B 1 64  ? -67.786  48.176  27.896  1.00 61.38  ? 1026 ARG B HH12   1 
ATOM   6824  H  HH21   . ARG B 1 64  ? -69.440  47.654  25.092  1.00 63.67  ? 1026 ARG B HH21   1 
ATOM   6825  H  HH22   . ARG B 1 64  ? -68.886  46.972  26.295  1.00 63.67  ? 1026 ARG B HH22   1 
ATOM   6826  N  N      . GLN B 1 65  ? -65.522  48.625  23.505  1.00 57.06  ? 1027 GLN B N      1 
ATOM   6827  C  CA     . GLN B 1 65  ? -65.486  47.207  23.837  1.00 62.06  ? 1027 GLN B CA     1 
ATOM   6828  C  C      . GLN B 1 65  ? -64.054  46.688  23.868  1.00 60.93  ? 1027 GLN B C      1 
ATOM   6829  O  O      . GLN B 1 65  ? -63.685  45.917  24.761  1.00 62.90  ? 1027 GLN B O      1 
ATOM   6830  C  CB     . GLN B 1 65  ? -66.327  46.442  22.817  1.00 65.22  ? 1027 GLN B CB     1 
ATOM   6831  C  CG     . GLN B 1 65  ? -66.669  45.020  23.185  1.00 70.01  ? 1027 GLN B CG     1 
ATOM   6832  C  CD     . GLN B 1 65  ? -67.716  44.437  22.252  1.00 74.33  ? 1027 GLN B CD     1 
ATOM   6833  O  OE1    . GLN B 1 65  ? -68.283  45.147  21.418  1.00 72.99  ? 1027 GLN B OE1    1 
ATOM   6834  N  NE2    . GLN B 1 65  ? -67.979  43.140  22.388  1.00 77.15  ? 1027 GLN B NE2    1 
ATOM   6835  H  H      . GLN B 1 65  ? -65.931  48.805  22.770  1.00 68.47  ? 1027 GLN B H      1 
ATOM   6836  H  HA     . GLN B 1 65  ? -65.877  47.074  24.714  1.00 74.48  ? 1027 GLN B HA     1 
ATOM   6837  H  HB2    . GLN B 1 65  ? -67.163  46.918  22.691  1.00 78.26  ? 1027 GLN B HB2    1 
ATOM   6838  H  HB3    . GLN B 1 65  ? -65.841  46.415  21.978  1.00 78.26  ? 1027 GLN B HB3    1 
ATOM   6839  H  HG2    . GLN B 1 65  ? -65.870  44.473  23.125  1.00 84.01  ? 1027 GLN B HG2    1 
ATOM   6840  H  HG3    . GLN B 1 65  ? -67.022  44.999  24.088  1.00 84.01  ? 1027 GLN B HG3    1 
ATOM   6841  H  HE21   . GLN B 1 65  ? -67.563  42.677  22.982  1.00 92.58  ? 1027 GLN B HE21   1 
ATOM   6842  H  HE22   . GLN B 1 65  ? -68.564  42.765  21.882  1.00 92.58  ? 1027 GLN B HE22   1 
ATOM   6843  N  N      . ASN B 1 66  ? -63.229  47.115  22.911  1.00 62.19  ? 1028 ASN B N      1 
ATOM   6844  C  CA     . ASN B 1 66  ? -61.839  46.672  22.866  1.00 62.09  ? 1028 ASN B CA     1 
ATOM   6845  C  C      . ASN B 1 66  ? -61.034  47.260  24.020  1.00 59.83  ? 1028 ASN B C      1 
ATOM   6846  O  O      . ASN B 1 66  ? -60.269  46.550  24.683  1.00 59.74  ? 1028 ASN B O      1 
ATOM   6847  C  CB     . ASN B 1 66  ? -61.220  47.058  21.524  1.00 61.66  ? 1028 ASN B CB     1 
ATOM   6848  C  CG     . ASN B 1 66  ? -59.728  46.797  21.473  1.00 63.26  ? 1028 ASN B CG     1 
ATOM   6849  O  OD1    . ASN B 1 66  ? -58.919  47.715  21.607  1.00 61.54  ? 1028 ASN B OD1    1 
ATOM   6850  N  ND2    . ASN B 1 66  ? -59.355  45.538  21.277  1.00 67.63  ? 1028 ASN B ND2    1 
ATOM   6851  H  H      . ASN B 1 66  ? -63.449  47.658  22.282  1.00 74.63  ? 1028 ASN B H      1 
ATOM   6852  H  HA     . ASN B 1 66  ? -61.813  45.706  22.943  1.00 74.50  ? 1028 ASN B HA     1 
ATOM   6853  H  HB2    . ASN B 1 66  ? -61.640  46.538  20.821  1.00 73.99  ? 1028 ASN B HB2    1 
ATOM   6854  H  HB3    . ASN B 1 66  ? -61.365  48.004  21.369  1.00 73.99  ? 1028 ASN B HB3    1 
ATOM   6855  H  HD21   . ASN B 1 66  ? -58.520  45.337  21.239  1.00 81.15  ? 1028 ASN B HD21   1 
ATOM   6856  H  HD22   . ASN B 1 66  ? -59.949  44.922  21.187  1.00 81.15  ? 1028 ASN B HD22   1 
ATOM   6857  N  N      . LEU B 1 67  ? -61.187  48.562  24.271  1.00 54.22  ? 1029 LEU B N      1 
ATOM   6858  C  CA     . LEU B 1 67  ? -60.454  49.198  25.361  1.00 51.01  ? 1029 LEU B CA     1 
ATOM   6859  C  C      . LEU B 1 67  ? -60.827  48.588  26.705  1.00 52.97  ? 1029 LEU B C      1 
ATOM   6860  O  O      . LEU B 1 67  ? -59.967  48.413  27.578  1.00 52.02  ? 1029 LEU B O      1 
ATOM   6861  C  CB     . LEU B 1 67  ? -60.728  50.701  25.365  1.00 47.04  ? 1029 LEU B CB     1 
ATOM   6862  C  CG     . LEU B 1 67  ? -60.211  51.489  24.162  1.00 44.79  ? 1029 LEU B CG     1 
ATOM   6863  C  CD1    . LEU B 1 67  ? -60.730  52.913  24.201  1.00 41.62  ? 1029 LEU B CD1    1 
ATOM   6864  C  CD2    . LEU B 1 67  ? -58.693  51.480  24.129  1.00 45.44  ? 1029 LEU B CD2    1 
ATOM   6865  H  H      . LEU B 1 67  ? -61.703  49.091  23.830  1.00 65.07  ? 1029 LEU B H      1 
ATOM   6866  H  HA     . LEU B 1 67  ? -59.503  49.065  25.223  1.00 61.21  ? 1029 LEU B HA     1 
ATOM   6867  H  HB2    . LEU B 1 67  ? -61.688  50.835  25.405  1.00 56.45  ? 1029 LEU B HB2    1 
ATOM   6868  H  HB3    . LEU B 1 67  ? -60.318  51.083  26.157  1.00 56.45  ? 1029 LEU B HB3    1 
ATOM   6869  H  HG     . LEU B 1 67  ? -60.533  51.073  23.347  1.00 53.75  ? 1029 LEU B HG     1 
ATOM   6870  H  HD11   . LEU B 1 67  ? -60.391  53.394  23.431  1.00 49.94  ? 1029 LEU B HD11   1 
ATOM   6871  H  HD12   . LEU B 1 67  ? -61.700  52.896  24.180  1.00 49.94  ? 1029 LEU B HD12   1 
ATOM   6872  H  HD13   . LEU B 1 67  ? -60.425  53.338  25.018  1.00 49.94  ? 1029 LEU B HD13   1 
ATOM   6873  H  HD21   . LEU B 1 67  ? -58.392  51.986  23.358  1.00 54.53  ? 1029 LEU B HD21   1 
ATOM   6874  H  HD22   . LEU B 1 67  ? -58.357  51.886  24.943  1.00 54.53  ? 1029 LEU B HD22   1 
ATOM   6875  H  HD23   . LEU B 1 67  ? -58.385  50.563  24.064  1.00 54.53  ? 1029 LEU B HD23   1 
ATOM   6876  N  N      . GLU B 1 68  ? -62.108  48.260  26.893  1.00 52.41  ? 1030 GLU B N      1 
ATOM   6877  C  CA     . GLU B 1 68  ? -62.543  47.667  28.152  1.00 52.80  ? 1030 GLU B CA     1 
ATOM   6878  C  C      . GLU B 1 68  ? -61.869  46.321  28.384  1.00 56.76  ? 1030 GLU B C      1 
ATOM   6879  O  O      . GLU B 1 68  ? -61.414  46.030  29.495  1.00 57.50  ? 1030 GLU B O      1 
ATOM   6880  C  CB     . GLU B 1 68  ? -64.063  47.520  28.161  1.00 54.96  ? 1030 GLU B CB     1 
ATOM   6881  C  CG     . GLU B 1 68  ? -64.637  47.114  29.509  1.00 54.85  ? 1030 GLU B CG     1 
ATOM   6882  C  CD     . GLU B 1 68  ? -66.145  46.959  29.478  1.00 55.43  ? 1030 GLU B CD     1 
ATOM   6883  O  OE1    . GLU B 1 68  ? -66.641  46.078  28.745  1.00 58.13  ? 1030 GLU B OE1    1 
ATOM   6884  O  OE2    . GLU B 1 68  ? -66.836  47.729  30.180  1.00 56.16  1 1030 GLU B OE2    1 
ATOM   6885  H  H      . GLU B 1 68  ? -62.734  48.371  26.314  1.00 62.89  ? 1030 GLU B H      1 
ATOM   6886  H  HA     . GLU B 1 68  ? -62.294  48.256  28.881  1.00 63.36  ? 1030 GLU B HA     1 
ATOM   6887  H  HB2    . GLU B 1 68  ? -64.460  48.370  27.914  1.00 65.96  ? 1030 GLU B HB2    1 
ATOM   6888  H  HB3    . GLU B 1 68  ? -64.315  46.841  27.516  1.00 65.96  ? 1030 GLU B HB3    1 
ATOM   6889  H  HG2    . GLU B 1 68  ? -64.253  46.264  29.774  1.00 65.82  ? 1030 GLU B HG2    1 
ATOM   6890  H  HG3    . GLU B 1 68  ? -64.419  47.796  30.164  1.00 65.82  ? 1030 GLU B HG3    1 
ATOM   6891  N  N      . SER B 1 69  ? -61.796  45.485  27.346  1.00 60.81  ? 1031 SER B N      1 
ATOM   6892  C  CA     . SER B 1 69  ? -61.132  44.194  27.485  1.00 60.76  ? 1031 SER B CA     1 
ATOM   6893  C  C      . SER B 1 69  ? -59.643  44.371  27.746  1.00 59.49  ? 1031 SER B C      1 
ATOM   6894  O  O      . SER B 1 69  ? -59.067  43.677  28.593  1.00 59.94  ? 1031 SER B O      1 
ATOM   6895  C  CB     . SER B 1 69  ? -61.351  43.352  26.230  1.00 63.17  ? 1031 SER B CB     1 
ATOM   6896  O  OG     . SER B 1 69  ? -62.727  43.096  26.020  1.00 66.44  ? 1031 SER B OG     1 
ATOM   6897  H  H      . SER B 1 69  ? -62.117  45.641  26.563  1.00 72.97  ? 1031 SER B H      1 
ATOM   6898  H  HA     . SER B 1 69  ? -61.516  43.719  28.239  1.00 72.91  ? 1031 SER B HA     1 
ATOM   6899  H  HB2    . SER B 1 69  ? -60.999  43.832  25.464  1.00 75.80  ? 1031 SER B HB2    1 
ATOM   6900  H  HB3    . SER B 1 69  ? -60.886  42.507  26.332  1.00 75.80  ? 1031 SER B HB3    1 
ATOM   6901  H  HG     . SER B 1 69  ? -63.143  43.820  25.929  1.00 79.73  ? 1031 SER B HG     1 
ATOM   6902  N  N      . PHE B 1 70  ? -59.003  45.296  27.031  1.00 55.38  ? 1032 PHE B N      1 
ATOM   6903  C  CA     . PHE B 1 70  ? -57.571  45.504  27.209  1.00 54.18  ? 1032 PHE B CA     1 
ATOM   6904  C  C      . PHE B 1 70  ? -57.266  46.018  28.609  1.00 50.71  ? 1032 PHE B C      1 
ATOM   6905  O  O      . PHE B 1 70  ? -56.357  45.520  29.281  1.00 50.94  ? 1032 PHE B O      1 
ATOM   6906  C  CB     . PHE B 1 70  ? -57.047  46.474  26.152  1.00 50.56  ? 1032 PHE B CB     1 
ATOM   6907  C  CG     . PHE B 1 70  ? -55.581  46.766  26.277  1.00 53.93  ? 1032 PHE B CG     1 
ATOM   6908  C  CD1    . PHE B 1 70  ? -54.643  45.946  25.671  1.00 57.28  ? 1032 PHE B CD1    1 
ATOM   6909  C  CD2    . PHE B 1 70  ? -55.139  47.861  27.000  1.00 53.05  ? 1032 PHE B CD2    1 
ATOM   6910  C  CE1    . PHE B 1 70  ? -53.292  46.213  25.784  1.00 58.13  ? 1032 PHE B CE1    1 
ATOM   6911  C  CE2    . PHE B 1 70  ? -53.789  48.133  27.117  1.00 55.39  ? 1032 PHE B CE2    1 
ATOM   6912  C  CZ     . PHE B 1 70  ? -52.864  47.308  26.508  1.00 58.06  ? 1032 PHE B CZ     1 
ATOM   6913  H  H      . PHE B 1 70  ? -59.370  45.807  26.445  1.00 66.46  ? 1032 PHE B H      1 
ATOM   6914  H  HA     . PHE B 1 70  ? -57.112  44.657  27.093  1.00 65.02  ? 1032 PHE B HA     1 
ATOM   6915  H  HB2    . PHE B 1 70  ? -57.200  46.093  25.274  1.00 60.67  ? 1032 PHE B HB2    1 
ATOM   6916  H  HB3    . PHE B 1 70  ? -57.525  47.314  26.234  1.00 60.67  ? 1032 PHE B HB3    1 
ATOM   6917  H  HD1    . PHE B 1 70  ? -54.927  45.207  25.183  1.00 68.74  ? 1032 PHE B HD1    1 
ATOM   6918  H  HD2    . PHE B 1 70  ? -55.757  48.420  27.412  1.00 63.66  ? 1032 PHE B HD2    1 
ATOM   6919  H  HE1    . PHE B 1 70  ? -52.671  45.655  25.373  1.00 69.76  ? 1032 PHE B HE1    1 
ATOM   6920  H  HE2    . PHE B 1 70  ? -53.504  48.872  27.605  1.00 66.47  ? 1032 PHE B HE2    1 
ATOM   6921  H  HZ     . PHE B 1 70  ? -51.956  47.490  26.586  1.00 69.67  ? 1032 PHE B HZ     1 
ATOM   6922  N  N      . ILE B 1 71  ? -58.023  47.016  29.069  1.00 49.21  ? 1033 ILE B N      1 
ATOM   6923  C  CA     . ILE B 1 71  ? -57.764  47.588  30.386  1.00 52.71  ? 1033 ILE B CA     1 
ATOM   6924  C  C      . ILE B 1 71  ? -58.063  46.581  31.490  1.00 55.42  ? 1033 ILE B C      1 
ATOM   6925  O  O      . ILE B 1 71  ? -57.459  46.641  32.568  1.00 54.86  ? 1033 ILE B O      1 
ATOM   6926  C  CB     . ILE B 1 71  ? -58.569  48.888  30.563  1.00 49.04  ? 1033 ILE B CB     1 
ATOM   6927  C  CG1    . ILE B 1 71  ? -58.032  49.961  29.613  1.00 49.41  ? 1033 ILE B CG1    1 
ATOM   6928  C  CG2    . ILE B 1 71  ? -58.517  49.368  32.014  1.00 51.83  ? 1033 ILE B CG2    1 
ATOM   6929  C  CD1    . ILE B 1 71  ? -58.891  51.199  29.517  1.00 48.05  ? 1033 ILE B CD1    1 
ATOM   6930  H  H      . ILE B 1 71  ? -58.681  47.372  28.645  1.00 59.05  ? 1033 ILE B H      1 
ATOM   6931  H  HA     . ILE B 1 71  ? -56.823  47.816  30.444  1.00 63.25  ? 1033 ILE B HA     1 
ATOM   6932  H  HB     . ILE B 1 71  ? -59.495  48.710  30.332  1.00 58.85  ? 1033 ILE B HB     1 
ATOM   6933  H  HG12   . ILE B 1 71  ? -57.153  50.236  29.920  1.00 59.30  ? 1033 ILE B HG12   1 
ATOM   6934  H  HG13   . ILE B 1 71  ? -57.963  49.582  28.723  1.00 59.30  ? 1033 ILE B HG13   1 
ATOM   6935  H  HG21   . ILE B 1 71  ? -59.032  50.186  32.094  1.00 62.20  ? 1033 ILE B HG21   1 
ATOM   6936  H  HG22   . ILE B 1 71  ? -58.894  48.682  32.586  1.00 62.20  ? 1033 ILE B HG22   1 
ATOM   6937  H  HG23   . ILE B 1 71  ? -57.593  49.533  32.258  1.00 62.20  ? 1033 ILE B HG23   1 
ATOM   6938  H  HD11   . ILE B 1 71  ? -58.479  51.822  28.898  1.00 57.67  ? 1033 ILE B HD11   1 
ATOM   6939  H  HD12   . ILE B 1 71  ? -59.771  50.947  29.197  1.00 57.67  ? 1033 ILE B HD12   1 
ATOM   6940  H  HD13   . ILE B 1 71  ? -58.961  51.603  30.396  1.00 57.67  ? 1033 ILE B HD13   1 
ATOM   6941  N  N      . ARG B 1 72  ? -58.984  45.645  31.254  1.00 57.16  ? 1034 ARG B N      1 
ATOM   6942  C  CA     . ARG B 1 72  ? -59.315  44.662  32.278  1.00 59.87  ? 1034 ARG B CA     1 
ATOM   6943  C  C      . ARG B 1 72  ? -58.147  43.738  32.592  1.00 64.58  ? 1034 ARG B C      1 
ATOM   6944  O  O      . ARG B 1 72  ? -58.129  43.128  33.665  1.00 63.58  ? 1034 ARG B O      1 
ATOM   6945  C  CB     . ARG B 1 72  ? -60.521  43.828  31.847  1.00 61.19  ? 1034 ARG B CB     1 
ATOM   6946  C  CG     . ARG B 1 72  ? -61.858  44.432  32.230  1.00 63.21  ? 1034 ARG B CG     1 
ATOM   6947  C  CD     . ARG B 1 72  ? -63.014  43.596  31.714  1.00 66.86  ? 1034 ARG B CD     1 
ATOM   6948  N  NE     . ARG B 1 72  ? -64.305  44.152  32.109  1.00 70.56  ? 1034 ARG B NE     1 
ATOM   6949  C  CZ     . ARG B 1 72  ? -65.478  43.726  31.651  1.00 74.96  ? 1034 ARG B CZ     1 
ATOM   6950  N  NH1    . ARG B 1 72  ? -65.535  42.733  30.774  1.00 76.94  1 1034 ARG B NH1    1 
ATOM   6951  N  NH2    . ARG B 1 72  ? -66.599  44.297  32.071  1.00 75.91  ? 1034 ARG B NH2    1 
ATOM   6952  H  H      . ARG B 1 72  ? -59.424  45.560  30.520  1.00 68.59  ? 1034 ARG B H      1 
ATOM   6953  H  HA     . ARG B 1 72  ? -59.552  45.129  33.095  1.00 71.84  ? 1034 ARG B HA     1 
ATOM   6954  H  HB2    . ARG B 1 72  ? -60.505  43.733  30.881  1.00 73.43  ? 1034 ARG B HB2    1 
ATOM   6955  H  HB3    . ARG B 1 72  ? -60.461  42.954  32.263  1.00 73.43  ? 1034 ARG B HB3    1 
ATOM   6956  H  HG2    . ARG B 1 72  ? -61.923  44.477  33.197  1.00 75.85  ? 1034 ARG B HG2    1 
ATOM   6957  H  HG3    . ARG B 1 72  ? -61.929  45.320  31.846  1.00 75.85  ? 1034 ARG B HG3    1 
ATOM   6958  H  HD2    . ARG B 1 72  ? -62.980  43.568  30.745  1.00 80.24  ? 1034 ARG B HD2    1 
ATOM   6959  H  HD3    . ARG B 1 72  ? -62.947  42.699  32.077  1.00 80.24  ? 1034 ARG B HD3    1 
ATOM   6960  H  HE     . ARG B 1 72  ? -64.306  44.799  32.676  1.00 84.68  ? 1034 ARG B HE     1 
ATOM   6961  H  HH11   . ARG B 1 72  ? -64.810  42.360  30.498  1.00 92.32  ? 1034 ARG B HH11   1 
ATOM   6962  H  HH12   . ARG B 1 72  ? -66.296  42.461  30.480  1.00 92.32  ? 1034 ARG B HH12   1 
ATOM   6963  H  HH21   . ARG B 1 72  ? -66.567  44.941  32.640  1.00 91.10  ? 1034 ARG B HH21   1 
ATOM   6964  H  HH22   . ARG B 1 72  ? -67.358  44.022  31.775  1.00 91.10  ? 1034 ARG B HH22   1 
ATOM   6965  N  N      . GLN B 1 73  ? -57.170  43.630  31.689  1.00 71.96  ? 1035 GLN B N      1 
ATOM   6966  C  CA     . GLN B 1 73  ? -56.000  42.801  31.958  1.00 78.25  ? 1035 GLN B CA     1 
ATOM   6967  C  C      . GLN B 1 73  ? -55.231  43.308  33.173  1.00 81.00  ? 1035 GLN B C      1 
ATOM   6968  O  O      . GLN B 1 73  ? -54.692  42.512  33.949  1.00 82.63  ? 1035 GLN B O      1 
ATOM   6969  C  CB     . GLN B 1 73  ? -55.099  42.764  30.723  1.00 79.20  ? 1035 GLN B CB     1 
ATOM   6970  C  CG     . GLN B 1 73  ? -55.755  42.130  29.502  1.00 80.52  ? 1035 GLN B CG     1 
ATOM   6971  C  CD     . GLN B 1 73  ? -54.853  42.138  28.279  1.00 83.77  ? 1035 GLN B CD     1 
ATOM   6972  O  OE1    . GLN B 1 73  ? -53.678  41.778  28.357  1.00 86.20  ? 1035 GLN B OE1    1 
ATOM   6973  N  NE2    . GLN B 1 73  ? -55.402  42.544  27.138  1.00 81.60  ? 1035 GLN B NE2    1 
ATOM   6974  H  H      . GLN B 1 73  ? -57.163  44.021  30.923  1.00 86.35  ? 1035 GLN B H      1 
ATOM   6975  H  HA     . GLN B 1 73  ? -56.291  41.895  32.144  1.00 93.91  ? 1035 GLN B HA     1 
ATOM   6976  H  HB2    . GLN B 1 73  ? -54.852  43.673  30.489  1.00 95.04  ? 1035 GLN B HB2    1 
ATOM   6977  H  HB3    . GLN B 1 73  ? -54.303  42.251  30.932  1.00 95.04  ? 1035 GLN B HB3    1 
ATOM   6978  H  HG2    . GLN B 1 73  ? -55.977  41.208  29.706  1.00 96.62  ? 1035 GLN B HG2    1 
ATOM   6979  H  HG3    . GLN B 1 73  ? -56.561  42.625  29.284  1.00 96.62  ? 1035 GLN B HG3    1 
ATOM   6980  H  HE21   . GLN B 1 73  ? -56.228  42.785  27.121  1.00 97.92  ? 1035 GLN B HE21   1 
ATOM   6981  H  HE22   . GLN B 1 73  ? -54.933  42.566  26.418  1.00 97.92  ? 1035 GLN B HE22   1 
ATOM   6982  N  N      . ASP B 1 74  ? -55.168  44.627  33.354  1.00 84.31  ? 1036 ASP B N      1 
ATOM   6983  C  CA     . ASP B 1 74  ? -54.462  45.231  34.480  1.00 84.44  ? 1036 ASP B CA     1 
ATOM   6984  C  C      . ASP B 1 74  ? -55.393  45.756  35.566  1.00 81.89  ? 1036 ASP B C      1 
ATOM   6985  O  O      . ASP B 1 74  ? -54.983  45.829  36.729  1.00 85.65  ? 1036 ASP B O      1 
ATOM   6986  C  CB     . ASP B 1 74  ? -53.553  46.362  33.988  1.00 85.76  ? 1036 ASP B CB     1 
ATOM   6987  C  CG     . ASP B 1 74  ? -52.440  45.861  33.081  1.00 86.62  ? 1036 ASP B CG     1 
ATOM   6988  O  OD1    . ASP B 1 74  ? -52.661  45.767  31.856  1.00 86.88  ? 1036 ASP B OD1    1 
ATOM   6989  O  OD2    . ASP B 1 74  ? -51.342  45.558  33.595  1.00 87.82  1 1036 ASP B OD2    1 
ATOM   6990  H  H      . ASP B 1 74  ? -55.534  45.202  32.829  1.00 101.17 ? 1036 ASP B H      1 
ATOM   6991  H  HA     . ASP B 1 74  ? -53.895  44.556  34.884  1.00 101.33 ? 1036 ASP B HA     1 
ATOM   6992  H  HB2    . ASP B 1 74  ? -54.084  47.001  33.488  1.00 102.91 ? 1036 ASP B HB2    1 
ATOM   6993  H  HB3    . ASP B 1 74  ? -53.145  46.796  34.754  1.00 102.91 ? 1036 ASP B HB3    1 
ATOM   6994  N  N      . PHE B 1 75  ? -56.625  46.137  35.217  1.00 72.92  ? 1037 PHE B N      1 
ATOM   6995  C  CA     . PHE B 1 75  ? -57.629  46.612  36.170  1.00 66.32  ? 1037 PHE B CA     1 
ATOM   6996  C  C      . PHE B 1 75  ? -58.863  45.732  36.019  1.00 62.32  ? 1037 PHE B C      1 
ATOM   6997  O  O      . PHE B 1 75  ? -59.858  46.147  35.405  1.00 60.49  ? 1037 PHE B O      1 
ATOM   6998  C  CB     . PHE B 1 75  ? -58.010  48.077  35.948  1.00 64.50  ? 1037 PHE B CB     1 
ATOM   6999  C  CG     . PHE B 1 75  ? -56.913  49.056  36.240  1.00 63.90  ? 1037 PHE B CG     1 
ATOM   7000  C  CD1    . PHE B 1 75  ? -56.672  49.464  37.540  1.00 64.81  ? 1037 PHE B CD1    1 
ATOM   7001  C  CD2    . PHE B 1 75  ? -56.142  49.589  35.221  1.00 63.11  ? 1037 PHE B CD2    1 
ATOM   7002  C  CE1    . PHE B 1 75  ? -55.673  50.371  37.823  1.00 65.68  ? 1037 PHE B CE1    1 
ATOM   7003  C  CE2    . PHE B 1 75  ? -55.139  50.499  35.498  1.00 63.23  ? 1037 PHE B CE2    1 
ATOM   7004  C  CZ     . PHE B 1 75  ? -54.906  50.892  36.800  1.00 63.93  ? 1037 PHE B CZ     1 
ATOM   7005  H  H      . PHE B 1 75  ? -56.910  46.127  34.405  1.00 87.50  ? 1037 PHE B H      1 
ATOM   7006  H  HA     . PHE B 1 75  ? -57.289  46.516  37.073  1.00 79.58  ? 1037 PHE B HA     1 
ATOM   7007  H  HB2    . PHE B 1 75  ? -58.268  48.193  35.020  1.00 77.40  ? 1037 PHE B HB2    1 
ATOM   7008  H  HB3    . PHE B 1 75  ? -58.759  48.294  36.525  1.00 77.40  ? 1037 PHE B HB3    1 
ATOM   7009  H  HD1    . PHE B 1 75  ? -57.186  49.116  38.232  1.00 77.77  ? 1037 PHE B HD1    1 
ATOM   7010  H  HD2    . PHE B 1 75  ? -56.296  49.327  34.342  1.00 75.73  ? 1037 PHE B HD2    1 
ATOM   7011  H  HE1    . PHE B 1 75  ? -55.518  50.634  38.702  1.00 78.82  ? 1037 PHE B HE1    1 
ATOM   7012  H  HE2    . PHE B 1 75  ? -54.624  50.848  34.807  1.00 75.88  ? 1037 PHE B HE2    1 
ATOM   7013  H  HZ     . PHE B 1 75  ? -54.231  51.503  36.988  1.00 76.71  ? 1037 PHE B HZ     1 
ATOM   7014  N  N      . PRO B 1 76  ? -58.844  44.517  36.564  1.00 60.48  ? 1038 PRO B N      1 
ATOM   7015  C  CA     . PRO B 1 76  ? -60.013  43.644  36.418  1.00 62.58  ? 1038 PRO B CA     1 
ATOM   7016  C  C      . PRO B 1 76  ? -61.248  44.293  37.023  1.00 62.00  ? 1038 PRO B C      1 
ATOM   7017  O  O      . PRO B 1 76  ? -61.173  44.998  38.032  1.00 59.73  ? 1038 PRO B O      1 
ATOM   7018  C  CB     . PRO B 1 76  ? -59.605  42.368  37.166  1.00 61.54  ? 1038 PRO B CB     1 
ATOM   7019  C  CG     . PRO B 1 76  ? -58.504  42.784  38.074  1.00 63.24  ? 1038 PRO B CG     1 
ATOM   7020  C  CD     . PRO B 1 76  ? -57.790  43.901  37.387  1.00 60.16  ? 1038 PRO B CD     1 
ATOM   7021  H  HA     . PRO B 1 76  ? -60.173  43.438  35.484  1.00 75.10  ? 1038 PRO B HA     1 
ATOM   7022  H  HB2    . PRO B 1 76  ? -60.360  42.032  37.674  1.00 73.85  ? 1038 PRO B HB2    1 
ATOM   7023  H  HB3    . PRO B 1 76  ? -59.294  41.703  36.533  1.00 73.85  ? 1038 PRO B HB3    1 
ATOM   7024  H  HG2    . PRO B 1 76  ? -58.878  43.088  38.917  1.00 75.89  ? 1038 PRO B HG2    1 
ATOM   7025  H  HG3    . PRO B 1 76  ? -57.904  42.036  38.219  1.00 75.89  ? 1038 PRO B HG3    1 
ATOM   7026  H  HD2    . PRO B 1 76  ? -57.451  44.537  38.036  1.00 72.19  ? 1038 PRO B HD2    1 
ATOM   7027  H  HD3    . PRO B 1 76  ? -57.081  43.553  36.824  1.00 72.19  ? 1038 PRO B HD3    1 
ATOM   7028  N  N      . GLY B 1 77  ? -62.394  44.056  36.390  1.00 61.78  ? 1039 GLY B N      1 
ATOM   7029  C  CA     . GLY B 1 77  ? -63.622  44.701  36.795  1.00 63.58  ? 1039 GLY B CA     1 
ATOM   7030  C  C      . GLY B 1 77  ? -63.815  46.097  36.245  1.00 61.94  ? 1039 GLY B C      1 
ATOM   7031  O  O      . GLY B 1 77  ? -64.811  46.748  36.591  1.00 61.13  ? 1039 GLY B O      1 
ATOM   7032  H  H      . GLY B 1 77  ? -62.479  43.521  35.722  1.00 74.14  ? 1039 GLY B H      1 
ATOM   7033  H  HA2    . GLY B 1 77  ? -64.373  44.159  36.506  1.00 76.30  ? 1039 GLY B HA2    1 
ATOM   7034  H  HA3    . GLY B 1 77  ? -63.646  44.756  37.763  1.00 76.30  ? 1039 GLY B HA3    1 
ATOM   7035  N  N      . THR B 1 78  ? -62.896  46.585  35.415  1.00 57.79  ? 1040 THR B N      1 
ATOM   7036  C  CA     . THR B 1 78  ? -63.086  47.877  34.773  1.00 55.55  ? 1040 THR B CA     1 
ATOM   7037  C  C      . THR B 1 78  ? -64.363  47.866  33.947  1.00 53.38  ? 1040 THR B C      1 
ATOM   7038  O  O      . THR B 1 78  ? -64.661  46.900  33.240  1.00 56.81  ? 1040 THR B O      1 
ATOM   7039  C  CB     . THR B 1 78  ? -61.886  48.219  33.882  1.00 55.62  ? 1040 THR B CB     1 
ATOM   7040  O  OG1    . THR B 1 78  ? -60.764  48.578  34.698  1.00 54.39  ? 1040 THR B OG1    1 
ATOM   7041  C  CG2    . THR B 1 78  ? -62.207  49.374  32.927  1.00 54.68  ? 1040 THR B CG2    1 
ATOM   7042  H  H      . THR B 1 78  ? -62.160  46.190  35.210  1.00 69.35  ? 1040 THR B H      1 
ATOM   7043  H  HA     . THR B 1 78  ? -63.168  48.564  35.452  1.00 66.66  ? 1040 THR B HA     1 
ATOM   7044  H  HB     . THR B 1 78  ? -61.656  47.442  33.349  1.00 66.74  ? 1040 THR B HB     1 
ATOM   7045  H  HG1    . THR B 1 78  ? -60.558  47.938  35.201  1.00 65.27  ? 1040 THR B HG1    1 
ATOM   7046  H  HG21   . THR B 1 78  ? -61.435  49.572  32.375  1.00 65.62  ? 1040 THR B HG21   1 
ATOM   7047  H  HG22   . THR B 1 78  ? -62.951  49.133  32.353  1.00 65.62  ? 1040 THR B HG22   1 
ATOM   7048  H  HG23   . THR B 1 78  ? -62.444  50.167  33.433  1.00 65.62  ? 1040 THR B HG23   1 
ATOM   7049  N  N      . LYS B 1 79  ? -65.121  48.949  34.045  1.00 48.66  ? 1041 LYS B N      1 
ATOM   7050  C  CA     . LYS B 1 79  ? -66.271  49.183  33.188  1.00 51.25  ? 1041 LYS B CA     1 
ATOM   7051  C  C      . LYS B 1 79  ? -66.058  50.497  32.455  1.00 52.60  ? 1041 LYS B C      1 
ATOM   7052  O  O      . LYS B 1 79  ? -65.777  51.523  33.086  1.00 48.88  ? 1041 LYS B O      1 
ATOM   7053  C  CB     . LYS B 1 79  ? -67.571  49.226  33.992  1.00 56.11  ? 1041 LYS B CB     1 
ATOM   7054  C  CG     . LYS B 1 79  ? -68.794  49.521  33.141  1.00 60.50  ? 1041 LYS B CG     1 
ATOM   7055  C  CD     . LYS B 1 79  ? -70.072  49.524  33.957  1.00 64.94  ? 1041 LYS B CD     1 
ATOM   7056  C  CE     . LYS B 1 79  ? -71.258  49.933  33.097  1.00 68.29  ? 1041 LYS B CE     1 
ATOM   7057  N  NZ     . LYS B 1 79  ? -72.534  49.970  33.865  1.00 72.73  1 1041 LYS B NZ     1 
ATOM   7058  H  H      . LYS B 1 79  ? -64.985  49.578  34.615  1.00 58.39  ? 1041 LYS B H      1 
ATOM   7059  H  HA     . LYS B 1 79  ? -66.338  48.471  32.532  1.00 61.50  ? 1041 LYS B HA     1 
ATOM   7060  H  HB2    . LYS B 1 79  ? -67.705  48.366  34.419  1.00 67.33  ? 1041 LYS B HB2    1 
ATOM   7061  H  HB3    . LYS B 1 79  ? -67.501  49.922  34.665  1.00 67.33  ? 1041 LYS B HB3    1 
ATOM   7062  H  HG2    . LYS B 1 79  ? -68.694  50.395  32.733  1.00 72.60  ? 1041 LYS B HG2    1 
ATOM   7063  H  HG3    . LYS B 1 79  ? -68.876  48.840  32.455  1.00 72.60  ? 1041 LYS B HG3    1 
ATOM   7064  H  HD2    . LYS B 1 79  ? -70.236  48.632  34.302  1.00 77.93  ? 1041 LYS B HD2    1 
ATOM   7065  H  HD3    . LYS B 1 79  ? -69.988  50.159  34.685  1.00 77.93  ? 1041 LYS B HD3    1 
ATOM   7066  H  HE2    . LYS B 1 79  ? -71.098  50.819  32.737  1.00 81.95  ? 1041 LYS B HE2    1 
ATOM   7067  H  HE3    . LYS B 1 79  ? -71.360  49.294  32.375  1.00 81.95  ? 1041 LYS B HE3    1 
ATOM   7068  H  HZ1    . LYS B 1 79  ? -73.203  50.212  33.330  1.00 87.28  ? 1041 LYS B HZ1    1 
ATOM   7069  H  HZ2    . LYS B 1 79  ? -72.710  49.165  34.202  1.00 87.28  ? 1041 LYS B HZ2    1 
ATOM   7070  H  HZ3    . LYS B 1 79  ? -72.470  50.555  34.532  1.00 87.28  ? 1041 LYS B HZ3    1 
ATOM   7071  N  N      . LEU B 1 80  ? -66.168  50.461  31.130  1.00 52.07  ? 1042 LEU B N      1 
ATOM   7072  C  CA     . LEU B 1 80  ? -66.079  51.655  30.303  1.00 48.68  ? 1042 LEU B CA     1 
ATOM   7073  C  C      . LEU B 1 80  ? -67.460  51.978  29.754  1.00 48.46  ? 1042 LEU B C      1 
ATOM   7074  O  O      . LEU B 1 80  ? -68.181  51.082  29.306  1.00 49.59  ? 1042 LEU B O      1 
ATOM   7075  C  CB     . LEU B 1 80  ? -65.081  51.473  29.159  1.00 48.67  ? 1042 LEU B CB     1 
ATOM   7076  C  CG     . LEU B 1 80  ? -63.639  51.150  29.547  1.00 48.02  ? 1042 LEU B CG     1 
ATOM   7077  C  CD1    . LEU B 1 80  ? -62.775  51.146  28.300  1.00 47.51  ? 1042 LEU B CD1    1 
ATOM   7078  C  CD2    . LEU B 1 80  ? -63.097  52.128  30.585  1.00 48.43  ? 1042 LEU B CD2    1 
ATOM   7079  H  H      . LEU B 1 80  ? -66.297  49.740  30.680  1.00 62.48  ? 1042 LEU B H      1 
ATOM   7080  H  HA     . LEU B 1 80  ? -65.785  52.402  30.848  1.00 58.41  ? 1042 LEU B HA     1 
ATOM   7081  H  HB2    . LEU B 1 80  ? -65.395  50.748  28.596  1.00 58.40  ? 1042 LEU B HB2    1 
ATOM   7082  H  HB3    . LEU B 1 80  ? -65.061  52.294  28.642  1.00 58.40  ? 1042 LEU B HB3    1 
ATOM   7083  H  HG     . LEU B 1 80  ? -63.610  50.260  29.932  1.00 57.62  ? 1042 LEU B HG     1 
ATOM   7084  H  HD11   . LEU B 1 80  ? -61.861  50.941  28.551  1.00 57.01  ? 1042 LEU B HD11   1 
ATOM   7085  H  HD12   . LEU B 1 80  ? -63.109  50.474  27.687  1.00 57.01  ? 1042 LEU B HD12   1 
ATOM   7086  H  HD13   . LEU B 1 80  ? -62.816  52.022  27.886  1.00 57.01  ? 1042 LEU B HD13   1 
ATOM   7087  H  HD21   . LEU B 1 80  ? -62.183  51.885  30.801  1.00 58.11  ? 1042 LEU B HD21   1 
ATOM   7088  H  HD22   . LEU B 1 80  ? -63.124  53.025  30.218  1.00 58.11  ? 1042 LEU B HD22   1 
ATOM   7089  H  HD23   . LEU B 1 80  ? -63.649  52.079  31.382  1.00 58.11  ? 1042 LEU B HD23   1 
ATOM   7090  N  N      . SER B 1 81  ? -67.831  53.252  29.816  1.00 49.19  ? 1043 SER B N      1 
ATOM   7091  C  CA     . SER B 1 81  ? -69.109  53.728  29.311  1.00 48.41  ? 1043 SER B CA     1 
ATOM   7092  C  C      . SER B 1 81  ? -68.867  54.947  28.436  1.00 45.74  ? 1043 SER B C      1 
ATOM   7093  O  O      . SER B 1 81  ? -68.123  55.854  28.825  1.00 45.55  ? 1043 SER B O      1 
ATOM   7094  C  CB     . SER B 1 81  ? -70.064  54.077  30.458  1.00 49.18  ? 1043 SER B CB     1 
ATOM   7095  O  OG     . SER B 1 81  ? -70.224  52.977  31.337  1.00 52.73  ? 1043 SER B OG     1 
ATOM   7096  H  H      . SER B 1 81  ? -67.345  53.875  30.157  1.00 59.03  ? 1043 SER B H      1 
ATOM   7097  H  HA     . SER B 1 81  ? -69.520  53.037  28.768  1.00 58.10  ? 1043 SER B HA     1 
ATOM   7098  H  HB2    . SER B 1 81  ? -69.700  54.826  30.954  1.00 59.01  ? 1043 SER B HB2    1 
ATOM   7099  H  HB3    . SER B 1 81  ? -70.929  54.313  30.088  1.00 59.01  ? 1043 SER B HB3    1 
ATOM   7100  H  HG     . SER B 1 81  ? -70.748  53.182  31.960  1.00 63.27  ? 1043 SER B HG     1 
ATOM   7101  N  N      . LEU B 1 82  ? -69.470  54.958  27.252  1.00 47.66  ? 1044 LEU B N      1 
ATOM   7102  C  CA     . LEU B 1 82  ? -69.401  56.123  26.385  1.00 44.88  ? 1044 LEU B CA     1 
ATOM   7103  C  C      . LEU B 1 82  ? -70.348  57.207  26.879  1.00 43.80  ? 1044 LEU B C      1 
ATOM   7104  O  O      . LEU B 1 82  ? -71.444  56.923  27.372  1.00 46.38  ? 1044 LEU B O      1 
ATOM   7105  C  CB     . LEU B 1 82  ? -69.748  55.747  24.945  1.00 42.34  ? 1044 LEU B CB     1 
ATOM   7106  C  CG     . LEU B 1 82  ? -68.758  54.852  24.195  1.00 45.88  ? 1044 LEU B CG     1 
ATOM   7107  C  CD1    . LEU B 1 82  ? -69.222  54.618  22.762  1.00 41.64  ? 1044 LEU B CD1    1 
ATOM   7108  C  CD2    . LEU B 1 82  ? -67.361  55.452  24.201  1.00 45.73  ? 1044 LEU B CD2    1 
ATOM   7109  H  H      . LEU B 1 82  ? -69.925  54.303  26.930  1.00 57.19  ? 1044 LEU B H      1 
ATOM   7110  H  HA     . LEU B 1 82  ? -68.498  56.479  26.398  1.00 53.86  ? 1044 LEU B HA     1 
ATOM   7111  H  HB2    . LEU B 1 82  ? -70.600  55.285  24.952  1.00 50.81  ? 1044 LEU B HB2    1 
ATOM   7112  H  HB3    . LEU B 1 82  ? -69.835  56.567  24.433  1.00 50.81  ? 1044 LEU B HB3    1 
ATOM   7113  H  HG     . LEU B 1 82  ? -68.714  53.991  24.639  1.00 55.06  ? 1044 LEU B HG     1 
ATOM   7114  H  HD11   . LEU B 1 82  ? -68.578  54.049  22.311  1.00 49.96  ? 1044 LEU B HD11   1 
ATOM   7115  H  HD12   . LEU B 1 82  ? -70.090  54.186  22.779  1.00 49.96  ? 1044 LEU B HD12   1 
ATOM   7116  H  HD13   . LEU B 1 82  ? -69.285  55.472  22.307  1.00 49.96  ? 1044 LEU B HD13   1 
ATOM   7117  H  HD21   . LEU B 1 82  ? -66.762  54.861  23.719  1.00 54.87  ? 1044 LEU B HD21   1 
ATOM   7118  H  HD22   . LEU B 1 82  ? -67.389  56.320  23.769  1.00 54.87  ? 1044 LEU B HD22   1 
ATOM   7119  H  HD23   . LEU B 1 82  ? -67.063  55.549  25.119  1.00 54.87  ? 1044 LEU B HD23   1 
ATOM   7120  N  N      . PHE B 1 83  ? -69.913  58.454  26.752  1.00 43.26  ? 1045 PHE B N      1 
ATOM   7121  C  CA     . PHE B 1 83  ? -70.769  59.601  27.010  1.00 44.92  ? 1045 PHE B CA     1 
ATOM   7122  C  C      . PHE B 1 83  ? -70.383  60.704  26.032  1.00 42.08  ? 1045 PHE B C      1 
ATOM   7123  O  O      . PHE B 1 83  ? -69.632  60.476  25.078  1.00 39.21  ? 1045 PHE B O      1 
ATOM   7124  C  CB     . PHE B 1 83  ? -70.665  60.035  28.478  1.00 41.85  ? 1045 PHE B CB     1 
ATOM   7125  C  CG     . PHE B 1 83  ? -69.326  60.602  28.858  1.00 42.39  ? 1045 PHE B CG     1 
ATOM   7126  C  CD1    . PHE B 1 83  ? -68.248  59.765  29.106  1.00 42.83  ? 1045 PHE B CD1    1 
ATOM   7127  C  CD2    . PHE B 1 83  ? -69.150  61.970  28.994  1.00 42.69  ? 1045 PHE B CD2    1 
ATOM   7128  C  CE1    . PHE B 1 83  ? -67.016  60.283  29.470  1.00 41.91  ? 1045 PHE B CE1    1 
ATOM   7129  C  CE2    . PHE B 1 83  ? -67.919  62.494  29.355  1.00 43.33  ? 1045 PHE B CE2    1 
ATOM   7130  C  CZ     . PHE B 1 83  ? -66.851  61.649  29.593  1.00 42.71  ? 1045 PHE B CZ     1 
ATOM   7131  H  H      . PHE B 1 83  ? -69.114  58.664  26.514  1.00 51.91  ? 1045 PHE B H      1 
ATOM   7132  H  HA     . PHE B 1 83  ? -71.691  59.354  26.835  1.00 53.90  ? 1045 PHE B HA     1 
ATOM   7133  H  HB2    . PHE B 1 83  ? -71.334  60.716  28.650  1.00 50.22  ? 1045 PHE B HB2    1 
ATOM   7134  H  HB3    . PHE B 1 83  ? -70.830  59.263  29.043  1.00 50.22  ? 1045 PHE B HB3    1 
ATOM   7135  H  HD1    . PHE B 1 83  ? -68.353  58.845  29.024  1.00 51.40  ? 1045 PHE B HD1    1 
ATOM   7136  H  HD2    . PHE B 1 83  ? -69.865  62.543  28.835  1.00 51.23  ? 1045 PHE B HD2    1 
ATOM   7137  H  HE1    . PHE B 1 83  ? -66.299  59.712  29.628  1.00 50.29  ? 1045 PHE B HE1    1 
ATOM   7138  H  HE2    . PHE B 1 83  ? -67.812  63.415  29.439  1.00 52.00  ? 1045 PHE B HE2    1 
ATOM   7139  H  HZ     . PHE B 1 83  ? -66.024  61.999  29.836  1.00 51.25  ? 1045 PHE B HZ     1 
ATOM   7140  N  N      . GLY B 1 84  ? -70.900  61.906  26.266  1.00 37.02  ? 1046 GLY B N      1 
ATOM   7141  C  CA     . GLY B 1 84  ? -70.610  62.990  25.360  1.00 41.76  ? 1046 GLY B CA     1 
ATOM   7142  C  C      . GLY B 1 84  ? -71.365  62.841  24.044  1.00 41.64  ? 1046 GLY B C      1 
ATOM   7143  O  O      . GLY B 1 84  ? -72.399  62.173  23.948  1.00 39.76  ? 1046 GLY B O      1 
ATOM   7144  H  H      . GLY B 1 84  ? -71.408  62.110  26.929  1.00 44.42  ? 1046 GLY B H      1 
ATOM   7145  H  HA2    . GLY B 1 84  ? -70.863  63.833  25.769  1.00 50.11  ? 1046 GLY B HA2    1 
ATOM   7146  H  HA3    . GLY B 1 84  ? -69.659  63.011  25.170  1.00 50.11  ? 1046 GLY B HA3    1 
ATOM   7147  N  N      . SER B 1 85  ? -70.818  63.474  23.007  1.00 38.92  ? 1047 SER B N      1 
ATOM   7148  C  CA     . SER B 1 85  ? -71.540  63.561  21.743  1.00 44.41  ? 1047 SER B CA     1 
ATOM   7149  C  C      . SER B 1 85  ? -71.651  62.220  21.028  1.00 43.37  ? 1047 SER B C      1 
ATOM   7150  O  O      . SER B 1 85  ? -72.445  62.106  20.090  1.00 43.76  ? 1047 SER B O      1 
ATOM   7151  C  CB     . SER B 1 85  ? -70.880  64.601  20.836  1.00 38.20  ? 1047 SER B CB     1 
ATOM   7152  O  OG     . SER B 1 85  ? -69.634  64.155  20.345  1.00 40.63  ? 1047 SER B OG     1 
ATOM   7153  H  H      . SER B 1 85  ? -70.046  63.853  23.009  1.00 46.71  ? 1047 SER B H      1 
ATOM   7154  H  HA     . SER B 1 85  ? -72.442  63.867  21.927  1.00 53.30  ? 1047 SER B HA     1 
ATOM   7155  H  HB2    . SER B 1 85  ? -71.467  64.777  20.084  1.00 45.85  ? 1047 SER B HB2    1 
ATOM   7156  H  HB3    . SER B 1 85  ? -70.742  65.417  21.343  1.00 45.85  ? 1047 SER B HB3    1 
ATOM   7157  H  HG     . SER B 1 85  ? -69.292  64.742  19.851  1.00 48.76  ? 1047 SER B HG     1 
ATOM   7158  N  N      . SER B 1 86  ? -70.895  61.203  21.447  1.00 44.38  ? 1048 SER B N      1 
ATOM   7159  C  CA     . SER B 1 86  ? -71.110  59.861  20.918  1.00 41.79  ? 1048 SER B CA     1 
ATOM   7160  C  C      . SER B 1 86  ? -72.461  59.290  21.328  1.00 44.64  ? 1048 SER B C      1 
ATOM   7161  O  O      . SER B 1 86  ? -72.939  58.351  20.684  1.00 46.15  ? 1048 SER B O      1 
ATOM   7162  C  CB     . SER B 1 86  ? -69.999  58.919  21.386  1.00 44.75  ? 1048 SER B CB     1 
ATOM   7163  O  OG     . SER B 1 86  ? -68.737  59.308  20.874  1.00 44.24  ? 1048 SER B OG     1 
ATOM   7164  H  H      . SER B 1 86  ? -70.262  61.264  22.025  1.00 53.25  ? 1048 SER B H      1 
ATOM   7165  H  HA     . SER B 1 86  ? -71.083  59.897  19.949  1.00 50.14  ? 1048 SER B HA     1 
ATOM   7166  H  HB2    . SER B 1 86  ? -69.963  58.935  22.356  1.00 53.70  ? 1048 SER B HB2    1 
ATOM   7167  H  HB3    . SER B 1 86  ? -70.199  58.021  21.079  1.00 53.70  ? 1048 SER B HB3    1 
ATOM   7168  H  HG     . SER B 1 86  ? -68.548  60.084  21.133  1.00 53.09  ? 1048 SER B HG     1 
ATOM   7169  N  N      . LYS B 1 87  ? -73.087  59.834  22.380  1.00 45.78  ? 1049 LYS B N      1 
ATOM   7170  C  CA     . LYS B 1 87  ? -74.329  59.287  22.913  1.00 46.63  ? 1049 LYS B CA     1 
ATOM   7171  C  C      . LYS B 1 87  ? -75.429  60.314  23.151  1.00 46.70  ? 1049 LYS B C      1 
ATOM   7172  O  O      . LYS B 1 87  ? -76.574  59.909  23.379  1.00 50.31  ? 1049 LYS B O      1 
ATOM   7173  C  CB     . LYS B 1 87  ? -74.070  58.552  24.240  1.00 49.66  ? 1049 LYS B CB     1 
ATOM   7174  C  CG     . LYS B 1 87  ? -73.282  57.259  24.107  1.00 52.53  ? 1049 LYS B CG     1 
ATOM   7175  C  CD     . LYS B 1 87  ? -74.026  56.245  23.253  1.00 56.39  ? 1049 LYS B CD     1 
ATOM   7176  C  CE     . LYS B 1 87  ? -73.560  54.827  23.527  1.00 59.58  ? 1049 LYS B CE     1 
ATOM   7177  N  NZ     . LYS B 1 87  ? -74.290  53.834  22.687  1.00 60.90  1 1049 LYS B NZ     1 
ATOM   7178  H  H      . LYS B 1 87  ? -72.804  60.527  22.803  1.00 54.93  ? 1049 LYS B H      1 
ATOM   7179  H  HA     . LYS B 1 87  ? -74.672  58.635  22.282  1.00 55.96  ? 1049 LYS B HA     1 
ATOM   7180  H  HB2    . LYS B 1 87  ? -73.570  59.141  24.827  1.00 59.59  ? 1049 LYS B HB2    1 
ATOM   7181  H  HB3    . LYS B 1 87  ? -74.924  58.336  24.646  1.00 59.59  ? 1049 LYS B HB3    1 
ATOM   7182  H  HG2    . LYS B 1 87  ? -72.429  57.444  23.686  1.00 63.04  ? 1049 LYS B HG2    1 
ATOM   7183  H  HG3    . LYS B 1 87  ? -73.146  56.874  24.987  1.00 63.04  ? 1049 LYS B HG3    1 
ATOM   7184  H  HD2    . LYS B 1 87  ? -74.974  56.296  23.451  1.00 67.67  ? 1049 LYS B HD2    1 
ATOM   7185  H  HD3    . LYS B 1 87  ? -73.868  56.440  22.316  1.00 67.67  ? 1049 LYS B HD3    1 
ATOM   7186  H  HE2    . LYS B 1 87  ? -72.613  54.757  23.325  1.00 71.49  ? 1049 LYS B HE2    1 
ATOM   7187  H  HE3    . LYS B 1 87  ? -73.720  54.612  24.459  1.00 71.49  ? 1049 LYS B HE3    1 
ATOM   7188  H  HZ1    . LYS B 1 87  ? -73.999  53.012  22.866  1.00 73.08  ? 1049 LYS B HZ1    1 
ATOM   7189  H  HZ2    . LYS B 1 87  ? -75.162  53.875  22.857  1.00 73.08  ? 1049 LYS B HZ2    1 
ATOM   7190  H  HZ3    . LYS B 1 87  ? -74.155  54.007  21.825  1.00 73.08  ? 1049 LYS B HZ3    1 
ATOM   7191  N  N      . ASN B 1 88  ? -75.137  61.611  23.117  1.00 47.81  ? 1050 ASN B N      1 
ATOM   7192  C  CA     . ASN B 1 88  ? -76.159  62.615  23.387  1.00 48.92  ? 1050 ASN B CA     1 
ATOM   7193  C  C      . ASN B 1 88  ? -76.910  63.049  22.134  1.00 50.69  ? 1050 ASN B C      1 
ATOM   7194  O  O      . ASN B 1 88  ? -77.765  63.936  22.219  1.00 50.20  ? 1050 ASN B O      1 
ATOM   7195  C  CB     . ASN B 1 88  ? -75.543  63.841  24.078  1.00 47.75  ? 1050 ASN B CB     1 
ATOM   7196  C  CG     . ASN B 1 88  ? -74.598  64.618  23.184  1.00 47.61  ? 1050 ASN B CG     1 
ATOM   7197  O  OD1    . ASN B 1 88  ? -74.609  64.478  21.957  1.00 46.24  ? 1050 ASN B OD1    1 
ATOM   7198  N  ND2    . ASN B 1 88  ? -73.770  65.453  23.800  1.00 41.86  ? 1050 ASN B ND2    1 
ATOM   7199  H  H      . ASN B 1 88  ? -74.360  61.934  22.941  1.00 57.37  ? 1050 ASN B H      1 
ATOM   7200  H  HA     . ASN B 1 88  ? -76.809  62.234  23.997  1.00 58.71  ? 1050 ASN B HA     1 
ATOM   7201  H  HB2    . ASN B 1 88  ? -76.256  64.439  24.351  1.00 57.31  ? 1050 ASN B HB2    1 
ATOM   7202  H  HB3    . ASN B 1 88  ? -75.044  63.546  24.856  1.00 57.31  ? 1050 ASN B HB3    1 
ATOM   7203  H  HD21   . ASN B 1 88  ? -73.211  65.921  23.343  1.00 50.23  ? 1050 ASN B HD21   1 
ATOM   7204  H  HD22   . ASN B 1 88  ? -73.792  65.527  24.656  1.00 50.23  ? 1050 ASN B HD22   1 
ATOM   7205  N  N      . GLY B 1 89  ? -76.602  62.463  20.980  1.00 53.91  ? 1051 GLY B N      1 
ATOM   7206  C  CA     . GLY B 1 89  ? -77.334  62.738  19.762  1.00 57.06  ? 1051 GLY B CA     1 
ATOM   7207  C  C      . GLY B 1 89  ? -76.807  63.880  18.923  1.00 53.31  ? 1051 GLY B C      1 
ATOM   7208  O  O      . GLY B 1 89  ? -77.470  64.264  17.952  1.00 54.53  ? 1051 GLY B O      1 
ATOM   7209  H  H      . GLY B 1 89  ? -75.963  61.896  20.881  1.00 64.69  ? 1051 GLY B H      1 
ATOM   7210  H  HA2    . GLY B 1 89  ? -77.333  61.941  19.210  1.00 68.47  ? 1051 GLY B HA2    1 
ATOM   7211  H  HA3    . GLY B 1 89  ? -78.255  62.940  19.990  1.00 68.47  ? 1051 GLY B HA3    1 
ATOM   7212  N  N      . PHE B 1 90  ? -75.638  64.430  19.256  1.00 48.19  ? 1052 PHE B N      1 
ATOM   7213  C  CA     . PHE B 1 90  ? -75.099  65.596  18.566  1.00 41.65  ? 1052 PHE B CA     1 
ATOM   7214  C  C      . PHE B 1 90  ? -73.654  65.363  18.140  1.00 36.48  ? 1052 PHE B C      1 
ATOM   7215  O  O      . PHE B 1 90  ? -72.869  66.309  18.048  1.00 36.66  ? 1052 PHE B O      1 
ATOM   7216  C  CB     . PHE B 1 90  ? -75.190  66.839  19.451  1.00 41.86  ? 1052 PHE B CB     1 
ATOM   7217  C  CG     . PHE B 1 90  ? -76.550  67.063  20.051  1.00 40.82  ? 1052 PHE B CG     1 
ATOM   7218  C  CD1    . PHE B 1 90  ? -77.685  67.081  19.257  1.00 41.53  ? 1052 PHE B CD1    1 
ATOM   7219  C  CD2    . PHE B 1 90  ? -76.691  67.246  21.416  1.00 40.61  ? 1052 PHE B CD2    1 
ATOM   7220  C  CE1    . PHE B 1 90  ? -78.932  67.284  19.814  1.00 43.31  ? 1052 PHE B CE1    1 
ATOM   7221  C  CE2    . PHE B 1 90  ? -77.935  67.448  21.980  1.00 42.67  ? 1052 PHE B CE2    1 
ATOM   7222  C  CZ     . PHE B 1 90  ? -79.057  67.466  21.180  1.00 44.33  ? 1052 PHE B CZ     1 
ATOM   7223  H  H      . PHE B 1 90  ? -75.134  64.140  19.889  1.00 57.83  ? 1052 PHE B H      1 
ATOM   7224  H  HA     . PHE B 1 90  ? -75.624  65.759  17.766  1.00 49.98  ? 1052 PHE B HA     1 
ATOM   7225  H  HB2    . PHE B 1 90  ? -74.556  66.750  20.180  1.00 50.23  ? 1052 PHE B HB2    1 
ATOM   7226  H  HB3    . PHE B 1 90  ? -74.969  67.619  18.918  1.00 50.23  ? 1052 PHE B HB3    1 
ATOM   7227  H  HD1    . PHE B 1 90  ? -77.605  66.958  18.339  1.00 49.83  ? 1052 PHE B HD1    1 
ATOM   7228  H  HD2    . PHE B 1 90  ? -75.937  67.234  21.961  1.00 48.74  ? 1052 PHE B HD2    1 
ATOM   7229  H  HE1    . PHE B 1 90  ? -79.687  67.295  19.272  1.00 51.97  ? 1052 PHE B HE1    1 
ATOM   7230  H  HE2    . PHE B 1 90  ? -78.016  67.571  22.898  1.00 51.20  ? 1052 PHE B HE2    1 
ATOM   7231  H  HZ     . PHE B 1 90  ? -79.896  67.603  21.556  1.00 53.19  ? 1052 PHE B HZ     1 
ATOM   7232  N  N      . GLY B 1 91  ? -73.288  64.113  17.870  1.00 34.62  ? 1053 GLY B N      1 
ATOM   7233  C  CA     . GLY B 1 91  ? -71.915  63.806  17.523  1.00 36.88  ? 1053 GLY B CA     1 
ATOM   7234  C  C      . GLY B 1 91  ? -71.616  64.036  16.052  1.00 40.11  ? 1053 GLY B C      1 
ATOM   7235  O  O      . GLY B 1 91  ? -72.471  63.878  15.182  1.00 37.29  ? 1053 GLY B O      1 
ATOM   7236  H  H      . GLY B 1 91  ? -73.815  63.433  17.881  1.00 41.55  ? 1053 GLY B H      1 
ATOM   7237  H  HA2    . GLY B 1 91  ? -71.318  64.363  18.047  1.00 44.25  ? 1053 GLY B HA2    1 
ATOM   7238  H  HA3    . GLY B 1 91  ? -71.730  62.878  17.732  1.00 44.25  ? 1053 GLY B HA3    1 
ATOM   7239  N  N      . PHE B 1 92  ? -70.370  64.422  15.785  1.00 39.91  ? 1054 PHE B N      1 
ATOM   7240  C  CA     . PHE B 1 92  ? -69.826  64.497  14.438  1.00 41.91  ? 1054 PHE B CA     1 
ATOM   7241  C  C      . PHE B 1 92  ? -69.022  63.237  14.148  1.00 45.38  ? 1054 PHE B C      1 
ATOM   7242  O  O      . PHE B 1 92  ? -68.594  62.521  15.057  1.00 42.86  ? 1054 PHE B O      1 
ATOM   7243  C  CB     . PHE B 1 92  ? -68.916  65.718  14.265  1.00 40.09  ? 1054 PHE B CB     1 
ATOM   7244  C  CG     . PHE B 1 92  ? -69.646  67.022  14.105  1.00 39.25  ? 1054 PHE B CG     1 
ATOM   7245  C  CD1    . PHE B 1 92  ? -70.969  67.159  14.493  1.00 44.29  ? 1054 PHE B CD1    1 
ATOM   7246  C  CD2    . PHE B 1 92  ? -68.991  68.126  13.593  1.00 36.44  ? 1054 PHE B CD2    1 
ATOM   7247  C  CE1    . PHE B 1 92  ? -71.624  68.371  14.351  1.00 42.40  ? 1054 PHE B CE1    1 
ATOM   7248  C  CE2    . PHE B 1 92  ? -69.643  69.335  13.451  1.00 39.46  ? 1054 PHE B CE2    1 
ATOM   7249  C  CZ     . PHE B 1 92  ? -70.958  69.456  13.831  1.00 41.09  ? 1054 PHE B CZ     1 
ATOM   7250  H  H      . PHE B 1 92  ? -69.805  64.652  16.392  1.00 47.90  ? 1054 PHE B H      1 
ATOM   7251  H  HA     . PHE B 1 92  ? -70.551  64.557  13.796  1.00 50.29  ? 1054 PHE B HA     1 
ATOM   7252  H  HB2    . PHE B 1 92  ? -68.347  65.794  15.047  1.00 48.11  ? 1054 PHE B HB2    1 
ATOM   7253  H  HB3    . PHE B 1 92  ? -68.369  65.589  13.474  1.00 48.11  ? 1054 PHE B HB3    1 
ATOM   7254  H  HD1    . PHE B 1 92  ? -71.424  66.428  14.844  1.00 53.15  ? 1054 PHE B HD1    1 
ATOM   7255  H  HD2    . PHE B 1 92  ? -68.101  68.051  13.333  1.00 43.72  ? 1054 PHE B HD2    1 
ATOM   7256  H  HE1    . PHE B 1 92  ? -72.514  68.451  14.608  1.00 50.88  ? 1054 PHE B HE1    1 
ATOM   7257  H  HE2    . PHE B 1 92  ? -69.191  70.068  13.099  1.00 47.35  ? 1054 PHE B HE2    1 
ATOM   7258  H  HZ     . PHE B 1 92  ? -71.398  70.270  13.735  1.00 49.30  ? 1054 PHE B HZ     1 
ATOM   7259  N  N      . LYS B 1 93  ? -68.819  62.974  12.856  1.00 41.37  ? 1055 LYS B N      1 
ATOM   7260  C  CA     . LYS B 1 93  ? -68.039  61.809  12.454  1.00 45.85  ? 1055 LYS B CA     1 
ATOM   7261  C  C      . LYS B 1 93  ? -66.680  61.793  13.146  1.00 47.01  ? 1055 LYS B C      1 
ATOM   7262  O  O      . LYS B 1 93  ? -66.210  60.737  13.585  1.00 43.24  ? 1055 LYS B O      1 
ATOM   7263  C  CB     . LYS B 1 93  ? -67.869  61.796  10.934  1.00 44.39  ? 1055 LYS B CB     1 
ATOM   7264  C  CG     . LYS B 1 93  ? -69.174  61.628  10.166  1.00 48.06  ? 1055 LYS B CG     1 
ATOM   7265  C  CD     . LYS B 1 93  ? -68.953  61.734  8.658   1.00 49.78  ? 1055 LYS B CD     1 
ATOM   7266  C  CE     . LYS B 1 93  ? -70.258  61.586  7.877   1.00 48.93  ? 1055 LYS B CE     1 
ATOM   7267  N  NZ     . LYS B 1 93  ? -70.778  60.189  7.895   1.00 53.55  1 1055 LYS B NZ     1 
ATOM   7268  H  H      . LYS B 1 93  ? -69.119  63.448  12.204  1.00 49.65  ? 1055 LYS B H      1 
ATOM   7269  H  HA     . LYS B 1 93  ? -68.516  61.004  12.711  1.00 55.02  ? 1055 LYS B HA     1 
ATOM   7270  H  HB2    . LYS B 1 93  ? -67.469  62.636  10.658  1.00 53.27  ? 1055 LYS B HB2    1 
ATOM   7271  H  HB3    . LYS B 1 93  ? -67.286  61.060  10.692  1.00 53.27  ? 1055 LYS B HB3    1 
ATOM   7272  H  HG2    . LYS B 1 93  ? -69.548  60.754  10.358  1.00 57.67  ? 1055 LYS B HG2    1 
ATOM   7273  H  HG3    . LYS B 1 93  ? -69.795  62.325  10.432  1.00 57.67  ? 1055 LYS B HG3    1 
ATOM   7274  H  HD2    . LYS B 1 93  ? -68.574  62.602  8.451   1.00 59.73  ? 1055 LYS B HD2    1 
ATOM   7275  H  HD3    . LYS B 1 93  ? -68.350  61.029  8.374   1.00 59.73  ? 1055 LYS B HD3    1 
ATOM   7276  H  HE2    . LYS B 1 93  ? -70.930  62.162  8.273   1.00 58.72  ? 1055 LYS B HE2    1 
ATOM   7277  H  HE3    . LYS B 1 93  ? -70.105  61.838  6.953   1.00 58.72  ? 1055 LYS B HE3    1 
ATOM   7278  H  HZ1    . LYS B 1 93  ? -71.537  60.142  7.431   1.00 64.26  ? 1055 LYS B HZ1    1 
ATOM   7279  H  HZ2    . LYS B 1 93  ? -70.182  59.638  7.530   1.00 64.26  ? 1055 LYS B HZ2    1 
ATOM   7280  H  HZ3    . LYS B 1 93  ? -70.935  59.933  8.733   1.00 64.26  ? 1055 LYS B HZ3    1 
ATOM   7281  N  N      . GLN B 1 94  ? -66.036  62.959  13.258  1.00 48.07  ? 1056 GLN B N      1 
ATOM   7282  C  CA     . GLN B 1 94  ? -64.689  63.073  13.807  1.00 48.12  ? 1056 GLN B CA     1 
ATOM   7283  C  C      . GLN B 1 94  ? -64.672  63.653  15.221  1.00 48.45  ? 1056 GLN B C      1 
ATOM   7284  O  O      . GLN B 1 94  ? -63.619  64.093  15.693  1.00 45.83  ? 1056 GLN B O      1 
ATOM   7285  C  CB     . GLN B 1 94  ? -63.819  63.918  12.875  1.00 48.60  ? 1056 GLN B CB     1 
ATOM   7286  C  CG     . GLN B 1 94  ? -63.575  63.276  11.510  1.00 51.86  ? 1056 GLN B CG     1 
ATOM   7287  C  CD     . GLN B 1 94  ? -62.819  61.964  11.611  1.00 55.80  ? 1056 GLN B CD     1 
ATOM   7288  O  OE1    . GLN B 1 94  ? -61.823  61.862  12.328  1.00 57.78  ? 1056 GLN B OE1    1 
ATOM   7289  N  NE2    . GLN B 1 94  ? -63.303  60.944  10.912  1.00 57.75  ? 1056 GLN B NE2    1 
ATOM   7290  H  H      . GLN B 1 94  ? -66.370  63.714  13.016  1.00 57.69  ? 1056 GLN B H      1 
ATOM   7291  H  HA     . GLN B 1 94  ? -64.298  62.186  13.850  1.00 57.74  ? 1056 GLN B HA     1 
ATOM   7292  H  HB2    . GLN B 1 94  ? -64.257  64.771  12.728  1.00 58.32  ? 1056 GLN B HB2    1 
ATOM   7293  H  HB3    . GLN B 1 94  ? -62.957  64.059  13.295  1.00 58.32  ? 1056 GLN B HB3    1 
ATOM   7294  H  HG2    . GLN B 1 94  ? -64.429  63.100  11.085  1.00 62.23  ? 1056 GLN B HG2    1 
ATOM   7295  H  HG3    . GLN B 1 94  ? -63.051  63.883  10.964  1.00 62.23  ? 1056 GLN B HG3    1 
ATOM   7296  H  HE21   . GLN B 1 94  ? -64.010  61.048  10.434  1.00 69.30  ? 1056 GLN B HE21   1 
ATOM   7297  H  HE22   . GLN B 1 94  ? -62.909  60.180  10.937  1.00 69.30  ? 1056 GLN B HE22   1 
ATOM   7298  N  N      . SER B 1 95  ? -65.810  63.657  15.911  1.00 44.93  ? 1057 SER B N      1 
ATOM   7299  C  CA     . SER B 1 95  ? -65.807  64.043  17.313  1.00 44.99  ? 1057 SER B CA     1 
ATOM   7300  C  C      . SER B 1 95  ? -64.968  63.050  18.107  1.00 46.12  ? 1057 SER B C      1 
ATOM   7301  O  O      . SER B 1 95  ? -64.798  61.892  17.713  1.00 46.67  ? 1057 SER B O      1 
ATOM   7302  C  CB     . SER B 1 95  ? -67.232  64.092  17.875  1.00 43.24  ? 1057 SER B CB     1 
ATOM   7303  O  OG     . SER B 1 95  ? -67.986  65.160  17.322  1.00 41.08  ? 1057 SER B OG     1 
ATOM   7304  H  H      . SER B 1 95  ? -66.581  63.445  15.596  1.00 53.92  ? 1057 SER B H      1 
ATOM   7305  H  HA     . SER B 1 95  ? -65.410  64.923  17.405  1.00 53.99  ? 1057 SER B HA     1 
ATOM   7306  H  HB2    . SER B 1 95  ? -67.678  63.255  17.668  1.00 51.88  ? 1057 SER B HB2    1 
ATOM   7307  H  HB3    . SER B 1 95  ? -67.184  64.208  18.837  1.00 51.88  ? 1057 SER B HB3    1 
ATOM   7308  H  HG     . SER B 1 95  ? -67.615  65.893  17.496  1.00 49.30  ? 1057 SER B HG     1 
ATOM   7309  N  N      . ASP B 1 96  ? -64.418  63.518  19.223  1.00 34.00  ? 1058 ASP B N      1 
ATOM   7310  C  CA     . ASP B 1 96  ? -63.638  62.639  20.077  1.00 38.77  ? 1058 ASP B CA     1 
ATOM   7311  C  C      . ASP B 1 96  ? -64.545  61.582  20.709  1.00 40.25  ? 1058 ASP B C      1 
ATOM   7312  O  O      . ASP B 1 96  ? -65.776  61.641  20.625  1.00 37.87  ? 1058 ASP B O      1 
ATOM   7313  C  CB     . ASP B 1 96  ? -62.903  63.445  21.153  1.00 38.68  ? 1058 ASP B CB     1 
ATOM   7314  C  CG     . ASP B 1 96  ? -63.846  64.109  22.145  1.00 41.78  ? 1058 ASP B CG     1 
ATOM   7315  O  OD1    . ASP B 1 96  ? -65.078  64.019  21.970  1.00 43.31  ? 1058 ASP B OD1    1 
ATOM   7316  O  OD2    . ASP B 1 96  ? -63.347  64.731  23.104  1.00 43.88  1 1058 ASP B OD2    1 
ATOM   7317  H  H      . ASP B 1 96  ? -64.481  64.328  19.503  1.00 40.80  ? 1058 ASP B H      1 
ATOM   7318  H  HA     . ASP B 1 96  ? -62.974  62.181  19.538  1.00 46.52  ? 1058 ASP B HA     1 
ATOM   7319  H  HB2    . ASP B 1 96  ? -62.318  62.850  21.648  1.00 46.42  ? 1058 ASP B HB2    1 
ATOM   7320  H  HB3    . ASP B 1 96  ? -62.381  64.141  20.724  1.00 46.42  ? 1058 ASP B HB3    1 
ATOM   7321  N  N      . LEU B 1 97  ? -63.915  60.583  21.317  1.00 43.68  ? 1059 LEU B N      1 
ATOM   7322  C  CA     . LEU B 1 97  ? -64.612  59.496  22.001  1.00 42.40  ? 1059 LEU B CA     1 
ATOM   7323  C  C      . LEU B 1 97  ? -64.436  59.706  23.502  1.00 42.94  ? 1059 LEU B C      1 
ATOM   7324  O  O      . LEU B 1 97  ? -63.357  59.459  24.048  1.00 40.94  ? 1059 LEU B O      1 
ATOM   7325  C  CB     . LEU B 1 97  ? -64.071  58.142  21.554  1.00 41.50  ? 1059 LEU B CB     1 
ATOM   7326  C  CG     . LEU B 1 97  ? -64.893  56.912  21.940  1.00 43.85  ? 1059 LEU B CG     1 
ATOM   7327  C  CD1    . LEU B 1 97  ? -66.180  56.844  21.136  1.00 42.80  ? 1059 LEU B CD1    1 
ATOM   7328  C  CD2    . LEU B 1 97  ? -64.071  55.643  21.748  1.00 45.34  ? 1059 LEU B CD2    1 
ATOM   7329  H  H      . LEU B 1 97  ? -63.058  60.509  21.348  1.00 52.41  ? 1059 LEU B H      1 
ATOM   7330  H  HA     . LEU B 1 97  ? -65.559  59.535  21.793  1.00 50.88  ? 1059 LEU B HA     1 
ATOM   7331  H  HB2    . LEU B 1 97  ? -64.002  58.148  20.587  1.00 49.80  ? 1059 LEU B HB2    1 
ATOM   7332  H  HB3    . LEU B 1 97  ? -63.188  58.027  21.937  1.00 49.80  ? 1059 LEU B HB3    1 
ATOM   7333  H  HG     . LEU B 1 97  ? -65.130  56.974  22.878  1.00 52.62  ? 1059 LEU B HG     1 
ATOM   7334  H  HD11   . LEU B 1 97  ? -66.677  56.055  21.403  1.00 51.36  ? 1059 LEU B HD11   1 
ATOM   7335  H  HD12   . LEU B 1 97  ? -66.704  57.641  21.312  1.00 51.36  ? 1059 LEU B HD12   1 
ATOM   7336  H  HD13   . LEU B 1 97  ? -65.960  56.793  20.192  1.00 51.36  ? 1059 LEU B HD13   1 
ATOM   7337  H  HD21   . LEU B 1 97  ? -64.610  54.876  21.998  1.00 54.41  ? 1059 LEU B HD21   1 
ATOM   7338  H  HD22   . LEU B 1 97  ? -63.810  55.574  20.816  1.00 54.41  ? 1059 LEU B HD22   1 
ATOM   7339  H  HD23   . LEU B 1 97  ? -63.282  55.690  22.311  1.00 54.41  ? 1059 LEU B HD23   1 
ATOM   7340  N  N      . ASP B 1 98  ? -65.493  60.167  24.165  1.00 41.83  ? 1060 ASP B N      1 
ATOM   7341  C  CA     . ASP B 1 98  ? -65.446  60.437  25.598  1.00 42.71  ? 1060 ASP B CA     1 
ATOM   7342  C  C      . ASP B 1 98  ? -65.847  59.173  26.351  1.00 42.54  ? 1060 ASP B C      1 
ATOM   7343  O  O      . ASP B 1 98  ? -66.951  58.653  26.156  1.00 43.81  ? 1060 ASP B O      1 
ATOM   7344  C  CB     . ASP B 1 98  ? -66.363  61.604  25.962  1.00 40.56  ? 1060 ASP B CB     1 
ATOM   7345  C  CG     . ASP B 1 98  ? -66.054  62.861  25.160  1.00 39.50  ? 1060 ASP B CG     1 
ATOM   7346  O  OD1    . ASP B 1 98  ? -64.983  63.463  25.380  1.00 38.03  ? 1060 ASP B OD1    1 
ATOM   7347  O  OD2    . ASP B 1 98  ? -66.892  63.260  24.324  1.00 38.94  1 1060 ASP B OD2    1 
ATOM   7348  H  H      . ASP B 1 98  ? -66.256  60.332  23.805  1.00 50.20  ? 1060 ASP B H      1 
ATOM   7349  H  HA     . ASP B 1 98  ? -64.539  60.670  25.852  1.00 51.26  ? 1060 ASP B HA     1 
ATOM   7350  H  HB2    . ASP B 1 98  ? -67.283  61.352  25.783  1.00 48.67  ? 1060 ASP B HB2    1 
ATOM   7351  H  HB3    . ASP B 1 98  ? -66.252  61.813  26.902  1.00 48.67  ? 1060 ASP B HB3    1 
ATOM   7352  N  N      . VAL B 1 99  ? -64.952  58.684  27.209  1.00 41.29  ? 1061 VAL B N      1 
ATOM   7353  C  CA     . VAL B 1 99  ? -65.108  57.392  27.867  1.00 42.26  ? 1061 VAL B CA     1 
ATOM   7354  C  C      . VAL B 1 99  ? -65.005  57.592  29.375  1.00 42.02  ? 1061 VAL B C      1 
ATOM   7355  O  O      . VAL B 1 99  ? -64.091  58.270  29.856  1.00 37.70  ? 1061 VAL B O      1 
ATOM   7356  C  CB     . VAL B 1 99  ? -64.051  56.379  27.382  1.00 40.72  ? 1061 VAL B CB     1 
ATOM   7357  C  CG1    . VAL B 1 99  ? -64.239  55.029  28.068  1.00 43.18  ? 1061 VAL B CG1    1 
ATOM   7358  C  CG2    . VAL B 1 99  ? -64.122  56.216  25.875  1.00 41.59  ? 1061 VAL B CG2    1 
ATOM   7359  H  H      . VAL B 1 99  ? -64.229  59.094  27.429  1.00 49.54  ? 1061 VAL B H      1 
ATOM   7360  H  HA     . VAL B 1 99  ? -65.987  57.034  27.667  1.00 50.71  ? 1061 VAL B HA     1 
ATOM   7361  H  HB     . VAL B 1 99  ? -63.168  56.710  27.608  1.00 48.87  ? 1061 VAL B HB     1 
ATOM   7362  H  HG11   . VAL B 1 99  ? -63.563  54.414  27.745  1.00 51.81  ? 1061 VAL B HG11   1 
ATOM   7363  H  HG12   . VAL B 1 99  ? -64.149  55.147  29.027  1.00 51.81  ? 1061 VAL B HG12   1 
ATOM   7364  H  HG13   . VAL B 1 99  ? -65.123  54.690  27.858  1.00 51.81  ? 1061 VAL B HG13   1 
ATOM   7365  H  HG21   . VAL B 1 99  ? -63.449  55.575  25.596  1.00 49.90  ? 1061 VAL B HG21   1 
ATOM   7366  H  HG22   . VAL B 1 99  ? -65.005  55.895  25.634  1.00 49.90  ? 1061 VAL B HG22   1 
ATOM   7367  H  HG23   . VAL B 1 99  ? -63.956  57.075  25.457  1.00 49.90  ? 1061 VAL B HG23   1 
ATOM   7368  N  N      . CYS B 1 100 ? -65.943  57.004  30.113  1.00 43.49  ? 1062 CYS B N      1 
ATOM   7369  C  CA     . CYS B 1 100 ? -65.937  57.029  31.570  1.00 46.34  ? 1062 CYS B CA     1 
ATOM   7370  C  C      . CYS B 1 100 ? -65.574  55.649  32.100  1.00 48.79  ? 1062 CYS B C      1 
ATOM   7371  O  O      . CYS B 1 100 ? -66.223  54.654  31.755  1.00 44.78  ? 1062 CYS B O      1 
ATOM   7372  C  CB     . CYS B 1 100 ? -67.293  57.462  32.130  1.00 46.51  ? 1062 CYS B CB     1 
ATOM   7373  S  SG     . CYS B 1 100 ? -67.433  57.212  33.925  1.00 50.18  ? 1062 CYS B SG     1 
ATOM   7374  H  H      . CYS B 1 100 ? -66.609  56.573  29.783  1.00 52.18  ? 1062 CYS B H      1 
ATOM   7375  H  HA     . CYS B 1 100 ? -65.266  57.659  31.876  1.00 55.61  ? 1062 CYS B HA     1 
ATOM   7376  H  HB2    . CYS B 1 100 ? -67.422  58.406  31.949  1.00 55.81  ? 1062 CYS B HB2    1 
ATOM   7377  H  HB3    . CYS B 1 100 ? -67.991  56.943  31.701  1.00 55.81  ? 1062 CYS B HB3    1 
ATOM   7378  H  HG     . CYS B 1 100 ? -68.519  57.574  34.285  1.00 60.22  ? 1062 CYS B HG     1 
ATOM   7379  N  N      . MET B 1 101 ? -64.547  55.597  32.941  1.00 50.09  ? 1063 MET B N      1 
ATOM   7380  C  CA     . MET B 1 101 ? -64.075  54.354  33.531  1.00 51.53  ? 1063 MET B CA     1 
ATOM   7381  C  C      . MET B 1 101 ? -64.541  54.244  34.975  1.00 53.44  ? 1063 MET B C      1 
ATOM   7382  O  O      . MET B 1 101 ? -64.421  55.201  35.748  1.00 54.63  ? 1063 MET B O      1 
ATOM   7383  C  CB     . MET B 1 101 ? -62.550  54.279  33.482  1.00 53.47  ? 1063 MET B CB     1 
ATOM   7384  C  CG     . MET B 1 101 ? -61.969  53.133  34.289  1.00 53.40  ? 1063 MET B CG     1 
ATOM   7385  S  SD     . MET B 1 101 ? -60.210  52.911  33.999  1.00 54.32  ? 1063 MET B SD     1 
ATOM   7386  C  CE     . MET B 1 101 ? -59.830  51.645  35.205  1.00 56.87  ? 1063 MET B CE     1 
ATOM   7387  H  H      . MET B 1 101 ? -64.098  56.287  33.191  1.00 60.11  ? 1063 MET B H      1 
ATOM   7388  H  HA     . MET B 1 101 ? -64.430  53.606  33.024  1.00 61.84  ? 1063 MET B HA     1 
ATOM   7389  H  HB2    . MET B 1 101 ? -62.271  54.164  32.560  1.00 64.17  ? 1063 MET B HB2    1 
ATOM   7390  H  HB3    . MET B 1 101 ? -62.185  55.106  33.835  1.00 64.17  ? 1063 MET B HB3    1 
ATOM   7391  H  HG2    . MET B 1 101 ? -62.098  53.313  35.233  1.00 64.08  ? 1063 MET B HG2    1 
ATOM   7392  H  HG3    . MET B 1 101 ? -62.421  52.311  34.042  1.00 64.08  ? 1063 MET B HG3    1 
ATOM   7393  H  HE1    . MET B 1 101 ? -58.886  51.430  35.149  1.00 68.25  ? 1063 MET B HE1    1 
ATOM   7394  H  HE2    . MET B 1 101 ? -60.042  51.979  36.090  1.00 68.25  ? 1063 MET B HE2    1 
ATOM   7395  H  HE3    . MET B 1 101 ? -60.361  50.856  35.012  1.00 68.25  ? 1063 MET B HE3    1 
ATOM   7396  N  N      . THR B 1 102 ? -65.070  53.076  35.332  1.00 52.14  ? 1064 THR B N      1 
ATOM   7397  C  CA     . THR B 1 102 ? -65.358  52.728  36.713  1.00 51.98  ? 1064 THR B CA     1 
ATOM   7398  C  C      . THR B 1 102 ? -64.841  51.319  36.969  1.00 55.88  ? 1064 THR B C      1 
ATOM   7399  O  O      . THR B 1 102 ? -64.439  50.604  36.047  1.00 51.64  ? 1064 THR B O      1 
ATOM   7400  C  CB     . THR B 1 102 ? -66.858  52.816  37.030  1.00 52.90  ? 1064 THR B CB     1 
ATOM   7401  O  OG1    . THR B 1 102 ? -67.590  51.953  36.153  1.00 54.44  ? 1064 THR B OG1    1 
ATOM   7402  C  CG2    . THR B 1 102 ? -67.352  54.246  36.869  1.00 49.93  ? 1064 THR B CG2    1 
ATOM   7403  H  H      . THR B 1 102 ? -65.274  52.455  34.774  1.00 62.57  ? 1064 THR B H      1 
ATOM   7404  H  HA     . THR B 1 102 ? -64.887  53.337  37.302  1.00 62.37  ? 1064 THR B HA     1 
ATOM   7405  H  HB     . THR B 1 102 ? -67.008  52.544  37.949  1.00 63.48  ? 1064 THR B HB     1 
ATOM   7406  H  HG1    . THR B 1 102 ? -68.411  51.999  36.324  1.00 65.33  ? 1064 THR B HG1    1 
ATOM   7407  H  HG21   . THR B 1 102 ? -68.299  54.294  37.071  1.00 59.91  ? 1064 THR B HG21   1 
ATOM   7408  H  HG22   . THR B 1 102 ? -66.870  54.833  37.473  1.00 59.91  ? 1064 THR B HG22   1 
ATOM   7409  H  HG23   . THR B 1 102 ? -67.208  54.545  35.957  1.00 59.91  ? 1064 THR B HG23   1 
ATOM   7410  N  N      . ILE B 1 103 ? -64.863  50.921  38.238  1.00 63.25  ? 1065 ILE B N      1 
ATOM   7411  C  CA     . ILE B 1 103 ? -64.340  49.633  38.681  1.00 69.97  ? 1065 ILE B CA     1 
ATOM   7412  C  C      . ILE B 1 103 ? -65.416  48.932  39.495  1.00 77.00  ? 1065 ILE B C      1 
ATOM   7413  O  O      . ILE B 1 103 ? -65.862  49.456  40.523  1.00 77.50  ? 1065 ILE B O      1 
ATOM   7414  C  CB     . ILE B 1 103 ? -63.046  49.781  39.501  1.00 70.89  ? 1065 ILE B CB     1 
ATOM   7415  C  CG1    . ILE B 1 103 ? -61.963  50.449  38.644  1.00 65.76  ? 1065 ILE B CG1    1 
ATOM   7416  C  CG2    . ILE B 1 103 ? -62.583  48.419  40.022  1.00 69.61  ? 1065 ILE B CG2    1 
ATOM   7417  C  CD1    . ILE B 1 103 ? -60.653  50.698  39.365  1.00 67.87  ? 1065 ILE B CD1    1 
ATOM   7418  H  H      . ILE B 1 103 ? -65.186  51.395  38.879  1.00 75.90  ? 1065 ILE B H      1 
ATOM   7419  H  HA     . ILE B 1 103 ? -64.144  49.086  37.905  1.00 83.96  ? 1065 ILE B HA     1 
ATOM   7420  H  HB     . ILE B 1 103 ? -63.230  50.353  40.262  1.00 85.06  ? 1065 ILE B HB     1 
ATOM   7421  H  HG12   . ILE B 1 103 ? -61.776  49.880  37.881  1.00 78.91  ? 1065 ILE B HG12   1 
ATOM   7422  H  HG13   . ILE B 1 103 ? -62.297  51.307  38.337  1.00 78.91  ? 1065 ILE B HG13   1 
ATOM   7423  H  HG21   . ILE B 1 103 ? -61.768  48.538  40.534  1.00 83.54  ? 1065 ILE B HG21   1 
ATOM   7424  H  HG22   . ILE B 1 103 ? -63.277  48.045  40.587  1.00 83.54  ? 1065 ILE B HG22   1 
ATOM   7425  H  HG23   . ILE B 1 103 ? -62.418  47.832  39.267  1.00 83.54  ? 1065 ILE B HG23   1 
ATOM   7426  H  HD11   . ILE B 1 103 ? -60.031  51.120  38.752  1.00 81.45  ? 1065 ILE B HD11   1 
ATOM   7427  H  HD12   . ILE B 1 103 ? -60.816  51.278  40.124  1.00 81.45  ? 1065 ILE B HD12   1 
ATOM   7428  H  HD13   . ILE B 1 103 ? -60.294  49.849  39.667  1.00 81.45  ? 1065 ILE B HD13   1 
ATOM   7429  N  N      . ASN B 1 104 ? -65.845  47.760  39.030  1.00 82.16  ? 1066 ASN B N      1 
ATOM   7430  C  CA     . ASN B 1 104 ? -66.859  47.002  39.749  1.00 89.18  ? 1066 ASN B CA     1 
ATOM   7431  C  C      . ASN B 1 104 ? -66.379  46.730  41.168  1.00 87.96  ? 1066 ASN B C      1 
ATOM   7432  O  O      . ASN B 1 104 ? -65.279  46.211  41.379  1.00 91.84  ? 1066 ASN B O      1 
ATOM   7433  C  CB     . ASN B 1 104 ? -67.148  45.686  39.029  1.00 94.52  ? 1066 ASN B CB     1 
ATOM   7434  C  CG     . ASN B 1 104 ? -67.802  45.889  37.675  1.00 95.86  ? 1066 ASN B CG     1 
ATOM   7435  O  OD1    . ASN B 1 104 ? -68.360  46.951  37.392  1.00 95.93  ? 1066 ASN B OD1    1 
ATOM   7436  N  ND2    . ASN B 1 104 ? -67.731  44.869  36.826  1.00 96.07  ? 1066 ASN B ND2    1 
ATOM   7437  H  H      . ASN B 1 104 ? -65.566  47.387  38.307  1.00 98.59  ? 1066 ASN B H      1 
ATOM   7438  H  HA     . ASN B 1 104 ? -67.679  47.518  39.793  1.00 107.01 ? 1066 ASN B HA     1 
ATOM   7439  H  HB2    . ASN B 1 104 ? -66.313  45.211  38.890  1.00 113.42 ? 1066 ASN B HB2    1 
ATOM   7440  H  HB3    . ASN B 1 104 ? -67.746  45.152  39.574  1.00 113.42 ? 1066 ASN B HB3    1 
ATOM   7441  H  HD21   . ASN B 1 104 ? -68.086  44.933  36.045  1.00 115.28 ? 1066 ASN B HD21   1 
ATOM   7442  H  HD22   . ASN B 1 104 ? -67.329  44.144  37.057  1.00 115.28 ? 1066 ASN B HD22   1 
ATOM   7443  N  N      . GLY B 1 105 ? -67.213  47.088  42.140  1.00 80.12  ? 1067 GLY B N      1 
ATOM   7444  C  CA     . GLY B 1 105 ? -66.882  46.992  43.545  1.00 76.12  ? 1067 GLY B CA     1 
ATOM   7445  C  C      . GLY B 1 105 ? -66.687  48.339  44.206  1.00 73.13  ? 1067 GLY B C      1 
ATOM   7446  O  O      . GLY B 1 105 ? -66.720  48.421  45.440  1.00 74.69  ? 1067 GLY B O      1 
ATOM   7447  H  H      . GLY B 1 105 ? -68.002  47.399  41.998  1.00 96.14  ? 1067 GLY B H      1 
ATOM   7448  H  HA2    . GLY B 1 105 ? -67.594  46.525  44.010  1.00 91.35  ? 1067 GLY B HA2    1 
ATOM   7449  H  HA3    . GLY B 1 105 ? -66.064  46.481  43.647  1.00 91.35  ? 1067 GLY B HA3    1 
ATOM   7450  N  N      . LEU B 1 106 ? -66.483  49.391  43.416  1.00 72.14  ? 1068 LEU B N      1 
ATOM   7451  C  CA     . LEU B 1 106 ? -66.340  50.762  43.900  1.00 70.89  ? 1068 LEU B CA     1 
ATOM   7452  C  C      . LEU B 1 106 ? -67.501  51.571  43.335  1.00 72.81  ? 1068 LEU B C      1 
ATOM   7453  O  O      . LEU B 1 106 ? -67.481  51.957  42.162  1.00 72.70  ? 1068 LEU B O      1 
ATOM   7454  C  CB     . LEU B 1 106 ? -65.002  51.357  43.472  1.00 67.73  ? 1068 LEU B CB     1 
ATOM   7455  C  CG     . LEU B 1 106 ? -63.738  50.779  44.099  1.00 66.85  ? 1068 LEU B CG     1 
ATOM   7456  C  CD1    . LEU B 1 106 ? -62.510  51.308  43.386  1.00 66.96  ? 1068 LEU B CD1    1 
ATOM   7457  C  CD2    . LEU B 1 106 ? -63.687  51.131  45.567  1.00 73.68  ? 1068 LEU B CD2    1 
ATOM   7458  H  H      . LEU B 1 106 ? -66.421  49.331  42.560  1.00 86.57  ? 1068 LEU B H      1 
ATOM   7459  H  HA     . LEU B 1 106 ? -66.392  50.776  44.869  1.00 85.06  ? 1068 LEU B HA     1 
ATOM   7460  H  HB2    . LEU B 1 106 ? -64.918  51.246  42.512  1.00 81.27  ? 1068 LEU B HB2    1 
ATOM   7461  H  HB3    . LEU B 1 106 ? -65.014  52.304  43.682  1.00 81.27  ? 1068 LEU B HB3    1 
ATOM   7462  H  HG     . LEU B 1 106 ? -63.748  49.813  44.016  1.00 80.22  ? 1068 LEU B HG     1 
ATOM   7463  H  HD11   . LEU B 1 106 ? -61.718  50.930  43.799  1.00 80.36  ? 1068 LEU B HD11   1 
ATOM   7464  H  HD12   . LEU B 1 106 ? -62.552  51.050  42.452  1.00 80.36  ? 1068 LEU B HD12   1 
ATOM   7465  H  HD13   . LEU B 1 106 ? -62.493  52.275  43.462  1.00 80.36  ? 1068 LEU B HD13   1 
ATOM   7466  H  HD21   . LEU B 1 106 ? -62.880  50.758  45.953  1.00 88.42  ? 1068 LEU B HD21   1 
ATOM   7467  H  HD22   . LEU B 1 106 ? -63.683  52.097  45.659  1.00 88.42  ? 1068 LEU B HD22   1 
ATOM   7468  H  HD23   . LEU B 1 106 ? -64.467  50.759  46.007  1.00 88.42  ? 1068 LEU B HD23   1 
ATOM   7469  N  N      . GLU B 1 107 ? -68.510  51.831  44.165  1.00 76.37  ? 1069 GLU B N      1 
ATOM   7470  C  CA     . GLU B 1 107 ? -69.683  52.555  43.689  1.00 78.74  ? 1069 GLU B CA     1 
ATOM   7471  C  C      . GLU B 1 107 ? -69.361  54.013  43.386  1.00 73.30  ? 1069 GLU B C      1 
ATOM   7472  O  O      . GLU B 1 107 ? -69.969  54.605  42.487  1.00 73.68  ? 1069 GLU B O      1 
ATOM   7473  C  CB     . GLU B 1 107 ? -70.812  52.458  44.717  1.00 87.57  ? 1069 GLU B CB     1 
ATOM   7474  C  CG     . GLU B 1 107 ? -71.322  51.037  44.935  1.00 94.08  ? 1069 GLU B CG     1 
ATOM   7475  C  CD     . GLU B 1 107 ? -72.395  50.949  46.014  1.00 104.89 ? 1069 GLU B CD     1 
ATOM   7476  O  OE1    . GLU B 1 107 ? -72.645  51.965  46.699  1.00 108.81 ? 1069 GLU B OE1    1 
ATOM   7477  O  OE2    . GLU B 1 107 ? -72.989  49.861  46.181  1.00 107.92 1 1069 GLU B OE2    1 
ATOM   7478  H  H      . GLU B 1 107 ? -68.540  51.603  44.994  1.00 91.65  ? 1069 GLU B H      1 
ATOM   7479  H  HA     . GLU B 1 107 ? -69.993  52.143  42.868  1.00 94.49  ? 1069 GLU B HA     1 
ATOM   7480  H  HB2    . GLU B 1 107 ? -70.489  52.791  45.569  1.00 105.08 ? 1069 GLU B HB2    1 
ATOM   7481  H  HB3    . GLU B 1 107 ? -71.558  52.998  44.414  1.00 105.08 ? 1069 GLU B HB3    1 
ATOM   7482  H  HG2    . GLU B 1 107 ? -71.704  50.708  44.106  1.00 112.90 ? 1069 GLU B HG2    1 
ATOM   7483  H  HG3    . GLU B 1 107 ? -70.580  50.473  45.205  1.00 112.90 ? 1069 GLU B HG3    1 
ATOM   7484  N  N      . THR B 1 108 ? -68.418  54.608  44.116  1.00 65.82  ? 1070 THR B N      1 
ATOM   7485  C  CA     . THR B 1 108 ? -67.998  55.979  43.866  1.00 60.24  ? 1070 THR B CA     1 
ATOM   7486  C  C      . THR B 1 108 ? -66.481  56.063  43.967  1.00 59.02  ? 1070 THR B C      1 
ATOM   7487  O  O      . THR B 1 108 ? -65.803  55.100  44.337  1.00 56.36  ? 1070 THR B O      1 
ATOM   7488  C  CB     . THR B 1 108 ? -68.640  56.973  44.849  1.00 61.99  ? 1070 THR B CB     1 
ATOM   7489  O  OG1    . THR B 1 108 ? -68.079  56.795  46.155  1.00 64.91  ? 1070 THR B OG1    1 
ATOM   7490  C  CG2    . THR B 1 108 ? -70.148  56.779  44.919  1.00 63.25  ? 1070 THR B CG2    1 
ATOM   7491  H  H      . THR B 1 108 ? -68.004  54.231  44.768  1.00 78.99  ? 1070 THR B H      1 
ATOM   7492  H  HA     . THR B 1 108 ? -68.256  56.233  42.966  1.00 72.28  ? 1070 THR B HA     1 
ATOM   7493  H  HB     . THR B 1 108 ? -68.464  57.878  44.547  1.00 74.39  ? 1070 THR B HB     1 
ATOM   7494  H  HG1    . THR B 1 108 ? -68.428  57.337  46.694  1.00 77.90  ? 1070 THR B HG1    1 
ATOM   7495  H  HG21   . THR B 1 108 ? -70.534  57.414  45.543  1.00 75.90  ? 1070 THR B HG21   1 
ATOM   7496  H  HG22   . THR B 1 108 ? -70.541  56.919  44.043  1.00 75.90  ? 1070 THR B HG22   1 
ATOM   7497  H  HG23   . THR B 1 108 ? -70.353  55.879  45.217  1.00 75.90  ? 1070 THR B HG23   1 
ATOM   7498  N  N      . ALA B 1 109 ? -65.957  57.238  43.626  1.00 59.80  ? 1071 ALA B N      1 
ATOM   7499  C  CA     . ALA B 1 109 ? -64.535  57.553  43.758  1.00 59.02  ? 1071 ALA B CA     1 
ATOM   7500  C  C      . ALA B 1 109 ? -64.168  58.027  45.159  1.00 63.64  ? 1071 ALA B C      1 
ATOM   7501  O  O      . ALA B 1 109 ? -63.371  58.956  45.314  1.00 63.89  ? 1071 ALA B O      1 
ATOM   7502  C  CB     . ALA B 1 109 ? -64.149  58.601  42.717  1.00 53.77  ? 1071 ALA B CB     1 
ATOM   7503  H  H      . ALA B 1 109 ? -66.419  57.889  43.306  1.00 71.76  ? 1071 ALA B H      1 
ATOM   7504  H  HA     . ALA B 1 109 ? -64.021  56.751  43.574  1.00 70.83  ? 1071 ALA B HA     1 
ATOM   7505  H  HB1    . ALA B 1 109 ? -63.205  58.805  42.810  1.00 64.52  ? 1071 ALA B HB1    1 
ATOM   7506  H  HB2    . ALA B 1 109 ? -64.325  58.246  41.831  1.00 64.52  ? 1071 ALA B HB2    1 
ATOM   7507  H  HB3    . ALA B 1 109 ? -64.677  59.401  42.864  1.00 64.52  ? 1071 ALA B HB3    1 
ATOM   7508  N  N      . GLU B 1 110 ? -64.699  57.384  46.194  1.00 68.68  ? 1072 GLU B N      1 
ATOM   7509  C  CA     . GLU B 1 110 ? -64.531  57.836  47.568  1.00 72.70  ? 1072 GLU B CA     1 
ATOM   7510  C  C      . GLU B 1 110 ? -63.376  57.065  48.184  1.00 70.34  ? 1072 GLU B C      1 
ATOM   7511  O  O      . GLU B 1 110 ? -63.430  55.835  48.294  1.00 71.46  ? 1072 GLU B O      1 
ATOM   7512  C  CB     . GLU B 1 110 ? -65.809  57.616  48.378  1.00 78.55  ? 1072 GLU B CB     1 
ATOM   7513  C  CG     . GLU B 1 110 ? -66.575  58.885  48.706  1.00 82.07  ? 1072 GLU B CG     1 
ATOM   7514  C  CD     . GLU B 1 110 ? -65.884  59.729  49.757  1.00 86.31  ? 1072 GLU B CD     1 
ATOM   7515  O  OE1    . GLU B 1 110 ? -65.267  59.148  50.676  1.00 85.99  ? 1072 GLU B OE1    1 
ATOM   7516  O  OE2    . GLU B 1 110 ? -65.955  60.973  49.660  1.00 88.61  1 1072 GLU B OE2    1 
ATOM   7517  H  H      . GLU B 1 110 ? -65.170  56.668  46.123  1.00 82.42  ? 1072 GLU B H      1 
ATOM   7518  H  HA     . GLU B 1 110 ? -64.315  58.782  47.577  1.00 87.24  ? 1072 GLU B HA     1 
ATOM   7519  H  HB2    . GLU B 1 110 ? -66.401  57.038  47.873  1.00 94.26  ? 1072 GLU B HB2    1 
ATOM   7520  H  HB3    . GLU B 1 110 ? -65.574  57.190  49.217  1.00 94.26  ? 1072 GLU B HB3    1 
ATOM   7521  H  HG2    . GLU B 1 110 ? -66.662  59.419  47.901  1.00 98.48  ? 1072 GLU B HG2    1 
ATOM   7522  H  HG3    . GLU B 1 110 ? -67.453  58.645  49.043  1.00 98.48  ? 1072 GLU B HG3    1 
ATOM   7523  N  N      . GLY B 1 111 ? -62.328  57.791  48.568  1.00 62.45  ? 1073 GLY B N      1 
ATOM   7524  C  CA     . GLY B 1 111 ? -61.096  57.185  49.009  1.00 62.91  ? 1073 GLY B CA     1 
ATOM   7525  C  C      . GLY B 1 111 ? -60.162  56.777  47.895  1.00 58.59  ? 1073 GLY B C      1 
ATOM   7526  O  O      . GLY B 1 111 ? -59.012  56.422  48.175  1.00 59.97  ? 1073 GLY B O      1 
ATOM   7527  H  H      . GLY B 1 111 ? -62.315  58.651  48.578  1.00 74.94  ? 1073 GLY B H      1 
ATOM   7528  H  HA2    . GLY B 1 111 ? -60.625  57.809  49.582  1.00 75.50  ? 1073 GLY B HA2    1 
ATOM   7529  H  HA3    . GLY B 1 111 ? -61.303  56.394  49.531  1.00 75.50  ? 1073 GLY B HA3    1 
ATOM   7530  N  N      . LEU B 1 112 ? -60.600  56.849  46.641  1.00 63.24  ? 1074 LEU B N      1 
ATOM   7531  C  CA     . LEU B 1 112 ? -59.790  56.403  45.518  1.00 65.19  ? 1074 LEU B CA     1 
ATOM   7532  C  C      . LEU B 1 112 ? -58.781  57.479  45.145  1.00 65.14  ? 1074 LEU B C      1 
ATOM   7533  O  O      . LEU B 1 112 ? -59.143  58.645  44.955  1.00 66.69  ? 1074 LEU B O      1 
ATOM   7534  C  CB     . LEU B 1 112 ? -60.680  56.080  44.317  1.00 62.06  ? 1074 LEU B CB     1 
ATOM   7535  C  CG     . LEU B 1 112 ? -59.990  55.551  43.053  1.00 61.98  ? 1074 LEU B CG     1 
ATOM   7536  C  CD1    . LEU B 1 112 ? -59.370  54.183  43.283  1.00 63.09  ? 1074 LEU B CD1    1 
ATOM   7537  C  CD2    . LEU B 1 112 ? -60.968  55.504  41.881  1.00 59.05  ? 1074 LEU B CD2    1 
ATOM   7538  H  H      . LEU B 1 112 ? -61.372  57.155  46.415  1.00 75.89  ? 1074 LEU B H      1 
ATOM   7539  H  HA     . LEU B 1 112 ? -59.306  55.600  45.767  1.00 78.23  ? 1074 LEU B HA     1 
ATOM   7540  H  HB2    . LEU B 1 112 ? -61.323  55.408  44.592  1.00 74.48  ? 1074 LEU B HB2    1 
ATOM   7541  H  HB3    . LEU B 1 112 ? -61.151  56.889  44.066  1.00 74.48  ? 1074 LEU B HB3    1 
ATOM   7542  H  HG     . LEU B 1 112 ? -59.275  56.160  42.813  1.00 74.37  ? 1074 LEU B HG     1 
ATOM   7543  H  HD11   . LEU B 1 112 ? -58.947  53.887  42.462  1.00 75.71  ? 1074 LEU B HD11   1 
ATOM   7544  H  HD12   . LEU B 1 112 ? -58.710  54.250  43.990  1.00 75.71  ? 1074 LEU B HD12   1 
ATOM   7545  H  HD13   . LEU B 1 112 ? -60.068  53.559  43.539  1.00 75.71  ? 1074 LEU B HD13   1 
ATOM   7546  H  HD21   . LEU B 1 112 ? -60.506  55.167  41.098  1.00 70.86  ? 1074 LEU B HD21   1 
ATOM   7547  H  HD22   . LEU B 1 112 ? -61.706  54.917  42.109  1.00 70.86  ? 1074 LEU B HD22   1 
ATOM   7548  H  HD23   . LEU B 1 112 ? -61.298  56.400  41.711  1.00 70.86  ? 1074 LEU B HD23   1 
ATOM   7549  N  N      . ASP B 1 113 ? -57.515  57.085  45.044  1.00 62.55  ? 1075 ASP B N      1 
ATOM   7550  C  CA     . ASP B 1 113 ? -56.464  57.987  44.583  1.00 62.21  ? 1075 ASP B CA     1 
ATOM   7551  C  C      . ASP B 1 113 ? -56.600  58.096  43.069  1.00 62.41  ? 1075 ASP B C      1 
ATOM   7552  O  O      . ASP B 1 113 ? -56.095  57.255  42.322  1.00 60.33  ? 1075 ASP B O      1 
ATOM   7553  C  CB     . ASP B 1 113 ? -55.094  57.460  44.992  1.00 63.87  ? 1075 ASP B CB     1 
ATOM   7554  C  CG     . ASP B 1 113 ? -53.991  58.474  44.777  1.00 64.51  ? 1075 ASP B CG     1 
ATOM   7555  O  OD1    . ASP B 1 113 ? -54.189  59.404  43.969  1.00 61.60  ? 1075 ASP B OD1    1 
ATOM   7556  O  OD2    . ASP B 1 113 ? -52.924  58.335  45.415  1.00 65.47  1 1075 ASP B OD2    1 
ATOM   7557  H  H      . ASP B 1 113 ? -57.237  56.295  45.237  1.00 75.06  ? 1075 ASP B H      1 
ATOM   7558  H  HA     . ASP B 1 113 ? -56.591  58.866  44.973  1.00 74.65  ? 1075 ASP B HA     1 
ATOM   7559  H  HB2    . ASP B 1 113 ? -55.112  57.231  45.935  1.00 76.65  ? 1075 ASP B HB2    1 
ATOM   7560  H  HB3    . ASP B 1 113 ? -54.887  56.674  44.464  1.00 76.65  ? 1075 ASP B HB3    1 
ATOM   7561  N  N      . CYS B 1 114 ? -57.298  59.136  42.611  1.00 63.61  ? 1076 CYS B N      1 
ATOM   7562  C  CA     . CYS B 1 114 ? -57.652  59.221  41.198  1.00 62.99  ? 1076 CYS B CA     1 
ATOM   7563  C  C      . CYS B 1 114 ? -56.440  59.546  40.334  1.00 64.10  ? 1076 CYS B C      1 
ATOM   7564  O  O      . CYS B 1 114 ? -56.287  58.988  39.242  1.00 62.34  ? 1076 CYS B O      1 
ATOM   7565  C  CB     . CYS B 1 114 ? -58.754  60.258  41.002  1.00 64.03  ? 1076 CYS B CB     1 
ATOM   7566  S  SG     . CYS B 1 114 ? -60.333  59.747  41.714  1.00 65.40  ? 1076 CYS B SG     1 
ATOM   7567  H  H      . CYS B 1 114 ? -57.574  59.794  43.090  1.00 76.34  ? 1076 CYS B H      1 
ATOM   7568  H  HA     . CYS B 1 114 ? -57.999  58.362  40.911  1.00 75.59  ? 1076 CYS B HA     1 
ATOM   7569  H  HB2    . CYS B 1 114 ? -58.487  61.087  41.428  1.00 76.84  ? 1076 CYS B HB2    1 
ATOM   7570  H  HB3    . CYS B 1 114 ? -58.887  60.401  40.052  1.00 76.84  ? 1076 CYS B HB3    1 
ATOM   7571  H  HG     . CYS B 1 114 ? -61.145  60.609  41.520  1.00 78.48  ? 1076 CYS B HG     1 
ATOM   7572  N  N      . VAL B 1 115 ? -55.573  60.450  40.796  1.00 65.18  ? 1077 VAL B N      1 
ATOM   7573  C  CA     . VAL B 1 115 ? -54.382  60.785  40.021  1.00 64.88  ? 1077 VAL B CA     1 
ATOM   7574  C  C      . VAL B 1 115 ? -53.492  59.559  39.876  1.00 61.92  ? 1077 VAL B C      1 
ATOM   7575  O  O      . VAL B 1 115 ? -52.950  59.290  38.797  1.00 60.48  ? 1077 VAL B O      1 
ATOM   7576  C  CB     . VAL B 1 115 ? -53.621  61.966  40.658  1.00 65.75  ? 1077 VAL B CB     1 
ATOM   7577  C  CG1    . VAL B 1 115 ? -54.404  63.263  40.484  1.00 66.11  ? 1077 VAL B CG1    1 
ATOM   7578  C  CG2    . VAL B 1 115 ? -53.319  61.702  42.128  1.00 69.73  ? 1077 VAL B CG2    1 
ATOM   7579  H  H      . VAL B 1 115 ? -55.651  60.874  41.540  1.00 78.22  ? 1077 VAL B H      1 
ATOM   7580  H  HA     . VAL B 1 115 ? -54.656  61.057  39.131  1.00 77.86  ? 1077 VAL B HA     1 
ATOM   7581  H  HB     . VAL B 1 115 ? -52.774  62.072  40.199  1.00 78.90  ? 1077 VAL B HB     1 
ATOM   7582  H  HG11   . VAL B 1 115 ? -53.906  63.988  40.892  1.00 79.34  ? 1077 VAL B HG11   1 
ATOM   7583  H  HG12   . VAL B 1 115 ? -54.523  63.434  39.537  1.00 79.34  ? 1077 VAL B HG12   1 
ATOM   7584  H  HG13   . VAL B 1 115 ? -55.268  63.170  40.915  1.00 79.34  ? 1077 VAL B HG13   1 
ATOM   7585  H  HG21   . VAL B 1 115 ? -52.842  62.463  42.493  1.00 83.67  ? 1077 VAL B HG21   1 
ATOM   7586  H  HG22   . VAL B 1 115 ? -54.154  61.574  42.604  1.00 83.67  ? 1077 VAL B HG22   1 
ATOM   7587  H  HG23   . VAL B 1 115 ? -52.772  60.904  42.198  1.00 83.67  ? 1077 VAL B HG23   1 
ATOM   7588  N  N      . ARG B 1 116 ? -53.324  58.797  40.958  1.00 59.84  ? 1078 ARG B N      1 
ATOM   7589  C  CA     . ARG B 1 116 ? -52.509  57.590  40.889  1.00 56.19  ? 1078 ARG B CA     1 
ATOM   7590  C  C      . ARG B 1 116 ? -53.133  56.558  39.958  1.00 52.18  ? 1078 ARG B C      1 
ATOM   7591  O  O      . ARG B 1 116 ? -52.422  55.866  39.219  1.00 50.66  ? 1078 ARG B O      1 
ATOM   7592  C  CB     . ARG B 1 116 ? -52.328  57.009  42.288  1.00 58.24  ? 1078 ARG B CB     1 
ATOM   7593  C  CG     . ARG B 1 116 ? -51.348  55.864  42.345  1.00 60.39  ? 1078 ARG B CG     1 
ATOM   7594  C  CD     . ARG B 1 116 ? -51.022  55.485  43.772  1.00 64.39  ? 1078 ARG B CD     1 
ATOM   7595  N  NE     . ARG B 1 116 ? -50.202  54.281  43.828  1.00 69.09  ? 1078 ARG B NE     1 
ATOM   7596  C  CZ     . ARG B 1 116 ? -49.737  53.741  44.950  1.00 71.53  ? 1078 ARG B CZ     1 
ATOM   7597  N  NH1    . ARG B 1 116 ? -50.009  54.298  46.123  1.00 72.67  1 1078 ARG B NH1    1 
ATOM   7598  N  NH2    . ARG B 1 116 ? -48.991  52.646  44.897  1.00 71.98  ? 1078 ARG B NH2    1 
ATOM   7599  H  H      . ARG B 1 116 ? -53.666  58.955  41.731  1.00 71.80  ? 1078 ARG B H      1 
ATOM   7600  H  HA     . ARG B 1 116 ? -51.632  57.819  40.541  1.00 67.43  ? 1078 ARG B HA     1 
ATOM   7601  H  HB2    . ARG B 1 116 ? -52.003  57.707  42.878  1.00 69.88  ? 1078 ARG B HB2    1 
ATOM   7602  H  HB3    . ARG B 1 116 ? -53.185  56.682  42.605  1.00 69.88  ? 1078 ARG B HB3    1 
ATOM   7603  H  HG2    . ARG B 1 116 ? -51.734  55.090  41.905  1.00 72.47  ? 1078 ARG B HG2    1 
ATOM   7604  H  HG3    . ARG B 1 116 ? -50.525  56.125  41.904  1.00 72.47  ? 1078 ARG B HG3    1 
ATOM   7605  H  HD2    . ARG B 1 116 ? -50.530  56.208  44.191  1.00 77.27  ? 1078 ARG B HD2    1 
ATOM   7606  H  HD3    . ARG B 1 116 ? -51.846  55.315  44.255  1.00 77.27  ? 1078 ARG B HD3    1 
ATOM   7607  H  HE     . ARG B 1 116 ? -50.005  53.894  43.086  1.00 82.91  ? 1078 ARG B HE     1 
ATOM   7608  H  HH11   . ARG B 1 116 ? -50.490  55.010  46.160  1.00 87.21  ? 1078 ARG B HH11   1 
ATOM   7609  H  HH12   . ARG B 1 116 ? -49.706  53.946  46.846  1.00 87.21  ? 1078 ARG B HH12   1 
ATOM   7610  H  HH21   . ARG B 1 116 ? -48.814  52.283  44.138  1.00 86.38  ? 1078 ARG B HH21   1 
ATOM   7611  H  HH22   . ARG B 1 116 ? -48.691  52.295  45.623  1.00 86.38  ? 1078 ARG B HH22   1 
ATOM   7612  N  N      . THR B 1 117 ? -54.462  56.444  39.974  1.00 47.99  ? 1079 THR B N      1 
ATOM   7613  C  CA     . THR B 1 117 ? -55.138  55.533  39.056  1.00 45.30  ? 1079 THR B CA     1 
ATOM   7614  C  C      . THR B 1 117 ? -54.980  55.992  37.611  1.00 45.05  ? 1079 THR B C      1 
ATOM   7615  O  O      . THR B 1 117 ? -54.772  55.168  36.713  1.00 42.59  ? 1079 THR B O      1 
ATOM   7616  C  CB     . THR B 1 117 ? -56.620  55.425  39.422  1.00 42.92  ? 1079 THR B CB     1 
ATOM   7617  O  OG1    . THR B 1 117 ? -56.750  54.964  40.771  1.00 44.01  ? 1079 THR B OG1    1 
ATOM   7618  C  CG2    . THR B 1 117 ? -57.346  54.456  38.493  1.00 41.61  ? 1079 THR B CG2    1 
ATOM   7619  H  H      . THR B 1 117 ? -54.987  56.877  40.500  1.00 57.59  ? 1079 THR B H      1 
ATOM   7620  H  HA     . THR B 1 117 ? -54.743  54.651  39.137  1.00 54.36  ? 1079 THR B HA     1 
ATOM   7621  H  HB     . THR B 1 117 ? -57.036  56.297  39.339  1.00 51.50  ? 1079 THR B HB     1 
ATOM   7622  H  HG1    . THR B 1 117 ? -56.375  55.502  41.296  1.00 52.81  ? 1079 THR B HG1    1 
ATOM   7623  H  HG21   . THR B 1 117 ? -58.283  54.400  38.740  1.00 49.94  ? 1079 THR B HG21   1 
ATOM   7624  H  HG22   . THR B 1 117 ? -57.279  54.763  37.576  1.00 49.94  ? 1079 THR B HG22   1 
ATOM   7625  H  HG23   . THR B 1 117 ? -56.950  53.573  38.560  1.00 49.94  ? 1079 THR B HG23   1 
ATOM   7626  N  N      . ILE B 1 118 ? -55.096  57.301  37.367  1.00 50.75  ? 1080 ILE B N      1 
ATOM   7627  C  CA     . ILE B 1 118 ? -54.953  57.834  36.012  1.00 53.64  ? 1080 ILE B CA     1 
ATOM   7628  C  C      . ILE B 1 118 ? -53.563  57.549  35.458  1.00 58.24  ? 1080 ILE B C      1 
ATOM   7629  O  O      . ILE B 1 118 ? -53.412  57.148  34.297  1.00 53.41  ? 1080 ILE B O      1 
ATOM   7630  C  CB     . ILE B 1 118 ? -55.267  59.342  35.999  1.00 53.03  ? 1080 ILE B CB     1 
ATOM   7631  C  CG1    . ILE B 1 118 ? -56.772  59.578  36.168  1.00 53.09  ? 1080 ILE B CG1    1 
ATOM   7632  C  CG2    . ILE B 1 118 ? -54.733  60.014  34.727  1.00 53.96  ? 1080 ILE B CG2    1 
ATOM   7633  C  CD1    . ILE B 1 118 ? -57.609  59.222  34.948  1.00 52.05  ? 1080 ILE B CD1    1 
ATOM   7634  H  H      . ILE B 1 118 ? -55.256  57.896  37.966  1.00 60.90  ? 1080 ILE B H      1 
ATOM   7635  H  HA     . ILE B 1 118 ? -55.597  57.394  35.435  1.00 64.37  ? 1080 ILE B HA     1 
ATOM   7636  H  HB     . ILE B 1 118 ? -54.816  59.745  36.758  1.00 63.64  ? 1080 ILE B HB     1 
ATOM   7637  H  HG12   . ILE B 1 118 ? -57.088  59.038  36.909  1.00 63.70  ? 1080 ILE B HG12   1 
ATOM   7638  H  HG13   . ILE B 1 118 ? -56.919  60.517  36.361  1.00 63.70  ? 1080 ILE B HG13   1 
ATOM   7639  H  HG21   . ILE B 1 118 ? -54.949  60.959  34.755  1.00 64.75  ? 1080 ILE B HG21   1 
ATOM   7640  H  HG22   . ILE B 1 118 ? -53.771  59.894  34.687  1.00 64.75  ? 1080 ILE B HG22   1 
ATOM   7641  H  HG23   . ILE B 1 118 ? -55.151  59.602  33.954  1.00 64.75  ? 1080 ILE B HG23   1 
ATOM   7642  H  HD11   . ILE B 1 118 ? -58.542  59.401  35.143  1.00 62.45  ? 1080 ILE B HD11   1 
ATOM   7643  H  HD12   . ILE B 1 118 ? -57.318  59.762  34.197  1.00 62.45  ? 1080 ILE B HD12   1 
ATOM   7644  H  HD13   . ILE B 1 118 ? -57.488  58.281  34.746  1.00 62.45  ? 1080 ILE B HD13   1 
ATOM   7645  N  N      . GLU B 1 119 ? -52.526  57.753  36.272  1.00 60.89  ? 1081 GLU B N      1 
ATOM   7646  C  CA     . GLU B 1 119 ? -51.166  57.564  35.779  1.00 65.14  ? 1081 GLU B CA     1 
ATOM   7647  C  C      . GLU B 1 119 ? -50.868  56.094  35.524  1.00 65.41  ? 1081 GLU B C      1 
ATOM   7648  O  O      . GLU B 1 119 ? -50.153  55.757  34.573  1.00 67.39  ? 1081 GLU B O      1 
ATOM   7649  C  CB     . GLU B 1 119 ? -50.162  58.163  36.761  1.00 71.01  ? 1081 GLU B CB     1 
ATOM   7650  C  CG     . GLU B 1 119 ? -50.202  59.683  36.799  1.00 76.79  ? 1081 GLU B CG     1 
ATOM   7651  C  CD     . GLU B 1 119 ? -49.407  60.267  37.947  1.00 83.64  ? 1081 GLU B CD     1 
ATOM   7652  O  OE1    . GLU B 1 119 ? -48.866  59.486  38.760  1.00 87.81  ? 1081 GLU B OE1    1 
ATOM   7653  O  OE2    . GLU B 1 119 ? -49.319  61.512  38.032  1.00 85.81  1 1081 GLU B OE2    1 
ATOM   7654  H  H      . GLU B 1 119 ? -52.582  57.996  37.095  1.00 73.07  ? 1081 GLU B H      1 
ATOM   7655  H  HA     . GLU B 1 119 ? -51.072  58.035  34.936  1.00 78.17  ? 1081 GLU B HA     1 
ATOM   7656  H  HB2    . GLU B 1 119 ? -50.360  57.836  37.652  1.00 85.22  ? 1081 GLU B HB2    1 
ATOM   7657  H  HB3    . GLU B 1 119 ? -49.267  57.893  36.500  1.00 85.22  ? 1081 GLU B HB3    1 
ATOM   7658  H  HG2    . GLU B 1 119 ? -49.831  60.028  35.972  1.00 92.15  ? 1081 GLU B HG2    1 
ATOM   7659  H  HG3    . GLU B 1 119 ? -51.123  59.972  36.896  1.00 92.15  ? 1081 GLU B HG3    1 
ATOM   7660  N  N      . GLU B 1 120 ? -51.406  55.201  36.356  1.00 61.42  ? 1082 GLU B N      1 
ATOM   7661  C  CA     . GLU B 1 120 ? -51.261  53.777  36.082  1.00 62.37  ? 1082 GLU B CA     1 
ATOM   7662  C  C      . GLU B 1 120 ? -52.009  53.394  34.813  1.00 58.81  ? 1082 GLU B C      1 
ATOM   7663  O  O      . GLU B 1 120 ? -51.531  52.570  34.025  1.00 56.90  ? 1082 GLU B O      1 
ATOM   7664  C  CB     . GLU B 1 120 ? -51.762  52.960  37.273  1.00 63.02  ? 1082 GLU B CB     1 
ATOM   7665  C  CG     . GLU B 1 120 ? -51.559  51.457  37.134  1.00 67.52  ? 1082 GLU B CG     1 
ATOM   7666  C  CD     . GLU B 1 120 ? -50.096  51.071  37.004  1.00 72.67  ? 1082 GLU B CD     1 
ATOM   7667  O  OE1    . GLU B 1 120 ? -49.792  50.128  36.241  1.00 73.96  ? 1082 GLU B OE1    1 
ATOM   7668  O  OE2    . GLU B 1 120 ? -49.248  51.714  37.660  1.00 75.23  1 1082 GLU B OE2    1 
ATOM   7669  H  H      . GLU B 1 120 ? -51.848  55.391  37.069  1.00 73.71  ? 1082 GLU B H      1 
ATOM   7670  H  HA     . GLU B 1 120 ? -50.322  53.573  35.951  1.00 74.85  ? 1082 GLU B HA     1 
ATOM   7671  H  HB2    . GLU B 1 120 ? -51.290  53.249  38.069  1.00 75.62  ? 1082 GLU B HB2    1 
ATOM   7672  H  HB3    . GLU B 1 120 ? -52.713  53.120  37.381  1.00 75.62  ? 1082 GLU B HB3    1 
ATOM   7673  H  HG2    . GLU B 1 120 ? -51.916  51.016  37.921  1.00 81.03  ? 1082 GLU B HG2    1 
ATOM   7674  H  HG3    . GLU B 1 120 ? -52.023  51.147  36.341  1.00 81.03  ? 1082 GLU B HG3    1 
ATOM   7675  N  N      . LEU B 1 121 ? -53.183  53.992  34.598  1.00 54.24  ? 1083 LEU B N      1 
ATOM   7676  C  CA     . LEU B 1 121 ? -53.937  53.738  33.376  1.00 53.70  ? 1083 LEU B CA     1 
ATOM   7677  C  C      . LEU B 1 121 ? -53.134  54.129  32.141  1.00 53.23  ? 1083 LEU B C      1 
ATOM   7678  O  O      . LEU B 1 121 ? -53.119  53.397  31.145  1.00 51.63  ? 1083 LEU B O      1 
ATOM   7679  C  CB     . LEU B 1 121 ? -55.258  54.504  33.424  1.00 52.19  ? 1083 LEU B CB     1 
ATOM   7680  C  CG     . LEU B 1 121 ? -56.165  54.417  32.198  1.00 49.56  ? 1083 LEU B CG     1 
ATOM   7681  C  CD1    . LEU B 1 121 ? -56.548  52.980  31.898  1.00 50.80  ? 1083 LEU B CD1    1 
ATOM   7682  C  CD2    . LEU B 1 121 ? -57.404  55.266  32.419  1.00 49.25  ? 1083 LEU B CD2    1 
ATOM   7683  H  H      . LEU B 1 121 ? -53.559  54.543  35.140  1.00 65.08  ? 1083 LEU B H      1 
ATOM   7684  H  HA     . LEU B 1 121 ? -54.138  52.791  33.318  1.00 64.44  ? 1083 LEU B HA     1 
ATOM   7685  H  HB2    . LEU B 1 121 ? -55.769  54.173  34.180  1.00 62.63  ? 1083 LEU B HB2    1 
ATOM   7686  H  HB3    . LEU B 1 121 ? -55.057  55.442  33.563  1.00 62.63  ? 1083 LEU B HB3    1 
ATOM   7687  H  HG     . LEU B 1 121 ? -55.692  54.770  31.428  1.00 59.48  ? 1083 LEU B HG     1 
ATOM   7688  H  HD11   . LEU B 1 121 ? -57.121  52.963  31.116  1.00 60.96  ? 1083 LEU B HD11   1 
ATOM   7689  H  HD12   . LEU B 1 121 ? -55.741  52.468  31.728  1.00 60.96  ? 1083 LEU B HD12   1 
ATOM   7690  H  HD13   . LEU B 1 121 ? -57.019  52.612  32.662  1.00 60.96  ? 1083 LEU B HD13   1 
ATOM   7691  H  HD21   . LEU B 1 121 ? -57.972  55.204  31.635  1.00 59.10  ? 1083 LEU B HD21   1 
ATOM   7692  H  HD22   . LEU B 1 121 ? -57.877  54.936  33.198  1.00 59.10  ? 1083 LEU B HD22   1 
ATOM   7693  H  HD23   . LEU B 1 121 ? -57.134  56.187  32.560  1.00 59.10  ? 1083 LEU B HD23   1 
ATOM   7694  N  N      . ALA B 1 122 ? -52.456  55.278  32.188  1.00 53.80  ? 1084 ALA B N      1 
ATOM   7695  C  CA     . ALA B 1 122 ? -51.638  55.703  31.058  1.00 55.16  ? 1084 ALA B CA     1 
ATOM   7696  C  C      . ALA B 1 122 ? -50.536  54.692  30.769  1.00 59.20  ? 1084 ALA B C      1 
ATOM   7697  O  O      . ALA B 1 122 ? -50.261  54.376  29.606  1.00 61.36  ? 1084 ALA B O      1 
ATOM   7698  C  CB     . ALA B 1 122 ? -51.043  57.083  31.332  1.00 55.04  ? 1084 ALA B CB     1 
ATOM   7699  H  H      . ALA B 1 122 ? -52.455  55.822  32.855  1.00 64.57  ? 1084 ALA B H      1 
ATOM   7700  H  HA     . ALA B 1 122 ? -52.199  55.768  30.269  1.00 66.19  ? 1084 ALA B HA     1 
ATOM   7701  H  HB1    . ALA B 1 122 ? -50.502  57.350  30.572  1.00 66.05  ? 1084 ALA B HB1    1 
ATOM   7702  H  HB2    . ALA B 1 122 ? -51.765  57.717  31.464  1.00 66.05  ? 1084 ALA B HB2    1 
ATOM   7703  H  HB3    . ALA B 1 122 ? -50.493  57.037  32.129  1.00 66.05  ? 1084 ALA B HB3    1 
ATOM   7704  N  N      . ARG B 1 123 ? -49.892  54.175  31.818  1.00 61.17  ? 1085 ARG B N      1 
ATOM   7705  C  CA     . ARG B 1 123 ? -48.839  53.181  31.632  1.00 63.23  ? 1085 ARG B CA     1 
ATOM   7706  C  C      . ARG B 1 123 ? -49.375  51.923  30.961  1.00 60.96  ? 1085 ARG B C      1 
ATOM   7707  O  O      . ARG B 1 123 ? -48.734  51.369  30.061  1.00 61.24  ? 1085 ARG B O      1 
ATOM   7708  C  CB     . ARG B 1 123 ? -48.212  52.839  32.983  1.00 67.88  ? 1085 ARG B CB     1 
ATOM   7709  C  CG     . ARG B 1 123 ? -47.378  53.963  33.568  1.00 73.96  ? 1085 ARG B CG     1 
ATOM   7710  C  CD     . ARG B 1 123 ? -46.959  53.670  35.000  1.00 78.06  ? 1085 ARG B CD     1 
ATOM   7711  N  NE     . ARG B 1 123 ? -46.457  54.874  35.658  1.00 81.52  ? 1085 ARG B NE     1 
ATOM   7712  C  CZ     . ARG B 1 123 ? -46.981  55.423  36.754  1.00 84.60  ? 1085 ARG B CZ     1 
ATOM   7713  N  NH1    . ARG B 1 123 ? -48.039  54.887  37.350  1.00 83.14  1 1085 ARG B NH1    1 
ATOM   7714  N  NH2    . ARG B 1 123 ? -46.440  56.525  37.258  1.00 87.96  ? 1085 ARG B NH2    1 
ATOM   7715  H  H      . ARG B 1 123 ? -50.046  54.381  32.639  1.00 73.40  ? 1085 ARG B H      1 
ATOM   7716  H  HA     . ARG B 1 123 ? -48.147  53.555  31.064  1.00 75.87  ? 1085 ARG B HA     1 
ATOM   7717  H  HB2    . ARG B 1 123 ? -48.920  52.635  33.614  1.00 81.45  ? 1085 ARG B HB2    1 
ATOM   7718  H  HB3    . ARG B 1 123 ? -47.636  52.067  32.874  1.00 81.45  ? 1085 ARG B HB3    1 
ATOM   7719  H  HG2    . ARG B 1 123 ? -46.576  54.076  33.034  1.00 88.76  ? 1085 ARG B HG2    1 
ATOM   7720  H  HG3    . ARG B 1 123 ? -47.899  54.781  33.566  1.00 88.76  ? 1085 ARG B HG3    1 
ATOM   7721  H  HD2    . ARG B 1 123 ? -47.725  53.346  35.499  1.00 93.68  ? 1085 ARG B HD2    1 
ATOM   7722  H  HD3    . ARG B 1 123 ? -46.252  53.006  34.998  1.00 93.68  ? 1085 ARG B HD3    1 
ATOM   7723  H  HE     . ARG B 1 123 ? -45.770  55.259  35.312  1.00 97.83  ? 1085 ARG B HE     1 
ATOM   7724  H  HH11   . ARG B 1 123 ? -48.398  54.174  37.030  1.00 99.77  ? 1085 ARG B HH11   1 
ATOM   7725  H  HH12   . ARG B 1 123 ? -48.365  55.253  38.057  1.00 99.77  ? 1085 ARG B HH12   1 
ATOM   7726  H  HH21   . ARG B 1 123 ? -45.754  56.879  36.880  1.00 105.55 ? 1085 ARG B HH21   1 
ATOM   7727  H  HH22   . ARG B 1 123 ? -46.773  56.882  37.967  1.00 105.55 ? 1085 ARG B HH22   1 
ATOM   7728  N  N      . VAL B 1 124 ? -50.555  51.460  31.381  1.00 59.55  ? 1086 VAL B N      1 
ATOM   7729  C  CA     . VAL B 1 124 ? -51.144  50.267  30.777  1.00 60.48  ? 1086 VAL B CA     1 
ATOM   7730  C  C      . VAL B 1 124 ? -51.425  50.503  29.300  1.00 57.17  ? 1086 VAL B C      1 
ATOM   7731  O  O      . VAL B 1 124 ? -51.139  49.647  28.454  1.00 59.19  ? 1086 VAL B O      1 
ATOM   7732  C  CB     . VAL B 1 124 ? -52.421  49.858  31.536  1.00 60.07  ? 1086 VAL B CB     1 
ATOM   7733  C  CG1    . VAL B 1 124 ? -53.161  48.737  30.797  1.00 60.45  ? 1086 VAL B CG1    1 
ATOM   7734  C  CG2    . VAL B 1 124 ? -52.080  49.429  32.950  1.00 60.21  ? 1086 VAL B CG2    1 
ATOM   7735  H  H      . VAL B 1 124 ? -51.028  51.815  32.005  1.00 71.45  ? 1086 VAL B H      1 
ATOM   7736  H  HA     . VAL B 1 124 ? -50.510  49.536  30.846  1.00 72.57  ? 1086 VAL B HA     1 
ATOM   7737  H  HB     . VAL B 1 124 ? -53.014  50.624  31.591  1.00 72.09  ? 1086 VAL B HB     1 
ATOM   7738  H  HG11   . VAL B 1 124 ? -53.958  48.502  31.298  1.00 72.54  ? 1086 VAL B HG11   1 
ATOM   7739  H  HG12   . VAL B 1 124 ? -53.406  49.051  29.913  1.00 72.54  ? 1086 VAL B HG12   1 
ATOM   7740  H  HG13   . VAL B 1 124 ? -52.575  47.967  30.726  1.00 72.54  ? 1086 VAL B HG13   1 
ATOM   7741  H  HG21   . VAL B 1 124 ? -52.896  49.177  33.408  1.00 72.25  ? 1086 VAL B HG21   1 
ATOM   7742  H  HG22   . VAL B 1 124 ? -51.473  48.673  32.912  1.00 72.25  ? 1086 VAL B HG22   1 
ATOM   7743  H  HG23   . VAL B 1 124 ? -51.656  50.170  33.411  1.00 72.25  ? 1086 VAL B HG23   1 
ATOM   7744  N  N      . LEU B 1 125 ? -51.988  51.664  28.964  1.00 53.22  ? 1087 LEU B N      1 
ATOM   7745  C  CA     . LEU B 1 125 ? -52.374  51.937  27.586  1.00 53.99  ? 1087 LEU B CA     1 
ATOM   7746  C  C      . LEU B 1 125 ? -51.172  52.052  26.658  1.00 55.24  ? 1087 LEU B C      1 
ATOM   7747  O  O      . LEU B 1 125 ? -51.327  51.897  25.441  1.00 55.43  ? 1087 LEU B O      1 
ATOM   7748  C  CB     . LEU B 1 125 ? -53.207  53.219  27.525  1.00 49.67  ? 1087 LEU B CB     1 
ATOM   7749  C  CG     . LEU B 1 125 ? -54.582  53.141  28.189  1.00 45.65  ? 1087 LEU B CG     1 
ATOM   7750  C  CD1    . LEU B 1 125 ? -55.188  54.531  28.327  1.00 46.09  ? 1087 LEU B CD1    1 
ATOM   7751  C  CD2    . LEU B 1 125 ? -55.508  52.235  27.393  1.00 45.85  ? 1087 LEU B CD2    1 
ATOM   7752  H  H      . LEU B 1 125 ? -52.154  52.305  29.514  1.00 63.86  ? 1087 LEU B H      1 
ATOM   7753  H  HA     . LEU B 1 125 ? -52.928  51.208  27.266  1.00 64.79  ? 1087 LEU B HA     1 
ATOM   7754  H  HB2    . LEU B 1 125 ? -52.711  53.928  27.964  1.00 59.60  ? 1087 LEU B HB2    1 
ATOM   7755  H  HB3    . LEU B 1 125 ? -53.346  53.450  26.594  1.00 59.60  ? 1087 LEU B HB3    1 
ATOM   7756  H  HG     . LEU B 1 125 ? -54.484  52.766  29.078  1.00 54.78  ? 1087 LEU B HG     1 
ATOM   7757  H  HD11   . LEU B 1 125 ? -56.058  54.455  28.750  1.00 55.31  ? 1087 LEU B HD11   1 
ATOM   7758  H  HD12   . LEU B 1 125 ? -54.601  55.078  28.873  1.00 55.31  ? 1087 LEU B HD12   1 
ATOM   7759  H  HD13   . LEU B 1 125 ? -55.281  54.923  27.445  1.00 55.31  ? 1087 LEU B HD13   1 
ATOM   7760  H  HD21   . LEU B 1 125 ? -56.371  52.202  27.833  1.00 55.01  ? 1087 LEU B HD21   1 
ATOM   7761  H  HD22   . LEU B 1 125 ? -55.606  52.593  26.497  1.00 55.01  ? 1087 LEU B HD22   1 
ATOM   7762  H  HD23   . LEU B 1 125 ? -55.122  51.346  27.355  1.00 55.01  ? 1087 LEU B HD23   1 
ATOM   7763  N  N      . ARG B 1 126 ? -49.982  52.322  27.199  1.00 55.64  ? 1088 ARG B N      1 
ATOM   7764  C  CA     . ARG B 1 126 ? -48.781  52.374  26.374  1.00 59.88  ? 1088 ARG B CA     1 
ATOM   7765  C  C      . ARG B 1 126 ? -48.396  51.007  25.822  1.00 64.91  ? 1088 ARG B C      1 
ATOM   7766  O  O      . ARG B 1 126 ? -47.580  50.935  24.898  1.00 63.97  ? 1088 ARG B O      1 
ATOM   7767  C  CB     . ARG B 1 126 ? -47.624  52.970  27.177  1.00 62.36  ? 1088 ARG B CB     1 
ATOM   7768  C  CG     . ARG B 1 126 ? -47.797  54.458  27.435  1.00 64.02  ? 1088 ARG B CG     1 
ATOM   7769  C  CD     . ARG B 1 126 ? -46.685  55.047  28.284  1.00 64.85  ? 1088 ARG B CD     1 
ATOM   7770  N  NE     . ARG B 1 126 ? -46.946  56.457  28.567  1.00 66.64  ? 1088 ARG B NE     1 
ATOM   7771  C  CZ     . ARG B 1 126 ? -47.205  56.966  29.770  1.00 68.01  ? 1088 ARG B CZ     1 
ATOM   7772  N  NH1    . ARG B 1 126 ? -47.235  56.195  30.846  1.00 70.87  1 1088 ARG B NH1    1 
ATOM   7773  N  NH2    . ARG B 1 126 ? -47.433  58.266  29.897  1.00 68.32  ? 1088 ARG B NH2    1 
ATOM   7774  H  H      . ARG B 1 126 ? -49.847  52.477  28.034  1.00 66.77  ? 1088 ARG B H      1 
ATOM   7775  H  HA     . ARG B 1 126 ? -48.948  52.959  25.619  1.00 71.86  ? 1088 ARG B HA     1 
ATOM   7776  H  HB2    . ARG B 1 126 ? -47.569  52.521  28.035  1.00 74.83  ? 1088 ARG B HB2    1 
ATOM   7777  H  HB3    . ARG B 1 126 ? -46.798  52.845  26.683  1.00 74.83  ? 1088 ARG B HB3    1 
ATOM   7778  H  HG2    . ARG B 1 126 ? -47.804  54.926  26.585  1.00 76.82  ? 1088 ARG B HG2    1 
ATOM   7779  H  HG3    . ARG B 1 126 ? -48.636  54.601  27.899  1.00 76.82  ? 1088 ARG B HG3    1 
ATOM   7780  H  HD2    . ARG B 1 126 ? -46.635  54.569  29.126  1.00 77.82  ? 1088 ARG B HD2    1 
ATOM   7781  H  HD3    . ARG B 1 126 ? -45.844  54.981  27.805  1.00 77.82  ? 1088 ARG B HD3    1 
ATOM   7782  H  HE     . ARG B 1 126 ? -46.931  57.003  27.902  1.00 79.96  ? 1088 ARG B HE     1 
ATOM   7783  H  HH11   . ARG B 1 126 ? -47.090  55.350  30.774  1.00 85.04  ? 1088 ARG B HH11   1 
ATOM   7784  H  HH12   . ARG B 1 126 ? -47.402  56.539  31.617  1.00 85.04  ? 1088 ARG B HH12   1 
ATOM   7785  H  HH21   . ARG B 1 126 ? -47.413  58.776  29.204  1.00 81.98  ? 1088 ARG B HH21   1 
ATOM   7786  H  HH22   . ARG B 1 126 ? -47.597  58.600  30.672  1.00 81.98  ? 1088 ARG B HH22   1 
ATOM   7787  N  N      . LYS B 1 127 ? -48.949  49.927  26.371  1.00 71.24  ? 1089 LYS B N      1 
ATOM   7788  C  CA     . LYS B 1 127 ? -48.714  48.587  25.851  1.00 75.06  ? 1089 LYS B CA     1 
ATOM   7789  C  C      . LYS B 1 127 ? -49.680  48.212  24.735  1.00 72.94  ? 1089 LYS B C      1 
ATOM   7790  O  O      . LYS B 1 127 ? -49.568  47.114  24.182  1.00 78.42  ? 1089 LYS B O      1 
ATOM   7791  C  CB     . LYS B 1 127 ? -48.818  47.556  26.981  1.00 77.23  ? 1089 LYS B CB     1 
ATOM   7792  C  CG     . LYS B 1 127 ? -47.878  47.816  28.150  1.00 79.04  ? 1089 LYS B CG     1 
ATOM   7793  C  CD     . LYS B 1 127 ? -47.984  46.736  29.222  1.00 80.79  ? 1089 LYS B CD     1 
ATOM   7794  C  CE     . LYS B 1 127 ? -49.401  46.616  29.771  1.00 79.46  ? 1089 LYS B CE     1 
ATOM   7795  N  NZ     . LYS B 1 127 ? -49.454  45.816  31.028  1.00 79.98  1 1089 LYS B NZ     1 
ATOM   7796  H  H      . LYS B 1 127 ? -49.470  49.947  27.054  1.00 85.49  ? 1089 LYS B H      1 
ATOM   7797  H  HA     . LYS B 1 127 ? -47.814  48.544  25.492  1.00 90.08  ? 1089 LYS B HA     1 
ATOM   7798  H  HB2    . LYS B 1 127 ? -49.726  47.562  27.324  1.00 92.68  ? 1089 LYS B HB2    1 
ATOM   7799  H  HB3    . LYS B 1 127 ? -48.609  46.680  26.622  1.00 92.68  ? 1089 LYS B HB3    1 
ATOM   7800  H  HG2    . LYS B 1 127 ? -46.964  47.833  27.826  1.00 94.85  ? 1089 LYS B HG2    1 
ATOM   7801  H  HG3    . LYS B 1 127 ? -48.104  48.668  28.557  1.00 94.85  ? 1089 LYS B HG3    1 
ATOM   7802  H  HD2    . LYS B 1 127 ? -47.736  45.880  28.837  1.00 96.95  ? 1089 LYS B HD2    1 
ATOM   7803  H  HD3    . LYS B 1 127 ? -47.392  46.957  29.957  1.00 96.95  ? 1089 LYS B HD3    1 
ATOM   7804  H  HE2    . LYS B 1 127 ? -49.742  47.503  29.964  1.00 95.36  ? 1089 LYS B HE2    1 
ATOM   7805  H  HE3    . LYS B 1 127 ? -49.962  46.179  29.111  1.00 95.36  ? 1089 LYS B HE3    1 
ATOM   7806  H  HZ1    . LYS B 1 127 ? -50.293  45.766  31.321  1.00 95.98  ? 1089 LYS B HZ1    1 
ATOM   7807  H  HZ2    . LYS B 1 127 ? -49.151  44.993  30.877  1.00 95.98  ? 1089 LYS B HZ2    1 
ATOM   7808  H  HZ3    . LYS B 1 127 ? -48.951  46.200  31.654  1.00 95.98  ? 1089 LYS B HZ3    1 
ATOM   7809  N  N      . HIS B 1 128 ? -50.624  49.087  24.397  1.00 66.32  ? 1090 HIS B N      1 
ATOM   7810  C  CA     . HIS B 1 128 ? -51.623  48.809  23.372  1.00 62.96  ? 1090 HIS B CA     1 
ATOM   7811  C  C      . HIS B 1 128 ? -51.074  49.247  22.017  1.00 61.54  ? 1090 HIS B C      1 
ATOM   7812  O  O      . HIS B 1 128 ? -50.844  50.440  21.794  1.00 62.06  ? 1090 HIS B O      1 
ATOM   7813  C  CB     . HIS B 1 128 ? -52.927  49.536  23.700  1.00 60.67  ? 1090 HIS B CB     1 
ATOM   7814  C  CG     . HIS B 1 128 ? -54.110  49.054  22.920  1.00 59.80  ? 1090 HIS B CG     1 
ATOM   7815  N  ND1    . HIS B 1 128 ? -54.126  49.003  21.543  1.00 58.21  ? 1090 HIS B ND1    1 
ATOM   7816  C  CD2    . HIS B 1 128 ? -55.327  48.619  23.325  1.00 58.07  ? 1090 HIS B CD2    1 
ATOM   7817  C  CE1    . HIS B 1 128 ? -55.296  48.547  21.133  1.00 55.74  ? 1090 HIS B CE1    1 
ATOM   7818  N  NE2    . HIS B 1 128 ? -56.044  48.309  22.195  1.00 58.35  ? 1090 HIS B NE2    1 
ATOM   7819  H  H      . HIS B 1 128 ? -50.707  49.864  24.756  1.00 79.58  ? 1090 HIS B H      1 
ATOM   7820  H  HA     . HIS B 1 128 ? -51.800  47.855  23.340  1.00 75.55  ? 1090 HIS B HA     1 
ATOM   7821  H  HB2    . HIS B 1 128 ? -53.124  49.411  24.642  1.00 72.80  ? 1090 HIS B HB2    1 
ATOM   7822  H  HB3    . HIS B 1 128 ? -52.813  50.480  23.511  1.00 72.80  ? 1090 HIS B HB3    1 
ATOM   7823  H  HD2    . HIS B 1 128 ? -55.621  48.542  24.204  1.00 69.69  ? 1090 HIS B HD2    1 
ATOM   7824  H  HE1    . HIS B 1 128 ? -55.550  48.419  20.248  1.00 66.89  ? 1090 HIS B HE1    1 
ATOM   7825  H  HE2    . HIS B 1 128 ? -56.849  48.006  22.181  1.00 70.01  ? 1090 HIS B HE2    1 
ATOM   7826  N  N      . SER B 1 129 ? -50.867  48.282  21.116  1.00 64.23  ? 1091 SER B N      1 
ATOM   7827  C  CA     . SER B 1 129 ? -50.195  48.554  19.847  1.00 65.47  ? 1091 SER B CA     1 
ATOM   7828  C  C      . SER B 1 129 ? -51.036  49.397  18.896  1.00 63.13  ? 1091 SER B C      1 
ATOM   7829  O  O      . SER B 1 129 ? -50.493  49.935  17.927  1.00 65.04  ? 1091 SER B O      1 
ATOM   7830  C  CB     . SER B 1 129 ? -49.815  47.241  19.162  1.00 67.00  ? 1091 SER B CB     1 
ATOM   7831  O  OG     . SER B 1 129 ? -50.965  46.471  18.862  1.00 69.37  ? 1091 SER B OG     1 
ATOM   7832  H  H      . SER B 1 129 ? -51.106  47.462  21.218  1.00 77.08  ? 1091 SER B H      1 
ATOM   7833  H  HA     . SER B 1 129 ? -49.376  49.042  20.028  1.00 78.57  ? 1091 SER B HA     1 
ATOM   7834  H  HB2    . SER B 1 129 ? -49.345  47.441  18.337  1.00 80.40  ? 1091 SER B HB2    1 
ATOM   7835  H  HB3    . SER B 1 129 ? -49.240  46.731  19.754  1.00 80.40  ? 1091 SER B HB3    1 
ATOM   7836  H  HG     . SER B 1 129 ? -50.740  45.754  18.486  1.00 83.25  ? 1091 SER B HG     1 
ATOM   7837  N  N      . GLY B 1 130 ? -52.335  49.520  19.140  1.00 58.81  ? 1092 GLY B N      1 
ATOM   7838  C  CA     . GLY B 1 130 ? -53.221  50.300  18.305  1.00 56.91  ? 1092 GLY B CA     1 
ATOM   7839  C  C      . GLY B 1 130 ? -53.432  51.733  18.744  1.00 57.04  ? 1092 GLY B C      1 
ATOM   7840  O  O      . GLY B 1 130 ? -54.285  52.419  18.169  1.00 53.26  ? 1092 GLY B O      1 
ATOM   7841  H  H      . GLY B 1 130 ? -52.732  49.147  19.806  1.00 70.58  ? 1092 GLY B H      1 
ATOM   7842  H  HA2    . GLY B 1 130 ? -52.867  50.315  17.402  1.00 68.29  ? 1092 GLY B HA2    1 
ATOM   7843  H  HA3    . GLY B 1 130 ? -54.088  49.866  18.279  1.00 68.29  ? 1092 GLY B HA3    1 
ATOM   7844  N  N      . LEU B 1 131 ? -52.690  52.210  19.743  1.00 55.25  ? 1093 LEU B N      1 
ATOM   7845  C  CA     . LEU B 1 131 ? -52.846  53.557  20.268  1.00 50.77  ? 1093 LEU B CA     1 
ATOM   7846  C  C      . LEU B 1 131 ? -51.556  54.344  20.073  1.00 50.45  ? 1093 LEU B C      1 
ATOM   7847  O  O      . LEU B 1 131 ? -50.478  53.775  19.887  1.00 56.54  ? 1093 LEU B O      1 
ATOM   7848  C  CB     . LEU B 1 131 ? -53.214  53.532  21.756  1.00 48.44  ? 1093 LEU B CB     1 
ATOM   7849  C  CG     . LEU B 1 131 ? -54.350  52.583  22.144  1.00 46.61  ? 1093 LEU B CG     1 
ATOM   7850  C  CD1    . LEU B 1 131 ? -54.614  52.652  23.640  1.00 44.17  ? 1093 LEU B CD1    1 
ATOM   7851  C  CD2    . LEU B 1 131 ? -55.616  52.888  21.352  1.00 44.00  ? 1093 LEU B CD2    1 
ATOM   7852  H  H      . LEU B 1 131 ? -52.076  51.757  20.140  1.00 66.30  ? 1093 LEU B H      1 
ATOM   7853  H  HA     . LEU B 1 131 ? -53.555  54.010  19.786  1.00 60.92  ? 1093 LEU B HA     1 
ATOM   7854  H  HB2    . LEU B 1 131 ? -52.429  53.266  22.260  1.00 58.13  ? 1093 LEU B HB2    1 
ATOM   7855  H  HB3    . LEU B 1 131 ? -53.480  54.426  22.020  1.00 58.13  ? 1093 LEU B HB3    1 
ATOM   7856  H  HG     . LEU B 1 131 ? -54.082  51.675  21.933  1.00 55.94  ? 1093 LEU B HG     1 
ATOM   7857  H  HD11   . LEU B 1 131 ? -55.337  52.043  23.861  1.00 53.00  ? 1093 LEU B HD11   1 
ATOM   7858  H  HD12   . LEU B 1 131 ? -53.808  52.395  24.115  1.00 53.00  ? 1093 LEU B HD12   1 
ATOM   7859  H  HD13   . LEU B 1 131 ? -54.863  53.559  23.875  1.00 53.00  ? 1093 LEU B HD13   1 
ATOM   7860  H  HD21   . LEU B 1 131 ? -56.313  52.270  21.622  1.00 52.80  ? 1093 LEU B HD21   1 
ATOM   7861  H  HD22   . LEU B 1 131 ? -55.891  53.799  21.536  1.00 52.80  ? 1093 LEU B HD22   1 
ATOM   7862  H  HD23   . LEU B 1 131 ? -55.429  52.784  20.406  1.00 52.80  ? 1093 LEU B HD23   1 
ATOM   7863  N  N      . ARG B 1 132 ? -51.681  55.668  20.122  1.00 48.88  ? 1094 ARG B N      1 
ATOM   7864  C  CA     . ARG B 1 132 ? -50.538  56.555  19.971  1.00 52.66  ? 1094 ARG B CA     1 
ATOM   7865  C  C      . ARG B 1 132 ? -50.732  57.775  20.858  1.00 49.50  ? 1094 ARG B C      1 
ATOM   7866  O  O      . ARG B 1 132 ? -51.862  58.184  21.139  1.00 46.45  ? 1094 ARG B O      1 
ATOM   7867  C  CB     . ARG B 1 132 ? -50.350  57.007  18.514  1.00 57.61  ? 1094 ARG B CB     1 
ATOM   7868  C  CG     . ARG B 1 132 ? -50.008  55.900  17.540  1.00 61.27  ? 1094 ARG B CG     1 
ATOM   7869  C  CD     . ARG B 1 132 ? -48.640  55.302  17.831  1.00 68.62  ? 1094 ARG B CD     1 
ATOM   7870  N  NE     . ARG B 1 132 ? -48.221  54.364  16.792  1.00 74.16  ? 1094 ARG B NE     1 
ATOM   7871  C  CZ     . ARG B 1 132 ? -48.642  53.105  16.698  1.00 75.77  ? 1094 ARG B CZ     1 
ATOM   7872  N  NH1    . ARG B 1 132 ? -49.508  52.618  17.579  1.00 74.91  1 1094 ARG B NH1    1 
ATOM   7873  N  NH2    . ARG B 1 132 ? -48.202  52.331  15.715  1.00 79.23  ? 1094 ARG B NH2    1 
ATOM   7874  H  H      . ARG B 1 132 ? -52.427  56.079  20.242  1.00 58.65  ? 1094 ARG B H      1 
ATOM   7875  H  HA     . ARG B 1 132 ? -49.732  56.095  20.255  1.00 63.19  ? 1094 ARG B HA     1 
ATOM   7876  H  HB2    . ARG B 1 132 ? -51.174  57.420  18.211  1.00 69.14  ? 1094 ARG B HB2    1 
ATOM   7877  H  HB3    . ARG B 1 132 ? -49.631  57.657  18.483  1.00 69.14  ? 1094 ARG B HB3    1 
ATOM   7878  H  HG2    . ARG B 1 132 ? -50.669  55.194  17.612  1.00 73.53  ? 1094 ARG B HG2    1 
ATOM   7879  H  HG3    . ARG B 1 132 ? -49.997  56.258  16.638  1.00 73.53  ? 1094 ARG B HG3    1 
ATOM   7880  H  HD2    . ARG B 1 132 ? -47.984  56.016  17.876  1.00 82.34  ? 1094 ARG B HD2    1 
ATOM   7881  H  HD3    . ARG B 1 132 ? -48.674  54.825  18.674  1.00 82.34  ? 1094 ARG B HD3    1 
ATOM   7882  H  HE     . ARG B 1 132 ? -47.663  54.645  16.200  1.00 88.99  ? 1094 ARG B HE     1 
ATOM   7883  H  HH11   . ARG B 1 132 ? -49.797  53.116  18.218  1.00 89.89  ? 1094 ARG B HH11   1 
ATOM   7884  H  HH12   . ARG B 1 132 ? -49.777  51.804  17.512  1.00 89.89  ? 1094 ARG B HH12   1 
ATOM   7885  H  HH21   . ARG B 1 132 ? -47.642  52.642  15.141  1.00 95.07  ? 1094 ARG B HH21   1 
ATOM   7886  H  HH22   . ARG B 1 132 ? -48.475  51.518  15.653  1.00 95.07  ? 1094 ARG B HH22   1 
ATOM   7887  N  N      . ASN B 1 133 ? -49.611  58.354  21.289  1.00 49.20  ? 1095 ASN B N      1 
ATOM   7888  C  CA     . ASN B 1 133 ? -49.596  59.634  21.996  1.00 50.66  ? 1095 ASN B CA     1 
ATOM   7889  C  C      . ASN B 1 133 ? -50.427  59.574  23.280  1.00 47.64  ? 1095 ASN B C      1 
ATOM   7890  O  O      . ASN B 1 133 ? -51.336  60.377  23.499  1.00 42.03  ? 1095 ASN B O      1 
ATOM   7891  C  CB     . ASN B 1 133 ? -50.092  60.759  21.082  1.00 49.47  ? 1095 ASN B CB     1 
ATOM   7892  C  CG     . ASN B 1 133 ? -49.355  60.803  19.761  1.00 55.68  ? 1095 ASN B CG     1 
ATOM   7893  O  OD1    . ASN B 1 133 ? -49.966  60.722  18.697  1.00 58.92  ? 1095 ASN B OD1    1 
ATOM   7894  N  ND2    . ASN B 1 133 ? -48.034  60.923  19.821  1.00 58.55  ? 1095 ASN B ND2    1 
ATOM   7895  H  H      . ASN B 1 133 ? -48.828  58.015  21.181  1.00 59.04  ? 1095 ASN B H      1 
ATOM   7896  H  HA     . ASN B 1 133 ? -48.682  59.839  22.246  1.00 60.79  ? 1095 ASN B HA     1 
ATOM   7897  H  HB2    . ASN B 1 133 ? -51.034  60.623  20.896  1.00 59.37  ? 1095 ASN B HB2    1 
ATOM   7898  H  HB3    . ASN B 1 133 ? -49.960  61.610  21.528  1.00 59.37  ? 1095 ASN B HB3    1 
ATOM   7899  H  HD21   . ASN B 1 133 ? -47.572  60.952  19.096  1.00 70.27  ? 1095 ASN B HD21   1 
ATOM   7900  H  HD22   . ASN B 1 133 ? -47.640  60.971  20.584  1.00 70.27  ? 1095 ASN B HD22   1 
ATOM   7901  N  N      . ILE B 1 134 ? -50.080  58.625  24.150  1.00 53.17  ? 1096 ILE B N      1 
ATOM   7902  C  CA     . ILE B 1 134 ? -50.741  58.544  25.447  1.00 52.72  ? 1096 ILE B CA     1 
ATOM   7903  C  C      . ILE B 1 134 ? -50.369  59.775  26.258  1.00 53.90  ? 1096 ILE B C      1 
ATOM   7904  O  O      . ILE B 1 134 ? -49.185  60.081  26.444  1.00 59.06  ? 1096 ILE B O      1 
ATOM   7905  C  CB     . ILE B 1 134 ? -50.351  57.257  26.190  1.00 54.58  ? 1096 ILE B CB     1 
ATOM   7906  C  CG1    . ILE B 1 134 ? -50.471  56.026  25.286  1.00 53.77  ? 1096 ILE B CG1    1 
ATOM   7907  C  CG2    . ILE B 1 134 ? -51.217  57.083  27.431  1.00 55.35  ? 1096 ILE B CG2    1 
ATOM   7908  C  CD1    . ILE B 1 134 ? -51.801  55.883  24.609  1.00 55.64  ? 1096 ILE B CD1    1 
ATOM   7909  H  H      . ILE B 1 134 ? -49.476  58.027  24.015  1.00 63.81  ? 1096 ILE B H      1 
ATOM   7910  H  HA     . ILE B 1 134 ? -51.702  58.542  25.318  1.00 63.27  ? 1096 ILE B HA     1 
ATOM   7911  H  HB     . ILE B 1 134 ? -49.427  57.337  26.473  1.00 65.49  ? 1096 ILE B HB     1 
ATOM   7912  H  HG12   . ILE B 1 134 ? -49.793  56.082  24.594  1.00 64.52  ? 1096 ILE B HG12   1 
ATOM   7913  H  HG13   . ILE B 1 134 ? -50.327  55.231  25.823  1.00 64.52  ? 1096 ILE B HG13   1 
ATOM   7914  H  HG21   . ILE B 1 134 ? -50.957  56.267  27.886  1.00 66.42  ? 1096 ILE B HG21   1 
ATOM   7915  H  HG22   . ILE B 1 134 ? -51.085  57.845  28.017  1.00 66.42  ? 1096 ILE B HG22   1 
ATOM   7916  H  HG23   . ILE B 1 134 ? -52.148  57.030  27.161  1.00 66.42  ? 1096 ILE B HG23   1 
ATOM   7917  H  HD11   . ILE B 1 134 ? -51.790  55.083  24.060  1.00 66.76  ? 1096 ILE B HD11   1 
ATOM   7918  H  HD12   . ILE B 1 134 ? -52.492  55.811  25.285  1.00 66.76  ? 1096 ILE B HD12   1 
ATOM   7919  H  HD13   . ILE B 1 134 ? -51.958  56.663  24.055  1.00 66.76  ? 1096 ILE B HD13   1 
ATOM   7920  N  N      . LEU B 1 135 ? -51.375  60.485  26.744  1.00 51.91  ? 1097 LEU B N      1 
ATOM   7921  C  CA     . LEU B 1 135 ? -51.128  61.730  27.455  1.00 53.66  ? 1097 LEU B CA     1 
ATOM   7922  C  C      . LEU B 1 135 ? -52.041  61.859  28.669  1.00 50.86  ? 1097 LEU B C      1 
ATOM   7923  O  O      . LEU B 1 135 ? -53.241  62.119  28.518  1.00 48.62  ? 1097 LEU B O      1 
ATOM   7924  C  CB     . LEU B 1 135 ? -51.334  62.915  26.511  1.00 56.40  ? 1097 LEU B CB     1 
ATOM   7925  C  CG     . LEU B 1 135 ? -51.063  64.307  27.080  1.00 59.09  ? 1097 LEU B CG     1 
ATOM   7926  C  CD1    . LEU B 1 135 ? -49.629  64.431  27.548  1.00 57.59  ? 1097 LEU B CD1    1 
ATOM   7927  C  CD2    . LEU B 1 135 ? -51.385  65.371  26.032  1.00 59.11  ? 1097 LEU B CD2    1 
ATOM   7928  H  H      . LEU B 1 135 ? -52.205  60.270  26.677  1.00 62.29  ? 1097 LEU B H      1 
ATOM   7929  H  HA     . LEU B 1 135 ? -50.209  61.744  27.764  1.00 64.40  ? 1097 LEU B HA     1 
ATOM   7930  H  HB2    . LEU B 1 135 ? -50.746  62.798  25.748  1.00 67.68  ? 1097 LEU B HB2    1 
ATOM   7931  H  HB3    . LEU B 1 135 ? -52.256  62.903  26.209  1.00 67.68  ? 1097 LEU B HB3    1 
ATOM   7932  H  HG     . LEU B 1 135 ? -51.642  64.454  27.845  1.00 70.91  ? 1097 LEU B HG     1 
ATOM   7933  H  HD11   . LEU B 1 135 ? -49.489  65.323  27.903  1.00 69.11  ? 1097 LEU B HD11   1 
ATOM   7934  H  HD12   . LEU B 1 135 ? -49.464  63.770  28.238  1.00 69.11  ? 1097 LEU B HD12   1 
ATOM   7935  H  HD13   . LEU B 1 135 ? -49.037  64.278  26.795  1.00 69.11  ? 1097 LEU B HD13   1 
ATOM   7936  H  HD21   . LEU B 1 135 ? -51.208  66.248  26.408  1.00 70.93  ? 1097 LEU B HD21   1 
ATOM   7937  H  HD22   . LEU B 1 135 ? -50.825  65.226  25.253  1.00 70.93  ? 1097 LEU B HD22   1 
ATOM   7938  H  HD23   . LEU B 1 135 ? -52.321  65.299  25.786  1.00 70.93  ? 1097 LEU B HD23   1 
ATOM   7939  N  N      . PRO B 1 136 ? -51.525  61.684  29.884  1.00 52.16  ? 1098 PRO B N      1 
ATOM   7940  C  CA     . PRO B 1 136 ? -52.344  61.956  31.067  1.00 50.87  ? 1098 PRO B CA     1 
ATOM   7941  C  C      . PRO B 1 136 ? -52.324  63.437  31.401  1.00 51.54  ? 1098 PRO B C      1 
ATOM   7942  O  O      . PRO B 1 136 ? -51.279  64.091  31.367  1.00 53.48  ? 1098 PRO B O      1 
ATOM   7943  C  CB     . PRO B 1 136 ? -51.679  61.113  32.163  1.00 49.45  ? 1098 PRO B CB     1 
ATOM   7944  C  CG     . PRO B 1 136 ? -50.270  60.870  31.690  1.00 50.57  ? 1098 PRO B CG     1 
ATOM   7945  C  CD     . PRO B 1 136 ? -50.152  61.298  30.251  1.00 51.78  ? 1098 PRO B CD     1 
ATOM   7946  H  HA     . PRO B 1 136 ? -53.257  61.659  30.931  1.00 61.04  ? 1098 PRO B HA     1 
ATOM   7947  H  HB2    . PRO B 1 136 ? -51.679  61.608  32.998  1.00 59.34  ? 1098 PRO B HB2    1 
ATOM   7948  H  HB3    . PRO B 1 136 ? -52.156  60.274  32.263  1.00 59.34  ? 1098 PRO B HB3    1 
ATOM   7949  H  HG2    . PRO B 1 136 ? -49.660  61.386  32.240  1.00 60.68  ? 1098 PRO B HG2    1 
ATOM   7950  H  HG3    . PRO B 1 136 ? -50.070  59.924  31.771  1.00 60.68  ? 1098 PRO B HG3    1 
ATOM   7951  H  HD2    . PRO B 1 136 ? -49.556  62.059  30.173  1.00 62.13  ? 1098 PRO B HD2    1 
ATOM   7952  H  HD3    . PRO B 1 136 ? -49.852  60.556  29.702  1.00 62.13  ? 1098 PRO B HD3    1 
ATOM   7953  N  N      . ILE B 1 137 ? -53.501  63.970  31.692  1.00 55.85  ? 1099 ILE B N      1 
ATOM   7954  C  CA     . ILE B 1 137 ? -53.671  65.375  32.053  1.00 59.72  ? 1099 ILE B CA     1 
ATOM   7955  C  C      . ILE B 1 137 ? -54.312  65.382  33.435  1.00 60.42  ? 1099 ILE B C      1 
ATOM   7956  O  O      . ILE B 1 137 ? -55.537  65.354  33.581  1.00 59.49  ? 1099 ILE B O      1 
ATOM   7957  C  CB     . ILE B 1 137 ? -54.506  66.149  31.028  1.00 58.85  ? 1099 ILE B CB     1 
ATOM   7958  C  CG1    . ILE B 1 137 ? -53.873  66.010  29.637  1.00 58.10  ? 1099 ILE B CG1    1 
ATOM   7959  C  CG2    . ILE B 1 137 ? -54.620  67.617  31.437  1.00 59.76  ? 1099 ILE B CG2    1 
ATOM   7960  C  CD1    . ILE B 1 137 ? -54.608  66.735  28.530  1.00 58.95  ? 1099 ILE B CD1    1 
ATOM   7961  H  H      . ILE B 1 137 ? -54.239  63.527  31.688  1.00 67.01  ? 1099 ILE B H      1 
ATOM   7962  H  HA     . ILE B 1 137 ? -52.800  65.798  32.117  1.00 71.67  ? 1099 ILE B HA     1 
ATOM   7963  H  HB     . ILE B 1 137 ? -55.396  65.766  31.002  1.00 70.62  ? 1099 ILE B HB     1 
ATOM   7964  H  HG12   . ILE B 1 137 ? -52.970  66.364  29.671  1.00 69.72  ? 1099 ILE B HG12   1 
ATOM   7965  H  HG13   . ILE B 1 137 ? -53.844  65.069  29.403  1.00 69.72  ? 1099 ILE B HG13   1 
ATOM   7966  H  HG21   . ILE B 1 137 ? -55.151  68.088  30.776  1.00 71.71  ? 1099 ILE B HG21   1 
ATOM   7967  H  HG22   . ILE B 1 137 ? -55.049  67.669  32.306  1.00 71.71  ? 1099 ILE B HG22   1 
ATOM   7968  H  HG23   . ILE B 1 137 ? -53.731  68.002  31.483  1.00 71.71  ? 1099 ILE B HG23   1 
ATOM   7969  H  HD11   . ILE B 1 137 ? -54.138  66.592  27.693  1.00 70.74  ? 1099 ILE B HD11   1 
ATOM   7970  H  HD12   . ILE B 1 137 ? -55.510  66.385  28.468  1.00 70.74  ? 1099 ILE B HD12   1 
ATOM   7971  H  HD13   . ILE B 1 137 ? -54.634  67.683  28.737  1.00 70.74  ? 1099 ILE B HD13   1 
ATOM   7972  N  N      . THR B 1 138 ? -53.473  65.400  34.468  1.00 64.12  ? 1100 THR B N      1 
ATOM   7973  C  CA     . THR B 1 138 ? -53.923  65.287  35.847  1.00 63.55  ? 1100 THR B CA     1 
ATOM   7974  C  C      . THR B 1 138 ? -54.267  66.628  36.483  1.00 64.50  ? 1100 THR B C      1 
ATOM   7975  O  O      . THR B 1 138 ? -54.888  66.643  37.551  1.00 67.39  ? 1100 THR B O      1 
ATOM   7976  C  CB     . THR B 1 138 ? -52.847  64.597  36.690  1.00 64.10  ? 1100 THR B CB     1 
ATOM   7977  O  OG1    . THR B 1 138 ? -51.609  65.308  36.557  1.00 64.86  ? 1100 THR B OG1    1 
ATOM   7978  C  CG2    . THR B 1 138 ? -52.659  63.152  36.247  1.00 62.95  ? 1100 THR B CG2    1 
ATOM   7979  H  H      . THR B 1 138 ? -52.620  65.478  34.390  1.00 76.94  ? 1100 THR B H      1 
ATOM   7980  H  HA     . THR B 1 138 ? -54.720  64.734  35.872  1.00 76.27  ? 1100 THR B HA     1 
ATOM   7981  H  HB     . THR B 1 138 ? -53.119  64.598  37.622  1.00 76.92  ? 1100 THR B HB     1 
ATOM   7982  H  HG1    . THR B 1 138 ? -51.013  64.935  37.017  1.00 77.83  ? 1100 THR B HG1    1 
ATOM   7983  H  HG21   . THR B 1 138 ? -51.975  62.726  36.787  1.00 75.54  ? 1100 THR B HG21   1 
ATOM   7984  H  HG22   . THR B 1 138 ? -53.490  62.664  36.347  1.00 75.54  ? 1100 THR B HG22   1 
ATOM   7985  H  HG23   . THR B 1 138 ? -52.387  63.124  35.316  1.00 75.54  ? 1100 THR B HG23   1 
ATOM   7986  N  N      . THR B 1 139 ? -53.892  67.746  35.861  1.00 65.77  ? 1101 THR B N      1 
ATOM   7987  C  CA     . THR B 1 139 ? -54.110  69.061  36.449  1.00 67.34  ? 1101 THR B CA     1 
ATOM   7988  C  C      . THR B 1 139 ? -55.456  69.678  36.080  1.00 63.21  ? 1101 THR B C      1 
ATOM   7989  O  O      . THR B 1 139 ? -55.807  70.728  36.627  1.00 66.44  ? 1101 THR B O      1 
ATOM   7990  C  CB     . THR B 1 139 ? -52.985  70.018  36.031  1.00 69.41  ? 1101 THR B CB     1 
ATOM   7991  O  OG1    . THR B 1 139 ? -52.987  70.179  34.607  1.00 69.58  ? 1101 THR B OG1    1 
ATOM   7992  C  CG2    . THR B 1 139 ? -51.631  69.478  36.479  1.00 70.50  ? 1101 THR B CG2    1 
ATOM   7993  H  H      . THR B 1 139 ? -53.506  67.766  35.092  1.00 78.92  ? 1101 THR B H      1 
ATOM   7994  H  HA     . THR B 1 139 ? -54.081  68.977  37.414  1.00 80.80  ? 1101 THR B HA     1 
ATOM   7995  H  HB     . THR B 1 139 ? -53.124  70.880  36.452  1.00 83.29  ? 1101 THR B HB     1 
ATOM   7996  H  HG1    . THR B 1 139 ? -53.723  70.496  34.355  1.00 83.50  ? 1101 THR B HG1    1 
ATOM   7997  H  HG21   . THR B 1 139 ? -50.926  70.088  36.211  1.00 84.60  ? 1101 THR B HG21   1 
ATOM   7998  H  HG22   . THR B 1 139 ? -51.616  69.383  37.444  1.00 84.60  ? 1101 THR B HG22   1 
ATOM   7999  H  HG23   . THR B 1 139 ? -51.469  68.612  36.074  1.00 84.60  ? 1101 THR B HG23   1 
ATOM   8000  N  N      . ALA B 1 140 ? -56.206  69.077  35.162  1.00 58.49  ? 1102 ALA B N      1 
ATOM   8001  C  CA     . ALA B 1 140 ? -57.518  69.599  34.816  1.00 56.60  ? 1102 ALA B CA     1 
ATOM   8002  C  C      . ALA B 1 140 ? -58.527  69.274  35.917  1.00 55.37  ? 1102 ALA B C      1 
ATOM   8003  O  O      . ALA B 1 140 ? -58.359  68.323  36.685  1.00 55.34  ? 1102 ALA B O      1 
ATOM   8004  C  CB     . ALA B 1 140 ? -57.991  69.019  33.482  1.00 53.05  ? 1102 ALA B CB     1 
ATOM   8005  H  H      . ALA B 1 140 ? -55.978  68.371  34.728  1.00 70.18  ? 1102 ALA B H      1 
ATOM   8006  H  HA     . ALA B 1 140 ? -57.466  70.563  34.727  1.00 67.92  ? 1102 ALA B HA     1 
ATOM   8007  H  HB1    . ALA B 1 140 ? -58.867  69.381  33.273  1.00 63.66  ? 1102 ALA B HB1    1 
ATOM   8008  H  HB2    . ALA B 1 140 ? -57.358  69.264  32.789  1.00 63.66  ? 1102 ALA B HB2    1 
ATOM   8009  H  HB3    . ALA B 1 140 ? -58.041  68.053  33.557  1.00 63.66  ? 1102 ALA B HB3    1 
ATOM   8010  N  N      . LYS B 1 141 ? -59.594  70.078  35.983  1.00 57.65  ? 1103 LYS B N      1 
ATOM   8011  C  CA     . LYS B 1 141 ? -60.676  69.793  36.924  1.00 62.78  ? 1103 LYS B CA     1 
ATOM   8012  C  C      . LYS B 1 141 ? -61.151  68.353  36.785  1.00 57.25  ? 1103 LYS B C      1 
ATOM   8013  O  O      . LYS B 1 141 ? -61.347  67.650  37.782  1.00 57.62  ? 1103 LYS B O      1 
ATOM   8014  C  CB     . LYS B 1 141 ? -61.843  70.761  36.715  1.00 67.20  ? 1103 LYS B CB     1 
ATOM   8015  C  CG     . LYS B 1 141 ? -61.624  72.145  37.306  1.00 75.20  ? 1103 LYS B CG     1 
ATOM   8016  C  CD     . LYS B 1 141 ? -62.712  73.116  36.866  1.00 78.99  ? 1103 LYS B CD     1 
ATOM   8017  C  CE     . LYS B 1 141 ? -62.460  74.523  37.397  1.00 84.33  ? 1103 LYS B CE     1 
ATOM   8018  N  NZ     . LYS B 1 141 ? -62.672  74.620  38.870  1.00 87.67  1 1103 LYS B NZ     1 
ATOM   8019  H  H      . LYS B 1 141 ? -59.712  70.782  35.503  1.00 69.18  ? 1103 LYS B H      1 
ATOM   8020  H  HA     . LYS B 1 141 ? -60.346  69.913  37.828  1.00 75.33  ? 1103 LYS B HA     1 
ATOM   8021  H  HB2    . LYS B 1 141 ? -61.991  70.868  35.762  1.00 80.64  ? 1103 LYS B HB2    1 
ATOM   8022  H  HB3    . LYS B 1 141 ? -62.636  70.386  37.129  1.00 80.64  ? 1103 LYS B HB3    1 
ATOM   8023  H  HG2    . LYS B 1 141 ? -61.642  72.086  38.274  1.00 90.24  ? 1103 LYS B HG2    1 
ATOM   8024  H  HG3    . LYS B 1 141 ? -60.769  72.490  37.006  1.00 90.24  ? 1103 LYS B HG3    1 
ATOM   8025  H  HD2    . LYS B 1 141 ? -62.732  73.157  35.897  1.00 94.79  ? 1103 LYS B HD2    1 
ATOM   8026  H  HD3    . LYS B 1 141 ? -63.568  72.813  37.206  1.00 94.79  ? 1103 LYS B HD3    1 
ATOM   8027  H  HE2    . LYS B 1 141 ? -61.542  74.773  37.207  1.00 101.19 ? 1103 LYS B HE2    1 
ATOM   8028  H  HE3    . LYS B 1 141 ? -63.070  75.140  36.963  1.00 101.19 ? 1103 LYS B HE3    1 
ATOM   8029  H  HZ1    . LYS B 1 141 ? -62.516  75.452  39.146  1.00 105.21 ? 1103 LYS B HZ1    1 
ATOM   8030  H  HZ2    . LYS B 1 141 ? -63.510  74.401  39.072  1.00 105.21 ? 1103 LYS B HZ2    1 
ATOM   8031  H  HZ3    . LYS B 1 141 ? -62.118  74.067  39.294  1.00 105.21 ? 1103 LYS B HZ3    1 
ATOM   8032  N  N      . VAL B 1 142 ? -61.338  67.899  35.551  1.00 51.34  ? 1104 VAL B N      1 
ATOM   8033  C  CA     . VAL B 1 142 ? -61.645  66.498  35.284  1.00 47.96  ? 1104 VAL B CA     1 
ATOM   8034  C  C      . VAL B 1 142 ? -60.390  65.857  34.702  1.00 48.60  ? 1104 VAL B C      1 
ATOM   8035  O  O      . VAL B 1 142 ? -60.148  65.968  33.492  1.00 48.55  ? 1104 VAL B O      1 
ATOM   8036  C  CB     . VAL B 1 142 ? -62.844  66.355  34.334  1.00 46.29  ? 1104 VAL B CB     1 
ATOM   8037  C  CG1    . VAL B 1 142 ? -63.131  64.883  34.048  1.00 42.13  ? 1104 VAL B CG1    1 
ATOM   8038  C  CG2    . VAL B 1 142 ? -64.071  67.037  34.926  1.00 44.31  ? 1104 VAL B CG2    1 
ATOM   8039  H  H      . VAL B 1 142 ? -61.292  68.386  34.844  1.00 61.61  ? 1104 VAL B H      1 
ATOM   8040  H  HA     . VAL B 1 142 ? -61.859  66.050  36.118  1.00 57.55  ? 1104 VAL B HA     1 
ATOM   8041  H  HB     . VAL B 1 142 ? -62.635  66.789  33.492  1.00 55.55  ? 1104 VAL B HB     1 
ATOM   8042  H  HG11   . VAL B 1 142 ? -63.890  64.820  33.448  1.00 50.56  ? 1104 VAL B HG11   1 
ATOM   8043  H  HG12   . VAL B 1 142 ? -62.349  64.483  33.636  1.00 50.56  ? 1104 VAL B HG12   1 
ATOM   8044  H  HG13   . VAL B 1 142 ? -63.332  64.433  34.884  1.00 50.56  ? 1104 VAL B HG13   1 
ATOM   8045  H  HG21   . VAL B 1 142 ? -64.815  66.936  34.312  1.00 53.17  ? 1104 VAL B HG21   1 
ATOM   8046  H  HG22   . VAL B 1 142 ? -64.284  66.621  35.776  1.00 53.17  ? 1104 VAL B HG22   1 
ATOM   8047  H  HG23   . VAL B 1 142 ? -63.876  67.978  35.057  1.00 53.17  ? 1104 VAL B HG23   1 
ATOM   8048  N  N      . PRO B 1 143 ? -59.559  65.198  35.510  1.00 52.56  ? 1105 PRO B N      1 
ATOM   8049  C  CA     . PRO B 1 143 ? -58.363  64.557  34.954  1.00 50.25  ? 1105 PRO B CA     1 
ATOM   8050  C  C      . PRO B 1 143 ? -58.733  63.485  33.938  1.00 49.91  ? 1105 PRO B C      1 
ATOM   8051  O  O      . PRO B 1 143 ? -59.704  62.745  34.108  1.00 48.49  ? 1105 PRO B O      1 
ATOM   8052  C  CB     . PRO B 1 143 ? -57.662  63.967  36.185  1.00 53.33  ? 1105 PRO B CB     1 
ATOM   8053  C  CG     . PRO B 1 143 ? -58.703  63.909  37.248  1.00 53.94  ? 1105 PRO B CG     1 
ATOM   8054  C  CD     . PRO B 1 143 ? -59.636  65.043  36.975  1.00 54.11  ? 1105 PRO B CD     1 
ATOM   8055  H  HA     . PRO B 1 143 ? -57.786  65.216  34.536  1.00 60.30  ? 1105 PRO B HA     1 
ATOM   8056  H  HB2    . PRO B 1 143 ? -57.334  63.078  35.978  1.00 63.99  ? 1105 PRO B HB2    1 
ATOM   8057  H  HB3    . PRO B 1 143 ? -56.932  64.547  36.453  1.00 63.99  ? 1105 PRO B HB3    1 
ATOM   8058  H  HG2    . PRO B 1 143 ? -59.173  63.062  37.195  1.00 64.73  ? 1105 PRO B HG2    1 
ATOM   8059  H  HG3    . PRO B 1 143 ? -58.286  64.013  38.117  1.00 64.73  ? 1105 PRO B HG3    1 
ATOM   8060  H  HD2    . PRO B 1 143 ? -60.538  64.812  37.244  1.00 64.93  ? 1105 PRO B HD2    1 
ATOM   8061  H  HD3    . PRO B 1 143 ? -59.327  65.849  37.417  1.00 64.93  ? 1105 PRO B HD3    1 
ATOM   8062  N  N      . ILE B 1 144 ? -57.959  63.432  32.853  1.00 46.11  ? 1106 ILE B N      1 
ATOM   8063  C  CA     . ILE B 1 144 ? -58.188  62.482  31.775  1.00 43.74  ? 1106 ILE B CA     1 
ATOM   8064  C  C      . ILE B 1 144 ? -56.856  61.885  31.351  1.00 44.28  ? 1106 ILE B C      1 
ATOM   8065  O  O      . ILE B 1 144 ? -55.783  62.404  31.665  1.00 44.71  ? 1106 ILE B O      1 
ATOM   8066  C  CB     . ILE B 1 144 ? -58.873  63.132  30.550  1.00 42.69  ? 1106 ILE B CB     1 
ATOM   8067  C  CG1    . ILE B 1 144 ? -58.098  64.381  30.119  1.00 43.32  ? 1106 ILE B CG1    1 
ATOM   8068  C  CG2    . ILE B 1 144 ? -60.324  63.466  30.858  1.00 41.26  ? 1106 ILE B CG2    1 
ATOM   8069  C  CD1    . ILE B 1 144 ? -58.539  64.957  28.796  1.00 42.18  ? 1106 ILE B CD1    1 
ATOM   8070  H  H      . ILE B 1 144 ? -57.284  63.948  32.719  1.00 55.33  ? 1106 ILE B H      1 
ATOM   8071  H  HA     . ILE B 1 144 ? -58.756  61.764  32.095  1.00 52.49  ? 1106 ILE B HA     1 
ATOM   8072  H  HB     . ILE B 1 144 ? -58.856  62.496  29.818  1.00 51.22  ? 1106 ILE B HB     1 
ATOM   8073  H  HG12   . ILE B 1 144 ? -58.215  65.068  30.794  1.00 51.99  ? 1106 ILE B HG12   1 
ATOM   8074  H  HG13   . ILE B 1 144 ? -57.158  64.154  30.043  1.00 51.99  ? 1106 ILE B HG13   1 
ATOM   8075  H  HG21   . ILE B 1 144 ? -60.727  63.872  30.075  1.00 49.51  ? 1106 ILE B HG21   1 
ATOM   8076  H  HG22   . ILE B 1 144 ? -60.794  62.650  31.088  1.00 49.51  ? 1106 ILE B HG22   1 
ATOM   8077  H  HG23   . ILE B 1 144 ? -60.353  64.086  31.604  1.00 49.51  ? 1106 ILE B HG23   1 
ATOM   8078  H  HD11   . ILE B 1 144 ? -58.002  65.740  28.597  1.00 50.61  ? 1106 ILE B HD11   1 
ATOM   8079  H  HD12   . ILE B 1 144 ? -58.417  64.288  28.104  1.00 50.61  ? 1106 ILE B HD12   1 
ATOM   8080  H  HD13   . ILE B 1 144 ? -59.476  65.204  28.856  1.00 50.61  ? 1106 ILE B HD13   1 
ATOM   8081  N  N      . VAL B 1 145 ? -56.941  60.772  30.634  1.00 44.07  ? 1107 VAL B N      1 
ATOM   8082  C  CA     . VAL B 1 145 ? -55.845  60.282  29.809  1.00 53.08  ? 1107 VAL B CA     1 
ATOM   8083  C  C      . VAL B 1 145 ? -56.362  60.237  28.381  1.00 48.68  ? 1107 VAL B C      1 
ATOM   8084  O  O      . VAL B 1 145 ? -57.339  59.536  28.089  1.00 46.40  ? 1107 VAL B O      1 
ATOM   8085  C  CB     . VAL B 1 145 ? -55.330  58.907  30.266  1.00 53.24  ? 1107 VAL B CB     1 
ATOM   8086  C  CG1    . VAL B 1 145 ? -56.476  57.955  30.527  1.00 54.23  ? 1107 VAL B CG1    1 
ATOM   8087  C  CG2    . VAL B 1 145 ? -54.380  58.317  29.218  1.00 53.42  ? 1107 VAL B CG2    1 
ATOM   8088  H  H      . VAL B 1 145 ? -57.640  60.271  30.608  1.00 52.89  ? 1107 VAL B H      1 
ATOM   8089  H  HA     . VAL B 1 145 ? -55.108  60.912  29.847  1.00 63.70  ? 1107 VAL B HA     1 
ATOM   8090  H  HB     . VAL B 1 145 ? -54.835  59.014  31.093  1.00 63.88  ? 1107 VAL B HB     1 
ATOM   8091  H  HG11   . VAL B 1 145 ? -56.118  57.100  30.813  1.00 65.08  ? 1107 VAL B HG11   1 
ATOM   8092  H  HG12   . VAL B 1 145 ? -57.042  58.325  31.223  1.00 65.08  ? 1107 VAL B HG12   1 
ATOM   8093  H  HG13   . VAL B 1 145 ? -56.986  57.843  29.710  1.00 65.08  ? 1107 VAL B HG13   1 
ATOM   8094  H  HG21   . VAL B 1 145 ? -54.068  57.451  29.527  1.00 64.11  ? 1107 VAL B HG21   1 
ATOM   8095  H  HG22   . VAL B 1 145 ? -54.857  58.216  28.380  1.00 64.11  ? 1107 VAL B HG22   1 
ATOM   8096  H  HG23   . VAL B 1 145 ? -53.627  58.917  29.101  1.00 64.11  ? 1107 VAL B HG23   1 
ATOM   8097  N  N      . LYS B 1 146 ? -55.731  61.002  27.502  1.00 50.55  ? 1108 LYS B N      1 
ATOM   8098  C  CA     . LYS B 1 146 ? -56.144  61.049  26.112  1.00 52.73  ? 1108 LYS B CA     1 
ATOM   8099  C  C      . LYS B 1 146 ? -55.096  60.389  25.230  1.00 47.83  ? 1108 LYS B C      1 
ATOM   8100  O  O      . LYS B 1 146 ? -53.917  60.296  25.583  1.00 47.21  ? 1108 LYS B O      1 
ATOM   8101  C  CB     . LYS B 1 146 ? -56.389  62.494  25.663  1.00 56.05  ? 1108 LYS B CB     1 
ATOM   8102  C  CG     . LYS B 1 146 ? -55.225  63.434  25.885  1.00 58.30  ? 1108 LYS B CG     1 
ATOM   8103  C  CD     . LYS B 1 146 ? -55.368  64.692  25.040  1.00 63.27  ? 1108 LYS B CD     1 
ATOM   8104  C  CE     . LYS B 1 146 ? -56.662  65.434  25.349  1.00 64.70  ? 1108 LYS B CE     1 
ATOM   8105  N  NZ     . LYS B 1 146 ? -56.896  66.564  24.419  1.00 68.07  1 1108 LYS B NZ     1 
ATOM   8106  H  H      . LYS B 1 146 ? -55.058  61.504  27.687  1.00 60.66  ? 1108 LYS B H      1 
ATOM   8107  H  HA     . LYS B 1 146 ? -56.974  60.558  26.011  1.00 63.27  ? 1108 LYS B HA     1 
ATOM   8108  H  HB2    . LYS B 1 146 ? -56.589  62.493  24.714  1.00 67.26  ? 1108 LYS B HB2    1 
ATOM   8109  H  HB3    . LYS B 1 146 ? -57.148  62.845  26.155  1.00 67.26  ? 1108 LYS B HB3    1 
ATOM   8110  H  HG2    . LYS B 1 146 ? -55.196  63.695  26.819  1.00 69.96  ? 1108 LYS B HG2    1 
ATOM   8111  H  HG3    . LYS B 1 146 ? -54.400  62.989  25.634  1.00 69.96  ? 1108 LYS B HG3    1 
ATOM   8112  H  HD2    . LYS B 1 146 ? -54.624  65.287  25.224  1.00 75.92  ? 1108 LYS B HD2    1 
ATOM   8113  H  HD3    . LYS B 1 146 ? -55.375  64.447  24.101  1.00 75.92  ? 1108 LYS B HD3    1 
ATOM   8114  H  HE2    . LYS B 1 146 ? -57.408  64.819  25.271  1.00 77.64  ? 1108 LYS B HE2    1 
ATOM   8115  H  HE3    . LYS B 1 146 ? -56.616  65.790  26.251  1.00 77.64  ? 1108 LYS B HE3    1 
ATOM   8116  H  HZ1    . LYS B 1 146 ? -57.657  66.976  24.626  1.00 81.68  ? 1108 LYS B HZ1    1 
ATOM   8117  H  HZ2    . LYS B 1 146 ? -56.226  67.148  24.476  1.00 81.68  ? 1108 LYS B HZ2    1 
ATOM   8118  H  HZ3    . LYS B 1 146 ? -56.948  66.264  23.583  1.00 81.68  ? 1108 LYS B HZ3    1 
ATOM   8119  N  N      . PHE B 1 147 ? -55.546  59.926  24.070  1.00 45.93  ? 1109 PHE B N      1 
ATOM   8120  C  CA     . PHE B 1 147 ? -54.665  59.225  23.147  1.00 46.06  ? 1109 PHE B CA     1 
ATOM   8121  C  C      . PHE B 1 147 ? -55.350  59.132  21.792  1.00 45.89  ? 1109 PHE B C      1 
ATOM   8122  O  O      . PHE B 1 147 ? -56.527  59.471  21.635  1.00 41.59  ? 1109 PHE B O      1 
ATOM   8123  C  CB     . PHE B 1 147 ? -54.295  57.837  23.674  1.00 43.94  ? 1109 PHE B CB     1 
ATOM   8124  C  CG     . PHE B 1 147 ? -55.477  56.981  24.019  1.00 42.03  ? 1109 PHE B CG     1 
ATOM   8125  C  CD1    . PHE B 1 147 ? -56.050  56.151  23.070  1.00 38.41  ? 1109 PHE B CD1    1 
ATOM   8126  C  CD2    . PHE B 1 147 ? -56.015  57.004  25.293  1.00 40.67  ? 1109 PHE B CD2    1 
ATOM   8127  C  CE1    . PHE B 1 147 ? -57.133  55.358  23.388  1.00 38.31  ? 1109 PHE B CE1    1 
ATOM   8128  C  CE2    . PHE B 1 147 ? -57.103  56.212  25.616  1.00 40.98  ? 1109 PHE B CE2    1 
ATOM   8129  C  CZ     . PHE B 1 147 ? -57.662  55.388  24.660  1.00 37.54  ? 1109 PHE B CZ     1 
ATOM   8130  H  H      . PHE B 1 147 ? -56.356  60.005  23.794  1.00 55.12  ? 1109 PHE B H      1 
ATOM   8131  H  HA     . PHE B 1 147 ? -53.847  59.735  23.039  1.00 55.28  ? 1109 PHE B HA     1 
ATOM   8132  H  HB2    . PHE B 1 147 ? -53.782  57.372  22.995  1.00 52.73  ? 1109 PHE B HB2    1 
ATOM   8133  H  HB3    . PHE B 1 147 ? -53.760  57.940  24.476  1.00 52.73  ? 1109 PHE B HB3    1 
ATOM   8134  H  HD1    . PHE B 1 147 ? -55.697  56.124  22.210  1.00 46.09  ? 1109 PHE B HD1    1 
ATOM   8135  H  HD2    . PHE B 1 147 ? -55.641  57.557  25.941  1.00 48.81  ? 1109 PHE B HD2    1 
ATOM   8136  H  HE1    . PHE B 1 147 ? -57.509  54.804  22.742  1.00 45.97  ? 1109 PHE B HE1    1 
ATOM   8137  H  HE2    . PHE B 1 147 ? -57.457  56.235  26.475  1.00 49.18  ? 1109 PHE B HE2    1 
ATOM   8138  H  HZ     . PHE B 1 147 ? -58.394  54.856  24.874  1.00 45.05  ? 1109 PHE B HZ     1 
ATOM   8139  N  N      . PHE B 1 148 ? -54.590  58.653  20.817  1.00 44.71  ? 1110 PHE B N      1 
ATOM   8140  C  CA     . PHE B 1 148 ? -55.022  58.556  19.433  1.00 50.46  ? 1110 PHE B CA     1 
ATOM   8141  C  C      . PHE B 1 148 ? -55.242  57.091  19.080  1.00 50.23  ? 1110 PHE B C      1 
ATOM   8142  O  O      . PHE B 1 148 ? -54.366  56.254  19.317  1.00 50.13  ? 1110 PHE B O      1 
ATOM   8143  C  CB     . PHE B 1 148 ? -53.970  59.201  18.524  1.00 54.67  ? 1110 PHE B CB     1 
ATOM   8144  C  CG     . PHE B 1 148 ? -54.313  59.186  17.065  1.00 54.89  ? 1110 PHE B CG     1 
ATOM   8145  C  CD1    . PHE B 1 148 ? -55.368  59.937  16.574  1.00 56.00  ? 1110 PHE B CD1    1 
ATOM   8146  C  CD2    . PHE B 1 148 ? -53.540  58.459  16.172  1.00 59.00  ? 1110 PHE B CD2    1 
ATOM   8147  C  CE1    . PHE B 1 148 ? -55.667  59.935  15.217  1.00 58.62  ? 1110 PHE B CE1    1 
ATOM   8148  C  CE2    . PHE B 1 148 ? -53.832  58.454  14.820  1.00 58.41  ? 1110 PHE B CE2    1 
ATOM   8149  C  CZ     . PHE B 1 148 ? -54.894  59.193  14.342  1.00 56.25  ? 1110 PHE B CZ     1 
ATOM   8150  H  H      . PHE B 1 148 ? -53.788  58.366  20.940  1.00 53.65  ? 1110 PHE B H      1 
ATOM   8151  H  HA     . PHE B 1 148 ? -55.860  59.031  19.321  1.00 60.55  ? 1110 PHE B HA     1 
ATOM   8152  H  HB2    . PHE B 1 148 ? -53.856  60.127  18.790  1.00 65.61  ? 1110 PHE B HB2    1 
ATOM   8153  H  HB3    . PHE B 1 148 ? -53.132  58.724  18.634  1.00 65.61  ? 1110 PHE B HB3    1 
ATOM   8154  H  HD1    . PHE B 1 148 ? -55.890  60.437  17.160  1.00 67.21  ? 1110 PHE B HD1    1 
ATOM   8155  H  HD2    . PHE B 1 148 ? -52.823  57.958  16.488  1.00 70.80  ? 1110 PHE B HD2    1 
ATOM   8156  H  HE1    . PHE B 1 148 ? -56.383  60.434  14.897  1.00 70.35  ? 1110 PHE B HE1    1 
ATOM   8157  H  HE2    . PHE B 1 148 ? -53.312  57.953  14.234  1.00 70.09  ? 1110 PHE B HE2    1 
ATOM   8158  H  HZ     . PHE B 1 148 ? -55.093  59.189  13.434  1.00 67.50  ? 1110 PHE B HZ     1 
ATOM   8159  N  N      . HIS B 1 149 ? -56.425  56.782  18.553  1.00 50.96  ? 1111 HIS B N      1 
ATOM   8160  C  CA     . HIS B 1 149 ? -56.754  55.432  18.107  1.00 51.51  ? 1111 HIS B CA     1 
ATOM   8161  C  C      . HIS B 1 149 ? -56.456  55.322  16.614  1.00 53.43  ? 1111 HIS B C      1 
ATOM   8162  O  O      . HIS B 1 149 ? -57.090  55.998  15.797  1.00 51.12  ? 1111 HIS B O      1 
ATOM   8163  C  CB     . HIS B 1 149 ? -58.218  55.108  18.397  1.00 47.97  ? 1111 HIS B CB     1 
ATOM   8164  C  CG     . HIS B 1 149 ? -58.593  53.693  18.089  1.00 50.85  ? 1111 HIS B CG     1 
ATOM   8165  N  ND1    . HIS B 1 149 ? -59.240  53.330  16.927  1.00 50.13  ? 1111 HIS B ND1    1 
ATOM   8166  C  CD2    . HIS B 1 149 ? -58.407  52.549  18.789  1.00 50.25  ? 1111 HIS B CD2    1 
ATOM   8167  C  CE1    . HIS B 1 149 ? -59.439  52.025  16.925  1.00 50.86  ? 1111 HIS B CE1    1 
ATOM   8168  N  NE2    . HIS B 1 149 ? -58.945  51.527  18.044  1.00 53.07  ? 1111 HIS B NE2    1 
ATOM   8169  H  H      . HIS B 1 149 ? -57.063  57.347  18.441  1.00 61.15  ? 1111 HIS B H      1 
ATOM   8170  H  HA     . HIS B 1 149 ? -56.199  54.792  18.579  1.00 61.81  ? 1111 HIS B HA     1 
ATOM   8171  H  HB2    . HIS B 1 149 ? -58.392  55.263  19.339  1.00 57.56  ? 1111 HIS B HB2    1 
ATOM   8172  H  HB3    . HIS B 1 149 ? -58.779  55.688  17.859  1.00 57.56  ? 1111 HIS B HB3    1 
ATOM   8173  H  HD2    . HIS B 1 149 ? -57.996  52.470  19.619  1.00 60.30  ? 1111 HIS B HD2    1 
ATOM   8174  H  HE1    . HIS B 1 149 ? -59.857  51.539  16.251  1.00 61.04  ? 1111 HIS B HE1    1 
ATOM   8175  H  HE2    . HIS B 1 149 ? -58.955  50.697  18.269  1.00 63.68  ? 1111 HIS B HE2    1 
ATOM   8176  N  N      . LEU B 1 150 ? -55.498  54.462  16.263  1.00 56.10  ? 1112 LEU B N      1 
ATOM   8177  C  CA     . LEU B 1 150 ? -54.957  54.443  14.906  1.00 58.34  ? 1112 LEU B CA     1 
ATOM   8178  C  C      . LEU B 1 150 ? -56.011  54.071  13.869  1.00 58.84  ? 1112 LEU B C      1 
ATOM   8179  O  O      . LEU B 1 150 ? -56.212  54.793  12.886  1.00 54.42  ? 1112 LEU B O      1 
ATOM   8180  C  CB     . LEU B 1 150 ? -53.783  53.470  14.830  1.00 64.54  ? 1112 LEU B CB     1 
ATOM   8181  C  CG     . LEU B 1 150 ? -52.380  54.062  14.726  1.00 70.40  ? 1112 LEU B CG     1 
ATOM   8182  C  CD1    . LEU B 1 150 ? -51.363  52.935  14.654  1.00 75.17  ? 1112 LEU B CD1    1 
ATOM   8183  C  CD2    . LEU B 1 150 ? -52.247  54.966  13.506  1.00 71.93  ? 1112 LEU B CD2    1 
ATOM   8184  H  H      . LEU B 1 150 ? -55.147  53.881  16.791  1.00 67.32  ? 1112 LEU B H      1 
ATOM   8185  H  HA     . LEU B 1 150 ? -54.625  55.328  14.688  1.00 70.01  ? 1112 LEU B HA     1 
ATOM   8186  H  HB2    . LEU B 1 150 ? -53.799  52.917  15.627  1.00 77.44  ? 1112 LEU B HB2    1 
ATOM   8187  H  HB3    . LEU B 1 150 ? -53.911  52.906  14.050  1.00 77.44  ? 1112 LEU B HB3    1 
ATOM   8188  H  HG     . LEU B 1 150 ? -52.194  54.590  15.519  1.00 84.48  ? 1112 LEU B HG     1 
ATOM   8189  H  HD11   . LEU B 1 150 ? -50.474  53.316  14.588  1.00 90.20  ? 1112 LEU B HD11   1 
ATOM   8190  H  HD12   . LEU B 1 150 ? -51.434  52.395  15.457  1.00 90.20  ? 1112 LEU B HD12   1 
ATOM   8191  H  HD13   . LEU B 1 150 ? -51.550  52.392  13.872  1.00 90.20  ? 1112 LEU B HD13   1 
ATOM   8192  H  HD21   . LEU B 1 150 ? -51.345  55.323  13.475  1.00 86.32  ? 1112 LEU B HD21   1 
ATOM   8193  H  HD22   . LEU B 1 150 ? -52.425  54.446  12.707  1.00 86.32  ? 1112 LEU B HD22   1 
ATOM   8194  H  HD23   . LEU B 1 150 ? -52.887  55.691  13.579  1.00 86.32  ? 1112 LEU B HD23   1 
ATOM   8195  N  N      . ARG B 1 151 ? -56.680  52.932  14.057  1.00 60.54  ? 1113 ARG B N      1 
ATOM   8196  C  CA     . ARG B 1 151 ? -57.528  52.400  12.995  1.00 59.95  ? 1113 ARG B CA     1 
ATOM   8197  C  C      . ARG B 1 151 ? -58.725  53.297  12.713  1.00 56.29  ? 1113 ARG B C      1 
ATOM   8198  O  O      . ARG B 1 151 ? -59.178  53.373  11.566  1.00 60.68  ? 1113 ARG B O      1 
ATOM   8199  C  CB     . ARG B 1 151 ? -57.980  50.983  13.343  1.00 62.81  ? 1113 ARG B CB     1 
ATOM   8200  C  CG     . ARG B 1 151 ? -56.845  49.970  13.255  1.00 70.38  ? 1113 ARG B CG     1 
ATOM   8201  C  CD     . ARG B 1 151 ? -57.317  48.535  13.425  1.00 73.19  ? 1113 ARG B CD     1 
ATOM   8202  N  NE     . ARG B 1 151 ? -56.208  47.595  13.277  1.00 75.91  ? 1113 ARG B NE     1 
ATOM   8203  C  CZ     . ARG B 1 151 ? -55.833  47.046  12.123  1.00 80.09  ? 1113 ARG B CZ     1 
ATOM   8204  N  NH1    . ARG B 1 151 ? -56.476  47.331  10.999  1.00 81.58  1 1113 ARG B NH1    1 
ATOM   8205  N  NH2    . ARG B 1 151 ? -54.807  46.207  12.090  1.00 82.82  ? 1113 ARG B NH2    1 
ATOM   8206  H  H      . ARG B 1 151 ? -56.660  52.458  14.774  1.00 72.64  ? 1113 ARG B H      1 
ATOM   8207  H  HA     . ARG B 1 151 ? -57.005  52.348  12.180  1.00 71.94  ? 1113 ARG B HA     1 
ATOM   8208  H  HB2    . ARG B 1 151 ? -58.322  50.973  14.251  1.00 75.37  ? 1113 ARG B HB2    1 
ATOM   8209  H  HB3    . ARG B 1 151 ? -58.675  50.711  12.723  1.00 75.37  ? 1113 ARG B HB3    1 
ATOM   8210  H  HG2    . ARG B 1 151 ? -56.422  50.045  12.385  1.00 84.45  ? 1113 ARG B HG2    1 
ATOM   8211  H  HG3    . ARG B 1 151 ? -56.200  50.157  13.955  1.00 84.45  ? 1113 ARG B HG3    1 
ATOM   8212  H  HD2    . ARG B 1 151 ? -57.695  48.423  14.311  1.00 87.83  ? 1113 ARG B HD2    1 
ATOM   8213  H  HD3    . ARG B 1 151 ? -57.981  48.332  12.747  1.00 87.83  ? 1113 ARG B HD3    1 
ATOM   8214  H  HE     . ARG B 1 151 ? -55.768  47.381  13.984  1.00 91.10  ? 1113 ARG B HE     1 
ATOM   8215  H  HH11   . ARG B 1 151 ? -57.142  47.876  11.011  1.00 97.89  ? 1113 ARG B HH11   1 
ATOM   8216  H  HH12   . ARG B 1 151 ? -56.227  46.972  10.259  1.00 97.89  ? 1113 ARG B HH12   1 
ATOM   8217  H  HH21   . ARG B 1 151 ? -54.384  46.015  12.814  1.00 99.39  ? 1113 ARG B HH21   1 
ATOM   8218  H  HH22   . ARG B 1 151 ? -54.566  45.851  11.345  1.00 99.39  ? 1113 ARG B HH22   1 
ATOM   8219  N  N      . SER B 1 152 ? -59.249  53.981  13.728  1.00 51.95  ? 1114 SER B N      1 
ATOM   8220  C  CA     . SER B 1 152 ? -60.367  54.891  13.527  1.00 44.73  ? 1114 SER B CA     1 
ATOM   8221  C  C      . SER B 1 152 ? -59.922  56.329  13.317  1.00 47.53  ? 1114 SER B C      1 
ATOM   8222  O  O      . SER B 1 152 ? -60.705  57.136  12.803  1.00 47.66  ? 1114 SER B O      1 
ATOM   8223  C  CB     . SER B 1 152 ? -61.321  54.839  14.724  1.00 42.20  ? 1114 SER B CB     1 
ATOM   8224  O  OG     . SER B 1 152 ? -60.807  55.572  15.826  1.00 41.92  ? 1114 SER B OG     1 
ATOM   8225  H  H      . SER B 1 152 ? -58.973  53.934  14.541  1.00 62.34  ? 1114 SER B H      1 
ATOM   8226  H  HA     . SER B 1 152 ? -60.860  54.614  12.739  1.00 53.68  ? 1114 SER B HA     1 
ATOM   8227  H  HB2    . SER B 1 152 ? -62.174  55.221  14.463  1.00 50.64  ? 1114 SER B HB2    1 
ATOM   8228  H  HB3    . SER B 1 152 ? -61.441  53.914  14.990  1.00 50.64  ? 1114 SER B HB3    1 
ATOM   8229  H  HG     . SER B 1 152 ? -60.068  55.251  16.064  1.00 50.30  ? 1114 SER B HG     1 
ATOM   8230  N  N      . GLY B 1 153 ? -58.688  56.664  13.690  1.00 48.19  ? 1115 GLY B N      1 
ATOM   8231  C  CA     . GLY B 1 153 ? -58.240  58.038  13.626  1.00 46.51  ? 1115 GLY B CA     1 
ATOM   8232  C  C      . GLY B 1 153 ? -58.910  58.950  14.625  1.00 46.03  ? 1115 GLY B C      1 
ATOM   8233  O  O      . GLY B 1 153 ? -58.823  60.172  14.488  1.00 51.40  ? 1115 GLY B O      1 
ATOM   8234  H  H      . GLY B 1 153 ? -58.098  56.111  13.983  1.00 57.82  ? 1115 GLY B H      1 
ATOM   8235  H  HA2    . GLY B 1 153 ? -57.284  58.068  13.783  1.00 55.81  ? 1115 GLY B HA2    1 
ATOM   8236  H  HA3    . GLY B 1 153 ? -58.411  58.386  12.737  1.00 55.81  ? 1115 GLY B HA3    1 
ATOM   8237  N  N      . LEU B 1 154 ? -59.561  58.396  15.644  1.00 42.32  ? 1116 LEU B N      1 
ATOM   8238  C  CA     . LEU B 1 154 ? -60.303  59.185  16.615  1.00 42.40  ? 1116 LEU B CA     1 
ATOM   8239  C  C      . LEU B 1 154 ? -59.462  59.449  17.855  1.00 40.67  ? 1116 LEU B C      1 
ATOM   8240  O  O      . LEU B 1 154 ? -58.650  58.619  18.272  1.00 41.02  ? 1116 LEU B O      1 
ATOM   8241  C  CB     . LEU B 1 154 ? -61.591  58.469  17.027  1.00 38.35  ? 1116 LEU B CB     1 
ATOM   8242  C  CG     . LEU B 1 154 ? -62.656  58.237  15.951  1.00 39.53  ? 1116 LEU B CG     1 
ATOM   8243  C  CD1    . LEU B 1 154 ? -63.820  57.449  16.531  1.00 37.80  ? 1116 LEU B CD1    1 
ATOM   8244  C  CD2    . LEU B 1 154 ? -63.147  59.549  15.374  1.00 38.59  ? 1116 LEU B CD2    1 
ATOM   8245  H  H      . LEU B 1 154 ? -59.586  57.549  15.795  1.00 50.78  ? 1116 LEU B H      1 
ATOM   8246  H  HA     . LEU B 1 154 ? -60.542  60.038  16.220  1.00 50.89  ? 1116 LEU B HA     1 
ATOM   8247  H  HB2    . LEU B 1 154 ? -61.349  57.597  17.377  1.00 46.02  ? 1116 LEU B HB2    1 
ATOM   8248  H  HB3    . LEU B 1 154 ? -62.009  58.988  17.731  1.00 46.02  ? 1116 LEU B HB3    1 
ATOM   8249  H  HG     . LEU B 1 154 ? -62.269  57.716  15.229  1.00 47.44  ? 1116 LEU B HG     1 
ATOM   8250  H  HD11   . LEU B 1 154 ? -64.484  57.312  15.837  1.00 45.36  ? 1116 LEU B HD11   1 
ATOM   8251  H  HD12   . LEU B 1 154 ? -63.494  56.594  16.851  1.00 45.36  ? 1116 LEU B HD12   1 
ATOM   8252  H  HD13   . LEU B 1 154 ? -64.207  57.952  17.264  1.00 45.36  ? 1116 LEU B HD13   1 
ATOM   8253  H  HD21   . LEU B 1 154 ? -63.818  59.365  14.698  1.00 46.31  ? 1116 LEU B HD21   1 
ATOM   8254  H  HD22   . LEU B 1 154 ? -63.532  60.082  16.087  1.00 46.31  ? 1116 LEU B HD22   1 
ATOM   8255  H  HD23   . LEU B 1 154 ? -62.397  60.020  14.977  1.00 46.31  ? 1116 LEU B HD23   1 
ATOM   8256  N  N      . GLU B 1 155 ? -59.678  60.616  18.449  1.00 44.88  ? 1117 GLU B N      1 
ATOM   8257  C  CA     . GLU B 1 155 ? -59.099  60.945  19.741  1.00 47.92  ? 1117 GLU B CA     1 
ATOM   8258  C  C      . GLU B 1 155 ? -60.011  60.407  20.835  1.00 45.95  ? 1117 GLU B C      1 
ATOM   8259  O  O      . GLU B 1 155 ? -61.237  60.523  20.746  1.00 41.49  ? 1117 GLU B O      1 
ATOM   8260  C  CB     . GLU B 1 155 ? -58.925  62.459  19.880  1.00 52.65  ? 1117 GLU B CB     1 
ATOM   8261  C  CG     . GLU B 1 155 ? -58.148  62.902  21.115  1.00 64.02  ? 1117 GLU B CG     1 
ATOM   8262  C  CD     . GLU B 1 155 ? -56.664  62.575  21.024  1.00 70.89  ? 1117 GLU B CD     1 
ATOM   8263  O  OE1    . GLU B 1 155 ? -56.190  62.257  19.910  1.00 73.92  ? 1117 GLU B OE1    1 
ATOM   8264  O  OE2    . GLU B 1 155 ? -55.973  62.638  22.065  1.00 72.38  1 1117 GLU B OE2    1 
ATOM   8265  H  H      . GLU B 1 155 ? -60.164  61.242  18.117  1.00 53.86  ? 1117 GLU B H      1 
ATOM   8266  H  HA     . GLU B 1 155 ? -58.230  60.524  19.826  1.00 57.51  ? 1117 GLU B HA     1 
ATOM   8267  H  HB2    . GLU B 1 155 ? -58.450  62.789  19.101  1.00 63.17  ? 1117 GLU B HB2    1 
ATOM   8268  H  HB3    . GLU B 1 155 ? -59.803  62.869  19.923  1.00 63.17  ? 1117 GLU B HB3    1 
ATOM   8269  H  HG2    . GLU B 1 155 ? -58.238  63.862  21.218  1.00 76.82  ? 1117 GLU B HG2    1 
ATOM   8270  H  HG3    . GLU B 1 155 ? -58.508  62.449  21.894  1.00 76.82  ? 1117 GLU B HG3    1 
ATOM   8271  N  N      . VAL B 1 156 ? -59.407  59.792  21.852  1.00 46.15  ? 1118 VAL B N      1 
ATOM   8272  C  CA     . VAL B 1 156 ? -60.130  59.180  22.963  1.00 46.80  ? 1118 VAL B CA     1 
ATOM   8273  C  C      . VAL B 1 156 ? -59.724  59.868  24.259  1.00 44.51  ? 1118 VAL B C      1 
ATOM   8274  O  O      . VAL B 1 156 ? -58.541  60.142  24.479  1.00 40.83  ? 1118 VAL B O      1 
ATOM   8275  C  CB     . VAL B 1 156 ? -59.852  57.665  23.054  1.00 45.95  ? 1118 VAL B CB     1 
ATOM   8276  C  CG1    . VAL B 1 156 ? -60.758  57.014  24.087  1.00 43.17  ? 1118 VAL B CG1    1 
ATOM   8277  C  CG2    . VAL B 1 156 ? -60.018  57.005  21.692  1.00 45.25  ? 1118 VAL B CG2    1 
ATOM   8278  H  H      . VAL B 1 156 ? -58.553  59.715  21.921  1.00 55.38  ? 1118 VAL B H      1 
ATOM   8279  H  HA     . VAL B 1 156 ? -61.083  59.308  22.835  1.00 56.16  ? 1118 VAL B HA     1 
ATOM   8280  H  HB     . VAL B 1 156 ? -58.934  57.533  23.338  1.00 55.14  ? 1118 VAL B HB     1 
ATOM   8281  H  HG11   . VAL B 1 156 ? -60.562  56.065  24.124  1.00 51.81  ? 1118 VAL B HG11   1 
ATOM   8282  H  HG12   . VAL B 1 156 ? -60.592  57.420  24.952  1.00 51.81  ? 1118 VAL B HG12   1 
ATOM   8283  H  HG13   . VAL B 1 156 ? -61.682  57.153  23.828  1.00 51.81  ? 1118 VAL B HG13   1 
ATOM   8284  H  HG21   . VAL B 1 156 ? -59.837  56.056  21.777  1.00 54.30  ? 1118 VAL B HG21   1 
ATOM   8285  H  HG22   . VAL B 1 156 ? -60.927  57.142  21.383  1.00 54.30  ? 1118 VAL B HG22   1 
ATOM   8286  H  HG23   . VAL B 1 156 ? -59.392  57.406  21.068  1.00 54.30  ? 1118 VAL B HG23   1 
ATOM   8287  N  N      . ASP B 1 157 ? -60.706  60.132  25.121  1.00 45.63  ? 1119 ASP B N      1 
ATOM   8288  C  CA     . ASP B 1 157 ? -60.480  60.764  26.419  1.00 49.77  ? 1119 ASP B CA     1 
ATOM   8289  C  C      . ASP B 1 157 ? -61.146  59.910  27.490  1.00 49.43  ? 1119 ASP B C      1 
ATOM   8290  O  O      . ASP B 1 157 ? -62.375  59.782  27.505  1.00 50.00  ? 1119 ASP B O      1 
ATOM   8291  C  CB     . ASP B 1 157 ? -61.033  62.191  26.451  1.00 52.59  ? 1119 ASP B CB     1 
ATOM   8292  C  CG     . ASP B 1 157 ? -60.338  63.114  25.468  1.00 55.64  ? 1119 ASP B CG     1 
ATOM   8293  O  OD1    . ASP B 1 157 ? -60.196  62.737  24.285  1.00 60.88  ? 1119 ASP B OD1    1 
ATOM   8294  O  OD2    . ASP B 1 157 ? -59.932  64.221  25.882  1.00 54.39  1 1119 ASP B OD2    1 
ATOM   8295  H  H      . ASP B 1 157 ? -61.533  59.949  24.972  1.00 54.75  ? 1119 ASP B H      1 
ATOM   8296  H  HA     . ASP B 1 157 ? -59.528  60.799  26.601  1.00 59.72  ? 1119 ASP B HA     1 
ATOM   8297  H  HB2    . ASP B 1 157 ? -61.976  62.170  26.226  1.00 63.11  ? 1119 ASP B HB2    1 
ATOM   8298  H  HB3    . ASP B 1 157 ? -60.913  62.557  27.341  1.00 63.11  ? 1119 ASP B HB3    1 
ATOM   8299  N  N      . ILE B 1 158 ? -60.344  59.328  28.382  1.00 45.47  ? 1120 ILE B N      1 
ATOM   8300  C  CA     . ILE B 1 158 ? -60.843  58.487  29.467  1.00 45.52  ? 1120 ILE B CA     1 
ATOM   8301  C  C      . ILE B 1 158 ? -60.757  59.268  30.772  1.00 46.90  ? 1120 ILE B C      1 
ATOM   8302  O  O      . ILE B 1 158 ? -59.702  59.821  31.106  1.00 45.19  ? 1120 ILE B O      1 
ATOM   8303  C  CB     . ILE B 1 158 ? -60.063  57.164  29.575  1.00 45.60  ? 1120 ILE B CB     1 
ATOM   8304  C  CG1    . ILE B 1 158 ? -60.144  56.389  28.256  1.00 48.22  ? 1120 ILE B CG1    1 
ATOM   8305  C  CG2    . ILE B 1 158 ? -60.622  56.322  30.720  1.00 46.43  ? 1120 ILE B CG2    1 
ATOM   8306  C  CD1    . ILE B 1 158 ? -59.456  55.029  28.270  1.00 45.99  ? 1120 ILE B CD1    1 
ATOM   8307  H  H      . ILE B 1 158 ? -59.488  59.408  28.378  1.00 54.56  ? 1120 ILE B H      1 
ATOM   8308  H  HA     . ILE B 1 158 ? -61.775  58.275  29.302  1.00 54.63  ? 1120 ILE B HA     1 
ATOM   8309  H  HB     . ILE B 1 158 ? -59.133  57.365  29.761  1.00 54.72  ? 1120 ILE B HB     1 
ATOM   8310  H  HG12   . ILE B 1 158 ? -61.079  56.243  28.040  1.00 57.86  ? 1120 ILE B HG12   1 
ATOM   8311  H  HG13   . ILE B 1 158 ? -59.729  56.921  27.559  1.00 57.86  ? 1120 ILE B HG13   1 
ATOM   8312  H  HG21   . ILE B 1 158 ? -60.121  55.493  30.775  1.00 55.71  ? 1120 ILE B HG21   1 
ATOM   8313  H  HG22   . ILE B 1 158 ? -60.534  56.818  31.548  1.00 55.71  ? 1120 ILE B HG22   1 
ATOM   8314  H  HG23   . ILE B 1 158 ? -61.557  56.133  30.545  1.00 55.71  ? 1120 ILE B HG23   1 
ATOM   8315  H  HD11   . ILE B 1 158 ? -59.558  54.615  27.398  1.00 55.19  ? 1120 ILE B HD11   1 
ATOM   8316  H  HD12   . ILE B 1 158 ? -58.515  55.154  28.468  1.00 55.19  ? 1120 ILE B HD12   1 
ATOM   8317  H  HD13   . ILE B 1 158 ? -59.867  54.475  28.951  1.00 55.19  ? 1120 ILE B HD13   1 
ATOM   8318  N  N      . SER B 1 159 ? -61.868  59.304  31.506  1.00 48.75  ? 1121 SER B N      1 
ATOM   8319  C  CA     . SER B 1 159 ? -61.950  59.909  32.826  1.00 49.54  ? 1121 SER B CA     1 
ATOM   8320  C  C      . SER B 1 159 ? -62.463  58.879  33.827  1.00 49.02  ? 1121 SER B C      1 
ATOM   8321  O  O      . SER B 1 159 ? -62.982  57.825  33.446  1.00 44.81  ? 1121 SER B O      1 
ATOM   8322  C  CB     . SER B 1 159 ? -62.877  61.131  32.814  1.00 49.19  ? 1121 SER B CB     1 
ATOM   8323  O  OG     . SER B 1 159 ? -64.125  60.802  32.229  1.00 46.15  ? 1121 SER B OG     1 
ATOM   8324  H  H      . SER B 1 159 ? -62.615  58.969  31.245  1.00 58.50  ? 1121 SER B H      1 
ATOM   8325  H  HA     . SER B 1 159 ? -61.067  60.195  33.106  1.00 59.45  ? 1121 SER B HA     1 
ATOM   8326  H  HB2    . SER B 1 159 ? -63.023  61.427  33.726  1.00 59.03  ? 1121 SER B HB2    1 
ATOM   8327  H  HB3    . SER B 1 159 ? -62.461  61.839  32.297  1.00 59.03  ? 1121 SER B HB3    1 
ATOM   8328  H  HG     . SER B 1 159 ? -64.627  61.475  32.225  1.00 55.38  ? 1121 SER B HG     1 
ATOM   8329  N  N      . LEU B 1 160 ? -62.298  59.189  35.116  1.00 51.70  ? 1122 LEU B N      1 
ATOM   8330  C  CA     . LEU B 1 160 ? -62.681  58.297  36.207  1.00 53.48  ? 1122 LEU B CA     1 
ATOM   8331  C  C      . LEU B 1 160 ? -63.937  58.807  36.899  1.00 53.38  ? 1122 LEU B C      1 
ATOM   8332  O  O      . LEU B 1 160 ? -63.987  59.961  37.338  1.00 55.46  ? 1122 LEU B O      1 
ATOM   8333  C  CB     . LEU B 1 160 ? -61.571  58.155  37.252  1.00 59.30  ? 1122 LEU B CB     1 
ATOM   8334  C  CG     . LEU B 1 160 ? -60.352  57.292  36.944  1.00 60.14  ? 1122 LEU B CG     1 
ATOM   8335  C  CD1    . LEU B 1 160 ? -59.330  57.434  38.061  1.00 59.29  ? 1122 LEU B CD1    1 
ATOM   8336  C  CD2    . LEU B 1 160 ? -60.770  55.839  36.794  1.00 59.63  ? 1122 LEU B CD2    1 
ATOM   8337  H  H      . LEU B 1 160 ? -61.956  59.930  35.387  1.00 62.04  ? 1122 LEU B H      1 
ATOM   8338  H  HA     . LEU B 1 160 ? -62.871  57.417  35.847  1.00 64.17  ? 1122 LEU B HA     1 
ATOM   8339  H  HB2    . LEU B 1 160 ? -61.237  59.045  37.445  1.00 71.16  ? 1122 LEU B HB2    1 
ATOM   8340  H  HB3    . LEU B 1 160 ? -61.971  57.790  38.056  1.00 71.16  ? 1122 LEU B HB3    1 
ATOM   8341  H  HG     . LEU B 1 160 ? -59.946  57.585  36.113  1.00 72.16  ? 1122 LEU B HG     1 
ATOM   8342  H  HD11   . LEU B 1 160 ? -58.560  56.881  37.855  1.00 71.15  ? 1122 LEU B HD11   1 
ATOM   8343  H  HD12   . LEU B 1 160 ? -59.063  58.364  38.127  1.00 71.15  ? 1122 LEU B HD12   1 
ATOM   8344  H  HD13   . LEU B 1 160 ? -59.733  57.144  38.894  1.00 71.15  ? 1122 LEU B HD13   1 
ATOM   8345  H  HD21   . LEU B 1 160 ? -59.985  55.304  36.599  1.00 71.55  ? 1122 LEU B HD21   1 
ATOM   8346  H  HD22   . LEU B 1 160 ? -61.176  55.541  37.623  1.00 71.55  ? 1122 LEU B HD22   1 
ATOM   8347  H  HD23   . LEU B 1 160 ? -61.408  55.768  36.067  1.00 71.55  ? 1122 LEU B HD23   1 
ATOM   8348  N  N      . TYR B 1 161 ? -64.930  57.930  37.023  1.00 52.39  ? 1123 TYR B N      1 
ATOM   8349  C  CA     . TYR B 1 161 ? -66.144  58.201  37.789  1.00 54.95  ? 1123 TYR B CA     1 
ATOM   8350  C  C      . TYR B 1 161 ? -66.722  59.572  37.453  1.00 60.02  ? 1123 TYR B C      1 
ATOM   8351  O  O      . TYR B 1 161 ? -67.054  60.374  38.328  1.00 60.97  ? 1123 TYR B O      1 
ATOM   8352  C  CB     . TYR B 1 161 ? -65.869  58.057  39.288  1.00 54.89  ? 1123 TYR B CB     1 
ATOM   8353  C  CG     . TYR B 1 161 ? -65.734  56.607  39.680  1.00 54.28  ? 1123 TYR B CG     1 
ATOM   8354  C  CD1    . TYR B 1 161 ? -64.527  55.942  39.532  1.00 49.75  ? 1123 TYR B CD1    1 
ATOM   8355  C  CD2    . TYR B 1 161 ? -66.823  55.892  40.161  1.00 53.42  ? 1123 TYR B CD2    1 
ATOM   8356  C  CE1    . TYR B 1 161 ? -64.402  54.615  39.863  1.00 50.24  ? 1123 TYR B CE1    1 
ATOM   8357  C  CE2    . TYR B 1 161 ? -66.706  54.562  40.495  1.00 53.39  ? 1123 TYR B CE2    1 
ATOM   8358  C  CZ     . TYR B 1 161 ? -65.493  53.929  40.341  1.00 53.60  ? 1123 TYR B CZ     1 
ATOM   8359  O  OH     . TYR B 1 161 ? -65.366  52.603  40.671  1.00 59.45  ? 1123 TYR B OH     1 
ATOM   8360  H  H      . TYR B 1 161 ? -64.922  57.149  36.662  1.00 62.87  ? 1123 TYR B H      1 
ATOM   8361  H  HA     . TYR B 1 161 ? -66.811  57.538  37.551  1.00 65.94  ? 1123 TYR B HA     1 
ATOM   8362  H  HB2    . TYR B 1 161 ? -65.039  58.510  39.508  1.00 65.87  ? 1123 TYR B HB2    1 
ATOM   8363  H  HB3    . TYR B 1 161 ? -66.605  58.441  39.789  1.00 65.87  ? 1123 TYR B HB3    1 
ATOM   8364  H  HD1    . TYR B 1 161 ? -63.788  56.403  39.204  1.00 59.70  ? 1123 TYR B HD1    1 
ATOM   8365  H  HD2    . TYR B 1 161 ? -67.644  56.318  40.260  1.00 64.10  ? 1123 TYR B HD2    1 
ATOM   8366  H  HE1    . TYR B 1 161 ? -63.584  54.183  39.762  1.00 60.29  ? 1123 TYR B HE1    1 
ATOM   8367  H  HE2    . TYR B 1 161 ? -67.441  54.093  40.820  1.00 64.07  ? 1123 TYR B HE2    1 
ATOM   8368  H  HH     . TYR B 1 161 ? -66.100  52.305  40.948  1.00 71.33  ? 1123 TYR B HH     1 
ATOM   8369  N  N      . ASN B 1 162 ? -66.841  59.836  36.152  1.00 67.85  ? 1124 ASN B N      1 
ATOM   8370  C  CA     . ASN B 1 162 ? -67.472  61.057  35.658  1.00 73.86  ? 1124 ASN B CA     1 
ATOM   8371  C  C      . ASN B 1 162 ? -68.989  60.857  35.603  1.00 72.59  ? 1124 ASN B C      1 
ATOM   8372  O  O      . ASN B 1 162 ? -69.620  60.867  34.547  1.00 76.62  ? 1124 ASN B O      1 
ATOM   8373  C  CB     . ASN B 1 162 ? -66.903  61.423  34.294  1.00 71.97  ? 1124 ASN B CB     1 
ATOM   8374  C  CG     . ASN B 1 162 ? -67.109  62.881  33.949  1.00 72.85  ? 1124 ASN B CG     1 
ATOM   8375  O  OD1    . ASN B 1 162 ? -67.925  63.569  34.562  1.00 75.32  ? 1124 ASN B OD1    1 
ATOM   8376  N  ND2    . ASN B 1 162 ? -66.367  63.361  32.964  1.00 73.55  ? 1124 ASN B ND2    1 
ATOM   8377  H  H      . ASN B 1 162 ? -66.560  59.315  35.528  1.00 81.43  ? 1124 ASN B H      1 
ATOM   8378  H  HA     . ASN B 1 162 ? -67.284  61.785  36.271  1.00 88.64  ? 1124 ASN B HA     1 
ATOM   8379  H  HB2    . ASN B 1 162 ? -65.950  61.246  34.290  1.00 86.36  ? 1124 ASN B HB2    1 
ATOM   8380  H  HB3    . ASN B 1 162 ? -67.343  60.889  33.614  1.00 86.36  ? 1124 ASN B HB3    1 
ATOM   8381  H  HD21   . ASN B 1 162 ? -66.446  64.185  32.729  1.00 88.26  ? 1124 ASN B HD21   1 
ATOM   8382  H  HD22   . ASN B 1 162 ? -65.807  62.850  32.559  1.00 88.26  ? 1124 ASN B HD22   1 
ATOM   8383  N  N      . THR B 1 163 ? -69.571  60.671  36.788  1.00 63.64  ? 1125 THR B N      1 
ATOM   8384  C  CA     . THR B 1 163 ? -70.955  60.219  36.867  1.00 59.91  ? 1125 THR B CA     1 
ATOM   8385  C  C      . THR B 1 163 ? -71.918  61.267  36.325  1.00 55.40  ? 1125 THR B C      1 
ATOM   8386  O  O      . THR B 1 163 ? -72.848  60.933  35.582  1.00 57.15  ? 1125 THR B O      1 
ATOM   8387  C  CB     . THR B 1 163 ? -71.312  59.863  38.308  1.00 60.18  ? 1125 THR B CB     1 
ATOM   8388  O  OG1    . THR B 1 163 ? -70.214  59.171  38.911  1.00 63.95  ? 1125 THR B OG1    1 
ATOM   8389  C  CG2    . THR B 1 163 ? -72.548  58.973  38.344  1.00 59.14  ? 1125 THR B CG2    1 
ATOM   8390  H  H      . THR B 1 163 ? -69.192  60.799  37.549  1.00 76.37  ? 1125 THR B H      1 
ATOM   8391  H  HA     . THR B 1 163 ? -71.055  59.418  36.329  1.00 71.90  ? 1125 THR B HA     1 
ATOM   8392  H  HB     . THR B 1 163 ? -71.499  60.674  38.807  1.00 72.22  ? 1125 THR B HB     1 
ATOM   8393  H  HG1    . THR B 1 163 ? -70.401  58.971  39.705  1.00 76.74  ? 1125 THR B HG1    1 
ATOM   8394  H  HG21   . THR B 1 163 ? -72.769  58.751  39.262  1.00 70.97  ? 1125 THR B HG21   1 
ATOM   8395  H  HG22   . THR B 1 163 ? -73.300  59.434  37.941  1.00 70.97  ? 1125 THR B HG22   1 
ATOM   8396  H  HG23   . THR B 1 163 ? -72.380  58.154  37.853  1.00 70.97  ? 1125 THR B HG23   1 
ATOM   8397  N  N      . LEU B 1 164 ? -71.720  62.538  36.684  1.00 52.93  ? 1126 LEU B N      1 
ATOM   8398  C  CA     . LEU B 1 164 ? -72.651  63.569  36.239  1.00 51.97  ? 1126 LEU B CA     1 
ATOM   8399  C  C      . LEU B 1 164 ? -72.627  63.734  34.728  1.00 49.57  ? 1126 LEU B C      1 
ATOM   8400  O  O      . LEU B 1 164 ? -73.666  64.017  34.121  1.00 46.96  ? 1126 LEU B O      1 
ATOM   8401  C  CB     . LEU B 1 164 ? -72.326  64.903  36.908  1.00 53.08  ? 1126 LEU B CB     1 
ATOM   8402  C  CG     . LEU B 1 164 ? -72.575  65.023  38.410  1.00 55.15  ? 1126 LEU B CG     1 
ATOM   8403  C  CD1    . LEU B 1 164 ? -72.200  66.420  38.867  1.00 56.06  ? 1126 LEU B CD1    1 
ATOM   8404  C  CD2    . LEU B 1 164 ? -74.021  64.712  38.766  1.00 54.12  ? 1126 LEU B CD2    1 
ATOM   8405  H  H      . LEU B 1 164 ? -71.071  62.820  37.172  1.00 63.51  ? 1126 LEU B H      1 
ATOM   8406  H  HA     . LEU B 1 164 ? -73.550  63.315  36.499  1.00 62.36  ? 1126 LEU B HA     1 
ATOM   8407  H  HB2    . LEU B 1 164 ? -71.386  65.090  36.761  1.00 63.70  ? 1126 LEU B HB2    1 
ATOM   8408  H  HB3    . LEU B 1 164 ? -72.858  65.590  36.477  1.00 63.70  ? 1126 LEU B HB3    1 
ATOM   8409  H  HG     . LEU B 1 164 ? -72.007  64.390  38.877  1.00 66.17  ? 1126 LEU B HG     1 
ATOM   8410  H  HD11   . LEU B 1 164 ? -72.359  66.492  39.821  1.00 67.28  ? 1126 LEU B HD11   1 
ATOM   8411  H  HD12   . LEU B 1 164 ? -71.262  66.573  38.676  1.00 67.28  ? 1126 LEU B HD12   1 
ATOM   8412  H  HD13   . LEU B 1 164 ? -72.745  67.065  38.390  1.00 67.28  ? 1126 LEU B HD13   1 
ATOM   8413  H  HD21   . LEU B 1 164 ? -74.136  64.799  39.725  1.00 64.94  ? 1126 LEU B HD21   1 
ATOM   8414  H  HD22   . LEU B 1 164 ? -74.601  65.338  38.305  1.00 64.94  ? 1126 LEU B HD22   1 
ATOM   8415  H  HD23   . LEU B 1 164 ? -74.226  63.805  38.489  1.00 64.94  ? 1126 LEU B HD23   1 
ATOM   8416  N  N      . ALA B 1 165 ? -71.462  63.556  34.100  1.00 50.08  ? 1127 ALA B N      1 
ATOM   8417  C  CA     . ALA B 1 165 ? -71.391  63.654  32.646  1.00 48.02  ? 1127 ALA B CA     1 
ATOM   8418  C  C      . ALA B 1 165 ? -72.250  62.579  31.992  1.00 50.74  ? 1127 ALA B C      1 
ATOM   8419  O  O      . ALA B 1 165 ? -72.865  62.814  30.944  1.00 44.08  ? 1127 ALA B O      1 
ATOM   8420  C  CB     . ALA B 1 165 ? -69.940  63.548  32.178  1.00 45.62  ? 1127 ALA B CB     1 
ATOM   8421  H  H      . ALA B 1 165 ? -70.714  63.382  34.487  1.00 60.09  ? 1127 ALA B H      1 
ATOM   8422  H  HA     . ALA B 1 165 ? -71.733  64.519  32.371  1.00 57.63  ? 1127 ALA B HA     1 
ATOM   8423  H  HB1    . ALA B 1 165 ? -69.915  63.615  31.211  1.00 54.74  ? 1127 ALA B HB1    1 
ATOM   8424  H  HB2    . ALA B 1 165 ? -69.428  64.271  32.573  1.00 54.74  ? 1127 ALA B HB2    1 
ATOM   8425  H  HB3    . ALA B 1 165 ? -69.579  62.693  32.460  1.00 54.74  ? 1127 ALA B HB3    1 
ATOM   8426  N  N      . LEU B 1 166 ? -72.309  61.392  32.602  1.00 54.24  ? 1128 LEU B N      1 
ATOM   8427  C  CA     . LEU B 1 166 ? -73.163  60.332  32.079  1.00 56.83  ? 1128 LEU B CA     1 
ATOM   8428  C  C      . LEU B 1 166 ? -74.628  60.750  32.100  1.00 56.07  ? 1128 LEU B C      1 
ATOM   8429  O  O      . LEU B 1 166 ? -75.390  60.415  31.186  1.00 55.12  ? 1128 LEU B O      1 
ATOM   8430  C  CB     . LEU B 1 166 ? -72.965  59.055  32.896  1.00 56.67  ? 1128 LEU B CB     1 
ATOM   8431  C  CG     . LEU B 1 166 ? -71.667  58.289  32.641  1.00 57.78  ? 1128 LEU B CG     1 
ATOM   8432  C  CD1    . LEU B 1 166 ? -71.408  57.308  33.769  1.00 60.54  ? 1128 LEU B CD1    1 
ATOM   8433  C  CD2    . LEU B 1 166 ? -71.735  57.563  31.312  1.00 59.12  ? 1128 LEU B CD2    1 
ATOM   8434  H  H      . LEU B 1 166 ? -71.869  61.181  33.310  1.00 65.09  ? 1128 LEU B H      1 
ATOM   8435  H  HA     . LEU B 1 166 ? -72.914  60.146  31.161  1.00 68.20  ? 1128 LEU B HA     1 
ATOM   8436  H  HB2    . LEU B 1 166 ? -72.982  59.290  33.837  1.00 68.01  ? 1128 LEU B HB2    1 
ATOM   8437  H  HB3    . LEU B 1 166 ? -73.699  58.452  32.702  1.00 68.01  ? 1128 LEU B HB3    1 
ATOM   8438  H  HG     . LEU B 1 166 ? -70.928  58.916  32.608  1.00 69.33  ? 1128 LEU B HG     1 
ATOM   8439  H  HD11   . LEU B 1 166 ? -70.581  56.832  33.589  1.00 72.64  ? 1128 LEU B HD11   1 
ATOM   8440  H  HD12   . LEU B 1 166 ? -71.333  57.798  34.603  1.00 72.64  ? 1128 LEU B HD12   1 
ATOM   8441  H  HD13   . LEU B 1 166 ? -72.146  56.681  33.818  1.00 72.64  ? 1128 LEU B HD13   1 
ATOM   8442  H  HD21   . LEU B 1 166 ? -70.902  57.084  31.172  1.00 70.94  ? 1128 LEU B HD21   1 
ATOM   8443  H  HD22   . LEU B 1 166 ? -72.476  56.938  31.332  1.00 70.94  ? 1128 LEU B HD22   1 
ATOM   8444  H  HD23   . LEU B 1 166 ? -71.867  58.212  30.604  1.00 70.94  ? 1128 LEU B HD23   1 
ATOM   8445  N  N      . HIS B 1 167 ? -75.034  61.501  33.124  1.00 54.05  ? 1129 HIS B N      1 
ATOM   8446  C  CA     . HIS B 1 167 ? -76.438  61.864  33.273  1.00 52.75  ? 1129 HIS B CA     1 
ATOM   8447  C  C      . HIS B 1 167 ? -76.831  63.035  32.377  1.00 48.25  ? 1129 HIS B C      1 
ATOM   8448  O  O      . HIS B 1 167 ? -77.936  63.041  31.823  1.00 44.48  ? 1129 HIS B O      1 
ATOM   8449  C  CB     . HIS B 1 167 ? -76.740  62.175  34.738  1.00 49.40  ? 1129 HIS B CB     1 
ATOM   8450  C  CG     . HIS B 1 167 ? -76.817  60.956  35.603  1.00 54.06  ? 1129 HIS B CG     1 
ATOM   8451  N  ND1    . HIS B 1 167 ? -75.755  60.507  36.359  1.00 54.80  ? 1129 HIS B ND1    1 
ATOM   8452  C  CD2    . HIS B 1 167 ? -77.828  60.082  35.820  1.00 55.57  ? 1129 HIS B CD2    1 
ATOM   8453  C  CE1    . HIS B 1 167 ? -76.112  59.414  37.010  1.00 55.50  ? 1129 HIS B CE1    1 
ATOM   8454  N  NE2    . HIS B 1 167 ? -77.366  59.135  36.701  1.00 54.12  ? 1129 HIS B NE2    1 
ATOM   8455  H  H      . HIS B 1 167 ? -74.519  61.810  33.740  1.00 64.86  ? 1129 HIS B H      1 
ATOM   8456  H  HA     . HIS B 1 167 ? -76.982  61.103  33.017  1.00 63.30  ? 1129 HIS B HA     1 
ATOM   8457  H  HB2    . HIS B 1 167 ? -76.037  62.745  35.089  1.00 59.28  ? 1129 HIS B HB2    1 
ATOM   8458  H  HB3    . HIS B 1 167 ? -77.593  62.633  34.792  1.00 59.28  ? 1129 HIS B HB3    1 
ATOM   8459  H  HD1    . HIS B 1 167 ? -74.983  60.882  36.403  1.00 65.76  ? 1129 HIS B HD1    1 
ATOM   8460  H  HD2    . HIS B 1 167 ? -78.679  60.119  35.446  1.00 66.68  ? 1129 HIS B HD2    1 
ATOM   8461  H  HE1    . HIS B 1 167 ? -75.573  58.925  37.588  1.00 66.60  ? 1129 HIS B HE1    1 
ATOM   8462  N  N      . ASN B 1 168 ? -75.966  64.044  32.230  1.00 46.16  ? 1130 ASN B N      1 
ATOM   8463  C  CA     . ASN B 1 168 ? -76.293  65.126  31.309  1.00 47.73  ? 1130 ASN B CA     1 
ATOM   8464  C  C      . ASN B 1 168 ? -76.209  64.667  29.859  1.00 43.45  ? 1130 ASN B C      1 
ATOM   8465  O  O      . ASN B 1 168 ? -76.835  65.283  28.992  1.00 42.13  ? 1130 ASN B O      1 
ATOM   8466  C  CB     . ASN B 1 168 ? -75.397  66.352  31.553  1.00 46.62  ? 1130 ASN B CB     1 
ATOM   8467  C  CG     . ASN B 1 168 ? -73.964  66.164  31.070  1.00 47.79  ? 1130 ASN B CG     1 
ATOM   8468  O  OD1    . ASN B 1 168 ? -73.718  65.671  29.971  1.00 41.91  ? 1130 ASN B OD1    1 
ATOM   8469  N  ND2    . ASN B 1 168 ? -73.008  66.598  31.889  1.00 45.71  ? 1130 ASN B ND2    1 
ATOM   8470  H  H      . ASN B 1 168 ? -75.213  64.122  32.638  1.00 55.39  ? 1130 ASN B H      1 
ATOM   8471  H  HA     . ASN B 1 168 ? -77.209  65.400  31.473  1.00 57.27  ? 1130 ASN B HA     1 
ATOM   8472  H  HB2    . ASN B 1 168 ? -75.771  67.113  31.083  1.00 55.94  ? 1130 ASN B HB2    1 
ATOM   8473  H  HB3    . ASN B 1 168 ? -75.368  66.535  32.506  1.00 55.94  ? 1130 ASN B HB3    1 
ATOM   8474  H  HD21   . ASN B 1 168 ? -72.181  66.516  31.666  1.00 54.85  ? 1130 ASN B HD21   1 
ATOM   8475  H  HD22   . ASN B 1 168 ? -73.217  66.959  32.641  1.00 54.85  ? 1130 ASN B HD22   1 
ATOM   8476  N  N      . THR B 1 169 ? -75.463  63.596  29.582  1.00 41.27  ? 1131 THR B N      1 
ATOM   8477  C  CA     . THR B 1 169 ? -75.533  62.961  28.270  1.00 41.88  ? 1131 THR B CA     1 
ATOM   8478  C  C      . THR B 1 169 ? -76.926  62.395  28.025  1.00 45.93  ? 1131 THR B C      1 
ATOM   8479  O  O      . THR B 1 169 ? -77.523  62.618  26.965  1.00 47.91  ? 1131 THR B O      1 
ATOM   8480  C  CB     . THR B 1 169 ? -74.474  61.860  28.157  1.00 41.64  ? 1131 THR B CB     1 
ATOM   8481  O  OG1    . THR B 1 169 ? -73.166  62.433  28.275  1.00 40.52  ? 1131 THR B OG1    1 
ATOM   8482  C  CG2    . THR B 1 169 ? -74.576  61.135  26.823  1.00 41.47  ? 1131 THR B CG2    1 
ATOM   8483  H  H      . THR B 1 169 ? -74.915  63.223  30.131  1.00 49.52  ? 1131 THR B H      1 
ATOM   8484  H  HA     . THR B 1 169 ? -75.352  63.625  27.587  1.00 50.25  ? 1131 THR B HA     1 
ATOM   8485  H  HB     . THR B 1 169 ? -74.606  61.213  28.868  1.00 49.97  ? 1131 THR B HB     1 
ATOM   8486  H  HG1    . THR B 1 169 ? -73.085  62.816  29.019  1.00 48.62  ? 1131 THR B HG1    1 
ATOM   8487  H  HG21   . THR B 1 169 ? -73.898  60.443  26.770  1.00 49.77  ? 1131 THR B HG21   1 
ATOM   8488  H  HG22   . THR B 1 169 ? -75.451  60.727  26.734  1.00 49.77  ? 1131 THR B HG22   1 
ATOM   8489  H  HG23   . THR B 1 169 ? -74.444  61.762  26.095  1.00 49.77  ? 1131 THR B HG23   1 
ATOM   8490  N  N      . ARG B 1 170 ? -77.456  61.652  28.999  1.00 46.29  ? 1132 ARG B N      1 
ATOM   8491  C  CA     . ARG B 1 170 ? -78.822  61.147  28.897  1.00 49.58  ? 1132 ARG B CA     1 
ATOM   8492  C  C      . ARG B 1 170 ? -79.820  62.290  28.779  1.00 46.66  ? 1132 ARG B C      1 
ATOM   8493  O  O      . ARG B 1 170 ? -80.799  62.196  28.031  1.00 50.03  ? 1132 ARG B O      1 
ATOM   8494  C  CB     . ARG B 1 170 ? -79.153  60.277  30.112  1.00 55.94  ? 1132 ARG B CB     1 
ATOM   8495  C  CG     . ARG B 1 170 ? -78.443  58.933  30.141  1.00 59.62  ? 1132 ARG B CG     1 
ATOM   8496  C  CD     . ARG B 1 170 ? -78.737  58.157  31.429  1.00 66.47  ? 1132 ARG B CD     1 
ATOM   8497  N  NE     . ARG B 1 170 ? -80.161  58.149  31.768  1.00 71.47  ? 1132 ARG B NE     1 
ATOM   8498  C  CZ     . ARG B 1 170 ? -80.716  58.821  32.779  1.00 72.32  ? 1132 ARG B CZ     1 
ATOM   8499  N  NH1    . ARG B 1 170 ? -79.979  59.567  33.594  1.00 69.45  1 1132 ARG B NH1    1 
ATOM   8500  N  NH2    . ARG B 1 170 ? -82.025  58.740  32.982  1.00 72.79  ? 1132 ARG B NH2    1 
ATOM   8501  H  H      . ARG B 1 170 ? -77.048  61.428  29.722  1.00 55.55  ? 1132 ARG B H      1 
ATOM   8502  H  HA     . ARG B 1 170 ? -78.898  60.597  28.102  1.00 59.50  ? 1132 ARG B HA     1 
ATOM   8503  H  HB2    . ARG B 1 170 ? -78.903  60.759  30.915  1.00 67.12  ? 1132 ARG B HB2    1 
ATOM   8504  H  HB3    . ARG B 1 170 ? -80.108  60.105  30.118  1.00 67.12  ? 1132 ARG B HB3    1 
ATOM   8505  H  HG2    . ARG B 1 170 ? -78.743  58.397  29.390  1.00 71.54  ? 1132 ARG B HG2    1 
ATOM   8506  H  HG3    . ARG B 1 170 ? -77.485  59.077  30.087  1.00 71.54  ? 1132 ARG B HG3    1 
ATOM   8507  H  HD2    . ARG B 1 170 ? -78.449  57.238  31.318  1.00 79.76  ? 1132 ARG B HD2    1 
ATOM   8508  H  HD3    . ARG B 1 170 ? -78.256  58.570  32.164  1.00 79.76  ? 1132 ARG B HD3    1 
ATOM   8509  H  HE     . ARG B 1 170 ? -80.682  57.674  31.276  1.00 85.76  ? 1132 ARG B HE     1 
ATOM   8510  H  HH11   . ARG B 1 170 ? -79.130  59.628  33.471  1.00 83.34  ? 1132 ARG B HH11   1 
ATOM   8511  H  HH12   . ARG B 1 170 ? -80.351  59.992  34.242  1.00 83.34  ? 1132 ARG B HH12   1 
ATOM   8512  H  HH21   . ARG B 1 170 ? -82.512  58.258  32.462  1.00 87.35  ? 1132 ARG B HH21   1 
ATOM   8513  H  HH22   . ARG B 1 170 ? -82.387  59.167  33.635  1.00 87.35  ? 1132 ARG B HH22   1 
ATOM   8514  N  N      . LEU B 1 171 ? -79.600  63.370  29.532  1.00 47.50  ? 1133 LEU B N      1 
ATOM   8515  C  CA     . LEU B 1 171 ? -80.495  64.522  29.479  1.00 46.91  ? 1133 LEU B CA     1 
ATOM   8516  C  C      . LEU B 1 171 ? -80.534  65.119  28.076  1.00 46.44  ? 1133 LEU B C      1 
ATOM   8517  O  O      . LEU B 1 171 ? -81.611  65.321  27.503  1.00 43.57  ? 1133 LEU B O      1 
ATOM   8518  C  CB     . LEU B 1 171 ? -80.047  65.566  30.503  1.00 44.21  ? 1133 LEU B CB     1 
ATOM   8519  C  CG     . LEU B 1 171 ? -80.840  66.872  30.586  1.00 43.67  ? 1133 LEU B CG     1 
ATOM   8520  C  CD1    . LEU B 1 171 ? -82.231  66.623  31.142  1.00 44.57  ? 1133 LEU B CD1    1 
ATOM   8521  C  CD2    . LEU B 1 171 ? -80.092  67.886  31.437  1.00 43.21  ? 1133 LEU B CD2    1 
ATOM   8522  H  H      . LEU B 1 171 ? -78.942  63.458  30.078  1.00 57.00  ? 1133 LEU B H      1 
ATOM   8523  H  HA     . LEU B 1 171 ? -81.393  64.237  29.710  1.00 56.29  ? 1133 LEU B HA     1 
ATOM   8524  H  HB2    . LEU B 1 171 ? -80.084  65.157  31.382  1.00 53.05  ? 1133 LEU B HB2    1 
ATOM   8525  H  HB3    . LEU B 1 171 ? -79.129  65.805  30.304  1.00 53.05  ? 1133 LEU B HB3    1 
ATOM   8526  H  HG     . LEU B 1 171 ? -80.935  67.241  29.694  1.00 52.40  ? 1133 LEU B HG     1 
ATOM   8527  H  HD11   . LEU B 1 171 ? -82.710  67.466  31.183  1.00 53.48  ? 1133 LEU B HD11   1 
ATOM   8528  H  HD12   . LEU B 1 171 ? -82.699  66.005  30.559  1.00 53.48  ? 1133 LEU B HD12   1 
ATOM   8529  H  HD13   . LEU B 1 171 ? -82.152  66.244  32.031  1.00 53.48  ? 1133 LEU B HD13   1 
ATOM   8530  H  HD21   . LEU B 1 171 ? -80.609  68.705  31.478  1.00 51.85  ? 1133 LEU B HD21   1 
ATOM   8531  H  HD22   . LEU B 1 171 ? -79.976  67.523  32.329  1.00 51.85  ? 1133 LEU B HD22   1 
ATOM   8532  H  HD23   . LEU B 1 171 ? -79.227  68.059  31.034  1.00 51.85  ? 1133 LEU B HD23   1 
ATOM   8533  N  N      . LEU B 1 172 ? -79.360  65.409  27.506  1.00 44.48  ? 1134 LEU B N      1 
ATOM   8534  C  CA     . LEU B 1 172 ? -79.308  65.993  26.169  1.00 47.55  ? 1134 LEU B CA     1 
ATOM   8535  C  C      . LEU B 1 172 ? -79.891  65.047  25.125  1.00 48.11  ? 1134 LEU B C      1 
ATOM   8536  O  O      . LEU B 1 172 ? -80.550  65.488  24.176  1.00 44.90  ? 1134 LEU B O      1 
ATOM   8537  C  CB     . LEU B 1 172 ? -77.868  66.363  25.816  1.00 43.39  ? 1134 LEU B CB     1 
ATOM   8538  C  CG     . LEU B 1 172 ? -77.468  67.800  26.158  1.00 43.93  ? 1134 LEU B CG     1 
ATOM   8539  C  CD1    . LEU B 1 172 ? -77.719  68.107  27.627  1.00 43.23  ? 1134 LEU B CD1    1 
ATOM   8540  C  CD2    . LEU B 1 172 ? -76.008  68.042  25.805  1.00 43.45  ? 1134 LEU B CD2    1 
ATOM   8541  H  H      . LEU B 1 172 ? -78.592  65.278  27.869  1.00 53.38  ? 1134 LEU B H      1 
ATOM   8542  H  HA     . LEU B 1 172 ? -79.836  66.807  26.161  1.00 57.06  ? 1134 LEU B HA     1 
ATOM   8543  H  HB2    . LEU B 1 172 ? -77.270  65.771  26.298  1.00 52.07  ? 1134 LEU B HB2    1 
ATOM   8544  H  HB3    . LEU B 1 172 ? -77.744  66.244  24.861  1.00 52.07  ? 1134 LEU B HB3    1 
ATOM   8545  H  HG     . LEU B 1 172 ? -78.007  68.410  25.630  1.00 52.71  ? 1134 LEU B HG     1 
ATOM   8546  H  HD11   . LEU B 1 172 ? -77.456  69.023  27.808  1.00 51.88  ? 1134 LEU B HD11   1 
ATOM   8547  H  HD12   . LEU B 1 172 ? -78.664  67.990  27.816  1.00 51.88  ? 1134 LEU B HD12   1 
ATOM   8548  H  HD13   . LEU B 1 172 ? -77.195  67.498  28.170  1.00 51.88  ? 1134 LEU B HD13   1 
ATOM   8549  H  HD21   . LEU B 1 172 ? -75.776  68.957  26.029  1.00 52.13  ? 1134 LEU B HD21   1 
ATOM   8550  H  HD22   . LEU B 1 172 ? -75.455  67.426  26.311  1.00 52.13  ? 1134 LEU B HD22   1 
ATOM   8551  H  HD23   . LEU B 1 172 ? -75.885  67.893  24.854  1.00 52.13  ? 1134 LEU B HD23   1 
ATOM   8552  N  N      . SER B 1 173 ? -79.667  63.741  25.285  1.00 47.42  ? 1135 SER B N      1 
ATOM   8553  C  CA     . SER B 1 173 ? -80.250  62.778  24.357  1.00 47.53  ? 1135 SER B CA     1 
ATOM   8554  C  C      . SER B 1 173 ? -81.771  62.847  24.387  1.00 52.84  ? 1135 SER B C      1 
ATOM   8555  O  O      . SER B 1 173 ? -82.425  62.795  23.338  1.00 52.35  ? 1135 SER B O      1 
ATOM   8556  C  CB     . SER B 1 173 ? -79.772  61.369  24.700  1.00 48.73  ? 1135 SER B CB     1 
ATOM   8557  O  OG     . SER B 1 173 ? -80.247  60.429  23.754  1.00 53.97  ? 1135 SER B OG     1 
ATOM   8558  H  H      . SER B 1 173 ? -79.189  63.394  25.911  1.00 56.90  ? 1135 SER B H      1 
ATOM   8559  H  HA     . SER B 1 173 ? -79.956  62.986  23.457  1.00 57.04  ? 1135 SER B HA     1 
ATOM   8560  H  HB2    . SER B 1 173 ? -78.802  61.355  24.698  1.00 58.48  ? 1135 SER B HB2    1 
ATOM   8561  H  HB3    . SER B 1 173 ? -80.106  61.127  25.578  1.00 58.48  ? 1135 SER B HB3    1 
ATOM   8562  H  HG     . SER B 1 173 ? -79.978  59.659  23.953  1.00 64.77  ? 1135 SER B HG     1 
ATOM   8563  N  N      . ALA B 1 174 ? -82.354  62.972  25.582  1.00 52.04  ? 1136 ALA B N      1 
ATOM   8564  C  CA     . ALA B 1 174 ? -83.801  63.116  25.689  1.00 51.73  ? 1136 ALA B CA     1 
ATOM   8565  C  C      . ALA B 1 174 ? -84.282  64.351  24.939  1.00 49.06  ? 1136 ALA B C      1 
ATOM   8566  O  O      . ALA B 1 174 ? -85.283  64.297  24.215  1.00 50.63  ? 1136 ALA B O      1 
ATOM   8567  C  CB     . ALA B 1 174 ? -84.214  63.186  27.159  1.00 51.58  ? 1136 ALA B CB     1 
ATOM   8568  H  H      . ALA B 1 174 ? -81.937  62.976  26.335  1.00 62.44  ? 1136 ALA B H      1 
ATOM   8569  H  HA     . ALA B 1 174 ? -84.227  62.339  25.293  1.00 62.07  ? 1136 ALA B HA     1 
ATOM   8570  H  HB1    . ALA B 1 174 ? -85.178  63.281  27.212  1.00 61.89  ? 1136 ALA B HB1    1 
ATOM   8571  H  HB2    . ALA B 1 174 ? -83.937  62.370  27.604  1.00 61.89  ? 1136 ALA B HB2    1 
ATOM   8572  H  HB3    . ALA B 1 174 ? -83.783  63.951  27.571  1.00 61.89  ? 1136 ALA B HB3    1 
ATOM   8573  N  N      . TYR B 1 175 ? -83.583  65.477  25.105  1.00 47.09  ? 1137 TYR B N      1 
ATOM   8574  C  CA     . TYR B 1 175 ? -83.952  66.692  24.386  1.00 47.92  ? 1137 TYR B CA     1 
ATOM   8575  C  C      . TYR B 1 175 ? -83.847  66.495  22.879  1.00 49.41  ? 1137 TYR B C      1 
ATOM   8576  O  O      . TYR B 1 175 ? -84.722  66.940  22.127  1.00 51.50  ? 1137 TYR B O      1 
ATOM   8577  C  CB     . TYR B 1 175 ? -83.071  67.860  24.837  1.00 45.43  ? 1137 TYR B CB     1 
ATOM   8578  C  CG     . TYR B 1 175 ? -83.497  68.488  26.151  1.00 43.86  ? 1137 TYR B CG     1 
ATOM   8579  C  CD1    . TYR B 1 175 ? -84.719  69.136  26.269  1.00 45.77  ? 1137 TYR B CD1    1 
ATOM   8580  C  CD2    . TYR B 1 175 ? -82.671  68.445  27.267  1.00 42.84  ? 1137 TYR B CD2    1 
ATOM   8581  C  CE1    . TYR B 1 175 ? -85.113  69.715  27.463  1.00 47.76  ? 1137 TYR B CE1    1 
ATOM   8582  C  CE2    . TYR B 1 175 ? -83.056  69.021  28.466  1.00 44.40  ? 1137 TYR B CE2    1 
ATOM   8583  C  CZ     . TYR B 1 175 ? -84.280  69.656  28.556  1.00 48.07  ? 1137 TYR B CZ     1 
ATOM   8584  O  OH     . TYR B 1 175 ? -84.676  70.235  29.741  1.00 48.77  ? 1137 TYR B OH     1 
ATOM   8585  H  H      . TYR B 1 175 ? -82.900  65.560  25.622  1.00 56.51  ? 1137 TYR B H      1 
ATOM   8586  H  HA     . TYR B 1 175 ? -84.873  66.913  24.595  1.00 57.51  ? 1137 TYR B HA     1 
ATOM   8587  H  HB2    . TYR B 1 175 ? -82.161  67.542  24.943  1.00 54.52  ? 1137 TYR B HB2    1 
ATOM   8588  H  HB3    . TYR B 1 175 ? -83.099  68.552  24.157  1.00 54.52  ? 1137 TYR B HB3    1 
ATOM   8589  H  HD1    . TYR B 1 175 ? -85.286  69.178  25.533  1.00 54.93  ? 1137 TYR B HD1    1 
ATOM   8590  H  HD2    . TYR B 1 175 ? -81.847  68.017  27.210  1.00 51.41  ? 1137 TYR B HD2    1 
ATOM   8591  H  HE1    . TYR B 1 175 ? -85.937  70.143  27.526  1.00 57.31  ? 1137 TYR B HE1    1 
ATOM   8592  H  HE2    . TYR B 1 175 ? -82.494  68.982  29.206  1.00 53.28  ? 1137 TYR B HE2    1 
ATOM   8593  H  HH     . TYR B 1 175 ? -84.082  70.130  30.325  1.00 58.52  ? 1137 TYR B HH     1 
ATOM   8594  N  N      . SER B 1 176 ? -82.787  65.825  22.415  1.00 54.04  ? 1138 SER B N      1 
ATOM   8595  C  CA     . SER B 1 176 ? -82.610  65.626  20.980  1.00 56.75  ? 1138 SER B CA     1 
ATOM   8596  C  C      . SER B 1 176 ? -83.733  64.794  20.380  1.00 58.40  ? 1138 SER B C      1 
ATOM   8597  O  O      . SER B 1 176 ? -83.961  64.862  19.167  1.00 61.39  ? 1138 SER B O      1 
ATOM   8598  C  CB     . SER B 1 176 ? -81.265  64.958  20.691  1.00 57.95  ? 1138 SER B CB     1 
ATOM   8599  O  OG     . SER B 1 176 ? -81.335  63.556  20.872  1.00 61.50  ? 1138 SER B OG     1 
ATOM   8600  H  H      . SER B 1 176 ? -82.168  65.483  22.904  1.00 64.85  ? 1138 SER B H      1 
ATOM   8601  H  HA     . SER B 1 176 ? -82.613  66.491  20.541  1.00 68.10  ? 1138 SER B HA     1 
ATOM   8602  H  HB2    . SER B 1 176 ? -81.013  65.143  19.773  1.00 69.55  ? 1138 SER B HB2    1 
ATOM   8603  H  HB3    . SER B 1 176 ? -80.598  65.319  21.295  1.00 69.55  ? 1138 SER B HB3    1 
ATOM   8604  H  HG     . SER B 1 176 ? -81.551  63.379  21.664  1.00 73.80  ? 1138 SER B HG     1 
ATOM   8605  N  N      . ALA B 1 177 ? -84.435  64.010  21.197  1.00 52.58  ? 1139 ALA B N      1 
ATOM   8606  C  CA     . ALA B 1 177 ? -85.500  63.144  20.716  1.00 53.37  ? 1139 ALA B CA     1 
ATOM   8607  C  C      . ALA B 1 177 ? -86.866  63.818  20.716  1.00 54.14  ? 1139 ALA B C      1 
ATOM   8608  O  O      . ALA B 1 177 ? -87.799  63.289  20.101  1.00 51.98  ? 1139 ALA B O      1 
ATOM   8609  C  CB     . ALA B 1 177 ? -85.564  61.875  21.572  1.00 52.69  ? 1139 ALA B CB     1 
ATOM   8610  H  H      . ALA B 1 177 ? -84.309  63.965  22.047  1.00 63.10  ? 1139 ALA B H      1 
ATOM   8611  H  HA     . ALA B 1 177 ? -85.299  62.878  19.805  1.00 64.04  ? 1139 ALA B HA     1 
ATOM   8612  H  HB1    . ALA B 1 177 ? -86.277  61.307  21.241  1.00 63.22  ? 1139 ALA B HB1    1 
ATOM   8613  H  HB2    . ALA B 1 177 ? -84.715  61.411  21.512  1.00 63.22  ? 1139 ALA B HB2    1 
ATOM   8614  H  HB3    . ALA B 1 177 ? -85.740  62.125  22.493  1.00 63.22  ? 1139 ALA B HB3    1 
ATOM   8615  N  N      . ILE B 1 178 ? -87.010  64.962  21.387  1.00 56.67  ? 1140 ILE B N      1 
ATOM   8616  C  CA     . ILE B 1 178 ? -88.309  65.625  21.447  1.00 58.96  ? 1140 ILE B CA     1 
ATOM   8617  C  C      . ILE B 1 178 ? -88.707  66.147  20.072  1.00 57.40  ? 1140 ILE B C      1 
ATOM   8618  O  O      . ILE B 1 178 ? -89.874  66.059  19.677  1.00 57.95  ? 1140 ILE B O      1 
ATOM   8619  C  CB     . ILE B 1 178 ? -88.296  66.746  22.505  1.00 54.71  ? 1140 ILE B CB     1 
ATOM   8620  C  CG1    . ILE B 1 178 ? -88.142  66.137  23.902  1.00 54.97  ? 1140 ILE B CG1    1 
ATOM   8621  C  CG2    . ILE B 1 178 ? -89.562  67.599  22.411  1.00 54.48  ? 1140 ILE B CG2    1 
ATOM   8622  C  CD1    . ILE B 1 178 ? -87.987  67.150  25.022  1.00 53.21  ? 1140 ILE B CD1    1 
ATOM   8623  H  H      . ILE B 1 178 ? -86.380  65.369  21.808  1.00 68.01  ? 1140 ILE B H      1 
ATOM   8624  H  HA     . ILE B 1 178 ? -88.976  64.975  21.718  1.00 70.75  ? 1140 ILE B HA     1 
ATOM   8625  H  HB     . ILE B 1 178 ? -87.530  67.317  22.335  1.00 65.65  ? 1140 ILE B HB     1 
ATOM   8626  H  HG12   . ILE B 1 178 ? -88.929  65.604  24.096  1.00 65.97  ? 1140 ILE B HG12   1 
ATOM   8627  H  HG13   . ILE B 1 178 ? -87.355  65.570  23.908  1.00 65.97  ? 1140 ILE B HG13   1 
ATOM   8628  H  HG21   . ILE B 1 178 ? -89.525  68.294  23.087  1.00 65.38  ? 1140 ILE B HG21   1 
ATOM   8629  H  HG22   . ILE B 1 178 ? -89.609  67.998  21.528  1.00 65.38  ? 1140 ILE B HG22   1 
ATOM   8630  H  HG23   . ILE B 1 178 ? -90.335  67.033  22.561  1.00 65.38  ? 1140 ILE B HG23   1 
ATOM   8631  H  HD11   . ILE B 1 178 ? -87.897  66.677  25.864  1.00 63.85  ? 1140 ILE B HD11   1 
ATOM   8632  H  HD12   . ILE B 1 178 ? -87.195  67.685  24.856  1.00 63.85  ? 1140 ILE B HD12   1 
ATOM   8633  H  HD13   . ILE B 1 178 ? -88.773  67.718  25.044  1.00 63.85  ? 1140 ILE B HD13   1 
ATOM   8634  N  N      . ASP B 1 179 ? -87.751  66.695  19.321  1.00 58.01  ? 1141 ASP B N      1 
ATOM   8635  C  CA     . ASP B 1 179 ? -88.075  67.351  18.069  1.00 59.80  ? 1141 ASP B CA     1 
ATOM   8636  C  C      . ASP B 1 179 ? -86.864  67.307  17.145  1.00 57.73  ? 1141 ASP B C      1 
ATOM   8637  O  O      . ASP B 1 179 ? -85.748  67.605  17.600  1.00 57.14  ? 1141 ASP B O      1 
ATOM   8638  C  CB     . ASP B 1 179 ? -88.497  68.801  18.313  1.00 62.20  ? 1141 ASP B CB     1 
ATOM   8639  C  CG     . ASP B 1 179 ? -89.110  69.451  17.086  1.00 65.31  ? 1141 ASP B CG     1 
ATOM   8640  O  OD1    . ASP B 1 179 ? -88.475  69.428  16.009  1.00 63.50  ? 1141 ASP B OD1    1 
ATOM   8641  O  OD2    . ASP B 1 179 ? -90.235  69.982  17.200  1.00 68.11  1 1141 ASP B OD2    1 
ATOM   8642  H  H      . ASP B 1 179 ? -86.914  66.698  19.518  1.00 69.61  ? 1141 ASP B H      1 
ATOM   8643  H  HA     . ASP B 1 179 ? -88.809  66.884  17.639  1.00 71.76  ? 1141 ASP B HA     1 
ATOM   8644  H  HB2    . ASP B 1 179 ? -89.156  68.823  19.024  1.00 74.63  ? 1141 ASP B HB2    1 
ATOM   8645  H  HB3    . ASP B 1 179 ? -87.717  69.319  18.568  1.00 74.63  ? 1141 ASP B HB3    1 
ATOM   8646  N  N      . PRO B 1 180 ? -87.035  66.944  15.868  1.00 57.99  ? 1142 PRO B N      1 
ATOM   8647  C  CA     . PRO B 1 180 ? -85.871  66.910  14.965  1.00 54.49  ? 1142 PRO B CA     1 
ATOM   8648  C  C      . PRO B 1 180 ? -85.147  68.238  14.875  1.00 50.59  ? 1142 PRO B C      1 
ATOM   8649  O  O      . PRO B 1 180 ? -83.941  68.263  14.602  1.00 50.86  ? 1142 PRO B O      1 
ATOM   8650  C  CB     . PRO B 1 180 ? -86.482  66.512  13.616  1.00 56.95  ? 1142 PRO B CB     1 
ATOM   8651  C  CG     . PRO B 1 180 ? -87.757  65.831  13.957  1.00 58.70  ? 1142 PRO B CG     1 
ATOM   8652  C  CD     . PRO B 1 180 ? -88.267  66.505  15.190  1.00 58.21  ? 1142 PRO B CD     1 
ATOM   8653  H  HA     . PRO B 1 180 ? -85.246  66.224  15.248  1.00 65.38  ? 1142 PRO B HA     1 
ATOM   8654  H  HB2    . PRO B 1 180 ? -86.648  67.306  13.085  1.00 68.34  ? 1142 PRO B HB2    1 
ATOM   8655  H  HB3    . PRO B 1 180 ? -85.883  65.906  13.151  1.00 68.34  ? 1142 PRO B HB3    1 
ATOM   8656  H  HG2    . PRO B 1 180 ? -88.387  65.937  13.226  1.00 70.44  ? 1142 PRO B HG2    1 
ATOM   8657  H  HG3    . PRO B 1 180 ? -87.588  64.892  14.128  1.00 70.44  ? 1142 PRO B HG3    1 
ATOM   8658  H  HD2    . PRO B 1 180 ? -88.815  67.270  14.955  1.00 69.85  ? 1142 PRO B HD2    1 
ATOM   8659  H  HD3    . PRO B 1 180 ? -88.753  65.875  15.744  1.00 69.85  ? 1142 PRO B HD3    1 
ATOM   8660  N  N      . ARG B 1 181 ? -85.850  69.349  15.096  1.00 51.18  ? 1143 ARG B N      1 
ATOM   8661  C  CA     . ARG B 1 181 ? -85.213  70.657  15.003  1.00 48.69  ? 1143 ARG B CA     1 
ATOM   8662  C  C      . ARG B 1 181 ? -84.134  70.825  16.063  1.00 45.74  ? 1143 ARG B C      1 
ATOM   8663  O  O      . ARG B 1 181 ? -83.194  71.606  15.872  1.00 46.63  ? 1143 ARG B O      1 
ATOM   8664  C  CB     . ARG B 1 181 ? -86.271  71.756  15.120  1.00 48.90  ? 1143 ARG B CB     1 
ATOM   8665  C  CG     . ARG B 1 181 ? -87.308  71.725  13.995  1.00 49.32  ? 1143 ARG B CG     1 
ATOM   8666  C  CD     . ARG B 1 181 ? -88.399  72.768  14.191  1.00 54.12  ? 1143 ARG B CD     1 
ATOM   8667  N  NE     . ARG B 1 181 ? -89.276  72.440  15.314  1.00 53.89  ? 1143 ARG B NE     1 
ATOM   8668  C  CZ     . ARG B 1 181 ? -90.219  73.246  15.793  1.00 53.31  ? 1143 ARG B CZ     1 
ATOM   8669  N  NH1    . ARG B 1 181 ? -90.419  74.441  15.255  1.00 53.02  1 1143 ARG B NH1    1 
ATOM   8670  N  NH2    . ARG B 1 181 ? -90.962  72.858  16.819  1.00 57.14  ? 1143 ARG B NH2    1 
ATOM   8671  H  H      . ARG B 1 181 ? -86.686  69.371  15.299  1.00 61.41  ? 1143 ARG B H      1 
ATOM   8672  H  HA     . ARG B 1 181 ? -84.792  70.739  14.133  1.00 58.43  ? 1143 ARG B HA     1 
ATOM   8673  H  HB2    . ARG B 1 181 ? -86.742  71.650  15.961  1.00 58.68  ? 1143 ARG B HB2    1 
ATOM   8674  H  HB3    . ARG B 1 181 ? -85.831  72.619  15.095  1.00 58.68  ? 1143 ARG B HB3    1 
ATOM   8675  H  HG2    . ARG B 1 181 ? -86.866  71.905  13.151  1.00 59.18  ? 1143 ARG B HG2    1 
ATOM   8676  H  HG3    . ARG B 1 181 ? -87.727  70.850  13.973  1.00 59.18  ? 1143 ARG B HG3    1 
ATOM   8677  H  HD2    . ARG B 1 181 ? -87.989  73.628  14.369  1.00 64.94  ? 1143 ARG B HD2    1 
ATOM   8678  H  HD3    . ARG B 1 181 ? -88.941  72.816  13.388  1.00 64.94  ? 1143 ARG B HD3    1 
ATOM   8679  H  HE     . ARG B 1 181 ? -89.176  71.674  15.691  1.00 64.67  ? 1143 ARG B HE     1 
ATOM   8680  H  HH11   . ARG B 1 181 ? -89.939  74.699  14.589  1.00 63.62  ? 1143 ARG B HH11   1 
ATOM   8681  H  HH12   . ARG B 1 181 ? -91.030  74.958  15.570  1.00 63.62  ? 1143 ARG B HH12   1 
ATOM   8682  H  HH21   . ARG B 1 181 ? -90.837  72.084  17.173  1.00 68.57  ? 1143 ARG B HH21   1 
ATOM   8683  H  HH22   . ARG B 1 181 ? -91.572  73.379  17.130  1.00 68.57  ? 1143 ARG B HH22   1 
ATOM   8684  N  N      . VAL B 1 182 ? -84.245  70.108  17.184  1.00 47.53  ? 1144 VAL B N      1 
ATOM   8685  C  CA     . VAL B 1 182 ? -83.210  70.176  18.214  1.00 46.33  ? 1144 VAL B CA     1 
ATOM   8686  C  C      . VAL B 1 182 ? -81.872  69.709  17.652  1.00 45.03  ? 1144 VAL B C      1 
ATOM   8687  O  O      . VAL B 1 182 ? -80.839  70.363  17.839  1.00 43.43  ? 1144 VAL B O      1 
ATOM   8688  C  CB     . VAL B 1 182 ? -83.623  69.359  19.453  1.00 45.50  ? 1144 VAL B CB     1 
ATOM   8689  C  CG1    . VAL B 1 182 ? -82.548  69.438  20.536  1.00 41.26  ? 1144 VAL B CG1    1 
ATOM   8690  C  CG2    . VAL B 1 182 ? -84.951  69.857  19.999  1.00 45.33  ? 1144 VAL B CG2    1 
ATOM   8691  H  H      . VAL B 1 182 ? -84.900  69.582  17.368  1.00 57.04  ? 1144 VAL B H      1 
ATOM   8692  H  HA     . VAL B 1 182 ? -83.107  71.100  18.491  1.00 55.60  ? 1144 VAL B HA     1 
ATOM   8693  H  HB     . VAL B 1 182 ? -83.729  68.428  19.200  1.00 54.60  ? 1144 VAL B HB     1 
ATOM   8694  H  HG11   . VAL B 1 182 ? -82.833  68.916  21.302  1.00 49.52  ? 1144 VAL B HG11   1 
ATOM   8695  H  HG12   . VAL B 1 182 ? -81.718  69.082  20.183  1.00 49.52  ? 1144 VAL B HG12   1 
ATOM   8696  H  HG13   . VAL B 1 182 ? -82.428  70.366  20.793  1.00 49.52  ? 1144 VAL B HG13   1 
ATOM   8697  H  HG21   . VAL B 1 182 ? -85.191  69.328  20.776  1.00 54.40  ? 1144 VAL B HG21   1 
ATOM   8698  H  HG22   . VAL B 1 182 ? -84.860  70.790  20.247  1.00 54.40  ? 1144 VAL B HG22   1 
ATOM   8699  H  HG23   . VAL B 1 182 ? -85.630  69.761  19.312  1.00 54.40  ? 1144 VAL B HG23   1 
ATOM   8700  N  N      . LYS B 1 183 ? -81.868  68.569  16.954  1.00 49.32  ? 1145 LYS B N      1 
ATOM   8701  C  CA     . LYS B 1 183 ? -80.628  68.072  16.362  1.00 51.90  ? 1145 LYS B CA     1 
ATOM   8702  C  C      . LYS B 1 183 ? -80.088  69.040  15.317  1.00 49.09  ? 1145 LYS B C      1 
ATOM   8703  O  O      . LYS B 1 183 ? -78.910  69.410  15.351  1.00 46.42  ? 1145 LYS B O      1 
ATOM   8704  C  CB     . LYS B 1 183 ? -80.845  66.692  15.740  1.00 56.75  ? 1145 LYS B CB     1 
ATOM   8705  C  CG     . LYS B 1 183 ? -80.767  65.544  16.728  1.00 62.27  ? 1145 LYS B CG     1 
ATOM   8706  C  CD     . LYS B 1 183 ? -80.745  64.203  16.010  1.00 65.45  ? 1145 LYS B CD     1 
ATOM   8707  C  CE     . LYS B 1 183 ? -80.456  63.052  16.968  1.00 69.21  ? 1145 LYS B CE     1 
ATOM   8708  N  NZ     . LYS B 1 183 ? -80.334  61.749  16.247  1.00 74.87  1 1145 LYS B NZ     1 
ATOM   8709  H  H      . LYS B 1 183 ? -82.558  68.075  16.812  1.00 59.18  ? 1145 LYS B H      1 
ATOM   8710  H  HA     . LYS B 1 183 ? -79.961  67.983  17.060  1.00 62.28  ? 1145 LYS B HA     1 
ATOM   8711  H  HB2    . LYS B 1 183 ? -81.725  66.670  15.332  1.00 68.10  ? 1145 LYS B HB2    1 
ATOM   8712  H  HB3    . LYS B 1 183 ? -80.166  66.545  15.064  1.00 68.10  ? 1145 LYS B HB3    1 
ATOM   8713  H  HG2    . LYS B 1 183 ? -79.953  65.625  17.250  1.00 74.72  ? 1145 LYS B HG2    1 
ATOM   8714  H  HG3    . LYS B 1 183 ? -81.543  65.567  17.310  1.00 74.72  ? 1145 LYS B HG3    1 
ATOM   8715  H  HD2    . LYS B 1 183 ? -81.611  64.046  15.601  1.00 78.55  ? 1145 LYS B HD2    1 
ATOM   8716  H  HD3    . LYS B 1 183 ? -80.052  64.215  15.332  1.00 78.55  ? 1145 LYS B HD3    1 
ATOM   8717  H  HE2    . LYS B 1 183 ? -79.619  63.223  17.429  1.00 83.05  ? 1145 LYS B HE2    1 
ATOM   8718  H  HE3    . LYS B 1 183 ? -81.181  62.978  17.607  1.00 83.05  ? 1145 LYS B HE3    1 
ATOM   8719  H  HZ1    . LYS B 1 183 ? -80.165  61.095  16.827  1.00 89.84  ? 1145 LYS B HZ1    1 
ATOM   8720  H  HZ2    . LYS B 1 183 ? -81.092  61.567  15.819  1.00 89.84  ? 1145 LYS B HZ2    1 
ATOM   8721  H  HZ3    . LYS B 1 183 ? -79.670  61.789  15.656  1.00 89.84  ? 1145 LYS B HZ3    1 
ATOM   8722  N  N      . TYR B 1 184 ? -80.936  69.460  14.375  1.00 48.16  ? 1146 TYR B N      1 
ATOM   8723  C  CA     . TYR B 1 184 ? -80.481  70.352  13.312  1.00 49.45  ? 1146 TYR B CA     1 
ATOM   8724  C  C      . TYR B 1 184 ? -79.828  71.609  13.877  1.00 50.35  ? 1146 TYR B C      1 
ATOM   8725  O  O      . TYR B 1 184 ? -78.799  72.065  13.365  1.00 51.67  ? 1146 TYR B O      1 
ATOM   8726  C  CB     . TYR B 1 184 ? -81.649  70.719  12.395  1.00 50.17  ? 1146 TYR B CB     1 
ATOM   8727  C  CG     . TYR B 1 184 ? -82.266  69.540  11.674  1.00 49.44  ? 1146 TYR B CG     1 
ATOM   8728  C  CD1    . TYR B 1 184 ? -81.485  68.476  11.249  1.00 49.29  ? 1146 TYR B CD1    1 
ATOM   8729  C  CD2    . TYR B 1 184 ? -83.630  69.488  11.428  1.00 50.63  ? 1146 TYR B CD2    1 
ATOM   8730  C  CE1    . TYR B 1 184 ? -82.039  67.401  10.590  1.00 52.04  ? 1146 TYR B CE1    1 
ATOM   8731  C  CE2    . TYR B 1 184 ? -84.195  68.412  10.770  1.00 55.63  ? 1146 TYR B CE2    1 
ATOM   8732  C  CZ     . TYR B 1 184 ? -83.394  67.370  10.353  1.00 55.48  ? 1146 TYR B CZ     1 
ATOM   8733  O  OH     . TYR B 1 184 ? -83.945  66.292  9.695   1.00 58.08  ? 1146 TYR B OH     1 
ATOM   8734  H  H      . TYR B 1 184 ? -81.768  69.245  14.330  1.00 57.80  ? 1146 TYR B H      1 
ATOM   8735  H  HA     . TYR B 1 184 ? -79.818  69.888  12.777  1.00 59.34  ? 1146 TYR B HA     1 
ATOM   8736  H  HB2    . TYR B 1 184 ? -82.344  71.136  12.928  1.00 60.21  ? 1146 TYR B HB2    1 
ATOM   8737  H  HB3    . TYR B 1 184 ? -81.333  71.344  11.723  1.00 60.21  ? 1146 TYR B HB3    1 
ATOM   8738  H  HD1    . TYR B 1 184 ? -80.568  68.493  11.404  1.00 59.14  ? 1146 TYR B HD1    1 
ATOM   8739  H  HD2    . TYR B 1 184 ? -84.172  70.190  11.706  1.00 60.75  ? 1146 TYR B HD2    1 
ATOM   8740  H  HE1    . TYR B 1 184 ? -81.500  66.697  10.309  1.00 62.45  ? 1146 TYR B HE1    1 
ATOM   8741  H  HE2    . TYR B 1 184 ? -85.111  68.391  10.609  1.00 66.75  ? 1146 TYR B HE2    1 
ATOM   8742  H  HH     . TYR B 1 184 ? -84.775  66.397  9.616   1.00 69.70  ? 1146 TYR B HH     1 
ATOM   8743  N  N      . LEU B 1 185 ? -80.413  72.189  14.927  1.00 46.55  ? 1147 LEU B N      1 
ATOM   8744  C  CA     . LEU B 1 185 ? -79.871  73.430  15.471  1.00 47.76  ? 1147 LEU B CA     1 
ATOM   8745  C  C      . LEU B 1 185 ? -78.579  73.186  16.235  1.00 47.11  ? 1147 LEU B C      1 
ATOM   8746  O  O      . LEU B 1 185 ? -77.634  73.976  16.131  1.00 47.31  ? 1147 LEU B O      1 
ATOM   8747  C  CB     . LEU B 1 185 ? -80.901  74.107  16.369  1.00 52.57  ? 1147 LEU B CB     1 
ATOM   8748  C  CG     . LEU B 1 185 ? -82.017  74.838  15.629  1.00 58.07  ? 1147 LEU B CG     1 
ATOM   8749  C  CD1    . LEU B 1 185 ? -83.118  75.198  16.597  1.00 61.96  ? 1147 LEU B CD1    1 
ATOM   8750  C  CD2    . LEU B 1 185 ? -81.479  76.091  14.942  1.00 58.34  ? 1147 LEU B CD2    1 
ATOM   8751  H  H      . LEU B 1 185 ? -81.110  71.891  15.333  1.00 55.86  ? 1147 LEU B H      1 
ATOM   8752  H  HA     . LEU B 1 185 ? -79.673  74.034  14.738  1.00 57.31  ? 1147 LEU B HA     1 
ATOM   8753  H  HB2    . LEU B 1 185 ? -81.315  73.430  16.928  1.00 63.09  ? 1147 LEU B HB2    1 
ATOM   8754  H  HB3    . LEU B 1 185 ? -80.446  74.756  16.927  1.00 63.09  ? 1147 LEU B HB3    1 
ATOM   8755  H  HG     . LEU B 1 185 ? -82.388  74.254  14.949  1.00 69.68  ? 1147 LEU B HG     1 
ATOM   8756  H  HD11   . LEU B 1 185 ? -83.821  75.662  16.116  1.00 74.35  ? 1147 LEU B HD11   1 
ATOM   8757  H  HD12   . LEU B 1 185 ? -83.468  74.385  16.992  1.00 74.35  ? 1147 LEU B HD12   1 
ATOM   8758  H  HD13   . LEU B 1 185 ? -82.754  75.773  17.288  1.00 74.35  ? 1147 LEU B HD13   1 
ATOM   8759  H  HD21   . LEU B 1 185 ? -82.207  76.536  14.481  1.00 70.01  ? 1147 LEU B HD21   1 
ATOM   8760  H  HD22   . LEU B 1 185 ? -81.103  76.682  15.614  1.00 70.01  ? 1147 LEU B HD22   1 
ATOM   8761  H  HD23   . LEU B 1 185 ? -80.793  75.833  14.307  1.00 70.01  ? 1147 LEU B HD23   1 
ATOM   8762  N  N      . CYS B 1 186 ? -78.519  72.109  17.019  1.00 47.53  ? 1148 CYS B N      1 
ATOM   8763  C  CA     . CYS B 1 186 ? -77.288  71.798  17.736  1.00 43.67  ? 1148 CYS B CA     1 
ATOM   8764  C  C      . CYS B 1 186 ? -76.152  71.498  16.766  1.00 43.37  ? 1148 CYS B C      1 
ATOM   8765  O  O      . CYS B 1 186 ? -75.007  71.905  16.996  1.00 44.68  ? 1148 CYS B O      1 
ATOM   8766  C  CB     . CYS B 1 186 ? -77.518  70.627  18.690  1.00 47.31  ? 1148 CYS B CB     1 
ATOM   8767  S  SG     . CYS B 1 186 ? -78.513  71.066  20.145  1.00 46.77  ? 1148 CYS B SG     1 
ATOM   8768  H  H      . CYS B 1 186 ? -79.163  71.554  17.150  1.00 57.04  ? 1148 CYS B H      1 
ATOM   8769  H  HA     . CYS B 1 186 ? -77.031  72.569  18.266  1.00 52.40  ? 1148 CYS B HA     1 
ATOM   8770  H  HB2    . CYS B 1 186 ? -77.982  69.921  18.214  1.00 56.78  ? 1148 CYS B HB2    1 
ATOM   8771  H  HB3    . CYS B 1 186 ? -76.659  70.304  19.004  1.00 56.78  ? 1148 CYS B HB3    1 
ATOM   8772  H  HG     . CYS B 1 186 ? -78.644  70.095  20.836  1.00 56.13  ? 1148 CYS B HG     1 
ATOM   8773  N  N      . TYR B 1 187 ? -76.453  70.815  15.658  1.00 39.50  ? 1149 TYR B N      1 
ATOM   8774  C  CA     . TYR B 1 187 ? -75.428  70.578  14.649  1.00 40.03  ? 1149 TYR B CA     1 
ATOM   8775  C  C      . TYR B 1 187 ? -74.981  71.886  14.007  1.00 39.39  ? 1149 TYR B C      1 
ATOM   8776  O  O      . TYR B 1 187 ? -73.780  72.106  13.814  1.00 38.88  ? 1149 TYR B O      1 
ATOM   8777  C  CB     . TYR B 1 187 ? -75.938  69.599  13.587  1.00 38.42  ? 1149 TYR B CB     1 
ATOM   8778  C  CG     . TYR B 1 187 ? -75.714  68.153  13.961  1.00 37.40  ? 1149 TYR B CG     1 
ATOM   8779  C  CD1    . TYR B 1 187 ? -76.569  67.502  14.837  1.00 39.90  ? 1149 TYR B CD1    1 
ATOM   8780  C  CD2    . TYR B 1 187 ? -74.637  67.444  13.454  1.00 39.73  ? 1149 TYR B CD2    1 
ATOM   8781  C  CE1    . TYR B 1 187 ? -76.364  66.183  15.190  1.00 40.08  ? 1149 TYR B CE1    1 
ATOM   8782  C  CE2    . TYR B 1 187 ? -74.421  66.124  13.803  1.00 42.68  ? 1149 TYR B CE2    1 
ATOM   8783  C  CZ     . TYR B 1 187 ? -75.287  65.500  14.675  1.00 40.01  ? 1149 TYR B CZ     1 
ATOM   8784  O  OH     . TYR B 1 187 ? -75.083  64.188  15.034  1.00 39.37  ? 1149 TYR B OH     1 
ATOM   8785  H  H      . TYR B 1 187 ? -77.226  70.487  15.473  1.00 47.40  ? 1149 TYR B H      1 
ATOM   8786  H  HA     . TYR B 1 187 ? -74.654  70.178  15.076  1.00 48.03  ? 1149 TYR B HA     1 
ATOM   8787  H  HB2    . TYR B 1 187 ? -76.891  69.733  13.467  1.00 46.11  ? 1149 TYR B HB2    1 
ATOM   8788  H  HB3    . TYR B 1 187 ? -75.473  69.768  12.753  1.00 46.11  ? 1149 TYR B HB3    1 
ATOM   8789  H  HD1    . TYR B 1 187 ? -77.296  67.961  15.190  1.00 47.88  ? 1149 TYR B HD1    1 
ATOM   8790  H  HD2    . TYR B 1 187 ? -74.049  67.864  12.868  1.00 47.68  ? 1149 TYR B HD2    1 
ATOM   8791  H  HE1    . TYR B 1 187 ? -76.946  65.761  15.779  1.00 48.09  ? 1149 TYR B HE1    1 
ATOM   8792  H  HE2    . TYR B 1 187 ? -73.693  65.661  13.454  1.00 51.21  ? 1149 TYR B HE2    1 
ATOM   8793  H  HH     . TYR B 1 187 ? -74.397  63.889  14.653  1.00 47.24  ? 1149 TYR B HH     1 
ATOM   8794  N  N      . THR B 1 188 ? -75.929  72.772  13.685  1.00 36.92  ? 1150 THR B N      1 
ATOM   8795  C  CA     . THR B 1 188 ? -75.569  74.065  13.107  1.00 40.27  ? 1150 THR B CA     1 
ATOM   8796  C  C      . THR B 1 188 ? -74.730  74.890  14.075  1.00 40.04  ? 1150 THR B C      1 
ATOM   8797  O  O      . THR B 1 188 ? -73.742  75.517  13.673  1.00 38.38  ? 1150 THR B O      1 
ATOM   8798  C  CB     . THR B 1 188 ? -76.827  74.837  12.712  1.00 39.66  ? 1150 THR B CB     1 
ATOM   8799  O  OG1    . THR B 1 188 ? -77.605  74.055  11.800  1.00 41.64  ? 1150 THR B OG1    1 
ATOM   8800  C  CG2    . THR B 1 188 ? -76.458  76.166  12.053  1.00 36.77  ? 1150 THR B CG2    1 
ATOM   8801  H  H      . THR B 1 188 ? -76.774  72.649  13.789  1.00 44.31  ? 1150 THR B H      1 
ATOM   8802  H  HA     . THR B 1 188 ? -75.044  73.917  12.305  1.00 48.32  ? 1150 THR B HA     1 
ATOM   8803  H  HB     . THR B 1 188 ? -77.353  75.025  13.506  1.00 47.59  ? 1150 THR B HB     1 
ATOM   8804  H  HG1    . THR B 1 188 ? -77.830  73.331  12.161  1.00 49.96  ? 1150 THR B HG1    1 
ATOM   8805  H  HG21   . THR B 1 188 ? -77.263  76.648  11.806  1.00 44.13  ? 1150 THR B HG21   1 
ATOM   8806  H  HG22   . THR B 1 188 ? -75.942  76.709  12.668  1.00 44.13  ? 1150 THR B HG22   1 
ATOM   8807  H  HG23   . THR B 1 188 ? -75.931  76.004  11.255  1.00 44.13  ? 1150 THR B HG23   1 
ATOM   8808  N  N      . MET B 1 189 ? -75.120  74.919  15.352  1.00 41.75  ? 1151 MET B N      1 
ATOM   8809  C  CA     . MET B 1 189 ? -74.333  75.634  16.353  1.00 40.87  ? 1151 MET B CA     1 
ATOM   8810  C  C      . MET B 1 189 ? -72.926  75.064  16.459  1.00 38.32  ? 1151 MET B C      1 
ATOM   8811  O  O      . MET B 1 189 ? -71.952  75.815  16.590  1.00 33.56  ? 1151 MET B O      1 
ATOM   8812  C  CB     . MET B 1 189 ? -75.033  75.572  17.711  1.00 45.19  ? 1151 MET B CB     1 
ATOM   8813  C  CG     . MET B 1 189 ? -74.237  76.195  18.863  1.00 46.96  ? 1151 MET B CG     1 
ATOM   8814  S  SD     . MET B 1 189 ? -74.003  77.972  18.688  1.00 47.37  ? 1151 MET B SD     1 
ATOM   8815  C  CE     . MET B 1 189 ? -75.119  78.568  19.950  1.00 50.53  ? 1151 MET B CE     1 
ATOM   8816  H  H      . MET B 1 189 ? -75.827  74.538  15.659  1.00 50.10  ? 1151 MET B H      1 
ATOM   8817  H  HA     . MET B 1 189 ? -74.273  76.567  16.094  1.00 49.05  ? 1151 MET B HA     1 
ATOM   8818  H  HB2    . MET B 1 189 ? -75.878  76.044  17.647  1.00 54.22  ? 1151 MET B HB2    1 
ATOM   8819  H  HB3    . MET B 1 189 ? -75.195  74.642  17.934  1.00 54.22  ? 1151 MET B HB3    1 
ATOM   8820  H  HG2    . MET B 1 189 ? -74.711  76.038  19.694  1.00 56.35  ? 1151 MET B HG2    1 
ATOM   8821  H  HG3    . MET B 1 189 ? -73.360  75.781  18.899  1.00 56.35  ? 1151 MET B HG3    1 
ATOM   8822  H  HE1    . MET B 1 189 ? -75.091  79.537  19.964  1.00 60.64  ? 1151 MET B HE1    1 
ATOM   8823  H  HE2    . MET B 1 189 ? -76.018  78.266  19.745  1.00 60.64  ? 1151 MET B HE2    1 
ATOM   8824  H  HE3    . MET B 1 189 ? -74.840  78.216  20.810  1.00 60.64  ? 1151 MET B HE3    1 
ATOM   8825  N  N      . LYS B 1 190 ? -72.799  73.737  16.415  1.00 36.08  ? 1152 LYS B N      1 
ATOM   8826  C  CA     . LYS B 1 190 ? -71.484  73.119  16.533  1.00 38.99  ? 1152 LYS B CA     1 
ATOM   8827  C  C      . LYS B 1 190 ? -70.604  73.452  15.330  1.00 43.01  ? 1152 LYS B C      1 
ATOM   8828  O  O      . LYS B 1 190 ? -69.406  73.710  15.487  1.00 37.45  ? 1152 LYS B O      1 
ATOM   8829  C  CB     . LYS B 1 190 ? -71.638  71.608  16.692  1.00 41.41  ? 1152 LYS B CB     1 
ATOM   8830  C  CG     . LYS B 1 190 ? -70.407  70.907  17.226  1.00 45.60  ? 1152 LYS B CG     1 
ATOM   8831  C  CD     . LYS B 1 190 ? -70.723  69.468  17.614  1.00 50.73  ? 1152 LYS B CD     1 
ATOM   8832  C  CE     . LYS B 1 190 ? -70.910  69.322  19.122  1.00 51.38  ? 1152 LYS B CE     1 
ATOM   8833  N  NZ     . LYS B 1 190 ? -71.310  67.942  19.510  1.00 50.38  1 1152 LYS B NZ     1 
ATOM   8834  H  H      . LYS B 1 190 ? -73.449  73.183  16.320  1.00 43.29  ? 1152 LYS B H      1 
ATOM   8835  H  HA     . LYS B 1 190 ? -71.045  73.460  17.328  1.00 46.79  ? 1152 LYS B HA     1 
ATOM   8836  H  HB2    . LYS B 1 190 ? -72.367  71.434  17.309  1.00 49.70  ? 1152 LYS B HB2    1 
ATOM   8837  H  HB3    . LYS B 1 190 ? -71.844  71.224  15.826  1.00 49.70  ? 1152 LYS B HB3    1 
ATOM   8838  H  HG2    . LYS B 1 190 ? -69.722  70.896  16.540  1.00 54.72  ? 1152 LYS B HG2    1 
ATOM   8839  H  HG3    . LYS B 1 190 ? -70.088  71.373  18.014  1.00 54.72  ? 1152 LYS B HG3    1 
ATOM   8840  H  HD2    . LYS B 1 190 ? -71.544  69.192  17.178  1.00 60.88  ? 1152 LYS B HD2    1 
ATOM   8841  H  HD3    . LYS B 1 190 ? -69.989  68.895  17.342  1.00 60.88  ? 1152 LYS B HD3    1 
ATOM   8842  H  HE2    . LYS B 1 190 ? -70.073  69.530  19.567  1.00 61.65  ? 1152 LYS B HE2    1 
ATOM   8843  H  HE3    . LYS B 1 190 ? -71.604  69.932  19.416  1.00 61.65  ? 1152 LYS B HE3    1 
ATOM   8844  H  HZ1    . LYS B 1 190 ? -71.410  67.892  20.393  1.00 60.45  ? 1152 LYS B HZ1    1 
ATOM   8845  H  HZ2    . LYS B 1 190 ? -72.081  67.728  19.119  1.00 60.45  ? 1152 LYS B HZ2    1 
ATOM   8846  H  HZ3    . LYS B 1 190 ? -70.686  67.361  19.257  1.00 60.45  ? 1152 LYS B HZ3    1 
ATOM   8847  N  N      . VAL B 1 191 ? -71.179  73.456  14.123  1.00 40.33  ? 1153 VAL B N      1 
ATOM   8848  C  CA     . VAL B 1 191 ? -70.429  73.877  12.942  1.00 39.60  ? 1153 VAL B CA     1 
ATOM   8849  C  C      . VAL B 1 191 ? -70.020  75.339  13.075  1.00 40.17  ? 1153 VAL B C      1 
ATOM   8850  O  O      . VAL B 1 191 ? -68.854  75.699  12.874  1.00 39.20  ? 1153 VAL B O      1 
ATOM   8851  C  CB     . VAL B 1 191 ? -71.258  73.634  11.665  1.00 46.68  ? 1153 VAL B CB     1 
ATOM   8852  C  CG1    . VAL B 1 191 ? -70.580  74.246  10.431  1.00 47.04  ? 1153 VAL B CG1    1 
ATOM   8853  C  CG2    . VAL B 1 191 ? -71.486  72.144  11.450  1.00 44.75  ? 1153